data_4GDY
# 
_entry.id   4GDY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.379 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   4GDY         pdb_00004gdy 10.2210/pdb4gdy/pdb 
RCSB  RCSB074062   ?            ?                   
WWPDB D_1000074062 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4GE9 . unspecified 
PDB 4GE4 . unspecified 
PDB 4GE7 . unspecified 
PDB 4GEB . unspecified 
PDB 3UE8 . unspecified 
# 
_pdbx_database_status.entry_id                        4GDY 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'Pandit, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of Hydroxamate Bioisosteres as KATII Inhibitors with Improved Oral Bioavailability and Pharmacokinetics' 
_citation.journal_abbrev            MEDCHEMCOMM 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2040-2511 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      10.1039/C2MD20166F 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Verhoest, P.R.'   1  ? 
primary 'Henderson, J.L.'  2  ? 
primary 'Sawant-Basak, A.' 3  ? 
primary 'Tuttle, J.B.'     4  ? 
primary 'Dounay, A.B.'     5  ? 
primary 'McAllister, L.A.' 6  ? 
primary 'Pandit, J.'       7  ? 
primary 'Rong, S.'         8  ? 
primary 'Hou, X.'          9  ? 
primary 'Bechle, B.'       10 ? 
primary 'Parikh, V.'       11 ? 
primary 'Evrard, E.'       12 ? 
primary 'Ghosh, S.'        13 ? 
primary 'Salafia, M.A.'    14 ? 
primary 'Rago, B.'         15 ? 
primary 'Obach, R.'        16 ? 
primary 'Fonseca, K.R.'    17 ? 
primary 'Chang, C.'        18 ? 
# 
_cell.length_a           116.457 
_cell.length_b           116.457 
_cell.length_c           115.211 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4GDY 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         4GDY 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial' 48950.074 2   '2.6.1.39, 2.6.1.7' 'K240S, F241G' 
? ? 
2 non-polymer syn 
;(5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate
;
523.435   2   ?                   ?              ? ? 
3 water       nat water 18.015    217 ?                   ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KAT/AadAT, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, AadAT, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNS
GRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNS
GRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 SER n 
1 241 GLY n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
1 426 LEU n 
1 427 VAL n 
1 428 PRO n 
1 429 ARG n 
1 430 GLY n 
1 431 SER n 
1 432 LEU n 
1 433 GLU n 
1 434 HIS n 
1 435 HIS n 
1 436 HIS n 
1 437 HIS n 
1 438 HIS n 
1 439 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GDY A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 4GDY B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GDY SER A 240 ? UNP Q8N5Z0 LYS 240 'engineered mutation' 240 1  
1 4GDY GLY A 241 ? UNP Q8N5Z0 PHE 241 'engineered mutation' 241 2  
1 4GDY LEU A 426 ? UNP Q8N5Z0 ?   ?   'expression tag'      426 3  
1 4GDY VAL A 427 ? UNP Q8N5Z0 ?   ?   'expression tag'      427 4  
1 4GDY PRO A 428 ? UNP Q8N5Z0 ?   ?   'expression tag'      428 5  
1 4GDY ARG A 429 ? UNP Q8N5Z0 ?   ?   'expression tag'      429 6  
1 4GDY GLY A 430 ? UNP Q8N5Z0 ?   ?   'expression tag'      430 7  
1 4GDY SER A 431 ? UNP Q8N5Z0 ?   ?   'expression tag'      431 8  
1 4GDY LEU A 432 ? UNP Q8N5Z0 ?   ?   'expression tag'      432 9  
1 4GDY GLU A 433 ? UNP Q8N5Z0 ?   ?   'expression tag'      433 10 
1 4GDY HIS A 434 ? UNP Q8N5Z0 ?   ?   'expression tag'      434 11 
1 4GDY HIS A 435 ? UNP Q8N5Z0 ?   ?   'expression tag'      435 12 
1 4GDY HIS A 436 ? UNP Q8N5Z0 ?   ?   'expression tag'      436 13 
1 4GDY HIS A 437 ? UNP Q8N5Z0 ?   ?   'expression tag'      437 14 
1 4GDY HIS A 438 ? UNP Q8N5Z0 ?   ?   'expression tag'      438 15 
1 4GDY HIS A 439 ? UNP Q8N5Z0 ?   ?   'expression tag'      439 16 
2 4GDY SER B 240 ? UNP Q8N5Z0 LYS 240 'engineered mutation' 240 17 
2 4GDY GLY B 241 ? UNP Q8N5Z0 PHE 241 'engineered mutation' 241 18 
2 4GDY LEU B 426 ? UNP Q8N5Z0 ?   ?   'expression tag'      426 19 
2 4GDY VAL B 427 ? UNP Q8N5Z0 ?   ?   'expression tag'      427 20 
2 4GDY PRO B 428 ? UNP Q8N5Z0 ?   ?   'expression tag'      428 21 
2 4GDY ARG B 429 ? UNP Q8N5Z0 ?   ?   'expression tag'      429 22 
2 4GDY GLY B 430 ? UNP Q8N5Z0 ?   ?   'expression tag'      430 23 
2 4GDY SER B 431 ? UNP Q8N5Z0 ?   ?   'expression tag'      431 24 
2 4GDY LEU B 432 ? UNP Q8N5Z0 ?   ?   'expression tag'      432 25 
2 4GDY GLU B 433 ? UNP Q8N5Z0 ?   ?   'expression tag'      433 26 
2 4GDY HIS B 434 ? UNP Q8N5Z0 ?   ?   'expression tag'      434 27 
2 4GDY HIS B 435 ? UNP Q8N5Z0 ?   ?   'expression tag'      435 28 
2 4GDY HIS B 436 ? UNP Q8N5Z0 ?   ?   'expression tag'      436 29 
2 4GDY HIS B 437 ? UNP Q8N5Z0 ?   ?   'expression tag'      437 30 
2 4GDY HIS B 438 ? UNP Q8N5Z0 ?   ?   'expression tag'      438 31 
2 4GDY HIS B 439 ? UNP Q8N5Z0 ?   ?   'expression tag'      439 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0X1 non-polymer         . 
;(5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate
;
? 'C24 H22 N5 O7 P' 523.435 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4GDY 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-03-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     4GDY 
_reflns.d_resolution_high            2.8900 
_reflns.d_resolution_low             115.211 
_reflns.number_all                   20593 
_reflns.number_obs                   20593 
_reflns.pdbx_netI_over_sigmaI        17.400 
_reflns.pdbx_Rsym_value              0.127 
_reflns.pdbx_redundancy              10.500 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.890 3.050   ? 32885 ? 0.495 1.400  0.495 ? 11.100 ? 2957 100.000 1  1 
3.050 3.240   ? 31199 ? 0.366 1.900  0.366 ? 11.100 ? 2804 100.000 2  1 
3.240 3.460   ? 28627 ? 0.254 2.800  0.254 ? 10.900 ? 2637 100.000 3  1 
3.460 3.740   ? 23387 ? 0.182 4.000  0.182 ? 9.500  ? 2474 100.000 4  1 
3.740 4.090   ? 21976 ? 0.145 5.100  0.145 ? 9.600  ? 2282 100.000 5  1 
4.090 4.580   ? 22058 ? 0.095 7.600  0.095 ? 10.700 ? 2062 100.000 6  1 
4.580 5.280   ? 19650 ? 0.079 9.100  0.079 ? 10.600 ? 1852 100.000 7  1 
5.280 6.470   ? 16636 ? 0.077 9.300  0.077 ? 10.600 ? 1566 100.000 8  1 
6.470 9.150   ? 12712 ? 0.055 11.800 0.055 ? 10.300 ? 1231 100.000 9  1 
9.150 115.211 ? 6825  ? 0.039 15.600 0.039 ? 9.400  ? 728  99.700  10 1 
# 
_refine.entry_id                                 4GDY 
_refine.ls_d_res_high                            2.8900 
_refine.ls_d_res_low                             100.8500 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.3300 
_refine.ls_number_reflns_obs                     20510 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1744 
_refine.ls_R_factor_R_work                       0.1709 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2399 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1100 
_refine.ls_number_reflns_R_free                  1049 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               48.8469 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.7586 
_refine.aniso_B[2][2]                            1.7586 
_refine.aniso_B[3][3]                            -3.5172 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9415 
_refine.correlation_coeff_Fo_to_Fc_free          0.8883 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3UE8 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                168.360 
_refine.B_iso_min                                3.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4GDY 
_refine_analyze.Luzzati_coordinate_error_obs    0.335 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6589 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         74 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               6880 
_refine_hist.d_res_high                       2.8900 
_refine_hist.d_res_low                        100.8500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        2310 ?      ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           162  ?      ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              990  ?      ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      6832 ?      ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 889  ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      7498 ?      ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  6832 0.010  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               9287 1.220  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?    2.740  ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?    21.700 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.8900 
_refine_ls_shell.d_res_low                        3.0500 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.percent_reflns_obs               99.3300 
_refine_ls_shell.number_reflns_R_work             2730 
_refine_ls_shell.R_factor_all                     0.1936 
_refine_ls_shell.R_factor_R_work                  0.1888 
_refine_ls_shell.R_factor_R_free                  0.2810 
_refine_ls_shell.percent_reflns_R_free            5.1800 
_refine_ls_shell.number_reflns_R_free             149 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2879 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4GDY 
_struct.title                     'Kynurenine Aminotransferase II inhibitors' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GDY 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'Aminotransferase, Pyridoxal phosphate co-factor, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 2   ? PHE A 6   ? ASN A 2   PHE A 6   5 ? 5  
HELX_P HELX_P2  2  THR A 8   ? ARG A 14  ? THR A 8   ARG A 14  1 ? 7  
HELX_P HELX_P3  3  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P4  4  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P5  5  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P6  6  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P7  7  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P8  8  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P9  9  PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P10 10 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P11 11 ARG A 177 ? TRP A 178 ? ARG A 177 TRP A 178 5 ? 2  
HELX_P HELX_P12 12 LYS A 179 ? ASN A 189 ? LYS A 179 ASN A 189 5 ? 11 
HELX_P HELX_P13 13 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P14 14 TYR A 233 ? GLN A 237 ? TYR A 233 GLN A 237 5 ? 5  
HELX_P HELX_P15 15 THR A 245 ? ASP A 250 ? THR A 245 ASP A 250 5 ? 6  
HELX_P HELX_P16 16 LYS A 278 ? GLN A 289 ? LYS A 278 GLN A 289 1 ? 12 
HELX_P HELX_P17 17 SER A 296 ? THR A 342 ? SER A 296 THR A 342 1 ? 47 
HELX_P HELX_P18 18 VAL A 366 ? GLU A 371 ? VAL A 366 GLU A 371 1 ? 6  
HELX_P HELX_P19 19 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P20 20 SER A 406 ? VAL A 427 ? SER A 406 VAL A 427 1 ? 22 
HELX_P HELX_P21 21 ASN B 2   ? PHE B 6   ? ASN B 2   PHE B 6   5 ? 5  
HELX_P HELX_P22 22 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P23 23 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P24 24 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P25 25 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P26 26 PRO B 103 ? GLY B 107 ? PRO B 103 GLY B 107 5 ? 5  
HELX_P HELX_P27 27 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P28 28 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P29 29 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P30 30 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P31 31 ARG B 177 ? TRP B 178 ? ARG B 177 TRP B 178 5 ? 2  
HELX_P HELX_P32 32 LYS B 179 ? ASN B 189 ? LYS B 179 ASN B 189 5 ? 11 
HELX_P HELX_P33 33 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P34 34 TYR B 233 ? GLN B 237 ? TYR B 233 GLN B 237 5 ? 5  
HELX_P HELX_P35 35 THR B 245 ? ASP B 250 ? THR B 245 ASP B 250 5 ? 6  
HELX_P HELX_P36 36 LYS B 278 ? GLN B 289 ? LYS B 278 GLN B 289 1 ? 12 
HELX_P HELX_P37 37 SER B 296 ? THR B 342 ? SER B 296 THR B 342 1 ? 47 
HELX_P HELX_P38 38 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P39 39 GLU B 372 ? MET B 377 ? GLU B 372 MET B 377 1 ? 6  
HELX_P HELX_P40 40 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P41 41 SER B 406 ? VAL B 427 ? SER B 406 VAL B 427 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 20  A . ? ARG 20  A THR 21  A ? THR 21  A 1 -6.56 
2 GLU 56  A . ? GLU 56  A ASN 57  A ? ASN 57  A 1 0.06  
3 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 -0.15 
4 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 11.22 
5 ALA 37  B . ? ALA 37  B GLY 38  B ? GLY 38  B 1 -1.66 
6 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 -0.37 
7 ASN 202 B . ? ASN 202 B PRO 203 B ? PRO 203 B 1 11.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 5 ? 
I ? 2 ? 
J ? 2 ? 
K ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
A 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
B 1 THR A 60  ? PHE A 63  ? THR A 60  PHE A 63  
B 2 PHE A 48  ? THR A 54  ? PHE A 48  THR A 54  
B 3 THR B 50  ? VAL B 55  ? THR B 50  VAL B 55  
B 4 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
C 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
C 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
C 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
C 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
C 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
D 1 ASN A 134 ? LEU A 137 ? ASN A 134 LEU A 137 
D 2 ASN A 155 ? ASN A 158 ? ASN A 155 ASN A 158 
E 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
E 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
F 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
F 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
F 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
F 4 MET A 381 ? PRO A 383 ? MET A 381 PRO A 383 
G 1 THR B 21  ? THR B 23  ? THR B 21  THR B 23  
G 2 MET B 33  ? SER B 35  ? MET B 33  SER B 35  
H 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
H 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
H 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
H 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
H 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
I 1 ASN B 134 ? LEU B 137 ? ASN B 134 LEU B 137 
I 2 ASN B 155 ? ASN B 158 ? ASN B 155 ASN B 158 
J 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
J 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
K 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
K 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
K 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
K 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 34  ? N ILE A 34  O LEU B 380 ? O LEU B 380 
B 1 2 O PHE A 63  ? O PHE A 63  N ALA A 51  ? N ALA A 51  
B 2 3 N LYS A 49  ? N LYS A 49  O THR B 54  ? O THR B 54  
B 3 4 N ALA B 51  ? N ALA B 51  O PHE B 63  ? O PHE B 63  
C 1 2 N ASP A 110 ? N ASP A 110 O GLY A 276 ? O GLY A 276 
C 2 3 O THR A 275 ? O THR A 275 N ARG A 257 ? N ARG A 257 
C 3 4 O ALA A 258 ? O ALA A 258 N GLU A 229 ? N GLU A 229 
C 4 5 O ILE A 228 ? O ILE A 228 N LEU A 194 ? N LEU A 194 
D 1 2 N VAL A 135 ? N VAL A 135 O ASN A 155 ? O ASN A 155 
E 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
F 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
F 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
F 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
G 1 2 N MET B 22  ? N MET B 22  O ILE B 34  ? O ILE B 34  
H 1 2 N ASP B 110 ? N ASP B 110 O GLY B 276 ? O GLY B 276 
H 2 3 O THR B 275 ? O THR B 275 N ARG B 257 ? N ARG B 257 
H 3 4 O ILE B 256 ? O ILE B 256 N ILE B 227 ? N ILE B 227 
H 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
I 1 2 N VAL B 135 ? N VAL B 135 O ASN B 155 ? O ASN B 155 
J 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
K 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
K 2 3 N LEU B 356 ? N LEU B 356 O ALA B 400 ? O ALA B 400 
K 3 4 O ARG B 399 ? O ARG B 399 N LEU B 382 ? N LEU B 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 0X1 501 ? 19 'BINDING SITE FOR RESIDUE 0X1 A 501' 
AC2 Software B 0X1 501 ? 21 'BINDING SITE FOR RESIDUE 0X1 B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 GLY A 116 ? GLY A 116 . ? 1_555 ? 
2  AC1 19 SER A 117 ? SER A 117 . ? 1_555 ? 
3  AC1 19 GLN A 118 ? GLN A 118 . ? 1_555 ? 
4  AC1 19 TYR A 142 ? TYR A 142 . ? 1_555 ? 
5  AC1 19 ASN A 202 ? ASN A 202 . ? 1_555 ? 
6  AC1 19 ASP A 230 ? ASP A 230 . ? 1_555 ? 
7  AC1 19 TYR A 233 ? TYR A 233 . ? 1_555 ? 
8  AC1 19 SER A 260 ? SER A 260 . ? 1_555 ? 
9  AC1 19 SER A 262 ? SER A 262 . ? 1_555 ? 
10 AC1 19 ARG A 270 ? ARG A 270 . ? 1_555 ? 
11 AC1 19 PHE A 355 ? PHE A 355 . ? 1_555 ? 
12 AC1 19 ARG A 399 ? ARG A 399 . ? 1_555 ? 
13 AC1 19 ILE B 19  ? ILE B 19  . ? 1_555 ? 
14 AC1 19 MET B 33  ? MET B 33  . ? 1_555 ? 
15 AC1 19 GLY B 39  ? GLY B 39  . ? 1_555 ? 
16 AC1 19 LEU B 40  ? LEU B 40  . ? 1_555 ? 
17 AC1 19 TYR B 74  ? TYR B 74  . ? 1_555 ? 
18 AC1 19 SER B 75  ? SER B 75  . ? 1_555 ? 
19 AC1 19 SER B 77  ? SER B 77  . ? 1_555 ? 
20 AC2 21 ILE A 19  ? ILE A 19  . ? 1_555 ? 
21 AC2 21 ARG A 20  ? ARG A 20  . ? 1_555 ? 
22 AC2 21 GLY A 39  ? GLY A 39  . ? 1_555 ? 
23 AC2 21 LEU A 40  ? LEU A 40  . ? 1_555 ? 
24 AC2 21 TYR A 74  ? TYR A 74  . ? 1_555 ? 
25 AC2 21 SER A 75  ? SER A 75  . ? 1_555 ? 
26 AC2 21 SER A 77  ? SER A 77  . ? 1_555 ? 
27 AC2 21 LEU A 293 ? LEU A 293 . ? 1_555 ? 
28 AC2 21 GLY B 116 ? GLY B 116 . ? 1_555 ? 
29 AC2 21 SER B 117 ? SER B 117 . ? 1_555 ? 
30 AC2 21 GLN B 118 ? GLN B 118 . ? 1_555 ? 
31 AC2 21 TYR B 142 ? TYR B 142 . ? 1_555 ? 
32 AC2 21 ASN B 202 ? ASN B 202 . ? 1_555 ? 
33 AC2 21 ASP B 230 ? ASP B 230 . ? 1_555 ? 
34 AC2 21 PRO B 232 ? PRO B 232 . ? 1_555 ? 
35 AC2 21 TYR B 233 ? TYR B 233 . ? 1_555 ? 
36 AC2 21 SER B 260 ? SER B 260 . ? 1_555 ? 
37 AC2 21 SER B 262 ? SER B 262 . ? 1_555 ? 
38 AC2 21 ARG B 270 ? ARG B 270 . ? 1_555 ? 
39 AC2 21 PHE B 355 ? PHE B 355 . ? 1_555 ? 
40 AC2 21 ARG B 399 ? ARG B 399 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4GDY 
_atom_sites.fract_transf_matrix[1][1]   0.008587 
_atom_sites.fract_transf_matrix[1][2]   0.004958 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009915 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008680 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? -7.204  41.862 -12.518 1.00 77.31  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? -7.913  41.992 -11.248 1.00 75.24  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? -7.386  43.150 -10.402 1.00 77.01  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? -6.184  43.205 -10.101 1.00 76.31  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? -7.820  40.692 -10.442 1.00 75.68  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? -8.764  39.611 -10.914 1.00 80.15  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? -10.458 39.752 -10.295 1.00 84.35  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? -10.239 39.242 -8.633  1.00 78.02  ? 1   MET A CE  1 
ATOM   9    N N   . ASN A 1 2   ? -8.290  44.071 -10.009 1.00 71.64  ? 2   ASN A N   1 
ATOM   10   C CA  . ASN A 1 2   ? -7.943  45.192 -9.135  1.00 69.74  ? 2   ASN A CA  1 
ATOM   11   C C   . ASN A 1 2   ? -8.204  44.719 -7.710  1.00 69.12  ? 2   ASN A C   1 
ATOM   12   O O   . ASN A 1 2   ? -9.322  44.835 -7.192  1.00 69.32  ? 2   ASN A O   1 
ATOM   13   C CB  . ASN A 1 2   ? -8.738  46.465 -9.482  1.00 70.43  ? 2   ASN A CB  1 
ATOM   14   C CG  . ASN A 1 2   ? -8.498  47.630 -8.542  1.00 87.84  ? 2   ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 2   ? -7.380  47.888 -8.080  1.00 80.89  ? 2   ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 2   ? -9.555  48.358 -8.232  1.00 79.42  ? 2   ASN A ND2 1 
ATOM   17   N N   . TYR A 1 3   ? -7.184  44.109 -7.107  1.00 61.37  ? 3   TYR A N   1 
ATOM   18   C CA  . TYR A 1 3   ? -7.279  43.565 -5.757  1.00 57.94  ? 3   TYR A CA  1 
ATOM   19   C C   . TYR A 1 3   ? -7.510  44.630 -4.691  1.00 61.30  ? 3   TYR A C   1 
ATOM   20   O O   . TYR A 1 3   ? -8.057  44.315 -3.631  1.00 59.41  ? 3   TYR A O   1 
ATOM   21   C CB  . TYR A 1 3   ? -6.067  42.671 -5.435  1.00 56.85  ? 3   TYR A CB  1 
ATOM   22   C CG  . TYR A 1 3   ? -6.002  41.419 -6.286  1.00 57.36  ? 3   TYR A CG  1 
ATOM   23   C CD1 . TYR A 1 3   ? -4.923  41.180 -7.129  1.00 58.98  ? 3   TYR A CD1 1 
ATOM   24   C CD2 . TYR A 1 3   ? -7.036  40.486 -6.269  1.00 57.81  ? 3   TYR A CD2 1 
ATOM   25   C CE1 . TYR A 1 3   ? -4.859  40.031 -7.915  1.00 59.26  ? 3   TYR A CE1 1 
ATOM   26   C CE2 . TYR A 1 3   ? -6.987  39.338 -7.055  1.00 59.01  ? 3   TYR A CE2 1 
ATOM   27   C CZ  . TYR A 1 3   ? -5.894  39.110 -7.872  1.00 65.65  ? 3   TYR A CZ  1 
ATOM   28   O OH  . TYR A 1 3   ? -5.860  37.977 -8.650  1.00 65.44  ? 3   TYR A OH  1 
ATOM   29   N N   . ALA A 1 4   ? -7.154  45.900 -5.006  1.00 59.61  ? 4   ALA A N   1 
ATOM   30   C CA  . ALA A 1 4   ? -7.289  47.082 -4.143  1.00 59.24  ? 4   ALA A CA  1 
ATOM   31   C C   . ALA A 1 4   ? -8.713  47.306 -3.597  1.00 62.29  ? 4   ALA A C   1 
ATOM   32   O O   . ALA A 1 4   ? -8.870  47.853 -2.500  1.00 61.03  ? 4   ALA A O   1 
ATOM   33   C CB  . ALA A 1 4   ? -6.794  48.324 -4.870  1.00 61.75  ? 4   ALA A CB  1 
ATOM   34   N N   . ARG A 1 5   ? -9.740  46.866 -4.349  1.00 58.77  ? 5   ARG A N   1 
ATOM   35   C CA  . ARG A 1 5   ? -11.124 47.004 -3.923  1.00 58.65  ? 5   ARG A CA  1 
ATOM   36   C C   . ARG A 1 5   ? -11.568 45.905 -2.934  1.00 60.48  ? 5   ARG A C   1 
ATOM   37   O O   . ARG A 1 5   ? -12.660 46.006 -2.370  1.00 60.17  ? 5   ARG A O   1 
ATOM   38   C CB  . ARG A 1 5   ? -12.072 47.163 -5.127  1.00 60.95  ? 5   ARG A CB  1 
ATOM   39   C CG  . ARG A 1 5   ? -12.302 45.910 -5.973  1.00 70.26  ? 5   ARG A CG  1 
ATOM   40   C CD  . ARG A 1 5   ? -13.367 46.139 -7.042  1.00 78.69  ? 5   ARG A CD  1 
ATOM   41   N NE  . ARG A 1 5   ? -14.690 46.434 -6.478  1.00 80.54  ? 5   ARG A NE  1 
ATOM   42   C CZ  . ARG A 1 5   ? -15.713 45.583 -6.469  1.00 87.23  ? 5   ARG A CZ  1 
ATOM   43   N NH1 . ARG A 1 5   ? -16.876 45.940 -5.939  1.00 73.60  ? 5   ARG A NH1 1 
ATOM   44   N NH2 . ARG A 1 5   ? -15.584 44.374 -7.002  1.00 65.82  ? 5   ARG A NH2 1 
ATOM   45   N N   . PHE A 1 6   ? -10.703 44.888 -2.700  1.00 54.91  ? 6   PHE A N   1 
ATOM   46   C CA  . PHE A 1 6   ? -10.966 43.759 -1.799  1.00 52.63  ? 6   PHE A CA  1 
ATOM   47   C C   . PHE A 1 6   ? -10.084 43.758 -0.545  1.00 52.54  ? 6   PHE A C   1 
ATOM   48   O O   . PHE A 1 6   ? -10.232 42.887 0.317   1.00 50.31  ? 6   PHE A O   1 
ATOM   49   C CB  . PHE A 1 6   ? -10.832 42.424 -2.547  1.00 54.63  ? 6   PHE A CB  1 
ATOM   50   C CG  . PHE A 1 6   ? -11.728 42.288 -3.751  1.00 58.57  ? 6   PHE A CG  1 
ATOM   51   C CD1 . PHE A 1 6   ? -11.207 42.371 -5.038  1.00 63.49  ? 6   PHE A CD1 1 
ATOM   52   C CD2 . PHE A 1 6   ? -13.095 42.094 -3.603  1.00 61.20  ? 6   PHE A CD2 1 
ATOM   53   C CE1 . PHE A 1 6   ? -12.032 42.232 -6.153  1.00 65.99  ? 6   PHE A CE1 1 
ATOM   54   C CE2 . PHE A 1 6   ? -13.922 41.960 -4.722  1.00 65.85  ? 6   PHE A CE2 1 
ATOM   55   C CZ  . PHE A 1 6   ? -13.386 42.033 -5.988  1.00 65.36  ? 6   PHE A CZ  1 
ATOM   56   N N   . ILE A 1 7   ? -9.168  44.722 -0.449  1.00 48.12  ? 7   ILE A N   1 
ATOM   57   C CA  . ILE A 1 7   ? -8.274  44.875 0.701   1.00 46.17  ? 7   ILE A CA  1 
ATOM   58   C C   . ILE A 1 7   ? -8.752  46.122 1.476   1.00 48.15  ? 7   ILE A C   1 
ATOM   59   O O   . ILE A 1 7   ? -9.019  47.150 0.844   1.00 49.11  ? 7   ILE A O   1 
ATOM   60   C CB  . ILE A 1 7   ? -6.760  44.934 0.263   1.00 49.95  ? 7   ILE A CB  1 
ATOM   61   C CG1 . ILE A 1 7   ? -6.505  46.032 -0.820  1.00 54.43  ? 7   ILE A CG1 1 
ATOM   62   C CG2 . ILE A 1 7   ? -6.272  43.579 -0.255  1.00 48.44  ? 7   ILE A CG2 1 
ATOM   63   C CD1 . ILE A 1 7   ? -4.935  46.452 -1.186  1.00 68.70  ? 7   ILE A CD1 1 
ATOM   64   N N   . THR A 1 8   ? -8.940  46.030 2.815   1.00 41.90  ? 8   THR A N   1 
ATOM   65   C CA  . THR A 1 8   ? -9.347  47.224 3.591   1.00 41.70  ? 8   THR A CA  1 
ATOM   66   C C   . THR A 1 8   ? -8.165  48.226 3.787   1.00 44.12  ? 8   THR A C   1 
ATOM   67   O O   . THR A 1 8   ? -6.998  47.919 3.453   1.00 41.83  ? 8   THR A O   1 
ATOM   68   C CB  . THR A 1 8   ? -9.951  46.863 4.964   1.00 45.79  ? 8   THR A CB  1 
ATOM   69   O OG1 . THR A 1 8   ? -9.052  46.015 5.675   1.00 48.58  ? 8   THR A OG1 1 
ATOM   70   C CG2 . THR A 1 8   ? -11.346 46.265 4.872   1.00 40.92  ? 8   THR A CG2 1 
ATOM   71   N N   . ALA A 1 9   ? -8.476  49.422 4.350   1.00 40.90  ? 9   ALA A N   1 
ATOM   72   C CA  . ALA A 1 9   ? -7.435  50.409 4.649   1.00 40.88  ? 9   ALA A CA  1 
ATOM   73   C C   . ALA A 1 9   ? -6.473  49.837 5.732   1.00 43.92  ? 9   ALA A C   1 
ATOM   74   O O   . ALA A 1 9   ? -5.254  49.992 5.621   1.00 43.45  ? 9   ALA A O   1 
ATOM   75   C CB  . ALA A 1 9   ? -8.059  51.708 5.115   1.00 42.41  ? 9   ALA A CB  1 
ATOM   76   N N   . ALA A 1 10  ? -7.029  49.114 6.722   1.00 38.90  ? 10  ALA A N   1 
ATOM   77   C CA  . ALA A 1 10  ? -6.275  48.463 7.785   1.00 37.43  ? 10  ALA A CA  1 
ATOM   78   C C   . ALA A 1 10  ? -5.371  47.339 7.241   1.00 40.81  ? 10  ALA A C   1 
ATOM   79   O O   . ALA A 1 10  ? -4.215  47.232 7.642   1.00 38.06  ? 10  ALA A O   1 
ATOM   80   C CB  . ALA A 1 10  ? -7.239  47.894 8.809   1.00 37.39  ? 10  ALA A CB  1 
ATOM   81   N N   . SER A 1 11  ? -5.902  46.505 6.328   1.00 39.61  ? 11  SER A N   1 
ATOM   82   C CA  . SER A 1 11  ? -5.156  45.396 5.738   1.00 39.38  ? 11  SER A CA  1 
ATOM   83   C C   . SER A 1 11  ? -3.998  45.920 4.898   1.00 44.98  ? 11  SER A C   1 
ATOM   84   O O   . SER A 1 11  ? -2.890  45.409 5.054   1.00 44.40  ? 11  SER A O   1 
ATOM   85   C CB  . SER A 1 11  ? -6.076  44.493 4.921   1.00 44.06  ? 11  SER A CB  1 
ATOM   86   O OG  . SER A 1 11  ? -5.402  43.344 4.432   1.00 53.91  ? 11  SER A OG  1 
ATOM   87   N N   . ALA A 1 12  ? -4.234  46.970 4.056   1.00 42.75  ? 12  ALA A N   1 
ATOM   88   C CA  . ALA A 1 12  ? -3.193  47.586 3.219   1.00 43.23  ? 12  ALA A CA  1 
ATOM   89   C C   . ALA A 1 12  ? -2.020  48.120 4.039   1.00 44.94  ? 12  ALA A C   1 
ATOM   90   O O   . ALA A 1 12  ? -0.865  47.912 3.668   1.00 43.83  ? 12  ALA A O   1 
ATOM   91   C CB  . ALA A 1 12  ? -3.778  48.705 2.384   1.00 46.12  ? 12  ALA A CB  1 
ATOM   92   N N   . ALA A 1 13  ? -2.327  48.770 5.176   1.00 41.89  ? 13  ALA A N   1 
ATOM   93   C CA  . ALA A 1 13  ? -1.390  49.369 6.131   1.00 41.44  ? 13  ALA A CA  1 
ATOM   94   C C   . ALA A 1 13  ? -0.314  48.431 6.652   1.00 45.24  ? 13  ALA A C   1 
ATOM   95   O O   . ALA A 1 13  ? 0.803   48.887 6.887   1.00 45.75  ? 13  ALA A O   1 
ATOM   96   C CB  . ALA A 1 13  ? -2.159  49.952 7.297   1.00 42.07  ? 13  ALA A CB  1 
ATOM   97   N N   . ARG A 1 14  ? -0.644  47.135 6.837   1.00 41.54  ? 14  ARG A N   1 
ATOM   98   C CA  . ARG A 1 14  ? 0.250   46.088 7.342   1.00 40.69  ? 14  ARG A CA  1 
ATOM   99   C C   . ARG A 1 14  ? 1.575   45.996 6.584   1.00 47.10  ? 14  ARG A C   1 
ATOM   100  O O   . ARG A 1 14  ? 1.594   46.013 5.353   1.00 47.36  ? 14  ARG A O   1 
ATOM   101  C CB  . ARG A 1 14  ? -0.457  44.722 7.350   1.00 38.37  ? 14  ARG A CB  1 
ATOM   102  C CG  . ARG A 1 14  ? -1.654  44.649 8.291   1.00 35.18  ? 14  ARG A CG  1 
ATOM   103  C CD  . ARG A 1 14  ? -2.176  43.232 8.467   1.00 31.53  ? 14  ARG A CD  1 
ATOM   104  N NE  . ARG A 1 14  ? -3.577  43.217 8.878   1.00 32.73  ? 14  ARG A NE  1 
ATOM   105  C CZ  . ARG A 1 14  ? -4.000  43.423 10.119  1.00 40.48  ? 14  ARG A CZ  1 
ATOM   106  N NH1 . ARG A 1 14  ? -3.129  43.646 11.095  1.00 28.51  ? 14  ARG A NH1 1 
ATOM   107  N NH2 . ARG A 1 14  ? -5.296  43.420 10.393  1.00 22.72  ? 14  ARG A NH2 1 
ATOM   108  N N   . ASN A 1 15  ? 2.682   45.932 7.336   1.00 45.09  ? 15  ASN A N   1 
ATOM   109  C CA  . ASN A 1 15  ? 4.044   45.822 6.795   1.00 45.60  ? 15  ASN A CA  1 
ATOM   110  C C   . ASN A 1 15  ? 4.746   44.537 7.318   1.00 49.49  ? 15  ASN A C   1 
ATOM   111  O O   . ASN A 1 15  ? 4.376   44.023 8.387   1.00 45.37  ? 15  ASN A O   1 
ATOM   112  C CB  . ASN A 1 15  ? 4.874   47.056 7.164   1.00 45.11  ? 15  ASN A CB  1 
ATOM   113  C CG  . ASN A 1 15  ? 4.277   48.375 6.744   1.00 65.51  ? 15  ASN A CG  1 
ATOM   114  O OD1 . ASN A 1 15  ? 4.159   48.689 5.552   1.00 65.64  ? 15  ASN A OD1 1 
ATOM   115  N ND2 . ASN A 1 15  ? 3.960   49.214 7.723   1.00 54.39  ? 15  ASN A ND2 1 
ATOM   116  N N   . PRO A 1 16  ? 5.776   44.015 6.601   1.00 50.38  ? 16  PRO A N   1 
ATOM   117  C CA  . PRO A 1 16  ? 6.465   42.807 7.089   1.00 50.90  ? 16  PRO A CA  1 
ATOM   118  C C   . PRO A 1 16  ? 7.309   43.084 8.326   1.00 57.38  ? 16  PRO A C   1 
ATOM   119  O O   . PRO A 1 16  ? 7.720   44.225 8.547   1.00 56.74  ? 16  PRO A O   1 
ATOM   120  C CB  . PRO A 1 16  ? 7.336   42.376 5.898   1.00 53.02  ? 16  PRO A CB  1 
ATOM   121  C CG  . PRO A 1 16  ? 6.904   43.222 4.755   1.00 57.85  ? 16  PRO A CG  1 
ATOM   122  C CD  . PRO A 1 16  ? 6.375   44.476 5.336   1.00 53.15  ? 16  PRO A CD  1 
ATOM   123  N N   . SER A 1 17  ? 7.548   42.035 9.134   1.00 56.19  ? 17  SER A N   1 
ATOM   124  C CA  . SER A 1 17  ? 8.336   42.119 10.361  1.00 57.24  ? 17  SER A CA  1 
ATOM   125  C C   . SER A 1 17  ? 9.782   42.448 10.040  1.00 66.83  ? 17  SER A C   1 
ATOM   126  O O   . SER A 1 17  ? 10.331  41.896 9.082   1.00 66.39  ? 17  SER A O   1 
ATOM   127  C CB  . SER A 1 17  ? 8.262   40.823 11.164  1.00 59.25  ? 17  SER A CB  1 
ATOM   128  O OG  . SER A 1 17  ? 8.810   41.022 12.458  1.00 66.49  ? 17  SER A OG  1 
ATOM   129  N N   . PRO A 1 18  ? 10.415  43.345 10.832  1.00 67.73  ? 18  PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? 11.815  43.716 10.557  1.00 69.91  ? 18  PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? 12.851  42.629 10.863  1.00 79.31  ? 18  PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? 13.981  42.731 10.399  1.00 79.67  ? 18  PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? 12.031  44.942 11.443  1.00 71.49  ? 18  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? 10.664  45.344 11.932  1.00 74.62  ? 18  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? 9.890   44.093 11.990  1.00 68.90  ? 18  PRO A CD  1 
ATOM   136  N N   . ILE A 1 19  ? 12.466  41.595 11.627  1.00 79.79  ? 19  ILE A N   1 
ATOM   137  C CA  . ILE A 1 19  ? 13.328  40.474 12.028  1.00 81.96  ? 19  ILE A CA  1 
ATOM   138  C C   . ILE A 1 19  ? 13.004  39.196 11.190  1.00 90.22  ? 19  ILE A C   1 
ATOM   139  O O   . ILE A 1 19  ? 13.409  38.086 11.570  1.00 90.06  ? 19  ILE A O   1 
ATOM   140  C CB  . ILE A 1 19  ? 13.228  40.217 13.581  1.00 84.76  ? 19  ILE A CB  1 
ATOM   141  C CG1 . ILE A 1 19  ? 12.855  41.485 14.392  1.00 84.82  ? 19  ILE A CG1 1 
ATOM   142  C CG2 . ILE A 1 19  ? 14.486  39.537 14.149  1.00 86.05  ? 19  ILE A CG2 1 
ATOM   143  C CD1 . ILE A 1 19  ? 11.527  41.398 15.018  1.00 87.85  ? 19  ILE A CD1 1 
ATOM   144  N N   . ARG A 1 20  ? 12.291  39.355 10.042  1.00 89.51  ? 20  ARG A N   1 
ATOM   145  C CA  . ARG A 1 20  ? 11.899  38.220 9.193   1.00 90.29  ? 20  ARG A CA  1 
ATOM   146  C C   . ARG A 1 20  ? 11.716  38.493 7.664   1.00 97.50  ? 20  ARG A C   1 
ATOM   147  O O   . ARG A 1 20  ? 10.624  38.207 7.163   1.00 97.11  ? 20  ARG A O   1 
ATOM   148  C CB  . ARG A 1 20  ? 10.686  37.471 9.794   1.00 89.30  ? 20  ARG A CB  1 
ATOM   149  C CG  . ARG A 1 20  ? 11.023  36.076 10.304  1.00 97.32  ? 20  ARG A CG  1 
ATOM   150  C CD  . ARG A 1 20  ? 9.776   35.240 10.522  1.00 98.91  ? 20  ARG A CD  1 
ATOM   151  N NE  . ARG A 1 20  ? 9.368   34.502 9.322   1.00 96.96  ? 20  ARG A NE  1 
ATOM   152  C CZ  . ARG A 1 20  ? 8.194   34.644 8.715   1.00 97.45  ? 20  ARG A CZ  1 
ATOM   153  N NH1 . ARG A 1 20  ? 7.293   35.492 9.189   1.00 81.96  ? 20  ARG A NH1 1 
ATOM   154  N NH2 . ARG A 1 20  ? 7.909   33.934 7.633   1.00 76.35  ? 20  ARG A NH2 1 
ATOM   155  N N   . THR A 1 21  ? 12.743  38.943 6.870   1.00 96.45  ? 21  THR A N   1 
ATOM   156  C CA  . THR A 1 21  ? 14.131  39.402 7.093   1.00 97.56  ? 21  THR A CA  1 
ATOM   157  C C   . THR A 1 21  ? 15.046  38.602 8.037   1.00 102.56 ? 21  THR A C   1 
ATOM   158  O O   . THR A 1 21  ? 14.573  37.755 8.795   1.00 101.20 ? 21  THR A O   1 
ATOM   159  C CB  . THR A 1 21  ? 14.223  40.928 7.253   1.00 106.28 ? 21  THR A CB  1 
ATOM   160  O OG1 . THR A 1 21  ? 12.917  41.506 7.275   1.00 106.17 ? 21  THR A OG1 1 
ATOM   161  C CG2 . THR A 1 21  ? 15.039  41.569 6.145   1.00 105.75 ? 21  THR A CG2 1 
ATOM   162  N N   . MET A 1 22  ? 16.374  38.866 7.971   1.00 101.02 ? 22  MET A N   1 
ATOM   163  C CA  . MET A 1 22  ? 17.429  38.205 8.768   1.00 101.38 ? 22  MET A CA  1 
ATOM   164  C C   . MET A 1 22  ? 17.531  36.703 8.424   1.00 105.87 ? 22  MET A C   1 
ATOM   165  O O   . MET A 1 22  ? 18.539  36.264 7.860   1.00 106.61 ? 22  MET A O   1 
ATOM   166  C CB  . MET A 1 22  ? 17.267  38.433 10.301  1.00 102.90 ? 22  MET A CB  1 
ATOM   167  C CG  . MET A 1 22  ? 16.872  39.856 10.703  1.00 106.34 ? 22  MET A CG  1 
ATOM   168  S SD  . MET A 1 22  ? 18.061  41.127 10.215  1.00 111.75 ? 22  MET A SD  1 
ATOM   169  C CE  . MET A 1 22  ? 17.007  42.225 9.365   1.00 108.43 ? 22  MET A CE  1 
ATOM   170  N N   . THR A 1 23  ? 16.459  35.941 8.735   1.00 101.29 ? 23  THR A N   1 
ATOM   171  C CA  . THR A 1 23  ? 16.293  34.507 8.491   1.00 118.18 ? 23  THR A CA  1 
ATOM   172  C C   . THR A 1 23  ? 15.998  34.241 7.009   1.00 136.99 ? 23  THR A C   1 
ATOM   173  O O   . THR A 1 23  ? 16.697  34.739 6.125   1.00 97.86  ? 23  THR A O   1 
ATOM   174  C CB  . THR A 1 23  ? 15.162  33.951 9.384   1.00 122.79 ? 23  THR A CB  1 
ATOM   175  O OG1 . THR A 1 23  ? 13.995  34.762 9.230   1.00 121.25 ? 23  THR A OG1 1 
ATOM   176  C CG2 . THR A 1 23  ? 15.549  33.882 10.861  1.00 119.75 ? 23  THR A CG2 1 
ATOM   177  N N   . LYS A 1 31  ? 27.182  30.402 5.372   1.00 96.41  ? 31  LYS A N   1 
ATOM   178  C CA  . LYS A 1 31  ? 26.778  29.429 6.389   1.00 95.19  ? 31  LYS A CA  1 
ATOM   179  C C   . LYS A 1 31  ? 27.561  29.517 7.719   1.00 97.80  ? 31  LYS A C   1 
ATOM   180  O O   . LYS A 1 31  ? 27.162  28.887 8.705   1.00 96.96  ? 31  LYS A O   1 
ATOM   181  C CB  . LYS A 1 31  ? 26.708  27.991 5.828   1.00 98.43  ? 31  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 31  ? 27.968  27.493 5.114   1.00 114.84 ? 31  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 31  ? 27.716  26.124 4.471   1.00 124.34 ? 31  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 31  ? 28.949  25.493 3.870   1.00 131.21 ? 31  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 31  ? 28.648  24.160 3.282   1.00 135.41 ? 31  LYS A NZ  1 
ATOM   186  N N   . SER A 1 32  ? 28.650  30.320 7.751   1.00 93.32  ? 32  SER A N   1 
ATOM   187  C CA  . SER A 1 32  ? 29.455  30.547 8.958   1.00 92.28  ? 32  SER A CA  1 
ATOM   188  C C   . SER A 1 32  ? 29.172  31.953 9.558   1.00 91.92  ? 32  SER A C   1 
ATOM   189  O O   . SER A 1 32  ? 30.085  32.649 10.023  1.00 93.06  ? 32  SER A O   1 
ATOM   190  C CB  . SER A 1 32  ? 30.940  30.311 8.684   1.00 97.79  ? 32  SER A CB  1 
ATOM   191  O OG  . SER A 1 32  ? 31.451  31.219 7.722   1.00 108.06 ? 32  SER A OG  1 
ATOM   192  N N   . MET A 1 33  ? 27.876  32.343 9.549   1.00 82.66  ? 33  MET A N   1 
ATOM   193  C CA  . MET A 1 33  ? 27.333  33.593 10.078  1.00 79.01  ? 33  MET A CA  1 
ATOM   194  C C   . MET A 1 33  ? 27.280  33.564 11.592  1.00 76.84  ? 33  MET A C   1 
ATOM   195  O O   . MET A 1 33  ? 26.915  32.547 12.174  1.00 76.19  ? 33  MET A O   1 
ATOM   196  C CB  . MET A 1 33  ? 25.888  33.772 9.587   1.00 80.09  ? 33  MET A CB  1 
ATOM   197  C CG  . MET A 1 33  ? 25.779  34.376 8.236   1.00 84.82  ? 33  MET A CG  1 
ATOM   198  S SD  . MET A 1 33  ? 25.910  36.172 8.294   1.00 89.97  ? 33  MET A SD  1 
ATOM   199  C CE  . MET A 1 33  ? 26.107  36.490 6.593   1.00 88.07  ? 33  MET A CE  1 
ATOM   200  N N   . ILE A 1 34  ? 27.575  34.687 12.234  1.00 69.89  ? 34  ILE A N   1 
ATOM   201  C CA  . ILE A 1 34  ? 27.420  34.792 13.681  1.00 67.56  ? 34  ILE A CA  1 
ATOM   202  C C   . ILE A 1 34  ? 26.132  35.598 13.881  1.00 68.24  ? 34  ILE A C   1 
ATOM   203  O O   . ILE A 1 34  ? 26.097  36.779 13.540  1.00 67.94  ? 34  ILE A O   1 
ATOM   204  C CB  . ILE A 1 34  ? 28.654  35.404 14.392  1.00 71.27  ? 34  ILE A CB  1 
ATOM   205  C CG1 . ILE A 1 34  ? 29.887  34.497 14.218  1.00 72.77  ? 34  ILE A CG1 1 
ATOM   206  C CG2 . ILE A 1 34  ? 28.357  35.644 15.878  1.00 71.27  ? 34  ILE A CG2 1 
ATOM   207  C CD1 . ILE A 1 34  ? 31.187  35.116 14.543  1.00 75.36  ? 34  ILE A CD1 1 
ATOM   208  N N   . SER A 1 35  ? 25.062  34.942 14.359  1.00 62.20  ? 35  SER A N   1 
ATOM   209  C CA  . SER A 1 35  ? 23.767  35.592 14.570  1.00 60.01  ? 35  SER A CA  1 
ATOM   210  C C   . SER A 1 35  ? 23.503  36.060 16.016  1.00 60.38  ? 35  SER A C   1 
ATOM   211  O O   . SER A 1 35  ? 23.301  35.242 16.926  1.00 59.68  ? 35  SER A O   1 
ATOM   212  C CB  . SER A 1 35  ? 22.624  34.718 14.053  1.00 63.38  ? 35  SER A CB  1 
ATOM   213  O OG  . SER A 1 35  ? 21.358  35.360 14.124  1.00 72.59  ? 35  SER A OG  1 
ATOM   214  N N   . LEU A 1 36  ? 23.498  37.391 16.204  1.00 54.11  ? 36  LEU A N   1 
ATOM   215  C CA  . LEU A 1 36  ? 23.165  38.078 17.459  1.00 52.03  ? 36  LEU A CA  1 
ATOM   216  C C   . LEU A 1 36  ? 21.944  38.933 17.170  1.00 52.33  ? 36  LEU A C   1 
ATOM   217  O O   . LEU A 1 36  ? 21.632  39.846 17.937  1.00 50.25  ? 36  LEU A O   1 
ATOM   218  C CB  . LEU A 1 36  ? 24.315  38.976 17.926  1.00 52.74  ? 36  LEU A CB  1 
ATOM   219  C CG  . LEU A 1 36  ? 25.515  38.251 18.430  1.00 57.69  ? 36  LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 36  ? 26.668  38.553 17.584  1.00 59.04  ? 36  LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 36  ? 25.809  38.626 19.829  1.00 59.22  ? 36  LEU A CD2 1 
ATOM   222  N N   . ALA A 1 37  ? 21.263  38.629 16.045  1.00 48.80  ? 37  ALA A N   1 
ATOM   223  C CA  . ALA A 1 37  ? 20.092  39.344 15.570  1.00 48.66  ? 37  ALA A CA  1 
ATOM   224  C C   . ALA A 1 37  ? 18.846  38.878 16.273  1.00 54.62  ? 37  ALA A C   1 
ATOM   225  O O   . ALA A 1 37  ? 18.376  39.536 17.207  1.00 53.97  ? 37  ALA A O   1 
ATOM   226  C CB  . ALA A 1 37  ? 19.949  39.183 14.062  1.00 49.38  ? 37  ALA A CB  1 
ATOM   227  N N   . GLY A 1 38  ? 18.353  37.726 15.830  1.00 53.54  ? 38  GLY A N   1 
ATOM   228  C CA  . GLY A 1 38  ? 17.137  37.083 16.305  1.00 52.71  ? 38  GLY A CA  1 
ATOM   229  C C   . GLY A 1 38  ? 17.146  36.684 17.759  1.00 56.78  ? 38  GLY A C   1 
ATOM   230  O O   . GLY A 1 38  ? 18.084  36.043 18.248  1.00 57.20  ? 38  GLY A O   1 
ATOM   231  N N   . GLY A 1 39  ? 16.089  37.101 18.431  1.00 52.48  ? 39  GLY A N   1 
ATOM   232  C CA  . GLY A 1 39  ? 15.798  36.795 19.825  1.00 51.95  ? 39  GLY A CA  1 
ATOM   233  C C   . GLY A 1 39  ? 15.110  35.455 20.021  1.00 54.21  ? 39  GLY A C   1 
ATOM   234  O O   . GLY A 1 39  ? 14.134  35.360 20.768  1.00 53.67  ? 39  GLY A O   1 
ATOM   235  N N   . LEU A 1 40  ? 15.626  34.401 19.356  1.00 49.19  ? 40  LEU A N   1 
ATOM   236  C CA  . LEU A 1 40  ? 15.127  33.037 19.496  1.00 47.14  ? 40  LEU A CA  1 
ATOM   237  C C   . LEU A 1 40  ? 15.638  32.481 20.828  1.00 50.31  ? 40  LEU A C   1 
ATOM   238  O O   . LEU A 1 40  ? 16.827  32.623 21.135  1.00 51.57  ? 40  LEU A O   1 
ATOM   239  C CB  . LEU A 1 40  ? 15.575  32.112 18.346  1.00 46.78  ? 40  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 40  ? 15.170  32.462 16.908  1.00 50.85  ? 40  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 40  ? 15.462  31.308 15.990  1.00 52.47  ? 40  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 40  ? 13.693  32.832 16.779  1.00 49.57  ? 40  LEU A CD2 1 
ATOM   243  N N   . PRO A 1 41  ? 14.758  31.870 21.645  1.00 44.29  ? 41  PRO A N   1 
ATOM   244  C CA  . PRO A 1 41  ? 15.221  31.314 22.924  1.00 44.72  ? 41  PRO A CA  1 
ATOM   245  C C   . PRO A 1 41  ? 16.147  30.114 22.708  1.00 49.71  ? 41  PRO A C   1 
ATOM   246  O O   . PRO A 1 41  ? 16.069  29.472 21.658  1.00 49.74  ? 41  PRO A O   1 
ATOM   247  C CB  . PRO A 1 41  ? 13.920  30.897 23.602  1.00 45.51  ? 41  PRO A CB  1 
ATOM   248  C CG  . PRO A 1 41  ? 12.990  30.640 22.485  1.00 48.23  ? 41  PRO A CG  1 
ATOM   249  C CD  . PRO A 1 41  ? 13.317  31.628 21.442  1.00 43.66  ? 41  PRO A CD  1 
ATOM   250  N N   . ASN A 1 42  ? 17.027  29.821 23.678  1.00 46.12  ? 42  ASN A N   1 
ATOM   251  C CA  . ASN A 1 42  ? 17.914  28.682 23.543  1.00 46.75  ? 42  ASN A CA  1 
ATOM   252  C C   . ASN A 1 42  ? 17.126  27.345 23.648  1.00 52.80  ? 42  ASN A C   1 
ATOM   253  O O   . ASN A 1 42  ? 16.450  27.084 24.654  1.00 50.64  ? 42  ASN A O   1 
ATOM   254  C CB  . ASN A 1 42  ? 19.066  28.735 24.534  1.00 45.93  ? 42  ASN A CB  1 
ATOM   255  C CG  . ASN A 1 42  ? 20.201  27.836 24.125  1.00 65.44  ? 42  ASN A CG  1 
ATOM   256  O OD1 . ASN A 1 42  ? 20.041  26.620 23.994  1.00 58.26  ? 42  ASN A OD1 1 
ATOM   257  N ND2 . ASN A 1 42  ? 21.353  28.424 23.826  1.00 59.57  ? 42  ASN A ND2 1 
ATOM   258  N N   . PRO A 1 43  ? 17.190  26.500 22.594  1.00 52.62  ? 43  PRO A N   1 
ATOM   259  C CA  . PRO A 1 43  ? 16.446  25.230 22.633  1.00 53.33  ? 43  PRO A CA  1 
ATOM   260  C C   . PRO A 1 43  ? 17.047  24.163 23.565  1.00 58.25  ? 43  PRO A C   1 
ATOM   261  O O   . PRO A 1 43  ? 16.337  23.212 23.940  1.00 60.59  ? 43  PRO A O   1 
ATOM   262  C CB  . PRO A 1 43  ? 16.413  24.797 21.164  1.00 54.89  ? 43  PRO A CB  1 
ATOM   263  C CG  . PRO A 1 43  ? 17.655  25.365 20.593  1.00 59.65  ? 43  PRO A CG  1 
ATOM   264  C CD  . PRO A 1 43  ? 17.946  26.641 21.332  1.00 54.78  ? 43  PRO A CD  1 
ATOM   265  N N   . ASN A 1 44  ? 18.325  24.333 23.974  1.00 50.69  ? 44  ASN A N   1 
ATOM   266  C CA  . ASN A 1 44  ? 18.952  23.403 24.908  1.00 50.60  ? 44  ASN A CA  1 
ATOM   267  C C   . ASN A 1 44  ? 18.389  23.555 26.337  1.00 53.70  ? 44  ASN A C   1 
ATOM   268  O O   . ASN A 1 44  ? 18.800  22.829 27.238  1.00 55.18  ? 44  ASN A O   1 
ATOM   269  C CB  . ASN A 1 44  ? 20.485  23.517 24.864  1.00 52.41  ? 44  ASN A CB  1 
ATOM   270  C CG  . ASN A 1 44  ? 21.100  23.211 23.511  1.00 76.80  ? 44  ASN A CG  1 
ATOM   271  O OD1 . ASN A 1 44  ? 20.973  22.109 22.965  1.00 73.38  ? 44  ASN A OD1 1 
ATOM   272  N ND2 . ASN A 1 44  ? 21.820  24.167 22.953  1.00 68.33  ? 44  ASN A ND2 1 
ATOM   273  N N   . MET A 1 45  ? 17.416  24.470 26.524  1.00 48.62  ? 45  MET A N   1 
ATOM   274  C CA  . MET A 1 45  ? 16.755  24.769 27.797  1.00 48.22  ? 45  MET A CA  1 
ATOM   275  C C   . MET A 1 45  ? 15.363  24.153 27.889  1.00 50.20  ? 45  MET A C   1 
ATOM   276  O O   . MET A 1 45  ? 14.800  24.075 28.981  1.00 49.54  ? 45  MET A O   1 
ATOM   277  C CB  . MET A 1 45  ? 16.644  26.296 27.992  1.00 50.26  ? 45  MET A CB  1 
ATOM   278  C CG  . MET A 1 45  ? 17.982  27.014 28.088  1.00 54.93  ? 45  MET A CG  1 
ATOM   279  S SD  . MET A 1 45  ? 18.977  26.482 29.498  1.00 61.16  ? 45  MET A SD  1 
ATOM   280  C CE  . MET A 1 45  ? 20.304  25.678 28.689  1.00 59.08  ? 45  MET A CE  1 
ATOM   281  N N   . PHE A 1 46  ? 14.796  23.755 26.737  1.00 46.10  ? 46  PHE A N   1 
ATOM   282  C CA  . PHE A 1 46  ? 13.457  23.181 26.621  1.00 44.83  ? 46  PHE A CA  1 
ATOM   283  C C   . PHE A 1 46  ? 13.389  21.810 27.273  1.00 45.77  ? 46  PHE A C   1 
ATOM   284  O O   . PHE A 1 46  ? 14.314  21.018 27.097  1.00 44.95  ? 46  PHE A O   1 
ATOM   285  C CB  . PHE A 1 46  ? 12.978  23.182 25.154  1.00 46.67  ? 46  PHE A CB  1 
ATOM   286  C CG  . PHE A 1 46  ? 12.792  24.555 24.520  1.00 48.76  ? 46  PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 46  ? 12.570  25.689 25.310  1.00 51.66  ? 46  PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 46  ? 12.817  24.709 23.138  1.00 51.29  ? 46  PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 46  ? 12.399  26.944 24.730  1.00 52.27  ? 46  PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 46  ? 12.641  25.970 22.558  1.00 53.65  ? 46  PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 46  ? 12.442  27.078 23.359  1.00 51.55  ? 46  PHE A CZ  1 
ATOM   292  N N   . PRO A 1 47  ? 12.345  21.538 28.096  1.00 41.04  ? 47  PRO A N   1 
ATOM   293  C CA  . PRO A 1 47  ? 12.302  20.254 28.832  1.00 40.83  ? 47  PRO A CA  1 
ATOM   294  C C   . PRO A 1 47  ? 12.008  18.984 28.030  1.00 42.12  ? 47  PRO A C   1 
ATOM   295  O O   . PRO A 1 47  ? 12.382  17.902 28.485  1.00 41.74  ? 47  PRO A O   1 
ATOM   296  C CB  . PRO A 1 47  ? 11.268  20.513 29.933  1.00 41.91  ? 47  PRO A CB  1 
ATOM   297  C CG  . PRO A 1 47  ? 10.369  21.527 29.357  1.00 44.85  ? 47  PRO A CG  1 
ATOM   298  C CD  . PRO A 1 47  ? 11.197  22.402 28.454  1.00 40.64  ? 47  PRO A CD  1 
ATOM   299  N N   . PHE A 1 48  ? 11.329  19.094 26.870  1.00 36.82  ? 48  PHE A N   1 
ATOM   300  C CA  . PHE A 1 48  ? 11.024  17.917 26.047  1.00 36.67  ? 48  PHE A CA  1 
ATOM   301  C C   . PHE A 1 48  ? 12.243  17.577 25.184  1.00 41.06  ? 48  PHE A C   1 
ATOM   302  O O   . PHE A 1 48  ? 12.835  18.469 24.565  1.00 40.98  ? 48  PHE A O   1 
ATOM   303  C CB  . PHE A 1 48  ? 9.750   18.126 25.225  1.00 37.36  ? 48  PHE A CB  1 
ATOM   304  C CG  . PHE A 1 48  ? 8.602   18.678 26.031  1.00 38.02  ? 48  PHE A CG  1 
ATOM   305  C CD1 . PHE A 1 48  ? 7.945   17.887 26.968  1.00 41.65  ? 48  PHE A CD1 1 
ATOM   306  C CD2 . PHE A 1 48  ? 8.191   19.995 25.870  1.00 39.37  ? 48  PHE A CD2 1 
ATOM   307  C CE1 . PHE A 1 48  ? 6.892   18.405 27.724  1.00 42.47  ? 48  PHE A CE1 1 
ATOM   308  C CE2 . PHE A 1 48  ? 7.136   20.514 26.624  1.00 41.84  ? 48  PHE A CE2 1 
ATOM   309  C CZ  . PHE A 1 48  ? 6.483   19.712 27.536  1.00 40.81  ? 48  PHE A CZ  1 
ATOM   310  N N   . LYS A 1 49  ? 12.659  16.303 25.193  1.00 37.66  ? 49  LYS A N   1 
ATOM   311  C CA  . LYS A 1 49  ? 13.897  15.893 24.537  1.00 38.63  ? 49  LYS A CA  1 
ATOM   312  C C   . LYS A 1 49  ? 13.810  15.066 23.253  1.00 43.06  ? 49  LYS A C   1 
ATOM   313  O O   . LYS A 1 49  ? 14.563  15.349 22.315  1.00 42.44  ? 49  LYS A O   1 
ATOM   314  C CB  . LYS A 1 49  ? 14.887  15.295 25.567  1.00 42.75  ? 49  LYS A CB  1 
ATOM   315  C CG  . LYS A 1 49  ? 15.281  16.259 26.704  1.00 57.91  ? 49  LYS A CG  1 
ATOM   316  C CD  . LYS A 1 49  ? 16.140  17.450 26.230  1.00 66.03  ? 49  LYS A CD  1 
ATOM   317  C CE  . LYS A 1 49  ? 16.478  18.443 27.315  1.00 71.05  ? 49  LYS A CE  1 
ATOM   318  N NZ  . LYS A 1 49  ? 16.925  19.751 26.755  1.00 76.10  ? 49  LYS A NZ  1 
ATOM   319  N N   . THR A 1 50  ? 12.954  14.018 23.234  1.00 40.16  ? 50  THR A N   1 
ATOM   320  C CA  . THR A 1 50  ? 12.732  13.121 22.086  1.00 40.35  ? 50  THR A CA  1 
ATOM   321  C C   . THR A 1 50  ? 11.279  12.666 22.092  1.00 44.62  ? 50  THR A C   1 
ATOM   322  O O   . THR A 1 50  ? 10.647  12.664 23.148  1.00 44.87  ? 50  THR A O   1 
ATOM   323  C CB  . THR A 1 50  ? 13.620  11.852 22.124  1.00 47.50  ? 50  THR A CB  1 
ATOM   324  O OG1 . THR A 1 50  ? 13.256  11.039 23.232  1.00 48.01  ? 50  THR A OG1 1 
ATOM   325  C CG2 . THR A 1 50  ? 15.115  12.133 22.123  1.00 45.60  ? 50  THR A CG2 1 
ATOM   326  N N   . ALA A 1 51  ? 10.752  12.261 20.933  1.00 40.67  ? 51  ALA A N   1 
ATOM   327  C CA  . ALA A 1 51  ? 9.369   11.805 20.856  1.00 40.01  ? 51  ALA A CA  1 
ATOM   328  C C   . ALA A 1 51  ? 9.208   10.658 19.877  1.00 46.00  ? 51  ALA A C   1 
ATOM   329  O O   . ALA A 1 51  ? 9.892   10.611 18.847  1.00 46.83  ? 51  ALA A O   1 
ATOM   330  C CB  . ALA A 1 51  ? 8.442   12.949 20.482  1.00 38.87  ? 51  ALA A CB  1 
ATOM   331  N N   . VAL A 1 52  ? 8.311   9.719  20.222  1.00 41.03  ? 52  VAL A N   1 
ATOM   332  C CA  . VAL A 1 52  ? 7.975   8.577  19.393  1.00 41.06  ? 52  VAL A CA  1 
ATOM   333  C C   . VAL A 1 52  ? 6.470   8.377  19.444  1.00 42.92  ? 52  VAL A C   1 
ATOM   334  O O   . VAL A 1 52  ? 5.905   8.115  20.506  1.00 42.88  ? 52  VAL A O   1 
ATOM   335  C CB  . VAL A 1 52  ? 8.843   7.293  19.603  1.00 47.06  ? 52  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 52  ? 9.201   7.073  21.070  1.00 47.99  ? 52  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 52  ? 8.193   6.046  18.995  1.00 46.95  ? 52  VAL A CG2 1 
ATOM   338  N N   . ILE A 1 53  ? 5.830   8.592  18.288  1.00 37.24  ? 53  ILE A N   1 
ATOM   339  C CA  . ILE A 1 53  ? 4.396   8.493  18.072  1.00 35.37  ? 53  ILE A CA  1 
ATOM   340  C C   . ILE A 1 53  ? 4.120   7.285  17.166  1.00 41.15  ? 53  ILE A C   1 
ATOM   341  O O   . ILE A 1 53  ? 4.695   7.182  16.065  1.00 40.17  ? 53  ILE A O   1 
ATOM   342  C CB  . ILE A 1 53  ? 3.851   9.836  17.481  1.00 36.30  ? 53  ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 53  ? 4.106   11.012 18.452  1.00 36.13  ? 53  ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 53  ? 2.361   9.750  17.103  1.00 34.74  ? 53  ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 53  ? 4.316   12.397 17.799  1.00 43.48  ? 53  ILE A CD1 1 
ATOM   346  N N   . THR A 1 54  ? 3.235   6.372  17.642  1.00 38.92  ? 54  THR A N   1 
ATOM   347  C CA  . THR A 1 54  ? 2.821   5.196  16.866  1.00 39.97  ? 54  THR A CA  1 
ATOM   348  C C   . THR A 1 54  ? 1.656   5.578  15.938  1.00 43.87  ? 54  THR A C   1 
ATOM   349  O O   . THR A 1 54  ? 0.842   6.438  16.289  1.00 39.25  ? 54  THR A O   1 
ATOM   350  C CB  . THR A 1 54  ? 2.529   3.958  17.735  1.00 42.91  ? 54  THR A CB  1 
ATOM   351  O OG1 . THR A 1 54  ? 1.342   4.176  18.481  1.00 47.41  ? 54  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 54  ? 3.671   3.577  18.655  1.00 34.72  ? 54  THR A CG2 1 
ATOM   353  N N   . VAL A 1 55  ? 1.600   4.940  14.751  1.00 45.80  ? 55  VAL A N   1 
ATOM   354  C CA  . VAL A 1 55  ? 0.608   5.208  13.693  1.00 47.56  ? 55  VAL A CA  1 
ATOM   355  C C   . VAL A 1 55  ? -0.246  3.927  13.384  1.00 57.99  ? 55  VAL A C   1 
ATOM   356  O O   . VAL A 1 55  ? -0.160  2.950  14.130  1.00 58.61  ? 55  VAL A O   1 
ATOM   357  C CB  . VAL A 1 55  ? 1.324   5.829  12.435  1.00 51.23  ? 55  VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 55  ? 0.328   6.304  11.377  1.00 50.11  ? 55  VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 55  ? 2.256   6.981  12.829  1.00 50.37  ? 55  VAL A CG2 1 
ATOM   360  N N   . GLU A 1 56  ? -1.085  3.959  12.324  1.00 58.61  ? 56  GLU A N   1 
ATOM   361  C CA  . GLU A 1 56  ? -1.935  2.855  11.858  1.00 61.20  ? 56  GLU A CA  1 
ATOM   362  C C   . GLU A 1 56  ? -1.275  2.033  10.695  1.00 72.29  ? 56  GLU A C   1 
ATOM   363  O O   . GLU A 1 56  ? -1.474  2.376  9.526   1.00 73.50  ? 56  GLU A O   1 
ATOM   364  C CB  . GLU A 1 56  ? -3.347  3.366  11.466  1.00 61.42  ? 56  GLU A CB  1 
ATOM   365  C CG  . GLU A 1 56  ? -3.398  4.423  10.365  1.00 67.46  ? 56  GLU A CG  1 
ATOM   366  C CD  . GLU A 1 56  ? -4.781  4.769  9.846   1.00 92.37  ? 56  GLU A CD  1 
ATOM   367  O OE1 . GLU A 1 56  ? -4.991  4.682  8.613   1.00 83.09  ? 56  GLU A OE1 1 
ATOM   368  O OE2 . GLU A 1 56  ? -5.647  5.160  10.664  1.00 92.47  ? 56  GLU A OE2 1 
ATOM   369  N N   . ASN A 1 57  ? -0.507  0.956  10.969  1.00 72.32  ? 57  ASN A N   1 
ATOM   370  C CA  . ASN A 1 57  ? -0.149  0.366  12.259  1.00 73.76  ? 57  ASN A CA  1 
ATOM   371  C C   . ASN A 1 57  ? 1.272   -0.194 12.160  1.00 80.43  ? 57  ASN A C   1 
ATOM   372  O O   . ASN A 1 57  ? 1.690   -0.631 11.079  1.00 81.07  ? 57  ASN A O   1 
ATOM   373  C CB  . ASN A 1 57  ? -1.132  -0.752 12.631  1.00 77.64  ? 57  ASN A CB  1 
ATOM   374  C CG  . ASN A 1 57  ? -0.644  -1.663 13.731  1.00 105.26 ? 57  ASN A CG  1 
ATOM   375  O OD1 . ASN A 1 57  ? -0.352  -1.230 14.856  1.00 102.39 ? 57  ASN A OD1 1 
ATOM   376  N ND2 . ASN A 1 57  ? -0.486  -2.932 13.403  1.00 97.15  ? 57  ASN A ND2 1 
ATOM   377  N N   . GLY A 1 58  ? 1.998   -0.170 13.283  1.00 77.09  ? 58  GLY A N   1 
ATOM   378  C CA  . GLY A 1 58  ? 3.378   -0.641 13.338  1.00 77.98  ? 58  GLY A CA  1 
ATOM   379  C C   . GLY A 1 58  ? 4.314   0.408  12.782  1.00 80.98  ? 58  GLY A C   1 
ATOM   380  O O   . GLY A 1 58  ? 5.534   0.325  12.963  1.00 82.48  ? 58  GLY A O   1 
ATOM   381  N N   . LYS A 1 59  ? 3.727   1.403  12.087  1.00 74.71  ? 59  LYS A N   1 
ATOM   382  C CA  . LYS A 1 59  ? 4.397   2.564  11.511  1.00 73.22  ? 59  LYS A CA  1 
ATOM   383  C C   . LYS A 1 59  ? 4.739   3.490  12.683  1.00 73.15  ? 59  LYS A C   1 
ATOM   384  O O   . LYS A 1 59  ? 3.979   3.568  13.663  1.00 71.01  ? 59  LYS A O   1 
ATOM   385  C CB  . LYS A 1 59  ? 3.489   3.277  10.496  1.00 74.78  ? 59  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 59  ? 3.054   2.410  9.314   1.00 84.38  ? 59  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 59  ? 1.755   2.942  8.727   1.00 87.32  ? 59  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 59  ? 1.281   2.160  7.535   1.00 91.51  ? 59  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 59  ? 0.084   2.794  6.922   1.00 97.84  ? 59  LYS A NZ  1 
ATOM   390  N N   . THR A 1 60  ? 5.910   4.145  12.605  1.00 67.92  ? 60  THR A N   1 
ATOM   391  C CA  . THR A 1 60  ? 6.398   4.981  13.686  1.00 65.92  ? 60  THR A CA  1 
ATOM   392  C C   . THR A 1 60  ? 7.048   6.280  13.230  1.00 65.76  ? 60  THR A C   1 
ATOM   393  O O   . THR A 1 60  ? 7.974   6.264  12.418  1.00 67.52  ? 60  THR A O   1 
ATOM   394  C CB  . THR A 1 60  ? 7.249   4.105  14.641  1.00 75.82  ? 60  THR A CB  1 
ATOM   395  O OG1 . THR A 1 60  ? 6.364   3.401  15.509  1.00 75.61  ? 60  THR A OG1 1 
ATOM   396  C CG2 . THR A 1 60  ? 8.250   4.892  15.471  1.00 74.92  ? 60  THR A CG2 1 
ATOM   397  N N   . ILE A 1 61  ? 6.548   7.399  13.776  1.00 57.04  ? 61  ILE A N   1 
ATOM   398  C CA  . ILE A 1 61  ? 7.090   8.754  13.623  1.00 54.23  ? 61  ILE A CA  1 
ATOM   399  C C   . ILE A 1 61  ? 8.073   8.975  14.792  1.00 53.79  ? 61  ILE A C   1 
ATOM   400  O O   . ILE A 1 61  ? 7.758   8.625  15.933  1.00 52.97  ? 61  ILE A O   1 
ATOM   401  C CB  . ILE A 1 61  ? 5.935   9.802  13.605  1.00 55.78  ? 61  ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 61  ? 5.308   9.885  12.213  1.00 55.59  ? 61  ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 61  ? 6.381   11.194 14.084  1.00 56.55  ? 61  ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 61  ? 3.951   10.471 12.206  1.00 62.31  ? 61  ILE A CD1 1 
ATOM   405  N N   . GLN A 1 62  ? 9.252   9.546  14.514  1.00 48.40  ? 62  GLN A N   1 
ATOM   406  C CA  . GLN A 1 62  ? 10.257  9.789  15.555  1.00 47.51  ? 62  GLN A CA  1 
ATOM   407  C C   . GLN A 1 62  ? 10.870  11.158 15.487  1.00 48.67  ? 62  GLN A C   1 
ATOM   408  O O   . GLN A 1 62  ? 11.353  11.573 14.428  1.00 50.15  ? 62  GLN A O   1 
ATOM   409  C CB  . GLN A 1 62  ? 11.384  8.741  15.512  1.00 50.44  ? 62  GLN A CB  1 
ATOM   410  C CG  . GLN A 1 62  ? 11.019  7.425  16.171  1.00 75.58  ? 62  GLN A CG  1 
ATOM   411  C CD  . GLN A 1 62  ? 11.718  6.256  15.533  1.00 99.12  ? 62  GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 62  ? 11.362  5.816  14.428  1.00 94.96  ? 62  GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 62  ? 12.709  5.711  16.233  1.00 91.73  ? 62  GLN A NE2 1 
ATOM   414  N N   . PHE A 1 63  ? 10.879  11.858 16.623  1.00 40.64  ? 63  PHE A N   1 
ATOM   415  C CA  . PHE A 1 63  ? 11.557  13.138 16.699  1.00 38.40  ? 63  PHE A CA  1 
ATOM   416  C C   . PHE A 1 63  ? 12.804  12.909 17.553  1.00 40.81  ? 63  PHE A C   1 
ATOM   417  O O   . PHE A 1 63  ? 12.698  12.677 18.761  1.00 40.44  ? 63  PHE A O   1 
ATOM   418  C CB  . PHE A 1 63  ? 10.667  14.266 17.274  1.00 38.22  ? 63  PHE A CB  1 
ATOM   419  C CG  . PHE A 1 63  ? 9.466   14.742 16.477  1.00 37.89  ? 63  PHE A CG  1 
ATOM   420  C CD1 . PHE A 1 63  ? 9.073   14.089 15.312  1.00 39.92  ? 63  PHE A CD1 1 
ATOM   421  C CD2 . PHE A 1 63  ? 8.686   15.801 16.931  1.00 38.88  ? 63  PHE A CD2 1 
ATOM   422  C CE1 . PHE A 1 63  ? 7.936   14.499 14.607  1.00 39.61  ? 63  PHE A CE1 1 
ATOM   423  C CE2 . PHE A 1 63  ? 7.556   16.221 16.215  1.00 40.33  ? 63  PHE A CE2 1 
ATOM   424  C CZ  . PHE A 1 63  ? 7.201   15.575 15.048  1.00 38.42  ? 63  PHE A CZ  1 
ATOM   425  N N   . GLY A 1 64  ? 13.961  12.909 16.897  1.00 36.44  ? 64  GLY A N   1 
ATOM   426  C CA  . GLY A 1 64  ? 15.252  12.771 17.552  1.00 37.50  ? 64  GLY A CA  1 
ATOM   427  C C   . GLY A 1 64  ? 15.664  14.044 18.267  1.00 41.50  ? 64  GLY A C   1 
ATOM   428  O O   . GLY A 1 64  ? 14.923  15.030 18.266  1.00 39.96  ? 64  GLY A O   1 
ATOM   429  N N   . GLU A 1 65  ? 16.857  14.034 18.876  1.00 39.85  ? 65  GLU A N   1 
ATOM   430  C CA  . GLU A 1 65  ? 17.404  15.152 19.637  1.00 39.87  ? 65  GLU A CA  1 
ATOM   431  C C   . GLU A 1 65  ? 17.260  16.507 18.932  1.00 43.42  ? 65  GLU A C   1 
ATOM   432  O O   . GLU A 1 65  ? 16.718  17.462 19.508  1.00 40.70  ? 65  GLU A O   1 
ATOM   433  C CB  . GLU A 1 65  ? 18.872  14.873 20.020  1.00 43.11  ? 65  GLU A CB  1 
ATOM   434  C CG  . GLU A 1 65  ? 19.094  14.606 21.504  1.00 55.77  ? 65  GLU A CG  1 
ATOM   435  C CD  . GLU A 1 65  ? 18.723  13.237 22.048  1.00 90.24  ? 65  GLU A CD  1 
ATOM   436  O OE1 . GLU A 1 65  ? 18.423  12.323 21.243  1.00 106.49 ? 65  GLU A OE1 1 
ATOM   437  O OE2 . GLU A 1 65  ? 18.770  13.071 23.288  1.00 81.97  ? 65  GLU A OE2 1 
ATOM   438  N N   . GLU A 1 66  ? 17.698  16.559 17.672  1.00 42.30  ? 66  GLU A N   1 
ATOM   439  C CA  . GLU A 1 66  ? 17.679  17.770 16.854  1.00 41.98  ? 66  GLU A CA  1 
ATOM   440  C C   . GLU A 1 66  ? 16.323  18.132 16.270  1.00 46.31  ? 66  GLU A C   1 
ATOM   441  O O   . GLU A 1 66  ? 15.976  19.320 16.272  1.00 43.09  ? 66  GLU A O   1 
ATOM   442  C CB  . GLU A 1 66  ? 18.789  17.735 15.806  1.00 44.26  ? 66  GLU A CB  1 
ATOM   443  C CG  . GLU A 1 66  ? 20.172  17.617 16.433  1.00 54.61  ? 66  GLU A CG  1 
ATOM   444  C CD  . GLU A 1 66  ? 20.680  18.797 17.235  1.00 79.24  ? 66  GLU A CD  1 
ATOM   445  O OE1 . GLU A 1 66  ? 20.464  19.957 16.813  1.00 78.31  ? 66  GLU A OE1 1 
ATOM   446  O OE2 . GLU A 1 66  ? 21.320  18.554 18.283  1.00 73.69  ? 66  GLU A OE2 1 
ATOM   447  N N   . MET A 1 67  ? 15.543  17.112 15.806  1.00 46.13  ? 67  MET A N   1 
ATOM   448  C CA  . MET A 1 67  ? 14.182  17.277 15.271  1.00 46.40  ? 67  MET A CA  1 
ATOM   449  C C   . MET A 1 67  ? 13.265  17.901 16.351  1.00 47.01  ? 67  MET A C   1 
ATOM   450  O O   . MET A 1 67  ? 12.473  18.795 16.041  1.00 43.65  ? 67  MET A O   1 
ATOM   451  C CB  . MET A 1 67  ? 13.641  15.927 14.773  1.00 50.66  ? 67  MET A CB  1 
ATOM   452  C CG  . MET A 1 67  ? 12.263  15.991 14.122  1.00 55.71  ? 67  MET A CG  1 
ATOM   453  S SD  . MET A 1 67  ? 12.197  16.818 12.514  1.00 62.15  ? 67  MET A SD  1 
ATOM   454  C CE  . MET A 1 67  ? 12.488  15.436 11.440  1.00 60.09  ? 67  MET A CE  1 
ATOM   455  N N   . MET A 1 68  ? 13.429  17.462 17.620  1.00 44.26  ? 68  MET A N   1 
ATOM   456  C CA  . MET A 1 68  ? 12.694  17.973 18.777  1.00 43.25  ? 68  MET A CA  1 
ATOM   457  C C   . MET A 1 68  ? 13.018  19.444 19.023  1.00 44.49  ? 68  MET A C   1 
ATOM   458  O O   . MET A 1 68  ? 12.106  20.228 19.264  1.00 44.24  ? 68  MET A O   1 
ATOM   459  C CB  . MET A 1 68  ? 12.972  17.120 20.028  1.00 46.99  ? 68  MET A CB  1 
ATOM   460  C CG  . MET A 1 68  ? 12.035  17.404 21.196  1.00 51.05  ? 68  MET A CG  1 
ATOM   461  S SD  . MET A 1 68  ? 10.295  17.077 20.826  1.00 55.49  ? 68  MET A SD  1 
ATOM   462  C CE  . MET A 1 68  ? 9.899   15.955 22.096  1.00 53.11  ? 68  MET A CE  1 
ATOM   463  N N   . LYS A 1 69  ? 14.300  19.826 18.930  1.00 39.77  ? 69  LYS A N   1 
ATOM   464  C CA  . LYS A 1 69  ? 14.725  21.216 19.108  1.00 38.07  ? 69  LYS A CA  1 
ATOM   465  C C   . LYS A 1 69  ? 14.079  22.104 18.039  1.00 39.58  ? 69  LYS A C   1 
ATOM   466  O O   . LYS A 1 69  ? 13.626  23.207 18.347  1.00 38.36  ? 69  LYS A O   1 
ATOM   467  C CB  . LYS A 1 69  ? 16.257  21.338 19.082  1.00 41.10  ? 69  LYS A CB  1 
ATOM   468  C CG  . LYS A 1 69  ? 16.897  20.999 20.414  1.00 48.19  ? 69  LYS A CG  1 
ATOM   469  C CD  . LYS A 1 69  ? 18.383  21.291 20.412  1.00 52.95  ? 69  LYS A CD  1 
ATOM   470  C CE  . LYS A 1 69  ? 19.199  20.036 20.516  1.00 55.17  ? 69  LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 69  ? 20.649  20.345 20.534  1.00 66.49  ? 69  LYS A NZ  1 
ATOM   472  N N   . ARG A 1 70  ? 13.972  21.587 16.800  1.00 34.27  ? 70  ARG A N   1 
ATOM   473  C CA  . ARG A 1 70  ? 13.322  22.305 15.717  1.00 32.06  ? 70  ARG A CA  1 
ATOM   474  C C   . ARG A 1 70  ? 11.808  22.458 16.014  1.00 34.07  ? 70  ARG A C   1 
ATOM   475  O O   . ARG A 1 70  ? 11.269  23.561 15.920  1.00 32.39  ? 70  ARG A O   1 
ATOM   476  C CB  . ARG A 1 70  ? 13.562  21.585 14.381  1.00 30.27  ? 70  ARG A CB  1 
ATOM   477  C CG  . ARG A 1 70  ? 13.091  22.412 13.209  1.00 33.96  ? 70  ARG A CG  1 
ATOM   478  C CD  . ARG A 1 70  ? 13.008  21.636 11.928  1.00 36.05  ? 70  ARG A CD  1 
ATOM   479  N NE  . ARG A 1 70  ? 12.247  22.417 10.955  1.00 42.27  ? 70  ARG A NE  1 
ATOM   480  C CZ  . ARG A 1 70  ? 11.970  22.011 9.725   1.00 56.81  ? 70  ARG A CZ  1 
ATOM   481  N NH1 . ARG A 1 70  ? 12.371  20.815 9.306   1.00 52.94  ? 70  ARG A NH1 1 
ATOM   482  N NH2 . ARG A 1 70  ? 11.273  22.789 8.907   1.00 34.86  ? 70  ARG A NH2 1 
ATOM   483  N N   . ALA A 1 71  ? 11.151  21.347 16.402  1.00 30.55  ? 71  ALA A N   1 
ATOM   484  C CA  . ALA A 1 71  ? 9.724   21.271 16.719  1.00 28.42  ? 71  ALA A CA  1 
ATOM   485  C C   . ALA A 1 71  ? 9.279   22.208 17.840  1.00 31.29  ? 71  ALA A C   1 
ATOM   486  O O   . ALA A 1 71  ? 8.166   22.723 17.785  1.00 30.76  ? 71  ALA A O   1 
ATOM   487  C CB  . ALA A 1 71  ? 9.354   19.842 17.063  1.00 29.06  ? 71  ALA A CB  1 
ATOM   488  N N   . LEU A 1 72  ? 10.136  22.421 18.850  1.00 26.90  ? 72  LEU A N   1 
ATOM   489  C CA  . LEU A 1 72  ? 9.833   23.248 20.011  1.00 25.60  ? 72  LEU A CA  1 
ATOM   490  C C   . LEU A 1 72  ? 10.195  24.725 19.835  1.00 30.27  ? 72  LEU A C   1 
ATOM   491  O O   . LEU A 1 72  ? 10.001  25.517 20.758  1.00 30.76  ? 72  LEU A O   1 
ATOM   492  C CB  . LEU A 1 72  ? 10.543  22.667 21.246  1.00 26.24  ? 72  LEU A CB  1 
ATOM   493  C CG  . LEU A 1 72  ? 10.140  21.268 21.734  1.00 31.00  ? 72  LEU A CG  1 
ATOM   494  C CD1 . LEU A 1 72  ? 10.903  20.904 23.006  1.00 32.06  ? 72  LEU A CD1 1 
ATOM   495  C CD2 . LEU A 1 72  ? 8.630   21.152 21.962  1.00 32.13  ? 72  LEU A CD2 1 
ATOM   496  N N   . GLN A 1 73  ? 10.726  25.092 18.656  1.00 26.92  ? 73  GLN A N   1 
ATOM   497  C CA  . GLN A 1 73  ? 11.190  26.447 18.312  1.00 25.99  ? 73  GLN A CA  1 
ATOM   498  C C   . GLN A 1 73  ? 10.268  27.177 17.306  1.00 27.28  ? 73  GLN A C   1 
ATOM   499  O O   . GLN A 1 73  ? 9.496   26.517 16.608  1.00 26.88  ? 73  GLN A O   1 
ATOM   500  C CB  . GLN A 1 73  ? 12.656  26.363 17.784  1.00 27.62  ? 73  GLN A CB  1 
ATOM   501  C CG  . GLN A 1 73  ? 13.373  27.683 17.440  1.00 28.88  ? 73  GLN A CG  1 
ATOM   502  C CD  . GLN A 1 73  ? 13.476  28.648 18.594  1.00 43.29  ? 73  GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 73  ? 12.517  29.356 18.935  1.00 45.80  ? 73  GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 73  ? 14.646  28.717 19.211  1.00 22.10  ? 73  GLN A NE2 1 
ATOM   505  N N   . TYR A 1 74  ? 10.368  28.539 17.227  1.00 22.23  ? 74  TYR A N   1 
ATOM   506  C CA  . TYR A 1 74  ? 9.638   29.378 16.268  1.00 21.75  ? 74  TYR A CA  1 
ATOM   507  C C   . TYR A 1 74  ? 9.906   28.907 14.811  1.00 27.78  ? 74  TYR A C   1 
ATOM   508  O O   . TYR A 1 74  ? 10.970  28.344 14.507  1.00 26.79  ? 74  TYR A O   1 
ATOM   509  C CB  . TYR A 1 74  ? 10.042  30.868 16.386  1.00 22.70  ? 74  TYR A CB  1 
ATOM   510  C CG  . TYR A 1 74  ? 9.604   31.605 17.640  1.00 25.43  ? 74  TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 74  ? 8.252   31.834 17.906  1.00 27.63  ? 74  TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 74  ? 10.542  32.185 18.498  1.00 25.97  ? 74  TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 74  ? 7.845   32.546 19.040  1.00 27.67  ? 74  TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 74  ? 10.149  32.918 19.617  1.00 26.20  ? 74  TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 74  ? 8.797   33.100 19.886  1.00 31.42  ? 74  TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 74  ? 8.398   33.832 20.990  1.00 23.86  ? 74  TYR A OH  1 
ATOM   517  N N   . SER A 1 75  ? 8.941   29.155 13.917  1.00 26.22  ? 75  SER A N   1 
ATOM   518  C CA  . SER A 1 75  ? 9.049   28.794 12.499  1.00 27.46  ? 75  SER A CA  1 
ATOM   519  C C   . SER A 1 75  ? 8.309   29.825 11.599  1.00 32.00  ? 75  SER A C   1 
ATOM   520  O O   . SER A 1 75  ? 7.548   30.638 12.138  1.00 29.43  ? 75  SER A O   1 
ATOM   521  C CB  . SER A 1 75  ? 8.563   27.361 12.264  1.00 30.88  ? 75  SER A CB  1 
ATOM   522  O OG  . SER A 1 75  ? 7.295   27.110 12.837  1.00 33.91  ? 75  SER A OG  1 
ATOM   523  N N   . PRO A 1 76  ? 8.539   29.851 10.248  1.00 29.84  ? 76  PRO A N   1 
ATOM   524  C CA  . PRO A 1 76  ? 7.876   30.873 9.402   1.00 28.56  ? 76  PRO A CA  1 
ATOM   525  C C   . PRO A 1 76  ? 6.347   30.959 9.497   1.00 30.89  ? 76  PRO A C   1 
ATOM   526  O O   . PRO A 1 76  ? 5.666   29.948 9.664   1.00 29.28  ? 76  PRO A O   1 
ATOM   527  C CB  . PRO A 1 76  ? 8.330   30.509 7.983   1.00 30.60  ? 76  PRO A CB  1 
ATOM   528  C CG  . PRO A 1 76  ? 9.541   29.713 8.148   1.00 35.29  ? 76  PRO A CG  1 
ATOM   529  C CD  . PRO A 1 76  ? 9.408   28.971 9.431   1.00 30.96  ? 76  PRO A CD  1 
ATOM   530  N N   . SER A 1 77  ? 5.820   32.184 9.352   1.00 28.14  ? 77  SER A N   1 
ATOM   531  C CA  . SER A 1 77  ? 4.394   32.517 9.410   1.00 27.74  ? 77  SER A CA  1 
ATOM   532  C C   . SER A 1 77  ? 3.515   31.703 8.471   1.00 34.96  ? 77  SER A C   1 
ATOM   533  O O   . SER A 1 77  ? 2.429   31.289 8.885   1.00 35.21  ? 77  SER A O   1 
ATOM   534  C CB  . SER A 1 77  ? 4.169   34.003 9.145   1.00 28.57  ? 77  SER A CB  1 
ATOM   535  O OG  . SER A 1 77  ? 4.671   34.798 10.199  1.00 31.25  ? 77  SER A OG  1 
ATOM   536  N N   . ALA A 1 78  ? 3.972   31.484 7.223   1.00 33.62  ? 78  ALA A N   1 
ATOM   537  C CA  . ALA A 1 78  ? 3.238   30.757 6.183   1.00 34.61  ? 78  ALA A CA  1 
ATOM   538  C C   . ALA A 1 78  ? 3.214   29.228 6.362   1.00 38.64  ? 78  ALA A C   1 
ATOM   539  O O   . ALA A 1 78  ? 2.383   28.558 5.748   1.00 38.44  ? 78  ALA A O   1 
ATOM   540  C CB  . ALA A 1 78  ? 3.790   31.115 4.815   1.00 36.44  ? 78  ALA A CB  1 
ATOM   541  N N   . GLY A 1 79  ? 4.124   28.703 7.183   1.00 34.56  ? 79  GLY A N   1 
ATOM   542  C CA  . GLY A 1 79  ? 4.261   27.274 7.445   1.00 33.61  ? 79  GLY A CA  1 
ATOM   543  C C   . GLY A 1 79  ? 5.680   26.800 7.224   1.00 36.76  ? 79  GLY A C   1 
ATOM   544  O O   . GLY A 1 79  ? 6.513   27.540 6.676   1.00 37.55  ? 79  GLY A O   1 
ATOM   545  N N   . ILE A 1 80  ? 5.981   25.566 7.678   1.00 30.22  ? 80  ILE A N   1 
ATOM   546  C CA  . ILE A 1 80  ? 7.301   24.962 7.475   1.00 29.27  ? 80  ILE A CA  1 
ATOM   547  C C   . ILE A 1 80  ? 7.484   24.646 5.964   1.00 32.25  ? 80  ILE A C   1 
ATOM   548  O O   . ILE A 1 80  ? 6.512   24.253 5.305   1.00 30.58  ? 80  ILE A O   1 
ATOM   549  C CB  . ILE A 1 80  ? 7.566   23.762 8.418   1.00 32.28  ? 80  ILE A CB  1 
ATOM   550  C CG1 . ILE A 1 80  ? 6.522   22.620 8.227   1.00 33.31  ? 80  ILE A CG1 1 
ATOM   551  C CG2 . ILE A 1 80  ? 7.620   24.249 9.876   1.00 31.55  ? 80  ILE A CG2 1 
ATOM   552  C CD1 . ILE A 1 80  ? 6.925   21.210 8.644   1.00 36.08  ? 80  ILE A CD1 1 
ATOM   553  N N   . PRO A 1 81  ? 8.675   24.911 5.372   1.00 29.65  ? 81  PRO A N   1 
ATOM   554  C CA  . PRO A 1 81  ? 8.836   24.721 3.914   1.00 30.03  ? 81  PRO A CA  1 
ATOM   555  C C   . PRO A 1 81  ? 8.402   23.383 3.326   1.00 34.84  ? 81  PRO A C   1 
ATOM   556  O O   . PRO A 1 81  ? 7.747   23.380 2.274   1.00 36.13  ? 81  PRO A O   1 
ATOM   557  C CB  . PRO A 1 81  ? 10.318  25.049 3.657   1.00 31.62  ? 81  PRO A CB  1 
ATOM   558  C CG  . PRO A 1 81  ? 10.954  25.064 4.961   1.00 35.42  ? 81  PRO A CG  1 
ATOM   559  C CD  . PRO A 1 81  ? 9.915   25.444 5.968   1.00 30.51  ? 81  PRO A CD  1 
ATOM   560  N N   . GLU A 1 82  ? 8.749   22.265 3.999   1.00 29.69  ? 82  GLU A N   1 
ATOM   561  C CA  . GLU A 1 82  ? 8.404   20.917 3.555   1.00 29.89  ? 82  GLU A CA  1 
ATOM   562  C C   . GLU A 1 82  ? 6.902   20.667 3.495   1.00 37.03  ? 82  GLU A C   1 
ATOM   563  O O   . GLU A 1 82  ? 6.452   20.020 2.554   1.00 38.46  ? 82  GLU A O   1 
ATOM   564  C CB  . GLU A 1 82  ? 9.154   19.816 4.326   1.00 31.12  ? 82  GLU A CB  1 
ATOM   565  C CG  . GLU A 1 82  ? 9.191   19.969 5.831   1.00 41.08  ? 82  GLU A CG  1 
ATOM   566  C CD  . GLU A 1 82  ? 10.384  20.736 6.374   1.00 62.07  ? 82  GLU A CD  1 
ATOM   567  O OE1 . GLU A 1 82  ? 10.357  21.988 6.360   1.00 56.21  ? 82  GLU A OE1 1 
ATOM   568  O OE2 . GLU A 1 82  ? 11.330  20.078 6.860   1.00 52.06  ? 82  GLU A OE2 1 
ATOM   569  N N   . LEU A 1 83  ? 6.117   21.227 4.460   1.00 33.48  ? 83  LEU A N   1 
ATOM   570  C CA  . LEU A 1 83  ? 4.654   21.105 4.454   1.00 32.73  ? 83  LEU A CA  1 
ATOM   571  C C   . LEU A 1 83  ? 4.064   21.894 3.294   1.00 39.28  ? 83  LEU A C   1 
ATOM   572  O O   . LEU A 1 83  ? 3.283   21.333 2.526   1.00 40.90  ? 83  LEU A O   1 
ATOM   573  C CB  . LEU A 1 83  ? 4.032   21.549 5.787   1.00 31.14  ? 83  LEU A CB  1 
ATOM   574  C CG  . LEU A 1 83  ? 2.572   21.112 6.109   1.00 34.05  ? 83  LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 83  ? 2.307   19.614 5.826   1.00 33.46  ? 83  LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 83  ? 2.233   21.422 7.556   1.00 33.90  ? 83  LEU A CD2 1 
ATOM   577  N N   . LEU A 1 84  ? 4.494   23.163 3.124   1.00 35.82  ? 84  LEU A N   1 
ATOM   578  C CA  . LEU A 1 84  ? 4.044   24.051 2.050   1.00 36.15  ? 84  LEU A CA  1 
ATOM   579  C C   . LEU A 1 84  ? 4.278   23.489 0.652   1.00 41.70  ? 84  LEU A C   1 
ATOM   580  O O   . LEU A 1 84  ? 3.361   23.556 -0.169  1.00 43.40  ? 84  LEU A O   1 
ATOM   581  C CB  . LEU A 1 84  ? 4.655   25.448 2.175   1.00 36.40  ? 84  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 84  ? 4.048   26.372 3.212   1.00 40.85  ? 84  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 84  ? 4.899   27.593 3.393   1.00 41.30  ? 84  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 84  ? 2.618   26.797 2.830   1.00 44.70  ? 84  LEU A CD2 1 
ATOM   585  N N   . SER A 1 85  ? 5.466   22.912 0.384   1.00 38.20  ? 85  SER A N   1 
ATOM   586  C CA  . SER A 1 85  ? 5.751   22.331 -0.936  1.00 40.51  ? 85  SER A CA  1 
ATOM   587  C C   . SER A 1 85  ? 4.887   21.097 -1.235  1.00 46.48  ? 85  SER A C   1 
ATOM   588  O O   . SER A 1 85  ? 4.420   20.944 -2.367  1.00 47.39  ? 85  SER A O   1 
ATOM   589  C CB  . SER A 1 85  ? 7.230   22.005 -1.100  1.00 45.09  ? 85  SER A CB  1 
ATOM   590  O OG  . SER A 1 85  ? 7.710   21.224 -0.019  1.00 57.37  ? 85  SER A OG  1 
ATOM   591  N N   . TRP A 1 86  ? 4.644   20.249 -0.213  1.00 42.18  ? 86  TRP A N   1 
ATOM   592  C CA  . TRP A 1 86  ? 3.844   19.034 -0.346  1.00 42.74  ? 86  TRP A CA  1 
ATOM   593  C C   . TRP A 1 86  ? 2.391   19.362 -0.681  1.00 48.41  ? 86  TRP A C   1 
ATOM   594  O O   . TRP A 1 86  ? 1.783   18.712 -1.545  1.00 49.16  ? 86  TRP A O   1 
ATOM   595  C CB  . TRP A 1 86  ? 3.910   18.216 0.950   1.00 40.46  ? 86  TRP A CB  1 
ATOM   596  C CG  . TRP A 1 86  ? 3.587   16.767 0.765   1.00 41.75  ? 86  TRP A CG  1 
ATOM   597  C CD1 . TRP A 1 86  ? 4.478   15.750 0.592   1.00 45.39  ? 86  TRP A CD1 1 
ATOM   598  C CD2 . TRP A 1 86  ? 2.282   16.167 0.748   1.00 41.24  ? 86  TRP A CD2 1 
ATOM   599  N NE1 . TRP A 1 86  ? 3.816   14.551 0.483   1.00 44.64  ? 86  TRP A NE1 1 
ATOM   600  C CE2 . TRP A 1 86  ? 2.466   14.774 0.576   1.00 45.35  ? 86  TRP A CE2 1 
ATOM   601  C CE3 . TRP A 1 86  ? 0.976   16.663 0.937   1.00 41.56  ? 86  TRP A CE3 1 
ATOM   602  C CZ2 . TRP A 1 86  ? 1.392   13.874 0.534   1.00 44.56  ? 86  TRP A CZ2 1 
ATOM   603  C CZ3 . TRP A 1 86  ? -0.091  15.772 0.879   1.00 42.70  ? 86  TRP A CZ3 1 
ATOM   604  C CH2 . TRP A 1 86  ? 0.121   14.398 0.657   1.00 44.13  ? 86  TRP A CH2 1 
ATOM   605  N N   . LEU A 1 87  ? 1.842   20.372 0.019   1.00 43.80  ? 87  LEU A N   1 
ATOM   606  C CA  . LEU A 1 87  ? 0.474   20.825 -0.166  1.00 43.22  ? 87  LEU A CA  1 
ATOM   607  C C   . LEU A 1 87  ? 0.253   21.487 -1.532  1.00 49.18  ? 87  LEU A C   1 
ATOM   608  O O   . LEU A 1 87  ? -0.763  21.216 -2.165  1.00 48.30  ? 87  LEU A O   1 
ATOM   609  C CB  . LEU A 1 87  ? 0.039   21.721 0.996   1.00 41.64  ? 87  LEU A CB  1 
ATOM   610  C CG  . LEU A 1 87  ? -0.071  21.012 2.354   1.00 44.76  ? 87  LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 87  ? -0.230  22.018 3.481   1.00 45.90  ? 87  LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 87  ? -1.207  19.976 2.381   1.00 43.96  ? 87  LEU A CD2 1 
ATOM   613  N N   . LYS A 1 88  ? 1.241   22.279 -2.016  1.00 47.69  ? 88  LYS A N   1 
ATOM   614  C CA  . LYS A 1 88  ? 1.232   22.932 -3.335  1.00 49.41  ? 88  LYS A CA  1 
ATOM   615  C C   . LYS A 1 88  ? 1.056   21.889 -4.449  1.00 55.22  ? 88  LYS A C   1 
ATOM   616  O O   . LYS A 1 88  ? 0.248   22.077 -5.359  1.00 55.52  ? 88  LYS A O   1 
ATOM   617  C CB  . LYS A 1 88  ? 2.559   23.665 -3.559  1.00 52.70  ? 88  LYS A CB  1 
ATOM   618  C CG  . LYS A 1 88  ? 2.546   25.121 -3.123  1.00 72.22  ? 88  LYS A CG  1 
ATOM   619  C CD  . LYS A 1 88  ? 3.798   25.854 -3.600  1.00 83.51  ? 88  LYS A CD  1 
ATOM   620  C CE  . LYS A 1 88  ? 3.640   26.512 -4.965  1.00 97.26  ? 88  LYS A CE  1 
ATOM   621  N NZ  . LYS A 1 88  ? 2.922   27.819 -4.895  1.00 108.20 ? 88  LYS A NZ  1 
ATOM   622  N N   . GLN A 1 89  ? 1.817   20.783 -4.350  1.00 51.85  ? 89  GLN A N   1 
ATOM   623  C CA  . GLN A 1 89  ? 1.816   19.671 -5.288  1.00 52.47  ? 89  GLN A CA  1 
ATOM   624  C C   . GLN A 1 89  ? 0.480   18.937 -5.283  1.00 56.43  ? 89  GLN A C   1 
ATOM   625  O O   . GLN A 1 89  ? 0.013   18.497 -6.348  1.00 58.83  ? 89  GLN A O   1 
ATOM   626  C CB  . GLN A 1 89  ? 2.943   18.703 -4.941  1.00 53.77  ? 89  GLN A CB  1 
ATOM   627  C CG  . GLN A 1 89  ? 4.329   19.217 -5.287  1.00 66.89  ? 89  GLN A CG  1 
ATOM   628  C CD  . GLN A 1 89  ? 5.142   18.087 -5.874  1.00 89.63  ? 89  GLN A CD  1 
ATOM   629  O OE1 . GLN A 1 89  ? 4.707   17.403 -6.815  1.00 88.85  ? 89  GLN A OE1 1 
ATOM   630  N NE2 . GLN A 1 89  ? 6.322   17.832 -5.316  1.00 78.92  ? 89  GLN A NE2 1 
ATOM   631  N N   . LEU A 1 90  ? -0.135  18.806 -4.089  1.00 48.57  ? 90  LEU A N   1 
ATOM   632  C CA  . LEU A 1 90  ? -1.440  18.166 -3.949  1.00 46.68  ? 90  LEU A CA  1 
ATOM   633  C C   . LEU A 1 90  ? -2.506  19.002 -4.672  1.00 47.47  ? 90  LEU A C   1 
ATOM   634  O O   . LEU A 1 90  ? -3.281  18.446 -5.445  1.00 45.79  ? 90  LEU A O   1 
ATOM   635  C CB  . LEU A 1 90  ? -1.791  17.968 -2.467  1.00 45.21  ? 90  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 90  ? -3.029  17.132 -2.184  1.00 50.10  ? 90  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 90  ? -2.770  15.634 -2.445  1.00 51.15  ? 90  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 90  ? -3.498  17.349 -0.777  1.00 50.70  ? 90  LEU A CD2 1 
ATOM   639  N N   . GLN A 1 91  ? -2.487  20.346 -4.468  1.00 43.04  ? 91  GLN A N   1 
ATOM   640  C CA  . GLN A 1 91  ? -3.394  21.314 -5.096  1.00 42.07  ? 91  GLN A CA  1 
ATOM   641  C C   . GLN A 1 91  ? -3.273  21.255 -6.611  1.00 47.94  ? 91  GLN A C   1 
ATOM   642  O O   . GLN A 1 91  ? -4.295  21.323 -7.303  1.00 49.24  ? 91  GLN A O   1 
ATOM   643  C CB  . GLN A 1 91  ? -3.139  22.750 -4.588  1.00 41.90  ? 91  GLN A CB  1 
ATOM   644  C CG  . GLN A 1 91  ? -3.390  22.976 -3.104  1.00 42.86  ? 91  GLN A CG  1 
ATOM   645  C CD  . GLN A 1 91  ? -4.805  22.702 -2.680  1.00 62.22  ? 91  GLN A CD  1 
ATOM   646  O OE1 . GLN A 1 91  ? -5.682  23.557 -2.775  1.00 61.31  ? 91  GLN A OE1 1 
ATOM   647  N NE2 . GLN A 1 91  ? -5.049  21.514 -2.154  1.00 54.95  ? 91  GLN A NE2 1 
ATOM   648  N N   . ILE A 1 92  ? -2.033  21.087 -7.123  1.00 44.28  ? 92  ILE A N   1 
ATOM   649  C CA  . ILE A 1 92  ? -1.784  20.947 -8.556  1.00 46.12  ? 92  ILE A CA  1 
ATOM   650  C C   . ILE A 1 92  ? -2.396  19.627 -9.117  1.00 52.79  ? 92  ILE A C   1 
ATOM   651  O O   . ILE A 1 92  ? -3.096  19.685 -10.128 1.00 53.50  ? 92  ILE A O   1 
ATOM   652  C CB  . ILE A 1 92  ? -0.290  21.166 -8.908  1.00 49.60  ? 92  ILE A CB  1 
ATOM   653  C CG1 . ILE A 1 92  ? 0.082   22.642 -8.697  1.00 49.72  ? 92  ILE A CG1 1 
ATOM   654  C CG2 . ILE A 1 92  ? 0.023   20.746 -10.347 1.00 52.74  ? 92  ILE A CG2 1 
ATOM   655  C CD1 . ILE A 1 92  ? 1.551   22.947 -8.551  1.00 55.96  ? 92  ILE A CD1 1 
ATOM   656  N N   . LYS A 1 93  ? -2.173  18.460 -8.459  1.00 49.68  ? 93  LYS A N   1 
ATOM   657  C CA  . LYS A 1 93  ? -2.733  17.195 -8.963  1.00 50.61  ? 93  LYS A CA  1 
ATOM   658  C C   . LYS A 1 93  ? -4.238  17.092 -8.856  1.00 55.07  ? 93  LYS A C   1 
ATOM   659  O O   . LYS A 1 93  ? -4.876  16.436 -9.675  1.00 57.37  ? 93  LYS A O   1 
ATOM   660  C CB  . LYS A 1 93  ? -2.070  15.966 -8.339  1.00 53.52  ? 93  LYS A CB  1 
ATOM   661  C CG  . LYS A 1 93  ? -0.804  15.566 -9.065  1.00 90.04  ? 93  LYS A CG  1 
ATOM   662  C CD  . LYS A 1 93  ? -0.148  14.325 -8.451  1.00 107.85 ? 93  LYS A CD  1 
ATOM   663  C CE  . LYS A 1 93  ? 1.282   14.180 -8.925  1.00 125.86 ? 93  LYS A CE  1 
ATOM   664  N NZ  . LYS A 1 93  ? 2.189   15.191 -8.311  1.00 132.80 ? 93  LYS A NZ  1 
ATOM   665  N N   . LEU A 1 94  ? -4.806  17.737 -7.858  1.00 49.54  ? 94  LEU A N   1 
ATOM   666  C CA  . LEU A 1 94  ? -6.234  17.677 -7.605  1.00 48.07  ? 94  LEU A CA  1 
ATOM   667  C C   . LEU A 1 94  ? -7.014  18.752 -8.363  1.00 54.58  ? 94  LEU A C   1 
ATOM   668  O O   . LEU A 1 94  ? -8.091  18.459 -8.879  1.00 55.67  ? 94  LEU A O   1 
ATOM   669  C CB  . LEU A 1 94  ? -6.485  17.764 -6.077  1.00 45.16  ? 94  LEU A CB  1 
ATOM   670  C CG  . LEU A 1 94  ? -6.563  16.447 -5.259  1.00 47.79  ? 94  LEU A CG  1 
ATOM   671  C CD1 . LEU A 1 94  ? -5.450  15.479 -5.571  1.00 47.94  ? 94  LEU A CD1 1 
ATOM   672  C CD2 . LEU A 1 94  ? -6.515  16.726 -3.787  1.00 48.27  ? 94  LEU A CD2 1 
ATOM   673  N N   . HIS A 1 95  ? -6.486  19.985 -8.436  1.00 51.53  ? 95  HIS A N   1 
ATOM   674  C CA  . HIS A 1 95  ? -7.226  21.090 -9.037  1.00 52.69  ? 95  HIS A CA  1 
ATOM   675  C C   . HIS A 1 95  ? -6.611  21.759 -10.252 1.00 59.54  ? 95  HIS A C   1 
ATOM   676  O O   . HIS A 1 95  ? -7.336  22.475 -10.946 1.00 60.11  ? 95  HIS A O   1 
ATOM   677  C CB  . HIS A 1 95  ? -7.605  22.134 -7.966  1.00 52.46  ? 95  HIS A CB  1 
ATOM   678  C CG  . HIS A 1 95  ? -8.056  21.534 -6.669  1.00 54.80  ? 95  HIS A CG  1 
ATOM   679  N ND1 . HIS A 1 95  ? -7.250  21.561 -5.543  1.00 55.46  ? 95  HIS A ND1 1 
ATOM   680  C CD2 . HIS A 1 95  ? -9.193  20.861 -6.373  1.00 56.60  ? 95  HIS A CD2 1 
ATOM   681  C CE1 . HIS A 1 95  ? -7.937  20.939 -4.596  1.00 53.94  ? 95  HIS A CE1 1 
ATOM   682  N NE2 . HIS A 1 95  ? -9.113  20.504 -5.048  1.00 54.81  ? 95  HIS A NE2 1 
ATOM   683  N N   . ASN A 1 96  ? -5.298  21.530 -10.528 1.00 57.78  ? 96  ASN A N   1 
ATOM   684  C CA  . ASN A 1 96  ? -4.562  22.148 -11.641 1.00 59.49  ? 96  ASN A CA  1 
ATOM   685  C C   . ASN A 1 96  ? -5.111  23.572 -11.919 1.00 64.52  ? 96  ASN A C   1 
ATOM   686  O O   . ASN A 1 96  ? -5.796  23.797 -12.928 1.00 66.05  ? 96  ASN A O   1 
ATOM   687  C CB  . ASN A 1 96  ? -4.564  21.246 -12.890 1.00 62.43  ? 96  ASN A CB  1 
ATOM   688  C CG  . ASN A 1 96  ? -3.663  21.721 -14.032 1.00 91.70  ? 96  ASN A CG  1 
ATOM   689  O OD1 . ASN A 1 96  ? -2.626  22.381 -13.837 1.00 85.57  ? 96  ASN A OD1 1 
ATOM   690  N ND2 . ASN A 1 96  ? -4.034  21.384 -15.262 1.00 83.24  ? 96  ASN A ND2 1 
ATOM   691  N N   . PRO A 1 97  ? -4.937  24.513 -10.957 1.00 59.65  ? 97  PRO A N   1 
ATOM   692  C CA  . PRO A 1 97  ? -5.510  25.853 -11.145 1.00 59.41  ? 97  PRO A CA  1 
ATOM   693  C C   . PRO A 1 97  ? -4.878  26.608 -12.302 1.00 63.78  ? 97  PRO A C   1 
ATOM   694  O O   . PRO A 1 97  ? -3.675  26.485 -12.519 1.00 62.66  ? 97  PRO A O   1 
ATOM   695  C CB  . PRO A 1 97  ? -5.248  26.551 -9.802  1.00 59.70  ? 97  PRO A CB  1 
ATOM   696  C CG  . PRO A 1 97  ? -4.890  25.448 -8.833  1.00 62.87  ? 97  PRO A CG  1 
ATOM   697  C CD  . PRO A 1 97  ? -4.216  24.418 -9.667  1.00 59.75  ? 97  PRO A CD  1 
ATOM   698  N N   . PRO A 1 98  ? -5.666  27.403 -13.058 1.00 62.42  ? 98  PRO A N   1 
ATOM   699  C CA  . PRO A 1 98  ? -5.086  28.159 -14.178 1.00 64.12  ? 98  PRO A CA  1 
ATOM   700  C C   . PRO A 1 98  ? -4.011  29.170 -13.760 1.00 68.29  ? 98  PRO A C   1 
ATOM   701  O O   . PRO A 1 98  ? -3.095  29.445 -14.534 1.00 69.48  ? 98  PRO A O   1 
ATOM   702  C CB  . PRO A 1 98  ? -6.306  28.867 -14.794 1.00 66.97  ? 98  PRO A CB  1 
ATOM   703  C CG  . PRO A 1 98  ? -7.488  28.106 -14.327 1.00 70.31  ? 98  PRO A CG  1 
ATOM   704  C CD  . PRO A 1 98  ? -7.118  27.651 -12.951 1.00 63.83  ? 98  PRO A CD  1 
ATOM   705  N N   . THR A 1 99  ? -4.107  29.681 -12.523 1.00 64.14  ? 99  THR A N   1 
ATOM   706  C CA  . THR A 1 99  ? -3.259  30.725 -11.940 1.00 64.03  ? 99  THR A CA  1 
ATOM   707  C C   . THR A 1 99  ? -1.808  30.384 -11.562 1.00 68.99  ? 99  THR A C   1 
ATOM   708  O O   . THR A 1 99  ? -1.068  31.303 -11.206 1.00 68.10  ? 99  THR A O   1 
ATOM   709  C CB  . THR A 1 99  ? -4.000  31.422 -10.788 1.00 69.73  ? 99  THR A CB  1 
ATOM   710  O OG1 . THR A 1 99  ? -4.158  30.507 -9.699  1.00 67.73  ? 99  THR A OG1 1 
ATOM   711  C CG2 . THR A 1 99  ? -5.338  32.011 -11.215 1.00 67.52  ? 99  THR A CG2 1 
ATOM   712  N N   . ILE A 1 100 ? -1.394  29.102 -11.642 1.00 67.24  ? 100 ILE A N   1 
ATOM   713  C CA  . ILE A 1 100 ? -0.052  28.636 -11.252 1.00 67.29  ? 100 ILE A CA  1 
ATOM   714  C C   . ILE A 1 100 ? 1.121   29.500 -11.746 1.00 75.18  ? 100 ILE A C   1 
ATOM   715  O O   . ILE A 1 100 ? 1.903   29.984 -10.923 1.00 74.31  ? 100 ILE A O   1 
ATOM   716  C CB  . ILE A 1 100 ? 0.188   27.116 -11.504 1.00 70.41  ? 100 ILE A CB  1 
ATOM   717  C CG1 . ILE A 1 100 ? -0.884  26.233 -10.846 1.00 69.21  ? 100 ILE A CG1 1 
ATOM   718  C CG2 . ILE A 1 100 ? 1.585   26.700 -10.999 1.00 70.68  ? 100 ILE A CG2 1 
ATOM   719  C CD1 . ILE A 1 100 ? -1.046  24.855 -11.511 1.00 75.83  ? 100 ILE A CD1 1 
ATOM   720  N N   . HIS A 1 101 ? 1.253   29.673 -13.074 1.00 75.95  ? 101 HIS A N   1 
ATOM   721  C CA  . HIS A 1 101 ? 2.367   30.420 -13.662 1.00 77.61  ? 101 HIS A CA  1 
ATOM   722  C C   . HIS A 1 101 ? 2.122   31.874 -14.035 1.00 80.13  ? 101 HIS A C   1 
ATOM   723  O O   . HIS A 1 101 ? 2.984   32.497 -14.657 1.00 82.15  ? 101 HIS A O   1 
ATOM   724  C CB  . HIS A 1 101 ? 3.100   29.602 -14.738 1.00 80.75  ? 101 HIS A CB  1 
ATOM   725  C CG  . HIS A 1 101 ? 3.744   28.378 -14.156 1.00 83.66  ? 101 HIS A CG  1 
ATOM   726  N ND1 . HIS A 1 101 ? 3.073   27.165 -14.109 1.00 85.25  ? 101 HIS A ND1 1 
ATOM   727  C CD2 . HIS A 1 101 ? 4.942   28.240 -13.530 1.00 84.94  ? 101 HIS A CD2 1 
ATOM   728  C CE1 . HIS A 1 101 ? 3.888   26.327 -13.481 1.00 84.07  ? 101 HIS A CE1 1 
ATOM   729  N NE2 . HIS A 1 101 ? 5.025   26.929 -13.112 1.00 84.13  ? 101 HIS A NE2 1 
ATOM   730  N N   . TYR A 1 102 ? 0.995   32.434 -13.583 1.00 72.92  ? 102 TYR A N   1 
ATOM   731  C CA  . TYR A 1 102 ? 0.618   33.832 -13.797 1.00 72.46  ? 102 TYR A CA  1 
ATOM   732  C C   . TYR A 1 102 ? 1.618   34.758 -13.071 1.00 73.60  ? 102 TYR A C   1 
ATOM   733  O O   . TYR A 1 102 ? 2.176   34.332 -12.054 1.00 71.85  ? 102 TYR A O   1 
ATOM   734  C CB  . TYR A 1 102 ? -0.784  34.076 -13.190 1.00 72.77  ? 102 TYR A CB  1 
ATOM   735  C CG  . TYR A 1 102 ? -1.987  33.647 -14.011 1.00 75.79  ? 102 TYR A CG  1 
ATOM   736  C CD1 . TYR A 1 102 ? -3.248  34.178 -13.762 1.00 77.47  ? 102 TYR A CD1 1 
ATOM   737  C CD2 . TYR A 1 102 ? -1.873  32.679 -15.006 1.00 77.84  ? 102 TYR A CD2 1 
ATOM   738  C CE1 . TYR A 1 102 ? -4.361  33.788 -14.503 1.00 79.07  ? 102 TYR A CE1 1 
ATOM   739  C CE2 . TYR A 1 102 ? -2.976  32.289 -15.762 1.00 79.71  ? 102 TYR A CE2 1 
ATOM   740  C CZ  . TYR A 1 102 ? -4.221  32.838 -15.498 1.00 85.67  ? 102 TYR A CZ  1 
ATOM   741  O OH  . TYR A 1 102 ? -5.319  32.461 -16.229 1.00 86.69  ? 102 TYR A OH  1 
ATOM   742  N N   . PRO A 1 103 ? 1.850   36.020 -13.514 1.00 69.21  ? 103 PRO A N   1 
ATOM   743  C CA  . PRO A 1 103 ? 2.730   36.917 -12.732 1.00 67.36  ? 103 PRO A CA  1 
ATOM   744  C C   . PRO A 1 103 ? 2.162   37.168 -11.324 1.00 68.61  ? 103 PRO A C   1 
ATOM   745  O O   . PRO A 1 103 ? 0.940   37.218 -11.180 1.00 67.49  ? 103 PRO A O   1 
ATOM   746  C CB  . PRO A 1 103 ? 2.750   38.215 -13.545 1.00 70.84  ? 103 PRO A CB  1 
ATOM   747  C CG  . PRO A 1 103 ? 2.200   37.871 -14.863 1.00 77.45  ? 103 PRO A CG  1 
ATOM   748  C CD  . PRO A 1 103 ? 1.287   36.711 -14.689 1.00 72.47  ? 103 PRO A CD  1 
ATOM   749  N N   . PRO A 1 104 ? 3.003   37.309 -10.270 1.00 65.16  ? 104 PRO A N   1 
ATOM   750  C CA  . PRO A 1 104 ? 2.467   37.503 -8.901  1.00 63.50  ? 104 PRO A CA  1 
ATOM   751  C C   . PRO A 1 104 ? 1.343   38.525 -8.740  1.00 68.43  ? 104 PRO A C   1 
ATOM   752  O O   . PRO A 1 104 ? 0.350   38.217 -8.068  1.00 66.56  ? 104 PRO A O   1 
ATOM   753  C CB  . PRO A 1 104 ? 3.709   37.842 -8.078  1.00 64.04  ? 104 PRO A CB  1 
ATOM   754  C CG  . PRO A 1 104 ? 4.796   37.131 -8.782  1.00 69.47  ? 104 PRO A CG  1 
ATOM   755  C CD  . PRO A 1 104 ? 4.477   37.245 -10.248 1.00 67.18  ? 104 PRO A CD  1 
ATOM   756  N N   . SER A 1 105 ? 1.477   39.702 -9.404  1.00 67.18  ? 105 SER A N   1 
ATOM   757  C CA  . SER A 1 105 ? 0.499   40.797 -9.408  1.00 67.41  ? 105 SER A CA  1 
ATOM   758  C C   . SER A 1 105 ? -0.783  40.449 -10.174 1.00 72.73  ? 105 SER A C   1 
ATOM   759  O O   . SER A 1 105 ? -1.826  41.050 -9.911  1.00 72.52  ? 105 SER A O   1 
ATOM   760  C CB  . SER A 1 105 ? 1.122   42.083 -9.939  1.00 72.14  ? 105 SER A CB  1 
ATOM   761  O OG  . SER A 1 105 ? 1.975   41.853 -11.050 1.00 82.00  ? 105 SER A OG  1 
ATOM   762  N N   . GLN A 1 106 ? -0.719  39.472 -11.100 1.00 70.51  ? 106 GLN A N   1 
ATOM   763  C CA  . GLN A 1 106 ? -1.885  39.020 -11.865 1.00 71.54  ? 106 GLN A CA  1 
ATOM   764  C C   . GLN A 1 106 ? -2.731  37.943 -11.138 1.00 73.45  ? 106 GLN A C   1 
ATOM   765  O O   . GLN A 1 106 ? -3.706  37.432 -11.698 1.00 74.15  ? 106 GLN A O   1 
ATOM   766  C CB  . GLN A 1 106 ? -1.479  38.566 -13.270 1.00 74.96  ? 106 GLN A CB  1 
ATOM   767  C CG  . GLN A 1 106 ? -1.634  39.660 -14.312 1.00 104.71 ? 106 GLN A CG  1 
ATOM   768  C CD  . GLN A 1 106 ? -1.244  39.198 -15.694 1.00 133.72 ? 106 GLN A CD  1 
ATOM   769  O OE1 . GLN A 1 106 ? -1.819  38.256 -16.256 1.00 133.48 ? 106 GLN A OE1 1 
ATOM   770  N NE2 . GLN A 1 106 ? -0.281  39.885 -16.292 1.00 124.94 ? 106 GLN A NE2 1 
ATOM   771  N N   . GLY A 1 107 ? -2.357  37.626 -9.902  1.00 67.10  ? 107 GLY A N   1 
ATOM   772  C CA  . GLY A 1 107 ? -3.063  36.652 -9.076  1.00 64.65  ? 107 GLY A CA  1 
ATOM   773  C C   . GLY A 1 107 ? -2.493  35.250 -9.047  1.00 64.77  ? 107 GLY A C   1 
ATOM   774  O O   . GLY A 1 107 ? -3.258  34.282 -9.008  1.00 64.06  ? 107 GLY A O   1 
ATOM   775  N N   . GLN A 1 108 ? -1.150  35.135 -9.029  1.00 58.47  ? 108 GLN A N   1 
ATOM   776  C CA  . GLN A 1 108 ? -0.438  33.855 -8.962  1.00 56.60  ? 108 GLN A CA  1 
ATOM   777  C C   . GLN A 1 108 ? -0.883  33.010 -7.739  1.00 55.35  ? 108 GLN A C   1 
ATOM   778  O O   . GLN A 1 108 ? -1.073  33.563 -6.650  1.00 53.00  ? 108 GLN A O   1 
ATOM   779  C CB  . GLN A 1 108 ? 1.075   34.102 -8.915  1.00 57.98  ? 108 GLN A CB  1 
ATOM   780  C CG  . GLN A 1 108 ? 1.920   32.834 -9.021  1.00 77.58  ? 108 GLN A CG  1 
ATOM   781  C CD  . GLN A 1 108 ? 3.396   33.124 -9.040  1.00 105.08 ? 108 GLN A CD  1 
ATOM   782  O OE1 . GLN A 1 108 ? 3.918   33.910 -8.237  1.00 98.06  ? 108 GLN A OE1 1 
ATOM   783  N NE2 . GLN A 1 108 ? 4.109   32.450 -9.934  1.00 105.68 ? 108 GLN A NE2 1 
ATOM   784  N N   . MET A 1 109 ? -1.055  31.680 -7.937  1.00 50.00  ? 109 MET A N   1 
ATOM   785  C CA  . MET A 1 109 ? -1.474  30.757 -6.885  1.00 47.51  ? 109 MET A CA  1 
ATOM   786  C C   . MET A 1 109 ? -0.450  30.720 -5.760  1.00 48.93  ? 109 MET A C   1 
ATOM   787  O O   . MET A 1 109 ? 0.738   30.503 -5.996  1.00 48.27  ? 109 MET A O   1 
ATOM   788  C CB  . MET A 1 109 ? -1.749  29.343 -7.427  1.00 50.51  ? 109 MET A CB  1 
ATOM   789  C CG  . MET A 1 109 ? -2.375  28.402 -6.382  1.00 53.02  ? 109 MET A CG  1 
ATOM   790  S SD  . MET A 1 109 ? -2.173  26.614 -6.690  1.00 57.40  ? 109 MET A SD  1 
ATOM   791  C CE  . MET A 1 109 ? -0.896  26.212 -5.534  1.00 52.80  ? 109 MET A CE  1 
ATOM   792  N N   . ASP A 1 110 ? -0.923  30.976 -4.539  1.00 44.90  ? 110 ASP A N   1 
ATOM   793  C CA  . ASP A 1 110 ? -0.114  30.949 -3.328  1.00 44.04  ? 110 ASP A CA  1 
ATOM   794  C C   . ASP A 1 110 ? -0.869  30.221 -2.218  1.00 46.25  ? 110 ASP A C   1 
ATOM   795  O O   . ASP A 1 110 ? -2.095  30.122 -2.268  1.00 44.99  ? 110 ASP A O   1 
ATOM   796  C CB  . ASP A 1 110 ? 0.337   32.365 -2.903  1.00 46.51  ? 110 ASP A CB  1 
ATOM   797  C CG  . ASP A 1 110 ? 1.586   32.401 -2.025  1.00 62.18  ? 110 ASP A CG  1 
ATOM   798  O OD1 . ASP A 1 110 ? 2.245   31.332 -1.865  1.00 63.54  ? 110 ASP A OD1 1 
ATOM   799  O OD2 . ASP A 1 110 ? 1.914   33.492 -1.503  1.00 68.95  ? 110 ASP A OD2 1 
ATOM   800  N N   . LEU A 1 111 ? -0.121  29.702 -1.231  1.00 42.50  ? 111 LEU A N   1 
ATOM   801  C CA  . LEU A 1 111 ? -0.625  28.902 -0.120  1.00 41.12  ? 111 LEU A CA  1 
ATOM   802  C C   . LEU A 1 111 ? -0.071  29.321 1.214   1.00 42.95  ? 111 LEU A C   1 
ATOM   803  O O   . LEU A 1 111 ? 1.069   29.780 1.303   1.00 42.84  ? 111 LEU A O   1 
ATOM   804  C CB  . LEU A 1 111 ? -0.173  27.443 -0.343  1.00 41.66  ? 111 LEU A CB  1 
ATOM   805  C CG  . LEU A 1 111 ? -1.249  26.398 -0.513  1.00 46.93  ? 111 LEU A CG  1 
ATOM   806  C CD1 . LEU A 1 111 ? -1.118  25.738 -1.848  1.00 48.67  ? 111 LEU A CD1 1 
ATOM   807  C CD2 . LEU A 1 111 ? -1.147  25.347 0.560   1.00 49.49  ? 111 LEU A CD2 1 
ATOM   808  N N   . CYS A 1 112 ? -0.833  29.044 2.270   1.00 38.67  ? 112 CYS A N   1 
ATOM   809  C CA  . CYS A 1 112 ? -0.362  29.215 3.634   1.00 38.35  ? 112 CYS A CA  1 
ATOM   810  C C   . CYS A 1 112 ? -1.056  28.287 4.619   1.00 37.90  ? 112 CYS A C   1 
ATOM   811  O O   . CYS A 1 112 ? -2.240  28.003 4.480   1.00 37.42  ? 112 CYS A O   1 
ATOM   812  C CB  . CYS A 1 112 ? -0.371  30.670 4.095   1.00 39.88  ? 112 CYS A CB  1 
ATOM   813  S SG  . CYS A 1 112 ? -2.017  31.400 4.240   1.00 44.34  ? 112 CYS A SG  1 
ATOM   814  N N   . VAL A 1 113 ? -0.290  27.767 5.576   1.00 31.25  ? 113 VAL A N   1 
ATOM   815  C CA  . VAL A 1 113 ? -0.787  26.899 6.633   1.00 29.13  ? 113 VAL A CA  1 
ATOM   816  C C   . VAL A 1 113 ? -1.371  27.835 7.705   1.00 36.46  ? 113 VAL A C   1 
ATOM   817  O O   . VAL A 1 113 ? -0.737  28.837 8.067   1.00 38.02  ? 113 VAL A O   1 
ATOM   818  C CB  . VAL A 1 113 ? 0.314   25.976 7.220   1.00 30.87  ? 113 VAL A CB  1 
ATOM   819  C CG1 . VAL A 1 113 ? -0.290  24.898 8.112   1.00 29.42  ? 113 VAL A CG1 1 
ATOM   820  C CG2 . VAL A 1 113 ? 1.164   25.345 6.120   1.00 31.08  ? 113 VAL A CG2 1 
ATOM   821  N N   . THR A 1 114 ? -2.594  27.531 8.180   1.00 32.58  ? 114 THR A N   1 
ATOM   822  C CA  . THR A 1 114 ? -3.300  28.318 9.198   1.00 30.99  ? 114 THR A CA  1 
ATOM   823  C C   . THR A 1 114 ? -3.589  27.446 10.420  1.00 33.95  ? 114 THR A C   1 
ATOM   824  O O   . THR A 1 114 ? -3.491  26.221 10.343  1.00 32.96  ? 114 THR A O   1 
ATOM   825  C CB  . THR A 1 114 ? -4.576  28.969 8.595   1.00 36.72  ? 114 THR A CB  1 
ATOM   826  O OG1 . THR A 1 114 ? -5.384  27.953 8.002   1.00 38.21  ? 114 THR A OG1 1 
ATOM   827  C CG2 . THR A 1 114 ? -4.262  30.063 7.555   1.00 30.88  ? 114 THR A CG2 1 
ATOM   828  N N   . SER A 1 115 ? -3.941  28.066 11.554  1.00 31.92  ? 115 SER A N   1 
ATOM   829  C CA  . SER A 1 115 ? -4.255  27.324 12.780  1.00 31.78  ? 115 SER A CA  1 
ATOM   830  C C   . SER A 1 115 ? -5.715  26.871 12.732  1.00 36.95  ? 115 SER A C   1 
ATOM   831  O O   . SER A 1 115 ? -6.566  27.371 13.471  1.00 36.64  ? 115 SER A O   1 
ATOM   832  C CB  . SER A 1 115 ? -3.916  28.154 14.012  1.00 34.44  ? 115 SER A CB  1 
ATOM   833  O OG  . SER A 1 115 ? -2.511  28.320 14.134  1.00 40.78  ? 115 SER A OG  1 
ATOM   834  N N   . GLY A 1 116 ? -5.958  25.909 11.838  1.00 34.44  ? 116 GLY A N   1 
ATOM   835  C CA  . GLY A 1 116 ? -7.265  25.392 11.451  1.00 34.68  ? 116 GLY A CA  1 
ATOM   836  C C   . GLY A 1 116 ? -7.706  26.145 10.206  1.00 40.29  ? 116 GLY A C   1 
ATOM   837  O O   . GLY A 1 116 ? -7.080  27.153 9.868   1.00 41.30  ? 116 GLY A O   1 
ATOM   838  N N   . SER A 1 117 ? -8.765  25.690 9.494   1.00 36.74  ? 117 SER A N   1 
ATOM   839  C CA  . SER A 1 117 ? -9.265  26.425 8.316   1.00 37.03  ? 117 SER A CA  1 
ATOM   840  C C   . SER A 1 117 ? -10.061 27.680 8.745   1.00 38.90  ? 117 SER A C   1 
ATOM   841  O O   . SER A 1 117 ? -10.223 28.608 7.954   1.00 38.56  ? 117 SER A O   1 
ATOM   842  C CB  . SER A 1 117 ? -10.087 25.519 7.392   1.00 41.70  ? 117 SER A CB  1 
ATOM   843  O OG  . SER A 1 117 ? -11.375 25.209 7.904   1.00 52.69  ? 117 SER A OG  1 
ATOM   844  N N   . GLN A 1 118 ? -10.537 27.695 10.005  1.00 33.71  ? 118 GLN A N   1 
ATOM   845  C CA  . GLN A 1 118 ? -11.298 28.781 10.614  1.00 33.83  ? 118 GLN A CA  1 
ATOM   846  C C   . GLN A 1 118 ? -10.474 30.079 10.698  1.00 38.39  ? 118 GLN A C   1 
ATOM   847  O O   . GLN A 1 118 ? -11.030 31.176 10.569  1.00 39.10  ? 118 GLN A O   1 
ATOM   848  C CB  . GLN A 1 118 ? -11.791 28.355 12.016  1.00 34.72  ? 118 GLN A CB  1 
ATOM   849  C CG  . GLN A 1 118 ? -12.852 29.256 12.659  1.00 50.47  ? 118 GLN A CG  1 
ATOM   850  C CD  . GLN A 1 118 ? -14.075 29.444 11.801  1.00 66.01  ? 118 GLN A CD  1 
ATOM   851  O OE1 . GLN A 1 118 ? -14.794 28.498 11.451  1.00 69.57  ? 118 GLN A OE1 1 
ATOM   852  N NE2 . GLN A 1 118 ? -14.318 30.687 11.440  1.00 44.75  ? 118 GLN A NE2 1 
ATOM   853  N N   . GLN A 1 119 ? -9.159  29.952 10.940  1.00 32.74  ? 119 GLN A N   1 
ATOM   854  C CA  . GLN A 1 119 ? -8.259  31.095 11.051  1.00 31.00  ? 119 GLN A CA  1 
ATOM   855  C C   . GLN A 1 119 ? -8.111  31.797 9.715   1.00 34.60  ? 119 GLN A C   1 
ATOM   856  O O   . GLN A 1 119 ? -8.185  33.022 9.668   1.00 33.79  ? 119 GLN A O   1 
ATOM   857  C CB  . GLN A 1 119 ? -6.909  30.696 11.654  1.00 31.30  ? 119 GLN A CB  1 
ATOM   858  C CG  . GLN A 1 119 ? -6.172  31.878 12.264  1.00 34.82  ? 119 GLN A CG  1 
ATOM   859  C CD  . GLN A 1 119 ? -4.675  31.704 12.405  1.00 46.58  ? 119 GLN A CD  1 
ATOM   860  O OE1 . GLN A 1 119 ? -4.025  30.876 11.744  1.00 41.15  ? 119 GLN A OE1 1 
ATOM   861  N NE2 . GLN A 1 119 ? -4.083  32.542 13.250  1.00 31.65  ? 119 GLN A NE2 1 
ATOM   862  N N   . GLY A 1 120 ? -7.963  31.015 8.647   1.00 32.12  ? 120 GLY A N   1 
ATOM   863  C CA  . GLY A 1 120 ? -7.861  31.531 7.285   1.00 33.09  ? 120 GLY A CA  1 
ATOM   864  C C   . GLY A 1 120 ? -9.109  32.290 6.887   1.00 38.76  ? 120 GLY A C   1 
ATOM   865  O O   . GLY A 1 120 ? -9.020  33.446 6.471   1.00 38.06  ? 120 GLY A O   1 
ATOM   866  N N   . LEU A 1 121 ? -10.287 31.662 7.101   1.00 37.62  ? 121 LEU A N   1 
ATOM   867  C CA  . LEU A 1 121 ? -11.603 32.239 6.843   1.00 39.41  ? 121 LEU A CA  1 
ATOM   868  C C   . LEU A 1 121 ? -11.770 33.578 7.580   1.00 44.47  ? 121 LEU A C   1 
ATOM   869  O O   . LEU A 1 121 ? -12.176 34.566 6.965   1.00 44.95  ? 121 LEU A O   1 
ATOM   870  C CB  . LEU A 1 121 ? -12.709 31.258 7.274   1.00 39.53  ? 121 LEU A CB  1 
ATOM   871  C CG  . LEU A 1 121 ? -12.916 30.004 6.414   1.00 45.32  ? 121 LEU A CG  1 
ATOM   872  C CD1 . LEU A 1 121 ? -13.693 28.957 7.175   1.00 45.51  ? 121 LEU A CD1 1 
ATOM   873  C CD2 . LEU A 1 121 ? -13.650 30.317 5.133   1.00 48.37  ? 121 LEU A CD2 1 
ATOM   874  N N   . CYS A 1 122 ? -11.410 33.606 8.878   1.00 39.99  ? 122 CYS A N   1 
ATOM   875  C CA  . CYS A 1 122 ? -11.484 34.774 9.748   1.00 40.02  ? 122 CYS A CA  1 
ATOM   876  C C   . CYS A 1 122 ? -10.659 35.948 9.215   1.00 39.78  ? 122 CYS A C   1 
ATOM   877  O O   . CYS A 1 122 ? -11.197 37.047 9.093   1.00 39.15  ? 122 CYS A O   1 
ATOM   878  C CB  . CYS A 1 122 ? -11.074 34.397 11.170  1.00 40.97  ? 122 CYS A CB  1 
ATOM   879  S SG  . CYS A 1 122 ? -10.849 35.804 12.299  1.00 45.57  ? 122 CYS A SG  1 
ATOM   880  N N   . LYS A 1 123 ? -9.361  35.718 8.910   1.00 32.92  ? 123 LYS A N   1 
ATOM   881  C CA  . LYS A 1 123 ? -8.439  36.737 8.404   1.00 31.57  ? 123 LYS A CA  1 
ATOM   882  C C   . LYS A 1 123 ? -8.895  37.268 7.048   1.00 36.11  ? 123 LYS A C   1 
ATOM   883  O O   . LYS A 1 123 ? -8.718  38.459 6.770   1.00 37.82  ? 123 LYS A O   1 
ATOM   884  C CB  . LYS A 1 123 ? -6.998  36.208 8.322   1.00 33.41  ? 123 LYS A CB  1 
ATOM   885  C CG  . LYS A 1 123 ? -6.404  35.630 9.624   1.00 52.43  ? 123 LYS A CG  1 
ATOM   886  C CD  . LYS A 1 123 ? -6.273  36.628 10.763  1.00 62.62  ? 123 LYS A CD  1 
ATOM   887  C CE  . LYS A 1 123 ? -6.914  36.120 12.029  1.00 77.05  ? 123 LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 123 ? -6.920  37.165 13.084  1.00 86.54  ? 123 LYS A NZ  1 
ATOM   889  N N   . VAL A 1 124 ? -9.508  36.393 6.219   1.00 30.82  ? 124 VAL A N   1 
ATOM   890  C CA  . VAL A 1 124 ? -10.039 36.724 4.895   1.00 30.51  ? 124 VAL A CA  1 
ATOM   891  C C   . VAL A 1 124 ? -11.265 37.636 5.040   1.00 35.04  ? 124 VAL A C   1 
ATOM   892  O O   . VAL A 1 124 ? -11.348 38.646 4.350   1.00 36.07  ? 124 VAL A O   1 
ATOM   893  C CB  . VAL A 1 124 ? -10.331 35.442 4.071   1.00 33.05  ? 124 VAL A CB  1 
ATOM   894  C CG1 . VAL A 1 124 ? -11.281 35.713 2.902   1.00 33.58  ? 124 VAL A CG1 1 
ATOM   895  C CG2 . VAL A 1 124 ? -9.033  34.826 3.578   1.00 32.40  ? 124 VAL A CG2 1 
ATOM   896  N N   . PHE A 1 125 ? -12.197 37.286 5.941   1.00 30.92  ? 125 PHE A N   1 
ATOM   897  C CA  . PHE A 1 125 ? -13.387 38.084 6.199   1.00 31.85  ? 125 PHE A CA  1 
ATOM   898  C C   . PHE A 1 125 ? -12.997 39.478 6.696   1.00 35.07  ? 125 PHE A C   1 
ATOM   899  O O   . PHE A 1 125 ? -13.572 40.460 6.232   1.00 36.53  ? 125 PHE A O   1 
ATOM   900  C CB  . PHE A 1 125 ? -14.308 37.387 7.226   1.00 33.90  ? 125 PHE A CB  1 
ATOM   901  C CG  . PHE A 1 125 ? -14.965 36.087 6.812   1.00 36.52  ? 125 PHE A CG  1 
ATOM   902  C CD1 . PHE A 1 125 ? -15.357 35.145 7.767   1.00 39.69  ? 125 PHE A CD1 1 
ATOM   903  C CD2 . PHE A 1 125 ? -15.256 35.828 5.477   1.00 40.04  ? 125 PHE A CD2 1 
ATOM   904  C CE1 . PHE A 1 125 ? -16.010 33.953 7.386   1.00 40.61  ? 125 PHE A CE1 1 
ATOM   905  C CE2 . PHE A 1 125 ? -15.900 34.639 5.101   1.00 43.00  ? 125 PHE A CE2 1 
ATOM   906  C CZ  . PHE A 1 125 ? -16.265 33.706 6.058   1.00 40.07  ? 125 PHE A CZ  1 
ATOM   907  N N   . GLU A 1 126 ? -12.004 39.560 7.614   1.00 29.51  ? 126 GLU A N   1 
ATOM   908  C CA  . GLU A 1 126 ? -11.495 40.795 8.222   1.00 29.18  ? 126 GLU A CA  1 
ATOM   909  C C   . GLU A 1 126 ? -10.758 41.712 7.213   1.00 36.35  ? 126 GLU A C   1 
ATOM   910  O O   . GLU A 1 126 ? -10.797 42.943 7.348   1.00 37.53  ? 126 GLU A O   1 
ATOM   911  C CB  . GLU A 1 126 ? -10.639 40.488 9.471   1.00 29.11  ? 126 GLU A CB  1 
ATOM   912  C CG  . GLU A 1 126 ? -11.468 39.954 10.637  1.00 44.50  ? 126 GLU A CG  1 
ATOM   913  C CD  . GLU A 1 126 ? -10.822 39.586 11.967  1.00 67.44  ? 126 GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 126 ? -11.569 39.181 12.891  1.00 50.74  ? 126 GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 126 ? -9.582  39.707 12.097  1.00 59.12  ? 126 GLU A OE2 1 
ATOM   916  N N   . MET A 1 127 ? -10.132 41.114 6.182   1.00 33.47  ? 127 MET A N   1 
ATOM   917  C CA  . MET A 1 127 ? -9.383  41.797 5.115   1.00 34.24  ? 127 MET A CA  1 
ATOM   918  C C   . MET A 1 127 ? -10.346 42.529 4.185   1.00 41.64  ? 127 MET A C   1 
ATOM   919  O O   . MET A 1 127 ? -10.057 43.643 3.738   1.00 43.73  ? 127 MET A O   1 
ATOM   920  C CB  . MET A 1 127 ? -8.571  40.736 4.323   1.00 36.06  ? 127 MET A CB  1 
ATOM   921  C CG  . MET A 1 127 ? -7.881  41.223 3.035   1.00 40.26  ? 127 MET A CG  1 
ATOM   922  S SD  . MET A 1 127 ? -7.104  39.865 2.097   1.00 43.58  ? 127 MET A SD  1 
ATOM   923  C CE  . MET A 1 127 ? -8.540  39.101 1.368   1.00 41.05  ? 127 MET A CE  1 
ATOM   924  N N   . ILE A 1 128 ? -11.479 41.889 3.889   1.00 38.19  ? 128 ILE A N   1 
ATOM   925  C CA  . ILE A 1 128 ? -12.485 42.375 2.952   1.00 39.44  ? 128 ILE A CA  1 
ATOM   926  C C   . ILE A 1 128 ? -13.534 43.335 3.525   1.00 46.54  ? 128 ILE A C   1 
ATOM   927  O O   . ILE A 1 128 ? -13.701 44.432 2.985   1.00 47.82  ? 128 ILE A O   1 
ATOM   928  C CB  . ILE A 1 128 ? -13.148 41.163 2.265   1.00 42.33  ? 128 ILE A CB  1 
ATOM   929  C CG1 . ILE A 1 128 ? -12.114 40.281 1.537   1.00 42.19  ? 128 ILE A CG1 1 
ATOM   930  C CG2 . ILE A 1 128 ? -14.270 41.600 1.336   1.00 44.69  ? 128 ILE A CG2 1 
ATOM   931  C CD1 . ILE A 1 128 ? -12.563 38.844 1.302   1.00 46.74  ? 128 ILE A CD1 1 
ATOM   932  N N   . ILE A 1 129 ? -14.291 42.891 4.555   1.00 43.73  ? 129 ILE A N   1 
ATOM   933  C CA  . ILE A 1 129 ? -15.439 43.611 5.128   1.00 44.31  ? 129 ILE A CA  1 
ATOM   934  C C   . ILE A 1 129 ? -15.208 44.936 5.839   1.00 48.85  ? 129 ILE A C   1 
ATOM   935  O O   . ILE A 1 129 ? -14.505 44.995 6.845   1.00 48.42  ? 129 ILE A O   1 
ATOM   936  C CB  . ILE A 1 129 ? -16.385 42.672 5.927   1.00 46.25  ? 129 ILE A CB  1 
ATOM   937  C CG1 . ILE A 1 129 ? -16.879 41.511 5.050   1.00 47.26  ? 129 ILE A CG1 1 
ATOM   938  C CG2 . ILE A 1 129 ? -17.565 43.438 6.536   1.00 46.15  ? 129 ILE A CG2 1 
ATOM   939  C CD1 . ILE A 1 129 ? -16.832 40.173 5.723   1.00 52.24  ? 129 ILE A CD1 1 
ATOM   940  N N   . ASN A 1 130 ? -15.892 45.973 5.343   1.00 46.76  ? 130 ASN A N   1 
ATOM   941  C CA  . ASN A 1 130 ? -16.008 47.310 5.924   1.00 47.73  ? 130 ASN A CA  1 
ATOM   942  C C   . ASN A 1 130 ? -17.457 47.401 6.406   1.00 54.15  ? 130 ASN A C   1 
ATOM   943  O O   . ASN A 1 130 ? -18.336 46.827 5.748   1.00 53.72  ? 130 ASN A O   1 
ATOM   944  C CB  . ASN A 1 130 ? -15.779 48.396 4.884   1.00 47.79  ? 130 ASN A CB  1 
ATOM   945  C CG  . ASN A 1 130 ? -14.351 48.566 4.487   1.00 61.57  ? 130 ASN A CG  1 
ATOM   946  O OD1 . ASN A 1 130 ? -13.476 48.831 5.322   1.00 64.57  ? 130 ASN A OD1 1 
ATOM   947  N ND2 . ASN A 1 130 ? -14.099 48.457 3.191   1.00 42.90  ? 130 ASN A ND2 1 
ATOM   948  N N   . PRO A 1 131 ? -17.755 48.082 7.537   1.00 52.21  ? 131 PRO A N   1 
ATOM   949  C CA  . PRO A 1 131 ? -19.156 48.135 8.000   1.00 52.69  ? 131 PRO A CA  1 
ATOM   950  C C   . PRO A 1 131 ? -20.101 48.702 6.936   1.00 57.05  ? 131 PRO A C   1 
ATOM   951  O O   . PRO A 1 131 ? -19.851 49.780 6.399   1.00 57.77  ? 131 PRO A O   1 
ATOM   952  C CB  . PRO A 1 131 ? -19.089 49.010 9.259   1.00 54.45  ? 131 PRO A CB  1 
ATOM   953  C CG  . PRO A 1 131 ? -17.662 48.976 9.681   1.00 57.57  ? 131 PRO A CG  1 
ATOM   954  C CD  . PRO A 1 131 ? -16.857 48.829 8.440   1.00 53.26  ? 131 PRO A CD  1 
ATOM   955  N N   . GLY A 1 132 ? -21.117 47.917 6.590   1.00 53.63  ? 132 GLY A N   1 
ATOM   956  C CA  . GLY A 1 132 ? -22.128 48.261 5.596   1.00 55.59  ? 132 GLY A CA  1 
ATOM   957  C C   . GLY A 1 132 ? -21.973 47.629 4.223   1.00 60.75  ? 132 GLY A C   1 
ATOM   958  O O   . GLY A 1 132 ? -22.724 47.971 3.308   1.00 62.69  ? 132 GLY A O   1 
ATOM   959  N N   . ASP A 1 133 ? -21.001 46.709 4.062   1.00 56.16  ? 133 ASP A N   1 
ATOM   960  C CA  . ASP A 1 133 ? -20.728 46.012 2.804   1.00 56.30  ? 133 ASP A CA  1 
ATOM   961  C C   . ASP A 1 133 ? -21.726 44.886 2.578   1.00 60.00  ? 133 ASP A C   1 
ATOM   962  O O   . ASP A 1 133 ? -22.189 44.264 3.535   1.00 59.74  ? 133 ASP A O   1 
ATOM   963  C CB  . ASP A 1 133 ? -19.285 45.467 2.770   1.00 57.01  ? 133 ASP A CB  1 
ATOM   964  C CG  . ASP A 1 133 ? -18.166 46.481 2.529   1.00 71.24  ? 133 ASP A CG  1 
ATOM   965  O OD1 . ASP A 1 133 ? -18.472 47.640 2.145   1.00 74.38  ? 133 ASP A OD1 1 
ATOM   966  O OD2 . ASP A 1 133 ? -16.984 46.102 2.674   1.00 76.08  ? 133 ASP A OD2 1 
ATOM   967  N N   . ASN A 1 134 ? -22.067 44.625 1.311   1.00 56.22  ? 134 ASN A N   1 
ATOM   968  C CA  . ASN A 1 134 ? -22.996 43.556 0.972   1.00 55.09  ? 134 ASN A CA  1 
ATOM   969  C C   . ASN A 1 134 ? -22.231 42.261 0.717   1.00 56.87  ? 134 ASN A C   1 
ATOM   970  O O   . ASN A 1 134 ? -21.209 42.278 0.029   1.00 56.47  ? 134 ASN A O   1 
ATOM   971  C CB  . ASN A 1 134 ? -23.815 43.942 -0.246  1.00 54.46  ? 134 ASN A CB  1 
ATOM   972  C CG  . ASN A 1 134 ? -24.831 45.022 0.018   1.00 80.54  ? 134 ASN A CG  1 
ATOM   973  O OD1 . ASN A 1 134 ? -25.513 45.043 1.052   1.00 76.87  ? 134 ASN A OD1 1 
ATOM   974  N ND2 . ASN A 1 134 ? -24.983 45.927 -0.938  1.00 76.15  ? 134 ASN A ND2 1 
ATOM   975  N N   . VAL A 1 135 ? -22.700 41.146 1.312   1.00 51.64  ? 135 VAL A N   1 
ATOM   976  C CA  . VAL A 1 135 ? -22.095 39.816 1.141   1.00 49.99  ? 135 VAL A CA  1 
ATOM   977  C C   . VAL A 1 135 ? -23.155 38.780 0.787   1.00 53.33  ? 135 VAL A C   1 
ATOM   978  O O   . VAL A 1 135 ? -24.271 38.830 1.318   1.00 52.05  ? 135 VAL A O   1 
ATOM   979  C CB  . VAL A 1 135 ? -21.124 39.344 2.273   1.00 51.73  ? 135 VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 135 ? -19.941 40.304 2.433   1.00 51.36  ? 135 VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 135 ? -21.844 39.137 3.605   1.00 50.49  ? 135 VAL A CG2 1 
ATOM   982  N N   . LEU A 1 136 ? -22.808 37.863 -0.139  1.00 50.63  ? 136 LEU A N   1 
ATOM   983  C CA  . LEU A 1 136 ? -23.704 36.812 -0.615  1.00 50.99  ? 136 LEU A CA  1 
ATOM   984  C C   . LEU A 1 136 ? -23.409 35.494 0.061   1.00 56.14  ? 136 LEU A C   1 
ATOM   985  O O   . LEU A 1 136 ? -22.259 35.062 0.133   1.00 53.66  ? 136 LEU A O   1 
ATOM   986  C CB  . LEU A 1 136 ? -23.637 36.665 -2.135  1.00 52.13  ? 136 LEU A CB  1 
ATOM   987  C CG  . LEU A 1 136 ? -24.089 37.863 -2.947  1.00 58.67  ? 136 LEU A CG  1 
ATOM   988  C CD1 . LEU A 1 136 ? -23.502 37.810 -4.341  1.00 60.26  ? 136 LEU A CD1 1 
ATOM   989  C CD2 . LEU A 1 136 ? -25.606 37.963 -2.992  1.00 62.33  ? 136 LEU A CD2 1 
ATOM   990  N N   . LEU A 1 137 ? -24.470 34.852 0.553   1.00 56.33  ? 137 LEU A N   1 
ATOM   991  C CA  . LEU A 1 137 ? -24.417 33.609 1.320   1.00 55.47  ? 137 LEU A CA  1 
ATOM   992  C C   . LEU A 1 137 ? -25.753 32.849 1.155   1.00 60.64  ? 137 LEU A C   1 
ATOM   993  O O   . LEU A 1 137 ? -26.771 33.450 0.792   1.00 60.19  ? 137 LEU A O   1 
ATOM   994  C CB  . LEU A 1 137 ? -24.202 34.042 2.784   1.00 54.37  ? 137 LEU A CB  1 
ATOM   995  C CG  . LEU A 1 137 ? -23.987 32.992 3.843   1.00 57.82  ? 137 LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 137 ? -22.774 33.331 4.660   1.00 57.04  ? 137 LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 137 ? -25.209 32.894 4.757   1.00 60.71  ? 137 LEU A CD2 1 
ATOM   998  N N   . ASP A 1 138 ? -25.736 31.534 1.418   1.00 57.95  ? 138 ASP A N   1 
ATOM   999  C CA  . ASP A 1 138 ? -26.927 30.686 1.352   1.00 58.80  ? 138 ASP A CA  1 
ATOM   1000 C C   . ASP A 1 138 ? -27.329 30.133 2.737   1.00 59.59  ? 138 ASP A C   1 
ATOM   1001 O O   . ASP A 1 138 ? -26.530 29.470 3.396   1.00 56.54  ? 138 ASP A O   1 
ATOM   1002 C CB  . ASP A 1 138 ? -26.753 29.552 0.315   1.00 61.91  ? 138 ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 138 ? -25.482 28.726 0.456   1.00 79.30  ? 138 ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 138 ? -24.371 29.313 0.352   1.00 79.80  ? 138 ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 138 ? -25.596 27.486 0.626   1.00 89.33  ? 138 ASP A OD2 1 
ATOM   1006 N N   . GLU A 1 139 ? -28.555 30.452 3.184   1.00 56.50  ? 139 GLU A N   1 
ATOM   1007 C CA  . GLU A 1 139 ? -29.126 29.951 4.439   1.00 54.51  ? 139 GLU A CA  1 
ATOM   1008 C C   . GLU A 1 139 ? -29.880 28.649 4.108   1.00 56.37  ? 139 GLU A C   1 
ATOM   1009 O O   . GLU A 1 139 ? -30.584 28.609 3.091   1.00 57.29  ? 139 GLU A O   1 
ATOM   1010 C CB  . GLU A 1 139 ? -30.111 30.954 5.062   1.00 56.86  ? 139 GLU A CB  1 
ATOM   1011 C CG  . GLU A 1 139 ? -29.478 32.122 5.794   1.00 67.60  ? 139 GLU A CG  1 
ATOM   1012 C CD  . GLU A 1 139 ? -30.501 33.063 6.401   1.00 96.15  ? 139 GLU A CD  1 
ATOM   1013 O OE1 . GLU A 1 139 ? -30.509 33.203 7.644   1.00 92.23  ? 139 GLU A OE1 1 
ATOM   1014 O OE2 . GLU A 1 139 ? -31.311 33.642 5.641   1.00 96.76  ? 139 GLU A OE2 1 
ATOM   1015 N N   . PRO A 1 140 ? -29.760 27.577 4.930   1.00 49.77  ? 140 PRO A N   1 
ATOM   1016 C CA  . PRO A 1 140 ? -28.961 27.477 6.165   1.00 47.21  ? 140 PRO A CA  1 
ATOM   1017 C C   . PRO A 1 140 ? -27.458 27.342 5.915   1.00 49.82  ? 140 PRO A C   1 
ATOM   1018 O O   . PRO A 1 140 ? -27.032 26.729 4.929   1.00 50.35  ? 140 PRO A O   1 
ATOM   1019 C CB  . PRO A 1 140 ? -29.610 26.305 6.905   1.00 48.06  ? 140 PRO A CB  1 
ATOM   1020 C CG  . PRO A 1 140 ? -30.175 25.431 5.834   1.00 53.15  ? 140 PRO A CG  1 
ATOM   1021 C CD  . PRO A 1 140 ? -30.458 26.309 4.636   1.00 50.50  ? 140 PRO A CD  1 
ATOM   1022 N N   . ALA A 1 141 ? -26.663 27.963 6.794   1.00 44.30  ? 141 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 141 ? -25.206 28.003 6.705   1.00 42.74  ? 141 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 141 ? -24.515 27.555 7.996   1.00 45.44  ? 141 ALA A C   1 
ATOM   1025 O O   . ALA A 1 141 ? -25.162 27.461 9.052   1.00 44.33  ? 141 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 141 ? -24.755 29.413 6.346   1.00 43.75  ? 141 ALA A CB  1 
ATOM   1027 N N   . TYR A 1 142 ? -23.174 27.296 7.895   1.00 40.59  ? 142 TYR A N   1 
ATOM   1028 C CA  . TYR A 1 142 ? -22.320 26.926 9.018   1.00 38.07  ? 142 TYR A CA  1 
ATOM   1029 C C   . TYR A 1 142 ? -22.349 28.087 10.030  1.00 40.96  ? 142 TYR A C   1 
ATOM   1030 O O   . TYR A 1 142 ? -22.023 29.231 9.682   1.00 40.57  ? 142 TYR A O   1 
ATOM   1031 C CB  . TYR A 1 142 ? -20.871 26.586 8.547   1.00 37.46  ? 142 TYR A CB  1 
ATOM   1032 C CG  . TYR A 1 142 ? -19.818 26.498 9.647   1.00 36.22  ? 142 TYR A CG  1 
ATOM   1033 C CD1 . TYR A 1 142 ? -18.628 27.215 9.560   1.00 37.38  ? 142 TYR A CD1 1 
ATOM   1034 C CD2 . TYR A 1 142 ? -20.002 25.680 10.760  1.00 35.80  ? 142 TYR A CD2 1 
ATOM   1035 C CE1 . TYR A 1 142 ? -17.651 27.133 10.550  1.00 36.62  ? 142 TYR A CE1 1 
ATOM   1036 C CE2 . TYR A 1 142 ? -19.039 25.605 11.770  1.00 35.57  ? 142 TYR A CE2 1 
ATOM   1037 C CZ  . TYR A 1 142 ? -17.863 26.335 11.660  1.00 43.28  ? 142 TYR A CZ  1 
ATOM   1038 O OH  . TYR A 1 142 ? -16.894 26.314 12.648  1.00 45.39  ? 142 TYR A OH  1 
ATOM   1039 N N   . SER A 1 143 ? -22.819 27.777 11.262  1.00 37.74  ? 143 SER A N   1 
ATOM   1040 C CA  . SER A 1 143 ? -22.961 28.726 12.380  1.00 38.31  ? 143 SER A CA  1 
ATOM   1041 C C   . SER A 1 143 ? -21.660 29.514 12.683  1.00 40.71  ? 143 SER A C   1 
ATOM   1042 O O   . SER A 1 143 ? -21.707 30.683 13.047  1.00 39.60  ? 143 SER A O   1 
ATOM   1043 C CB  . SER A 1 143 ? -23.493 28.008 13.624  1.00 42.32  ? 143 SER A CB  1 
ATOM   1044 O OG  . SER A 1 143 ? -22.573 27.024 14.069  1.00 50.24  ? 143 SER A OG  1 
ATOM   1045 N N   . GLY A 1 144 ? -20.525 28.874 12.444  1.00 37.13  ? 144 GLY A N   1 
ATOM   1046 C CA  . GLY A 1 144 ? -19.207 29.463 12.638  1.00 36.75  ? 144 GLY A CA  1 
ATOM   1047 C C   . GLY A 1 144 ? -18.937 30.646 11.742  1.00 41.31  ? 144 GLY A C   1 
ATOM   1048 O O   . GLY A 1 144 ? -18.258 31.585 12.160  1.00 41.55  ? 144 GLY A O   1 
ATOM   1049 N N   . THR A 1 145 ? -19.466 30.618 10.506  1.00 37.15  ? 145 THR A N   1 
ATOM   1050 C CA  . THR A 1 145 ? -19.277 31.750 9.602   1.00 36.16  ? 145 THR A CA  1 
ATOM   1051 C C   . THR A 1 145 ? -20.230 32.863 9.926   1.00 37.66  ? 145 THR A C   1 
ATOM   1052 O O   . THR A 1 145 ? -19.838 34.035 9.857   1.00 37.56  ? 145 THR A O   1 
ATOM   1053 C CB  . THR A 1 145 ? -19.036 31.380 8.134   1.00 38.23  ? 145 THR A CB  1 
ATOM   1054 O OG1 . THR A 1 145 ? -19.918 32.115 7.292   1.00 39.71  ? 145 THR A OG1 1 
ATOM   1055 C CG2 . THR A 1 145 ? -19.185 29.929 7.879   1.00 34.16  ? 145 THR A CG2 1 
ATOM   1056 N N   . LEU A 1 146 ? -21.454 32.502 10.355  1.00 33.10  ? 146 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 146 ? -22.483 33.480 10.751  1.00 33.13  ? 146 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 146 ? -22.000 34.251 11.991  1.00 35.14  ? 146 LEU A C   1 
ATOM   1059 O O   . LEU A 1 146 ? -22.084 35.484 12.035  1.00 33.86  ? 146 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 146 ? -23.843 32.780 11.034  1.00 33.26  ? 146 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 146 ? -24.456 31.928 9.908   1.00 39.32  ? 146 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 146 ? -25.588 31.035 10.435  1.00 40.27  ? 146 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 146 ? -24.941 32.798 8.742   1.00 43.52  ? 146 LEU A CD2 1 
ATOM   1064 N N   . GLN A 1 147 ? -21.393 33.511 12.948  1.00 30.78  ? 147 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 147 ? -20.839 34.061 14.181  1.00 30.09  ? 147 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 147 ? -19.645 34.968 13.937  1.00 33.75  ? 147 GLN A C   1 
ATOM   1067 O O   . GLN A 1 147 ? -19.404 35.891 14.722  1.00 33.40  ? 147 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 147 ? -20.525 32.949 15.193  1.00 30.70  ? 147 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 147 ? -21.762 32.334 15.856  1.00 60.21  ? 147 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 147 ? -22.594 33.323 16.632  1.00 90.09  ? 147 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 147 ? -22.422 33.491 17.843  1.00 89.33  ? 147 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 147 ? -23.574 33.928 15.976  1.00 81.53  ? 147 GLN A NE2 1 
ATOM   1073 N N   . SER A 1 148 ? -18.920 34.716 12.823  1.00 29.73  ? 148 SER A N   1 
ATOM   1074 C CA  . SER A 1 148 ? -17.769 35.492 12.369  1.00 29.24  ? 148 SER A CA  1 
ATOM   1075 C C   . SER A 1 148 ? -18.226 36.780 11.691  1.00 33.26  ? 148 SER A C   1 
ATOM   1076 O O   . SER A 1 148 ? -17.648 37.842 11.950  1.00 32.48  ? 148 SER A O   1 
ATOM   1077 C CB  . SER A 1 148 ? -16.939 34.686 11.371  1.00 33.27  ? 148 SER A CB  1 
ATOM   1078 O OG  . SER A 1 148 ? -15.925 33.929 12.002  1.00 41.87  ? 148 SER A OG  1 
ATOM   1079 N N   . LEU A 1 149 ? -19.238 36.685 10.804  1.00 31.35  ? 149 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 149 ? -19.719 37.834 10.037  1.00 33.72  ? 149 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 149 ? -20.531 38.869 10.823  1.00 40.37  ? 149 LEU A C   1 
ATOM   1082 O O   . LEU A 1 149 ? -20.409 40.070 10.553  1.00 39.85  ? 149 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 149 ? -20.441 37.408 8.746   1.00 34.63  ? 149 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 149 ? -19.649 36.532 7.748   1.00 38.94  ? 149 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 149 ? -20.504 36.158 6.570   1.00 40.99  ? 149 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 149 ? -18.398 37.213 7.245   1.00 39.85  ? 149 LEU A CD2 1 
ATOM   1087 N N   . HIS A 1 150 ? -21.349 38.402 11.797  1.00 38.68  ? 150 HIS A N   1 
ATOM   1088 C CA  . HIS A 1 150 ? -22.201 39.239 12.652  1.00 39.81  ? 150 HIS A CA  1 
ATOM   1089 C C   . HIS A 1 150 ? -21.504 40.497 13.261  1.00 42.37  ? 150 HIS A C   1 
ATOM   1090 O O   . HIS A 1 150 ? -22.038 41.598 13.090  1.00 42.38  ? 150 HIS A O   1 
ATOM   1091 C CB  . HIS A 1 150 ? -22.939 38.385 13.712  1.00 40.59  ? 150 HIS A CB  1 
ATOM   1092 C CG  . HIS A 1 150 ? -23.677 39.192 14.740  1.00 45.45  ? 150 HIS A CG  1 
ATOM   1093 N ND1 . HIS A 1 150 ? -23.236 39.278 16.054  1.00 46.91  ? 150 HIS A ND1 1 
ATOM   1094 C CD2 . HIS A 1 150 ? -24.783 39.959 14.606  1.00 48.93  ? 150 HIS A CD2 1 
ATOM   1095 C CE1 . HIS A 1 150 ? -24.100 40.071 16.673  1.00 47.33  ? 150 HIS A CE1 1 
ATOM   1096 N NE2 . HIS A 1 150 ? -25.042 40.508 15.844  1.00 48.90  ? 150 HIS A NE2 1 
ATOM   1097 N N   . PRO A 1 151 ? -20.314 40.385 13.918  1.00 37.59  ? 151 PRO A N   1 
ATOM   1098 C CA  . PRO A 1 151 ? -19.675 41.589 14.481  1.00 37.66  ? 151 PRO A CA  1 
ATOM   1099 C C   . PRO A 1 151 ? -19.101 42.562 13.453  1.00 42.81  ? 151 PRO A C   1 
ATOM   1100 O O   . PRO A 1 151 ? -18.799 43.699 13.804  1.00 42.88  ? 151 PRO A O   1 
ATOM   1101 C CB  . PRO A 1 151 ? -18.557 41.015 15.359  1.00 37.78  ? 151 PRO A CB  1 
ATOM   1102 C CG  . PRO A 1 151 ? -18.844 39.561 15.478  1.00 41.28  ? 151 PRO A CG  1 
ATOM   1103 C CD  . PRO A 1 151 ? -19.516 39.185 14.233  1.00 37.14  ? 151 PRO A CD  1 
ATOM   1104 N N   . LEU A 1 152 ? -18.942 42.114 12.197  1.00 40.75  ? 152 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 152 ? -18.351 42.898 11.105  1.00 41.72  ? 152 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 152 ? -19.271 43.945 10.487  1.00 47.52  ? 152 LEU A C   1 
ATOM   1107 O O   . LEU A 1 152 ? -18.813 44.764 9.668   1.00 49.16  ? 152 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 152 ? -17.717 41.996 10.024  1.00 41.26  ? 152 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 152 ? -16.512 41.161 10.446  1.00 43.75  ? 152 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 152 ? -16.343 39.992 9.534   1.00 45.44  ? 152 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 152 ? -15.245 41.992 10.436  1.00 43.53  ? 152 LEU A CD2 1 
ATOM   1112 N N   . GLY A 1 153 ? -20.536 43.928 10.905  1.00 43.89  ? 153 GLY A N   1 
ATOM   1113 C CA  . GLY A 1 153 ? -21.551 44.875 10.455  1.00 45.23  ? 153 GLY A CA  1 
ATOM   1114 C C   . GLY A 1 153 ? -21.755 44.929 8.956   1.00 49.22  ? 153 GLY A C   1 
ATOM   1115 O O   . GLY A 1 153 ? -21.817 46.010 8.377   1.00 49.10  ? 153 GLY A O   1 
ATOM   1116 N N   . CYS A 1 154 ? -21.838 43.761 8.326   1.00 46.18  ? 154 CYS A N   1 
ATOM   1117 C CA  . CYS A 1 154 ? -22.065 43.620 6.898   1.00 47.51  ? 154 CYS A CA  1 
ATOM   1118 C C   . CYS A 1 154 ? -23.490 43.138 6.671   1.00 53.31  ? 154 CYS A C   1 
ATOM   1119 O O   . CYS A 1 154 ? -24.078 42.543 7.579   1.00 54.11  ? 154 CYS A O   1 
ATOM   1120 C CB  . CYS A 1 154 ? -21.047 42.662 6.284   1.00 46.90  ? 154 CYS A CB  1 
ATOM   1121 S SG  . CYS A 1 154 ? -21.116 40.966 6.933   1.00 49.06  ? 154 CYS A SG  1 
ATOM   1122 N N   . ASN A 1 155 ? -24.041 43.367 5.463   1.00 50.26  ? 155 ASN A N   1 
ATOM   1123 C CA  . ASN A 1 155 ? -25.394 42.921 5.115   1.00 50.83  ? 155 ASN A CA  1 
ATOM   1124 C C   . ASN A 1 155 ? -25.341 41.571 4.411   1.00 52.54  ? 155 ASN A C   1 
ATOM   1125 O O   . ASN A 1 155 ? -24.784 41.478 3.309   1.00 53.48  ? 155 ASN A O   1 
ATOM   1126 C CB  . ASN A 1 155 ? -26.118 43.961 4.253   1.00 54.49  ? 155 ASN A CB  1 
ATOM   1127 C CG  . ASN A 1 155 ? -26.229 45.325 4.892   1.00 72.67  ? 155 ASN A CG  1 
ATOM   1128 O OD1 . ASN A 1 155 ? -26.798 45.492 5.978   1.00 63.85  ? 155 ASN A OD1 1 
ATOM   1129 N ND2 . ASN A 1 155 ? -25.683 46.336 4.226   1.00 65.28  ? 155 ASN A ND2 1 
ATOM   1130 N N   . ILE A 1 156 ? -25.874 40.521 5.067   1.00 45.33  ? 156 ILE A N   1 
ATOM   1131 C CA  . ILE A 1 156 ? -25.922 39.173 4.494   1.00 43.55  ? 156 ILE A CA  1 
ATOM   1132 C C   . ILE A 1 156 ? -27.214 39.030 3.673   1.00 49.82  ? 156 ILE A C   1 
ATOM   1133 O O   . ILE A 1 156 ? -28.309 39.077 4.235   1.00 49.76  ? 156 ILE A O   1 
ATOM   1134 C CB  . ILE A 1 156 ? -25.772 38.033 5.552   1.00 43.67  ? 156 ILE A CB  1 
ATOM   1135 C CG1 . ILE A 1 156 ? -24.393 38.081 6.232   1.00 41.42  ? 156 ILE A CG1 1 
ATOM   1136 C CG2 . ILE A 1 156 ? -26.015 36.651 4.902   1.00 43.42  ? 156 ILE A CG2 1 
ATOM   1137 C CD1 . ILE A 1 156 ? -24.301 37.334 7.533   1.00 37.83  ? 156 ILE A CD1 1 
ATOM   1138 N N   . ILE A 1 157 ? -27.063 38.849 2.350   1.00 47.67  ? 157 ILE A N   1 
ATOM   1139 C CA  . ILE A 1 157 ? -28.149 38.661 1.388   1.00 48.91  ? 157 ILE A CA  1 
ATOM   1140 C C   . ILE A 1 157 ? -28.256 37.148 1.139   1.00 54.11  ? 157 ILE A C   1 
ATOM   1141 O O   . ILE A 1 157 ? -27.315 36.539 0.620   1.00 53.01  ? 157 ILE A O   1 
ATOM   1142 C CB  . ILE A 1 157 ? -27.887 39.464 0.073   1.00 52.96  ? 157 ILE A CB  1 
ATOM   1143 C CG1 . ILE A 1 157 ? -27.493 40.943 0.362   1.00 53.06  ? 157 ILE A CG1 1 
ATOM   1144 C CG2 . ILE A 1 157 ? -29.085 39.372 -0.877  1.00 55.62  ? 157 ILE A CG2 1 
ATOM   1145 C CD1 . ILE A 1 157 ? -26.799 41.718 -0.813  1.00 51.33  ? 157 ILE A CD1 1 
ATOM   1146 N N   . ASN A 1 158 ? -29.377 36.537 1.553   1.00 52.83  ? 158 ASN A N   1 
ATOM   1147 C CA  . ASN A 1 158 ? -29.585 35.099 1.376   1.00 53.14  ? 158 ASN A CA  1 
ATOM   1148 C C   . ASN A 1 158 ? -29.941 34.709 -0.078  1.00 60.91  ? 158 ASN A C   1 
ATOM   1149 O O   . ASN A 1 158 ? -30.822 35.315 -0.687  1.00 62.19  ? 158 ASN A O   1 
ATOM   1150 C CB  . ASN A 1 158 ? -30.570 34.526 2.406   1.00 52.09  ? 158 ASN A CB  1 
ATOM   1151 C CG  . ASN A 1 158 ? -31.052 33.126 2.089   1.00 83.85  ? 158 ASN A CG  1 
ATOM   1152 O OD1 . ASN A 1 158 ? -30.271 32.168 1.992   1.00 71.58  ? 158 ASN A OD1 1 
ATOM   1153 N ND2 . ASN A 1 158 ? -32.354 32.991 1.862   1.00 84.43  ? 158 ASN A ND2 1 
ATOM   1154 N N   . VAL A 1 159 ? -29.235 33.700 -0.613  1.00 58.82  ? 159 VAL A N   1 
ATOM   1155 C CA  . VAL A 1 159 ? -29.435 33.166 -1.960  1.00 61.11  ? 159 VAL A CA  1 
ATOM   1156 C C   . VAL A 1 159 ? -30.171 31.834 -1.818  1.00 66.49  ? 159 VAL A C   1 
ATOM   1157 O O   . VAL A 1 159 ? -29.770 30.992 -0.999  1.00 66.21  ? 159 VAL A O   1 
ATOM   1158 C CB  . VAL A 1 159 ? -28.089 32.999 -2.725  1.00 65.30  ? 159 VAL A CB  1 
ATOM   1159 C CG1 . VAL A 1 159 ? -28.317 32.489 -4.147  1.00 67.00  ? 159 VAL A CG1 1 
ATOM   1160 C CG2 . VAL A 1 159 ? -27.296 34.303 -2.751  1.00 65.46  ? 159 VAL A CG2 1 
ATOM   1161 N N   . ALA A 1 160 ? -31.243 31.640 -2.603  1.00 63.40  ? 160 ALA A N   1 
ATOM   1162 C CA  . ALA A 1 160 ? -32.019 30.405 -2.554  1.00 62.85  ? 160 ALA A CA  1 
ATOM   1163 C C   . ALA A 1 160 ? -31.190 29.176 -2.946  1.00 64.70  ? 160 ALA A C   1 
ATOM   1164 O O   . ALA A 1 160 ? -30.306 29.262 -3.803  1.00 63.34  ? 160 ALA A O   1 
ATOM   1165 C CB  . ALA A 1 160 ? -33.251 30.518 -3.433  1.00 66.07  ? 160 ALA A CB  1 
ATOM   1166 N N   . SER A 1 161 ? -31.467 28.044 -2.277  1.00 60.84  ? 161 SER A N   1 
ATOM   1167 C CA  . SER A 1 161 ? -30.790 26.769 -2.504  1.00 60.02  ? 161 SER A CA  1 
ATOM   1168 C C   . SER A 1 161 ? -31.751 25.568 -2.481  1.00 64.85  ? 161 SER A C   1 
ATOM   1169 O O   . SER A 1 161 ? -32.875 25.674 -1.980  1.00 65.45  ? 161 SER A O   1 
ATOM   1170 C CB  . SER A 1 161 ? -29.651 26.579 -1.507  1.00 61.30  ? 161 SER A CB  1 
ATOM   1171 O OG  . SER A 1 161 ? -30.143 26.526 -0.181  1.00 71.33  ? 161 SER A OG  1 
ATOM   1172 N N   . ASP A 1 162 ? -31.301 24.434 -3.051  1.00 60.66  ? 162 ASP A N   1 
ATOM   1173 C CA  . ASP A 1 162 ? -32.038 23.172 -3.108  1.00 60.21  ? 162 ASP A CA  1 
ATOM   1174 C C   . ASP A 1 162 ? -31.064 21.980 -2.928  1.00 61.59  ? 162 ASP A C   1 
ATOM   1175 O O   . ASP A 1 162 ? -29.950 22.196 -2.447  1.00 59.43  ? 162 ASP A O   1 
ATOM   1176 C CB  . ASP A 1 162 ? -32.859 23.090 -4.408  1.00 64.18  ? 162 ASP A CB  1 
ATOM   1177 C CG  . ASP A 1 162 ? -32.065 23.047 -5.703  1.00 75.39  ? 162 ASP A CG  1 
ATOM   1178 O OD1 . ASP A 1 162 ? -30.854 23.359 -5.672  1.00 73.53  ? 162 ASP A OD1 1 
ATOM   1179 O OD2 . ASP A 1 162 ? -32.661 22.716 -6.751  1.00 85.35  ? 162 ASP A OD2 1 
ATOM   1180 N N   . GLU A 1 163 ? -31.474 20.743 -3.307  1.00 58.11  ? 163 GLU A N   1 
ATOM   1181 C CA  . GLU A 1 163 ? -30.678 19.500 -3.214  1.00 56.25  ? 163 GLU A CA  1 
ATOM   1182 C C   . GLU A 1 163 ? -29.320 19.593 -3.934  1.00 58.45  ? 163 GLU A C   1 
ATOM   1183 O O   . GLU A 1 163 ? -28.385 18.866 -3.579  1.00 57.17  ? 163 GLU A O   1 
ATOM   1184 C CB  . GLU A 1 163 ? -31.441 18.268 -3.760  1.00 58.84  ? 163 GLU A CB  1 
ATOM   1185 C CG  . GLU A 1 163 ? -32.957 18.375 -3.824  1.00 74.42  ? 163 GLU A CG  1 
ATOM   1186 C CD  . GLU A 1 163 ? -33.550 19.041 -5.052  1.00 103.78 ? 163 GLU A CD  1 
ATOM   1187 O OE1 . GLU A 1 163 ? -34.352 19.986 -4.876  1.00 107.07 ? 163 GLU A OE1 1 
ATOM   1188 O OE2 . GLU A 1 163 ? -33.240 18.604 -6.184  1.00 99.42  ? 163 GLU A OE2 1 
ATOM   1189 N N   . SER A 1 164 ? -29.222 20.460 -4.956  1.00 54.77  ? 164 SER A N   1 
ATOM   1190 C CA  . SER A 1 164 ? -28.006 20.649 -5.740  1.00 54.38  ? 164 SER A CA  1 
ATOM   1191 C C   . SER A 1 164 ? -27.271 21.956 -5.352  1.00 56.07  ? 164 SER A C   1 
ATOM   1192 O O   . SER A 1 164 ? -26.508 22.512 -6.149  1.00 54.50  ? 164 SER A O   1 
ATOM   1193 C CB  . SER A 1 164 ? -28.346 20.611 -7.226  1.00 61.57  ? 164 SER A CB  1 
ATOM   1194 O OG  . SER A 1 164 ? -29.174 19.499 -7.533  1.00 72.84  ? 164 SER A OG  1 
ATOM   1195 N N   . GLY A 1 165 ? -27.497 22.399 -4.109  1.00 52.07  ? 165 GLY A N   1 
ATOM   1196 C CA  . GLY A 1 165 ? -26.927 23.612 -3.532  1.00 50.96  ? 165 GLY A CA  1 
ATOM   1197 C C   . GLY A 1 165 ? -27.519 24.909 -4.065  1.00 55.66  ? 165 GLY A C   1 
ATOM   1198 O O   . GLY A 1 165 ? -28.702 24.963 -4.420  1.00 57.39  ? 165 GLY A O   1 
ATOM   1199 N N   . ILE A 1 166 ? -26.682 25.970 -4.122  1.00 49.83  ? 166 ILE A N   1 
ATOM   1200 C CA  . ILE A 1 166 ? -27.023 27.300 -4.618  1.00 50.25  ? 166 ILE A CA  1 
ATOM   1201 C C   . ILE A 1 166 ? -27.733 27.192 -5.965  1.00 57.27  ? 166 ILE A C   1 
ATOM   1202 O O   . ILE A 1 166 ? -27.302 26.414 -6.825  1.00 58.22  ? 166 ILE A O   1 
ATOM   1203 C CB  . ILE A 1 166 ? -25.744 28.200 -4.677  1.00 52.27  ? 166 ILE A CB  1 
ATOM   1204 C CG1 . ILE A 1 166 ? -25.419 28.774 -3.286  1.00 50.17  ? 166 ILE A CG1 1 
ATOM   1205 C CG2 . ILE A 1 166 ? -25.849 29.333 -5.737  1.00 55.09  ? 166 ILE A CG2 1 
ATOM   1206 C CD1 . ILE A 1 166 ? -24.040 29.348 -3.132  1.00 51.37  ? 166 ILE A CD1 1 
ATOM   1207 N N   . VAL A 1 167 ? -28.832 27.947 -6.123  1.00 54.81  ? 167 VAL A N   1 
ATOM   1208 C CA  . VAL A 1 167 ? -29.607 27.991 -7.359  1.00 57.05  ? 167 VAL A CA  1 
ATOM   1209 C C   . VAL A 1 167 ? -29.098 29.202 -8.149  1.00 62.46  ? 167 VAL A C   1 
ATOM   1210 O O   . VAL A 1 167 ? -29.243 30.330 -7.671  1.00 61.88  ? 167 VAL A O   1 
ATOM   1211 C CB  . VAL A 1 167 ? -31.140 28.048 -7.095  1.00 62.16  ? 167 VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 167 ? -31.930 28.080 -8.399  1.00 64.55  ? 167 VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 167 ? -31.594 26.880 -6.228  1.00 60.79  ? 167 VAL A CG2 1 
ATOM   1214 N N   . PRO A 1 168 ? -28.486 28.993 -9.344  1.00 61.47  ? 168 PRO A N   1 
ATOM   1215 C CA  . PRO A 1 168 ? -27.947 30.135 -10.116 1.00 62.56  ? 168 PRO A CA  1 
ATOM   1216 C C   . PRO A 1 168 ? -28.938 31.228 -10.512 1.00 68.82  ? 168 PRO A C   1 
ATOM   1217 O O   . PRO A 1 168 ? -28.539 32.391 -10.574 1.00 68.73  ? 168 PRO A O   1 
ATOM   1218 C CB  . PRO A 1 168 ? -27.291 29.473 -11.335 1.00 65.41  ? 168 PRO A CB  1 
ATOM   1219 C CG  . PRO A 1 168 ? -27.031 28.061 -10.909 1.00 68.92  ? 168 PRO A CG  1 
ATOM   1220 C CD  . PRO A 1 168 ? -28.193 27.712 -10.020 1.00 63.78  ? 168 PRO A CD  1 
ATOM   1221 N N   . ASP A 1 169 ? -30.216 30.875 -10.765 1.00 67.28  ? 169 ASP A N   1 
ATOM   1222 C CA  . ASP A 1 169 ? -31.241 31.857 -11.130 1.00 69.70  ? 169 ASP A CA  1 
ATOM   1223 C C   . ASP A 1 169 ? -31.605 32.804 -9.989  1.00 71.89  ? 169 ASP A C   1 
ATOM   1224 O O   . ASP A 1 169 ? -31.927 33.963 -10.247 1.00 72.28  ? 169 ASP A O   1 
ATOM   1225 C CB  . ASP A 1 169 ? -32.473 31.189 -11.743 1.00 74.44  ? 169 ASP A CB  1 
ATOM   1226 C CG  . ASP A 1 169 ? -32.273 30.819 -13.202 1.00 96.20  ? 169 ASP A CG  1 
ATOM   1227 O OD1 . ASP A 1 169 ? -32.356 31.726 -14.063 1.00 101.07 ? 169 ASP A OD1 1 
ATOM   1228 O OD2 . ASP A 1 169 ? -32.016 29.629 -13.482 1.00 103.86 ? 169 ASP A OD2 1 
ATOM   1229 N N   . SER A 1 170 ? -31.516 32.325 -8.727  1.00 66.71  ? 170 SER A N   1 
ATOM   1230 C CA  . SER A 1 170 ? -31.761 33.141 -7.529  1.00 65.38  ? 170 SER A CA  1 
ATOM   1231 C C   . SER A 1 170 ? -30.681 34.224 -7.447  1.00 67.20  ? 170 SER A C   1 
ATOM   1232 O O   . SER A 1 170 ? -30.999 35.397 -7.254  1.00 66.98  ? 170 SER A O   1 
ATOM   1233 C CB  . SER A 1 170 ? -31.724 32.277 -6.274  1.00 67.03  ? 170 SER A CB  1 
ATOM   1234 O OG  . SER A 1 170 ? -31.934 33.056 -5.107  1.00 78.06  ? 170 SER A OG  1 
ATOM   1235 N N   . LEU A 1 171 ? -29.406 33.812 -7.643  1.00 61.75  ? 171 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 171 ? -28.219 34.664 -7.655  1.00 60.59  ? 171 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 171 ? -28.327 35.692 -8.782  1.00 66.95  ? 171 LEU A C   1 
ATOM   1238 O O   . LEU A 1 171 ? -27.984 36.851 -8.568  1.00 66.38  ? 171 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 171 ? -26.959 33.785 -7.807  1.00 58.82  ? 171 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 171 ? -25.585 34.467 -7.894  1.00 62.10  ? 171 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 171 ? -25.211 35.141 -6.583  1.00 60.61  ? 171 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 171 ? -24.512 33.466 -8.276  1.00 61.77  ? 171 LEU A CD2 1 
ATOM   1243 N N   . ARG A 1 172 ? -28.860 35.278 -9.953  1.00 65.86  ? 172 ARG A N   1 
ATOM   1244 C CA  . ARG A 1 172 ? -29.075 36.150 -11.111 1.00 68.27  ? 172 ARG A CA  1 
ATOM   1245 C C   . ARG A 1 172 ? -30.093 37.248 -10.753 1.00 74.05  ? 172 ARG A C   1 
ATOM   1246 O O   . ARG A 1 172 ? -29.820 38.430 -10.965 1.00 74.27  ? 172 ARG A O   1 
ATOM   1247 C CB  . ARG A 1 172 ? -29.545 35.319 -12.319 1.00 68.79  ? 172 ARG A CB  1 
ATOM   1248 C CG  . ARG A 1 172 ? -29.261 35.958 -13.673 1.00 78.42  ? 172 ARG A CG  1 
ATOM   1249 C CD  . ARG A 1 172 ? -29.394 34.970 -14.823 1.00 92.40  ? 172 ARG A CD  1 
ATOM   1250 N NE  . ARG A 1 172 ? -28.299 33.994 -14.865 1.00 103.92 ? 172 ARG A NE  1 
ATOM   1251 C CZ  . ARG A 1 172 ? -28.460 32.672 -14.836 1.00 118.26 ? 172 ARG A CZ  1 
ATOM   1252 N NH1 . ARG A 1 172 ? -29.679 32.146 -14.772 1.00 106.91 ? 172 ARG A NH1 1 
ATOM   1253 N NH2 . ARG A 1 172 ? -27.407 31.867 -14.878 1.00 101.03 ? 172 ARG A NH2 1 
ATOM   1254 N N   . ASP A 1 173 ? -31.230 36.848 -10.160 1.00 72.08  ? 173 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 173 ? -32.322 37.725 -9.735  1.00 73.96  ? 173 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 173 ? -31.836 38.738 -8.695  1.00 74.03  ? 173 ASP A C   1 
ATOM   1257 O O   . ASP A 1 173 ? -32.166 39.921 -8.802  1.00 74.85  ? 173 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 173 ? -33.506 36.884 -9.201  1.00 76.96  ? 173 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 173 ? -34.740 37.686 -8.811  1.00 97.84  ? 173 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 173 ? -35.660 37.812 -9.654  1.00 102.23 ? 173 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 173 ? -34.804 38.152 -7.649  1.00 105.18 ? 173 ASP A OD2 1 
ATOM   1262 N N   . ILE A 1 174 ? -31.035 38.281 -7.715  1.00 66.36  ? 174 ILE A N   1 
ATOM   1263 C CA  . ILE A 1 174 ? -30.482 39.142 -6.665  1.00 64.09  ? 174 ILE A CA  1 
ATOM   1264 C C   . ILE A 1 174 ? -29.550 40.201 -7.283  1.00 67.57  ? 174 ILE A C   1 
ATOM   1265 O O   . ILE A 1 174 ? -29.804 41.393 -7.116  1.00 69.15  ? 174 ILE A O   1 
ATOM   1266 C CB  . ILE A 1 174 ? -29.802 38.299 -5.542  1.00 63.94  ? 174 ILE A CB  1 
ATOM   1267 C CG1 . ILE A 1 174 ? -30.856 37.569 -4.682  1.00 63.52  ? 174 ILE A CG1 1 
ATOM   1268 C CG2 . ILE A 1 174 ? -28.876 39.160 -4.663  1.00 63.14  ? 174 ILE A CG2 1 
ATOM   1269 C CD1 . ILE A 1 174 ? -30.383 36.247 -4.025  1.00 68.18  ? 174 ILE A CD1 1 
ATOM   1270 N N   . LEU A 1 175 ? -28.523 39.756 -8.040  1.00 62.08  ? 175 LEU A N   1 
ATOM   1271 C CA  . LEU A 1 175 ? -27.517 40.596 -8.695  1.00 62.36  ? 175 LEU A CA  1 
ATOM   1272 C C   . LEU A 1 175 ? -28.071 41.670 -9.623  1.00 69.73  ? 175 LEU A C   1 
ATOM   1273 O O   . LEU A 1 175 ? -27.407 42.688 -9.822  1.00 68.93  ? 175 LEU A O   1 
ATOM   1274 C CB  . LEU A 1 175 ? -26.480 39.736 -9.445  1.00 61.63  ? 175 LEU A CB  1 
ATOM   1275 C CG  . LEU A 1 175 ? -25.432 38.993 -8.602  1.00 62.34  ? 175 LEU A CG  1 
ATOM   1276 C CD1 . LEU A 1 175 ? -24.731 37.934 -9.430  1.00 61.91  ? 175 LEU A CD1 1 
ATOM   1277 C CD2 . LEU A 1 175 ? -24.425 39.951 -7.987  1.00 61.75  ? 175 LEU A CD2 1 
ATOM   1278 N N   . SER A 1 176 ? -29.288 41.461 -10.166 1.00 70.38  ? 176 SER A N   1 
ATOM   1279 C CA  . SER A 1 176 ? -29.951 42.391 -11.086 1.00 74.38  ? 176 SER A CA  1 
ATOM   1280 C C   . SER A 1 176 ? -30.232 43.783 -10.488 1.00 81.61  ? 176 SER A C   1 
ATOM   1281 O O   . SER A 1 176 ? -30.475 44.727 -11.252 1.00 82.88  ? 176 SER A O   1 
ATOM   1282 C CB  . SER A 1 176 ? -31.214 41.767 -11.681 1.00 79.18  ? 176 SER A CB  1 
ATOM   1283 O OG  . SER A 1 176 ? -32.386 42.032 -10.928 1.00 87.61  ? 176 SER A OG  1 
ATOM   1284 N N   . ARG A 1 177 ? -30.167 43.918 -9.130  1.00 78.27  ? 177 ARG A N   1 
ATOM   1285 C CA  . ARG A 1 177 ? -30.404 45.202 -8.461  1.00 79.68  ? 177 ARG A CA  1 
ATOM   1286 C C   . ARG A 1 177 ? -29.327 46.271 -8.762  1.00 86.24  ? 177 ARG A C   1 
ATOM   1287 O O   . ARG A 1 177 ? -29.572 47.466 -8.576  1.00 86.76  ? 177 ARG A O   1 
ATOM   1288 C CB  . ARG A 1 177 ? -30.769 45.042 -6.972  1.00 77.38  ? 177 ARG A CB  1 
ATOM   1289 C CG  . ARG A 1 177 ? -29.604 44.920 -6.021  1.00 86.82  ? 177 ARG A CG  1 
ATOM   1290 C CD  . ARG A 1 177 ? -30.051 44.813 -4.573  1.00 96.17  ? 177 ARG A CD  1 
ATOM   1291 N NE  . ARG A 1 177 ? -30.570 43.484 -4.219  1.00 99.06  ? 177 ARG A NE  1 
ATOM   1292 C CZ  . ARG A 1 177 ? -30.760 43.055 -2.972  1.00 106.47 ? 177 ARG A CZ  1 
ATOM   1293 N NH1 . ARG A 1 177 ? -30.459 43.834 -1.941  1.00 88.45  ? 177 ARG A NH1 1 
ATOM   1294 N NH2 . ARG A 1 177 ? -31.242 41.840 -2.747  1.00 92.86  ? 177 ARG A NH2 1 
ATOM   1295 N N   . TRP A 1 178 ? -28.167 45.819 -9.292  1.00 83.65  ? 178 TRP A N   1 
ATOM   1296 C CA  . TRP A 1 178 ? -27.029 46.620 -9.750  1.00 84.56  ? 178 TRP A CA  1 
ATOM   1297 C C   . TRP A 1 178 ? -26.789 46.308 -11.241 1.00 90.17  ? 178 TRP A C   1 
ATOM   1298 O O   . TRP A 1 178 ? -27.396 45.380 -11.790 1.00 90.20  ? 178 TRP A O   1 
ATOM   1299 C CB  . TRP A 1 178 ? -25.750 46.251 -8.974  1.00 81.17  ? 178 TRP A CB  1 
ATOM   1300 C CG  . TRP A 1 178 ? -25.835 46.362 -7.481  1.00 80.64  ? 178 TRP A CG  1 
ATOM   1301 C CD1 . TRP A 1 178 ? -25.601 47.474 -6.726  1.00 83.48  ? 178 TRP A CD1 1 
ATOM   1302 C CD2 . TRP A 1 178 ? -26.059 45.288 -6.558  1.00 78.46  ? 178 TRP A CD2 1 
ATOM   1303 N NE1 . TRP A 1 178 ? -25.725 47.173 -5.390  1.00 80.87  ? 178 TRP A NE1 1 
ATOM   1304 C CE2 . TRP A 1 178 ? -26.005 45.836 -5.257  1.00 81.08  ? 178 TRP A CE2 1 
ATOM   1305 C CE3 . TRP A 1 178 ? -26.327 43.912 -6.706  1.00 79.03  ? 178 TRP A CE3 1 
ATOM   1306 C CZ2 . TRP A 1 178 ? -26.221 45.063 -4.110  1.00 78.47  ? 178 TRP A CZ2 1 
ATOM   1307 C CZ3 . TRP A 1 178 ? -26.551 43.149 -5.570  1.00 78.72  ? 178 TRP A CZ3 1 
ATOM   1308 C CH2 . TRP A 1 178 ? -26.494 43.722 -4.290  1.00 78.22  ? 178 TRP A CH2 1 
ATOM   1309 N N   . LYS A 1 179 ? -25.884 47.074 -11.878 1.00 88.16  ? 179 LYS A N   1 
ATOM   1310 C CA  . LYS A 1 179 ? -25.460 46.908 -13.275 1.00 89.77  ? 179 LYS A CA  1 
ATOM   1311 C C   . LYS A 1 179 ? -23.994 46.433 -13.257 1.00 91.55  ? 179 LYS A C   1 
ATOM   1312 O O   . LYS A 1 179 ? -23.255 46.881 -12.376 1.00 88.75  ? 179 LYS A O   1 
ATOM   1313 C CB  . LYS A 1 179 ? -25.553 48.250 -14.054 1.00 94.89  ? 179 LYS A CB  1 
ATOM   1314 C CG  . LYS A 1 179 ? -26.944 48.889 -14.120 1.00 106.35 ? 179 LYS A CG  1 
ATOM   1315 C CD  . LYS A 1 179 ? -27.812 48.282 -15.217 1.00 118.40 ? 179 LYS A CD  1 
ATOM   1316 C CE  . LYS A 1 179 ? -29.242 48.757 -15.161 1.00 127.07 ? 179 LYS A CE  1 
ATOM   1317 N NZ  . LYS A 1 179 ? -30.107 47.992 -16.097 1.00 132.25 ? 179 LYS A NZ  1 
ATOM   1318 N N   . PRO A 1 180 ? -23.519 45.582 -14.209 1.00 88.56  ? 180 PRO A N   1 
ATOM   1319 C CA  . PRO A 1 180 ? -22.096 45.170 -14.186 1.00 87.04  ? 180 PRO A CA  1 
ATOM   1320 C C   . PRO A 1 180 ? -21.084 46.320 -14.042 1.00 93.39  ? 180 PRO A C   1 
ATOM   1321 O O   . PRO A 1 180 ? -20.071 46.157 -13.362 1.00 90.97  ? 180 PRO A O   1 
ATOM   1322 C CB  . PRO A 1 180 ? -21.926 44.414 -15.506 1.00 89.88  ? 180 PRO A CB  1 
ATOM   1323 C CG  . PRO A 1 180 ? -23.279 43.890 -15.803 1.00 95.03  ? 180 PRO A CG  1 
ATOM   1324 C CD  . PRO A 1 180 ? -24.238 44.944 -15.332 1.00 91.63  ? 180 PRO A CD  1 
ATOM   1325 N N   . GLU A 1 181 ? -21.388 47.494 -14.637 1.00 94.24  ? 181 GLU A N   1 
ATOM   1326 C CA  . GLU A 1 181 ? -20.562 48.708 -14.576 1.00 95.04  ? 181 GLU A CA  1 
ATOM   1327 C C   . GLU A 1 181 ? -20.405 49.274 -13.149 1.00 97.61  ? 181 GLU A C   1 
ATOM   1328 O O   . GLU A 1 181 ? -19.393 49.919 -12.864 1.00 97.18  ? 181 GLU A O   1 
ATOM   1329 C CB  . GLU A 1 181 ? -21.074 49.795 -15.551 1.00 99.92  ? 181 GLU A CB  1 
ATOM   1330 C CG  . GLU A 1 181 ? -22.548 50.149 -15.406 1.00 113.98 ? 181 GLU A CG  1 
ATOM   1331 C CD  . GLU A 1 181 ? -22.936 51.528 -15.904 1.00 144.43 ? 181 GLU A CD  1 
ATOM   1332 O OE1 . GLU A 1 181 ? -23.186 52.413 -15.054 1.00 147.42 ? 181 GLU A OE1 1 
ATOM   1333 O OE2 . GLU A 1 181 ? -23.009 51.723 -17.139 1.00 140.62 ? 181 GLU A OE2 1 
ATOM   1334 N N   . ASP A 1 182 ? -21.394 49.020 -12.263 1.00 93.12  ? 182 ASP A N   1 
ATOM   1335 C CA  . ASP A 1 182 ? -21.400 49.494 -10.876 1.00 91.22  ? 182 ASP A CA  1 
ATOM   1336 C C   . ASP A 1 182 ? -20.233 48.992 -10.027 1.00 91.30  ? 182 ASP A C   1 
ATOM   1337 O O   . ASP A 1 182 ? -19.836 49.700 -9.108  1.00 89.69  ? 182 ASP A O   1 
ATOM   1338 C CB  . ASP A 1 182 ? -22.739 49.185 -10.179 1.00 93.17  ? 182 ASP A CB  1 
ATOM   1339 C CG  . ASP A 1 182 ? -23.965 49.846 -10.775 1.00 110.03 ? 182 ASP A CG  1 
ATOM   1340 O OD1 . ASP A 1 182 ? -23.816 50.596 -11.766 1.00 114.80 ? 182 ASP A OD1 1 
ATOM   1341 O OD2 . ASP A 1 182 ? -25.076 49.620 -10.246 1.00 115.73 ? 182 ASP A OD2 1 
ATOM   1342 N N   . ALA A 1 183 ? -19.684 47.788 -10.323 1.00 86.53  ? 183 ALA A N   1 
ATOM   1343 C CA  . ALA A 1 183 ? -18.552 47.200 -9.583  1.00 83.73  ? 183 ALA A CA  1 
ATOM   1344 C C   . ALA A 1 183 ? -17.338 48.122 -9.595  1.00 87.64  ? 183 ALA A C   1 
ATOM   1345 O O   . ALA A 1 183 ? -16.622 48.204 -8.601  1.00 85.20  ? 183 ALA A O   1 
ATOM   1346 C CB  . ALA A 1 183 ? -18.181 45.847 -10.168 1.00 83.70  ? 183 ALA A CB  1 
ATOM   1347 N N   . LYS A 1 184 ? -17.153 48.852 -10.709 1.00 86.85  ? 184 LYS A N   1 
ATOM   1348 C CA  . LYS A 1 184 ? -16.088 49.828 -10.942 1.00 87.58  ? 184 LYS A CA  1 
ATOM   1349 C C   . LYS A 1 184 ? -16.320 51.136 -10.149 1.00 92.87  ? 184 LYS A C   1 
ATOM   1350 O O   . LYS A 1 184 ? -15.365 51.884 -9.921  1.00 92.36  ? 184 LYS A O   1 
ATOM   1351 C CB  . LYS A 1 184 ? -15.951 50.114 -12.450 1.00 92.79  ? 184 LYS A CB  1 
ATOM   1352 C CG  . LYS A 1 184 ? -15.677 48.869 -13.297 1.00 107.75 ? 184 LYS A CG  1 
ATOM   1353 C CD  . LYS A 1 184 ? -15.787 49.161 -14.789 1.00 123.64 ? 184 LYS A CD  1 
ATOM   1354 C CE  . LYS A 1 184 ? -15.757 47.908 -15.636 1.00 134.15 ? 184 LYS A CE  1 
ATOM   1355 N NZ  . LYS A 1 184 ? -17.070 47.206 -15.650 1.00 139.89 ? 184 LYS A NZ  1 
ATOM   1356 N N   . ASN A 1 185 ? -17.581 51.412 -9.742  1.00 91.04  ? 185 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 185 ? -17.952 52.598 -8.961  1.00 92.03  ? 185 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 185 ? -18.023 52.239 -7.460  1.00 94.56  ? 185 ASN A C   1 
ATOM   1359 O O   . ASN A 1 185 ? -18.944 51.528 -7.045  1.00 93.79  ? 185 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 185 ? -19.277 53.206 -9.462  1.00 97.04  ? 185 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 185 ? -19.699 54.506 -8.791  1.00 122.35 ? 185 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 185 ? -19.013 55.067 -7.921  1.00 116.80 ? 185 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 185 ? -20.846 55.027 -9.203  1.00 114.21 ? 185 ASN A ND2 1 
ATOM   1364 N N   . PRO A 1 186 ? -17.060 52.727 -6.637  1.00 90.27  ? 186 PRO A N   1 
ATOM   1365 C CA  . PRO A 1 186 ? -17.049 52.358 -5.205  1.00 87.58  ? 186 PRO A CA  1 
ATOM   1366 C C   . PRO A 1 186 ? -18.325 52.639 -4.406  1.00 91.03  ? 186 PRO A C   1 
ATOM   1367 O O   . PRO A 1 186 ? -18.758 51.779 -3.632  1.00 88.35  ? 186 PRO A O   1 
ATOM   1368 C CB  . PRO A 1 186 ? -15.827 53.098 -4.647  1.00 88.70  ? 186 PRO A CB  1 
ATOM   1369 C CG  . PRO A 1 186 ? -15.471 54.127 -5.681  1.00 95.59  ? 186 PRO A CG  1 
ATOM   1370 C CD  . PRO A 1 186 ? -15.888 53.556 -6.988  1.00 92.63  ? 186 PRO A CD  1 
ATOM   1371 N N   . GLN A 1 187 ? -18.948 53.814 -4.622  1.00 89.74  ? 187 GLN A N   1 
ATOM   1372 C CA  . GLN A 1 187 ? -20.170 54.209 -3.913  1.00 89.73  ? 187 GLN A CA  1 
ATOM   1373 C C   . GLN A 1 187 ? -21.470 53.470 -4.290  1.00 92.72  ? 187 GLN A C   1 
ATOM   1374 O O   . GLN A 1 187 ? -22.491 53.701 -3.638  1.00 93.20  ? 187 GLN A O   1 
ATOM   1375 C CB  . GLN A 1 187 ? -20.349 55.736 -3.862  1.00 93.24  ? 187 GLN A CB  1 
ATOM   1376 C CG  . GLN A 1 187 ? -20.434 56.412 -5.219  1.00 116.36 ? 187 GLN A CG  1 
ATOM   1377 C CD  . GLN A 1 187 ? -19.309 57.398 -5.392  1.00 138.38 ? 187 GLN A CD  1 
ATOM   1378 O OE1 . GLN A 1 187 ? -18.169 57.033 -5.696  1.00 132.77 ? 187 GLN A OE1 1 
ATOM   1379 N NE2 . GLN A 1 187 ? -19.599 58.674 -5.188  1.00 133.19 ? 187 GLN A NE2 1 
ATOM   1380 N N   . LYS A 1 188 ? -21.440 52.574 -5.303  1.00 87.44  ? 188 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 188 ? -22.634 51.807 -5.694  1.00 87.04  ? 188 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 188 ? -22.926 50.636 -4.743  1.00 86.45  ? 188 LYS A C   1 
ATOM   1383 O O   . LYS A 1 188 ? -24.074 50.170 -4.676  1.00 86.43  ? 188 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 188 ? -22.566 51.346 -7.157  1.00 90.85  ? 188 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 188 ? -22.860 52.449 -8.175  1.00 107.58 ? 188 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 188 ? -24.355 52.633 -8.455  1.00 118.30 ? 188 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 188 ? -24.589 53.597 -9.591  1.00 131.83 ? 188 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 188 ? -26.019 53.641 -9.998  1.00 141.84 ? 188 LYS A NZ  1 
ATOM   1389 N N   . ASN A 1 189 ? -21.879 50.180 -3.998  1.00 78.53  ? 189 ASN A N   1 
ATOM   1390 C CA  . ASN A 1 189 ? -21.897 49.121 -2.973  1.00 74.46  ? 189 ASN A CA  1 
ATOM   1391 C C   . ASN A 1 189 ? -22.320 47.709 -3.436  1.00 73.30  ? 189 ASN A C   1 
ATOM   1392 O O   . ASN A 1 189 ? -23.158 47.066 -2.803  1.00 69.55  ? 189 ASN A O   1 
ATOM   1393 C CB  . ASN A 1 189 ? -22.638 49.598 -1.705  1.00 76.86  ? 189 ASN A CB  1 
ATOM   1394 C CG  . ASN A 1 189 ? -22.113 49.038 -0.414  1.00 104.03 ? 189 ASN A CG  1 
ATOM   1395 O OD1 . ASN A 1 189 ? -22.851 48.418 0.360   1.00 98.20  ? 189 ASN A OD1 1 
ATOM   1396 N ND2 . ASN A 1 189 ? -20.841 49.288 -0.123  1.00 96.62  ? 189 ASN A ND2 1 
ATOM   1397 N N   . THR A 1 190 ? -21.697 47.224 -4.530  1.00 70.45  ? 190 THR A N   1 
ATOM   1398 C CA  . THR A 1 190 ? -21.933 45.889 -5.109  1.00 69.80  ? 190 THR A CA  1 
ATOM   1399 C C   . THR A 1 190 ? -21.346 44.797 -4.199  1.00 70.26  ? 190 THR A C   1 
ATOM   1400 O O   . THR A 1 190 ? -20.417 45.107 -3.447  1.00 68.54  ? 190 THR A O   1 
ATOM   1401 C CB  . THR A 1 190 ? -21.329 45.786 -6.525  1.00 81.14  ? 190 THR A CB  1 
ATOM   1402 O OG1 . THR A 1 190 ? -19.954 46.162 -6.499  1.00 82.91  ? 190 THR A OG1 1 
ATOM   1403 C CG2 . THR A 1 190 ? -22.089 46.601 -7.550  1.00 82.46  ? 190 THR A CG2 1 
ATOM   1404 N N   . PRO A 1 191 ? -21.827 43.521 -4.249  1.00 65.35  ? 191 PRO A N   1 
ATOM   1405 C CA  . PRO A 1 191 ? -21.272 42.490 -3.348  1.00 62.11  ? 191 PRO A CA  1 
ATOM   1406 C C   . PRO A 1 191 ? -19.771 42.242 -3.476  1.00 64.06  ? 191 PRO A C   1 
ATOM   1407 O O   . PRO A 1 191 ? -19.218 42.190 -4.581  1.00 65.29  ? 191 PRO A O   1 
ATOM   1408 C CB  . PRO A 1 191 ? -22.098 41.242 -3.665  1.00 63.63  ? 191 PRO A CB  1 
ATOM   1409 C CG  . PRO A 1 191 ? -23.364 41.772 -4.222  1.00 70.74  ? 191 PRO A CG  1 
ATOM   1410 C CD  . PRO A 1 191 ? -22.940 42.965 -5.041  1.00 68.22  ? 191 PRO A CD  1 
ATOM   1411 N N   . LYS A 1 192 ? -19.106 42.146 -2.320  1.00 56.87  ? 192 LYS A N   1 
ATOM   1412 C CA  . LYS A 1 192 ? -17.665 41.927 -2.250  1.00 54.30  ? 192 LYS A CA  1 
ATOM   1413 C C   . LYS A 1 192 ? -17.311 40.471 -2.572  1.00 56.13  ? 192 LYS A C   1 
ATOM   1414 O O   . LYS A 1 192 ? -16.340 40.223 -3.290  1.00 56.23  ? 192 LYS A O   1 
ATOM   1415 C CB  . LYS A 1 192 ? -17.124 42.352 -0.876  1.00 53.88  ? 192 LYS A CB  1 
ATOM   1416 C CG  . LYS A 1 192 ? -17.221 43.855 -0.587  1.00 52.16  ? 192 LYS A CG  1 
ATOM   1417 C CD  . LYS A 1 192 ? -16.081 44.668 -1.224  1.00 54.07  ? 192 LYS A CD  1 
ATOM   1418 C CE  . LYS A 1 192 ? -15.826 45.970 -0.506  1.00 63.83  ? 192 LYS A CE  1 
ATOM   1419 N NZ  . LYS A 1 192 ? -15.052 45.766 0.752   1.00 74.91  ? 192 LYS A NZ  1 
ATOM   1420 N N   . PHE A 1 193 ? -18.107 39.513 -2.061  1.00 50.00  ? 193 PHE A N   1 
ATOM   1421 C CA  . PHE A 1 193 ? -17.880 38.091 -2.294  1.00 48.06  ? 193 PHE A CA  1 
ATOM   1422 C C   . PHE A 1 193 ? -19.134 37.265 -2.132  1.00 50.86  ? 193 PHE A C   1 
ATOM   1423 O O   . PHE A 1 193 ? -20.141 37.744 -1.601  1.00 50.26  ? 193 PHE A O   1 
ATOM   1424 C CB  . PHE A 1 193 ? -16.792 37.539 -1.346  1.00 47.73  ? 193 PHE A CB  1 
ATOM   1425 C CG  . PHE A 1 193 ? -17.137 37.500 0.130   1.00 48.07  ? 193 PHE A CG  1 
ATOM   1426 C CD1 . PHE A 1 193 ? -16.626 38.454 1.005   1.00 50.97  ? 193 PHE A CD1 1 
ATOM   1427 C CD2 . PHE A 1 193 ? -17.926 36.477 0.654   1.00 49.10  ? 193 PHE A CD2 1 
ATOM   1428 C CE1 . PHE A 1 193 ? -16.910 38.396 2.374   1.00 50.17  ? 193 PHE A CE1 1 
ATOM   1429 C CE2 . PHE A 1 193 ? -18.219 36.426 2.019   1.00 50.66  ? 193 PHE A CE2 1 
ATOM   1430 C CZ  . PHE A 1 193 ? -17.700 37.379 2.872   1.00 48.34  ? 193 PHE A CZ  1 
ATOM   1431 N N   . LEU A 1 194 ? -19.023 35.984 -2.535  1.00 46.61  ? 194 LEU A N   1 
ATOM   1432 C CA  . LEU A 1 194 ? -20.019 34.941 -2.362  1.00 45.94  ? 194 LEU A CA  1 
ATOM   1433 C C   . LEU A 1 194 ? -19.298 33.843 -1.584  1.00 47.50  ? 194 LEU A C   1 
ATOM   1434 O O   . LEU A 1 194 ? -18.216 33.396 -1.996  1.00 46.71  ? 194 LEU A O   1 
ATOM   1435 C CB  . LEU A 1 194 ? -20.560 34.407 -3.697  1.00 47.71  ? 194 LEU A CB  1 
ATOM   1436 C CG  . LEU A 1 194 ? -21.495 33.193 -3.571  1.00 52.75  ? 194 LEU A CG  1 
ATOM   1437 C CD1 . LEU A 1 194 ? -22.858 33.475 -4.155  1.00 54.08  ? 194 LEU A CD1 1 
ATOM   1438 C CD2 . LEU A 1 194 ? -20.879 31.963 -4.208  1.00 56.93  ? 194 LEU A CD2 1 
ATOM   1439 N N   . TYR A 1 195 ? -19.869 33.461 -0.431  1.00 42.19  ? 195 TYR A N   1 
ATOM   1440 C CA  . TYR A 1 195 ? -19.329 32.415 0.430   1.00 39.89  ? 195 TYR A CA  1 
ATOM   1441 C C   . TYR A 1 195 ? -20.157 31.143 0.228   1.00 46.29  ? 195 TYR A C   1 
ATOM   1442 O O   . TYR A 1 195 ? -21.390 31.198 0.285   1.00 46.37  ? 195 TYR A O   1 
ATOM   1443 C CB  . TYR A 1 195 ? -19.345 32.852 1.915   1.00 38.50  ? 195 TYR A CB  1 
ATOM   1444 C CG  . TYR A 1 195 ? -19.088 31.708 2.877   1.00 36.76  ? 195 TYR A CG  1 
ATOM   1445 C CD1 . TYR A 1 195 ? -17.792 31.326 3.207   1.00 37.03  ? 195 TYR A CD1 1 
ATOM   1446 C CD2 . TYR A 1 195 ? -20.144 30.974 3.417   1.00 36.51  ? 195 TYR A CD2 1 
ATOM   1447 C CE1 . TYR A 1 195 ? -17.554 30.253 4.060   1.00 36.02  ? 195 TYR A CE1 1 
ATOM   1448 C CE2 . TYR A 1 195 ? -19.916 29.886 4.257   1.00 35.27  ? 195 TYR A CE2 1 
ATOM   1449 C CZ  . TYR A 1 195 ? -18.621 29.525 4.573   1.00 40.11  ? 195 TYR A CZ  1 
ATOM   1450 O OH  . TYR A 1 195 ? -18.412 28.465 5.426   1.00 38.51  ? 195 TYR A OH  1 
ATOM   1451 N N   . THR A 1 196 ? -19.480 29.996 0.039   1.00 43.79  ? 196 THR A N   1 
ATOM   1452 C CA  . THR A 1 196 ? -20.159 28.710 -0.149  1.00 44.00  ? 196 THR A CA  1 
ATOM   1453 C C   . THR A 1 196 ? -19.330 27.506 0.269   1.00 46.16  ? 196 THR A C   1 
ATOM   1454 O O   . THR A 1 196 ? -18.109 27.493 0.084   1.00 44.63  ? 196 THR A O   1 
ATOM   1455 C CB  . THR A 1 196 ? -20.740 28.564 -1.583  1.00 54.00  ? 196 THR A CB  1 
ATOM   1456 O OG1 . THR A 1 196 ? -21.586 27.410 -1.641  1.00 55.48  ? 196 THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 196 ? -19.668 28.526 -2.680  1.00 49.11  ? 196 THR A CG2 1 
ATOM   1458 N N   . VAL A 1 197 ? -20.020 26.494 0.830   1.00 42.77  ? 197 VAL A N   1 
ATOM   1459 C CA  . VAL A 1 197 ? -19.450 25.195 1.202   1.00 42.01  ? 197 VAL A CA  1 
ATOM   1460 C C   . VAL A 1 197 ? -19.938 24.313 0.053   1.00 46.57  ? 197 VAL A C   1 
ATOM   1461 O O   . VAL A 1 197 ? -21.129 23.981 0.028   1.00 46.42  ? 197 VAL A O   1 
ATOM   1462 C CB  . VAL A 1 197 ? -19.909 24.683 2.601   1.00 44.68  ? 197 VAL A CB  1 
ATOM   1463 C CG1 . VAL A 1 197 ? -19.373 23.277 2.872   1.00 43.25  ? 197 VAL A CG1 1 
ATOM   1464 C CG2 . VAL A 1 197 ? -19.484 25.650 3.709   1.00 43.49  ? 197 VAL A CG2 1 
ATOM   1465 N N   . PRO A 1 198 ? -19.095 24.050 -0.977  1.00 43.27  ? 198 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 198 ? -19.602 23.362 -2.180  1.00 44.73  ? 198 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 198 ? -19.989 21.904 -2.044  1.00 48.59  ? 198 PRO A C   1 
ATOM   1468 O O   . PRO A 1 198 ? -20.852 21.445 -2.789  1.00 50.17  ? 198 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 198 ? -18.498 23.577 -3.226  1.00 47.17  ? 198 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 198 ? -17.608 24.636 -2.645  1.00 50.67  ? 198 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 198 ? -17.689 24.452 -1.160  1.00 44.33  ? 198 PRO A CD  1 
ATOM   1472 N N   . ASN A 1 199 ? -19.354 21.180 -1.117  1.00 42.86  ? 199 ASN A N   1 
ATOM   1473 C CA  . ASN A 1 199 ? -19.597 19.761 -0.890  1.00 41.73  ? 199 ASN A CA  1 
ATOM   1474 C C   . ASN A 1 199 ? -20.119 19.529 0.507   1.00 44.43  ? 199 ASN A C   1 
ATOM   1475 O O   . ASN A 1 199 ? -19.450 19.858 1.498   1.00 42.01  ? 199 ASN A O   1 
ATOM   1476 C CB  . ASN A 1 199 ? -18.318 18.939 -1.122  1.00 39.67  ? 199 ASN A CB  1 
ATOM   1477 C CG  . ASN A 1 199 ? -17.782 19.014 -2.522  1.00 54.13  ? 199 ASN A CG  1 
ATOM   1478 O OD1 . ASN A 1 199 ? -18.333 18.423 -3.463  1.00 56.30  ? 199 ASN A OD1 1 
ATOM   1479 N ND2 . ASN A 1 199 ? -16.680 19.726 -2.683  1.00 35.89  ? 199 ASN A ND2 1 
ATOM   1480 N N   . GLY A 1 200 ? -21.308 18.940 0.557   1.00 43.18  ? 200 GLY A N   1 
ATOM   1481 C CA  . GLY A 1 200 ? -21.995 18.565 1.783   1.00 42.96  ? 200 GLY A CA  1 
ATOM   1482 C C   . GLY A 1 200 ? -22.100 19.695 2.779   1.00 47.02  ? 200 GLY A C   1 
ATOM   1483 O O   . GLY A 1 200 ? -21.582 19.590 3.894   1.00 46.16  ? 200 GLY A O   1 
ATOM   1484 N N   . ASN A 1 201 ? -22.758 20.785 2.367   1.00 43.79  ? 201 ASN A N   1 
ATOM   1485 C CA  . ASN A 1 201 ? -22.974 21.981 3.170   1.00 42.91  ? 201 ASN A CA  1 
ATOM   1486 C C   . ASN A 1 201 ? -23.435 21.674 4.606   1.00 45.78  ? 201 ASN A C   1 
ATOM   1487 O O   . ASN A 1 201 ? -24.311 20.824 4.817   1.00 46.44  ? 201 ASN A O   1 
ATOM   1488 C CB  . ASN A 1 201 ? -23.993 22.884 2.475   1.00 43.77  ? 201 ASN A CB  1 
ATOM   1489 C CG  . ASN A 1 201 ? -24.409 24.073 3.299   1.00 56.79  ? 201 ASN A CG  1 
ATOM   1490 O OD1 . ASN A 1 201 ? -23.618 24.991 3.551   1.00 57.04  ? 201 ASN A OD1 1 
ATOM   1491 N ND2 . ASN A 1 201 ? -25.647 24.053 3.773   1.00 39.67  ? 201 ASN A ND2 1 
ATOM   1492 N N   . ASN A 1 202 ? -22.833 22.368 5.587   1.00 39.74  ? 202 ASN A N   1 
ATOM   1493 C CA  . ASN A 1 202 ? -23.234 22.254 6.981   1.00 38.84  ? 202 ASN A CA  1 
ATOM   1494 C C   . ASN A 1 202 ? -24.371 23.284 7.135   1.00 44.78  ? 202 ASN A C   1 
ATOM   1495 O O   . ASN A 1 202 ? -24.129 24.468 6.847   1.00 45.81  ? 202 ASN A O   1 
ATOM   1496 C CB  . ASN A 1 202 ? -22.058 22.602 7.890   1.00 38.52  ? 202 ASN A CB  1 
ATOM   1497 C CG  . ASN A 1 202 ? -22.267 22.346 9.368   1.00 43.52  ? 202 ASN A CG  1 
ATOM   1498 O OD1 . ASN A 1 202 ? -23.394 22.195 9.861   1.00 29.47  ? 202 ASN A OD1 1 
ATOM   1499 N ND2 . ASN A 1 202 ? -21.167 22.317 10.113  1.00 30.29  ? 202 ASN A ND2 1 
ATOM   1500 N N   . PRO A 1 203 ? -25.639 22.892 7.432   1.00 40.10  ? 203 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 203 ? -26.155 21.577 7.872   1.00 39.14  ? 203 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 203 ? -26.868 20.640 6.867   1.00 40.40  ? 203 PRO A C   1 
ATOM   1503 O O   . PRO A 1 203 ? -27.264 19.537 7.258   1.00 38.40  ? 203 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 203 ? -27.184 21.996 8.927   1.00 41.39  ? 203 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 203 ? -27.815 23.231 8.318   1.00 47.01  ? 203 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 203 ? -26.685 23.929 7.567   1.00 42.38  ? 203 PRO A CD  1 
ATOM   1507 N N   . THR A 1 204 ? -27.110 21.089 5.626   1.00 36.87  ? 204 THR A N   1 
ATOM   1508 C CA  . THR A 1 204 ? -27.903 20.368 4.607   1.00 36.80  ? 204 THR A CA  1 
ATOM   1509 C C   . THR A 1 204 ? -27.357 19.033 4.075   1.00 39.32  ? 204 THR A C   1 
ATOM   1510 O O   . THR A 1 204 ? -28.131 18.109 3.787   1.00 38.57  ? 204 THR A O   1 
ATOM   1511 C CB  . THR A 1 204 ? -28.268 21.300 3.449   1.00 44.25  ? 204 THR A CB  1 
ATOM   1512 O OG1 . THR A 1 204 ? -27.092 21.596 2.687   1.00 46.87  ? 204 THR A OG1 1 
ATOM   1513 C CG2 . THR A 1 204 ? -28.905 22.576 3.917   1.00 42.82  ? 204 THR A CG2 1 
ATOM   1514 N N   . GLY A 1 205 ? -26.047 18.968 3.882   1.00 34.88  ? 205 GLY A N   1 
ATOM   1515 C CA  . GLY A 1 205 ? -25.400 17.808 3.289   1.00 34.48  ? 205 GLY A CA  1 
ATOM   1516 C C   . GLY A 1 205 ? -25.524 17.828 1.777   1.00 38.90  ? 205 GLY A C   1 
ATOM   1517 O O   . GLY A 1 205 ? -25.125 16.866 1.112   1.00 40.44  ? 205 GLY A O   1 
ATOM   1518 N N   . ASN A 1 206 ? -26.056 18.946 1.220   1.00 34.03  ? 206 ASN A N   1 
ATOM   1519 C CA  . ASN A 1 206 ? -26.251 19.125 -0.217  1.00 35.14  ? 206 ASN A CA  1 
ATOM   1520 C C   . ASN A 1 206 ? -24.981 19.640 -0.901  1.00 39.65  ? 206 ASN A C   1 
ATOM   1521 O O   . ASN A 1 206 ? -24.219 20.424 -0.301  1.00 37.13  ? 206 ASN A O   1 
ATOM   1522 C CB  . ASN A 1 206 ? -27.477 20.007 -0.515  1.00 34.58  ? 206 ASN A CB  1 
ATOM   1523 C CG  . ASN A 1 206 ? -28.803 19.428 -0.054  1.00 56.32  ? 206 ASN A CG  1 
ATOM   1524 O OD1 . ASN A 1 206 ? -29.700 20.150 0.394   1.00 55.47  ? 206 ASN A OD1 1 
ATOM   1525 N ND2 . ASN A 1 206 ? -28.970 18.116 -0.151  1.00 45.21  ? 206 ASN A ND2 1 
ATOM   1526 N N   . SER A 1 207 ? -24.754 19.182 -2.157  1.00 38.24  ? 207 SER A N   1 
ATOM   1527 C CA  . SER A 1 207 ? -23.572 19.526 -2.942  1.00 39.16  ? 207 SER A CA  1 
ATOM   1528 C C   . SER A 1 207 ? -23.870 20.143 -4.292  1.00 48.01  ? 207 SER A C   1 
ATOM   1529 O O   . SER A 1 207 ? -24.807 19.716 -4.973  1.00 51.14  ? 207 SER A O   1 
ATOM   1530 C CB  . SER A 1 207 ? -22.682 18.303 -3.131  1.00 41.88  ? 207 SER A CB  1 
ATOM   1531 O OG  . SER A 1 207 ? -22.180 17.840 -1.891  1.00 50.17  ? 207 SER A OG  1 
ATOM   1532 N N   . LEU A 1 208 ? -23.034 21.119 -4.699  1.00 44.50  ? 208 LEU A N   1 
ATOM   1533 C CA  . LEU A 1 208 ? -23.129 21.819 -5.982  1.00 46.20  ? 208 LEU A CA  1 
ATOM   1534 C C   . LEU A 1 208 ? -22.676 20.918 -7.129  1.00 53.48  ? 208 LEU A C   1 
ATOM   1535 O O   . LEU A 1 208 ? -21.809 20.058 -6.939  1.00 52.40  ? 208 LEU A O   1 
ATOM   1536 C CB  . LEU A 1 208 ? -22.265 23.102 -5.978  1.00 45.66  ? 208 LEU A CB  1 
ATOM   1537 C CG  . LEU A 1 208 ? -22.940 24.415 -5.577  1.00 50.09  ? 208 LEU A CG  1 
ATOM   1538 C CD1 . LEU A 1 208 ? -21.917 25.470 -5.278  1.00 49.51  ? 208 LEU A CD1 1 
ATOM   1539 C CD2 . LEU A 1 208 ? -23.874 24.908 -6.649  1.00 55.07  ? 208 LEU A CD2 1 
ATOM   1540 N N   . THR A 1 209 ? -23.240 21.148 -8.329  1.00 53.01  ? 209 THR A N   1 
ATOM   1541 C CA  . THR A 1 209 ? -22.912 20.401 -9.545  1.00 54.11  ? 209 THR A CA  1 
ATOM   1542 C C   . THR A 1 209 ? -21.912 21.190 -10.393 1.00 59.48  ? 209 THR A C   1 
ATOM   1543 O O   . THR A 1 209 ? -21.746 22.400 -10.178 1.00 58.98  ? 209 THR A O   1 
ATOM   1544 C CB  . THR A 1 209 ? -24.192 20.062 -10.316 1.00 62.22  ? 209 THR A CB  1 
ATOM   1545 O OG1 . THR A 1 209 ? -24.863 21.275 -10.656 1.00 64.70  ? 209 THR A OG1 1 
ATOM   1546 C CG2 . THR A 1 209 ? -25.130 19.161 -9.527  1.00 59.33  ? 209 THR A CG2 1 
ATOM   1547 N N   . SER A 1 210 ? -21.257 20.512 -11.367 1.00 57.29  ? 210 SER A N   1 
ATOM   1548 C CA  . SER A 1 210 ? -20.268 21.121 -12.277 1.00 58.08  ? 210 SER A CA  1 
ATOM   1549 C C   . SER A 1 210 ? -20.856 22.304 -13.045 1.00 62.55  ? 210 SER A C   1 
ATOM   1550 O O   . SER A 1 210 ? -20.252 23.374 -13.083 1.00 61.51  ? 210 SER A O   1 
ATOM   1551 C CB  . SER A 1 210 ? -19.725 20.087 -13.265 1.00 63.92  ? 210 SER A CB  1 
ATOM   1552 O OG  . SER A 1 210 ? -19.248 18.913 -12.625 1.00 75.71  ? 210 SER A OG  1 
ATOM   1553 N N   . GLU A 1 211 ? -22.053 22.094 -13.628 1.00 60.63  ? 211 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 211 ? -22.820 23.037 -14.445 1.00 62.30  ? 211 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 211 ? -23.182 24.292 -13.653 1.00 63.53  ? 211 GLU A C   1 
ATOM   1556 O O   . GLU A 1 211 ? -22.980 25.407 -14.151 1.00 63.93  ? 211 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 211 ? -24.076 22.362 -15.037 1.00 65.59  ? 211 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 211 ? -23.883 20.912 -15.483 1.00 82.58  ? 211 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 211 ? -23.916 19.867 -14.376 1.00 114.00 ? 211 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 211 ? -22.839 19.315 -14.053 1.00 108.80 ? 211 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 211 ? -25.008 19.623 -13.809 1.00 113.06 ? 211 GLU A OE2 1 
ATOM   1562 N N   . ARG A 1 212 ? -23.657 24.106 -12.405 1.00 57.00  ? 212 ARG A N   1 
ATOM   1563 C CA  . ARG A 1 212 ? -24.016 25.191 -11.486 1.00 55.74  ? 212 ARG A CA  1 
ATOM   1564 C C   . ARG A 1 212 ? -22.795 26.054 -11.120 1.00 56.38  ? 212 ARG A C   1 
ATOM   1565 O O   . ARG A 1 212 ? -22.881 27.285 -11.196 1.00 55.95  ? 212 ARG A O   1 
ATOM   1566 C CB  . ARG A 1 212 ? -24.710 24.649 -10.226 1.00 54.98  ? 212 ARG A CB  1 
ATOM   1567 C CG  . ARG A 1 212 ? -26.168 24.299 -10.457 1.00 60.38  ? 212 ARG A CG  1 
ATOM   1568 C CD  . ARG A 1 212 ? -26.916 24.145 -9.166  1.00 63.88  ? 212 ARG A CD  1 
ATOM   1569 N NE  . ARG A 1 212 ? -28.337 23.892 -9.405  1.00 71.14  ? 212 ARG A NE  1 
ATOM   1570 C CZ  . ARG A 1 212 ? -29.268 23.867 -8.455  1.00 80.16  ? 212 ARG A CZ  1 
ATOM   1571 N NH1 . ARG A 1 212 ? -28.942 24.101 -7.189  1.00 65.04  ? 212 ARG A NH1 1 
ATOM   1572 N NH2 . ARG A 1 212 ? -30.533 23.613 -8.765  1.00 60.75  ? 212 ARG A NH2 1 
ATOM   1573 N N   . LYS A 1 213 ? -21.652 25.410 -10.790 1.00 49.51  ? 213 LYS A N   1 
ATOM   1574 C CA  . LYS A 1 213 ? -20.392 26.093 -10.469 1.00 46.96  ? 213 LYS A CA  1 
ATOM   1575 C C   . LYS A 1 213 ? -19.940 26.978 -11.637 1.00 52.57  ? 213 LYS A C   1 
ATOM   1576 O O   . LYS A 1 213 ? -19.657 28.155 -11.419 1.00 52.03  ? 213 LYS A O   1 
ATOM   1577 C CB  . LYS A 1 213 ? -19.298 25.090 -10.075 1.00 46.62  ? 213 LYS A CB  1 
ATOM   1578 C CG  . LYS A 1 213 ? -19.472 24.495 -8.686  1.00 45.96  ? 213 LYS A CG  1 
ATOM   1579 C CD  . LYS A 1 213 ? -18.431 23.424 -8.401  1.00 45.52  ? 213 LYS A CD  1 
ATOM   1580 C CE  . LYS A 1 213 ? -18.545 22.863 -7.008  1.00 46.08  ? 213 LYS A CE  1 
ATOM   1581 N NZ  . LYS A 1 213 ? -17.625 21.717 -6.793  1.00 50.64  ? 213 LYS A NZ  1 
ATOM   1582 N N   . LYS A 1 214 ? -19.944 26.430 -12.878 1.00 52.08  ? 214 LYS A N   1 
ATOM   1583 C CA  . LYS A 1 214 ? -19.611 27.140 -14.124 1.00 54.48  ? 214 LYS A CA  1 
ATOM   1584 C C   . LYS A 1 214 ? -20.447 28.431 -14.208 1.00 60.68  ? 214 LYS A C   1 
ATOM   1585 O O   . LYS A 1 214 ? -19.876 29.516 -14.327 1.00 59.38  ? 214 LYS A O   1 
ATOM   1586 C CB  . LYS A 1 214 ? -19.888 26.248 -15.349 1.00 58.89  ? 214 LYS A CB  1 
ATOM   1587 C CG  . LYS A 1 214 ? -18.852 25.156 -15.584 1.00 76.52  ? 214 LYS A CG  1 
ATOM   1588 C CD  . LYS A 1 214 ? -19.357 24.137 -16.604 1.00 91.17  ? 214 LYS A CD  1 
ATOM   1589 C CE  . LYS A 1 214 ? -18.355 23.045 -16.889 1.00 105.44 ? 214 LYS A CE  1 
ATOM   1590 N NZ  . LYS A 1 214 ? -18.829 22.135 -17.965 1.00 118.38 ? 214 LYS A NZ  1 
ATOM   1591 N N   . GLU A 1 215 ? -21.798 28.299 -14.060 1.00 59.72  ? 215 GLU A N   1 
ATOM   1592 C CA  . GLU A 1 215 ? -22.793 29.380 -14.049 1.00 61.25  ? 215 GLU A CA  1 
ATOM   1593 C C   . GLU A 1 215 ? -22.509 30.408 -12.951 1.00 65.38  ? 215 GLU A C   1 
ATOM   1594 O O   . GLU A 1 215 ? -22.632 31.604 -13.211 1.00 65.52  ? 215 GLU A O   1 
ATOM   1595 C CB  . GLU A 1 215 ? -24.206 28.814 -13.844 1.00 63.13  ? 215 GLU A CB  1 
ATOM   1596 C CG  . GLU A 1 215 ? -24.939 28.422 -15.109 1.00 78.73  ? 215 GLU A CG  1 
ATOM   1597 C CD  . GLU A 1 215 ? -26.387 28.068 -14.833 1.00 105.27 ? 215 GLU A CD  1 
ATOM   1598 O OE1 . GLU A 1 215 ? -26.681 26.864 -14.656 1.00 94.67  ? 215 GLU A OE1 1 
ATOM   1599 O OE2 . GLU A 1 215 ? -27.217 29.002 -14.736 1.00 108.19 ? 215 GLU A OE2 1 
ATOM   1600 N N   . ILE A 1 216 ? -22.157 29.943 -11.720 1.00 61.59  ? 216 ILE A N   1 
ATOM   1601 C CA  . ILE A 1 216 ? -21.831 30.817 -10.589 1.00 60.39  ? 216 ILE A CA  1 
ATOM   1602 C C   . ILE A 1 216 ? -20.576 31.627 -10.935 1.00 64.18  ? 216 ILE A C   1 
ATOM   1603 O O   . ILE A 1 216 ? -20.627 32.857 -10.842 1.00 64.70  ? 216 ILE A O   1 
ATOM   1604 C CB  . ILE A 1 216 ? -21.750 30.060 -9.230  1.00 61.76  ? 216 ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 216 ? -23.124 29.483 -8.840  1.00 62.59  ? 216 ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 216 ? -21.217 30.965 -8.097  1.00 61.72  ? 216 ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 216 ? -23.038 28.192 -8.077  1.00 69.30  ? 216 ILE A CD1 1 
ATOM   1608 N N   . TYR A 1 217 ? -19.495 30.955 -11.416 1.00 60.21  ? 217 TYR A N   1 
ATOM   1609 C CA  . TYR A 1 217 ? -18.251 31.624 -11.839 1.00 60.39  ? 217 TYR A CA  1 
ATOM   1610 C C   . TYR A 1 217 ? -18.509 32.719 -12.884 1.00 65.71  ? 217 TYR A C   1 
ATOM   1611 O O   . TYR A 1 217 ? -17.930 33.797 -12.772 1.00 64.37  ? 217 TYR A O   1 
ATOM   1612 C CB  . TYR A 1 217 ? -17.191 30.621 -12.357 1.00 61.88  ? 217 TYR A CB  1 
ATOM   1613 C CG  . TYR A 1 217 ? -15.791 31.193 -12.376 1.00 64.25  ? 217 TYR A CG  1 
ATOM   1614 C CD1 . TYR A 1 217 ? -14.974 31.127 -11.249 1.00 64.39  ? 217 TYR A CD1 1 
ATOM   1615 C CD2 . TYR A 1 217 ? -15.295 31.839 -13.504 1.00 66.92  ? 217 TYR A CD2 1 
ATOM   1616 C CE1 . TYR A 1 217 ? -13.698 31.688 -11.246 1.00 65.10  ? 217 TYR A CE1 1 
ATOM   1617 C CE2 . TYR A 1 217 ? -14.024 32.407 -13.512 1.00 67.61  ? 217 TYR A CE2 1 
ATOM   1618 C CZ  . TYR A 1 217 ? -13.228 32.327 -12.380 1.00 74.25  ? 217 TYR A CZ  1 
ATOM   1619 O OH  . TYR A 1 217 ? -11.970 32.878 -12.375 1.00 77.29  ? 217 TYR A OH  1 
ATOM   1620 N N   . GLU A 1 218 ? -19.391 32.453 -13.882 1.00 64.82  ? 218 GLU A N   1 
ATOM   1621 C CA  . GLU A 1 218 ? -19.719 33.414 -14.941 1.00 66.74  ? 218 GLU A CA  1 
ATOM   1622 C C   . GLU A 1 218 ? -20.316 34.715 -14.370 1.00 69.49  ? 218 GLU A C   1 
ATOM   1623 O O   . GLU A 1 218 ? -19.978 35.799 -14.852 1.00 70.43  ? 218 GLU A O   1 
ATOM   1624 C CB  . GLU A 1 218 ? -20.547 32.760 -16.073 1.00 70.55  ? 218 GLU A CB  1 
ATOM   1625 C CG  . GLU A 1 218 ? -22.029 33.126 -16.126 1.00 87.74  ? 218 GLU A CG  1 
ATOM   1626 C CD  . GLU A 1 218 ? -23.060 32.043 -16.413 1.00 112.39 ? 218 GLU A CD  1 
ATOM   1627 O OE1 . GLU A 1 218 ? -24.191 32.170 -15.889 1.00 103.78 ? 218 GLU A OE1 1 
ATOM   1628 O OE2 . GLU A 1 218 ? -22.758 31.090 -17.170 1.00 108.32 ? 218 GLU A OE2 1 
ATOM   1629 N N   . LEU A 1 219 ? -21.119 34.601 -13.287 1.00 64.35  ? 219 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 219 ? -21.736 35.740 -12.595 1.00 64.15  ? 219 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 219 ? -20.732 36.551 -11.768 1.00 66.50  ? 219 LEU A C   1 
ATOM   1632 O O   . LEU A 1 219 ? -20.816 37.785 -11.749 1.00 66.18  ? 219 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 219 ? -22.949 35.307 -11.764 1.00 63.28  ? 219 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 219 ? -24.204 35.010 -12.601 1.00 69.90  ? 219 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 219 ? -25.048 33.928 -11.959 1.00 69.14  ? 219 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 219 ? -25.028 36.275 -12.859 1.00 72.05  ? 219 LEU A CD2 1 
ATOM   1637 N N   . ALA A 1 220 ? -19.746 35.860 -11.147 1.00 61.20  ? 220 ALA A N   1 
ATOM   1638 C CA  . ALA A 1 220 ? -18.650 36.445 -10.364 1.00 58.96  ? 220 ALA A CA  1 
ATOM   1639 C C   . ALA A 1 220 ? -17.709 37.306 -11.225 1.00 63.03  ? 220 ALA A C   1 
ATOM   1640 O O   . ALA A 1 220 ? -17.124 38.250 -10.698 1.00 61.99  ? 220 ALA A O   1 
ATOM   1641 C CB  . ALA A 1 220 ? -17.866 35.353 -9.653  1.00 57.44  ? 220 ALA A CB  1 
ATOM   1642 N N   . ARG A 1 221 ? -17.559 36.983 -12.538 1.00 60.51  ? 221 ARG A N   1 
ATOM   1643 C CA  . ARG A 1 221 ? -16.751 37.770 -13.481 1.00 61.46  ? 221 ARG A CA  1 
ATOM   1644 C C   . ARG A 1 221 ? -17.540 39.034 -13.779 1.00 67.09  ? 221 ARG A C   1 
ATOM   1645 O O   . ARG A 1 221 ? -17.027 40.137 -13.578 1.00 66.75  ? 221 ARG A O   1 
ATOM   1646 C CB  . ARG A 1 221 ? -16.543 37.035 -14.823 1.00 62.22  ? 221 ARG A CB  1 
ATOM   1647 C CG  . ARG A 1 221 ? -15.759 35.732 -14.792 1.00 66.91  ? 221 ARG A CG  1 
ATOM   1648 C CD  . ARG A 1 221 ? -15.778 35.050 -16.161 1.00 65.38  ? 221 ARG A CD  1 
ATOM   1649 N NE  . ARG A 1 221 ? -15.061 35.798 -17.193 1.00 65.42  ? 221 ARG A NE  1 
ATOM   1650 C CZ  . ARG A 1 221 ? -13.842 35.496 -17.633 1.00 84.90  ? 221 ARG A CZ  1 
ATOM   1651 N NH1 . ARG A 1 221 ? -13.190 34.448 -17.143 1.00 72.62  ? 221 ARG A NH1 1 
ATOM   1652 N NH2 . ARG A 1 221 ? -13.269 36.234 -18.575 1.00 79.80  ? 221 ARG A NH2 1 
ATOM   1653 N N   . LYS A 1 222 ? -18.806 38.845 -14.262 1.00 64.84  ? 222 LYS A N   1 
ATOM   1654 C CA  . LYS A 1 222 ? -19.783 39.867 -14.661 1.00 66.68  ? 222 LYS A CA  1 
ATOM   1655 C C   . LYS A 1 222 ? -19.943 40.988 -13.628 1.00 70.10  ? 222 LYS A C   1 
ATOM   1656 O O   . LYS A 1 222 ? -19.879 42.162 -13.995 1.00 70.57  ? 222 LYS A O   1 
ATOM   1657 C CB  . LYS A 1 222 ? -21.144 39.211 -14.977 1.00 69.85  ? 222 LYS A CB  1 
ATOM   1658 C CG  . LYS A 1 222 ? -22.191 40.158 -15.564 1.00 82.41  ? 222 LYS A CG  1 
ATOM   1659 C CD  . LYS A 1 222 ? -23.391 39.404 -16.104 1.00 95.51  ? 222 LYS A CD  1 
ATOM   1660 C CE  . LYS A 1 222 ? -24.396 40.330 -16.743 1.00 117.15 ? 222 LYS A CE  1 
ATOM   1661 N NZ  . LYS A 1 222 ? -25.470 39.582 -17.457 1.00 129.97 ? 222 LYS A NZ  1 
ATOM   1662 N N   . TYR A 1 223 ? -20.122 40.617 -12.341 1.00 64.53  ? 223 TYR A N   1 
ATOM   1663 C CA  . TYR A 1 223 ? -20.320 41.557 -11.244 1.00 62.86  ? 223 TYR A CA  1 
ATOM   1664 C C   . TYR A 1 223 ? -19.069 41.752 -10.370 1.00 64.45  ? 223 TYR A C   1 
ATOM   1665 O O   . TYR A 1 223 ? -19.142 42.424 -9.333  1.00 63.08  ? 223 TYR A O   1 
ATOM   1666 C CB  . TYR A 1 223 ? -21.560 41.158 -10.426 1.00 62.90  ? 223 TYR A CB  1 
ATOM   1667 C CG  . TYR A 1 223 ? -22.856 41.285 -11.197 1.00 66.63  ? 223 TYR A CG  1 
ATOM   1668 C CD1 . TYR A 1 223 ? -23.585 42.473 -11.186 1.00 69.95  ? 223 TYR A CD1 1 
ATOM   1669 C CD2 . TYR A 1 223 ? -23.344 40.226 -11.958 1.00 68.41  ? 223 TYR A CD2 1 
ATOM   1670 C CE1 . TYR A 1 223 ? -24.773 42.600 -11.905 1.00 73.01  ? 223 TYR A CE1 1 
ATOM   1671 C CE2 . TYR A 1 223 ? -24.529 40.343 -12.686 1.00 71.69  ? 223 TYR A CE2 1 
ATOM   1672 C CZ  . TYR A 1 223 ? -25.241 41.531 -12.655 1.00 79.77  ? 223 TYR A CZ  1 
ATOM   1673 O OH  . TYR A 1 223 ? -26.412 41.647 -13.367 1.00 82.46  ? 223 TYR A OH  1 
ATOM   1674 N N   . ASP A 1 224 ? -17.915 41.207 -10.820 1.00 60.67  ? 224 ASP A N   1 
ATOM   1675 C CA  . ASP A 1 224 ? -16.611 41.291 -10.151 1.00 59.13  ? 224 ASP A CA  1 
ATOM   1676 C C   . ASP A 1 224 ? -16.648 41.066 -8.626  1.00 59.83  ? 224 ASP A C   1 
ATOM   1677 O O   . ASP A 1 224 ? -16.510 42.010 -7.843  1.00 59.69  ? 224 ASP A O   1 
ATOM   1678 C CB  . ASP A 1 224 ? -15.818 42.559 -10.567 1.00 62.64  ? 224 ASP A CB  1 
ATOM   1679 C CG  . ASP A 1 224 ? -14.387 42.654 -10.016 1.00 72.73  ? 224 ASP A CG  1 
ATOM   1680 O OD1 . ASP A 1 224 ? -13.636 41.657 -10.129 1.00 72.66  ? 224 ASP A OD1 1 
ATOM   1681 O OD2 . ASP A 1 224 ? -14.016 43.738 -9.490  1.00 75.95  ? 224 ASP A OD2 1 
ATOM   1682 N N   . PHE A 1 225 ? -16.887 39.822 -8.213  1.00 53.42  ? 225 PHE A N   1 
ATOM   1683 C CA  . PHE A 1 225 ? -16.870 39.476 -6.799  1.00 50.74  ? 225 PHE A CA  1 
ATOM   1684 C C   . PHE A 1 225 ? -16.097 38.198 -6.571  1.00 53.42  ? 225 PHE A C   1 
ATOM   1685 O O   . PHE A 1 225 ? -16.056 37.328 -7.445  1.00 53.32  ? 225 PHE A O   1 
ATOM   1686 C CB  . PHE A 1 225 ? -18.269 39.450 -6.156  1.00 52.26  ? 225 PHE A CB  1 
ATOM   1687 C CG  . PHE A 1 225 ? -19.300 38.538 -6.774  1.00 53.93  ? 225 PHE A CG  1 
ATOM   1688 C CD1 . PHE A 1 225 ? -19.358 37.189 -6.429  1.00 55.18  ? 225 PHE A CD1 1 
ATOM   1689 C CD2 . PHE A 1 225 ? -20.265 39.044 -7.635  1.00 56.45  ? 225 PHE A CD2 1 
ATOM   1690 C CE1 . PHE A 1 225 ? -20.320 36.352 -6.986  1.00 56.43  ? 225 PHE A CE1 1 
ATOM   1691 C CE2 . PHE A 1 225 ? -21.230 38.209 -8.185  1.00 59.91  ? 225 PHE A CE2 1 
ATOM   1692 C CZ  . PHE A 1 225 ? -21.259 36.872 -7.852  1.00 57.07  ? 225 PHE A CZ  1 
ATOM   1693 N N   . LEU A 1 226 ? -15.483 38.089 -5.392  1.00 48.79  ? 226 LEU A N   1 
ATOM   1694 C CA  . LEU A 1 226 ? -14.677 36.929 -5.015  1.00 46.98  ? 226 LEU A CA  1 
ATOM   1695 C C   . LEU A 1 226 ? -15.517 35.707 -4.616  1.00 47.28  ? 226 LEU A C   1 
ATOM   1696 O O   . LEU A 1 226 ? -16.668 35.853 -4.216  1.00 46.39  ? 226 LEU A O   1 
ATOM   1697 C CB  . LEU A 1 226 ? -13.660 37.304 -3.911  1.00 45.42  ? 226 LEU A CB  1 
ATOM   1698 C CG  . LEU A 1 226 ? -12.686 38.463 -4.232  1.00 50.75  ? 226 LEU A CG  1 
ATOM   1699 C CD1 . LEU A 1 226 ? -11.774 38.742 -3.061  1.00 50.06  ? 226 LEU A CD1 1 
ATOM   1700 C CD2 . LEU A 1 226 ? -11.828 38.171 -5.449  1.00 51.17  ? 226 LEU A CD2 1 
ATOM   1701 N N   . ILE A 1 227 ? -14.955 34.509 -4.762  1.00 41.48  ? 227 ILE A N   1 
ATOM   1702 C CA  . ILE A 1 227 ? -15.650 33.294 -4.352  1.00 40.70  ? 227 ILE A CA  1 
ATOM   1703 C C   . ILE A 1 227 ? -14.866 32.682 -3.210  1.00 42.85  ? 227 ILE A C   1 
ATOM   1704 O O   . ILE A 1 227 ? -13.671 32.382 -3.362  1.00 41.90  ? 227 ILE A O   1 
ATOM   1705 C CB  . ILE A 1 227 ? -15.928 32.281 -5.501  1.00 44.92  ? 227 ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 227 ? -16.896 32.874 -6.553  1.00 47.51  ? 227 ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 227 ? -16.493 30.955 -4.933  1.00 44.19  ? 227 ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 227 ? -17.056 32.036 -7.879  1.00 54.15  ? 227 ILE A CD1 1 
ATOM   1709 N N   . ILE A 1 228 ? -15.528 32.536 -2.052  1.00 38.34  ? 228 ILE A N   1 
ATOM   1710 C CA  . ILE A 1 228 ? -14.879 31.936 -0.889  1.00 36.77  ? 228 ILE A CA  1 
ATOM   1711 C C   . ILE A 1 228 ? -15.323 30.483 -0.782  1.00 42.44  ? 228 ILE A C   1 
ATOM   1712 O O   . ILE A 1 228 ? -16.442 30.190 -0.322  1.00 42.36  ? 228 ILE A O   1 
ATOM   1713 C CB  . ILE A 1 228 ? -14.998 32.765 0.422   1.00 37.68  ? 228 ILE A CB  1 
ATOM   1714 C CG1 . ILE A 1 228 ? -14.408 34.187 0.207   1.00 37.54  ? 228 ILE A CG1 1 
ATOM   1715 C CG2 . ILE A 1 228 ? -14.314 32.023 1.587   1.00 35.44  ? 228 ILE A CG2 1 
ATOM   1716 C CD1 . ILE A 1 228 ? -14.677 35.181 1.284   1.00 41.18  ? 228 ILE A CD1 1 
ATOM   1717 N N   . GLU A 1 229 ? -14.447 29.590 -1.297  1.00 38.24  ? 229 GLU A N   1 
ATOM   1718 C CA  . GLU A 1 229 ? -14.660 28.154 -1.335  1.00 37.51  ? 229 GLU A CA  1 
ATOM   1719 C C   . GLU A 1 229 ? -14.230 27.488 -0.032  1.00 40.09  ? 229 GLU A C   1 
ATOM   1720 O O   . GLU A 1 229 ? -13.067 27.089 0.095   1.00 38.18  ? 229 GLU A O   1 
ATOM   1721 C CB  . GLU A 1 229 ? -13.923 27.547 -2.536  1.00 39.47  ? 229 GLU A CB  1 
ATOM   1722 C CG  . GLU A 1 229 ? -14.221 26.072 -2.743  1.00 45.49  ? 229 GLU A CG  1 
ATOM   1723 C CD  . GLU A 1 229 ? -13.885 25.534 -4.116  1.00 58.33  ? 229 GLU A CD  1 
ATOM   1724 O OE1 . GLU A 1 229 ? -14.790 24.953 -4.757  1.00 55.27  ? 229 GLU A OE1 1 
ATOM   1725 O OE2 . GLU A 1 229 ? -12.711 25.656 -4.535  1.00 44.66  ? 229 GLU A OE2 1 
ATOM   1726 N N   . ASP A 1 230 ? -15.171 27.369 0.937   1.00 37.42  ? 230 ASP A N   1 
ATOM   1727 C CA  . ASP A 1 230 ? -14.901 26.703 2.215   1.00 37.05  ? 230 ASP A CA  1 
ATOM   1728 C C   . ASP A 1 230 ? -15.251 25.223 2.019   1.00 44.37  ? 230 ASP A C   1 
ATOM   1729 O O   . ASP A 1 230 ? -16.418 24.845 2.140   1.00 45.45  ? 230 ASP A O   1 
ATOM   1730 C CB  . ASP A 1 230 ? -15.717 27.338 3.355   1.00 38.22  ? 230 ASP A CB  1 
ATOM   1731 C CG  . ASP A 1 230 ? -15.404 26.814 4.751   1.00 49.80  ? 230 ASP A CG  1 
ATOM   1732 O OD1 . ASP A 1 230 ? -14.323 26.204 4.933   1.00 52.48  ? 230 ASP A OD1 1 
ATOM   1733 O OD2 . ASP A 1 230 ? -16.226 27.041 5.672   1.00 51.39  ? 230 ASP A OD2 1 
ATOM   1734 N N   . ASP A 1 231 ? -14.244 24.397 1.667   1.00 40.69  ? 231 ASP A N   1 
ATOM   1735 C CA  . ASP A 1 231 ? -14.420 22.987 1.319   1.00 40.50  ? 231 ASP A CA  1 
ATOM   1736 C C   . ASP A 1 231 ? -13.798 21.986 2.334   1.00 44.80  ? 231 ASP A C   1 
ATOM   1737 O O   . ASP A 1 231 ? -12.818 21.318 1.993   1.00 45.63  ? 231 ASP A O   1 
ATOM   1738 C CB  . ASP A 1 231 ? -13.860 22.771 -0.106  1.00 43.15  ? 231 ASP A CB  1 
ATOM   1739 C CG  . ASP A 1 231 ? -14.739 22.024 -1.104  1.00 53.30  ? 231 ASP A CG  1 
ATOM   1740 O OD1 . ASP A 1 231 ? -15.793 21.486 -0.692  1.00 54.04  ? 231 ASP A OD1 1 
ATOM   1741 O OD2 . ASP A 1 231 ? -14.353 21.947 -2.293  1.00 56.89  ? 231 ASP A OD2 1 
ATOM   1742 N N   . PRO A 1 232 ? -14.336 21.826 3.569   1.00 40.59  ? 232 PRO A N   1 
ATOM   1743 C CA  . PRO A 1 232 ? -13.728 20.856 4.501   1.00 39.02  ? 232 PRO A CA  1 
ATOM   1744 C C   . PRO A 1 232 ? -14.114 19.411 4.219   1.00 42.31  ? 232 PRO A C   1 
ATOM   1745 O O   . PRO A 1 232 ? -13.376 18.506 4.602   1.00 40.70  ? 232 PRO A O   1 
ATOM   1746 C CB  . PRO A 1 232 ? -14.233 21.301 5.877   1.00 40.27  ? 232 PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 232 ? -15.211 22.422 5.643   1.00 45.44  ? 232 PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 232 ? -15.499 22.501 4.184   1.00 42.24  ? 232 PRO A CD  1 
ATOM   1749 N N   . TYR A 1 233 ? -15.264 19.192 3.549   1.00 41.04  ? 233 TYR A N   1 
ATOM   1750 C CA  . TYR A 1 233 ? -15.785 17.858 3.203   1.00 40.78  ? 233 TYR A CA  1 
ATOM   1751 C C   . TYR A 1 233 ? -15.440 17.416 1.782   1.00 44.35  ? 233 TYR A C   1 
ATOM   1752 O O   . TYR A 1 233 ? -16.059 16.482 1.271   1.00 43.95  ? 233 TYR A O   1 
ATOM   1753 C CB  . TYR A 1 233 ? -17.307 17.759 3.477   1.00 41.69  ? 233 TYR A CB  1 
ATOM   1754 C CG  . TYR A 1 233 ? -17.717 18.348 4.811   1.00 41.70  ? 233 TYR A CG  1 
ATOM   1755 C CD1 . TYR A 1 233 ? -18.441 19.533 4.879   1.00 43.08  ? 233 TYR A CD1 1 
ATOM   1756 C CD2 . TYR A 1 233 ? -17.321 17.759 6.007   1.00 42.11  ? 233 TYR A CD2 1 
ATOM   1757 C CE1 . TYR A 1 233 ? -18.792 20.100 6.105   1.00 43.26  ? 233 TYR A CE1 1 
ATOM   1758 C CE2 . TYR A 1 233 ? -17.659 18.321 7.239   1.00 42.83  ? 233 TYR A CE2 1 
ATOM   1759 C CZ  . TYR A 1 233 ? -18.401 19.489 7.285   1.00 50.83  ? 233 TYR A CZ  1 
ATOM   1760 O OH  . TYR A 1 233 ? -18.728 20.044 8.504   1.00 49.81  ? 233 TYR A OH  1 
ATOM   1761 N N   . TYR A 1 234 ? -14.425 18.063 1.157   1.00 41.71  ? 234 TYR A N   1 
ATOM   1762 C CA  . TYR A 1 234 ? -13.970 17.749 -0.202  1.00 43.05  ? 234 TYR A CA  1 
ATOM   1763 C C   . TYR A 1 234 ? -13.529 16.274 -0.324  1.00 49.36  ? 234 TYR A C   1 
ATOM   1764 O O   . TYR A 1 234 ? -13.800 15.623 -1.335  1.00 49.96  ? 234 TYR A O   1 
ATOM   1765 C CB  . TYR A 1 234 ? -12.851 18.724 -0.667  1.00 43.92  ? 234 TYR A CB  1 
ATOM   1766 C CG  . TYR A 1 234 ? -12.265 18.334 -2.008  1.00 46.88  ? 234 TYR A CG  1 
ATOM   1767 C CD1 . TYR A 1 234 ? -13.024 18.421 -3.175  1.00 50.45  ? 234 TYR A CD1 1 
ATOM   1768 C CD2 . TYR A 1 234 ? -10.998 17.767 -2.097  1.00 47.34  ? 234 TYR A CD2 1 
ATOM   1769 C CE1 . TYR A 1 234 ? -12.526 17.983 -4.400  1.00 51.51  ? 234 TYR A CE1 1 
ATOM   1770 C CE2 . TYR A 1 234 ? -10.491 17.321 -3.317  1.00 49.58  ? 234 TYR A CE2 1 
ATOM   1771 C CZ  . TYR A 1 234 ? -11.260 17.434 -4.467  1.00 57.57  ? 234 TYR A CZ  1 
ATOM   1772 O OH  . TYR A 1 234 ? -10.770 17.014 -5.679  1.00 60.22  ? 234 TYR A OH  1 
ATOM   1773 N N   . PHE A 1 235 ? -12.878 15.761 0.730   1.00 47.10  ? 235 PHE A N   1 
ATOM   1774 C CA  . PHE A 1 235 ? -12.385 14.397 0.824   1.00 48.40  ? 235 PHE A CA  1 
ATOM   1775 C C   . PHE A 1 235 ? -13.400 13.463 1.480   1.00 56.09  ? 235 PHE A C   1 
ATOM   1776 O O   . PHE A 1 235 ? -13.014 12.392 1.956   1.00 56.88  ? 235 PHE A O   1 
ATOM   1777 C CB  . PHE A 1 235 ? -11.047 14.357 1.584   1.00 49.59  ? 235 PHE A CB  1 
ATOM   1778 C CG  . PHE A 1 235 ? -9.936  15.112 0.904   1.00 52.13  ? 235 PHE A CG  1 
ATOM   1779 C CD1 . PHE A 1 235 ? -9.353  14.625 -0.265  1.00 56.12  ? 235 PHE A CD1 1 
ATOM   1780 C CD2 . PHE A 1 235 ? -9.470  16.311 1.427   1.00 54.15  ? 235 PHE A CD2 1 
ATOM   1781 C CE1 . PHE A 1 235 ? -8.322  15.321 -0.890  1.00 57.04  ? 235 PHE A CE1 1 
ATOM   1782 C CE2 . PHE A 1 235 ? -8.432  17.005 0.801   1.00 57.12  ? 235 PHE A CE2 1 
ATOM   1783 C CZ  . PHE A 1 235 ? -7.868  16.504 -0.353  1.00 55.97  ? 235 PHE A CZ  1 
ATOM   1784 N N   . LEU A 1 236 ? -14.691 13.857 1.513   1.00 53.72  ? 236 LEU A N   1 
ATOM   1785 C CA  . LEU A 1 236 ? -15.762 13.037 2.086   1.00 53.10  ? 236 LEU A CA  1 
ATOM   1786 C C   . LEU A 1 236 ? -16.951 12.910 1.131   1.00 59.60  ? 236 LEU A C   1 
ATOM   1787 O O   . LEU A 1 236 ? -18.082 12.714 1.566   1.00 59.48  ? 236 LEU A O   1 
ATOM   1788 C CB  . LEU A 1 236 ? -16.176 13.551 3.475   1.00 51.60  ? 236 LEU A CB  1 
ATOM   1789 C CG  . LEU A 1 236 ? -15.327 13.081 4.659   1.00 54.95  ? 236 LEU A CG  1 
ATOM   1790 C CD1 . LEU A 1 236 ? -14.192 14.058 4.954   1.00 54.78  ? 236 LEU A CD1 1 
ATOM   1791 C CD2 . LEU A 1 236 ? -16.160 12.985 5.896   1.00 55.98  ? 236 LEU A CD2 1 
ATOM   1792 N N   . GLN A 1 237 ? -16.683 13.006 -0.183  1.00 58.62  ? 237 GLN A N   1 
ATOM   1793 C CA  . GLN A 1 237 ? -17.691 12.876 -1.243  1.00 59.98  ? 237 GLN A CA  1 
ATOM   1794 C C   . GLN A 1 237 ? -18.014 11.403 -1.410  1.00 64.04  ? 237 GLN A C   1 
ATOM   1795 O O   . GLN A 1 237 ? -17.106 10.577 -1.509  1.00 63.39  ? 237 GLN A O   1 
ATOM   1796 C CB  . GLN A 1 237 ? -17.202 13.499 -2.563  1.00 62.40  ? 237 GLN A CB  1 
ATOM   1797 C CG  . GLN A 1 237 ? -17.040 15.021 -2.510  1.00 66.95  ? 237 GLN A CG  1 
ATOM   1798 C CD  . GLN A 1 237 ? -16.586 15.621 -3.819  1.00 81.77  ? 237 GLN A CD  1 
ATOM   1799 O OE1 . GLN A 1 237 ? -15.590 16.342 -3.867  1.00 83.66  ? 237 GLN A OE1 1 
ATOM   1800 N NE2 . GLN A 1 237 ? -17.313 15.377 -4.906  1.00 64.50  ? 237 GLN A NE2 1 
ATOM   1801 N N   . PHE A 1 238 ? -19.298 11.072 -1.379  1.00 61.53  ? 238 PHE A N   1 
ATOM   1802 C CA  . PHE A 1 238 ? -19.737 9.687  -1.410  1.00 61.89  ? 238 PHE A CA  1 
ATOM   1803 C C   . PHE A 1 238 ? -19.722 9.036  -2.740  1.00 70.73  ? 238 PHE A C   1 
ATOM   1804 O O   . PHE A 1 238 ? -19.371 7.849  -2.854  1.00 72.23  ? 238 PHE A O   1 
ATOM   1805 C CB  . PHE A 1 238 ? -21.101 9.533  -0.732  1.00 62.50  ? 238 PHE A CB  1 
ATOM   1806 C CG  . PHE A 1 238 ? -21.024 9.867  0.734   1.00 61.76  ? 238 PHE A CG  1 
ATOM   1807 C CD1 . PHE A 1 238 ? -21.901 10.781 1.301   1.00 63.56  ? 238 PHE A CD1 1 
ATOM   1808 C CD2 . PHE A 1 238 ? -20.018 9.333  1.531   1.00 62.29  ? 238 PHE A CD2 1 
ATOM   1809 C CE1 . PHE A 1 238 ? -21.806 11.111 2.647   1.00 63.15  ? 238 PHE A CE1 1 
ATOM   1810 C CE2 . PHE A 1 238 ? -19.907 9.684  2.868   1.00 63.74  ? 238 PHE A CE2 1 
ATOM   1811 C CZ  . PHE A 1 238 ? -20.809 10.565 3.422   1.00 61.53  ? 238 PHE A CZ  1 
ATOM   1812 N N   . ASN A 1 239 ? -20.082 9.807  -3.756  1.00 68.38  ? 239 ASN A N   1 
ATOM   1813 C CA  . ASN A 1 239 ? -20.240 9.245  -5.078  1.00 69.64  ? 239 ASN A CA  1 
ATOM   1814 C C   . ASN A 1 239 ? -19.083 9.391  -6.018  1.00 71.05  ? 239 ASN A C   1 
ATOM   1815 O O   . ASN A 1 239 ? -18.301 10.337 -5.890  1.00 68.93  ? 239 ASN A O   1 
ATOM   1816 C CB  . ASN A 1 239 ? -21.610 9.582  -5.641  1.00 75.78  ? 239 ASN A CB  1 
ATOM   1817 C CG  . ASN A 1 239 ? -22.694 9.291  -4.609  1.00 107.04 ? 239 ASN A CG  1 
ATOM   1818 O OD1 . ASN A 1 239 ? -23.029 10.149 -3.776  1.00 103.68 ? 239 ASN A OD1 1 
ATOM   1819 N ND2 . ASN A 1 239 ? -23.138 8.038  -4.529  1.00 99.97  ? 239 ASN A ND2 1 
ATOM   1820 N N   . SER A 1 240 ? -18.942 8.369  -6.904  1.00 68.09  ? 240 SER A N   1 
ATOM   1821 C CA  . SER A 1 240 ? -17.923 8.130  -7.936  1.00 68.39  ? 240 SER A CA  1 
ATOM   1822 C C   . SER A 1 240 ? -17.467 9.371  -8.676  1.00 70.85  ? 240 SER A C   1 
ATOM   1823 O O   . SER A 1 240 ? -18.248 9.966  -9.420  1.00 72.04  ? 240 SER A O   1 
ATOM   1824 C CB  . SER A 1 240 ? -18.398 7.064  -8.921  1.00 73.77  ? 240 SER A CB  1 
ATOM   1825 O OG  . SER A 1 240 ? -18.177 7.398  -10.282 1.00 85.22  ? 240 SER A OG  1 
ATOM   1826 N N   . GLY A 1 241 ? -16.193 9.710  -8.492  1.00 64.10  ? 241 GLY A N   1 
ATOM   1827 C CA  . GLY A 1 241 ? -15.536 10.862 -9.102  1.00 62.59  ? 241 GLY A CA  1 
ATOM   1828 C C   . GLY A 1 241 ? -15.910 12.197 -8.489  1.00 60.90  ? 241 GLY A C   1 
ATOM   1829 O O   . GLY A 1 241 ? -17.081 12.603 -8.553  1.00 60.88  ? 241 GLY A O   1 
ATOM   1830 N N   . ARG A 1 242 ? -14.900 12.898 -7.917  1.00 52.48  ? 242 ARG A N   1 
ATOM   1831 C CA  . ARG A 1 242 ? -15.057 14.223 -7.298  1.00 49.48  ? 242 ARG A CA  1 
ATOM   1832 C C   . ARG A 1 242 ? -15.364 15.311 -8.343  1.00 51.55  ? 242 ARG A C   1 
ATOM   1833 O O   . ARG A 1 242 ? -14.841 15.272 -9.455  1.00 51.43  ? 242 ARG A O   1 
ATOM   1834 C CB  . ARG A 1 242 ? -13.842 14.601 -6.432  1.00 46.93  ? 242 ARG A CB  1 
ATOM   1835 C CG  . ARG A 1 242 ? -13.552 13.607 -5.295  1.00 53.01  ? 242 ARG A CG  1 
ATOM   1836 C CD  . ARG A 1 242 ? -12.261 13.880 -4.518  1.00 59.25  ? 242 ARG A CD  1 
ATOM   1837 N NE  . ARG A 1 242 ? -11.154 14.274 -5.391  1.00 66.98  ? 242 ARG A NE  1 
ATOM   1838 C CZ  . ARG A 1 242 ? -10.140 13.490 -5.734  1.00 76.71  ? 242 ARG A CZ  1 
ATOM   1839 N NH1 . ARG A 1 242 ? -10.048 12.258 -5.250  1.00 61.66  ? 242 ARG A NH1 1 
ATOM   1840 N NH2 . ARG A 1 242 ? -9.192  13.942 -6.541  1.00 62.71  ? 242 ARG A NH2 1 
ATOM   1841 N N   . VAL A 1 243 ? -16.254 16.246 -7.984  1.00 47.21  ? 243 VAL A N   1 
ATOM   1842 C CA  . VAL A 1 243 ? -16.738 17.344 -8.834  1.00 48.19  ? 243 VAL A CA  1 
ATOM   1843 C C   . VAL A 1 243 ? -15.621 18.398 -8.947  1.00 53.39  ? 243 VAL A C   1 
ATOM   1844 O O   . VAL A 1 243 ? -14.988 18.694 -7.920  1.00 52.38  ? 243 VAL A O   1 
ATOM   1845 C CB  . VAL A 1 243 ? -18.053 17.966 -8.243  1.00 51.23  ? 243 VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 243 ? -18.720 18.950 -9.207  1.00 52.34  ? 243 VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 243 ? -19.045 16.894 -7.791  1.00 50.67  ? 243 VAL A CG2 1 
ATOM   1848 N N   . PRO A 1 244 ? -15.376 19.012 -10.141 1.00 51.17  ? 244 PRO A N   1 
ATOM   1849 C CA  . PRO A 1 244 ? -14.346 20.068 -10.220 1.00 50.11  ? 244 PRO A CA  1 
ATOM   1850 C C   . PRO A 1 244 ? -14.672 21.224 -9.279  1.00 51.26  ? 244 PRO A C   1 
ATOM   1851 O O   . PRO A 1 244 ? -15.843 21.565 -9.106  1.00 51.53  ? 244 PRO A O   1 
ATOM   1852 C CB  . PRO A 1 244 ? -14.397 20.521 -11.683 1.00 53.95  ? 244 PRO A CB  1 
ATOM   1853 C CG  . PRO A 1 244 ? -15.084 19.442 -12.402 1.00 60.01  ? 244 PRO A CG  1 
ATOM   1854 C CD  . PRO A 1 244 ? -16.035 18.814 -11.448 1.00 54.68  ? 244 PRO A CD  1 
ATOM   1855 N N   . THR A 1 245 ? -13.642 21.789 -8.644  1.00 45.05  ? 245 THR A N   1 
ATOM   1856 C CA  . THR A 1 245 ? -13.774 22.879 -7.671  1.00 42.62  ? 245 THR A CA  1 
ATOM   1857 C C   . THR A 1 245 ? -13.742 24.244 -8.359  1.00 46.35  ? 245 THR A C   1 
ATOM   1858 O O   . THR A 1 245 ? -13.260 24.350 -9.483  1.00 46.92  ? 245 THR A O   1 
ATOM   1859 C CB  . THR A 1 245 ? -12.658 22.774 -6.584  1.00 44.97  ? 245 THR A CB  1 
ATOM   1860 O OG1 . THR A 1 245 ? -11.378 22.892 -7.208  1.00 41.53  ? 245 THR A OG1 1 
ATOM   1861 C CG2 . THR A 1 245 ? -12.732 21.481 -5.753  1.00 38.74  ? 245 THR A CG2 1 
ATOM   1862 N N   . PHE A 1 246 ? -14.218 25.295 -7.662  1.00 43.39  ? 246 PHE A N   1 
ATOM   1863 C CA  . PHE A 1 246 ? -14.177 26.678 -8.150  1.00 44.34  ? 246 PHE A CA  1 
ATOM   1864 C C   . PHE A 1 246 ? -12.747 27.099 -8.504  1.00 51.57  ? 246 PHE A C   1 
ATOM   1865 O O   . PHE A 1 246 ? -12.545 27.755 -9.526  1.00 52.39  ? 246 PHE A O   1 
ATOM   1866 C CB  . PHE A 1 246 ? -14.800 27.652 -7.131  1.00 44.34  ? 246 PHE A CB  1 
ATOM   1867 C CG  . PHE A 1 246 ? -16.300 27.791 -7.273  1.00 45.66  ? 246 PHE A CG  1 
ATOM   1868 C CD1 . PHE A 1 246 ? -17.152 27.368 -6.260  1.00 46.32  ? 246 PHE A CD1 1 
ATOM   1869 C CD2 . PHE A 1 246 ? -16.864 28.302 -8.443  1.00 48.83  ? 246 PHE A CD2 1 
ATOM   1870 C CE1 . PHE A 1 246 ? -18.538 27.481 -6.400  1.00 47.60  ? 246 PHE A CE1 1 
ATOM   1871 C CE2 . PHE A 1 246 ? -18.249 28.417 -8.580  1.00 51.95  ? 246 PHE A CE2 1 
ATOM   1872 C CZ  . PHE A 1 246 ? -19.078 28.003 -7.560  1.00 48.62  ? 246 PHE A CZ  1 
ATOM   1873 N N   . LEU A 1 247 ? -11.757 26.682 -7.674  1.00 49.42  ? 247 LEU A N   1 
ATOM   1874 C CA  . LEU A 1 247 ? -10.322 26.931 -7.854  1.00 49.83  ? 247 LEU A CA  1 
ATOM   1875 C C   . LEU A 1 247 ? -9.820  26.336 -9.180  1.00 56.58  ? 247 LEU A C   1 
ATOM   1876 O O   . LEU A 1 247 ? -8.998  26.968 -9.847  1.00 56.85  ? 247 LEU A O   1 
ATOM   1877 C CB  . LEU A 1 247 ? -9.533  26.350 -6.657  1.00 48.08  ? 247 LEU A CB  1 
ATOM   1878 C CG  . LEU A 1 247 ? -7.998  26.333 -6.755  1.00 53.34  ? 247 LEU A CG  1 
ATOM   1879 C CD1 . LEU A 1 247 ? -7.415  27.741 -6.663  1.00 53.70  ? 247 LEU A CD1 1 
ATOM   1880 C CD2 . LEU A 1 247 ? -7.382  25.419 -5.696  1.00 54.80  ? 247 LEU A CD2 1 
ATOM   1881 N N   . SER A 1 248 ? -10.333 25.139 -9.569  1.00 54.63  ? 248 SER A N   1 
ATOM   1882 C CA  . SER A 1 248 ? -9.945  24.457 -10.813 1.00 56.48  ? 248 SER A CA  1 
ATOM   1883 C C   . SER A 1 248 ? -10.319 25.246 -12.063 1.00 63.33  ? 248 SER A C   1 
ATOM   1884 O O   . SER A 1 248 ? -9.617  25.164 -13.064 1.00 64.97  ? 248 SER A O   1 
ATOM   1885 C CB  . SER A 1 248 ? -10.511 23.041 -10.872 1.00 59.95  ? 248 SER A CB  1 
ATOM   1886 O OG  . SER A 1 248 ? -11.829 22.989 -11.395 1.00 72.06  ? 248 SER A OG  1 
ATOM   1887 N N   . MET A 1 249 ? -11.412 26.014 -11.994 1.00 60.89  ? 249 MET A N   1 
ATOM   1888 C CA  . MET A 1 249 ? -11.919 26.842 -13.095 1.00 63.03  ? 249 MET A CA  1 
ATOM   1889 C C   . MET A 1 249 ? -11.602 28.352 -12.918 1.00 65.66  ? 249 MET A C   1 
ATOM   1890 O O   . MET A 1 249 ? -12.147 29.182 -13.657 1.00 66.15  ? 249 MET A O   1 
ATOM   1891 C CB  . MET A 1 249 ? -13.432 26.581 -13.321 1.00 66.18  ? 249 MET A CB  1 
ATOM   1892 C CG  . MET A 1 249 ? -14.308 26.855 -12.106 1.00 68.50  ? 249 MET A CG  1 
ATOM   1893 S SD  . MET A 1 249 ? -16.058 26.446 -12.326 1.00 73.77  ? 249 MET A SD  1 
ATOM   1894 C CE  . MET A 1 249 ? -16.005 24.676 -12.079 1.00 69.61  ? 249 MET A CE  1 
ATOM   1895 N N   . ASP A 1 250 ? -10.705 28.693 -11.957 1.00 60.20  ? 250 ASP A N   1 
ATOM   1896 C CA  . ASP A 1 250 ? -10.347 30.080 -11.650 1.00 60.02  ? 250 ASP A CA  1 
ATOM   1897 C C   . ASP A 1 250 ? -9.361  30.742 -12.629 1.00 65.50  ? 250 ASP A C   1 
ATOM   1898 O O   . ASP A 1 250 ? -8.181  30.932 -12.322 1.00 65.23  ? 250 ASP A O   1 
ATOM   1899 C CB  . ASP A 1 250 ? -9.941  30.257 -10.178 1.00 59.61  ? 250 ASP A CB  1 
ATOM   1900 C CG  . ASP A 1 250 ? -9.756  31.704 -9.739  1.00 70.56  ? 250 ASP A CG  1 
ATOM   1901 O OD1 . ASP A 1 250 ? -10.405 32.605 -10.341 1.00 71.56  ? 250 ASP A OD1 1 
ATOM   1902 O OD2 . ASP A 1 250 ? -8.989  31.936 -8.772  1.00 75.56  ? 250 ASP A OD2 1 
ATOM   1903 N N   . VAL A 1 251 ? -9.880  31.128 -13.792 1.00 62.91  ? 251 VAL A N   1 
ATOM   1904 C CA  . VAL A 1 251 ? -9.131  31.761 -14.872 1.00 64.24  ? 251 VAL A CA  1 
ATOM   1905 C C   . VAL A 1 251 ? -8.667  33.196 -14.494 1.00 68.12  ? 251 VAL A C   1 
ATOM   1906 O O   . VAL A 1 251 ? -7.569  33.604 -14.888 1.00 68.51  ? 251 VAL A O   1 
ATOM   1907 C CB  . VAL A 1 251 ? -9.986  31.716 -16.167 1.00 69.87  ? 251 VAL A CB  1 
ATOM   1908 C CG1 . VAL A 1 251 ? -9.340  32.487 -17.314 1.00 71.89  ? 251 VAL A CG1 1 
ATOM   1909 C CG2 . VAL A 1 251 ? -10.264 30.277 -16.579 1.00 69.70  ? 251 VAL A CG2 1 
ATOM   1910 N N   . ASP A 1 252 ? -9.494  33.926 -13.710 1.00 63.02  ? 252 ASP A N   1 
ATOM   1911 C CA  . ASP A 1 252 ? -9.284  35.317 -13.285 1.00 62.16  ? 252 ASP A CA  1 
ATOM   1912 C C   . ASP A 1 252 ? -8.464  35.519 -12.012 1.00 63.95  ? 252 ASP A C   1 
ATOM   1913 O O   . ASP A 1 252 ? -7.937  36.611 -11.806 1.00 64.45  ? 252 ASP A O   1 
ATOM   1914 C CB  . ASP A 1 252 ? -10.639 36.032 -13.093 1.00 63.87  ? 252 ASP A CB  1 
ATOM   1915 C CG  . ASP A 1 252 ? -11.628 35.932 -14.237 1.00 70.96  ? 252 ASP A CG  1 
ATOM   1916 O OD1 . ASP A 1 252 ? -11.310 35.263 -15.246 1.00 70.87  ? 252 ASP A OD1 1 
ATOM   1917 O OD2 . ASP A 1 252 ? -12.723 36.517 -14.120 1.00 76.90  ? 252 ASP A OD2 1 
ATOM   1918 N N   . GLY A 1 253 ? -8.414  34.520 -11.142 1.00 57.74  ? 253 GLY A N   1 
ATOM   1919 C CA  . GLY A 1 253 ? -7.735  34.665 -9.859  1.00 55.33  ? 253 GLY A CA  1 
ATOM   1920 C C   . GLY A 1 253 ? -8.637  35.397 -8.880  1.00 58.08  ? 253 GLY A C   1 
ATOM   1921 O O   . GLY A 1 253 ? -8.210  36.347 -8.221  1.00 57.22  ? 253 GLY A O   1 
ATOM   1922 N N   . ARG A 1 254 ? -9.922  34.988 -8.835  1.00 53.82  ? 254 ARG A N   1 
ATOM   1923 C CA  . ARG A 1 254 ? -10.957 35.558 -7.970  1.00 51.54  ? 254 ARG A CA  1 
ATOM   1924 C C   . ARG A 1 254 ? -11.442 34.583 -6.901  1.00 50.86  ? 254 ARG A C   1 
ATOM   1925 O O   . ARG A 1 254 ? -12.398 34.892 -6.187  1.00 51.21  ? 254 ARG A O   1 
ATOM   1926 C CB  . ARG A 1 254 ? -12.136 36.126 -8.790  1.00 52.26  ? 254 ARG A CB  1 
ATOM   1927 C CG  . ARG A 1 254 ? -12.838 35.138 -9.710  1.00 58.34  ? 254 ARG A CG  1 
ATOM   1928 C CD  . ARG A 1 254 ? -14.081 35.730 -10.353 1.00 66.31  ? 254 ARG A CD  1 
ATOM   1929 N NE  . ARG A 1 254 ? -13.789 36.784 -11.336 1.00 70.88  ? 254 ARG A NE  1 
ATOM   1930 C CZ  . ARG A 1 254 ? -13.909 38.092 -11.101 1.00 76.59  ? 254 ARG A CZ  1 
ATOM   1931 N NH1 . ARG A 1 254 ? -14.280 38.528 -9.902  1.00 60.44  ? 254 ARG A NH1 1 
ATOM   1932 N NH2 . ARG A 1 254 ? -13.643 38.973 -12.059 1.00 55.43  ? 254 ARG A NH2 1 
ATOM   1933 N N   . VAL A 1 255 ? -10.760 33.435 -6.757  1.00 43.65  ? 255 VAL A N   1 
ATOM   1934 C CA  . VAL A 1 255 ? -11.152 32.392 -5.806  1.00 41.49  ? 255 VAL A CA  1 
ATOM   1935 C C   . VAL A 1 255 ? -10.178 32.222 -4.620  1.00 44.74  ? 255 VAL A C   1 
ATOM   1936 O O   . VAL A 1 255 ? -8.966  32.089 -4.823  1.00 44.74  ? 255 VAL A O   1 
ATOM   1937 C CB  . VAL A 1 255 ? -11.453 31.051 -6.548  1.00 44.83  ? 255 VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 255 ? -11.763 29.916 -5.579  1.00 43.34  ? 255 VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 255 ? -12.590 31.220 -7.547  1.00 46.08  ? 255 VAL A CG2 1 
ATOM   1940 N N   . ILE A 1 256 ? -10.731 32.217 -3.390  1.00 39.54  ? 256 ILE A N   1 
ATOM   1941 C CA  . ILE A 1 256 ? -10.011 31.942 -2.149  1.00 37.35  ? 256 ILE A CA  1 
ATOM   1942 C C   . ILE A 1 256 ? -10.585 30.616 -1.615  1.00 40.82  ? 256 ILE A C   1 
ATOM   1943 O O   . ILE A 1 256 ? -11.765 30.547 -1.241  1.00 40.33  ? 256 ILE A O   1 
ATOM   1944 C CB  . ILE A 1 256 ? -10.097 33.079 -1.097  1.00 39.39  ? 256 ILE A CB  1 
ATOM   1945 C CG1 . ILE A 1 256 ? -9.446  34.369 -1.602  1.00 40.14  ? 256 ILE A CG1 1 
ATOM   1946 C CG2 . ILE A 1 256 ? -9.438  32.641 0.215   1.00 38.62  ? 256 ILE A CG2 1 
ATOM   1947 C CD1 . ILE A 1 256 ? -10.017 35.652 -0.983  1.00 44.54  ? 256 ILE A CD1 1 
ATOM   1948 N N   . ARG A 1 257 ? -9.743  29.570 -1.602  1.00 36.72  ? 257 ARG A N   1 
ATOM   1949 C CA  . ARG A 1 257 ? -10.101 28.226 -1.154  1.00 35.40  ? 257 ARG A CA  1 
ATOM   1950 C C   . ARG A 1 257 ? -9.522  27.880 0.210   1.00 36.79  ? 257 ARG A C   1 
ATOM   1951 O O   . ARG A 1 257 ? -8.318  28.013 0.416   1.00 37.24  ? 257 ARG A O   1 
ATOM   1952 C CB  . ARG A 1 257 ? -9.654  27.172 -2.195  1.00 34.46  ? 257 ARG A CB  1 
ATOM   1953 C CG  . ARG A 1 257 ? -10.072 25.754 -1.817  1.00 31.21  ? 257 ARG A CG  1 
ATOM   1954 C CD  . ARG A 1 257 ? -9.481  24.677 -2.691  1.00 24.17  ? 257 ARG A CD  1 
ATOM   1955 N NE  . ARG A 1 257 ? -9.779  23.352 -2.149  1.00 26.76  ? 257 ARG A NE  1 
ATOM   1956 C CZ  . ARG A 1 257 ? -10.939 22.715 -2.304  1.00 47.95  ? 257 ARG A CZ  1 
ATOM   1957 N NH1 . ARG A 1 257 ? -11.127 21.519 -1.754  1.00 34.95  ? 257 ARG A NH1 1 
ATOM   1958 N NH2 . ARG A 1 257 ? -11.925 23.273 -3.000  1.00 36.25  ? 257 ARG A NH2 1 
ATOM   1959 N N   . ALA A 1 258 ? -10.364 27.342 1.101   1.00 31.73  ? 258 ALA A N   1 
ATOM   1960 C CA  . ALA A 1 258 ? -9.949  26.874 2.423   1.00 30.23  ? 258 ALA A CA  1 
ATOM   1961 C C   . ALA A 1 258 ? -10.127 25.348 2.562   1.00 34.55  ? 258 ALA A C   1 
ATOM   1962 O O   . ALA A 1 258 ? -11.220 24.807 2.375   1.00 33.80  ? 258 ALA A O   1 
ATOM   1963 C CB  . ALA A 1 258 ? -10.708 27.601 3.518   1.00 30.28  ? 258 ALA A CB  1 
ATOM   1964 N N   . ASP A 1 259 ? -9.025  24.675 2.884   1.00 32.42  ? 259 ASP A N   1 
ATOM   1965 C CA  . ASP A 1 259 ? -8.949  23.241 3.085   1.00 33.29  ? 259 ASP A CA  1 
ATOM   1966 C C   . ASP A 1 259 ? -8.664  22.939 4.549   1.00 37.94  ? 259 ASP A C   1 
ATOM   1967 O O   . ASP A 1 259 ? -7.965  23.712 5.221   1.00 36.57  ? 259 ASP A O   1 
ATOM   1968 C CB  . ASP A 1 259 ? -7.842  22.651 2.221   1.00 36.44  ? 259 ASP A CB  1 
ATOM   1969 C CG  . ASP A 1 259 ? -8.144  22.623 0.740   1.00 55.71  ? 259 ASP A CG  1 
ATOM   1970 O OD1 . ASP A 1 259 ? -8.971  21.763 0.314   1.00 57.30  ? 259 ASP A OD1 1 
ATOM   1971 O OD2 . ASP A 1 259 ? -7.508  23.407 -0.010  1.00 65.03  ? 259 ASP A OD2 1 
ATOM   1972 N N   . SER A 1 260 ? -9.183  21.799 5.035   1.00 35.76  ? 260 SER A N   1 
ATOM   1973 C CA  . SER A 1 260 ? -9.009  21.401 6.428   1.00 35.50  ? 260 SER A CA  1 
ATOM   1974 C C   . SER A 1 260 ? -8.629  19.923 6.614   1.00 39.32  ? 260 SER A C   1 
ATOM   1975 O O   . SER A 1 260 ? -9.175  19.050 5.934   1.00 39.27  ? 260 SER A O   1 
ATOM   1976 C CB  . SER A 1 260 ? -10.283 21.714 7.205   1.00 39.96  ? 260 SER A CB  1 
ATOM   1977 O OG  . SER A 1 260 ? -10.132 21.451 8.589   1.00 51.34  ? 260 SER A OG  1 
ATOM   1978 N N   . PHE A 1 261 ? -7.730  19.654 7.583   1.00 34.88  ? 261 PHE A N   1 
ATOM   1979 C CA  . PHE A 1 261 ? -7.331  18.300 7.966   1.00 34.69  ? 261 PHE A CA  1 
ATOM   1980 C C   . PHE A 1 261 ? -8.203  17.751 9.131   1.00 35.98  ? 261 PHE A C   1 
ATOM   1981 O O   . PHE A 1 261 ? -8.069  16.583 9.494   1.00 35.18  ? 261 PHE A O   1 
ATOM   1982 C CB  . PHE A 1 261 ? -5.842  18.262 8.351   1.00 36.84  ? 261 PHE A CB  1 
ATOM   1983 C CG  . PHE A 1 261 ? -4.885  18.298 7.184   1.00 40.16  ? 261 PHE A CG  1 
ATOM   1984 C CD1 . PHE A 1 261 ? -5.037  17.429 6.108   1.00 44.69  ? 261 PHE A CD1 1 
ATOM   1985 C CD2 . PHE A 1 261 ? -3.810  19.177 7.172   1.00 42.57  ? 261 PHE A CD2 1 
ATOM   1986 C CE1 . PHE A 1 261 ? -4.154  17.471 5.025   1.00 46.17  ? 261 PHE A CE1 1 
ATOM   1987 C CE2 . PHE A 1 261 ? -2.923  19.208 6.091   1.00 45.64  ? 261 PHE A CE2 1 
ATOM   1988 C CZ  . PHE A 1 261 ? -3.099  18.351 5.033   1.00 44.53  ? 261 PHE A CZ  1 
ATOM   1989 N N   . SER A 1 262 ? -9.088  18.597 9.697   1.00 30.89  ? 262 SER A N   1 
ATOM   1990 C CA  . SER A 1 262 ? -9.967  18.303 10.827  1.00 30.67  ? 262 SER A CA  1 
ATOM   1991 C C   . SER A 1 262 ? -10.860 17.072 10.687  1.00 36.43  ? 262 SER A C   1 
ATOM   1992 O O   . SER A 1 262 ? -11.049 16.348 11.668  1.00 36.64  ? 262 SER A O   1 
ATOM   1993 C CB  . SER A 1 262 ? -10.808 19.521 11.190  1.00 33.48  ? 262 SER A CB  1 
ATOM   1994 O OG  . SER A 1 262 ? -9.977  20.566 11.661  1.00 42.01  ? 262 SER A OG  1 
ATOM   1995 N N   . LYS A 1 263 ? -11.407 16.834 9.495   1.00 33.33  ? 263 LYS A N   1 
ATOM   1996 C CA  . LYS A 1 263 ? -12.283 15.683 9.286   1.00 34.00  ? 263 LYS A CA  1 
ATOM   1997 C C   . LYS A 1 263 ? -11.524 14.417 8.849   1.00 39.47  ? 263 LYS A C   1 
ATOM   1998 O O   . LYS A 1 263 ? -12.080 13.322 8.920   1.00 38.28  ? 263 LYS A O   1 
ATOM   1999 C CB  . LYS A 1 263 ? -13.435 16.032 8.309   1.00 36.90  ? 263 LYS A CB  1 
ATOM   2000 C CG  . LYS A 1 263 ? -14.595 16.817 8.953   1.00 47.83  ? 263 LYS A CG  1 
ATOM   2001 C CD  . LYS A 1 263 ? -14.380 18.342 9.054   1.00 53.80  ? 263 LYS A CD  1 
ATOM   2002 C CE  . LYS A 1 263 ? -15.409 19.060 9.915   1.00 64.54  ? 263 LYS A CE  1 
ATOM   2003 N NZ  . LYS A 1 263 ? -15.218 18.834 11.375  1.00 69.97  ? 263 LYS A NZ  1 
ATOM   2004 N N   . ILE A 1 264 ? -10.250 14.563 8.439   1.00 38.06  ? 264 ILE A N   1 
ATOM   2005 C CA  . ILE A 1 264 ? -9.443  13.464 7.898   1.00 39.10  ? 264 ILE A CA  1 
ATOM   2006 C C   . ILE A 1 264 ? -8.168  13.054 8.665   1.00 42.87  ? 264 ILE A C   1 
ATOM   2007 O O   . ILE A 1 264 ? -7.807  11.873 8.618   1.00 43.35  ? 264 ILE A O   1 
ATOM   2008 C CB  . ILE A 1 264 ? -9.216  13.633 6.360   1.00 42.92  ? 264 ILE A CB  1 
ATOM   2009 C CG1 . ILE A 1 264 ? -8.636  15.038 6.024   1.00 43.66  ? 264 ILE A CG1 1 
ATOM   2010 C CG2 . ILE A 1 264 ? -10.530 13.374 5.585   1.00 42.69  ? 264 ILE A CG2 1 
ATOM   2011 C CD1 . ILE A 1 264 ? -7.977  15.192 4.632   1.00 54.40  ? 264 ILE A CD1 1 
ATOM   2012 N N   . ILE A 1 265 ? -7.479  14.008 9.332   1.00 37.44  ? 265 ILE A N   1 
ATOM   2013 C CA  . ILE A 1 265 ? -6.240  13.731 10.083  1.00 36.48  ? 265 ILE A CA  1 
ATOM   2014 C C   . ILE A 1 265 ? -6.332  14.011 11.591  1.00 38.72  ? 265 ILE A C   1 
ATOM   2015 O O   . ILE A 1 265 ? -5.995  13.129 12.384  1.00 38.81  ? 265 ILE A O   1 
ATOM   2016 C CB  . ILE A 1 265 ? -4.969  14.286 9.385   1.00 39.52  ? 265 ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 265 ? -4.493  13.284 8.322   1.00 42.21  ? 265 ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 265 ? -3.832  14.579 10.373  1.00 37.77  ? 265 ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 265 ? -4.026  13.895 7.013   1.00 55.95  ? 265 ILE A CD1 1 
ATOM   2020 N N   . SER A 1 266 ? -6.768  15.230 11.979  1.00 32.76  ? 266 SER A N   1 
ATOM   2021 C CA  . SER A 1 266 ? -6.959  15.659 13.368  1.00 31.65  ? 266 SER A CA  1 
ATOM   2022 C C   . SER A 1 266 ? -7.541  17.056 13.439  1.00 34.99  ? 266 SER A C   1 
ATOM   2023 O O   . SER A 1 266 ? -7.053  17.969 12.767  1.00 35.35  ? 266 SER A O   1 
ATOM   2024 C CB  . SER A 1 266 ? -5.659  15.594 14.170  1.00 35.44  ? 266 SER A CB  1 
ATOM   2025 O OG  . SER A 1 266 ? -5.768  16.216 15.442  1.00 42.43  ? 266 SER A OG  1 
ATOM   2026 N N   . SER A 1 267 ? -8.556  17.227 14.295  1.00 29.81  ? 267 SER A N   1 
ATOM   2027 C CA  . SER A 1 267 ? -9.193  18.516 14.544  1.00 28.60  ? 267 SER A CA  1 
ATOM   2028 C C   . SER A 1 267 ? -8.472  19.303 15.678  1.00 33.01  ? 267 SER A C   1 
ATOM   2029 O O   . SER A 1 267 ? -8.377  20.528 15.621  1.00 32.59  ? 267 SER A O   1 
ATOM   2030 C CB  . SER A 1 267 ? -10.656 18.304 14.883  1.00 30.32  ? 267 SER A CB  1 
ATOM   2031 O OG  . SER A 1 267 ? -10.791 17.374 15.941  1.00 36.72  ? 267 SER A OG  1 
ATOM   2032 N N   . GLY A 1 268 ? -7.954  18.583 16.671  1.00 29.67  ? 268 GLY A N   1 
ATOM   2033 C CA  . GLY A 1 268 ? -7.257  19.162 17.814  1.00 29.25  ? 268 GLY A CA  1 
ATOM   2034 C C   . GLY A 1 268 ? -5.846  19.652 17.559  1.00 33.64  ? 268 GLY A C   1 
ATOM   2035 O O   . GLY A 1 268 ? -5.275  20.338 18.415  1.00 33.16  ? 268 GLY A O   1 
ATOM   2036 N N   . LEU A 1 269 ? -5.250  19.276 16.407  1.00 29.98  ? 269 LEU A N   1 
ATOM   2037 C CA  . LEU A 1 269 ? -3.905  19.721 16.043  1.00 29.01  ? 269 LEU A CA  1 
ATOM   2038 C C   . LEU A 1 269 ? -3.915  21.152 15.485  1.00 32.14  ? 269 LEU A C   1 
ATOM   2039 O O   . LEU A 1 269 ? -2.869  21.806 15.506  1.00 31.80  ? 269 LEU A O   1 
ATOM   2040 C CB  . LEU A 1 269 ? -3.233  18.756 15.053  1.00 29.22  ? 269 LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 269 ? -2.678  17.425 15.587  1.00 33.01  ? 269 LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 269 ? -1.929  16.692 14.508  1.00 33.48  ? 269 LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 269 ? -1.736  17.616 16.775  1.00 33.65  ? 269 LEU A CD2 1 
ATOM   2044 N N   . ARG A 1 270 ? -5.103  21.643 15.022  1.00 28.04  ? 270 ARG A N   1 
ATOM   2045 C CA  . ARG A 1 270 ? -5.340  22.995 14.477  1.00 28.01  ? 270 ARG A CA  1 
ATOM   2046 C C   . ARG A 1 270 ? -4.430  23.306 13.275  1.00 33.23  ? 270 ARG A C   1 
ATOM   2047 O O   . ARG A 1 270 ? -3.546  24.164 13.354  1.00 32.92  ? 270 ARG A O   1 
ATOM   2048 C CB  . ARG A 1 270 ? -5.251  24.107 15.563  1.00 25.66  ? 270 ARG A CB  1 
ATOM   2049 C CG  . ARG A 1 270 ? -6.066  23.900 16.850  1.00 26.50  ? 270 ARG A CG  1 
ATOM   2050 C CD  . ARG A 1 270 ? -7.543  23.645 16.645  1.00 29.00  ? 270 ARG A CD  1 
ATOM   2051 N NE  . ARG A 1 270 ? -8.224  24.678 15.868  1.00 33.62  ? 270 ARG A NE  1 
ATOM   2052 C CZ  . ARG A 1 270 ? -8.943  24.445 14.774  1.00 43.37  ? 270 ARG A CZ  1 
ATOM   2053 N NH1 . ARG A 1 270 ? -9.064  23.213 14.297  1.00 16.38  ? 270 ARG A NH1 1 
ATOM   2054 N NH2 . ARG A 1 270 ? -9.546  25.443 14.147  1.00 35.45  ? 270 ARG A NH2 1 
ATOM   2055 N N   . ILE A 1 271 ? -4.613  22.547 12.189  1.00 29.85  ? 271 ILE A N   1 
ATOM   2056 C CA  . ILE A 1 271 ? -3.831  22.686 10.971  1.00 30.78  ? 271 ILE A CA  1 
ATOM   2057 C C   . ILE A 1 271 ? -4.748  22.626 9.757   1.00 38.56  ? 271 ILE A C   1 
ATOM   2058 O O   . ILE A 1 271 ? -5.406  21.608 9.513   1.00 38.90  ? 271 ILE A O   1 
ATOM   2059 C CB  . ILE A 1 271 ? -2.656  21.639 10.878  1.00 33.95  ? 271 ILE A CB  1 
ATOM   2060 C CG1 . ILE A 1 271 ? -1.571  21.812 11.987  1.00 32.87  ? 271 ILE A CG1 1 
ATOM   2061 C CG2 . ILE A 1 271 ? -2.030  21.573 9.459   1.00 35.67  ? 271 ILE A CG2 1 
ATOM   2062 C CD1 . ILE A 1 271 ? -0.709  23.131 11.958  1.00 29.50  ? 271 ILE A CD1 1 
ATOM   2063 N N   . GLY A 1 272 ? -4.765  23.731 9.018   1.00 36.91  ? 272 GLY A N   1 
ATOM   2064 C CA  . GLY A 1 272 ? -5.503  23.901 7.776   1.00 37.32  ? 272 GLY A CA  1 
ATOM   2065 C C   . GLY A 1 272 ? -4.657  24.677 6.786   1.00 41.01  ? 272 GLY A C   1 
ATOM   2066 O O   . GLY A 1 272 ? -3.525  25.050 7.097   1.00 39.88  ? 272 GLY A O   1 
ATOM   2067 N N   . PHE A 1 273 ? -5.194  24.936 5.592   1.00 37.81  ? 273 PHE A N   1 
ATOM   2068 C CA  . PHE A 1 273 ? -4.482  25.709 4.581   1.00 37.74  ? 273 PHE A CA  1 
ATOM   2069 C C   . PHE A 1 273 ? -5.390  26.518 3.665   1.00 41.32  ? 273 PHE A C   1 
ATOM   2070 O O   . PHE A 1 273 ? -6.504  26.099 3.345   1.00 42.07  ? 273 PHE A O   1 
ATOM   2071 C CB  . PHE A 1 273 ? -3.447  24.870 3.806   1.00 39.76  ? 273 PHE A CB  1 
ATOM   2072 C CG  . PHE A 1 273 ? -3.921  23.576 3.200   1.00 40.98  ? 273 PHE A CG  1 
ATOM   2073 C CD1 . PHE A 1 273 ? -4.139  22.456 3.995   1.00 44.02  ? 273 PHE A CD1 1 
ATOM   2074 C CD2 . PHE A 1 273 ? -4.078  23.453 1.827   1.00 44.01  ? 273 PHE A CD2 1 
ATOM   2075 C CE1 . PHE A 1 273 ? -4.572  21.252 3.432   1.00 46.08  ? 273 PHE A CE1 1 
ATOM   2076 C CE2 . PHE A 1 273 ? -4.476  22.238 1.257   1.00 47.94  ? 273 PHE A CE2 1 
ATOM   2077 C CZ  . PHE A 1 273 ? -4.717  21.144 2.062   1.00 46.00  ? 273 PHE A CZ  1 
ATOM   2078 N N   . LEU A 1 274 ? -4.898  27.686 3.259   1.00 35.58  ? 274 LEU A N   1 
ATOM   2079 C CA  . LEU A 1 274 ? -5.588  28.633 2.397   1.00 35.01  ? 274 LEU A CA  1 
ATOM   2080 C C   . LEU A 1 274 ? -4.872  28.701 1.066   1.00 39.89  ? 274 LEU A C   1 
ATOM   2081 O O   . LEU A 1 274 ? -3.644  28.757 1.038   1.00 40.00  ? 274 LEU A O   1 
ATOM   2082 C CB  . LEU A 1 274 ? -5.538  30.012 3.066   1.00 34.34  ? 274 LEU A CB  1 
ATOM   2083 C CG  . LEU A 1 274 ? -6.790  30.849 3.042   1.00 38.59  ? 274 LEU A CG  1 
ATOM   2084 C CD1 . LEU A 1 274 ? -7.887  30.206 3.842   1.00 38.55  ? 274 LEU A CD1 1 
ATOM   2085 C CD2 . LEU A 1 274 ? -6.514  32.195 3.611   1.00 38.87  ? 274 LEU A CD2 1 
ATOM   2086 N N   . THR A 1 275 ? -5.633  28.676 -0.036  1.00 36.90  ? 275 THR A N   1 
ATOM   2087 C CA  . THR A 1 275 ? -5.109  28.741 -1.406  1.00 36.89  ? 275 THR A CA  1 
ATOM   2088 C C   . THR A 1 275 ? -5.843  29.869 -2.099  1.00 40.50  ? 275 THR A C   1 
ATOM   2089 O O   . THR A 1 275 ? -7.062  29.956 -1.999  1.00 39.74  ? 275 THR A O   1 
ATOM   2090 C CB  . THR A 1 275 ? -5.324  27.424 -2.148  1.00 42.05  ? 275 THR A CB  1 
ATOM   2091 O OG1 . THR A 1 275 ? -5.221  26.321 -1.249  1.00 43.78  ? 275 THR A OG1 1 
ATOM   2092 C CG2 . THR A 1 275 ? -4.376  27.255 -3.307  1.00 39.86  ? 275 THR A CG2 1 
ATOM   2093 N N   . GLY A 1 276 ? -5.092  30.734 -2.759  1.00 38.60  ? 276 GLY A N   1 
ATOM   2094 C CA  . GLY A 1 276 ? -5.633  31.893 -3.458  1.00 40.05  ? 276 GLY A CA  1 
ATOM   2095 C C   . GLY A 1 276 ? -4.575  32.777 -4.099  1.00 45.58  ? 276 GLY A C   1 
ATOM   2096 O O   . GLY A 1 276 ? -3.394  32.406 -4.127  1.00 44.58  ? 276 GLY A O   1 
ATOM   2097 N N   . PRO A 1 277 ? -4.974  33.948 -4.650  1.00 43.88  ? 277 PRO A N   1 
ATOM   2098 C CA  . PRO A 1 277 ? -3.994  34.837 -5.300  1.00 45.43  ? 277 PRO A CA  1 
ATOM   2099 C C   . PRO A 1 277 ? -2.999  35.422 -4.313  1.00 49.40  ? 277 PRO A C   1 
ATOM   2100 O O   . PRO A 1 277 ? -3.395  35.836 -3.209  1.00 48.94  ? 277 PRO A O   1 
ATOM   2101 C CB  . PRO A 1 277 ? -4.855  35.958 -5.891  1.00 48.61  ? 277 PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 277 ? -6.245  35.456 -5.837  1.00 52.91  ? 277 PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 277 ? -6.325  34.532 -4.686  1.00 46.15  ? 277 PRO A CD  1 
ATOM   2104 N N   . LYS A 1 278 ? -1.713  35.470 -4.726  1.00 44.63  ? 278 LYS A N   1 
ATOM   2105 C CA  . LYS A 1 278 ? -0.584  35.995 -3.954  1.00 43.09  ? 278 LYS A CA  1 
ATOM   2106 C C   . LYS A 1 278 ? -0.883  37.351 -3.241  1.00 43.72  ? 278 LYS A C   1 
ATOM   2107 O O   . LYS A 1 278 ? -0.690  37.406 -2.016  1.00 40.87  ? 278 LYS A O   1 
ATOM   2108 C CB  . LYS A 1 278 ? 0.692   36.053 -4.825  1.00 47.36  ? 278 LYS A CB  1 
ATOM   2109 C CG  . LYS A 1 278 ? 1.982   36.327 -4.056  1.00 65.88  ? 278 LYS A CG  1 
ATOM   2110 C CD  . LYS A 1 278 ? 3.219   35.806 -4.787  1.00 83.09  ? 278 LYS A CD  1 
ATOM   2111 C CE  . LYS A 1 278 ? 3.579   34.375 -4.436  1.00 97.15  ? 278 LYS A CE  1 
ATOM   2112 N NZ  . LYS A 1 278 ? 4.735   33.888 -5.235  1.00 110.39 ? 278 LYS A NZ  1 
ATOM   2113 N N   . PRO A 1 279 ? -1.418  38.408 -3.926  1.00 40.05  ? 279 PRO A N   1 
ATOM   2114 C CA  . PRO A 1 279 ? -1.697  39.672 -3.214  1.00 39.42  ? 279 PRO A CA  1 
ATOM   2115 C C   . PRO A 1 279 ? -2.539  39.492 -1.957  1.00 45.77  ? 279 PRO A C   1 
ATOM   2116 O O   . PRO A 1 279 ? -2.168  39.987 -0.887  1.00 45.84  ? 279 PRO A O   1 
ATOM   2117 C CB  . PRO A 1 279 ? -2.427  40.515 -4.261  1.00 41.88  ? 279 PRO A CB  1 
ATOM   2118 C CG  . PRO A 1 279 ? -1.906  40.027 -5.530  1.00 47.47  ? 279 PRO A CG  1 
ATOM   2119 C CD  . PRO A 1 279 ? -1.729  38.546 -5.366  1.00 42.40  ? 279 PRO A CD  1 
ATOM   2120 N N   . LEU A 1 280 ? -3.640  38.730 -2.079  1.00 42.90  ? 280 LEU A N   1 
ATOM   2121 C CA  . LEU A 1 280 ? -4.565  38.458 -0.983  1.00 41.05  ? 280 LEU A CA  1 
ATOM   2122 C C   . LEU A 1 280 ? -3.989  37.510 0.067   1.00 45.08  ? 280 LEU A C   1 
ATOM   2123 O O   . LEU A 1 280 ? -4.174  37.783 1.257   1.00 45.78  ? 280 LEU A O   1 
ATOM   2124 C CB  . LEU A 1 280 ? -5.931  37.975 -1.492  1.00 40.61  ? 280 LEU A CB  1 
ATOM   2125 C CG  . LEU A 1 280 ? -6.609  38.814 -2.563  1.00 44.87  ? 280 LEU A CG  1 
ATOM   2126 C CD1 . LEU A 1 280 ? -7.788  38.076 -3.124  1.00 45.50  ? 280 LEU A CD1 1 
ATOM   2127 C CD2 . LEU A 1 280 ? -7.019  40.181 -2.039  1.00 44.55  ? 280 LEU A CD2 1 
ATOM   2128 N N   . ILE A 1 281 ? -3.269  36.431 -0.351  1.00 40.10  ? 281 ILE A N   1 
ATOM   2129 C CA  . ILE A 1 281 ? -2.613  35.483 0.576   1.00 38.45  ? 281 ILE A CA  1 
ATOM   2130 C C   . ILE A 1 281 ? -1.578  36.233 1.453   1.00 40.63  ? 281 ILE A C   1 
ATOM   2131 O O   . ILE A 1 281 ? -1.514  36.009 2.664   1.00 37.39  ? 281 ILE A O   1 
ATOM   2132 C CB  . ILE A 1 281 ? -2.034  34.230 -0.171  1.00 41.51  ? 281 ILE A CB  1 
ATOM   2133 C CG1 . ILE A 1 281 ? -3.160  33.359 -0.798  1.00 42.25  ? 281 ILE A CG1 1 
ATOM   2134 C CG2 . ILE A 1 281 ? -1.095  33.376 0.704   1.00 40.32  ? 281 ILE A CG2 1 
ATOM   2135 C CD1 . ILE A 1 281 ? -4.151  32.611 0.194   1.00 48.65  ? 281 ILE A CD1 1 
ATOM   2136 N N   . GLU A 1 282 ? -0.835  37.168 0.832   1.00 39.52  ? 282 GLU A N   1 
ATOM   2137 C CA  . GLU A 1 282 ? 0.159   38.024 1.483   1.00 39.74  ? 282 GLU A CA  1 
ATOM   2138 C C   . GLU A 1 282 ? -0.494  38.784 2.669   1.00 42.05  ? 282 GLU A C   1 
ATOM   2139 O O   . GLU A 1 282 ? -0.040  38.643 3.818   1.00 40.49  ? 282 GLU A O   1 
ATOM   2140 C CB  . GLU A 1 282 ? 0.761   38.971 0.431   1.00 42.75  ? 282 GLU A CB  1 
ATOM   2141 C CG  . GLU A 1 282 ? 1.670   40.076 0.942   1.00 55.68  ? 282 GLU A CG  1 
ATOM   2142 C CD  . GLU A 1 282 ? 2.231   40.955 -0.162  1.00 79.02  ? 282 GLU A CD  1 
ATOM   2143 O OE1 . GLU A 1 282 ? 1.458   41.378 -1.056  1.00 60.91  ? 282 GLU A OE1 1 
ATOM   2144 O OE2 . GLU A 1 282 ? 3.453   41.225 -0.127  1.00 80.88  ? 282 GLU A OE2 1 
ATOM   2145 N N   . ARG A 1 283 ? -1.610  39.507 2.395   1.00 37.36  ? 283 ARG A N   1 
ATOM   2146 C CA  . ARG A 1 283 ? -2.363  40.250 3.413   1.00 36.15  ? 283 ARG A CA  1 
ATOM   2147 C C   . ARG A 1 283 ? -2.741  39.352 4.607   1.00 38.93  ? 283 ARG A C   1 
ATOM   2148 O O   . ARG A 1 283 ? -2.623  39.793 5.764   1.00 37.57  ? 283 ARG A O   1 
ATOM   2149 C CB  . ARG A 1 283 ? -3.630  40.891 2.820   1.00 35.58  ? 283 ARG A CB  1 
ATOM   2150 C CG  . ARG A 1 283 ? -3.415  41.851 1.653   1.00 41.68  ? 283 ARG A CG  1 
ATOM   2151 C CD  . ARG A 1 283 ? -2.719  43.124 2.072   1.00 46.27  ? 283 ARG A CD  1 
ATOM   2152 N NE  . ARG A 1 283 ? -1.290  43.064 1.759   1.00 45.47  ? 283 ARG A NE  1 
ATOM   2153 C CZ  . ARG A 1 283 ? -0.369  43.851 2.303   1.00 49.08  ? 283 ARG A CZ  1 
ATOM   2154 N NH1 . ARG A 1 283 ? 0.903   43.727 1.957   1.00 46.32  ? 283 ARG A NH1 1 
ATOM   2155 N NH2 . ARG A 1 283 ? -0.712  44.763 3.202   1.00 20.54  ? 283 ARG A NH2 1 
ATOM   2156 N N   . VAL A 1 284 ? -3.152  38.080 4.312   1.00 33.58  ? 284 VAL A N   1 
ATOM   2157 C CA  . VAL A 1 284 ? -3.517  37.080 5.318   1.00 31.42  ? 284 VAL A CA  1 
ATOM   2158 C C   . VAL A 1 284 ? -2.286  36.681 6.163   1.00 34.97  ? 284 VAL A C   1 
ATOM   2159 O O   . VAL A 1 284 ? -2.382  36.715 7.391   1.00 35.06  ? 284 VAL A O   1 
ATOM   2160 C CB  . VAL A 1 284 ? -4.300  35.881 4.705   1.00 34.31  ? 284 VAL A CB  1 
ATOM   2161 C CG1 . VAL A 1 284 ? -4.416  34.695 5.670   1.00 32.37  ? 284 VAL A CG1 1 
ATOM   2162 C CG2 . VAL A 1 284 ? -5.677  36.322 4.243   1.00 34.60  ? 284 VAL A CG2 1 
ATOM   2163 N N   . ILE A 1 285 ? -1.130  36.371 5.511   1.00 30.05  ? 285 ILE A N   1 
ATOM   2164 C CA  . ILE A 1 285 ? 0.138   36.019 6.184   1.00 28.08  ? 285 ILE A CA  1 
ATOM   2165 C C   . ILE A 1 285 ? 0.585   37.176 7.085   1.00 29.69  ? 285 ILE A C   1 
ATOM   2166 O O   . ILE A 1 285 ? 0.988   36.924 8.223   1.00 27.81  ? 285 ILE A O   1 
ATOM   2167 C CB  . ILE A 1 285 ? 1.272   35.531 5.216   1.00 30.93  ? 285 ILE A CB  1 
ATOM   2168 C CG1 . ILE A 1 285 ? 0.860   34.265 4.443   1.00 31.22  ? 285 ILE A CG1 1 
ATOM   2169 C CG2 . ILE A 1 285 ? 2.577   35.277 5.975   1.00 30.39  ? 285 ILE A CG2 1 
ATOM   2170 C CD1 . ILE A 1 285 ? 1.642   34.011 3.184   1.00 36.26  ? 285 ILE A CD1 1 
ATOM   2171 N N   . LEU A 1 286 ? 0.474   38.445 6.596   1.00 26.58  ? 286 LEU A N   1 
ATOM   2172 C CA  . LEU A 1 286 ? 0.842   39.615 7.423   1.00 26.79  ? 286 LEU A CA  1 
ATOM   2173 C C   . LEU A 1 286 ? -0.012  39.799 8.704   1.00 31.03  ? 286 LEU A C   1 
ATOM   2174 O O   . LEU A 1 286 ? 0.536   40.226 9.720   1.00 29.61  ? 286 LEU A O   1 
ATOM   2175 C CB  . LEU A 1 286 ? 0.903   40.928 6.639   1.00 27.40  ? 286 LEU A CB  1 
ATOM   2176 C CG  . LEU A 1 286 ? 1.940   41.046 5.540   1.00 31.46  ? 286 LEU A CG  1 
ATOM   2177 C CD1 . LEU A 1 286 ? 1.785   42.350 4.846   1.00 32.11  ? 286 LEU A CD1 1 
ATOM   2178 C CD2 . LEU A 1 286 ? 3.345   40.926 6.083   1.00 32.33  ? 286 LEU A CD2 1 
ATOM   2179 N N   . HIS A 1 287 ? -1.331  39.456 8.660   1.00 28.22  ? 287 HIS A N   1 
ATOM   2180 C CA  . HIS A 1 287 ? -2.213  39.531 9.826   1.00 27.42  ? 287 HIS A CA  1 
ATOM   2181 C C   . HIS A 1 287 ? -1.815  38.416 10.813  1.00 32.62  ? 287 HIS A C   1 
ATOM   2182 O O   . HIS A 1 287 ? -1.673  38.675 12.015  1.00 32.11  ? 287 HIS A O   1 
ATOM   2183 C CB  . HIS A 1 287 ? -3.686  39.352 9.422   1.00 27.91  ? 287 HIS A CB  1 
ATOM   2184 C CG  . HIS A 1 287 ? -4.672  39.862 10.435  1.00 31.09  ? 287 HIS A CG  1 
ATOM   2185 N ND1 . HIS A 1 287 ? -6.027  39.953 10.140  1.00 32.97  ? 287 HIS A ND1 1 
ATOM   2186 C CD2 . HIS A 1 287 ? -4.471  40.308 11.702  1.00 32.40  ? 287 HIS A CD2 1 
ATOM   2187 C CE1 . HIS A 1 287 ? -6.591  40.460 11.223  1.00 32.27  ? 287 HIS A CE1 1 
ATOM   2188 N NE2 . HIS A 1 287 ? -5.696  40.683 12.191  1.00 32.20  ? 287 HIS A NE2 1 
ATOM   2189 N N   . ILE A 1 288 ? -1.636  37.178 10.298  1.00 29.39  ? 288 ILE A N   1 
ATOM   2190 C CA  . ILE A 1 288 ? -1.250  36.007 11.086  1.00 29.03  ? 288 ILE A CA  1 
ATOM   2191 C C   . ILE A 1 288 ? 0.020   36.307 11.858  1.00 33.81  ? 288 ILE A C   1 
ATOM   2192 O O   . ILE A 1 288 ? 0.081   36.017 13.057  1.00 33.96  ? 288 ILE A O   1 
ATOM   2193 C CB  . ILE A 1 288 ? -1.161  34.721 10.211  1.00 32.08  ? 288 ILE A CB  1 
ATOM   2194 C CG1 . ILE A 1 288 ? -2.579  34.228 9.869   1.00 32.64  ? 288 ILE A CG1 1 
ATOM   2195 C CG2 . ILE A 1 288 ? -0.335  33.605 10.910  1.00 31.75  ? 288 ILE A CG2 1 
ATOM   2196 C CD1 . ILE A 1 288 ? -2.638  33.158 8.805   1.00 44.98  ? 288 ILE A CD1 1 
ATOM   2197 N N   . GLN A 1 289 ? 0.983   36.989 11.177  1.00 30.27  ? 289 GLN A N   1 
ATOM   2198 C CA  . GLN A 1 289 ? 2.276   37.436 11.691  1.00 29.88  ? 289 GLN A CA  1 
ATOM   2199 C C   . GLN A 1 289 ? 2.139   38.313 12.967  1.00 33.24  ? 289 GLN A C   1 
ATOM   2200 O O   . GLN A 1 289 ? 3.074   38.373 13.767  1.00 33.06  ? 289 GLN A O   1 
ATOM   2201 C CB  . GLN A 1 289 ? 3.036   38.169 10.584  1.00 31.74  ? 289 GLN A CB  1 
ATOM   2202 C CG  . GLN A 1 289 ? 4.551   38.186 10.763  1.00 46.40  ? 289 GLN A CG  1 
ATOM   2203 C CD  . GLN A 1 289 ? 5.222   38.763 9.543   1.00 56.62  ? 289 GLN A CD  1 
ATOM   2204 O OE1 . GLN A 1 289 ? 5.407   39.983 9.425   1.00 52.09  ? 289 GLN A OE1 1 
ATOM   2205 N NE2 . GLN A 1 289 ? 5.527   37.900 8.574   1.00 39.45  ? 289 GLN A NE2 1 
ATOM   2206 N N   . VAL A 1 290 ? 0.974   38.967 13.155  1.00 28.69  ? 290 VAL A N   1 
ATOM   2207 C CA  . VAL A 1 290 ? 0.693   39.765 14.350  1.00 28.59  ? 290 VAL A CA  1 
ATOM   2208 C C   . VAL A 1 290 ? -0.311  39.090 15.327  1.00 32.24  ? 290 VAL A C   1 
ATOM   2209 O O   . VAL A 1 290 ? -0.607  39.641 16.386  1.00 30.87  ? 290 VAL A O   1 
ATOM   2210 C CB  . VAL A 1 290 ? 0.407   41.282 14.096  1.00 33.02  ? 290 VAL A CB  1 
ATOM   2211 C CG1 . VAL A 1 290 ? 1.541   41.951 13.320  1.00 33.12  ? 290 VAL A CG1 1 
ATOM   2212 C CG2 . VAL A 1 290 ? -0.951  41.518 13.421  1.00 32.94  ? 290 VAL A CG2 1 
ATOM   2213 N N   . SER A 1 291 ? -0.830  37.911 14.975  1.00 30.64  ? 291 SER A N   1 
ATOM   2214 C CA  . SER A 1 291 ? -1.738  37.197 15.870  1.00 31.41  ? 291 SER A CA  1 
ATOM   2215 C C   . SER A 1 291 ? -1.000  36.030 16.531  1.00 35.64  ? 291 SER A C   1 
ATOM   2216 O O   . SER A 1 291 ? -0.483  36.173 17.626  1.00 35.97  ? 291 SER A O   1 
ATOM   2217 C CB  . SER A 1 291 ? -3.004  36.706 15.152  1.00 36.75  ? 291 SER A CB  1 
ATOM   2218 O OG  . SER A 1 291 ? -3.395  37.502 14.046  1.00 52.20  ? 291 SER A OG  1 
ATOM   2219 N N   . THR A 1 292 ? -0.916  34.897 15.840  1.00 31.98  ? 292 THR A N   1 
ATOM   2220 C CA  . THR A 1 292 ? -0.338  33.656 16.347  1.00 31.09  ? 292 THR A CA  1 
ATOM   2221 C C   . THR A 1 292 ? 1.128   33.455 15.991  1.00 36.04  ? 292 THR A C   1 
ATOM   2222 O O   . THR A 1 292 ? 1.687   32.436 16.420  1.00 36.01  ? 292 THR A O   1 
ATOM   2223 C CB  . THR A 1 292 ? -1.169  32.481 15.817  1.00 30.96  ? 292 THR A CB  1 
ATOM   2224 O OG1 . THR A 1 292 ? -1.307  32.642 14.404  1.00 27.13  ? 292 THR A OG1 1 
ATOM   2225 C CG2 . THR A 1 292 ? -2.548  32.406 16.449  1.00 30.21  ? 292 THR A CG2 1 
ATOM   2226 N N   . LEU A 1 293 ? 1.758   34.411 15.221  1.00 30.99  ? 293 LEU A N   1 
ATOM   2227 C CA  . LEU A 1 293 ? 3.118   34.358 14.648  1.00 29.81  ? 293 LEU A CA  1 
ATOM   2228 C C   . LEU A 1 293 ? 3.241   33.241 13.585  1.00 34.42  ? 293 LEU A C   1 
ATOM   2229 O O   . LEU A 1 293 ? 3.733   33.512 12.494  1.00 36.22  ? 293 LEU A O   1 
ATOM   2230 C CB  . LEU A 1 293 ? 4.260   34.214 15.684  1.00 29.53  ? 293 LEU A CB  1 
ATOM   2231 C CG  . LEU A 1 293 ? 4.462   35.259 16.796  1.00 33.30  ? 293 LEU A CG  1 
ATOM   2232 C CD1 . LEU A 1 293 ? 5.827   35.111 17.404  1.00 32.98  ? 293 LEU A CD1 1 
ATOM   2233 C CD2 . LEU A 1 293 ? 4.371   36.671 16.282  1.00 36.62  ? 293 LEU A CD2 1 
ATOM   2234 N N   . HIS A 1 294 ? 2.796   31.997 13.893  1.00 29.61  ? 294 HIS A N   1 
ATOM   2235 C CA  . HIS A 1 294 ? 2.865   30.830 12.994  1.00 29.90  ? 294 HIS A CA  1 
ATOM   2236 C C   . HIS A 1 294 ? 2.046   29.653 13.549  1.00 31.61  ? 294 HIS A C   1 
ATOM   2237 O O   . HIS A 1 294 ? 1.770   29.638 14.758  1.00 29.31  ? 294 HIS A O   1 
ATOM   2238 C CB  . HIS A 1 294 ? 4.348   30.388 12.791  1.00 31.72  ? 294 HIS A CB  1 
ATOM   2239 C CG  . HIS A 1 294 ? 5.072   29.952 14.046  1.00 35.02  ? 294 HIS A CG  1 
ATOM   2240 N ND1 . HIS A 1 294 ? 5.024   28.639 14.498  1.00 36.29  ? 294 HIS A ND1 1 
ATOM   2241 C CD2 . HIS A 1 294 ? 5.847   30.668 14.896  1.00 36.73  ? 294 HIS A CD2 1 
ATOM   2242 C CE1 . HIS A 1 294 ? 5.769   28.604 15.593  1.00 35.69  ? 294 HIS A CE1 1 
ATOM   2243 N NE2 . HIS A 1 294 ? 6.277   29.801 15.878  1.00 36.23  ? 294 HIS A NE2 1 
ATOM   2244 N N   . PRO A 1 295 ? 1.686   28.634 12.725  1.00 29.67  ? 295 PRO A N   1 
ATOM   2245 C CA  . PRO A 1 295 ? 1.017   27.441 13.294  1.00 29.59  ? 295 PRO A CA  1 
ATOM   2246 C C   . PRO A 1 295 ? 2.072   26.566 14.003  1.00 32.62  ? 295 PRO A C   1 
ATOM   2247 O O   . PRO A 1 295 ? 3.220   26.534 13.554  1.00 32.48  ? 295 PRO A O   1 
ATOM   2248 C CB  . PRO A 1 295 ? 0.411   26.727 12.063  1.00 31.50  ? 295 PRO A CB  1 
ATOM   2249 C CG  . PRO A 1 295 ? 0.756   27.595 10.852  1.00 36.80  ? 295 PRO A CG  1 
ATOM   2250 C CD  . PRO A 1 295 ? 1.911   28.470 11.274  1.00 32.53  ? 295 PRO A CD  1 
ATOM   2251 N N   . SER A 1 296 ? 1.701   25.904 15.126  1.00 27.96  ? 296 SER A N   1 
ATOM   2252 C CA  . SER A 1 296 ? 2.573   25.047 15.943  1.00 27.56  ? 296 SER A CA  1 
ATOM   2253 C C   . SER A 1 296 ? 3.606   24.276 15.107  1.00 32.19  ? 296 SER A C   1 
ATOM   2254 O O   . SER A 1 296 ? 3.220   23.576 14.172  1.00 33.65  ? 296 SER A O   1 
ATOM   2255 C CB  . SER A 1 296 ? 1.727   24.089 16.781  1.00 29.68  ? 296 SER A CB  1 
ATOM   2256 O OG  . SER A 1 296 ? 2.519   23.155 17.497  1.00 32.77  ? 296 SER A OG  1 
ATOM   2257 N N   . THR A 1 297 ? 4.911   24.458 15.396  1.00 28.40  ? 297 THR A N   1 
ATOM   2258 C CA  . THR A 1 297 ? 5.998   23.795 14.651  1.00 28.59  ? 297 THR A CA  1 
ATOM   2259 C C   . THR A 1 297 ? 5.901   22.288 14.844  1.00 33.47  ? 297 THR A C   1 
ATOM   2260 O O   . THR A 1 297 ? 5.968   21.544 13.858  1.00 33.78  ? 297 THR A O   1 
ATOM   2261 C CB  . THR A 1 297 ? 7.396   24.353 15.024  1.00 32.41  ? 297 THR A CB  1 
ATOM   2262 O OG1 . THR A 1 297 ? 7.360   25.782 15.132  1.00 33.94  ? 297 THR A OG1 1 
ATOM   2263 C CG2 . THR A 1 297 ? 8.477   23.950 14.031  1.00 27.07  ? 297 THR A CG2 1 
ATOM   2264 N N   . PHE A 1 298 ? 5.682   21.845 16.107  1.00 29.80  ? 298 PHE A N   1 
ATOM   2265 C CA  . PHE A 1 298 ? 5.549   20.427 16.466  1.00 29.38  ? 298 PHE A CA  1 
ATOM   2266 C C   . PHE A 1 298 ? 4.444   19.759 15.635  1.00 32.85  ? 298 PHE A C   1 
ATOM   2267 O O   . PHE A 1 298 ? 4.701   18.739 15.001  1.00 33.11  ? 298 PHE A O   1 
ATOM   2268 C CB  . PHE A 1 298 ? 5.266   20.279 17.980  1.00 30.69  ? 298 PHE A CB  1 
ATOM   2269 C CG  . PHE A 1 298 ? 5.423   18.890 18.554  1.00 32.84  ? 298 PHE A CG  1 
ATOM   2270 C CD1 . PHE A 1 298 ? 4.468   17.904 18.314  1.00 36.92  ? 298 PHE A CD1 1 
ATOM   2271 C CD2 . PHE A 1 298 ? 6.497   18.578 19.380  1.00 35.81  ? 298 PHE A CD2 1 
ATOM   2272 C CE1 . PHE A 1 298 ? 4.616   16.612 18.847  1.00 38.30  ? 298 PHE A CE1 1 
ATOM   2273 C CE2 . PHE A 1 298 ? 6.640   17.291 19.921  1.00 39.21  ? 298 PHE A CE2 1 
ATOM   2274 C CZ  . PHE A 1 298 ? 5.699   16.319 19.653  1.00 37.38  ? 298 PHE A CZ  1 
ATOM   2275 N N   . ASN A 1 299 ? 3.234   20.352 15.625  1.00 28.88  ? 299 ASN A N   1 
ATOM   2276 C CA  . ASN A 1 299 ? 2.052   19.820 14.943  1.00 28.89  ? 299 ASN A CA  1 
ATOM   2277 C C   . ASN A 1 299 ? 2.191   19.665 13.423  1.00 33.66  ? 299 ASN A C   1 
ATOM   2278 O O   . ASN A 1 299 ? 1.666   18.689 12.855  1.00 33.20  ? 299 ASN A O   1 
ATOM   2279 C CB  . ASN A 1 299 ? 0.791   20.589 15.338  1.00 27.53  ? 299 ASN A CB  1 
ATOM   2280 C CG  . ASN A 1 299 ? 0.468   20.532 16.818  1.00 39.65  ? 299 ASN A CG  1 
ATOM   2281 O OD1 . ASN A 1 299 ? 1.140   19.865 17.617  1.00 34.98  ? 299 ASN A OD1 1 
ATOM   2282 N ND2 . ASN A 1 299 ? -0.583  21.233 17.214  1.00 23.69  ? 299 ASN A ND2 1 
ATOM   2283 N N   . GLN A 1 300 ? 2.924   20.607 12.782  1.00 28.34  ? 300 GLN A N   1 
ATOM   2284 C CA  . GLN A 1 300 ? 3.200   20.598 11.350  1.00 28.24  ? 300 GLN A CA  1 
ATOM   2285 C C   . GLN A 1 300 ? 4.164   19.447 10.994  1.00 33.55  ? 300 GLN A C   1 
ATOM   2286 O O   . GLN A 1 300 ? 3.919   18.704 10.033  1.00 33.04  ? 300 GLN A O   1 
ATOM   2287 C CB  . GLN A 1 300 ? 3.834   21.927 10.933  1.00 29.25  ? 300 GLN A CB  1 
ATOM   2288 C CG  . GLN A 1 300 ? 2.874   23.095 10.913  1.00 29.05  ? 300 GLN A CG  1 
ATOM   2289 C CD  . GLN A 1 300 ? 3.529   24.280 10.286  1.00 31.82  ? 300 GLN A CD  1 
ATOM   2290 O OE1 . GLN A 1 300 ? 3.617   24.376 9.060   1.00 25.46  ? 300 GLN A OE1 1 
ATOM   2291 N NE2 . GLN A 1 300 ? 4.063   25.169 11.113  1.00 15.85  ? 300 GLN A NE2 1 
ATOM   2292 N N   . LEU A 1 301 ? 5.263   19.312 11.789  1.00 30.23  ? 301 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 301 ? 6.330   18.304 11.665  1.00 30.12  ? 301 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 301 ? 5.764   16.927 11.837  1.00 32.96  ? 301 LEU A C   1 
ATOM   2295 O O   . LEU A 1 301 ? 6.267   16.014 11.231  1.00 32.32  ? 301 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 301 ? 7.395   18.541 12.752  1.00 30.45  ? 301 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 301 ? 8.821   19.051 12.408  1.00 35.45  ? 301 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 301 ? 9.048   19.336 10.929  1.00 35.99  ? 301 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 301 ? 9.193   20.222 13.260  1.00 35.62  ? 301 LEU A CD2 1 
ATOM   2300 N N   . MET A 1 302 ? 4.725   16.774 12.672  1.00 31.41  ? 302 MET A N   1 
ATOM   2301 C CA  . MET A 1 302 ? 4.017   15.515 12.921  1.00 32.41  ? 302 MET A CA  1 
ATOM   2302 C C   . MET A 1 302 ? 3.321   15.058 11.637  1.00 35.08  ? 302 MET A C   1 
ATOM   2303 O O   . MET A 1 302 ? 3.427   13.890 11.276  1.00 37.94  ? 302 MET A O   1 
ATOM   2304 C CB  . MET A 1 302 ? 2.948   15.722 13.992  1.00 34.94  ? 302 MET A CB  1 
ATOM   2305 C CG  . MET A 1 302 ? 3.422   15.540 15.410  1.00 40.33  ? 302 MET A CG  1 
ATOM   2306 S SD  . MET A 1 302 ? 1.981   15.562 16.523  1.00 45.53  ? 302 MET A SD  1 
ATOM   2307 C CE  . MET A 1 302 ? 1.260   13.932 16.171  1.00 42.32  ? 302 MET A CE  1 
ATOM   2308 N N   . ILE A 1 303 ? 2.621   15.989 10.947  1.00 26.66  ? 303 ILE A N   1 
ATOM   2309 C CA  . ILE A 1 303 ? 1.880   15.774 9.708   1.00 24.13  ? 303 ILE A CA  1 
ATOM   2310 C C   . ILE A 1 303 ? 2.843   15.607 8.552   1.00 27.73  ? 303 ILE A C   1 
ATOM   2311 O O   . ILE A 1 303 ? 2.706   14.648 7.799   1.00 27.99  ? 303 ILE A O   1 
ATOM   2312 C CB  . ILE A 1 303 ? 0.800   16.881 9.513   1.00 25.67  ? 303 ILE A CB  1 
ATOM   2313 C CG1 . ILE A 1 303 ? -0.343  16.712 10.565  1.00 25.42  ? 303 ILE A CG1 1 
ATOM   2314 C CG2 . ILE A 1 303 ? 0.248   16.939 8.088   1.00 24.85  ? 303 ILE A CG2 1 
ATOM   2315 C CD1 . ILE A 1 303 ? -1.144  18.000 10.973  1.00 28.00  ? 303 ILE A CD1 1 
ATOM   2316 N N   . SER A 1 304 ? 3.860   16.468 8.448   1.00 25.12  ? 304 SER A N   1 
ATOM   2317 C CA  . SER A 1 304 ? 4.845   16.344 7.366   1.00 26.62  ? 304 SER A CA  1 
ATOM   2318 C C   . SER A 1 304 ? 5.653   15.026 7.414   1.00 34.55  ? 304 SER A C   1 
ATOM   2319 O O   . SER A 1 304 ? 5.935   14.456 6.351   1.00 37.54  ? 304 SER A O   1 
ATOM   2320 C CB  . SER A 1 304 ? 5.735   17.584 7.261   1.00 29.76  ? 304 SER A CB  1 
ATOM   2321 O OG  . SER A 1 304 ? 6.911   17.533 8.057   1.00 40.87  ? 304 SER A OG  1 
ATOM   2322 N N   . GLN A 1 305 ? 5.973   14.516 8.630   1.00 30.94  ? 305 GLN A N   1 
ATOM   2323 C CA  . GLN A 1 305 ? 6.702   13.248 8.792   1.00 32.38  ? 305 GLN A CA  1 
ATOM   2324 C C   . GLN A 1 305 ? 5.791   12.073 8.375   1.00 37.65  ? 305 GLN A C   1 
ATOM   2325 O O   . GLN A 1 305 ? 6.248   11.117 7.714   1.00 38.35  ? 305 GLN A O   1 
ATOM   2326 C CB  . GLN A 1 305 ? 7.238   13.052 10.236  1.00 33.36  ? 305 GLN A CB  1 
ATOM   2327 C CG  . GLN A 1 305 ? 8.486   13.870 10.617  1.00 45.18  ? 305 GLN A CG  1 
ATOM   2328 C CD  . GLN A 1 305 ? 9.717   13.659 9.761   1.00 75.96  ? 305 GLN A CD  1 
ATOM   2329 O OE1 . GLN A 1 305 ? 10.151  14.563 9.030   1.00 74.25  ? 305 GLN A OE1 1 
ATOM   2330 N NE2 . GLN A 1 305 ? 10.342  12.487 9.876   1.00 70.21  ? 305 GLN A NE2 1 
ATOM   2331 N N   . LEU A 1 306 ? 4.490   12.169 8.756   1.00 32.16  ? 306 LEU A N   1 
ATOM   2332 C CA  . LEU A 1 306 ? 3.485   11.180 8.401   1.00 31.61  ? 306 LEU A CA  1 
ATOM   2333 C C   . LEU A 1 306 ? 3.377   11.166 6.873   1.00 38.85  ? 306 LEU A C   1 
ATOM   2334 O O   . LEU A 1 306 ? 3.485   10.100 6.267   1.00 39.49  ? 306 LEU A O   1 
ATOM   2335 C CB  . LEU A 1 306 ? 2.139   11.544 9.063   1.00 29.66  ? 306 LEU A CB  1 
ATOM   2336 C CG  . LEU A 1 306 ? 0.875   10.764 8.641   1.00 33.16  ? 306 LEU A CG  1 
ATOM   2337 C CD1 . LEU A 1 306 ? 0.840   9.380  9.243   1.00 33.06  ? 306 LEU A CD1 1 
ATOM   2338 C CD2 . LEU A 1 306 ? -0.387  11.521 9.038   1.00 33.48  ? 306 LEU A CD2 1 
ATOM   2339 N N   . LEU A 1 307 ? 3.249   12.368 6.254   1.00 36.31  ? 307 LEU A N   1 
ATOM   2340 C CA  . LEU A 1 307 ? 3.117   12.538 4.799   1.00 36.77  ? 307 LEU A CA  1 
ATOM   2341 C C   . LEU A 1 307 ? 4.322   12.036 4.039   1.00 41.72  ? 307 LEU A C   1 
ATOM   2342 O O   . LEU A 1 307 ? 4.163   11.439 2.975   1.00 42.51  ? 307 LEU A O   1 
ATOM   2343 C CB  . LEU A 1 307 ? 2.783   13.989 4.404   1.00 35.75  ? 307 LEU A CB  1 
ATOM   2344 C CG  . LEU A 1 307 ? 1.441   14.556 4.892   1.00 38.02  ? 307 LEU A CG  1 
ATOM   2345 C CD1 . LEU A 1 307 ? 1.325   16.012 4.542   1.00 37.96  ? 307 LEU A CD1 1 
ATOM   2346 C CD2 . LEU A 1 307 ? 0.243   13.743 4.385   1.00 37.98  ? 307 LEU A CD2 1 
ATOM   2347 N N   . HIS A 1 308 ? 5.518   12.219 4.603   1.00 37.75  ? 308 HIS A N   1 
ATOM   2348 C CA  . HIS A 1 308 ? 6.727   11.716 3.960   1.00 38.94  ? 308 HIS A CA  1 
ATOM   2349 C C   . HIS A 1 308 ? 6.751   10.183 3.893   1.00 40.00  ? 308 HIS A C   1 
ATOM   2350 O O   . HIS A 1 308 ? 7.263   9.623  2.923   1.00 39.13  ? 308 HIS A O   1 
ATOM   2351 C CB  . HIS A 1 308 ? 7.997   12.261 4.635   1.00 40.19  ? 308 HIS A CB  1 
ATOM   2352 C CG  . HIS A 1 308 ? 9.244   11.776 3.964   1.00 45.61  ? 308 HIS A CG  1 
ATOM   2353 N ND1 . HIS A 1 308 ? 9.929   10.667 4.430   1.00 48.51  ? 308 HIS A ND1 1 
ATOM   2354 C CD2 . HIS A 1 308 ? 9.836   12.208 2.827   1.00 48.64  ? 308 HIS A CD2 1 
ATOM   2355 C CE1 . HIS A 1 308 ? 10.942  10.493 3.597   1.00 49.46  ? 308 HIS A CE1 1 
ATOM   2356 N NE2 . HIS A 1 308 ? 10.926  11.390 2.615   1.00 49.98  ? 308 HIS A NE2 1 
ATOM   2357 N N   . GLU A 1 309 ? 6.208   9.528  4.938   1.00 36.40  ? 309 GLU A N   1 
ATOM   2358 C CA  . GLU A 1 309 ? 6.128   8.074  5.103   1.00 37.03  ? 309 GLU A CA  1 
ATOM   2359 C C   . GLU A 1 309 ? 5.096   7.466  4.136   1.00 40.50  ? 309 GLU A C   1 
ATOM   2360 O O   . GLU A 1 309 ? 5.414   6.541  3.393   1.00 39.71  ? 309 GLU A O   1 
ATOM   2361 C CB  . GLU A 1 309 ? 5.767   7.754  6.561   1.00 37.69  ? 309 GLU A CB  1 
ATOM   2362 C CG  . GLU A 1 309 ? 6.310   6.427  7.059   1.00 55.67  ? 309 GLU A CG  1 
ATOM   2363 C CD  . GLU A 1 309 ? 7.786   6.400  7.404   1.00 90.86  ? 309 GLU A CD  1 
ATOM   2364 O OE1 . GLU A 1 309 ? 8.261   7.332  8.096   1.00 87.60  ? 309 GLU A OE1 1 
ATOM   2365 O OE2 . GLU A 1 309 ? 8.465   5.428  6.999   1.00 93.32  ? 309 GLU A OE2 1 
ATOM   2366 N N   . TRP A 1 310 ? 3.882   8.031  4.130   1.00 37.90  ? 310 TRP A N   1 
ATOM   2367 C CA  . TRP A 1 310 ? 2.747   7.648  3.308   1.00 39.18  ? 310 TRP A CA  1 
ATOM   2368 C C   . TRP A 1 310 ? 2.931   7.927  1.800   1.00 43.13  ? 310 TRP A C   1 
ATOM   2369 O O   . TRP A 1 310 ? 2.727   7.013  0.999   1.00 43.46  ? 310 TRP A O   1 
ATOM   2370 C CB  . TRP A 1 310 ? 1.514   8.430  3.784   1.00 37.86  ? 310 TRP A CB  1 
ATOM   2371 C CG  . TRP A 1 310 ? 0.688   7.817  4.879   1.00 39.28  ? 310 TRP A CG  1 
ATOM   2372 C CD1 . TRP A 1 310 ? 0.852   6.593  5.465   1.00 43.21  ? 310 TRP A CD1 1 
ATOM   2373 C CD2 . TRP A 1 310 ? -0.460  8.407  5.497   1.00 37.96  ? 310 TRP A CD2 1 
ATOM   2374 N NE1 . TRP A 1 310 ? -0.120  6.391  6.422   1.00 42.02  ? 310 TRP A NE1 1 
ATOM   2375 C CE2 . TRP A 1 310 ? -0.928  7.497  6.474   1.00 42.05  ? 310 TRP A CE2 1 
ATOM   2376 C CE3 . TRP A 1 310 ? -1.140  9.620  5.322   1.00 38.36  ? 310 TRP A CE3 1 
ATOM   2377 C CZ2 . TRP A 1 310 ? -2.034  7.772  7.284   1.00 40.14  ? 310 TRP A CZ2 1 
ATOM   2378 C CZ3 . TRP A 1 310 ? -2.232  9.891  6.132   1.00 39.12  ? 310 TRP A CZ3 1 
ATOM   2379 C CH2 . TRP A 1 310 ? -2.677  8.966  7.089   1.00 39.46  ? 310 TRP A CH2 1 
ATOM   2380 N N   . GLY A 1 311 ? 3.225   9.198  1.441   1.00 38.44  ? 311 GLY A N   1 
ATOM   2381 C CA  . GLY A 1 311 ? 3.297   9.694  0.070   1.00 38.28  ? 311 GLY A CA  1 
ATOM   2382 C C   . GLY A 1 311 ? 1.882   9.980  -0.399  1.00 42.80  ? 311 GLY A C   1 
ATOM   2383 O O   . GLY A 1 311 ? 0.937   9.847  0.390   1.00 40.68  ? 311 GLY A O   1 
ATOM   2384 N N   . GLU A 1 312 ? 1.705   10.360 -1.685  1.00 41.21  ? 312 GLU A N   1 
ATOM   2385 C CA  . GLU A 1 312 ? 0.367   10.618 -2.235  1.00 40.16  ? 312 GLU A CA  1 
ATOM   2386 C C   . GLU A 1 312 ? -0.553  9.411  -2.164  1.00 40.42  ? 312 GLU A C   1 
ATOM   2387 O O   . GLU A 1 312 ? -1.697  9.579  -1.745  1.00 37.38  ? 312 GLU A O   1 
ATOM   2388 C CB  . GLU A 1 312 ? 0.419   11.215 -3.653  1.00 43.02  ? 312 GLU A CB  1 
ATOM   2389 C CG  . GLU A 1 312 ? 0.639   12.717 -3.624  1.00 56.07  ? 312 GLU A CG  1 
ATOM   2390 C CD  . GLU A 1 312 ? 0.899   13.422 -4.945  1.00 90.13  ? 312 GLU A CD  1 
ATOM   2391 O OE1 . GLU A 1 312 ? 1.413   12.783 -5.894  1.00 88.54  ? 312 GLU A OE1 1 
ATOM   2392 O OE2 . GLU A 1 312 ? 0.653   14.648 -5.005  1.00 89.06  ? 312 GLU A OE2 1 
ATOM   2393 N N   . GLU A 1 313 ? -0.046  8.197  -2.534  1.00 37.62  ? 313 GLU A N   1 
ATOM   2394 C CA  . GLU A 1 313 ? -0.804  6.931  -2.537  1.00 37.68  ? 313 GLU A CA  1 
ATOM   2395 C C   . GLU A 1 313 ? -1.331  6.591  -1.162  1.00 42.08  ? 313 GLU A C   1 
ATOM   2396 O O   . GLU A 1 313 ? -2.523  6.359  -1.008  1.00 40.67  ? 313 GLU A O   1 
ATOM   2397 C CB  . GLU A 1 313 ? 0.041   5.774  -3.066  1.00 40.28  ? 313 GLU A CB  1 
ATOM   2398 C CG  . GLU A 1 313 ? 0.063   5.697  -4.575  1.00 51.45  ? 313 GLU A CG  1 
ATOM   2399 C CD  . GLU A 1 313 ? 1.302   5.053  -5.160  1.00 80.82  ? 313 GLU A CD  1 
ATOM   2400 O OE1 . GLU A 1 313 ? 1.896   4.171  -4.495  1.00 71.41  ? 313 GLU A OE1 1 
ATOM   2401 O OE2 . GLU A 1 313 ? 1.670   5.424  -6.299  1.00 84.30  ? 313 GLU A OE2 1 
ATOM   2402 N N   . GLY A 1 314 ? -0.437  6.613  -0.175  1.00 40.14  ? 314 GLY A N   1 
ATOM   2403 C CA  . GLY A 1 314 ? -0.734  6.338  1.228   1.00 38.48  ? 314 GLY A CA  1 
ATOM   2404 C C   . GLY A 1 314 ? -1.761  7.272  1.808   1.00 38.23  ? 314 GLY A C   1 
ATOM   2405 O O   . GLY A 1 314 ? -2.589  6.837  2.607   1.00 36.48  ? 314 GLY A O   1 
ATOM   2406 N N   . PHE A 1 315 ? -1.710  8.556  1.383   1.00 35.02  ? 315 PHE A N   1 
ATOM   2407 C CA  . PHE A 1 315 ? -2.642  9.621  1.769   1.00 34.31  ? 315 PHE A CA  1 
ATOM   2408 C C   . PHE A 1 315 ? -3.998  9.416  1.081   1.00 37.38  ? 315 PHE A C   1 
ATOM   2409 O O   . PHE A 1 315 ? -5.025  9.652  1.706   1.00 35.74  ? 315 PHE A O   1 
ATOM   2410 C CB  . PHE A 1 315 ? -2.082  11.020 1.433   1.00 36.42  ? 315 PHE A CB  1 
ATOM   2411 C CG  . PHE A 1 315 ? -3.080  12.141 1.627   1.00 37.70  ? 315 PHE A CG  1 
ATOM   2412 C CD1 . PHE A 1 315 ? -3.347  12.647 2.900   1.00 40.94  ? 315 PHE A CD1 1 
ATOM   2413 C CD2 . PHE A 1 315 ? -3.764  12.679 0.545   1.00 40.14  ? 315 PHE A CD2 1 
ATOM   2414 C CE1 . PHE A 1 315 ? -4.279  13.679 3.081   1.00 40.99  ? 315 PHE A CE1 1 
ATOM   2415 C CE2 . PHE A 1 315 ? -4.700  13.707 0.729   1.00 42.64  ? 315 PHE A CE2 1 
ATOM   2416 C CZ  . PHE A 1 315 ? -4.960  14.191 1.996   1.00 39.80  ? 315 PHE A CZ  1 
ATOM   2417 N N   . MET A 1 316 ? -3.998  9.020  -0.210  1.00 34.46  ? 316 MET A N   1 
ATOM   2418 C CA  . MET A 1 316 ? -5.224  8.770  -0.964  1.00 33.98  ? 316 MET A CA  1 
ATOM   2419 C C   . MET A 1 316 ? -5.899  7.519  -0.442  1.00 36.20  ? 316 MET A C   1 
ATOM   2420 O O   . MET A 1 316 ? -7.115  7.542  -0.240  1.00 36.10  ? 316 MET A O   1 
ATOM   2421 C CB  . MET A 1 316 ? -4.981  8.716  -2.484  1.00 38.04  ? 316 MET A CB  1 
ATOM   2422 C CG  . MET A 1 316 ? -4.567  10.067 -3.108  1.00 41.99  ? 316 MET A CG  1 
ATOM   2423 S SD  . MET A 1 316 ? -5.449  11.558 -2.523  1.00 44.87  ? 316 MET A SD  1 
ATOM   2424 C CE  . MET A 1 316 ? -7.012  11.381 -3.390  1.00 42.53  ? 316 MET A CE  1 
ATOM   2425 N N   . ALA A 1 317 ? -5.105  6.457  -0.133  1.00 32.35  ? 317 ALA A N   1 
ATOM   2426 C CA  . ALA A 1 317 ? -5.581  5.193  0.470   1.00 31.67  ? 317 ALA A CA  1 
ATOM   2427 C C   . ALA A 1 317 ? -6.242  5.476  1.845   1.00 34.28  ? 317 ALA A C   1 
ATOM   2428 O O   . ALA A 1 317 ? -7.284  4.883  2.152   1.00 32.38  ? 317 ALA A O   1 
ATOM   2429 C CB  . ALA A 1 317 ? -4.437  4.198  0.622   1.00 32.67  ? 317 ALA A CB  1 
ATOM   2430 N N   . HIS A 1 318 ? -5.659  6.427  2.634   1.00 30.60  ? 318 HIS A N   1 
ATOM   2431 C CA  . HIS A 1 318 ? -6.235  6.840  3.906   1.00 29.99  ? 318 HIS A CA  1 
ATOM   2432 C C   . HIS A 1 318 ? -7.553  7.572  3.682   1.00 35.63  ? 318 HIS A C   1 
ATOM   2433 O O   . HIS A 1 318 ? -8.499  7.266  4.408   1.00 36.01  ? 318 HIS A O   1 
ATOM   2434 C CB  . HIS A 1 318 ? -5.292  7.700  4.742   1.00 30.07  ? 318 HIS A CB  1 
ATOM   2435 C CG  . HIS A 1 318 ? -5.954  8.221  5.982   1.00 32.85  ? 318 HIS A CG  1 
ATOM   2436 N ND1 . HIS A 1 318 ? -6.135  7.415  7.099   1.00 34.75  ? 318 HIS A ND1 1 
ATOM   2437 C CD2 . HIS A 1 318 ? -6.500  9.438  6.229   1.00 33.90  ? 318 HIS A CD2 1 
ATOM   2438 C CE1 . HIS A 1 318 ? -6.749  8.175  7.993   1.00 33.07  ? 318 HIS A CE1 1 
ATOM   2439 N NE2 . HIS A 1 318 ? -6.989  9.400  7.519   1.00 32.92  ? 318 HIS A NE2 1 
ATOM   2440 N N   . VAL A 1 319 ? -7.640  8.518  2.688   1.00 31.98  ? 319 VAL A N   1 
ATOM   2441 C CA  . VAL A 1 319 ? -8.911  9.220  2.438   1.00 31.53  ? 319 VAL A CA  1 
ATOM   2442 C C   . VAL A 1 319 ? -10.027 8.240  2.107   1.00 37.14  ? 319 VAL A C   1 
ATOM   2443 O O   . VAL A 1 319 ? -11.115 8.344  2.665   1.00 36.43  ? 319 VAL A O   1 
ATOM   2444 C CB  . VAL A 1 319 ? -8.904  10.501 1.555   1.00 35.10  ? 319 VAL A CB  1 
ATOM   2445 C CG1 . VAL A 1 319 ? -7.643  11.324 1.750   1.00 34.54  ? 319 VAL A CG1 1 
ATOM   2446 C CG2 . VAL A 1 319 ? -9.141  10.206 0.085   1.00 36.33  ? 319 VAL A CG2 1 
ATOM   2447 N N   . ASP A 1 320 ? -9.702  7.216  1.315   1.00 35.50  ? 320 ASP A N   1 
ATOM   2448 C CA  . ASP A 1 320 ? -10.642 6.168  0.949   1.00 36.73  ? 320 ASP A CA  1 
ATOM   2449 C C   . ASP A 1 320 ? -11.169 5.340  2.123   1.00 39.98  ? 320 ASP A C   1 
ATOM   2450 O O   . ASP A 1 320 ? -12.327 4.923  2.088   1.00 40.22  ? 320 ASP A O   1 
ATOM   2451 C CB  . ASP A 1 320 ? -10.080 5.307  -0.186  1.00 40.46  ? 320 ASP A CB  1 
ATOM   2452 C CG  . ASP A 1 320 ? -10.291 5.983  -1.528  1.00 58.06  ? 320 ASP A CG  1 
ATOM   2453 O OD1 . ASP A 1 320 ? -11.471 6.118  -1.949  1.00 60.24  ? 320 ASP A OD1 1 
ATOM   2454 O OD2 . ASP A 1 320 ? -9.291  6.441  -2.130  1.00 65.86  ? 320 ASP A OD2 1 
ATOM   2455 N N   . ARG A 1 321 ? -10.344 5.147  3.178   1.00 35.04  ? 321 ARG A N   1 
ATOM   2456 C CA  . ARG A 1 321 ? -10.737 4.411  4.382   1.00 33.77  ? 321 ARG A CA  1 
ATOM   2457 C C   . ARG A 1 321 ? -11.693 5.274  5.208   1.00 36.55  ? 321 ARG A C   1 
ATOM   2458 O O   . ARG A 1 321 ? -12.636 4.760  5.806   1.00 36.63  ? 321 ARG A O   1 
ATOM   2459 C CB  . ARG A 1 321 ? -9.507  4.005  5.208   1.00 32.84  ? 321 ARG A CB  1 
ATOM   2460 C CG  . ARG A 1 321 ? -8.716  2.848  4.611   1.00 43.00  ? 321 ARG A CG  1 
ATOM   2461 C CD  . ARG A 1 321 ? -7.632  2.331  5.547   1.00 56.81  ? 321 ARG A CD  1 
ATOM   2462 N NE  . ARG A 1 321 ? -6.462  3.213  5.635   1.00 66.33  ? 321 ARG A NE  1 
ATOM   2463 C CZ  . ARG A 1 321 ? -5.426  3.171  4.800   1.00 83.24  ? 321 ARG A CZ  1 
ATOM   2464 N NH1 . ARG A 1 321 ? -5.416  2.313  3.784   1.00 75.37  ? 321 ARG A NH1 1 
ATOM   2465 N NH2 . ARG A 1 321 ? -4.401  3.998  4.962   1.00 67.59  ? 321 ARG A NH2 1 
ATOM   2466 N N   . VAL A 1 322 ? -11.473 6.595  5.196   1.00 31.66  ? 322 VAL A N   1 
ATOM   2467 C CA  . VAL A 1 322 ? -12.336 7.545  5.890   1.00 29.93  ? 322 VAL A CA  1 
ATOM   2468 C C   . VAL A 1 322 ? -13.708 7.589  5.161   1.00 35.83  ? 322 VAL A C   1 
ATOM   2469 O O   . VAL A 1 322 ? -14.739 7.434  5.822   1.00 35.45  ? 322 VAL A O   1 
ATOM   2470 C CB  . VAL A 1 322 ? -11.648 8.931  6.075   1.00 30.80  ? 322 VAL A CB  1 
ATOM   2471 C CG1 . VAL A 1 322 ? -12.575 9.937  6.751   1.00 28.82  ? 322 VAL A CG1 1 
ATOM   2472 C CG2 . VAL A 1 322 ? -10.359 8.789  6.869   1.00 29.81  ? 322 VAL A CG2 1 
ATOM   2473 N N   . ILE A 1 323 ? -13.706 7.733  3.811   1.00 34.23  ? 323 ILE A N   1 
ATOM   2474 C CA  . ILE A 1 323 ? -14.923 7.732  2.983   1.00 36.30  ? 323 ILE A CA  1 
ATOM   2475 C C   . ILE A 1 323 ? -15.706 6.446  3.253   1.00 40.93  ? 323 ILE A C   1 
ATOM   2476 O O   . ILE A 1 323 ? -16.913 6.520  3.453   1.00 40.72  ? 323 ILE A O   1 
ATOM   2477 C CB  . ILE A 1 323 ? -14.642 7.874  1.449   1.00 41.49  ? 323 ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 323 ? -13.890 9.176  1.104   1.00 42.80  ? 323 ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 323 ? -15.945 7.785  0.646   1.00 42.62  ? 323 ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 323 ? -13.308 9.247  -0.392  1.00 54.29  ? 323 ILE A CD1 1 
ATOM   2481 N N   . ASP A 1 324 ? -15.016 5.279  3.277   1.00 38.01  ? 324 ASP A N   1 
ATOM   2482 C CA  . ASP A 1 324 ? -15.647 3.978  3.534   1.00 38.77  ? 324 ASP A CA  1 
ATOM   2483 C C   . ASP A 1 324 ? -16.335 3.952  4.889   1.00 41.25  ? 324 ASP A C   1 
ATOM   2484 O O   . ASP A 1 324 ? -17.447 3.412  4.989   1.00 41.86  ? 324 ASP A O   1 
ATOM   2485 C CB  . ASP A 1 324 ? -14.668 2.791  3.356   1.00 41.79  ? 324 ASP A CB  1 
ATOM   2486 C CG  . ASP A 1 324 ? -15.257 1.416  3.673   1.00 54.51  ? 324 ASP A CG  1 
ATOM   2487 O OD1 . ASP A 1 324 ? -16.242 1.008  2.990   1.00 56.16  ? 324 ASP A OD1 1 
ATOM   2488 O OD2 . ASP A 1 324 ? -14.746 0.753  4.606   1.00 59.52  ? 324 ASP A OD2 1 
ATOM   2489 N N   . PHE A 1 325 ? -15.715 4.572  5.914   1.00 34.77  ? 325 PHE A N   1 
ATOM   2490 C CA  . PHE A 1 325 ? -16.364 4.634  7.209   1.00 33.68  ? 325 PHE A CA  1 
ATOM   2491 C C   . PHE A 1 325 ? -17.625 5.533  7.180   1.00 40.33  ? 325 PHE A C   1 
ATOM   2492 O O   . PHE A 1 325 ? -18.679 5.090  7.655   1.00 42.81  ? 325 PHE A O   1 
ATOM   2493 C CB  . PHE A 1 325 ? -15.395 5.033  8.321   1.00 33.90  ? 325 PHE A CB  1 
ATOM   2494 C CG  . PHE A 1 325 ? -16.089 5.486  9.585   1.00 34.05  ? 325 PHE A CG  1 
ATOM   2495 C CD1 . PHE A 1 325 ? -16.575 4.563  10.501  1.00 35.81  ? 325 PHE A CD1 1 
ATOM   2496 C CD2 . PHE A 1 325 ? -16.288 6.840  9.842   1.00 35.78  ? 325 PHE A CD2 1 
ATOM   2497 C CE1 . PHE A 1 325 ? -17.246 4.982  11.649  1.00 35.66  ? 325 PHE A CE1 1 
ATOM   2498 C CE2 . PHE A 1 325 ? -16.948 7.258  10.998  1.00 37.50  ? 325 PHE A CE2 1 
ATOM   2499 C CZ  . PHE A 1 325 ? -17.417 6.324  11.896  1.00 35.07  ? 325 PHE A CZ  1 
ATOM   2500 N N   . TYR A 1 326 ? -17.526 6.773  6.636   1.00 34.64  ? 326 TYR A N   1 
ATOM   2501 C CA  . TYR A 1 326 ? -18.669 7.695  6.575   1.00 33.59  ? 326 TYR A CA  1 
ATOM   2502 C C   . TYR A 1 326 ? -19.805 7.257  5.644   1.00 35.50  ? 326 TYR A C   1 
ATOM   2503 O O   . TYR A 1 326 ? -20.964 7.642  5.860   1.00 35.03  ? 326 TYR A O   1 
ATOM   2504 C CB  . TYR A 1 326 ? -18.227 9.129  6.280   1.00 34.82  ? 326 TYR A CB  1 
ATOM   2505 C CG  . TYR A 1 326 ? -17.594 9.797  7.479   1.00 37.46  ? 326 TYR A CG  1 
ATOM   2506 C CD1 . TYR A 1 326 ? -18.374 10.428 8.445   1.00 38.98  ? 326 TYR A CD1 1 
ATOM   2507 C CD2 . TYR A 1 326 ? -16.211 9.789  7.658   1.00 38.29  ? 326 TYR A CD2 1 
ATOM   2508 C CE1 . TYR A 1 326 ? -17.794 11.029 9.560   1.00 39.65  ? 326 TYR A CE1 1 
ATOM   2509 C CE2 . TYR A 1 326 ? -15.622 10.382 8.774   1.00 37.93  ? 326 TYR A CE2 1 
ATOM   2510 C CZ  . TYR A 1 326 ? -16.416 10.998 9.722   1.00 45.79  ? 326 TYR A CZ  1 
ATOM   2511 O OH  . TYR A 1 326 ? -15.826 11.584 10.813  1.00 49.44  ? 326 TYR A OH  1 
ATOM   2512 N N   . SER A 1 327 ? -19.484 6.455  4.625   1.00 30.77  ? 327 SER A N   1 
ATOM   2513 C CA  . SER A 1 327 ? -20.483 5.954  3.697   1.00 32.42  ? 327 SER A CA  1 
ATOM   2514 C C   . SER A 1 327 ? -21.403 4.926  4.428   1.00 38.71  ? 327 SER A C   1 
ATOM   2515 O O   . SER A 1 327 ? -22.630 4.996  4.283   1.00 38.09  ? 327 SER A O   1 
ATOM   2516 C CB  . SER A 1 327 ? -19.813 5.381  2.447   1.00 37.56  ? 327 SER A CB  1 
ATOM   2517 O OG  . SER A 1 327 ? -20.627 4.496  1.692   1.00 52.08  ? 327 SER A OG  1 
ATOM   2518 N N   . ASN A 1 328 ? -20.811 4.032  5.265   1.00 36.63  ? 328 ASN A N   1 
ATOM   2519 C CA  . ASN A 1 328 ? -21.558 3.036  6.043   1.00 37.50  ? 328 ASN A CA  1 
ATOM   2520 C C   . ASN A 1 328 ? -22.421 3.745  7.090   1.00 40.30  ? 328 ASN A C   1 
ATOM   2521 O O   . ASN A 1 328 ? -23.582 3.376  7.280   1.00 41.52  ? 328 ASN A O   1 
ATOM   2522 C CB  . ASN A 1 328 ? -20.630 1.990  6.704   1.00 43.32  ? 328 ASN A CB  1 
ATOM   2523 C CG  . ASN A 1 328 ? -19.882 1.031  5.782   1.00 90.80  ? 328 ASN A CG  1 
ATOM   2524 O OD1 . ASN A 1 328 ? -19.657 -0.137 6.133   1.00 89.58  ? 328 ASN A OD1 1 
ATOM   2525 N ND2 . ASN A 1 328 ? -19.409 1.499  4.623   1.00 88.44  ? 328 ASN A ND2 1 
ATOM   2526 N N   . GLN A 1 329 ? -21.879 4.785  7.726   1.00 34.73  ? 329 GLN A N   1 
ATOM   2527 C CA  . GLN A 1 329 ? -22.635 5.570  8.698   1.00 34.73  ? 329 GLN A CA  1 
ATOM   2528 C C   . GLN A 1 329 ? -23.867 6.201  8.022   1.00 40.44  ? 329 GLN A C   1 
ATOM   2529 O O   . GLN A 1 329 ? -24.981 6.028  8.525   1.00 40.72  ? 329 GLN A O   1 
ATOM   2530 C CB  . GLN A 1 329 ? -21.743 6.634  9.362   1.00 35.01  ? 329 GLN A CB  1 
ATOM   2531 C CG  . GLN A 1 329 ? -20.668 6.074  10.321  1.00 44.93  ? 329 GLN A CG  1 
ATOM   2532 C CD  . GLN A 1 329 ? -21.209 5.589  11.660  1.00 52.55  ? 329 GLN A CD  1 
ATOM   2533 O OE1 . GLN A 1 329 ? -21.081 4.416  12.030  1.00 45.45  ? 329 GLN A OE1 1 
ATOM   2534 N NE2 . GLN A 1 329 ? -21.795 6.483  12.435  1.00 42.15  ? 329 GLN A NE2 1 
ATOM   2535 N N   . LYS A 1 330 ? -23.675 6.838  6.829   1.00 36.83  ? 330 LYS A N   1 
ATOM   2536 C CA  . LYS A 1 330 ? -24.743 7.446  6.026   1.00 36.52  ? 330 LYS A CA  1 
ATOM   2537 C C   . LYS A 1 330 ? -25.858 6.434  5.714   1.00 42.14  ? 330 LYS A C   1 
ATOM   2538 O O   . LYS A 1 330 ? -27.031 6.743  5.894   1.00 42.84  ? 330 LYS A O   1 
ATOM   2539 C CB  . LYS A 1 330 ? -24.176 8.042  4.725   1.00 38.32  ? 330 LYS A CB  1 
ATOM   2540 C CG  . LYS A 1 330 ? -25.222 8.800  3.896   1.00 41.04  ? 330 LYS A CG  1 
ATOM   2541 C CD  . LYS A 1 330 ? -24.824 8.970  2.434   1.00 48.71  ? 330 LYS A CD  1 
ATOM   2542 C CE  . LYS A 1 330 ? -25.251 7.846  1.513   1.00 53.04  ? 330 LYS A CE  1 
ATOM   2543 N NZ  . LYS A 1 330 ? -24.209 6.793  1.403   1.00 52.32  ? 330 LYS A NZ  1 
ATOM   2544 N N   . ASP A 1 331 ? -25.487 5.231  5.262   1.00 39.44  ? 331 ASP A N   1 
ATOM   2545 C CA  . ASP A 1 331 ? -26.435 4.169  4.933   1.00 40.64  ? 331 ASP A CA  1 
ATOM   2546 C C   . ASP A 1 331 ? -27.251 3.777  6.172   1.00 44.39  ? 331 ASP A C   1 
ATOM   2547 O O   . ASP A 1 331 ? -28.468 3.599  6.069   1.00 44.04  ? 331 ASP A O   1 
ATOM   2548 C CB  . ASP A 1 331 ? -25.691 2.945  4.354   1.00 43.50  ? 331 ASP A CB  1 
ATOM   2549 C CG  . ASP A 1 331 ? -24.950 3.177  3.044   1.00 55.37  ? 331 ASP A CG  1 
ATOM   2550 O OD1 . ASP A 1 331 ? -25.443 3.978  2.205   1.00 57.88  ? 331 ASP A OD1 1 
ATOM   2551 O OD2 . ASP A 1 331 ? -23.913 2.520  2.829   1.00 59.71  ? 331 ASP A OD2 1 
ATOM   2552 N N   . ALA A 1 332 ? -26.574 3.707  7.351   1.00 40.79  ? 332 ALA A N   1 
ATOM   2553 C CA  . ALA A 1 332 ? -27.165 3.357  8.650   1.00 40.61  ? 332 ALA A CA  1 
ATOM   2554 C C   . ALA A 1 332 ? -28.130 4.417  9.197   1.00 44.32  ? 332 ALA A C   1 
ATOM   2555 O O   . ALA A 1 332 ? -29.105 4.052  9.855   1.00 44.91  ? 332 ALA A O   1 
ATOM   2556 C CB  . ALA A 1 332 ? -26.081 3.036  9.666   1.00 40.60  ? 332 ALA A CB  1 
ATOM   2557 N N   . ILE A 1 333 ? -27.869 5.714  8.934   1.00 39.57  ? 333 ILE A N   1 
ATOM   2558 C CA  . ILE A 1 333 ? -28.775 6.797  9.320   1.00 39.44  ? 333 ILE A CA  1 
ATOM   2559 C C   . ILE A 1 333 ? -30.009 6.808  8.388   1.00 44.05  ? 333 ILE A C   1 
ATOM   2560 O O   . ILE A 1 333 ? -31.123 7.069  8.858   1.00 45.11  ? 333 ILE A O   1 
ATOM   2561 C CB  . ILE A 1 333 ? -28.064 8.192  9.432   1.00 41.95  ? 333 ILE A CB  1 
ATOM   2562 C CG1 . ILE A 1 333 ? -28.873 9.190  10.283  1.00 41.98  ? 333 ILE A CG1 1 
ATOM   2563 C CG2 . ILE A 1 333 ? -27.715 8.816  8.080   1.00 42.85  ? 333 ILE A CG2 1 
ATOM   2564 C CD1 . ILE A 1 333 ? -28.376 9.364  11.640  1.00 48.28  ? 333 ILE A CD1 1 
ATOM   2565 N N   . LEU A 1 334 ? -29.800 6.510  7.081   1.00 38.10  ? 334 LEU A N   1 
ATOM   2566 C CA  . LEU A 1 334 ? -30.844 6.484  6.068   1.00 37.86  ? 334 LEU A CA  1 
ATOM   2567 C C   . LEU A 1 334 ? -31.823 5.341  6.293   1.00 43.95  ? 334 LEU A C   1 
ATOM   2568 O O   . LEU A 1 334 ? -33.024 5.510  6.050   1.00 43.85  ? 334 LEU A O   1 
ATOM   2569 C CB  . LEU A 1 334 ? -30.213 6.395  4.678   1.00 37.73  ? 334 LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 334 ? -30.180 7.652  3.800   1.00 41.35  ? 334 LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 334 ? -30.678 8.913  4.526   1.00 40.46  ? 334 LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 334 ? -28.815 7.844  3.178   1.00 41.31  ? 334 LEU A CD2 1 
ATOM   2573 N N   . ALA A 1 335 ? -31.318 4.194  6.783   1.00 42.24  ? 335 ALA A N   1 
ATOM   2574 C CA  . ALA A 1 335 ? -32.132 3.011  7.085   1.00 44.03  ? 335 ALA A CA  1 
ATOM   2575 C C   . ALA A 1 335 ? -33.012 3.304  8.297   1.00 50.80  ? 335 ALA A C   1 
ATOM   2576 O O   . ALA A 1 335 ? -34.234 3.117  8.224   1.00 53.64  ? 335 ALA A O   1 
ATOM   2577 C CB  . ALA A 1 335 ? -31.244 1.800  7.349   1.00 44.48  ? 335 ALA A CB  1 
ATOM   2578 N N   . ALA A 1 336 ? -32.401 3.828  9.383   1.00 45.61  ? 336 ALA A N   1 
ATOM   2579 C CA  . ALA A 1 336 ? -33.103 4.205  10.607  1.00 45.85  ? 336 ALA A CA  1 
ATOM   2580 C C   . ALA A 1 336 ? -34.160 5.285  10.319  1.00 50.59  ? 336 ALA A C   1 
ATOM   2581 O O   . ALA A 1 336 ? -35.275 5.197  10.841  1.00 50.40  ? 336 ALA A O   1 
ATOM   2582 C CB  . ALA A 1 336 ? -32.112 4.687  11.656  1.00 45.55  ? 336 ALA A CB  1 
ATOM   2583 N N   . ALA A 1 337 ? -33.829 6.254  9.430   1.00 46.87  ? 337 ALA A N   1 
ATOM   2584 C CA  . ALA A 1 337 ? -34.751 7.300  8.995   1.00 46.88  ? 337 ALA A CA  1 
ATOM   2585 C C   . ALA A 1 337 ? -35.930 6.682  8.231   1.00 53.77  ? 337 ALA A C   1 
ATOM   2586 O O   . ALA A 1 337 ? -37.074 7.090  8.462   1.00 53.92  ? 337 ALA A O   1 
ATOM   2587 C CB  . ALA A 1 337 ? -34.029 8.313  8.121   1.00 46.93  ? 337 ALA A CB  1 
ATOM   2588 N N   . ASP A 1 338 ? -35.654 5.680  7.344   1.00 51.46  ? 338 ASP A N   1 
ATOM   2589 C CA  . ASP A 1 338 ? -36.685 5.002  6.544   1.00 53.34  ? 338 ASP A CA  1 
ATOM   2590 C C   . ASP A 1 338 ? -37.683 4.257  7.430   1.00 55.97  ? 338 ASP A C   1 
ATOM   2591 O O   . ASP A 1 338 ? -38.893 4.434  7.289   1.00 56.54  ? 338 ASP A O   1 
ATOM   2592 C CB  . ASP A 1 338 ? -36.056 4.039  5.515   1.00 56.95  ? 338 ASP A CB  1 
ATOM   2593 C CG  . ASP A 1 338 ? -35.541 4.668  4.222   1.00 81.03  ? 338 ASP A CG  1 
ATOM   2594 O OD1 . ASP A 1 338 ? -35.934 5.825  3.915   1.00 83.77  ? 338 ASP A OD1 1 
ATOM   2595 O OD2 . ASP A 1 338 ? -34.786 3.984  3.487   1.00 90.42  ? 338 ASP A OD2 1 
ATOM   2596 N N   . LYS A 1 339 ? -37.156 3.456  8.363   1.00 50.05  ? 339 LYS A N   1 
ATOM   2597 C CA  . LYS A 1 339 ? -37.881 2.627  9.314   1.00 49.51  ? 339 LYS A CA  1 
ATOM   2598 C C   . LYS A 1 339 ? -38.919 3.378  10.168  1.00 55.56  ? 339 LYS A C   1 
ATOM   2599 O O   . LYS A 1 339 ? -40.048 2.899  10.290  1.00 57.78  ? 339 LYS A O   1 
ATOM   2600 C CB  . LYS A 1 339 ? -36.855 1.921  10.220  1.00 49.10  ? 339 LYS A CB  1 
ATOM   2601 C CG  . LYS A 1 339 ? -37.387 0.792  11.087  1.00 41.76  ? 339 LYS A CG  1 
ATOM   2602 C CD  . LYS A 1 339 ? -36.207 0.097  11.734  1.00 39.82  ? 339 LYS A CD  1 
ATOM   2603 C CE  . LYS A 1 339 ? -36.547 -1.145 12.502  1.00 47.18  ? 339 LYS A CE  1 
ATOM   2604 N NZ  . LYS A 1 339 ? -35.376 -1.632 13.286  1.00 53.39  ? 339 LYS A NZ  1 
ATOM   2605 N N   . TRP A 1 340 ? -38.541 4.531  10.753  1.00 50.63  ? 340 TRP A N   1 
ATOM   2606 C CA  . TRP A 1 340 ? -39.368 5.265  11.698  1.00 50.99  ? 340 TRP A CA  1 
ATOM   2607 C C   . TRP A 1 340 ? -39.969 6.579  11.238  1.00 57.62  ? 340 TRP A C   1 
ATOM   2608 O O   . TRP A 1 340 ? -41.093 6.880  11.643  1.00 59.59  ? 340 TRP A O   1 
ATOM   2609 C CB  . TRP A 1 340 ? -38.582 5.508  12.998  1.00 48.98  ? 340 TRP A CB  1 
ATOM   2610 C CG  . TRP A 1 340 ? -37.933 4.281  13.560  1.00 50.13  ? 340 TRP A CG  1 
ATOM   2611 C CD1 . TRP A 1 340 ? -36.614 3.927  13.470  1.00 52.27  ? 340 TRP A CD1 1 
ATOM   2612 C CD2 . TRP A 1 340 ? -38.588 3.217  14.257  1.00 50.77  ? 340 TRP A CD2 1 
ATOM   2613 N NE1 . TRP A 1 340 ? -36.406 2.714  14.088  1.00 51.80  ? 340 TRP A NE1 1 
ATOM   2614 C CE2 . TRP A 1 340 ? -37.603 2.253  14.576  1.00 54.44  ? 340 TRP A CE2 1 
ATOM   2615 C CE3 . TRP A 1 340 ? -39.918 2.985  14.651  1.00 53.17  ? 340 TRP A CE3 1 
ATOM   2616 C CZ2 . TRP A 1 340 ? -37.909 1.072  15.265  1.00 54.67  ? 340 TRP A CZ2 1 
ATOM   2617 C CZ3 . TRP A 1 340 ? -40.223 1.812  15.329  1.00 55.27  ? 340 TRP A CZ3 1 
ATOM   2618 C CH2 . TRP A 1 340 ? -39.230 0.869  15.625  1.00 55.53  ? 340 TRP A CH2 1 
ATOM   2619 N N   . LEU A 1 341 ? -39.218 7.396  10.472  1.00 53.82  ? 341 LEU A N   1 
ATOM   2620 C CA  . LEU A 1 341 ? -39.631 8.748  10.063  1.00 53.97  ? 341 LEU A CA  1 
ATOM   2621 C C   . LEU A 1 341 ? -40.547 8.840  8.837   1.00 59.34  ? 341 LEU A C   1 
ATOM   2622 O O   . LEU A 1 341 ? -41.183 9.880  8.643   1.00 58.54  ? 341 LEU A O   1 
ATOM   2623 C CB  . LEU A 1 341 ? -38.412 9.683  9.907   1.00 53.05  ? 341 LEU A CB  1 
ATOM   2624 C CG  . LEU A 1 341 ? -37.647 10.117 11.169  1.00 56.67  ? 341 LEU A CG  1 
ATOM   2625 C CD1 . LEU A 1 341 ? -36.720 9.033  11.643  1.00 55.85  ? 341 LEU A CD1 1 
ATOM   2626 C CD2 . LEU A 1 341 ? -36.754 11.329 10.880  1.00 59.04  ? 341 LEU A CD2 1 
ATOM   2627 N N   . THR A 1 342 ? -40.622 7.771  8.013   1.00 58.01  ? 342 THR A N   1 
ATOM   2628 C CA  . THR A 1 342 ? -41.487 7.745  6.825   1.00 59.87  ? 342 THR A CA  1 
ATOM   2629 C C   . THR A 1 342 ? -42.920 8.049  7.252   1.00 65.70  ? 342 THR A C   1 
ATOM   2630 O O   . THR A 1 342 ? -43.431 7.415  8.182   1.00 65.08  ? 342 THR A O   1 
ATOM   2631 C CB  . THR A 1 342 ? -41.316 6.434  6.033   1.00 70.62  ? 342 THR A CB  1 
ATOM   2632 O OG1 . THR A 1 342 ? -39.935 6.296  5.652   1.00 73.47  ? 342 THR A OG1 1 
ATOM   2633 C CG2 . THR A 1 342 ? -42.208 6.367  4.790   1.00 71.34  ? 342 THR A CG2 1 
ATOM   2634 N N   . GLY A 1 343 ? -43.496 9.071  6.614   1.00 63.71  ? 343 GLY A N   1 
ATOM   2635 C CA  . GLY A 1 343 ? -44.835 9.588  6.871   1.00 64.27  ? 343 GLY A CA  1 
ATOM   2636 C C   . GLY A 1 343 ? -44.836 10.798 7.792   1.00 66.46  ? 343 GLY A C   1 
ATOM   2637 O O   . GLY A 1 343 ? -45.785 11.589 7.768   1.00 67.24  ? 343 GLY A O   1 
ATOM   2638 N N   . LEU A 1 344 ? -43.756 10.958 8.602   1.00 60.12  ? 344 LEU A N   1 
ATOM   2639 C CA  . LEU A 1 344 ? -43.594 12.026 9.607   1.00 58.51  ? 344 LEU A CA  1 
ATOM   2640 C C   . LEU A 1 344 ? -42.586 13.121 9.238   1.00 59.72  ? 344 LEU A C   1 
ATOM   2641 O O   . LEU A 1 344 ? -42.581 14.196 9.861   1.00 58.13  ? 344 LEU A O   1 
ATOM   2642 C CB  . LEU A 1 344 ? -43.185 11.412 10.963  1.00 57.16  ? 344 LEU A CB  1 
ATOM   2643 C CG  . LEU A 1 344 ? -43.930 10.165 11.434  1.00 62.04  ? 344 LEU A CG  1 
ATOM   2644 C CD1 . LEU A 1 344 ? -43.240 9.547  12.625  1.00 60.84  ? 344 LEU A CD1 1 
ATOM   2645 C CD2 . LEU A 1 344 ? -45.402 10.462 11.729  1.00 65.59  ? 344 LEU A CD2 1 
ATOM   2646 N N   . ALA A 1 345 ? -41.693 12.821 8.271   1.00 55.63  ? 345 ALA A N   1 
ATOM   2647 C CA  . ALA A 1 345 ? -40.623 13.728 7.856   1.00 54.20  ? 345 ALA A CA  1 
ATOM   2648 C C   . ALA A 1 345 ? -40.161 13.508 6.421   1.00 57.98  ? 345 ALA A C   1 
ATOM   2649 O O   . ALA A 1 345 ? -40.450 12.471 5.820   1.00 58.19  ? 345 ALA A O   1 
ATOM   2650 C CB  . ALA A 1 345 ? -39.437 13.602 8.809   1.00 52.96  ? 345 ALA A CB  1 
ATOM   2651 N N   . GLU A 1 346 ? -39.412 14.494 5.894   1.00 54.12  ? 346 GLU A N   1 
ATOM   2652 C CA  . GLU A 1 346 ? -38.833 14.502 4.554   1.00 53.87  ? 346 GLU A CA  1 
ATOM   2653 C C   . GLU A 1 346 ? -37.350 14.860 4.650   1.00 54.21  ? 346 GLU A C   1 
ATOM   2654 O O   . GLU A 1 346 ? -36.951 15.683 5.480   1.00 51.84  ? 346 GLU A O   1 
ATOM   2655 C CB  . GLU A 1 346 ? -39.563 15.506 3.648   1.00 57.01  ? 346 GLU A CB  1 
ATOM   2656 C CG  . GLU A 1 346 ? -41.004 15.130 3.351   1.00 74.77  ? 346 GLU A CG  1 
ATOM   2657 C CD  . GLU A 1 346 ? -41.598 15.674 2.064   1.00 110.84 ? 346 GLU A CD  1 
ATOM   2658 O OE1 . GLU A 1 346 ? -41.475 16.896 1.816   1.00 113.17 ? 346 GLU A OE1 1 
ATOM   2659 O OE2 . GLU A 1 346 ? -42.230 14.884 1.324   1.00 108.09 ? 346 GLU A OE2 1 
ATOM   2660 N N   . TRP A 1 347 ? -36.532 14.225 3.815   1.00 50.62  ? 347 TRP A N   1 
ATOM   2661 C CA  . TRP A 1 347 ? -35.090 14.452 3.792   1.00 49.32  ? 347 TRP A CA  1 
ATOM   2662 C C   . TRP A 1 347 ? -34.478 14.168 2.429   1.00 53.16  ? 347 TRP A C   1 
ATOM   2663 O O   . TRP A 1 347 ? -35.039 13.421 1.635   1.00 53.13  ? 347 TRP A O   1 
ATOM   2664 C CB  . TRP A 1 347 ? -34.375 13.635 4.892   1.00 46.63  ? 347 TRP A CB  1 
ATOM   2665 C CG  . TRP A 1 347 ? -34.573 12.148 4.792   1.00 47.76  ? 347 TRP A CG  1 
ATOM   2666 C CD1 . TRP A 1 347 ? -33.744 11.253 4.185   1.00 50.45  ? 347 TRP A CD1 1 
ATOM   2667 C CD2 . TRP A 1 347 ? -35.663 11.382 5.334   1.00 48.23  ? 347 TRP A CD2 1 
ATOM   2668 N NE1 . TRP A 1 347 ? -34.243 9.975  4.317   1.00 50.14  ? 347 TRP A NE1 1 
ATOM   2669 C CE2 . TRP A 1 347 ? -35.422 10.025 5.011   1.00 51.98  ? 347 TRP A CE2 1 
ATOM   2670 C CE3 . TRP A 1 347 ? -36.833 11.711 6.050   1.00 49.88  ? 347 TRP A CE3 1 
ATOM   2671 C CZ2 . TRP A 1 347 ? -36.304 8.998  5.376   1.00 51.92  ? 347 TRP A CZ2 1 
ATOM   2672 C CZ3 . TRP A 1 347 ? -37.706 10.690 6.414   1.00 51.76  ? 347 TRP A CZ3 1 
ATOM   2673 C CH2 . TRP A 1 347 ? -37.436 9.351  6.085   1.00 52.41  ? 347 TRP A CH2 1 
ATOM   2674 N N   . HIS A 1 348 ? -33.330 14.786 2.160   1.00 50.34  ? 348 HIS A N   1 
ATOM   2675 C CA  . HIS A 1 348 ? -32.551 14.574 0.949   1.00 50.95  ? 348 HIS A CA  1 
ATOM   2676 C C   . HIS A 1 348 ? -31.354 13.699 1.302   1.00 52.22  ? 348 HIS A C   1 
ATOM   2677 O O   . HIS A 1 348 ? -30.805 13.821 2.402   1.00 49.39  ? 348 HIS A O   1 
ATOM   2678 C CB  . HIS A 1 348 ? -32.078 15.909 0.359   1.00 52.40  ? 348 HIS A CB  1 
ATOM   2679 C CG  . HIS A 1 348 ? -33.192 16.753 -0.188  1.00 57.77  ? 348 HIS A CG  1 
ATOM   2680 N ND1 . HIS A 1 348 ? -34.152 16.224 -1.043  1.00 61.53  ? 348 HIS A ND1 1 
ATOM   2681 C CD2 . HIS A 1 348 ? -33.442 18.072 -0.018  1.00 59.91  ? 348 HIS A CD2 1 
ATOM   2682 C CE1 . HIS A 1 348 ? -34.974 17.225 -1.323  1.00 62.08  ? 348 HIS A CE1 1 
ATOM   2683 N NE2 . HIS A 1 348 ? -34.577 18.360 -0.748  1.00 61.55  ? 348 HIS A NE2 1 
ATOM   2684 N N   . VAL A 1 349 ? -30.960 12.802 0.385   1.00 49.26  ? 349 VAL A N   1 
ATOM   2685 C CA  . VAL A 1 349 ? -29.796 11.946 0.616   1.00 47.47  ? 349 VAL A CA  1 
ATOM   2686 C C   . VAL A 1 349 ? -28.528 12.835 0.610   1.00 50.96  ? 349 VAL A C   1 
ATOM   2687 O O   . VAL A 1 349 ? -28.328 13.591 -0.351  1.00 51.30  ? 349 VAL A O   1 
ATOM   2688 C CB  . VAL A 1 349 ? -29.703 10.789 -0.395  1.00 51.44  ? 349 VAL A CB  1 
ATOM   2689 C CG1 . VAL A 1 349 ? -28.437 9.964  -0.165  1.00 50.83  ? 349 VAL A CG1 1 
ATOM   2690 C CG2 . VAL A 1 349 ? -30.941 9.906  -0.327  1.00 51.42  ? 349 VAL A CG2 1 
ATOM   2691 N N   . PRO A 1 350 ? -27.702 12.809 1.697   1.00 45.61  ? 350 PRO A N   1 
ATOM   2692 C CA  . PRO A 1 350 ? -26.485 13.643 1.721   1.00 43.28  ? 350 PRO A CA  1 
ATOM   2693 C C   . PRO A 1 350 ? -25.463 13.183 0.688   1.00 45.73  ? 350 PRO A C   1 
ATOM   2694 O O   . PRO A 1 350 ? -25.198 11.982 0.587   1.00 45.19  ? 350 PRO A O   1 
ATOM   2695 C CB  . PRO A 1 350 ? -25.948 13.454 3.145   1.00 43.45  ? 350 PRO A CB  1 
ATOM   2696 C CG  . PRO A 1 350 ? -27.026 12.797 3.915   1.00 48.32  ? 350 PRO A CG  1 
ATOM   2697 C CD  . PRO A 1 350 ? -27.807 11.999 2.927   1.00 46.06  ? 350 PRO A CD  1 
ATOM   2698 N N   . ALA A 1 351 ? -24.929 14.130 -0.111  1.00 42.39  ? 351 ALA A N   1 
ATOM   2699 C CA  . ALA A 1 351 ? -23.923 13.848 -1.147  1.00 42.84  ? 351 ALA A CA  1 
ATOM   2700 C C   . ALA A 1 351 ? -22.506 13.719 -0.545  1.00 47.97  ? 351 ALA A C   1 
ATOM   2701 O O   . ALA A 1 351 ? -21.670 12.986 -1.085  1.00 47.95  ? 351 ALA A O   1 
ATOM   2702 C CB  . ALA A 1 351 ? -23.943 14.937 -2.198  1.00 44.10  ? 351 ALA A CB  1 
ATOM   2703 N N   . ALA A 1 352 ? -22.253 14.422 0.584   1.00 44.04  ? 352 ALA A N   1 
ATOM   2704 C CA  . ALA A 1 352 ? -20.973 14.431 1.278   1.00 42.75  ? 352 ALA A CA  1 
ATOM   2705 C C   . ALA A 1 352 ? -21.132 14.823 2.749   1.00 47.03  ? 352 ALA A C   1 
ATOM   2706 O O   . ALA A 1 352 ? -22.215 15.254 3.174   1.00 47.43  ? 352 ALA A O   1 
ATOM   2707 C CB  . ALA A 1 352 ? -20.033 15.405 0.588   1.00 43.43  ? 352 ALA A CB  1 
ATOM   2708 N N   . GLY A 1 353 ? -20.045 14.673 3.506   1.00 42.08  ? 353 GLY A N   1 
ATOM   2709 C CA  . GLY A 1 353 ? -19.978 15.076 4.903   1.00 41.18  ? 353 GLY A CA  1 
ATOM   2710 C C   . GLY A 1 353 ? -20.470 14.081 5.928   1.00 45.86  ? 353 GLY A C   1 
ATOM   2711 O O   . GLY A 1 353 ? -20.331 12.865 5.736   1.00 44.29  ? 353 GLY A O   1 
ATOM   2712 N N   . MET A 1 354 ? -21.046 14.622 7.036   1.00 43.40  ? 354 MET A N   1 
ATOM   2713 C CA  . MET A 1 354 ? -21.528 13.876 8.200   1.00 43.17  ? 354 MET A CA  1 
ATOM   2714 C C   . MET A 1 354 ? -22.923 14.259 8.738   1.00 43.40  ? 354 MET A C   1 
ATOM   2715 O O   . MET A 1 354 ? -23.317 13.783 9.800   1.00 41.19  ? 354 MET A O   1 
ATOM   2716 C CB  . MET A 1 354 ? -20.463 13.872 9.315   1.00 45.83  ? 354 MET A CB  1 
ATOM   2717 C CG  . MET A 1 354 ? -19.911 15.255 9.647   1.00 51.29  ? 354 MET A CG  1 
ATOM   2718 S SD  . MET A 1 354 ? -18.604 15.324 10.920  1.00 57.08  ? 354 MET A SD  1 
ATOM   2719 C CE  . MET A 1 354 ? -17.245 14.553 10.044  1.00 53.76  ? 354 MET A CE  1 
ATOM   2720 N N   . PHE A 1 355 ? -23.703 15.046 7.990   1.00 41.23  ? 355 PHE A N   1 
ATOM   2721 C CA  . PHE A 1 355 ? -25.034 15.446 8.471   1.00 41.53  ? 355 PHE A CA  1 
ATOM   2722 C C   . PHE A 1 355 ? -26.241 15.024 7.625   1.00 45.09  ? 355 PHE A C   1 
ATOM   2723 O O   . PHE A 1 355 ? -26.162 14.984 6.399   1.00 44.86  ? 355 PHE A O   1 
ATOM   2724 C CB  . PHE A 1 355 ? -25.081 16.960 8.762   1.00 43.08  ? 355 PHE A CB  1 
ATOM   2725 C CG  . PHE A 1 355 ? -23.958 17.484 9.633   1.00 43.37  ? 355 PHE A CG  1 
ATOM   2726 C CD1 . PHE A 1 355 ? -23.826 17.065 10.956  1.00 45.47  ? 355 PHE A CD1 1 
ATOM   2727 C CD2 . PHE A 1 355 ? -23.025 18.389 9.129   1.00 44.95  ? 355 PHE A CD2 1 
ATOM   2728 C CE1 . PHE A 1 355 ? -22.780 17.539 11.757  1.00 45.10  ? 355 PHE A CE1 1 
ATOM   2729 C CE2 . PHE A 1 355 ? -21.974 18.861 9.930   1.00 46.40  ? 355 PHE A CE2 1 
ATOM   2730 C CZ  . PHE A 1 355 ? -21.865 18.441 11.240  1.00 43.62  ? 355 PHE A CZ  1 
ATOM   2731 N N   . LEU A 1 356 ? -27.364 14.741 8.299   1.00 41.69  ? 356 LEU A N   1 
ATOM   2732 C CA  . LEU A 1 356 ? -28.668 14.443 7.704   1.00 42.82  ? 356 LEU A CA  1 
ATOM   2733 C C   . LEU A 1 356 ? -29.617 15.542 8.181   1.00 47.12  ? 356 LEU A C   1 
ATOM   2734 O O   . LEU A 1 356 ? -29.789 15.721 9.383   1.00 46.46  ? 356 LEU A O   1 
ATOM   2735 C CB  . LEU A 1 356 ? -29.190 13.052 8.097   1.00 43.19  ? 356 LEU A CB  1 
ATOM   2736 C CG  . LEU A 1 356 ? -30.507 12.597 7.441   1.00 48.97  ? 356 LEU A CG  1 
ATOM   2737 C CD1 . LEU A 1 356 ? -30.339 12.352 5.946   1.00 49.47  ? 356 LEU A CD1 1 
ATOM   2738 C CD2 . LEU A 1 356 ? -31.067 11.358 8.126   1.00 51.10  ? 356 LEU A CD2 1 
ATOM   2739 N N   . TRP A 1 357 ? -30.175 16.307 7.234   1.00 45.11  ? 357 TRP A N   1 
ATOM   2740 C CA  . TRP A 1 357 ? -31.062 17.449 7.449   1.00 46.35  ? 357 TRP A CA  1 
ATOM   2741 C C   . TRP A 1 357 ? -32.516 16.981 7.298   1.00 51.97  ? 357 TRP A C   1 
ATOM   2742 O O   . TRP A 1 357 ? -32.969 16.673 6.192   1.00 54.50  ? 357 TRP A O   1 
ATOM   2743 C CB  . TRP A 1 357 ? -30.678 18.544 6.439   1.00 46.42  ? 357 TRP A CB  1 
ATOM   2744 C CG  . TRP A 1 357 ? -31.325 19.891 6.565   1.00 48.75  ? 357 TRP A CG  1 
ATOM   2745 C CD1 . TRP A 1 357 ? -31.956 20.572 5.568   1.00 52.89  ? 357 TRP A CD1 1 
ATOM   2746 C CD2 . TRP A 1 357 ? -31.214 20.810 7.670   1.00 48.55  ? 357 TRP A CD2 1 
ATOM   2747 N NE1 . TRP A 1 357 ? -32.296 21.835 5.994   1.00 52.90  ? 357 TRP A NE1 1 
ATOM   2748 C CE2 . TRP A 1 357 ? -31.870 22.003 7.288   1.00 53.32  ? 357 TRP A CE2 1 
ATOM   2749 C CE3 . TRP A 1 357 ? -30.665 20.728 8.964   1.00 49.08  ? 357 TRP A CE3 1 
ATOM   2750 C CZ2 . TRP A 1 357 ? -31.974 23.110 8.141   1.00 52.34  ? 357 TRP A CZ2 1 
ATOM   2751 C CZ3 . TRP A 1 357 ? -30.791 21.816 9.819   1.00 50.41  ? 357 TRP A CZ3 1 
ATOM   2752 C CH2 . TRP A 1 357 ? -31.436 22.987 9.405   1.00 51.97  ? 357 TRP A CH2 1 
ATOM   2753 N N   . ILE A 1 358 ? -33.223 16.873 8.431   1.00 46.67  ? 358 ILE A N   1 
ATOM   2754 C CA  . ILE A 1 358 ? -34.606 16.372 8.528   1.00 46.62  ? 358 ILE A CA  1 
ATOM   2755 C C   . ILE A 1 358 ? -35.629 17.503 8.659   1.00 50.27  ? 358 ILE A C   1 
ATOM   2756 O O   . ILE A 1 358 ? -35.483 18.353 9.529   1.00 49.38  ? 358 ILE A O   1 
ATOM   2757 C CB  . ILE A 1 358 ? -34.708 15.349 9.717   1.00 48.85  ? 358 ILE A CB  1 
ATOM   2758 C CG1 . ILE A 1 358 ? -33.834 14.106 9.477   1.00 48.71  ? 358 ILE A CG1 1 
ATOM   2759 C CG2 . ILE A 1 358 ? -36.143 14.939 10.030  1.00 49.23  ? 358 ILE A CG2 1 
ATOM   2760 C CD1 . ILE A 1 358 ? -33.099 13.682 10.662  1.00 55.03  ? 358 ILE A CD1 1 
ATOM   2761 N N   . LYS A 1 359 ? -36.683 17.483 7.827   1.00 49.01  ? 359 LYS A N   1 
ATOM   2762 C CA  . LYS A 1 359 ? -37.783 18.444 7.891   1.00 49.92  ? 359 LYS A CA  1 
ATOM   2763 C C   . LYS A 1 359 ? -38.970 17.717 8.473   1.00 55.24  ? 359 LYS A C   1 
ATOM   2764 O O   . LYS A 1 359 ? -39.502 16.811 7.817   1.00 55.24  ? 359 LYS A O   1 
ATOM   2765 C CB  . LYS A 1 359 ? -38.172 18.975 6.501   1.00 53.43  ? 359 LYS A CB  1 
ATOM   2766 C CG  . LYS A 1 359 ? -39.241 20.055 6.585   1.00 66.99  ? 359 LYS A CG  1 
ATOM   2767 C CD  . LYS A 1 359 ? -39.652 20.565 5.240   1.00 80.29  ? 359 LYS A CD  1 
ATOM   2768 C CE  . LYS A 1 359 ? -40.469 21.824 5.399   1.00 95.82  ? 359 LYS A CE  1 
ATOM   2769 N NZ  . LYS A 1 359 ? -40.999 22.317 4.101   1.00 107.96 ? 359 LYS A NZ  1 
ATOM   2770 N N   . VAL A 1 360 ? -39.412 18.117 9.682   1.00 52.58  ? 360 VAL A N   1 
ATOM   2771 C CA  . VAL A 1 360 ? -40.594 17.492 10.293  1.00 53.79  ? 360 VAL A CA  1 
ATOM   2772 C C   . VAL A 1 360 ? -41.847 18.034 9.599   1.00 60.43  ? 360 VAL A C   1 
ATOM   2773 O O   . VAL A 1 360 ? -42.047 19.254 9.554   1.00 60.19  ? 360 VAL A O   1 
ATOM   2774 C CB  . VAL A 1 360 ? -40.648 17.596 11.836  1.00 56.65  ? 360 VAL A CB  1 
ATOM   2775 C CG1 . VAL A 1 360 ? -41.777 16.736 12.398  1.00 56.48  ? 360 VAL A CG1 1 
ATOM   2776 C CG2 . VAL A 1 360 ? -39.310 17.193 12.455  1.00 54.80  ? 360 VAL A CG2 1 
ATOM   2777 N N   . LYS A 1 361 ? -42.641 17.113 9.008   1.00 59.53  ? 361 LYS A N   1 
ATOM   2778 C CA  . LYS A 1 361 ? -43.850 17.375 8.220   1.00 62.10  ? 361 LYS A CA  1 
ATOM   2779 C C   . LYS A 1 361 ? -44.891 18.337 8.786   1.00 70.37  ? 361 LYS A C   1 
ATOM   2780 O O   . LYS A 1 361 ? -45.238 19.310 8.106   1.00 71.53  ? 361 LYS A O   1 
ATOM   2781 C CB  . LYS A 1 361 ? -44.503 16.076 7.724   1.00 64.54  ? 361 LYS A CB  1 
ATOM   2782 C CG  . LYS A 1 361 ? -43.926 15.581 6.402   1.00 74.94  ? 361 LYS A CG  1 
ATOM   2783 C CD  . LYS A 1 361 ? -45.016 14.940 5.541   1.00 80.41  ? 361 LYS A CD  1 
ATOM   2784 C CE  . LYS A 1 361 ? -44.485 14.297 4.280   1.00 85.61  ? 361 LYS A CE  1 
ATOM   2785 N NZ  . LYS A 1 361 ? -43.953 12.923 4.522   1.00 89.46  ? 361 LYS A NZ  1 
ATOM   2786 N N   . GLY A 1 362 ? -45.380 18.062 9.997   1.00 68.42  ? 362 GLY A N   1 
ATOM   2787 C CA  . GLY A 1 362 ? -46.442 18.849 10.621  1.00 70.34  ? 362 GLY A CA  1 
ATOM   2788 C C   . GLY A 1 362 ? -46.048 20.112 11.360  1.00 75.79  ? 362 GLY A C   1 
ATOM   2789 O O   . GLY A 1 362 ? -46.544 21.196 11.040  1.00 76.29  ? 362 GLY A O   1 
ATOM   2790 N N   . ILE A 1 363 ? -45.189 19.964 12.382  1.00 72.93  ? 363 ILE A N   1 
ATOM   2791 C CA  . ILE A 1 363 ? -44.710 21.033 13.280  1.00 73.24  ? 363 ILE A CA  1 
ATOM   2792 C C   . ILE A 1 363 ? -44.035 22.236 12.583  1.00 78.68  ? 363 ILE A C   1 
ATOM   2793 O O   . ILE A 1 363 ? -43.460 22.083 11.503  1.00 78.72  ? 363 ILE A O   1 
ATOM   2794 C CB  . ILE A 1 363 ? -43.882 20.512 14.507  1.00 74.78  ? 363 ILE A CB  1 
ATOM   2795 C CG1 . ILE A 1 363 ? -43.723 18.951 14.570  1.00 74.50  ? 363 ILE A CG1 1 
ATOM   2796 C CG2 . ILE A 1 363 ? -44.365 21.117 15.831  1.00 76.13  ? 363 ILE A CG2 1 
ATOM   2797 C CD1 . ILE A 1 363 ? -45.026 18.009 14.932  1.00 82.77  ? 363 ILE A CD1 1 
ATOM   2798 N N   . ASN A 1 364 ? -44.124 23.433 13.220  1.00 75.28  ? 364 ASN A N   1 
ATOM   2799 C CA  . ASN A 1 364 ? -43.558 24.702 12.746  1.00 74.94  ? 364 ASN A CA  1 
ATOM   2800 C C   . ASN A 1 364 ? -42.241 25.036 13.460  1.00 76.87  ? 364 ASN A C   1 
ATOM   2801 O O   . ASN A 1 364 ? -41.329 25.589 12.834  1.00 76.07  ? 364 ASN A O   1 
ATOM   2802 C CB  . ASN A 1 364 ? -44.561 25.849 12.921  1.00 77.97  ? 364 ASN A CB  1 
ATOM   2803 C CG  . ASN A 1 364 ? -45.869 25.666 12.180  1.00 117.14 ? 364 ASN A CG  1 
ATOM   2804 O OD1 . ASN A 1 364 ? -45.916 25.230 11.018  1.00 116.42 ? 364 ASN A OD1 1 
ATOM   2805 N ND2 . ASN A 1 364 ? -46.967 26.034 12.828  1.00 113.72 ? 364 ASN A ND2 1 
ATOM   2806 N N   . ASP A 1 365 ? -42.157 24.717 14.773  1.00 71.71  ? 365 ASP A N   1 
ATOM   2807 C CA  . ASP A 1 365 ? -40.976 24.939 15.609  1.00 69.45  ? 365 ASP A CA  1 
ATOM   2808 C C   . ASP A 1 365 ? -40.563 23.635 16.293  1.00 70.72  ? 365 ASP A C   1 
ATOM   2809 O O   . ASP A 1 365 ? -41.299 23.109 17.129  1.00 70.43  ? 365 ASP A O   1 
ATOM   2810 C CB  . ASP A 1 365 ? -41.198 26.072 16.628  1.00 71.94  ? 365 ASP A CB  1 
ATOM   2811 C CG  . ASP A 1 365 ? -40.015 26.297 17.558  1.00 85.11  ? 365 ASP A CG  1 
ATOM   2812 O OD1 . ASP A 1 365 ? -40.117 25.920 18.749  1.00 86.11  ? 365 ASP A OD1 1 
ATOM   2813 O OD2 . ASP A 1 365 ? -38.965 26.806 17.080  1.00 90.63  ? 365 ASP A OD2 1 
ATOM   2814 N N   . VAL A 1 366 ? -39.384 23.117 15.920  1.00 64.99  ? 366 VAL A N   1 
ATOM   2815 C CA  . VAL A 1 366 ? -38.844 21.853 16.412  1.00 63.40  ? 366 VAL A CA  1 
ATOM   2816 C C   . VAL A 1 366 ? -38.015 21.999 17.697  1.00 67.70  ? 366 VAL A C   1 
ATOM   2817 O O   . VAL A 1 366 ? -37.699 20.987 18.342  1.00 66.08  ? 366 VAL A O   1 
ATOM   2818 C CB  . VAL A 1 366 ? -38.114 21.115 15.262  1.00 65.73  ? 366 VAL A CB  1 
ATOM   2819 C CG1 . VAL A 1 366 ? -36.617 21.422 15.234  1.00 63.78  ? 366 VAL A CG1 1 
ATOM   2820 C CG2 . VAL A 1 366 ? -38.383 19.621 15.303  1.00 65.30  ? 366 VAL A CG2 1 
ATOM   2821 N N   . LYS A 1 367 ? -37.662 23.254 18.063  1.00 65.65  ? 367 LYS A N   1 
ATOM   2822 C CA  . LYS A 1 367 ? -36.907 23.569 19.277  1.00 65.23  ? 367 LYS A CA  1 
ATOM   2823 C C   . LYS A 1 367 ? -37.762 23.195 20.504  1.00 72.17  ? 367 LYS A C   1 
ATOM   2824 O O   . LYS A 1 367 ? -37.229 22.748 21.521  1.00 70.99  ? 367 LYS A O   1 
ATOM   2825 C CB  . LYS A 1 367 ? -36.505 25.051 19.280  1.00 67.43  ? 367 LYS A CB  1 
ATOM   2826 C CG  . LYS A 1 367 ? -35.410 25.397 20.276  1.00 78.98  ? 367 LYS A CG  1 
ATOM   2827 C CD  . LYS A 1 367 ? -34.588 26.584 19.801  1.00 89.10  ? 367 LYS A CD  1 
ATOM   2828 C CE  . LYS A 1 367 ? -33.992 27.377 20.938  1.00 98.34  ? 367 LYS A CE  1 
ATOM   2829 N NZ  . LYS A 1 367 ? -34.965 28.352 21.506  1.00 106.87 ? 367 LYS A NZ  1 
ATOM   2830 N N   . GLU A 1 368 ? -39.094 23.321 20.363  1.00 72.36  ? 368 GLU A N   1 
ATOM   2831 C CA  . GLU A 1 368 ? -40.094 22.975 21.365  1.00 74.43  ? 368 GLU A CA  1 
ATOM   2832 C C   . GLU A 1 368 ? -40.132 21.456 21.621  1.00 80.90  ? 368 GLU A C   1 
ATOM   2833 O O   . GLU A 1 368 ? -40.234 21.043 22.780  1.00 81.83  ? 368 GLU A O   1 
ATOM   2834 C CB  . GLU A 1 368 ? -41.470 23.548 20.939  1.00 77.78  ? 368 GLU A CB  1 
ATOM   2835 C CG  . GLU A 1 368 ? -42.673 22.606 20.974  1.00 92.54  ? 368 GLU A CG  1 
ATOM   2836 C CD  . GLU A 1 368 ? -43.021 21.877 19.684  1.00 116.18 ? 368 GLU A CD  1 
ATOM   2837 O OE1 . GLU A 1 368 ? -42.100 21.341 19.028  1.00 104.66 ? 368 GLU A OE1 1 
ATOM   2838 O OE2 . GLU A 1 368 ? -44.227 21.806 19.350  1.00 110.60 ? 368 GLU A OE2 1 
ATOM   2839 N N   . LEU A 1 369 ? -40.024 20.642 20.537  1.00 77.44  ? 369 LEU A N   1 
ATOM   2840 C CA  . LEU A 1 369 ? -40.097 19.177 20.525  1.00 76.90  ? 369 LEU A CA  1 
ATOM   2841 C C   . LEU A 1 369 ? -38.954 18.447 21.229  1.00 79.66  ? 369 LEU A C   1 
ATOM   2842 O O   . LEU A 1 369 ? -39.225 17.475 21.936  1.00 79.89  ? 369 LEU A O   1 
ATOM   2843 C CB  . LEU A 1 369 ? -40.219 18.681 19.085  1.00 77.16  ? 369 LEU A CB  1 
ATOM   2844 C CG  . LEU A 1 369 ? -41.283 17.634 18.826  1.00 82.87  ? 369 LEU A CG  1 
ATOM   2845 C CD1 . LEU A 1 369 ? -42.304 18.156 17.860  1.00 84.01  ? 369 LEU A CD1 1 
ATOM   2846 C CD2 . LEU A 1 369 ? -40.662 16.376 18.254  1.00 84.59  ? 369 LEU A CD2 1 
ATOM   2847 N N   . ILE A 1 370 ? -37.688 18.870 21.008  1.00 74.65  ? 370 ILE A N   1 
ATOM   2848 C CA  . ILE A 1 370 ? -36.498 18.256 21.626  1.00 73.56  ? 370 ILE A CA  1 
ATOM   2849 C C   . ILE A 1 370 ? -36.583 18.259 23.182  1.00 78.59  ? 370 ILE A C   1 
ATOM   2850 O O   . ILE A 1 370 ? -36.253 17.246 23.820  1.00 78.39  ? 370 ILE A O   1 
ATOM   2851 C CB  . ILE A 1 370 ? -35.176 18.887 21.063  1.00 75.33  ? 370 ILE A CB  1 
ATOM   2852 C CG1 . ILE A 1 370 ? -34.924 18.413 19.606  1.00 75.09  ? 370 ILE A CG1 1 
ATOM   2853 C CG2 . ILE A 1 370 ? -33.942 18.615 21.982  1.00 74.71  ? 370 ILE A CG2 1 
ATOM   2854 C CD1 . ILE A 1 370 ? -33.947 19.248 18.785  1.00 78.47  ? 370 ILE A CD1 1 
ATOM   2855 N N   . GLU A 1 371 ? -37.052 19.396 23.764  1.00 74.90  ? 371 GLU A N   1 
ATOM   2856 C CA  . GLU A 1 371 ? -37.220 19.617 25.198  1.00 88.38  ? 371 GLU A CA  1 
ATOM   2857 C C   . GLU A 1 371 ? -38.348 18.730 25.732  1.00 112.15 ? 371 GLU A C   1 
ATOM   2858 O O   . GLU A 1 371 ? -38.104 17.584 26.102  1.00 73.36  ? 371 GLU A O   1 
ATOM   2859 C CB  . GLU A 1 371 ? -37.524 21.104 25.458  1.00 90.37  ? 371 GLU A CB  1 
ATOM   2860 C CG  . GLU A 1 371 ? -37.469 21.529 26.922  1.00 102.24 ? 371 GLU A CG  1 
ATOM   2861 C CD  . GLU A 1 371 ? -36.147 22.062 27.451  1.00 126.05 ? 371 GLU A CD  1 
ATOM   2862 O OE1 . GLU A 1 371 ? -35.080 21.635 26.951  1.00 130.68 ? 371 GLU A OE1 1 
ATOM   2863 O OE2 . GLU A 1 371 ? -36.179 22.880 28.400  1.00 115.94 ? 371 GLU A OE2 1 
ATOM   2864 N N   . GLY A 1 378 ? -31.895 14.758 21.481  1.00 81.60  ? 378 GLY A N   1 
ATOM   2865 C CA  . GLY A 1 378 ? -30.521 15.239 21.484  1.00 80.71  ? 378 GLY A CA  1 
ATOM   2866 C C   . GLY A 1 378 ? -29.529 14.166 21.094  1.00 84.85  ? 378 GLY A C   1 
ATOM   2867 O O   . GLY A 1 378 ? -29.897 13.243 20.360  1.00 86.78  ? 378 GLY A O   1 
ATOM   2868 N N   . VAL A 1 379 ? -28.265 14.264 21.605  1.00 78.56  ? 379 VAL A N   1 
ATOM   2869 C CA  . VAL A 1 379 ? -27.131 13.330 21.370  1.00 76.86  ? 379 VAL A CA  1 
ATOM   2870 C C   . VAL A 1 379 ? -26.532 13.570 19.982  1.00 74.92  ? 379 VAL A C   1 
ATOM   2871 O O   . VAL A 1 379 ? -25.399 14.057 19.871  1.00 73.55  ? 379 VAL A O   1 
ATOM   2872 C CB  . VAL A 1 379 ? -27.424 11.798 21.611  1.00 82.01  ? 379 VAL A CB  1 
ATOM   2873 C CG1 . VAL A 1 379 ? -26.157 10.952 21.455  1.00 81.23  ? 379 VAL A CG1 1 
ATOM   2874 C CG2 . VAL A 1 379 ? -28.092 11.537 22.965  1.00 82.69  ? 379 VAL A CG2 1 
ATOM   2875 N N   . LEU A 1 380 ? -27.300 13.192 18.937  1.00 67.60  ? 380 LEU A N   1 
ATOM   2876 C CA  . LEU A 1 380 ? -26.941 13.326 17.527  1.00 65.38  ? 380 LEU A CA  1 
ATOM   2877 C C   . LEU A 1 380 ? -27.736 14.423 16.833  1.00 64.62  ? 380 LEU A C   1 
ATOM   2878 O O   . LEU A 1 380 ? -27.311 14.899 15.781  1.00 63.55  ? 380 LEU A O   1 
ATOM   2879 C CB  . LEU A 1 380 ? -27.058 11.980 16.763  1.00 65.99  ? 380 LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 380 ? -28.404 11.224 16.785  1.00 71.05  ? 380 LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 380 ? -28.780 10.739 15.392  1.00 71.03  ? 380 LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 380 ? -28.344 10.050 17.746  1.00 73.27  ? 380 LEU A CD2 1 
ATOM   2883 N N   . MET A 1 381 ? -28.847 14.868 17.447  1.00 58.91  ? 381 MET A N   1 
ATOM   2884 C CA  . MET A 1 381 ? -29.725 15.890 16.872  1.00 57.98  ? 381 MET A CA  1 
ATOM   2885 C C   . MET A 1 381 ? -29.633 17.249 17.532  1.00 60.14  ? 381 MET A C   1 
ATOM   2886 O O   . MET A 1 381 ? -29.253 17.332 18.696  1.00 60.63  ? 381 MET A O   1 
ATOM   2887 C CB  . MET A 1 381 ? -31.179 15.398 16.842  1.00 60.93  ? 381 MET A CB  1 
ATOM   2888 C CG  . MET A 1 381 ? -31.368 14.160 15.978  1.00 64.22  ? 381 MET A CG  1 
ATOM   2889 S SD  . MET A 1 381 ? -32.995 13.403 16.132  1.00 68.75  ? 381 MET A SD  1 
ATOM   2890 C CE  . MET A 1 381 ? -32.779 12.466 17.615  1.00 65.34  ? 381 MET A CE  1 
ATOM   2891 N N   . LEU A 1 382 ? -29.955 18.316 16.765  1.00 55.06  ? 382 LEU A N   1 
ATOM   2892 C CA  . LEU A 1 382 ? -30.019 19.728 17.186  1.00 54.00  ? 382 LEU A CA  1 
ATOM   2893 C C   . LEU A 1 382 ? -30.992 20.547 16.273  1.00 57.90  ? 382 LEU A C   1 
ATOM   2894 O O   . LEU A 1 382 ? -31.203 20.136 15.125  1.00 57.55  ? 382 LEU A O   1 
ATOM   2895 C CB  . LEU A 1 382 ? -28.626 20.373 17.364  1.00 52.74  ? 382 LEU A CB  1 
ATOM   2896 C CG  . LEU A 1 382 ? -28.123 21.297 16.278  1.00 56.81  ? 382 LEU A CG  1 
ATOM   2897 C CD1 . LEU A 1 382 ? -27.322 22.427 16.865  1.00 56.10  ? 382 LEU A CD1 1 
ATOM   2898 C CD2 . LEU A 1 382 ? -27.296 20.551 15.308  1.00 59.33  ? 382 LEU A CD2 1 
ATOM   2899 N N   . PRO A 1 383 ? -31.635 21.653 16.756  1.00 54.10  ? 383 PRO A N   1 
ATOM   2900 C CA  . PRO A 1 383 ? -32.623 22.359 15.914  1.00 53.72  ? 383 PRO A CA  1 
ATOM   2901 C C   . PRO A 1 383 ? -32.043 23.334 14.903  1.00 52.08  ? 383 PRO A C   1 
ATOM   2902 O O   . PRO A 1 383 ? -31.016 23.972 15.160  1.00 49.44  ? 383 PRO A O   1 
ATOM   2903 C CB  . PRO A 1 383 ? -33.545 23.051 16.928  1.00 56.61  ? 383 PRO A CB  1 
ATOM   2904 C CG  . PRO A 1 383 ? -32.903 22.852 18.274  1.00 61.32  ? 383 PRO A CG  1 
ATOM   2905 C CD  . PRO A 1 383 ? -31.541 22.286 18.081  1.00 55.74  ? 383 PRO A CD  1 
ATOM   2906 N N   . GLY A 1 384 ? -32.744 23.449 13.777  1.00 48.05  ? 384 GLY A N   1 
ATOM   2907 C CA  . GLY A 1 384 ? -32.390 24.291 12.632  1.00 47.84  ? 384 GLY A CA  1 
ATOM   2908 C C   . GLY A 1 384 ? -32.096 25.767 12.869  1.00 51.01  ? 384 GLY A C   1 
ATOM   2909 O O   . GLY A 1 384 ? -31.366 26.377 12.084  1.00 51.12  ? 384 GLY A O   1 
ATOM   2910 N N   . ASN A 1 385 ? -32.672 26.350 13.937  1.00 46.93  ? 385 ASN A N   1 
ATOM   2911 C CA  . ASN A 1 385 ? -32.546 27.753 14.355  1.00 46.32  ? 385 ASN A CA  1 
ATOM   2912 C C   . ASN A 1 385 ? -31.114 28.312 14.247  1.00 49.01  ? 385 ASN A C   1 
ATOM   2913 O O   . ASN A 1 385 ? -30.911 29.368 13.647  1.00 50.72  ? 385 ASN A O   1 
ATOM   2914 C CB  . ASN A 1 385 ? -33.090 27.935 15.779  1.00 45.37  ? 385 ASN A CB  1 
ATOM   2915 C CG  . ASN A 1 385 ? -34.488 27.393 15.970  1.00 74.00  ? 385 ASN A CG  1 
ATOM   2916 O OD1 . ASN A 1 385 ? -34.686 26.224 16.313  1.00 70.21  ? 385 ASN A OD1 1 
ATOM   2917 N ND2 . ASN A 1 385 ? -35.493 28.217 15.727  1.00 70.61  ? 385 ASN A ND2 1 
ATOM   2918 N N   . ALA A 1 386 ? -30.133 27.569 14.764  1.00 42.25  ? 386 ALA A N   1 
ATOM   2919 C CA  . ALA A 1 386 ? -28.705 27.920 14.782  1.00 40.79  ? 386 ALA A CA  1 
ATOM   2920 C C   . ALA A 1 386 ? -28.047 28.250 13.436  1.00 41.92  ? 386 ALA A C   1 
ATOM   2921 O O   . ALA A 1 386 ? -27.002 28.917 13.396  1.00 42.32  ? 386 ALA A O   1 
ATOM   2922 C CB  . ALA A 1 386 ? -27.929 26.785 15.431  1.00 40.79  ? 386 ALA A CB  1 
ATOM   2923 N N   . PHE A 1 387 ? -28.610 27.730 12.349  1.00 36.29  ? 387 PHE A N   1 
ATOM   2924 C CA  . PHE A 1 387 ? -28.024 27.834 11.012  1.00 35.31  ? 387 PHE A CA  1 
ATOM   2925 C C   . PHE A 1 387 ? -28.584 28.969 10.173  1.00 41.12  ? 387 PHE A C   1 
ATOM   2926 O O   . PHE A 1 387 ? -28.395 29.014 8.952   1.00 41.80  ? 387 PHE A O   1 
ATOM   2927 C CB  . PHE A 1 387 ? -28.142 26.466 10.311  1.00 36.31  ? 387 PHE A CB  1 
ATOM   2928 C CG  . PHE A 1 387 ? -27.659 25.328 11.172  1.00 36.01  ? 387 PHE A CG  1 
ATOM   2929 C CD1 . PHE A 1 387 ? -28.546 24.629 11.994  1.00 38.41  ? 387 PHE A CD1 1 
ATOM   2930 C CD2 . PHE A 1 387 ? -26.312 24.965 11.182  1.00 36.65  ? 387 PHE A CD2 1 
ATOM   2931 C CE1 . PHE A 1 387 ? -28.101 23.585 12.804  1.00 38.04  ? 387 PHE A CE1 1 
ATOM   2932 C CE2 . PHE A 1 387 ? -25.871 23.904 11.975  1.00 38.30  ? 387 PHE A CE2 1 
ATOM   2933 C CZ  . PHE A 1 387 ? -26.773 23.220 12.778  1.00 36.37  ? 387 PHE A CZ  1 
ATOM   2934 N N   . TYR A 1 388 ? -29.240 29.908 10.843  1.00 38.33  ? 388 TYR A N   1 
ATOM   2935 C CA  . TYR A 1 388 ? -29.851 31.063 10.203  1.00 39.33  ? 388 TYR A CA  1 
ATOM   2936 C C   . TYR A 1 388 ? -29.363 32.373 10.822  1.00 45.71  ? 388 TYR A C   1 
ATOM   2937 O O   . TYR A 1 388 ? -29.040 32.403 12.019  1.00 46.51  ? 388 TYR A O   1 
ATOM   2938 C CB  . TYR A 1 388 ? -31.386 30.949 10.316  1.00 40.06  ? 388 TYR A CB  1 
ATOM   2939 C CG  . TYR A 1 388 ? -31.970 29.867 9.436   1.00 39.81  ? 388 TYR A CG  1 
ATOM   2940 C CD1 . TYR A 1 388 ? -32.256 30.112 8.096   1.00 42.36  ? 388 TYR A CD1 1 
ATOM   2941 C CD2 . TYR A 1 388 ? -32.207 28.583 9.935   1.00 39.31  ? 388 TYR A CD2 1 
ATOM   2942 C CE1 . TYR A 1 388 ? -32.767 29.107 7.268   1.00 43.82  ? 388 TYR A CE1 1 
ATOM   2943 C CE2 . TYR A 1 388 ? -32.710 27.565 9.115   1.00 40.22  ? 388 TYR A CE2 1 
ATOM   2944 C CZ  . TYR A 1 388 ? -33.007 27.836 7.784   1.00 47.10  ? 388 TYR A CZ  1 
ATOM   2945 O OH  . TYR A 1 388 ? -33.540 26.855 6.971   1.00 43.46  ? 388 TYR A OH  1 
ATOM   2946 N N   . VAL A 1 389 ? -29.339 33.461 10.015  1.00 41.94  ? 389 VAL A N   1 
ATOM   2947 C CA  . VAL A 1 389 ? -28.979 34.810 10.477  1.00 41.66  ? 389 VAL A CA  1 
ATOM   2948 C C   . VAL A 1 389 ? -30.039 35.229 11.548  1.00 50.14  ? 389 VAL A C   1 
ATOM   2949 O O   . VAL A 1 389 ? -29.673 35.690 12.632  1.00 48.39  ? 389 VAL A O   1 
ATOM   2950 C CB  . VAL A 1 389 ? -28.846 35.823 9.297   1.00 44.70  ? 389 VAL A CB  1 
ATOM   2951 C CG1 . VAL A 1 389 ? -28.614 37.230 9.806   1.00 44.10  ? 389 VAL A CG1 1 
ATOM   2952 C CG2 . VAL A 1 389 ? -27.726 35.435 8.336   1.00 43.62  ? 389 VAL A CG2 1 
ATOM   2953 N N   . ASP A 1 390 ? -31.336 34.969 11.258  1.00 51.09  ? 390 ASP A N   1 
ATOM   2954 C CA  . ASP A 1 390 ? -32.442 35.216 12.175  1.00 53.37  ? 390 ASP A CA  1 
ATOM   2955 C C   . ASP A 1 390 ? -32.764 33.889 12.880  1.00 59.20  ? 390 ASP A C   1 
ATOM   2956 O O   . ASP A 1 390 ? -33.666 33.149 12.465  1.00 60.62  ? 390 ASP A O   1 
ATOM   2957 C CB  . ASP A 1 390 ? -33.662 35.768 11.412  1.00 58.17  ? 390 ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 390 ? -34.869 36.189 12.253  1.00 73.94  ? 390 ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 390 ? -35.765 36.871 11.705  1.00 77.70  ? 390 ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 390 ? -34.931 35.813 13.451  1.00 77.56  ? 390 ASP A OD2 1 
ATOM   2961 N N   . SER A 1 391 ? -32.000 33.592 13.944  1.00 54.62  ? 391 SER A N   1 
ATOM   2962 C CA  . SER A 1 391 ? -32.125 32.364 14.739  1.00 53.28  ? 391 SER A CA  1 
ATOM   2963 C C   . SER A 1 391 ? -33.348 32.332 15.652  1.00 58.19  ? 391 SER A C   1 
ATOM   2964 O O   . SER A 1 391 ? -33.636 31.290 16.243  1.00 57.91  ? 391 SER A O   1 
ATOM   2965 C CB  . SER A 1 391 ? -30.845 32.097 15.529  1.00 54.84  ? 391 SER A CB  1 
ATOM   2966 O OG  . SER A 1 391 ? -30.118 33.280 15.815  1.00 63.30  ? 391 SER A OG  1 
ATOM   2967 N N   . SER A 1 392 ? -34.058 33.472 15.776  1.00 55.73  ? 392 SER A N   1 
ATOM   2968 C CA  . SER A 1 392 ? -35.264 33.612 16.599  1.00 56.60  ? 392 SER A CA  1 
ATOM   2969 C C   . SER A 1 392 ? -36.517 33.138 15.862  1.00 60.99  ? 392 SER A C   1 
ATOM   2970 O O   . SER A 1 392 ? -37.528 32.832 16.498  1.00 61.17  ? 392 SER A O   1 
ATOM   2971 C CB  . SER A 1 392 ? -35.429 35.047 17.086  1.00 61.58  ? 392 SER A CB  1 
ATOM   2972 O OG  . SER A 1 392 ? -35.224 35.971 16.031  1.00 74.82  ? 392 SER A OG  1 
ATOM   2973 N N   . ALA A 1 393 ? -36.440 33.063 14.524  1.00 57.84  ? 393 ALA A N   1 
ATOM   2974 C CA  . ALA A 1 393 ? -37.527 32.572 13.677  1.00 58.84  ? 393 ALA A CA  1 
ATOM   2975 C C   . ALA A 1 393 ? -37.738 31.059 13.927  1.00 60.47  ? 393 ALA A C   1 
ATOM   2976 O O   . ALA A 1 393 ? -36.746 30.348 14.154  1.00 57.47  ? 393 ALA A O   1 
ATOM   2977 C CB  . ALA A 1 393 ? -37.186 32.814 12.213  1.00 60.09  ? 393 ALA A CB  1 
ATOM   2978 N N   . PRO A 1 394 ? -39.001 30.546 13.922  1.00 57.68  ? 394 PRO A N   1 
ATOM   2979 C CA  . PRO A 1 394 ? -39.207 29.094 14.149  1.00 56.43  ? 394 PRO A CA  1 
ATOM   2980 C C   . PRO A 1 394 ? -38.698 28.244 12.980  1.00 58.69  ? 394 PRO A C   1 
ATOM   2981 O O   . PRO A 1 394 ? -38.740 28.704 11.835  1.00 59.97  ? 394 PRO A O   1 
ATOM   2982 C CB  . PRO A 1 394 ? -40.718 28.965 14.348  1.00 59.44  ? 394 PRO A CB  1 
ATOM   2983 C CG  . PRO A 1 394 ? -41.285 30.124 13.638  1.00 65.73  ? 394 PRO A CG  1 
ATOM   2984 C CD  . PRO A 1 394 ? -40.283 31.243 13.697  1.00 60.85  ? 394 PRO A CD  1 
ATOM   2985 N N   . SER A 1 395 ? -38.199 27.021 13.268  1.00 51.60  ? 395 SER A N   1 
ATOM   2986 C CA  . SER A 1 395 ? -37.645 26.117 12.253  1.00 49.31  ? 395 SER A CA  1 
ATOM   2987 C C   . SER A 1 395 ? -38.214 24.689 12.367  1.00 50.10  ? 395 SER A C   1 
ATOM   2988 O O   . SER A 1 395 ? -38.119 24.101 13.446  1.00 48.14  ? 395 SER A O   1 
ATOM   2989 C CB  . SER A 1 395 ? -36.114 26.093 12.342  1.00 50.06  ? 395 SER A CB  1 
ATOM   2990 O OG  . SER A 1 395 ? -35.534 25.413 11.241  1.00 53.13  ? 395 SER A OG  1 
ATOM   2991 N N   . PRO A 1 396 ? -38.763 24.091 11.276  1.00 46.58  ? 396 PRO A N   1 
ATOM   2992 C CA  . PRO A 1 396 ? -39.272 22.705 11.377  1.00 46.10  ? 396 PRO A CA  1 
ATOM   2993 C C   . PRO A 1 396 ? -38.174 21.649 11.178  1.00 48.21  ? 396 PRO A C   1 
ATOM   2994 O O   . PRO A 1 396 ? -38.435 20.444 11.332  1.00 48.33  ? 396 PRO A O   1 
ATOM   2995 C CB  . PRO A 1 396 ? -40.309 22.637 10.262  1.00 49.23  ? 396 PRO A CB  1 
ATOM   2996 C CG  . PRO A 1 396 ? -39.735 23.534 9.208   1.00 54.18  ? 396 PRO A CG  1 
ATOM   2997 C CD  . PRO A 1 396 ? -38.951 24.626 9.910   1.00 49.09  ? 396 PRO A CD  1 
ATOM   2998 N N   . TYR A 1 397 ? -36.952 22.110 10.831  1.00 42.17  ? 397 TYR A N   1 
ATOM   2999 C CA  . TYR A 1 397 ? -35.787 21.282 10.540  1.00 40.57  ? 397 TYR A CA  1 
ATOM   3000 C C   . TYR A 1 397 ? -34.944 20.953 11.747  1.00 44.85  ? 397 TYR A C   1 
ATOM   3001 O O   . TYR A 1 397 ? -34.826 21.752 12.682  1.00 45.43  ? 397 TYR A O   1 
ATOM   3002 C CB  . TYR A 1 397 ? -34.862 21.987 9.530   1.00 40.98  ? 397 TYR A CB  1 
ATOM   3003 C CG  . TYR A 1 397 ? -35.455 22.257 8.170   1.00 42.49  ? 397 TYR A CG  1 
ATOM   3004 C CD1 . TYR A 1 397 ? -36.018 23.494 7.867   1.00 45.39  ? 397 TYR A CD1 1 
ATOM   3005 C CD2 . TYR A 1 397 ? -35.409 21.295 7.168   1.00 42.88  ? 397 TYR A CD2 1 
ATOM   3006 C CE1 . TYR A 1 397 ? -36.574 23.746 6.617   1.00 48.38  ? 397 TYR A CE1 1 
ATOM   3007 C CE2 . TYR A 1 397 ? -35.933 21.544 5.905   1.00 45.57  ? 397 TYR A CE2 1 
ATOM   3008 C CZ  . TYR A 1 397 ? -36.541 22.761 5.637   1.00 57.35  ? 397 TYR A CZ  1 
ATOM   3009 O OH  . TYR A 1 397 ? -37.102 22.969 4.391   1.00 59.95  ? 397 TYR A OH  1 
ATOM   3010 N N   . LEU A 1 398 ? -34.266 19.817 11.670  1.00 40.59  ? 398 LEU A N   1 
ATOM   3011 C CA  . LEU A 1 398 ? -33.288 19.436 12.665  1.00 40.26  ? 398 LEU A CA  1 
ATOM   3012 C C   . LEU A 1 398 ? -32.096 18.763 11.979  1.00 43.19  ? 398 LEU A C   1 
ATOM   3013 O O   . LEU A 1 398 ? -32.259 18.156 10.911  1.00 42.37  ? 398 LEU A O   1 
ATOM   3014 C CB  . LEU A 1 398 ? -33.869 18.644 13.867  1.00 40.95  ? 398 LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 398 ? -34.553 17.287 13.622  1.00 47.56  ? 398 LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 398 ? -33.556 16.140 13.721  1.00 47.70  ? 398 LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 398 ? -35.628 17.035 14.652  1.00 49.69  ? 398 LEU A CD2 1 
ATOM   3018 N N   . ARG A 1 399 ? -30.890 18.938 12.552  1.00 38.16  ? 399 ARG A N   1 
ATOM   3019 C CA  . ARG A 1 399 ? -29.664 18.366 12.004  1.00 36.57  ? 399 ARG A CA  1 
ATOM   3020 C C   . ARG A 1 399 ? -29.209 17.175 12.841  1.00 40.10  ? 399 ARG A C   1 
ATOM   3021 O O   . ARG A 1 399 ? -28.935 17.316 14.037  1.00 39.55  ? 399 ARG A O   1 
ATOM   3022 C CB  . ARG A 1 399 ? -28.554 19.433 11.879  1.00 35.39  ? 399 ARG A CB  1 
ATOM   3023 C CG  . ARG A 1 399 ? -27.312 18.929 11.150  1.00 44.23  ? 399 ARG A CG  1 
ATOM   3024 C CD  . ARG A 1 399 ? -26.073 19.773 11.411  1.00 41.45  ? 399 ARG A CD  1 
ATOM   3025 N NE  . ARG A 1 399 ? -25.458 19.494 12.707  1.00 38.25  ? 399 ARG A NE  1 
ATOM   3026 C CZ  . ARG A 1 399 ? -24.428 20.172 13.209  1.00 47.28  ? 399 ARG A CZ  1 
ATOM   3027 N NH1 . ARG A 1 399 ? -23.880 21.168 12.522  1.00 30.83  ? 399 ARG A NH1 1 
ATOM   3028 N NH2 . ARG A 1 399 ? -23.944 19.865 14.409  1.00 32.60  ? 399 ARG A NH2 1 
ATOM   3029 N N   . ALA A 1 400 ? -29.135 16.003 12.196  1.00 36.43  ? 400 ALA A N   1 
ATOM   3030 C CA  . ALA A 1 400 ? -28.701 14.739 12.790  1.00 35.24  ? 400 ALA A CA  1 
ATOM   3031 C C   . ALA A 1 400 ? -27.304 14.390 12.258  1.00 38.57  ? 400 ALA A C   1 
ATOM   3032 O O   . ALA A 1 400 ? -27.071 14.419 11.047  1.00 38.36  ? 400 ALA A O   1 
ATOM   3033 C CB  . ALA A 1 400 ? -29.692 13.628 12.451  1.00 36.56  ? 400 ALA A CB  1 
ATOM   3034 N N   . SER A 1 401 ? -26.371 14.078 13.164  1.00 34.46  ? 401 SER A N   1 
ATOM   3035 C CA  . SER A 1 401 ? -25.001 13.723 12.790  1.00 32.47  ? 401 SER A CA  1 
ATOM   3036 C C   . SER A 1 401 ? -24.802 12.230 12.832  1.00 34.58  ? 401 SER A C   1 
ATOM   3037 O O   . SER A 1 401 ? -25.154 11.578 13.816  1.00 34.41  ? 401 SER A O   1 
ATOM   3038 C CB  . SER A 1 401 ? -23.988 14.430 13.683  1.00 33.11  ? 401 SER A CB  1 
ATOM   3039 O OG  . SER A 1 401 ? -22.666 14.106 13.291  1.00 41.00  ? 401 SER A OG  1 
ATOM   3040 N N   . PHE A 1 402 ? -24.232 11.691 11.760  1.00 29.80  ? 402 PHE A N   1 
ATOM   3041 C CA  . PHE A 1 402 ? -23.931 10.269 11.638  1.00 29.22  ? 402 PHE A CA  1 
ATOM   3042 C C   . PHE A 1 402 ? -22.407 9.968  11.753  1.00 35.49  ? 402 PHE A C   1 
ATOM   3043 O O   . PHE A 1 402 ? -21.961 8.904  11.344  1.00 36.34  ? 402 PHE A O   1 
ATOM   3044 C CB  . PHE A 1 402 ? -24.554 9.691  10.347  1.00 30.42  ? 402 PHE A CB  1 
ATOM   3045 C CG  . PHE A 1 402 ? -24.154 10.329 9.042   1.00 30.48  ? 402 PHE A CG  1 
ATOM   3046 C CD1 . PHE A 1 402 ? -22.989 9.947  8.392   1.00 33.12  ? 402 PHE A CD1 1 
ATOM   3047 C CD2 . PHE A 1 402 ? -24.984 11.254 8.421   1.00 31.42  ? 402 PHE A CD2 1 
ATOM   3048 C CE1 . PHE A 1 402 ? -22.638 10.511 7.163   1.00 34.25  ? 402 PHE A CE1 1 
ATOM   3049 C CE2 . PHE A 1 402 ? -24.647 11.804 7.187   1.00 34.51  ? 402 PHE A CE2 1 
ATOM   3050 C CZ  . PHE A 1 402 ? -23.475 11.432 6.564   1.00 33.16  ? 402 PHE A CZ  1 
ATOM   3051 N N   . SER A 1 403 ? -21.619 10.892 12.313  1.00 31.90  ? 403 SER A N   1 
ATOM   3052 C CA  . SER A 1 403 ? -20.175 10.703 12.431  1.00 32.00  ? 403 SER A CA  1 
ATOM   3053 C C   . SER A 1 403 ? -19.744 9.757  13.552  1.00 38.25  ? 403 SER A C   1 
ATOM   3054 O O   . SER A 1 403 ? -18.635 9.222  13.488  1.00 38.52  ? 403 SER A O   1 
ATOM   3055 C CB  . SER A 1 403 ? -19.458 12.045 12.575  1.00 34.89  ? 403 SER A CB  1 
ATOM   3056 O OG  . SER A 1 403 ? -19.825 12.730 13.763  1.00 46.73  ? 403 SER A OG  1 
ATOM   3057 N N   . SER A 1 404 ? -20.588 9.550  14.575  1.00 35.87  ? 404 SER A N   1 
ATOM   3058 C CA  . SER A 1 404 ? -20.190 8.723  15.714  1.00 36.49  ? 404 SER A CA  1 
ATOM   3059 C C   . SER A 1 404 ? -21.192 7.673  16.207  1.00 41.44  ? 404 SER A C   1 
ATOM   3060 O O   . SER A 1 404 ? -20.755 6.607  16.653  1.00 43.27  ? 404 SER A O   1 
ATOM   3061 C CB  . SER A 1 404 ? -19.748 9.609  16.869  1.00 40.51  ? 404 SER A CB  1 
ATOM   3062 O OG  . SER A 1 404 ? -20.671 10.671 17.067  1.00 54.19  ? 404 SER A OG  1 
ATOM   3063 N N   . ALA A 1 405 ? -22.507 7.967  16.166  1.00 35.47  ? 405 ALA A N   1 
ATOM   3064 C CA  . ALA A 1 405 ? -23.533 7.041  16.640  1.00 35.32  ? 405 ALA A CA  1 
ATOM   3065 C C   . ALA A 1 405 ? -23.478 5.672  15.929  1.00 41.40  ? 405 ALA A C   1 
ATOM   3066 O O   . ALA A 1 405 ? -23.148 5.597  14.745  1.00 41.19  ? 405 ALA A O   1 
ATOM   3067 C CB  . ALA A 1 405 ? -24.908 7.663  16.501  1.00 36.04  ? 405 ALA A CB  1 
ATOM   3068 N N   . SER A 1 406 ? -23.734 4.587  16.674  1.00 39.16  ? 406 SER A N   1 
ATOM   3069 C CA  . SER A 1 406 ? -23.719 3.237  16.117  1.00 39.60  ? 406 SER A CA  1 
ATOM   3070 C C   . SER A 1 406 ? -25.019 3.005  15.334  1.00 46.38  ? 406 SER A C   1 
ATOM   3071 O O   . SER A 1 406 ? -26.013 3.670  15.642  1.00 45.56  ? 406 SER A O   1 
ATOM   3072 C CB  . SER A 1 406 ? -23.558 2.194  17.223  1.00 41.80  ? 406 SER A CB  1 
ATOM   3073 O OG  . SER A 1 406 ? -24.732 2.009  17.995  1.00 49.83  ? 406 SER A OG  1 
ATOM   3074 N N   . PRO A 1 407 ? -25.063 2.068  14.343  1.00 45.57  ? 407 PRO A N   1 
ATOM   3075 C CA  . PRO A 1 407 ? -26.320 1.831  13.605  1.00 46.45  ? 407 PRO A CA  1 
ATOM   3076 C C   . PRO A 1 407 ? -27.545 1.549  14.482  1.00 50.61  ? 407 PRO A C   1 
ATOM   3077 O O   . PRO A 1 407 ? -28.659 1.935  14.123  1.00 49.19  ? 407 PRO A O   1 
ATOM   3078 C CB  . PRO A 1 407 ? -25.965 0.653  12.701  1.00 49.10  ? 407 PRO A CB  1 
ATOM   3079 C CG  . PRO A 1 407 ? -24.492 0.812  12.470  1.00 52.63  ? 407 PRO A CG  1 
ATOM   3080 C CD  . PRO A 1 407 ? -23.982 1.204  13.819  1.00 47.37  ? 407 PRO A CD  1 
ATOM   3081 N N   . GLU A 1 408 ? -27.325 0.920  15.647  1.00 48.70  ? 408 GLU A N   1 
ATOM   3082 C CA  . GLU A 1 408 ? -28.365 0.620  16.632  1.00 49.63  ? 408 GLU A CA  1 
ATOM   3083 C C   . GLU A 1 408 ? -28.629 1.810  17.565  1.00 51.96  ? 408 GLU A C   1 
ATOM   3084 O O   . GLU A 1 408 ? -29.744 1.940  18.073  1.00 53.24  ? 408 GLU A O   1 
ATOM   3085 C CB  . GLU A 1 408 ? -28.133 -0.716 17.373  1.00 52.20  ? 408 GLU A CB  1 
ATOM   3086 C CG  . GLU A 1 408 ? -26.680 -1.040 17.707  1.00 68.12  ? 408 GLU A CG  1 
ATOM   3087 C CD  . GLU A 1 408 ? -25.783 -1.523 16.580  1.00 91.64  ? 408 GLU A CD  1 
ATOM   3088 O OE1 . GLU A 1 408 ? -26.303 -2.157 15.632  1.00 86.65  ? 408 GLU A OE1 1 
ATOM   3089 O OE2 . GLU A 1 408 ? -24.553 -1.285 16.658  1.00 81.10  ? 408 GLU A OE2 1 
ATOM   3090 N N   . GLN A 1 409 ? -27.640 2.714  17.740  1.00 45.69  ? 409 GLN A N   1 
ATOM   3091 C CA  . GLN A 1 409 ? -27.824 3.955  18.518  1.00 44.70  ? 409 GLN A CA  1 
ATOM   3092 C C   . GLN A 1 409 ? -28.797 4.857  17.735  1.00 47.70  ? 409 GLN A C   1 
ATOM   3093 O O   . GLN A 1 409 ? -29.649 5.521  18.329  1.00 46.60  ? 409 GLN A O   1 
ATOM   3094 C CB  . GLN A 1 409 ? -26.487 4.698  18.720  1.00 44.76  ? 409 GLN A CB  1 
ATOM   3095 C CG  . GLN A 1 409 ? -25.851 4.474  20.073  1.00 62.07  ? 409 GLN A CG  1 
ATOM   3096 C CD  . GLN A 1 409 ? -24.536 5.195  20.220  1.00 90.85  ? 409 GLN A CD  1 
ATOM   3097 O OE1 . GLN A 1 409 ? -24.467 6.436  20.195  1.00 84.86  ? 409 GLN A OE1 1 
ATOM   3098 N NE2 . GLN A 1 409 ? -23.461 4.433  20.413  1.00 87.97  ? 409 GLN A NE2 1 
ATOM   3099 N N   . MET A 1 410 ? -28.664 4.835  16.390  1.00 44.00  ? 410 MET A N   1 
ATOM   3100 C CA  . MET A 1 410 ? -29.478 5.559  15.419  1.00 43.79  ? 410 MET A CA  1 
ATOM   3101 C C   . MET A 1 410 ? -30.914 5.047  15.435  1.00 50.09  ? 410 MET A C   1 
ATOM   3102 O O   . MET A 1 410 ? -31.842 5.853  15.479  1.00 50.24  ? 410 MET A O   1 
ATOM   3103 C CB  . MET A 1 410 ? -28.879 5.406  14.014  1.00 45.90  ? 410 MET A CB  1 
ATOM   3104 C CG  . MET A 1 410 ? -27.657 6.282  13.790  1.00 48.07  ? 410 MET A CG  1 
ATOM   3105 S SD  . MET A 1 410 ? -26.619 5.717  12.408  1.00 51.45  ? 410 MET A SD  1 
ATOM   3106 C CE  . MET A 1 410 ? -25.368 6.877  12.479  1.00 46.64  ? 410 MET A CE  1 
ATOM   3107 N N   . ASP A 1 411 ? -31.097 3.709  15.425  1.00 47.86  ? 411 ASP A N   1 
ATOM   3108 C CA  . ASP A 1 411 ? -32.404 3.054  15.463  1.00 48.60  ? 411 ASP A CA  1 
ATOM   3109 C C   . ASP A 1 411 ? -33.158 3.455  16.722  1.00 54.02  ? 411 ASP A C   1 
ATOM   3110 O O   . ASP A 1 411 ? -34.279 3.945  16.618  1.00 54.71  ? 411 ASP A O   1 
ATOM   3111 C CB  . ASP A 1 411 ? -32.235 1.540  15.406  1.00 51.17  ? 411 ASP A CB  1 
ATOM   3112 C CG  . ASP A 1 411 ? -33.453 0.819  14.882  1.00 68.12  ? 411 ASP A CG  1 
ATOM   3113 O OD1 . ASP A 1 411 ? -34.415 0.620  15.669  1.00 71.97  ? 411 ASP A OD1 1 
ATOM   3114 O OD2 . ASP A 1 411 ? -33.445 0.435  13.694  1.00 71.75  ? 411 ASP A OD2 1 
ATOM   3115 N N   . VAL A 1 412 ? -32.518 3.307  17.904  1.00 50.57  ? 412 VAL A N   1 
ATOM   3116 C CA  . VAL A 1 412 ? -33.073 3.660  19.213  1.00 50.28  ? 412 VAL A CA  1 
ATOM   3117 C C   . VAL A 1 412 ? -33.512 5.136  19.251  1.00 53.99  ? 412 VAL A C   1 
ATOM   3118 O O   . VAL A 1 412 ? -34.632 5.421  19.671  1.00 54.71  ? 412 VAL A O   1 
ATOM   3119 C CB  . VAL A 1 412 ? -32.085 3.304  20.367  1.00 53.37  ? 412 VAL A CB  1 
ATOM   3120 C CG1 . VAL A 1 412 ? -32.520 3.928  21.692  1.00 53.12  ? 412 VAL A CG1 1 
ATOM   3121 C CG2 . VAL A 1 412 ? -31.925 1.796  20.520  1.00 53.63  ? 412 VAL A CG2 1 
ATOM   3122 N N   . ALA A 1 413 ? -32.638 6.053  18.790  1.00 49.50  ? 413 ALA A N   1 
ATOM   3123 C CA  . ALA A 1 413 ? -32.870 7.500  18.782  1.00 48.72  ? 413 ALA A CA  1 
ATOM   3124 C C   . ALA A 1 413 ? -33.990 7.963  17.846  1.00 53.99  ? 413 ALA A C   1 
ATOM   3125 O O   . ALA A 1 413 ? -34.825 8.777  18.260  1.00 54.55  ? 413 ALA A O   1 
ATOM   3126 C CB  . ALA A 1 413 ? -31.582 8.232  18.468  1.00 48.27  ? 413 ALA A CB  1 
ATOM   3127 N N   . PHE A 1 414 ? -34.023 7.440  16.599  1.00 50.33  ? 414 PHE A N   1 
ATOM   3128 C CA  . PHE A 1 414 ? -35.059 7.788  15.625  1.00 51.11  ? 414 PHE A CA  1 
ATOM   3129 C C   . PHE A 1 414 ? -36.422 7.225  16.002  1.00 56.32  ? 414 PHE A C   1 
ATOM   3130 O O   . PHE A 1 414 ? -37.440 7.740  15.547  1.00 57.18  ? 414 PHE A O   1 
ATOM   3131 C CB  . PHE A 1 414 ? -34.656 7.391  14.199  1.00 53.40  ? 414 PHE A CB  1 
ATOM   3132 C CG  . PHE A 1 414 ? -33.787 8.381  13.448  1.00 54.59  ? 414 PHE A CG  1 
ATOM   3133 C CD1 . PHE A 1 414 ? -33.639 9.690  13.897  1.00 57.32  ? 414 PHE A CD1 1 
ATOM   3134 C CD2 . PHE A 1 414 ? -33.165 8.022  12.261  1.00 57.17  ? 414 PHE A CD2 1 
ATOM   3135 C CE1 . PHE A 1 414 ? -32.842 10.601 13.196  1.00 57.57  ? 414 PHE A CE1 1 
ATOM   3136 C CE2 . PHE A 1 414 ? -32.372 8.936  11.560  1.00 59.35  ? 414 PHE A CE2 1 
ATOM   3137 C CZ  . PHE A 1 414 ? -32.220 10.219 12.030  1.00 56.52  ? 414 PHE A CZ  1 
ATOM   3138 N N   . GLN A 1 415 ? -36.440 6.194  16.857  1.00 53.11  ? 415 GLN A N   1 
ATOM   3139 C CA  . GLN A 1 415 ? -37.658 5.599  17.393  1.00 54.71  ? 415 GLN A CA  1 
ATOM   3140 C C   . GLN A 1 415 ? -38.260 6.573  18.432  1.00 59.56  ? 415 GLN A C   1 
ATOM   3141 O O   . GLN A 1 415 ? -39.483 6.733  18.483  1.00 61.43  ? 415 GLN A O   1 
ATOM   3142 C CB  . GLN A 1 415 ? -37.332 4.236  18.003  1.00 56.53  ? 415 GLN A CB  1 
ATOM   3143 C CG  . GLN A 1 415 ? -38.453 3.582  18.795  1.00 76.87  ? 415 GLN A CG  1 
ATOM   3144 C CD  . GLN A 1 415 ? -37.997 2.250  19.305  1.00 101.07 ? 415 GLN A CD  1 
ATOM   3145 O OE1 . GLN A 1 415 ? -38.356 1.226  18.746  1.00 95.63  ? 415 GLN A OE1 1 
ATOM   3146 N NE2 . GLN A 1 415 ? -37.143 2.237  20.331  1.00 96.90  ? 415 GLN A NE2 1 
ATOM   3147 N N   . VAL A 1 416 ? -37.396 7.247  19.221  1.00 53.85  ? 416 VAL A N   1 
ATOM   3148 C CA  . VAL A 1 416 ? -37.790 8.249  20.220  1.00 52.98  ? 416 VAL A CA  1 
ATOM   3149 C C   . VAL A 1 416 ? -38.340 9.478  19.478  1.00 55.79  ? 416 VAL A C   1 
ATOM   3150 O O   . VAL A 1 416 ? -39.372 10.016 19.880  1.00 55.32  ? 416 VAL A O   1 
ATOM   3151 C CB  . VAL A 1 416 ? -36.617 8.595  21.200  1.00 55.19  ? 416 VAL A CB  1 
ATOM   3152 C CG1 . VAL A 1 416 ? -36.984 9.733  22.155  1.00 54.69  ? 416 VAL A CG1 1 
ATOM   3153 C CG2 . VAL A 1 416 ? -36.183 7.365  21.995  1.00 54.95  ? 416 VAL A CG2 1 
ATOM   3154 N N   . LEU A 1 417 ? -37.669 9.881  18.372  1.00 52.12  ? 417 LEU A N   1 
ATOM   3155 C CA  . LEU A 1 417 ? -38.069 11.018 17.537  1.00 52.61  ? 417 LEU A CA  1 
ATOM   3156 C C   . LEU A 1 417 ? -39.491 10.817 17.026  1.00 58.79  ? 417 LEU A C   1 
ATOM   3157 O O   . LEU A 1 417 ? -40.334 11.697 17.218  1.00 59.23  ? 417 LEU A O   1 
ATOM   3158 C CB  . LEU A 1 417 ? -37.098 11.208 16.342  1.00 51.90  ? 417 LEU A CB  1 
ATOM   3159 C CG  . LEU A 1 417 ? -36.614 12.641 15.963  1.00 55.16  ? 417 LEU A CG  1 
ATOM   3160 C CD1 . LEU A 1 417 ? -36.309 12.742 14.475  1.00 55.10  ? 417 LEU A CD1 1 
ATOM   3161 C CD2 . LEU A 1 417 ? -37.607 13.728 16.346  1.00 56.69  ? 417 LEU A CD2 1 
ATOM   3162 N N   . ALA A 1 418 ? -39.769 9.628  16.439  1.00 56.46  ? 418 ALA A N   1 
ATOM   3163 C CA  . ALA A 1 418 ? -41.072 9.248  15.884  1.00 57.84  ? 418 ALA A CA  1 
ATOM   3164 C C   . ALA A 1 418 ? -42.201 9.364  16.887  1.00 64.50  ? 418 ALA A C   1 
ATOM   3165 O O   . ALA A 1 418 ? -43.266 9.845  16.514  1.00 66.19  ? 418 ALA A O   1 
ATOM   3166 C CB  . ALA A 1 418 ? -41.021 7.843  15.319  1.00 58.74  ? 418 ALA A CB  1 
ATOM   3167 N N   . GLN A 1 419 ? -41.977 8.959  18.155  1.00 61.56  ? 419 GLN A N   1 
ATOM   3168 C CA  . GLN A 1 419 ? -43.000 9.039  19.204  1.00 63.00  ? 419 GLN A CA  1 
ATOM   3169 C C   . GLN A 1 419 ? -43.304 10.487 19.607  1.00 66.36  ? 419 GLN A C   1 
ATOM   3170 O O   . GLN A 1 419 ? -44.476 10.840 19.782  1.00 65.39  ? 419 GLN A O   1 
ATOM   3171 C CB  . GLN A 1 419 ? -42.609 8.205  20.429  1.00 64.57  ? 419 GLN A CB  1 
ATOM   3172 C CG  . GLN A 1 419 ? -43.812 7.823  21.284  1.00 95.93  ? 419 GLN A CG  1 
ATOM   3173 C CD  . GLN A 1 419 ? -43.395 7.429  22.675  1.00 130.94 ? 419 GLN A CD  1 
ATOM   3174 O OE1 . GLN A 1 419 ? -43.200 6.247  22.982  1.00 127.72 ? 419 GLN A OE1 1 
ATOM   3175 N NE2 . GLN A 1 419 ? -43.244 8.414  23.553  1.00 130.56 ? 419 GLN A NE2 1 
ATOM   3176 N N   . LEU A 1 420 ? -42.246 11.319 19.719  1.00 62.76  ? 420 LEU A N   1 
ATOM   3177 C CA  . LEU A 1 420 ? -42.363 12.731 20.066  1.00 63.02  ? 420 LEU A CA  1 
ATOM   3178 C C   . LEU A 1 420 ? -43.125 13.497 18.996  1.00 69.84  ? 420 LEU A C   1 
ATOM   3179 O O   . LEU A 1 420 ? -43.976 14.330 19.337  1.00 70.94  ? 420 LEU A O   1 
ATOM   3180 C CB  . LEU A 1 420 ? -40.987 13.355 20.326  1.00 61.37  ? 420 LEU A CB  1 
ATOM   3181 C CG  . LEU A 1 420 ? -40.251 12.837 21.559  1.00 65.00  ? 420 LEU A CG  1 
ATOM   3182 C CD1 . LEU A 1 420 ? -38.853 13.383 21.611  1.00 63.69  ? 420 LEU A CD1 1 
ATOM   3183 C CD2 . LEU A 1 420 ? -40.987 13.183 22.840  1.00 68.10  ? 420 LEU A CD2 1 
ATOM   3184 N N   . ILE A 1 421 ? -42.850 13.175 17.707  1.00 66.42  ? 421 ILE A N   1 
ATOM   3185 C CA  . ILE A 1 421 ? -43.517 13.766 16.548  1.00 67.66  ? 421 ILE A CA  1 
ATOM   3186 C C   . ILE A 1 421 ? -45.021 13.426 16.606  1.00 77.28  ? 421 ILE A C   1 
ATOM   3187 O O   . ILE A 1 421 ? -45.861 14.324 16.493  1.00 78.72  ? 421 ILE A O   1 
ATOM   3188 C CB  . ILE A 1 421 ? -42.813 13.324 15.236  1.00 69.67  ? 421 ILE A CB  1 
ATOM   3189 C CG1 . ILE A 1 421 ? -41.474 14.075 15.073  1.00 68.47  ? 421 ILE A CG1 1 
ATOM   3190 C CG2 . ILE A 1 421 ? -43.712 13.528 14.013  1.00 71.55  ? 421 ILE A CG2 1 
ATOM   3191 C CD1 . ILE A 1 421 ? -40.496 13.494 14.064  1.00 74.13  ? 421 ILE A CD1 1 
ATOM   3192 N N   . LYS A 1 422 ? -45.342 12.146 16.876  1.00 75.73  ? 422 LYS A N   1 
ATOM   3193 C CA  . LYS A 1 422 ? -46.702 11.629 17.001  1.00 77.87  ? 422 LYS A CA  1 
ATOM   3194 C C   . LYS A 1 422 ? -47.492 12.301 18.126  1.00 84.62  ? 422 LYS A C   1 
ATOM   3195 O O   . LYS A 1 422 ? -48.706 12.442 17.996  1.00 85.05  ? 422 LYS A O   1 
ATOM   3196 C CB  . LYS A 1 422 ? -46.663 10.112 17.223  1.00 80.51  ? 422 LYS A CB  1 
ATOM   3197 C CG  . LYS A 1 422 ? -46.575 9.313  15.937  1.00 95.18  ? 422 LYS A CG  1 
ATOM   3198 C CD  . LYS A 1 422 ? -46.032 7.927  16.203  1.00 101.48 ? 422 LYS A CD  1 
ATOM   3199 C CE  . LYS A 1 422 ? -45.974 7.121  14.943  1.00 110.34 ? 422 LYS A CE  1 
ATOM   3200 N NZ  . LYS A 1 422 ? -45.132 5.907  15.115  1.00 121.70 ? 422 LYS A NZ  1 
ATOM   3201 N N   . GLU A 1 423 ? -46.808 12.681 19.231  1.00 82.91  ? 423 GLU A N   1 
ATOM   3202 C CA  . GLU A 1 423 ? -47.400 13.331 20.406  1.00 84.66  ? 423 GLU A CA  1 
ATOM   3203 C C   . GLU A 1 423 ? -47.873 14.746 20.082  1.00 90.50  ? 423 GLU A C   1 
ATOM   3204 O O   . GLU A 1 423 ? -48.994 15.103 20.450  1.00 91.09  ? 423 GLU A O   1 
ATOM   3205 C CB  . GLU A 1 423 ? -46.388 13.386 21.563  1.00 85.45  ? 423 GLU A CB  1 
ATOM   3206 C CG  . GLU A 1 423 ? -46.257 12.097 22.362  1.00 100.66 ? 423 GLU A CG  1 
ATOM   3207 C CD  . GLU A 1 423 ? -44.953 11.953 23.134  1.00 124.79 ? 423 GLU A CD  1 
ATOM   3208 O OE1 . GLU A 1 423 ? -44.655 12.822 23.989  1.00 107.20 ? 423 GLU A OE1 1 
ATOM   3209 O OE2 . GLU A 1 423 ? -44.238 10.953 22.893  1.00 123.05 ? 423 GLU A OE2 1 
ATOM   3210 N N   . SER A 1 424 ? -47.005 15.552 19.413  1.00 87.71  ? 424 SER A N   1 
ATOM   3211 C CA  . SER A 1 424 ? -47.270 16.941 19.010  1.00 88.74  ? 424 SER A CA  1 
ATOM   3212 C C   . SER A 1 424 ? -48.399 17.038 17.994  1.00 95.80  ? 424 SER A C   1 
ATOM   3213 O O   . SER A 1 424 ? -49.168 18.004 18.021  1.00 96.87  ? 424 SER A O   1 
ATOM   3214 C CB  . SER A 1 424 ? -46.018 17.582 18.418  1.00 90.94  ? 424 SER A CB  1 
ATOM   3215 O OG  . SER A 1 424 ? -45.072 17.899 19.421  1.00 100.91 ? 424 SER A OG  1 
ATOM   3216 N N   . LEU A 1 425 ? -48.484 16.045 17.087  1.00 93.07  ? 425 LEU A N   1 
ATOM   3217 C CA  . LEU A 1 425 ? -49.503 16.001 16.048  1.00 94.94  ? 425 LEU A CA  1 
ATOM   3218 C C   . LEU A 1 425 ? -50.892 15.708 16.614  1.00 102.90 ? 425 LEU A C   1 
ATOM   3219 O O   . LEU A 1 425 ? -51.886 16.063 15.983  1.00 104.41 ? 425 LEU A O   1 
ATOM   3220 C CB  . LEU A 1 425 ? -49.123 14.996 14.951  1.00 94.41  ? 425 LEU A CB  1 
ATOM   3221 C CG  . LEU A 1 425 ? -47.871 15.316 14.122  1.00 97.27  ? 425 LEU A CG  1 
ATOM   3222 C CD1 . LEU A 1 425 ? -47.409 14.078 13.359  1.00 96.77  ? 425 LEU A CD1 1 
ATOM   3223 C CD2 . LEU A 1 425 ? -48.091 16.522 13.190  1.00 99.56  ? 425 LEU A CD2 1 
ATOM   3224 N N   . LEU A 1 426 ? -50.959 15.093 17.811  1.00 100.88 ? 426 LEU A N   1 
ATOM   3225 C CA  . LEU A 1 426 ? -52.214 14.763 18.486  1.00 103.15 ? 426 LEU A CA  1 
ATOM   3226 C C   . LEU A 1 426 ? -52.909 15.982 19.092  1.00 111.25 ? 426 LEU A C   1 
ATOM   3227 O O   . LEU A 1 426 ? -54.135 15.984 19.244  1.00 112.11 ? 426 LEU A O   1 
ATOM   3228 C CB  . LEU A 1 426 ? -51.986 13.702 19.566  1.00 102.38 ? 426 LEU A CB  1 
ATOM   3229 C CG  . LEU A 1 426 ? -52.021 12.252 19.109  1.00 106.74 ? 426 LEU A CG  1 
ATOM   3230 C CD1 . LEU A 1 426 ? -51.537 11.345 20.213  1.00 106.04 ? 426 LEU A CD1 1 
ATOM   3231 C CD2 . LEU A 1 426 ? -53.435 11.825 18.691  1.00 111.29 ? 426 LEU A CD2 1 
ATOM   3232 N N   . VAL A 1 427 ? -52.129 17.012 19.444  1.00 109.81 ? 427 VAL A N   1 
ATOM   3233 C CA  . VAL A 1 427 ? -52.659 18.235 20.041  1.00 111.77 ? 427 VAL A CA  1 
ATOM   3234 C C   . VAL A 1 427 ? -52.941 19.335 18.969  1.00 119.22 ? 427 VAL A C   1 
ATOM   3235 O O   . VAL A 1 427 ? -52.065 19.593 18.129  1.00 118.38 ? 427 VAL A O   1 
ATOM   3236 C CB  . VAL A 1 427 ? -51.796 18.697 21.261  1.00 114.31 ? 427 VAL A CB  1 
ATOM   3237 C CG1 . VAL A 1 427 ? -50.470 19.343 20.844  1.00 112.24 ? 427 VAL A CG1 1 
ATOM   3238 C CG2 . VAL A 1 427 ? -52.586 19.594 22.209  1.00 115.53 ? 427 VAL A CG2 1 
ATOM   3239 N N   . PRO A 1 428 ? -54.156 19.963 18.953  1.00 118.90 ? 428 PRO A N   1 
ATOM   3240 C CA  . PRO A 1 428 ? -54.433 21.011 17.941  1.00 124.91 ? 428 PRO A CA  1 
ATOM   3241 C C   . PRO A 1 428 ? -53.623 22.300 18.151  1.00 168.36 ? 428 PRO A C   1 
ATOM   3242 O O   . PRO A 1 428 ? -53.120 22.909 17.203  1.00 132.67 ? 428 PRO A O   1 
ATOM   3243 C CB  . PRO A 1 428 ? -55.944 21.267 18.085  1.00 128.41 ? 428 PRO A CB  1 
ATOM   3244 C CG  . PRO A 1 428 ? -56.472 20.163 18.967  1.00 131.30 ? 428 PRO A CG  1 
ATOM   3245 C CD  . PRO A 1 428 ? -55.324 19.763 19.836  1.00 123.59 ? 428 PRO A CD  1 
ATOM   3246 N N   . MET B 1 1   ? -16.138 50.399 37.929  1.00 41.38  ? 1   MET B N   1 
ATOM   3247 C CA  . MET B 1 1   ? -15.361 50.493 36.685  1.00 40.64  ? 1   MET B CA  1 
ATOM   3248 C C   . MET B 1 1   ? -16.159 50.171 35.424  1.00 43.82  ? 1   MET B C   1 
ATOM   3249 O O   . MET B 1 1   ? -16.572 49.028 35.220  1.00 42.65  ? 1   MET B O   1 
ATOM   3250 C CB  . MET B 1 1   ? -14.064 49.656 36.741  1.00 41.98  ? 1   MET B CB  1 
ATOM   3251 C CG  . MET B 1 1   ? -12.824 50.519 36.894  1.00 46.21  ? 1   MET B CG  1 
ATOM   3252 S SD  . MET B 1 1   ? -11.308 49.919 36.102  1.00 49.91  ? 1   MET B SD  1 
ATOM   3253 C CE  . MET B 1 1   ? -11.816 49.856 34.400  1.00 46.72  ? 1   MET B CE  1 
ATOM   3254 N N   . ASN B 1 2   ? -16.370 51.179 34.571  1.00 41.56  ? 2   ASN B N   1 
ATOM   3255 C CA  . ASN B 1 2   ? -17.097 50.952 33.326  1.00 41.50  ? 2   ASN B CA  1 
ATOM   3256 C C   . ASN B 1 2   ? -16.176 50.379 32.241  1.00 45.10  ? 2   ASN B C   1 
ATOM   3257 O O   . ASN B 1 2   ? -15.391 51.117 31.625  1.00 45.95  ? 2   ASN B O   1 
ATOM   3258 C CB  . ASN B 1 2   ? -17.837 52.191 32.839  1.00 40.66  ? 2   ASN B CB  1 
ATOM   3259 C CG  . ASN B 1 2   ? -19.079 51.796 32.093  1.00 76.93  ? 2   ASN B CG  1 
ATOM   3260 O OD1 . ASN B 1 2   ? -19.020 51.243 30.985  1.00 71.96  ? 2   ASN B OD1 1 
ATOM   3261 N ND2 . ASN B 1 2   ? -20.228 51.966 32.735  1.00 74.60  ? 2   ASN B ND2 1 
ATOM   3262 N N   . TYR B 1 3   ? -16.262 49.060 32.031  1.00 38.88  ? 3   TYR B N   1 
ATOM   3263 C CA  . TYR B 1 3   ? -15.450 48.388 31.035  1.00 37.83  ? 3   TYR B CA  1 
ATOM   3264 C C   . TYR B 1 3   ? -15.853 48.731 29.614  1.00 41.69  ? 3   TYR B C   1 
ATOM   3265 O O   . TYR B 1 3   ? -14.984 48.740 28.737  1.00 41.19  ? 3   TYR B O   1 
ATOM   3266 C CB  . TYR B 1 3   ? -15.413 46.867 31.270  1.00 38.90  ? 3   TYR B CB  1 
ATOM   3267 C CG  . TYR B 1 3   ? -14.654 46.466 32.520  1.00 40.79  ? 3   TYR B CG  1 
ATOM   3268 C CD1 . TYR B 1 3   ? -15.306 45.866 33.592  1.00 42.06  ? 3   TYR B CD1 1 
ATOM   3269 C CD2 . TYR B 1 3   ? -13.290 46.734 32.651  1.00 41.90  ? 3   TYR B CD2 1 
ATOM   3270 C CE1 . TYR B 1 3   ? -14.617 45.515 34.753  1.00 41.61  ? 3   TYR B CE1 1 
ATOM   3271 C CE2 . TYR B 1 3   ? -12.595 46.398 33.810  1.00 42.59  ? 3   TYR B CE2 1 
ATOM   3272 C CZ  . TYR B 1 3   ? -13.263 45.787 34.859  1.00 46.64  ? 3   TYR B CZ  1 
ATOM   3273 O OH  . TYR B 1 3   ? -12.581 45.455 36.000  1.00 43.53  ? 3   TYR B OH  1 
ATOM   3274 N N   . ALA B 1 4   ? -17.150 49.069 29.398  1.00 38.24  ? 4   ALA B N   1 
ATOM   3275 C CA  . ALA B 1 4   ? -17.711 49.412 28.089  1.00 37.75  ? 4   ALA B CA  1 
ATOM   3276 C C   . ALA B 1 4   ? -17.112 50.636 27.428  1.00 40.32  ? 4   ALA B C   1 
ATOM   3277 O O   . ALA B 1 4   ? -17.022 50.650 26.201  1.00 40.91  ? 4   ALA B O   1 
ATOM   3278 C CB  . ALA B 1 4   ? -19.214 49.536 28.158  1.00 39.45  ? 4   ALA B CB  1 
ATOM   3279 N N   . ARG B 1 5   ? -16.663 51.637 28.199  1.00 35.00  ? 5   ARG B N   1 
ATOM   3280 C CA  . ARG B 1 5   ? -16.053 52.824 27.582  1.00 35.17  ? 5   ARG B CA  1 
ATOM   3281 C C   . ARG B 1 5   ? -14.722 52.544 26.841  1.00 39.01  ? 5   ARG B C   1 
ATOM   3282 O O   . ARG B 1 5   ? -14.265 53.366 26.031  1.00 38.34  ? 5   ARG B O   1 
ATOM   3283 C CB  . ARG B 1 5   ? -15.943 54.005 28.568  1.00 35.30  ? 5   ARG B CB  1 
ATOM   3284 C CG  . ARG B 1 5   ? -14.934 53.857 29.697  1.00 41.64  ? 5   ARG B CG  1 
ATOM   3285 C CD  . ARG B 1 5   ? -14.863 55.170 30.465  1.00 47.28  ? 5   ARG B CD  1 
ATOM   3286 N NE  . ARG B 1 5   ? -13.512 55.535 30.905  1.00 46.35  ? 5   ARG B NE  1 
ATOM   3287 C CZ  . ARG B 1 5   ? -12.535 55.950 30.102  1.00 60.82  ? 5   ARG B CZ  1 
ATOM   3288 N NH1 . ARG B 1 5   ? -12.720 56.004 28.789  1.00 44.17  ? 5   ARG B NH1 1 
ATOM   3289 N NH2 . ARG B 1 5   ? -11.360 56.290 30.603  1.00 60.05  ? 5   ARG B NH2 1 
ATOM   3290 N N   . PHE B 1 6   ? -14.144 51.355 27.092  1.00 34.91  ? 6   PHE B N   1 
ATOM   3291 C CA  . PHE B 1 6   ? -12.885 50.914 26.508  1.00 33.87  ? 6   PHE B CA  1 
ATOM   3292 C C   . PHE B 1 6   ? -13.023 50.026 25.255  1.00 36.77  ? 6   PHE B C   1 
ATOM   3293 O O   . PHE B 1 6   ? -12.122 50.021 24.422  1.00 35.55  ? 6   PHE B O   1 
ATOM   3294 C CB  . PHE B 1 6   ? -12.040 50.201 27.573  1.00 34.67  ? 6   PHE B CB  1 
ATOM   3295 C CG  . PHE B 1 6   ? -11.730 51.043 28.787  1.00 36.59  ? 6   PHE B CG  1 
ATOM   3296 C CD1 . PHE B 1 6   ? -12.475 50.909 29.956  1.00 40.19  ? 6   PHE B CD1 1 
ATOM   3297 C CD2 . PHE B 1 6   ? -10.669 51.944 28.776  1.00 38.53  ? 6   PHE B CD2 1 
ATOM   3298 C CE1 . PHE B 1 6   ? -12.168 51.669 31.095  1.00 41.35  ? 6   PHE B CE1 1 
ATOM   3299 C CE2 . PHE B 1 6   ? -10.364 52.705 29.912  1.00 42.11  ? 6   PHE B CE2 1 
ATOM   3300 C CZ  . PHE B 1 6   ? -11.119 52.569 31.062  1.00 40.62  ? 6   PHE B CZ  1 
ATOM   3301 N N   . ILE B 1 7   ? -14.124 49.277 25.117  1.00 32.91  ? 7   ILE B N   1 
ATOM   3302 C CA  . ILE B 1 7   ? -14.283 48.349 23.987  1.00 31.91  ? 7   ILE B CA  1 
ATOM   3303 C C   . ILE B 1 7   ? -14.900 48.922 22.687  1.00 36.08  ? 7   ILE B C   1 
ATOM   3304 O O   . ILE B 1 7   ? -15.402 50.045 22.681  1.00 38.29  ? 7   ILE B O   1 
ATOM   3305 C CB  . ILE B 1 7   ? -14.866 46.982 24.449  1.00 34.31  ? 7   ILE B CB  1 
ATOM   3306 C CG1 . ILE B 1 7   ? -16.377 47.055 24.781  1.00 34.50  ? 7   ILE B CG1 1 
ATOM   3307 C CG2 . ILE B 1 7   ? -14.056 46.435 25.637  1.00 34.74  ? 7   ILE B CG2 1 
ATOM   3308 C CD1 . ILE B 1 7   ? -17.061 45.687 24.887  1.00 33.90  ? 7   ILE B CD1 1 
ATOM   3309 N N   . THR B 1 8   ? -14.784 48.187 21.580  1.00 29.69  ? 8   THR B N   1 
ATOM   3310 C CA  . THR B 1 8   ? -15.367 48.602 20.302  1.00 29.17  ? 8   THR B CA  1 
ATOM   3311 C C   . THR B 1 8   ? -16.771 47.987 20.214  1.00 33.02  ? 8   THR B C   1 
ATOM   3312 O O   . THR B 1 8   ? -17.096 47.074 20.987  1.00 32.35  ? 8   THR B O   1 
ATOM   3313 C CB  . THR B 1 8   ? -14.502 48.136 19.111  1.00 31.46  ? 8   THR B CB  1 
ATOM   3314 O OG1 . THR B 1 8   ? -14.400 46.722 19.125  1.00 32.50  ? 8   THR B OG1 1 
ATOM   3315 C CG2 . THR B 1 8   ? -13.124 48.715 19.122  1.00 28.83  ? 8   THR B CG2 1 
ATOM   3316 N N   . ALA B 1 9   ? -17.584 48.463 19.253  1.00 29.40  ? 9   ALA B N   1 
ATOM   3317 C CA  . ALA B 1 9   ? -18.931 47.988 18.972  1.00 29.35  ? 9   ALA B CA  1 
ATOM   3318 C C   . ALA B 1 9   ? -18.880 46.551 18.432  1.00 34.80  ? 9   ALA B C   1 
ATOM   3319 O O   . ALA B 1 9   ? -19.752 45.734 18.752  1.00 34.91  ? 9   ALA B O   1 
ATOM   3320 C CB  . ALA B 1 9   ? -19.589 48.901 17.958  1.00 31.25  ? 9   ALA B CB  1 
ATOM   3321 N N   . ALA B 1 10  ? -17.831 46.229 17.651  1.00 31.84  ? 10  ALA B N   1 
ATOM   3322 C CA  . ALA B 1 10  ? -17.641 44.902 17.070  1.00 31.43  ? 10  ALA B CA  1 
ATOM   3323 C C   . ALA B 1 10  ? -17.387 43.867 18.158  1.00 37.61  ? 10  ALA B C   1 
ATOM   3324 O O   . ALA B 1 10  ? -17.931 42.753 18.095  1.00 36.82  ? 10  ALA B O   1 
ATOM   3325 C CB  . ALA B 1 10  ? -16.488 44.927 16.097  1.00 31.62  ? 10  ALA B CB  1 
ATOM   3326 N N   . SER B 1 11  ? -16.582 44.260 19.172  1.00 35.13  ? 11  SER B N   1 
ATOM   3327 C CA  . SER B 1 11  ? -16.229 43.411 20.305  1.00 34.61  ? 11  SER B CA  1 
ATOM   3328 C C   . SER B 1 11  ? -17.481 43.008 21.086  1.00 36.74  ? 11  SER B C   1 
ATOM   3329 O O   . SER B 1 11  ? -17.701 41.810 21.295  1.00 36.01  ? 11  SER B O   1 
ATOM   3330 C CB  . SER B 1 11  ? -15.219 44.115 21.207  1.00 39.63  ? 11  SER B CB  1 
ATOM   3331 O OG  . SER B 1 11  ? -14.692 43.223 22.174  1.00 52.26  ? 11  SER B OG  1 
ATOM   3332 N N   . ALA B 1 12  ? -18.334 44.001 21.432  1.00 31.49  ? 12  ALA B N   1 
ATOM   3333 C CA  . ALA B 1 12  ? -19.578 43.809 22.180  1.00 30.87  ? 12  ALA B CA  1 
ATOM   3334 C C   . ALA B 1 12  ? -20.553 42.855 21.480  1.00 34.84  ? 12  ALA B C   1 
ATOM   3335 O O   . ALA B 1 12  ? -21.126 41.979 22.127  1.00 35.18  ? 12  ALA B O   1 
ATOM   3336 C CB  . ALA B 1 12  ? -20.238 45.156 22.424  1.00 32.27  ? 12  ALA B CB  1 
ATOM   3337 N N   . ALA B 1 13  ? -20.694 43.011 20.149  1.00 30.06  ? 13  ALA B N   1 
ATOM   3338 C CA  . ALA B 1 13  ? -21.561 42.243 19.258  1.00 29.03  ? 13  ALA B CA  1 
ATOM   3339 C C   . ALA B 1 13  ? -21.416 40.717 19.345  1.00 31.98  ? 13  ALA B C   1 
ATOM   3340 O O   . ALA B 1 13  ? -22.408 40.003 19.202  1.00 32.01  ? 13  ALA B O   1 
ATOM   3341 C CB  . ALA B 1 13  ? -21.335 42.697 17.828  1.00 29.77  ? 13  ALA B CB  1 
ATOM   3342 N N   . ARG B 1 14  ? -20.180 40.229 19.561  1.00 27.38  ? 14  ARG B N   1 
ATOM   3343 C CA  . ARG B 1 14  ? -19.812 38.810 19.632  1.00 25.97  ? 14  ARG B CA  1 
ATOM   3344 C C   . ARG B 1 14  ? -20.672 38.005 20.600  1.00 30.15  ? 14  ARG B C   1 
ATOM   3345 O O   . ARG B 1 14  ? -20.939 38.442 21.723  1.00 30.46  ? 14  ARG B O   1 
ATOM   3346 C CB  . ARG B 1 14  ? -18.321 38.661 19.974  1.00 24.43  ? 14  ARG B CB  1 
ATOM   3347 C CG  . ARG B 1 14  ? -17.388 39.219 18.909  1.00 29.20  ? 14  ARG B CG  1 
ATOM   3348 C CD  . ARG B 1 14  ? -15.939 38.860 19.170  1.00 37.18  ? 14  ARG B CD  1 
ATOM   3349 N NE  . ARG B 1 14  ? -15.008 39.770 18.492  1.00 39.47  ? 14  ARG B NE  1 
ATOM   3350 C CZ  . ARG B 1 14  ? -14.696 39.736 17.196  1.00 50.72  ? 14  ARG B CZ  1 
ATOM   3351 N NH1 . ARG B 1 14  ? -15.231 38.817 16.398  1.00 41.07  ? 14  ARG B NH1 1 
ATOM   3352 N NH2 . ARG B 1 14  ? -13.852 40.619 16.689  1.00 39.84  ? 14  ARG B NH2 1 
ATOM   3353 N N   . ASN B 1 15  ? -21.125 36.845 20.148  1.00 27.31  ? 15  ASN B N   1 
ATOM   3354 C CA  . ASN B 1 15  ? -21.964 35.937 20.932  1.00 28.47  ? 15  ASN B CA  1 
ATOM   3355 C C   . ASN B 1 15  ? -21.301 34.537 21.085  1.00 37.58  ? 15  ASN B C   1 
ATOM   3356 O O   . ASN B 1 15  ? -20.481 34.146 20.245  1.00 38.59  ? 15  ASN B O   1 
ATOM   3357 C CB  . ASN B 1 15  ? -23.325 35.767 20.254  1.00 25.52  ? 15  ASN B CB  1 
ATOM   3358 C CG  . ASN B 1 15  ? -24.110 37.016 20.015  1.00 36.16  ? 15  ASN B CG  1 
ATOM   3359 O OD1 . ASN B 1 15  ? -24.573 37.671 20.948  1.00 37.24  ? 15  ASN B OD1 1 
ATOM   3360 N ND2 . ASN B 1 15  ? -24.365 37.305 18.750  1.00 20.70  ? 15  ASN B ND2 1 
ATOM   3361 N N   . PRO B 1 16  ? -21.650 33.740 22.115  1.00 36.85  ? 16  PRO B N   1 
ATOM   3362 C CA  . PRO B 1 16  ? -21.078 32.379 22.194  1.00 37.42  ? 16  PRO B CA  1 
ATOM   3363 C C   . PRO B 1 16  ? -21.718 31.465 21.142  1.00 44.80  ? 16  PRO B C   1 
ATOM   3364 O O   . PRO B 1 16  ? -22.830 31.743 20.682  1.00 46.53  ? 16  PRO B O   1 
ATOM   3365 C CB  . PRO B 1 16  ? -21.442 31.916 23.613  1.00 39.19  ? 16  PRO B CB  1 
ATOM   3366 C CG  . PRO B 1 16  ? -22.092 33.117 24.299  1.00 43.29  ? 16  PRO B CG  1 
ATOM   3367 C CD  . PRO B 1 16  ? -22.603 33.991 23.218  1.00 39.00  ? 16  PRO B CD  1 
ATOM   3368 N N   . SER B 1 17  ? -21.036 30.382 20.774  1.00 42.01  ? 17  SER B N   1 
ATOM   3369 C CA  . SER B 1 17  ? -21.521 29.432 19.774  1.00 42.77  ? 17  SER B CA  1 
ATOM   3370 C C   . SER B 1 17  ? -22.854 28.786 20.169  1.00 50.40  ? 17  SER B C   1 
ATOM   3371 O O   . SER B 1 17  ? -23.037 28.427 21.343  1.00 50.07  ? 17  SER B O   1 
ATOM   3372 C CB  . SER B 1 17  ? -20.483 28.349 19.518  1.00 44.60  ? 17  SER B CB  1 
ATOM   3373 O OG  . SER B 1 17  ? -20.814 27.617 18.351  1.00 51.56  ? 17  SER B OG  1 
ATOM   3374 N N   . PRO B 1 18  ? -23.803 28.649 19.204  1.00 49.24  ? 18  PRO B N   1 
ATOM   3375 C CA  . PRO B 1 18  ? -25.092 28.013 19.531  1.00 50.47  ? 18  PRO B CA  1 
ATOM   3376 C C   . PRO B 1 18  ? -24.937 26.528 19.855  1.00 57.07  ? 18  PRO B C   1 
ATOM   3377 O O   . PRO B 1 18  ? -25.785 25.961 20.546  1.00 57.57  ? 18  PRO B O   1 
ATOM   3378 C CB  . PRO B 1 18  ? -25.921 28.228 18.265  1.00 52.73  ? 18  PRO B CB  1 
ATOM   3379 C CG  . PRO B 1 18  ? -24.935 28.354 17.182  1.00 56.33  ? 18  PRO B CG  1 
ATOM   3380 C CD  . PRO B 1 18  ? -23.741 29.032 17.778  1.00 50.83  ? 18  PRO B CD  1 
ATOM   3381 N N   . ILE B 1 19  ? -23.840 25.913 19.358  1.00 54.45  ? 19  ILE B N   1 
ATOM   3382 C CA  . ILE B 1 19  ? -23.492 24.506 19.576  1.00 54.42  ? 19  ILE B CA  1 
ATOM   3383 C C   . ILE B 1 19  ? -22.762 24.332 20.935  1.00 56.57  ? 19  ILE B C   1 
ATOM   3384 O O   . ILE B 1 19  ? -21.597 24.711 21.078  1.00 54.30  ? 19  ILE B O   1 
ATOM   3385 C CB  . ILE B 1 19  ? -22.796 23.860 18.320  1.00 57.63  ? 19  ILE B CB  1 
ATOM   3386 C CG1 . ILE B 1 19  ? -21.472 24.583 17.946  1.00 57.63  ? 19  ILE B CG1 1 
ATOM   3387 C CG2 . ILE B 1 19  ? -23.765 23.845 17.122  1.00 58.88  ? 19  ILE B CG2 1 
ATOM   3388 C CD1 . ILE B 1 19  ? -20.713 24.132 16.654  1.00 63.37  ? 19  ILE B CD1 1 
ATOM   3389 N N   . ARG B 1 20  ? -23.496 23.829 21.949  1.00 54.39  ? 20  ARG B N   1 
ATOM   3390 C CA  . ARG B 1 20  ? -22.992 23.629 23.317  1.00 54.66  ? 20  ARG B CA  1 
ATOM   3391 C C   . ARG B 1 20  ? -22.049 22.422 23.505  1.00 58.59  ? 20  ARG B C   1 
ATOM   3392 O O   . ARG B 1 20  ? -22.345 21.337 23.013  1.00 58.07  ? 20  ARG B O   1 
ATOM   3393 C CB  . ARG B 1 20  ? -24.155 23.603 24.332  1.00 56.04  ? 20  ARG B CB  1 
ATOM   3394 C CG  . ARG B 1 20  ? -24.846 24.957 24.528  1.00 65.80  ? 20  ARG B CG  1 
ATOM   3395 C CD  . ARG B 1 20  ? -23.947 25.994 25.183  1.00 77.18  ? 20  ARG B CD  1 
ATOM   3396 N NE  . ARG B 1 20  ? -24.301 27.349 24.761  1.00 96.94  ? 20  ARG B NE  1 
ATOM   3397 C CZ  . ARG B 1 20  ? -23.450 28.371 24.706  1.00 118.36 ? 20  ARG B CZ  1 
ATOM   3398 N NH1 . ARG B 1 20  ? -22.173 28.203 25.035  1.00 105.47 ? 20  ARG B NH1 1 
ATOM   3399 N NH2 . ARG B 1 20  ? -23.866 29.568 24.312  1.00 108.90 ? 20  ARG B NH2 1 
ATOM   3400 N N   . THR B 1 21  ? -20.905 22.624 24.202  1.00 55.53  ? 21  THR B N   1 
ATOM   3401 C CA  . THR B 1 21  ? -19.879 21.582 24.469  1.00 55.69  ? 21  THR B CA  1 
ATOM   3402 C C   . THR B 1 21  ? -19.542 21.498 25.973  1.00 61.35  ? 21  THR B C   1 
ATOM   3403 O O   . THR B 1 21  ? -20.120 22.272 26.738  1.00 61.95  ? 21  THR B O   1 
ATOM   3404 C CB  . THR B 1 21  ? -18.597 21.770 23.591  1.00 56.27  ? 21  THR B CB  1 
ATOM   3405 O OG1 . THR B 1 21  ? -17.899 22.968 23.950  1.00 51.93  ? 21  THR B OG1 1 
ATOM   3406 C CG2 . THR B 1 21  ? -18.867 21.698 22.075  1.00 51.06  ? 21  THR B CG2 1 
ATOM   3407 N N   . MET B 1 22  ? -18.634 20.557 26.401  1.00 58.05  ? 22  MET B N   1 
ATOM   3408 C CA  . MET B 1 22  ? -18.202 20.356 27.809  1.00 58.48  ? 22  MET B CA  1 
ATOM   3409 C C   . MET B 1 22  ? -17.368 19.100 28.036  1.00 63.80  ? 22  MET B C   1 
ATOM   3410 O O   . MET B 1 22  ? -17.558 18.120 27.314  1.00 64.32  ? 22  MET B O   1 
ATOM   3411 C CB  . MET B 1 22  ? -19.408 20.261 28.771  1.00 61.55  ? 22  MET B CB  1 
ATOM   3412 C CG  . MET B 1 22  ? -20.373 19.148 28.434  1.00 65.98  ? 22  MET B CG  1 
ATOM   3413 S SD  . MET B 1 22  ? -21.535 18.891 29.766  1.00 71.38  ? 22  MET B SD  1 
ATOM   3414 C CE  . MET B 1 22  ? -22.662 17.734 28.983  1.00 68.82  ? 22  MET B CE  1 
ATOM   3415 N N   . THR B 1 23  ? -16.555 19.068 29.127  1.00 59.93  ? 23  THR B N   1 
ATOM   3416 C CA  . THR B 1 23  ? -15.829 17.842 29.482  1.00 59.89  ? 23  THR B CA  1 
ATOM   3417 C C   . THR B 1 23  ? -16.769 16.871 30.235  1.00 64.06  ? 23  THR B C   1 
ATOM   3418 O O   . THR B 1 23  ? -17.441 17.276 31.188  1.00 62.34  ? 23  THR B O   1 
ATOM   3419 C CB  . THR B 1 23  ? -14.432 18.077 30.096  1.00 65.06  ? 23  THR B CB  1 
ATOM   3420 O OG1 . THR B 1 23  ? -14.526 18.238 31.508  1.00 66.02  ? 23  THR B OG1 1 
ATOM   3421 C CG2 . THR B 1 23  ? -13.669 19.224 29.440  1.00 60.68  ? 23  THR B CG2 1 
ATOM   3422 N N   . ASP B 1 24  ? -16.826 15.606 29.755  1.00 62.22  ? 24  ASP B N   1 
ATOM   3423 C CA  . ASP B 1 24  ? -17.683 14.502 30.199  1.00 63.50  ? 24  ASP B CA  1 
ATOM   3424 C C   . ASP B 1 24  ? -17.807 14.186 31.694  1.00 70.06  ? 24  ASP B C   1 
ATOM   3425 O O   . ASP B 1 24  ? -18.903 14.349 32.217  1.00 71.95  ? 24  ASP B O   1 
ATOM   3426 C CB  . ASP B 1 24  ? -17.439 13.233 29.375  1.00 65.91  ? 24  ASP B CB  1 
ATOM   3427 C CG  . ASP B 1 24  ? -18.647 12.329 29.203  1.00 80.35  ? 24  ASP B CG  1 
ATOM   3428 O OD1 . ASP B 1 24  ? -18.579 11.406 28.363  1.00 82.76  ? 24  ASP B OD1 1 
ATOM   3429 O OD2 . ASP B 1 24  ? -19.673 12.558 29.892  1.00 86.63  ? 24  ASP B OD2 1 
ATOM   3430 N N   . ILE B 1 25  ? -16.761 13.636 32.353  1.00 65.99  ? 25  ILE B N   1 
ATOM   3431 C CA  . ILE B 1 25  ? -16.767 13.262 33.785  1.00 65.80  ? 25  ILE B CA  1 
ATOM   3432 C C   . ILE B 1 25  ? -17.801 12.172 34.210  1.00 69.44  ? 25  ILE B C   1 
ATOM   3433 O O   . ILE B 1 25  ? -17.441 11.283 34.986  1.00 69.75  ? 25  ILE B O   1 
ATOM   3434 C CB  . ILE B 1 25  ? -16.655 14.505 34.734  1.00 68.40  ? 25  ILE B CB  1 
ATOM   3435 C CG1 . ILE B 1 25  ? -15.250 15.130 34.632  1.00 68.10  ? 25  ILE B CG1 1 
ATOM   3436 C CG2 . ILE B 1 25  ? -16.993 14.189 36.200  1.00 69.63  ? 25  ILE B CG2 1 
ATOM   3437 C CD1 . ILE B 1 25  ? -15.235 16.618 34.460  1.00 77.53  ? 25  ILE B CD1 1 
ATOM   3438 N N   . LEU B 1 26  ? -19.054 12.227 33.686  1.00 65.41  ? 26  LEU B N   1 
ATOM   3439 C CA  . LEU B 1 26  ? -20.152 11.283 33.968  1.00 65.92  ? 26  LEU B CA  1 
ATOM   3440 C C   . LEU B 1 26  ? -20.031 9.903  33.317  1.00 73.23  ? 26  LEU B C   1 
ATOM   3441 O O   . LEU B 1 26  ? -20.817 9.010  33.637  1.00 72.80  ? 26  LEU B O   1 
ATOM   3442 C CB  . LEU B 1 26  ? -21.502 11.883 33.560  1.00 65.41  ? 26  LEU B CB  1 
ATOM   3443 C CG  . LEU B 1 26  ? -22.177 12.861 34.510  1.00 69.75  ? 26  LEU B CG  1 
ATOM   3444 C CD1 . LEU B 1 26  ? -23.631 13.017 34.153  1.00 70.17  ? 26  LEU B CD1 1 
ATOM   3445 C CD2 . LEU B 1 26  ? -22.066 12.436 35.963  1.00 72.35  ? 26  LEU B CD2 1 
ATOM   3446 N N   . SER B 1 27  ? -19.093 9.727  32.383  1.00 73.14  ? 27  SER B N   1 
ATOM   3447 C CA  . SER B 1 27  ? -18.959 8.461  31.673  1.00 75.14  ? 27  SER B CA  1 
ATOM   3448 C C   . SER B 1 27  ? -17.730 7.611  32.033  1.00 82.53  ? 27  SER B C   1 
ATOM   3449 O O   . SER B 1 27  ? -17.056 7.862  33.041  1.00 81.08  ? 27  SER B O   1 
ATOM   3450 C CB  . SER B 1 27  ? -19.055 8.692  30.166  1.00 78.28  ? 27  SER B CB  1 
ATOM   3451 O OG  . SER B 1 27  ? -20.404 8.686  29.728  1.00 88.50  ? 27  SER B OG  1 
ATOM   3452 N N   . ARG B 1 28  ? -17.524 6.550  31.216  1.00 83.06  ? 28  ARG B N   1 
ATOM   3453 C CA  . ARG B 1 28  ? -16.442 5.560  31.164  1.00 85.09  ? 28  ARG B CA  1 
ATOM   3454 C C   . ARG B 1 28  ? -15.396 5.605  32.306  1.00 91.14  ? 28  ARG B C   1 
ATOM   3455 O O   . ARG B 1 28  ? -15.447 4.783  33.233  1.00 92.38  ? 28  ARG B O   1 
ATOM   3456 C CB  . ARG B 1 28  ? -15.777 5.581  29.754  1.00 86.59  ? 28  ARG B CB  1 
ATOM   3457 C CG  . ARG B 1 28  ? -15.291 6.972  29.294  1.00 99.01  ? 28  ARG B CG  1 
ATOM   3458 C CD  . ARG B 1 28  ? -15.172 7.120  27.790  1.00 111.51 ? 28  ARG B CD  1 
ATOM   3459 N NE  . ARG B 1 28  ? -14.715 8.462  27.412  1.00 118.11 ? 28  ARG B NE  1 
ATOM   3460 C CZ  . ARG B 1 28  ? -15.519 9.499  27.184  1.00 127.91 ? 28  ARG B CZ  1 
ATOM   3461 N NH1 . ARG B 1 28  ? -16.836 9.368  27.299  1.00 115.45 ? 28  ARG B NH1 1 
ATOM   3462 N NH2 . ARG B 1 28  ? -15.011 10.675 26.842  1.00 107.56 ? 28  ARG B NH2 1 
ATOM   3463 N N   . GLY B 1 29  ? -14.487 6.574  32.214  1.00 86.52  ? 29  GLY B N   1 
ATOM   3464 C CA  . GLY B 1 29  ? -13.391 6.800  33.140  1.00 86.17  ? 29  GLY B CA  1 
ATOM   3465 C C   . GLY B 1 29  ? -12.568 7.998  32.711  1.00 88.31  ? 29  GLY B C   1 
ATOM   3466 O O   . GLY B 1 29  ? -12.581 9.015  33.414  1.00 87.87  ? 29  GLY B O   1 
ATOM   3467 N N   . PRO B 1 30  ? -11.846 7.939  31.553  1.00 83.19  ? 30  PRO B N   1 
ATOM   3468 C CA  . PRO B 1 30  ? -11.048 9.109  31.147  1.00 80.74  ? 30  PRO B CA  1 
ATOM   3469 C C   . PRO B 1 30  ? -11.924 10.228 30.585  1.00 80.00  ? 30  PRO B C   1 
ATOM   3470 O O   . PRO B 1 30  ? -12.620 10.037 29.580  1.00 79.98  ? 30  PRO B O   1 
ATOM   3471 C CB  . PRO B 1 30  ? -10.043 8.537  30.137  1.00 82.67  ? 30  PRO B CB  1 
ATOM   3472 C CG  . PRO B 1 30  ? -10.716 7.337  29.560  1.00 88.34  ? 30  PRO B CG  1 
ATOM   3473 C CD  . PRO B 1 30  ? -11.709 6.827  30.580  1.00 85.19  ? 30  PRO B CD  1 
ATOM   3474 N N   . LYS B 1 31  ? -11.929 11.380 31.279  1.00 72.38  ? 31  LYS B N   1 
ATOM   3475 C CA  . LYS B 1 31  ? -12.717 12.532 30.864  1.00 69.90  ? 31  LYS B CA  1 
ATOM   3476 C C   . LYS B 1 31  ? -12.080 13.274 29.675  1.00 70.86  ? 31  LYS B C   1 
ATOM   3477 O O   . LYS B 1 31  ? -10.862 13.477 29.630  1.00 70.18  ? 31  LYS B O   1 
ATOM   3478 C CB  . LYS B 1 31  ? -13.088 13.433 32.065  1.00 71.43  ? 31  LYS B CB  1 
ATOM   3479 C CG  . LYS B 1 31  ? -12.617 14.888 32.020  1.00 79.68  ? 31  LYS B CG  1 
ATOM   3480 C CD  . LYS B 1 31  ? -11.225 15.087 32.631  1.00 81.06  ? 31  LYS B CD  1 
ATOM   3481 C CE  . LYS B 1 31  ? -10.692 16.481 32.400  1.00 82.65  ? 31  LYS B CE  1 
ATOM   3482 N NZ  . LYS B 1 31  ? -11.337 17.493 33.282  1.00 88.89  ? 31  LYS B NZ  1 
ATOM   3483 N N   . SER B 1 32  ? -12.931 13.632 28.705  1.00 65.31  ? 32  SER B N   1 
ATOM   3484 C CA  . SER B 1 32  ? -12.630 14.364 27.475  1.00 63.14  ? 32  SER B CA  1 
ATOM   3485 C C   . SER B 1 32  ? -13.872 15.188 27.121  1.00 63.46  ? 32  SER B C   1 
ATOM   3486 O O   . SER B 1 32  ? -14.968 14.855 27.577  1.00 62.91  ? 32  SER B O   1 
ATOM   3487 C CB  . SER B 1 32  ? -12.327 13.388 26.346  1.00 67.17  ? 32  SER B CB  1 
ATOM   3488 O OG  . SER B 1 32  ? -13.488 12.655 25.991  1.00 80.41  ? 32  SER B OG  1 
ATOM   3489 N N   . MET B 1 33  ? -13.721 16.240 26.303  1.00 57.67  ? 33  MET B N   1 
ATOM   3490 C CA  . MET B 1 33  ? -14.888 17.036 25.939  1.00 56.30  ? 33  MET B CA  1 
ATOM   3491 C C   . MET B 1 33  ? -15.810 16.372 24.902  1.00 60.16  ? 33  MET B C   1 
ATOM   3492 O O   . MET B 1 33  ? -15.371 15.584 24.060  1.00 59.26  ? 33  MET B O   1 
ATOM   3493 C CB  . MET B 1 33  ? -14.572 18.531 25.681  1.00 57.44  ? 33  MET B CB  1 
ATOM   3494 C CG  . MET B 1 33  ? -14.518 18.918 24.216  1.00 60.50  ? 33  MET B CG  1 
ATOM   3495 S SD  . MET B 1 33  ? -15.076 20.607 23.858  1.00 63.39  ? 33  MET B SD  1 
ATOM   3496 C CE  . MET B 1 33  ? -15.379 20.446 22.104  1.00 60.17  ? 33  MET B CE  1 
ATOM   3497 N N   . ILE B 1 34  ? -17.098 16.670 25.022  1.00 57.23  ? 34  ILE B N   1 
ATOM   3498 C CA  . ILE B 1 34  ? -18.171 16.167 24.172  1.00 57.75  ? 34  ILE B CA  1 
ATOM   3499 C C   . ILE B 1 34  ? -18.989 17.352 23.620  1.00 63.55  ? 34  ILE B C   1 
ATOM   3500 O O   . ILE B 1 34  ? -19.017 18.419 24.236  1.00 62.30  ? 34  ILE B O   1 
ATOM   3501 C CB  . ILE B 1 34  ? -19.064 15.144 24.959  1.00 61.04  ? 34  ILE B CB  1 
ATOM   3502 C CG1 . ILE B 1 34  ? -19.642 15.738 26.271  1.00 60.57  ? 34  ILE B CG1 1 
ATOM   3503 C CG2 . ILE B 1 34  ? -18.333 13.813 25.220  1.00 61.74  ? 34  ILE B CG2 1 
ATOM   3504 C CD1 . ILE B 1 34  ? -21.088 15.647 26.370  1.00 62.61  ? 34  ILE B CD1 1 
ATOM   3505 N N   . SER B 1 35  ? -19.656 17.164 22.473  1.00 62.72  ? 35  SER B N   1 
ATOM   3506 C CA  . SER B 1 35  ? -20.520 18.204 21.909  1.00 63.65  ? 35  SER B CA  1 
ATOM   3507 C C   . SER B 1 35  ? -21.989 17.789 22.050  1.00 69.27  ? 35  SER B C   1 
ATOM   3508 O O   . SER B 1 35  ? -22.353 16.655 21.701  1.00 68.49  ? 35  SER B O   1 
ATOM   3509 C CB  . SER B 1 35  ? -20.165 18.517 20.459  1.00 67.89  ? 35  SER B CB  1 
ATOM   3510 O OG  . SER B 1 35  ? -20.422 17.411 19.613  1.00 80.30  ? 35  SER B OG  1 
ATOM   3511 N N   . LEU B 1 36  ? -22.817 18.717 22.593  1.00 66.84  ? 36  LEU B N   1 
ATOM   3512 C CA  . LEU B 1 36  ? -24.243 18.521 22.860  1.00 67.55  ? 36  LEU B CA  1 
ATOM   3513 C C   . LEU B 1 36  ? -25.137 18.553 21.620  1.00 71.48  ? 36  LEU B C   1 
ATOM   3514 O O   . LEU B 1 36  ? -26.348 18.318 21.742  1.00 72.43  ? 36  LEU B O   1 
ATOM   3515 C CB  . LEU B 1 36  ? -24.753 19.437 23.998  1.00 67.72  ? 36  LEU B CB  1 
ATOM   3516 C CG  . LEU B 1 36  ? -24.284 19.050 25.416  1.00 72.07  ? 36  LEU B CG  1 
ATOM   3517 C CD1 . LEU B 1 36  ? -23.920 20.281 26.251  1.00 71.58  ? 36  LEU B CD1 1 
ATOM   3518 C CD2 . LEU B 1 36  ? -25.304 18.187 26.116  1.00 74.25  ? 36  LEU B CD2 1 
ATOM   3519 N N   . ALA B 1 37  ? -24.534 18.770 20.423  1.00 66.24  ? 37  ALA B N   1 
ATOM   3520 C CA  . ALA B 1 37  ? -25.251 18.739 19.147  1.00 65.94  ? 37  ALA B CA  1 
ATOM   3521 C C   . ALA B 1 37  ? -25.186 17.371 18.383  1.00 66.77  ? 37  ALA B C   1 
ATOM   3522 O O   . ALA B 1 37  ? -26.206 16.704 18.393  1.00 68.09  ? 37  ALA B O   1 
ATOM   3523 C CB  . ALA B 1 37  ? -24.890 19.927 18.267  1.00 66.63  ? 37  ALA B CB  1 
ATOM   3524 N N   . GLY B 1 38  ? -24.067 16.915 17.784  1.00 59.51  ? 38  GLY B N   1 
ATOM   3525 C CA  . GLY B 1 38  ? -22.746 17.535 17.668  1.00 57.51  ? 38  GLY B CA  1 
ATOM   3526 C C   . GLY B 1 38  ? -21.931 16.943 16.527  1.00 58.97  ? 38  GLY B C   1 
ATOM   3527 O O   . GLY B 1 38  ? -21.977 15.726 16.293  1.00 58.97  ? 38  GLY B O   1 
ATOM   3528 N N   . GLY B 1 39  ? -21.180 17.804 15.820  1.00 52.02  ? 39  GLY B N   1 
ATOM   3529 C CA  . GLY B 1 39  ? -20.448 17.383 14.637  1.00 49.84  ? 39  GLY B CA  1 
ATOM   3530 C C   . GLY B 1 39  ? -18.979 17.144 14.834  1.00 48.76  ? 39  GLY B C   1 
ATOM   3531 O O   . GLY B 1 39  ? -18.182 17.575 13.990  1.00 49.10  ? 39  GLY B O   1 
ATOM   3532 N N   . LEU B 1 40  ? -18.604 16.457 15.939  1.00 40.45  ? 40  LEU B N   1 
ATOM   3533 C CA  . LEU B 1 40  ? -17.199 16.138 16.197  1.00 37.45  ? 40  LEU B CA  1 
ATOM   3534 C C   . LEU B 1 40  ? -16.785 15.006 15.256  1.00 40.88  ? 40  LEU B C   1 
ATOM   3535 O O   . LEU B 1 40  ? -17.532 14.015 15.132  1.00 40.53  ? 40  LEU B O   1 
ATOM   3536 C CB  . LEU B 1 40  ? -16.943 15.722 17.653  1.00 36.28  ? 40  LEU B CB  1 
ATOM   3537 C CG  . LEU B 1 40  ? -17.273 16.687 18.789  1.00 38.55  ? 40  LEU B CG  1 
ATOM   3538 C CD1 . LEU B 1 40  ? -16.725 16.159 20.098  1.00 37.08  ? 40  LEU B CD1 1 
ATOM   3539 C CD2 . LEU B 1 40  ? -16.737 18.089 18.536  1.00 39.95  ? 40  LEU B CD2 1 
ATOM   3540 N N   . PRO B 1 41  ? -15.631 15.140 14.554  1.00 36.34  ? 41  PRO B N   1 
ATOM   3541 C CA  . PRO B 1 41  ? -15.210 14.069 13.643  1.00 36.18  ? 41  PRO B CA  1 
ATOM   3542 C C   . PRO B 1 41  ? -14.882 12.809 14.432  1.00 38.97  ? 41  PRO B C   1 
ATOM   3543 O O   . PRO B 1 41  ? -14.540 12.912 15.617  1.00 37.49  ? 41  PRO B O   1 
ATOM   3544 C CB  . PRO B 1 41  ? -13.969 14.650 12.961  1.00 37.55  ? 41  PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 41  ? -13.437 15.622 13.917  1.00 41.64  ? 41  PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 41  ? -14.636 16.232 14.587  1.00 37.37  ? 41  PRO B CD  1 
ATOM   3547 N N   . ASN B 1 42  ? -15.009 11.630 13.797  1.00 35.54  ? 42  ASN B N   1 
ATOM   3548 C CA  . ASN B 1 42  ? -14.703 10.399 14.493  1.00 36.23  ? 42  ASN B CA  1 
ATOM   3549 C C   . ASN B 1 42  ? -13.183 10.285 14.778  1.00 41.28  ? 42  ASN B C   1 
ATOM   3550 O O   . ASN B 1 42  ? -12.369 10.316 13.839  1.00 41.55  ? 42  ASN B O   1 
ATOM   3551 C CB  . ASN B 1 42  ? -15.259 9.193  13.772  1.00 37.92  ? 42  ASN B CB  1 
ATOM   3552 C CG  . ASN B 1 42  ? -15.359 7.995  14.675  1.00 65.24  ? 42  ASN B CG  1 
ATOM   3553 O OD1 . ASN B 1 42  ? -14.370 7.522  15.235  1.00 59.47  ? 42  ASN B OD1 1 
ATOM   3554 N ND2 . ASN B 1 42  ? -16.563 7.491  14.863  1.00 60.05  ? 42  ASN B ND2 1 
ATOM   3555 N N   . PRO B 1 43  ? -12.791 10.179 16.075  1.00 36.21  ? 43  PRO B N   1 
ATOM   3556 C CA  . PRO B 1 43  ? -11.358 10.063 16.398  1.00 35.84  ? 43  PRO B CA  1 
ATOM   3557 C C   . PRO B 1 43  ? -10.729 8.699  16.051  1.00 39.85  ? 43  PRO B C   1 
ATOM   3558 O O   . PRO B 1 43  ? -9.506  8.599  15.960  1.00 37.99  ? 43  PRO B O   1 
ATOM   3559 C CB  . PRO B 1 43  ? -11.309 10.391 17.891  1.00 36.90  ? 43  PRO B CB  1 
ATOM   3560 C CG  . PRO B 1 43  ? -12.631 9.942  18.399  1.00 41.21  ? 43  PRO B CG  1 
ATOM   3561 C CD  . PRO B 1 43  ? -13.626 10.109 17.291  1.00 36.91  ? 43  PRO B CD  1 
ATOM   3562 N N   . ASN B 1 44  ? -11.557 7.661  15.820  1.00 38.86  ? 44  ASN B N   1 
ATOM   3563 C CA  . ASN B 1 44  ? -11.063 6.340  15.427  1.00 40.58  ? 44  ASN B CA  1 
ATOM   3564 C C   . ASN B 1 44  ? -10.574 6.331  13.952  1.00 46.06  ? 44  ASN B C   1 
ATOM   3565 O O   . ASN B 1 44  ? -10.118 5.297  13.455  1.00 47.11  ? 44  ASN B O   1 
ATOM   3566 C CB  . ASN B 1 44  ? -12.104 5.243  15.692  1.00 42.23  ? 44  ASN B CB  1 
ATOM   3567 C CG  . ASN B 1 44  ? -12.508 5.107  17.146  1.00 70.98  ? 44  ASN B CG  1 
ATOM   3568 O OD1 . ASN B 1 44  ? -11.683 4.834  18.035  1.00 68.12  ? 44  ASN B OD1 1 
ATOM   3569 N ND2 . ASN B 1 44  ? -13.803 5.265  17.412  1.00 62.07  ? 44  ASN B ND2 1 
ATOM   3570 N N   . MET B 1 45  ? -10.613 7.505  13.286  1.00 41.80  ? 45  MET B N   1 
ATOM   3571 C CA  . MET B 1 45  ? -10.173 7.712  11.904  1.00 41.73  ? 45  MET B CA  1 
ATOM   3572 C C   . MET B 1 45  ? -8.809  8.398  11.837  1.00 43.18  ? 45  MET B C   1 
ATOM   3573 O O   . MET B 1 45  ? -8.157  8.358  10.800  1.00 42.12  ? 45  MET B O   1 
ATOM   3574 C CB  . MET B 1 45  ? -11.204 8.563  11.137  1.00 44.26  ? 45  MET B CB  1 
ATOM   3575 C CG  . MET B 1 45  ? -12.563 7.915  10.984  1.00 49.12  ? 45  MET B CG  1 
ATOM   3576 S SD  . MET B 1 45  ? -12.519 6.415  9.997   1.00 55.11  ? 45  MET B SD  1 
ATOM   3577 C CE  . MET B 1 45  ? -12.896 5.187  11.291  1.00 52.65  ? 45  MET B CE  1 
ATOM   3578 N N   . PHE B 1 46  ? -8.402  9.056  12.936  1.00 38.83  ? 46  PHE B N   1 
ATOM   3579 C CA  . PHE B 1 46  ? -7.150  9.799  13.049  1.00 36.91  ? 46  PHE B CA  1 
ATOM   3580 C C   . PHE B 1 46  ? -5.946  8.856  13.019  1.00 40.12  ? 46  PHE B C   1 
ATOM   3581 O O   . PHE B 1 46  ? -5.982  7.808  13.660  1.00 40.06  ? 46  PHE B O   1 
ATOM   3582 C CB  . PHE B 1 46  ? -7.165  10.710 14.291  1.00 37.27  ? 46  PHE B CB  1 
ATOM   3583 C CG  . PHE B 1 46  ? -8.211  11.814 14.307  1.00 37.52  ? 46  PHE B CG  1 
ATOM   3584 C CD1 . PHE B 1 46  ? -8.774  12.292 13.118  1.00 39.76  ? 46  PHE B CD1 1 
ATOM   3585 C CD2 . PHE B 1 46  ? -8.624  12.385 15.509  1.00 38.66  ? 46  PHE B CD2 1 
ATOM   3586 C CE1 . PHE B 1 46  ? -9.755  13.299 13.138  1.00 39.81  ? 46  PHE B CE1 1 
ATOM   3587 C CE2 . PHE B 1 46  ? -9.591  13.404 15.530  1.00 40.41  ? 46  PHE B CE2 1 
ATOM   3588 C CZ  . PHE B 1 46  ? -10.153 13.850 14.347  1.00 38.61  ? 46  PHE B CZ  1 
ATOM   3589 N N   . PRO B 1 47  ? -4.907  9.169  12.211  1.00 36.34  ? 47  PRO B N   1 
ATOM   3590 C CA  . PRO B 1 47  ? -3.764  8.233  12.077  1.00 36.79  ? 47  PRO B CA  1 
ATOM   3591 C C   . PRO B 1 47  ? -2.806  8.086  13.270  1.00 41.44  ? 47  PRO B C   1 
ATOM   3592 O O   . PRO B 1 47  ? -2.137  7.061  13.376  1.00 41.71  ? 47  PRO B O   1 
ATOM   3593 C CB  . PRO B 1 47  ? -3.060  8.716  10.815  1.00 38.10  ? 47  PRO B CB  1 
ATOM   3594 C CG  . PRO B 1 47  ? -3.369  10.162 10.769  1.00 41.31  ? 47  PRO B CG  1 
ATOM   3595 C CD  . PRO B 1 47  ? -4.747  10.344 11.333  1.00 36.11  ? 47  PRO B CD  1 
ATOM   3596 N N   . PHE B 1 48  ? -2.720  9.091  14.153  1.00 37.74  ? 48  PHE B N   1 
ATOM   3597 C CA  . PHE B 1 48  ? -1.832  9.007  15.317  1.00 38.02  ? 48  PHE B CA  1 
ATOM   3598 C C   . PHE B 1 48  ? -2.516  8.211  16.432  1.00 40.71  ? 48  PHE B C   1 
ATOM   3599 O O   . PHE B 1 48  ? -3.692  8.470  16.736  1.00 39.85  ? 48  PHE B O   1 
ATOM   3600 C CB  . PHE B 1 48  ? -1.367  10.402 15.769  1.00 39.13  ? 48  PHE B CB  1 
ATOM   3601 C CG  . PHE B 1 48  ? -0.885  11.263 14.625  1.00 41.13  ? 48  PHE B CG  1 
ATOM   3602 C CD1 . PHE B 1 48  ? 0.327   10.999 13.995  1.00 45.51  ? 48  PHE B CD1 1 
ATOM   3603 C CD2 . PHE B 1 48  ? -1.655  12.321 14.157  1.00 43.22  ? 48  PHE B CD2 1 
ATOM   3604 C CE1 . PHE B 1 48  ? 0.760   11.783 12.916  1.00 46.60  ? 48  PHE B CE1 1 
ATOM   3605 C CE2 . PHE B 1 48  ? -1.217  13.112 13.083  1.00 46.27  ? 48  PHE B CE2 1 
ATOM   3606 C CZ  . PHE B 1 48  ? -0.006  12.845 12.477  1.00 45.05  ? 48  PHE B CZ  1 
ATOM   3607 N N   . LYS B 1 49  ? -1.802  7.209  16.997  1.00 36.10  ? 49  LYS B N   1 
ATOM   3608 C CA  . LYS B 1 49  ? -2.406  6.291  17.970  1.00 35.59  ? 49  LYS B CA  1 
ATOM   3609 C C   . LYS B 1 49  ? -1.989  6.382  19.438  1.00 39.53  ? 49  LYS B C   1 
ATOM   3610 O O   . LYS B 1 49  ? -2.867  6.290  20.309  1.00 38.96  ? 49  LYS B O   1 
ATOM   3611 C CB  . LYS B 1 49  ? -2.430  4.839  17.453  1.00 37.03  ? 49  LYS B CB  1 
ATOM   3612 C CG  . LYS B 1 49  ? -3.154  4.654  16.106  1.00 32.29  ? 49  LYS B CG  1 
ATOM   3613 C CD  . LYS B 1 49  ? -4.674  4.834  16.188  1.00 35.21  ? 49  LYS B CD  1 
ATOM   3614 C CE  . LYS B 1 49  ? -5.357  4.671  14.846  1.00 43.92  ? 49  LYS B CE  1 
ATOM   3615 N NZ  . LYS B 1 49  ? -6.733  5.245  14.860  1.00 55.97  ? 49  LYS B NZ  1 
ATOM   3616 N N   . THR B 1 50  ? -0.670  6.500  19.714  1.00 35.06  ? 50  THR B N   1 
ATOM   3617 C CA  . THR B 1 50  ? -0.093  6.618  21.067  1.00 34.58  ? 50  THR B CA  1 
ATOM   3618 C C   . THR B 1 50  ? 1.161   7.485  20.995  1.00 40.14  ? 50  THR B C   1 
ATOM   3619 O O   . THR B 1 50  ? 1.772   7.590  19.931  1.00 40.39  ? 50  THR B O   1 
ATOM   3620 C CB  . THR B 1 50  ? 0.310   5.260  21.690  1.00 38.80  ? 50  THR B CB  1 
ATOM   3621 O OG1 . THR B 1 50  ? 1.408   4.700  20.976  1.00 42.50  ? 50  THR B OG1 1 
ATOM   3622 C CG2 . THR B 1 50  ? -0.836  4.272  21.837  1.00 34.66  ? 50  THR B CG2 1 
ATOM   3623 N N   . ALA B 1 51  ? 1.569   8.083  22.120  1.00 37.30  ? 51  ALA B N   1 
ATOM   3624 C CA  . ALA B 1 51  ? 2.764   8.921  22.128  1.00 37.52  ? 51  ALA B CA  1 
ATOM   3625 C C   . ALA B 1 51  ? 3.523   8.824  23.431  1.00 41.16  ? 51  ALA B C   1 
ATOM   3626 O O   . ALA B 1 51  ? 2.922   8.674  24.499  1.00 41.02  ? 51  ALA B O   1 
ATOM   3627 C CB  . ALA B 1 51  ? 2.398   10.379 21.845  1.00 37.25  ? 51  ALA B CB  1 
ATOM   3628 N N   . VAL B 1 52  ? 4.849   8.916  23.330  1.00 37.09  ? 52  VAL B N   1 
ATOM   3629 C CA  . VAL B 1 52  ? 5.759   8.910  24.468  1.00 37.14  ? 52  VAL B CA  1 
ATOM   3630 C C   . VAL B 1 52  ? 6.833   9.960  24.231  1.00 38.94  ? 52  VAL B C   1 
ATOM   3631 O O   . VAL B 1 52  ? 7.592   9.878  23.262  1.00 39.01  ? 52  VAL B O   1 
ATOM   3632 C CB  . VAL B 1 52  ? 6.268   7.503  24.928  1.00 42.48  ? 52  VAL B CB  1 
ATOM   3633 C CG1 . VAL B 1 52  ? 6.545   6.593  23.751  1.00 43.69  ? 52  VAL B CG1 1 
ATOM   3634 C CG2 . VAL B 1 52  ? 7.491   7.593  25.847  1.00 42.27  ? 52  VAL B CG2 1 
ATOM   3635 N N   . ILE B 1 53  ? 6.819   10.982 25.092  1.00 33.51  ? 53  ILE B N   1 
ATOM   3636 C CA  . ILE B 1 53  ? 7.730   12.114 25.070  1.00 33.51  ? 53  ILE B CA  1 
ATOM   3637 C C   . ILE B 1 53  ? 8.638   12.042 26.312  1.00 40.24  ? 53  ILE B C   1 
ATOM   3638 O O   . ILE B 1 53  ? 8.141   11.936 27.445  1.00 38.80  ? 53  ILE B O   1 
ATOM   3639 C CB  . ILE B 1 53  ? 6.932   13.456 24.980  1.00 34.96  ? 53  ILE B CB  1 
ATOM   3640 C CG1 . ILE B 1 53  ? 6.042   13.494 23.709  1.00 35.23  ? 53  ILE B CG1 1 
ATOM   3641 C CG2 . ILE B 1 53  ? 7.861   14.698 25.064  1.00 32.83  ? 53  ILE B CG2 1 
ATOM   3642 C CD1 . ILE B 1 53  ? 4.786   14.296 23.821  1.00 35.85  ? 53  ILE B CD1 1 
ATOM   3643 N N   . THR B 1 54  ? 9.963   12.097 26.085  1.00 39.31  ? 54  THR B N   1 
ATOM   3644 C CA  . THR B 1 54  ? 10.958  12.070 27.152  1.00 40.90  ? 54  THR B CA  1 
ATOM   3645 C C   . THR B 1 54  ? 11.148  13.458 27.741  1.00 46.67  ? 54  THR B C   1 
ATOM   3646 O O   . THR B 1 54  ? 11.070  14.456 27.021  1.00 45.69  ? 54  THR B O   1 
ATOM   3647 C CB  . THR B 1 54  ? 12.284  11.416 26.699  1.00 46.97  ? 54  THR B CB  1 
ATOM   3648 O OG1 . THR B 1 54  ? 12.907  12.195 25.662  1.00 41.13  ? 54  THR B OG1 1 
ATOM   3649 C CG2 . THR B 1 54  ? 12.098  9.968  26.278  1.00 46.90  ? 54  THR B CG2 1 
ATOM   3650 N N   . VAL B 1 55  ? 11.351  13.515 29.068  1.00 45.33  ? 55  VAL B N   1 
ATOM   3651 C CA  . VAL B 1 55  ? 11.580  14.760 29.792  1.00 45.20  ? 55  VAL B CA  1 
ATOM   3652 C C   . VAL B 1 55  ? 12.842  14.660 30.654  1.00 53.29  ? 55  VAL B C   1 
ATOM   3653 O O   . VAL B 1 55  ? 12.995  13.712 31.445  1.00 53.40  ? 55  VAL B O   1 
ATOM   3654 C CB  . VAL B 1 55  ? 10.344  15.249 30.593  1.00 47.65  ? 55  VAL B CB  1 
ATOM   3655 C CG1 . VAL B 1 55  ? 10.690  16.432 31.488  1.00 46.48  ? 55  VAL B CG1 1 
ATOM   3656 C CG2 . VAL B 1 55  ? 9.211   15.632 29.659  1.00 46.95  ? 55  VAL B CG2 1 
ATOM   3657 N N   . GLU B 1 56  ? 13.756  15.649 30.461  1.00 51.66  ? 56  GLU B N   1 
ATOM   3658 C CA  . GLU B 1 56  ? 14.974  15.855 31.236  1.00 53.01  ? 56  GLU B CA  1 
ATOM   3659 C C   . GLU B 1 56  ? 14.481  16.532 32.536  1.00 59.42  ? 56  GLU B C   1 
ATOM   3660 O O   . GLU B 1 56  ? 13.793  17.564 32.463  1.00 59.44  ? 56  GLU B O   1 
ATOM   3661 C CB  . GLU B 1 56  ? 15.929  16.774 30.451  1.00 54.08  ? 56  GLU B CB  1 
ATOM   3662 C CG  . GLU B 1 56  ? 17.322  16.913 31.045  1.00 69.51  ? 56  GLU B CG  1 
ATOM   3663 C CD  . GLU B 1 56  ? 18.473  16.741 30.071  1.00 104.29 ? 56  GLU B CD  1 
ATOM   3664 O OE1 . GLU B 1 56  ? 18.982  17.767 29.561  1.00 110.06 ? 56  GLU B OE1 1 
ATOM   3665 O OE2 . GLU B 1 56  ? 18.884  15.581 29.833  1.00 100.04 ? 56  GLU B OE2 1 
ATOM   3666 N N   . ASN B 1 57  ? 14.756  15.910 33.708  1.00 56.81  ? 57  ASN B N   1 
ATOM   3667 C CA  . ASN B 1 57  ? 14.314  16.395 35.034  1.00 56.14  ? 57  ASN B CA  1 
ATOM   3668 C C   . ASN B 1 57  ? 12.807  16.262 35.336  1.00 58.17  ? 57  ASN B C   1 
ATOM   3669 O O   . ASN B 1 57  ? 12.242  17.043 36.108  1.00 57.83  ? 57  ASN B O   1 
ATOM   3670 C CB  . ASN B 1 57  ? 14.868  17.788 35.382  1.00 54.91  ? 57  ASN B CB  1 
ATOM   3671 C CG  . ASN B 1 57  ? 16.134  17.732 36.194  1.00 81.65  ? 57  ASN B CG  1 
ATOM   3672 O OD1 . ASN B 1 57  ? 17.193  18.183 35.750  1.00 80.23  ? 57  ASN B OD1 1 
ATOM   3673 N ND2 . ASN B 1 57  ? 16.056  17.170 37.399  1.00 70.89  ? 57  ASN B ND2 1 
ATOM   3674 N N   . GLY B 1 58  ? 12.194  15.233 34.769  1.00 53.05  ? 58  GLY B N   1 
ATOM   3675 C CA  . GLY B 1 58  ? 10.783  14.921 34.957  1.00 51.67  ? 58  GLY B CA  1 
ATOM   3676 C C   . GLY B 1 58  ? 10.499  13.482 34.591  1.00 55.20  ? 58  GLY B C   1 
ATOM   3677 O O   . GLY B 1 58  ? 11.380  12.794 34.058  1.00 56.64  ? 58  GLY B O   1 
ATOM   3678 N N   . LYS B 1 59  ? 9.285   13.001 34.895  1.00 49.44  ? 59  LYS B N   1 
ATOM   3679 C CA  . LYS B 1 59  ? 8.894   11.641 34.526  1.00 49.15  ? 59  LYS B CA  1 
ATOM   3680 C C   . LYS B 1 59  ? 8.574   11.657 33.009  1.00 51.85  ? 59  LYS B C   1 
ATOM   3681 O O   . LYS B 1 59  ? 8.295   12.732 32.459  1.00 51.12  ? 59  LYS B O   1 
ATOM   3682 C CB  . LYS B 1 59  ? 7.676   11.189 35.353  1.00 50.64  ? 59  LYS B CB  1 
ATOM   3683 C CG  . LYS B 1 59  ? 7.536   9.674  35.447  1.00 62.87  ? 59  LYS B CG  1 
ATOM   3684 C CD  . LYS B 1 59  ? 6.297   9.258  36.235  1.00 70.98  ? 59  LYS B CD  1 
ATOM   3685 C CE  . LYS B 1 59  ? 5.747   7.908  35.810  1.00 80.01  ? 59  LYS B CE  1 
ATOM   3686 N NZ  . LYS B 1 59  ? 4.886   7.982  34.588  1.00 81.79  ? 59  LYS B NZ  1 
ATOM   3687 N N   . THR B 1 60  ? 8.656   10.499 32.329  1.00 47.10  ? 60  THR B N   1 
ATOM   3688 C CA  . THR B 1 60  ? 8.330   10.422 30.899  1.00 45.16  ? 60  THR B CA  1 
ATOM   3689 C C   . THR B 1 60  ? 6.815   10.581 30.679  1.00 45.31  ? 60  THR B C   1 
ATOM   3690 O O   . THR B 1 60  ? 6.043   9.891  31.344  1.00 46.39  ? 60  THR B O   1 
ATOM   3691 C CB  . THR B 1 60  ? 8.986   9.205  30.220  1.00 53.88  ? 60  THR B CB  1 
ATOM   3692 O OG1 . THR B 1 60  ? 8.598   9.170  28.850  1.00 51.24  ? 60  THR B OG1 1 
ATOM   3693 C CG2 . THR B 1 60  ? 8.641   7.872  30.892  1.00 58.25  ? 60  THR B CG2 1 
ATOM   3694 N N   . ILE B 1 61  ? 6.397   11.523 29.792  1.00 37.82  ? 61  ILE B N   1 
ATOM   3695 C CA  . ILE B 1 61  ? 4.991   11.831 29.463  1.00 35.87  ? 61  ILE B CA  1 
ATOM   3696 C C   . ILE B 1 61  ? 4.451   10.755 28.496  1.00 40.47  ? 61  ILE B C   1 
ATOM   3697 O O   . ILE B 1 61  ? 5.159   10.379 27.554  1.00 40.93  ? 61  ILE B O   1 
ATOM   3698 C CB  . ILE B 1 61  ? 4.893   13.273 28.871  1.00 36.96  ? 61  ILE B CB  1 
ATOM   3699 C CG1 . ILE B 1 61  ? 4.996   14.339 29.968  1.00 36.60  ? 61  ILE B CG1 1 
ATOM   3700 C CG2 . ILE B 1 61  ? 3.640   13.477 28.019  1.00 35.99  ? 61  ILE B CG2 1 
ATOM   3701 C CD1 . ILE B 1 61  ? 5.443   15.676 29.517  1.00 36.96  ? 61  ILE B CD1 1 
ATOM   3702 N N   . GLN B 1 62  ? 3.227   10.253 28.731  1.00 36.68  ? 62  GLN B N   1 
ATOM   3703 C CA  . GLN B 1 62  ? 2.639   9.218  27.870  1.00 37.49  ? 62  GLN B CA  1 
ATOM   3704 C C   . GLN B 1 62  ? 1.200   9.474  27.499  1.00 40.41  ? 62  GLN B C   1 
ATOM   3705 O O   . GLN B 1 62  ? 0.358   9.716  28.375  1.00 40.98  ? 62  GLN B O   1 
ATOM   3706 C CB  . GLN B 1 62  ? 2.746   7.822  28.505  1.00 40.54  ? 62  GLN B CB  1 
ATOM   3707 C CG  . GLN B 1 62  ? 4.128   7.191  28.379  1.00 72.42  ? 62  GLN B CG  1 
ATOM   3708 C CD  . GLN B 1 62  ? 4.474   6.307  29.556  1.00 95.36  ? 62  GLN B CD  1 
ATOM   3709 O OE1 . GLN B 1 62  ? 4.748   6.777  30.673  1.00 89.19  ? 62  GLN B OE1 1 
ATOM   3710 N NE2 . GLN B 1 62  ? 4.518   5.005  29.313  1.00 89.02  ? 62  GLN B NE2 1 
ATOM   3711 N N   . PHE B 1 63  ? 0.901   9.399  26.202  1.00 35.35  ? 63  PHE B N   1 
ATOM   3712 C CA  . PHE B 1 63  ? -0.475  9.525  25.739  1.00 33.85  ? 63  PHE B CA  1 
ATOM   3713 C C   . PHE B 1 63  ? -0.900  8.139  25.270  1.00 38.70  ? 63  PHE B C   1 
ATOM   3714 O O   . PHE B 1 63  ? -0.404  7.645  24.256  1.00 39.33  ? 63  PHE B O   1 
ATOM   3715 C CB  . PHE B 1 63  ? -0.646  10.578 24.619  1.00 34.33  ? 63  PHE B CB  1 
ATOM   3716 C CG  . PHE B 1 63  ? -0.411  12.047 24.935  1.00 34.89  ? 63  PHE B CG  1 
ATOM   3717 C CD1 . PHE B 1 63  ? 0.044   12.449 26.188  1.00 37.36  ? 63  PHE B CD1 1 
ATOM   3718 C CD2 . PHE B 1 63  ? -0.603  13.021 23.962  1.00 36.48  ? 63  PHE B CD2 1 
ATOM   3719 C CE1 . PHE B 1 63  ? 0.291   13.796 26.462  1.00 37.04  ? 63  PHE B CE1 1 
ATOM   3720 C CE2 . PHE B 1 63  ? -0.355  14.369 24.241  1.00 38.47  ? 63  PHE B CE2 1 
ATOM   3721 C CZ  . PHE B 1 63  ? 0.095   14.745 25.488  1.00 35.77  ? 63  PHE B CZ  1 
ATOM   3722 N N   . GLY B 1 64  ? -1.763  7.502  26.054  1.00 34.72  ? 64  GLY B N   1 
ATOM   3723 C CA  . GLY B 1 64  ? -2.330  6.202  25.733  1.00 35.31  ? 64  GLY B CA  1 
ATOM   3724 C C   . GLY B 1 64  ? -3.405  6.299  24.667  1.00 39.45  ? 64  GLY B C   1 
ATOM   3725 O O   . GLY B 1 64  ? -3.683  7.386  24.159  1.00 37.02  ? 64  GLY B O   1 
ATOM   3726 N N   . GLU B 1 65  ? -4.025  5.162  24.326  1.00 39.44  ? 65  GLU B N   1 
ATOM   3727 C CA  . GLU B 1 65  ? -5.060  5.056  23.289  1.00 40.42  ? 65  GLU B CA  1 
ATOM   3728 C C   . GLU B 1 65  ? -6.137  6.149  23.377  1.00 44.07  ? 65  GLU B C   1 
ATOM   3729 O O   . GLU B 1 65  ? -6.395  6.856  22.391  1.00 43.58  ? 65  GLU B O   1 
ATOM   3730 C CB  . GLU B 1 65  ? -5.700  3.653  23.302  1.00 43.47  ? 65  GLU B CB  1 
ATOM   3731 C CG  . GLU B 1 65  ? -5.319  2.775  22.115  1.00 61.66  ? 65  GLU B CG  1 
ATOM   3732 C CD  . GLU B 1 65  ? -3.942  2.123  22.115  1.00 101.11 ? 65  GLU B CD  1 
ATOM   3733 O OE1 . GLU B 1 65  ? -3.245  2.173  23.155  1.00 105.39 ? 65  GLU B OE1 1 
ATOM   3734 O OE2 . GLU B 1 65  ? -3.573  1.529  21.074  1.00 98.03  ? 65  GLU B OE2 1 
ATOM   3735 N N   . GLU B 1 66  ? -6.706  6.321  24.574  1.00 40.18  ? 66  GLU B N   1 
ATOM   3736 C CA  . GLU B 1 66  ? -7.771  7.283  24.841  1.00 38.69  ? 66  GLU B CA  1 
ATOM   3737 C C   . GLU B 1 66  ? -7.304  8.726  24.992  1.00 42.07  ? 66  GLU B C   1 
ATOM   3738 O O   . GLU B 1 66  ? -7.977  9.629  24.470  1.00 42.28  ? 66  GLU B O   1 
ATOM   3739 C CB  . GLU B 1 66  ? -8.651  6.814  26.003  1.00 40.01  ? 66  GLU B CB  1 
ATOM   3740 C CG  . GLU B 1 66  ? -9.339  5.483  25.727  1.00 51.26  ? 66  GLU B CG  1 
ATOM   3741 C CD  . GLU B 1 66  ? -10.349 5.426  24.592  1.00 75.08  ? 66  GLU B CD  1 
ATOM   3742 O OE1 . GLU B 1 66  ? -11.169 6.366  24.477  1.00 75.15  ? 66  GLU B OE1 1 
ATOM   3743 O OE2 . GLU B 1 66  ? -10.348 4.420  23.843  1.00 63.53  ? 66  GLU B OE2 1 
ATOM   3744 N N   . MET B 1 67  ? -6.143  8.945  25.668  1.00 36.48  ? 67  MET B N   1 
ATOM   3745 C CA  . MET B 1 67  ? -5.524  10.261 25.848  1.00 34.24  ? 67  MET B CA  1 
ATOM   3746 C C   . MET B 1 67  ? -5.193  10.882 24.473  1.00 36.70  ? 67  MET B C   1 
ATOM   3747 O O   . MET B 1 67  ? -5.421  12.077 24.263  1.00 35.65  ? 67  MET B O   1 
ATOM   3748 C CB  . MET B 1 67  ? -4.276  10.146 26.732  1.00 37.04  ? 67  MET B CB  1 
ATOM   3749 C CG  . MET B 1 67  ? -3.609  11.487 27.055  1.00 40.81  ? 67  MET B CG  1 
ATOM   3750 S SD  . MET B 1 67  ? -4.594  12.549 28.161  1.00 44.97  ? 67  MET B SD  1 
ATOM   3751 C CE  . MET B 1 67  ? -4.009  12.006 29.747  1.00 42.58  ? 67  MET B CE  1 
ATOM   3752 N N   . MET B 1 68  ? -4.704  10.048 23.528  1.00 33.04  ? 68  MET B N   1 
ATOM   3753 C CA  . MET B 1 68  ? -4.388  10.447 22.155  1.00 31.54  ? 68  MET B CA  1 
ATOM   3754 C C   . MET B 1 68  ? -5.656  10.895 21.413  1.00 31.53  ? 68  MET B C   1 
ATOM   3755 O O   . MET B 1 68  ? -5.627  11.918 20.732  1.00 29.32  ? 68  MET B O   1 
ATOM   3756 C CB  . MET B 1 68  ? -3.672  9.312  21.405  1.00 34.84  ? 68  MET B CB  1 
ATOM   3757 C CG  . MET B 1 68  ? -3.068  9.735  20.078  1.00 39.05  ? 68  MET B CG  1 
ATOM   3758 S SD  . MET B 1 68  ? -1.807  11.020 20.247  1.00 43.73  ? 68  MET B SD  1 
ATOM   3759 C CE  . MET B 1 68  ? -0.453  10.258 19.472  1.00 41.75  ? 68  MET B CE  1 
ATOM   3760 N N   . LYS B 1 69  ? -6.772  10.160 21.580  1.00 26.71  ? 69  LYS B N   1 
ATOM   3761 C CA  . LYS B 1 69  ? -8.041  10.518 20.954  1.00 25.78  ? 69  LYS B CA  1 
ATOM   3762 C C   . LYS B 1 69  ? -8.513  11.880 21.462  1.00 29.32  ? 69  LYS B C   1 
ATOM   3763 O O   . LYS B 1 69  ? -8.996  12.694 20.666  1.00 30.94  ? 69  LYS B O   1 
ATOM   3764 C CB  . LYS B 1 69  ? -9.102  9.433  21.166  1.00 27.81  ? 69  LYS B CB  1 
ATOM   3765 C CG  . LYS B 1 69  ? -8.964  8.279  20.187  1.00 29.82  ? 69  LYS B CG  1 
ATOM   3766 C CD  . LYS B 1 69  ? -10.105 7.300  20.309  1.00 30.86  ? 69  LYS B CD  1 
ATOM   3767 C CE  . LYS B 1 69  ? -9.667  5.986  20.877  1.00 42.82  ? 69  LYS B CE  1 
ATOM   3768 N NZ  . LYS B 1 69  ? -10.804 5.040  20.968  1.00 61.67  ? 69  LYS B NZ  1 
ATOM   3769 N N   . ARG B 1 70  ? -8.306  12.156 22.761  1.00 22.85  ? 70  ARG B N   1 
ATOM   3770 C CA  . ARG B 1 70  ? -8.643  13.446 23.346  1.00 21.35  ? 70  ARG B CA  1 
ATOM   3771 C C   . ARG B 1 70  ? -7.736  14.554 22.751  1.00 24.32  ? 70  ARG B C   1 
ATOM   3772 O O   . ARG B 1 70  ? -8.235  15.589 22.317  1.00 22.46  ? 70  ARG B O   1 
ATOM   3773 C CB  . ARG B 1 70  ? -8.517  13.394 24.883  1.00 20.16  ? 70  ARG B CB  1 
ATOM   3774 C CG  . ARG B 1 70  ? -9.039  14.655 25.537  1.00 25.30  ? 70  ARG B CG  1 
ATOM   3775 C CD  . ARG B 1 70  ? -8.692  14.773 26.986  1.00 30.44  ? 70  ARG B CD  1 
ATOM   3776 N NE  . ARG B 1 70  ? -8.965  16.136 27.450  1.00 33.16  ? 70  ARG B NE  1 
ATOM   3777 C CZ  . ARG B 1 70  ? -8.739  16.574 28.685  1.00 45.29  ? 70  ARG B CZ  1 
ATOM   3778 N NH1 . ARG B 1 70  ? -8.253  15.757 29.608  1.00 24.19  ? 70  ARG B NH1 1 
ATOM   3779 N NH2 . ARG B 1 70  ? -8.996  17.835 29.004  1.00 42.97  ? 70  ARG B NH2 1 
ATOM   3780 N N   . ALA B 1 71  ? -6.418  14.304 22.705  1.00 22.09  ? 71  ALA B N   1 
ATOM   3781 C CA  . ALA B 1 71  ? -5.403  15.224 22.201  1.00 23.13  ? 71  ALA B CA  1 
ATOM   3782 C C   . ALA B 1 71  ? -5.602  15.636 20.743  1.00 30.47  ? 71  ALA B C   1 
ATOM   3783 O O   . ALA B 1 71  ? -5.299  16.774 20.387  1.00 31.15  ? 71  ALA B O   1 
ATOM   3784 C CB  . ALA B 1 71  ? -4.023  14.612 22.378  1.00 24.71  ? 71  ALA B CB  1 
ATOM   3785 N N   . LEU B 1 72  ? -6.097  14.714 19.899  1.00 27.87  ? 72  LEU B N   1 
ATOM   3786 C CA  . LEU B 1 72  ? -6.309  14.944 18.470  1.00 26.56  ? 72  LEU B CA  1 
ATOM   3787 C C   . LEU B 1 72  ? -7.685  15.534 18.113  1.00 27.04  ? 72  LEU B C   1 
ATOM   3788 O O   . LEU B 1 72  ? -7.959  15.785 16.929  1.00 25.60  ? 72  LEU B O   1 
ATOM   3789 C CB  . LEU B 1 72  ? -6.085  13.633 17.712  1.00 27.36  ? 72  LEU B CB  1 
ATOM   3790 C CG  . LEU B 1 72  ? -4.681  13.025 17.744  1.00 32.20  ? 72  LEU B CG  1 
ATOM   3791 C CD1 . LEU B 1 72  ? -4.631  11.777 16.877  1.00 32.96  ? 72  LEU B CD1 1 
ATOM   3792 C CD2 . LEU B 1 72  ? -3.602  14.034 17.304  1.00 33.32  ? 72  LEU B CD2 1 
ATOM   3793 N N   . GLN B 1 73  ? -8.528  15.770 19.139  1.00 21.20  ? 73  GLN B N   1 
ATOM   3794 C CA  . GLN B 1 73  ? -9.897  16.269 19.012  1.00 20.19  ? 73  GLN B CA  1 
ATOM   3795 C C   . GLN B 1 73  ? -10.058 17.722 19.501  1.00 22.92  ? 73  GLN B C   1 
ATOM   3796 O O   . GLN B 1 73  ? -9.208  18.217 20.257  1.00 21.27  ? 73  GLN B O   1 
ATOM   3797 C CB  . GLN B 1 73  ? -10.860 15.305 19.761  1.00 21.53  ? 73  GLN B CB  1 
ATOM   3798 C CG  . GLN B 1 73  ? -12.372 15.606 19.693  1.00 22.80  ? 73  GLN B CG  1 
ATOM   3799 C CD  . GLN B 1 73  ? -12.935 15.607 18.292  1.00 37.93  ? 73  GLN B CD  1 
ATOM   3800 O OE1 . GLN B 1 73  ? -12.837 16.588 17.567  1.00 34.62  ? 73  GLN B OE1 1 
ATOM   3801 N NE2 . GLN B 1 73  ? -13.557 14.516 17.886  1.00 32.60  ? 73  GLN B NE2 1 
ATOM   3802 N N   . TYR B 1 74  ? -11.156 18.399 19.067  1.00 18.65  ? 74  TYR B N   1 
ATOM   3803 C CA  . TYR B 1 74  ? -11.475 19.754 19.503  1.00 17.91  ? 74  TYR B CA  1 
ATOM   3804 C C   . TYR B 1 74  ? -11.557 19.803 21.057  1.00 23.51  ? 74  TYR B C   1 
ATOM   3805 O O   . TYR B 1 74  ? -11.756 18.766 21.716  1.00 22.39  ? 74  TYR B O   1 
ATOM   3806 C CB  . TYR B 1 74  ? -12.811 20.226 18.899  1.00 18.53  ? 74  TYR B CB  1 
ATOM   3807 C CG  . TYR B 1 74  ? -12.827 20.446 17.401  1.00 19.90  ? 74  TYR B CG  1 
ATOM   3808 C CD1 . TYR B 1 74  ? -12.074 21.458 16.818  1.00 21.68  ? 74  TYR B CD1 1 
ATOM   3809 C CD2 . TYR B 1 74  ? -13.698 19.731 16.580  1.00 21.30  ? 74  TYR B CD2 1 
ATOM   3810 C CE1 . TYR B 1 74  ? -12.100 21.682 15.438  1.00 23.06  ? 74  TYR B CE1 1 
ATOM   3811 C CE2 . TYR B 1 74  ? -13.763 19.971 15.204  1.00 22.28  ? 74  TYR B CE2 1 
ATOM   3812 C CZ  . TYR B 1 74  ? -12.963 20.953 14.637  1.00 27.70  ? 74  TYR B CZ  1 
ATOM   3813 O OH  . TYR B 1 74  ? -13.026 21.226 13.290  1.00 24.26  ? 74  TYR B OH  1 
ATOM   3814 N N   . SER B 1 75  ? -11.370 21.013 21.628  1.00 20.56  ? 75  SER B N   1 
ATOM   3815 C CA  . SER B 1 75  ? -11.420 21.274 23.070  1.00 19.83  ? 75  SER B CA  1 
ATOM   3816 C C   . SER B 1 75  ? -11.912 22.723 23.354  1.00 27.14  ? 75  SER B C   1 
ATOM   3817 O O   . SER B 1 75  ? -11.966 23.521 22.408  1.00 27.72  ? 75  SER B O   1 
ATOM   3818 C CB  . SER B 1 75  ? -10.072 20.971 23.724  1.00 19.53  ? 75  SER B CB  1 
ATOM   3819 O OG  . SER B 1 75  ? -8.987  21.607 23.070  1.00 20.64  ? 75  SER B OG  1 
ATOM   3820 N N   . PRO B 1 76  ? -12.306 23.088 24.614  1.00 24.49  ? 76  PRO B N   1 
ATOM   3821 C CA  . PRO B 1 76  ? -12.822 24.452 24.858  1.00 24.17  ? 76  PRO B CA  1 
ATOM   3822 C C   . PRO B 1 76  ? -11.924 25.620 24.433  1.00 28.67  ? 76  PRO B C   1 
ATOM   3823 O O   . PRO B 1 76  ? -10.693 25.541 24.526  1.00 27.32  ? 76  PRO B O   1 
ATOM   3824 C CB  . PRO B 1 76  ? -13.083 24.464 26.367  1.00 25.69  ? 76  PRO B CB  1 
ATOM   3825 C CG  . PRO B 1 76  ? -13.226 23.057 26.753  1.00 29.47  ? 76  PRO B CG  1 
ATOM   3826 C CD  . PRO B 1 76  ? -12.327 22.289 25.860  1.00 25.31  ? 76  PRO B CD  1 
ATOM   3827 N N   . SER B 1 77  ? -12.562 26.716 23.998  1.00 26.70  ? 77  SER B N   1 
ATOM   3828 C CA  . SER B 1 77  ? -11.914 27.944 23.529  1.00 26.74  ? 77  SER B CA  1 
ATOM   3829 C C   . SER B 1 77  ? -10.905 28.553 24.506  1.00 30.80  ? 77  SER B C   1 
ATOM   3830 O O   . SER B 1 77  ? -9.845  28.994 24.072  1.00 30.72  ? 77  SER B O   1 
ATOM   3831 C CB  . SER B 1 77  ? -12.962 28.978 23.141  1.00 29.95  ? 77  SER B CB  1 
ATOM   3832 O OG  . SER B 1 77  ? -13.681 28.596 21.978  1.00 35.07  ? 77  SER B OG  1 
ATOM   3833 N N   . ALA B 1 78  ? -11.236 28.574 25.815  1.00 27.34  ? 78  ALA B N   1 
ATOM   3834 C CA  . ALA B 1 78  ? -10.413 29.148 26.892  1.00 26.15  ? 78  ALA B CA  1 
ATOM   3835 C C   . ALA B 1 78  ? -9.214  28.307 27.304  1.00 31.51  ? 78  ALA B C   1 
ATOM   3836 O O   . ALA B 1 78  ? -8.304  28.813 27.951  1.00 31.32  ? 78  ALA B O   1 
ATOM   3837 C CB  . ALA B 1 78  ? -11.279 29.434 28.101  1.00 26.83  ? 78  ALA B CB  1 
ATOM   3838 N N   . GLY B 1 79  ? -9.239  27.027 26.952  1.00 29.29  ? 79  GLY B N   1 
ATOM   3839 C CA  . GLY B 1 79  ? -8.199  26.065 27.290  1.00 27.98  ? 79  GLY B CA  1 
ATOM   3840 C C   . GLY B 1 79  ? -8.772  24.831 27.950  1.00 31.41  ? 79  GLY B C   1 
ATOM   3841 O O   . GLY B 1 79  ? -9.956  24.812 28.326  1.00 31.97  ? 79  GLY B O   1 
ATOM   3842 N N   . ILE B 1 80  ? -7.942  23.778 28.075  1.00 27.10  ? 80  ILE B N   1 
ATOM   3843 C CA  . ILE B 1 80  ? -8.355  22.539 28.740  1.00 27.23  ? 80  ILE B CA  1 
ATOM   3844 C C   . ILE B 1 80  ? -8.512  22.811 30.256  1.00 30.37  ? 80  ILE B C   1 
ATOM   3845 O O   . ILE B 1 80  ? -7.720  23.585 30.812  1.00 28.48  ? 80  ILE B O   1 
ATOM   3846 C CB  . ILE B 1 80  ? -7.444  21.334 28.386  1.00 31.23  ? 80  ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 80  ? -5.961  21.587 28.793  1.00 31.19  ? 80  ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 80  ? -7.575  20.995 26.896  1.00 32.38  ? 80  ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 80  ? -5.099  20.374 29.032  1.00 27.84  ? 80  ILE B CD1 1 
ATOM   3850 N N   . PRO B 1 81  ? -9.572  22.288 30.923  1.00 28.43  ? 81  PRO B N   1 
ATOM   3851 C CA  . PRO B 1 81  ? -9.791  22.634 32.349  1.00 28.19  ? 81  PRO B CA  1 
ATOM   3852 C C   . PRO B 1 81  ? -8.618  22.450 33.305  1.00 33.63  ? 81  PRO B C   1 
ATOM   3853 O O   . PRO B 1 81  ? -8.378  23.336 34.130  1.00 34.34  ? 81  PRO B O   1 
ATOM   3854 C CB  . PRO B 1 81  ? -11.022 21.822 32.748  1.00 30.20  ? 81  PRO B CB  1 
ATOM   3855 C CG  . PRO B 1 81  ? -11.203 20.809 31.668  1.00 35.16  ? 81  PRO B CG  1 
ATOM   3856 C CD  . PRO B 1 81  ? -10.638 21.399 30.418  1.00 30.36  ? 81  PRO B CD  1 
ATOM   3857 N N   . GLU B 1 82  ? -7.869  21.340 33.173  1.00 29.80  ? 82  GLU B N   1 
ATOM   3858 C CA  . GLU B 1 82  ? -6.723  21.038 34.020  1.00 29.96  ? 82  GLU B CA  1 
ATOM   3859 C C   . GLU B 1 82  ? -5.587  22.046 33.914  1.00 34.56  ? 82  GLU B C   1 
ATOM   3860 O O   . GLU B 1 82  ? -4.981  22.378 34.943  1.00 35.01  ? 82  GLU B O   1 
ATOM   3861 C CB  . GLU B 1 82  ? -6.257  19.575 33.886  1.00 32.09  ? 82  GLU B CB  1 
ATOM   3862 C CG  . GLU B 1 82  ? -6.124  19.048 32.467  1.00 44.86  ? 82  GLU B CG  1 
ATOM   3863 C CD  . GLU B 1 82  ? -7.356  18.359 31.915  1.00 55.75  ? 82  GLU B CD  1 
ATOM   3864 O OE1 . GLU B 1 82  ? -8.273  19.066 31.439  1.00 33.70  ? 82  GLU B OE1 1 
ATOM   3865 O OE2 . GLU B 1 82  ? -7.394  17.108 31.931  1.00 51.53  ? 82  GLU B OE2 1 
ATOM   3866 N N   . LEU B 1 83  ? -5.319  22.572 32.690  1.00 30.57  ? 83  LEU B N   1 
ATOM   3867 C CA  . LEU B 1 83  ? -4.287  23.614 32.456  1.00 28.25  ? 83  LEU B CA  1 
ATOM   3868 C C   . LEU B 1 83  ? -4.737  24.961 33.043  1.00 30.17  ? 83  LEU B C   1 
ATOM   3869 O O   . LEU B 1 83  ? -3.931  25.638 33.681  1.00 30.34  ? 83  LEU B O   1 
ATOM   3870 C CB  . LEU B 1 83  ? -3.937  23.740 30.951  1.00 27.13  ? 83  LEU B CB  1 
ATOM   3871 C CG  . LEU B 1 83  ? -2.849  24.741 30.514  1.00 30.36  ? 83  LEU B CG  1 
ATOM   3872 C CD1 . LEU B 1 83  ? -1.531  24.470 31.180  1.00 30.80  ? 83  LEU B CD1 1 
ATOM   3873 C CD2 . LEU B 1 83  ? -2.628  24.676 29.037  1.00 31.62  ? 83  LEU B CD2 1 
ATOM   3874 N N   . LEU B 1 84  ? -6.026  25.335 32.840  1.00 25.13  ? 84  LEU B N   1 
ATOM   3875 C CA  . LEU B 1 84  ? -6.613  26.570 33.375  1.00 24.10  ? 84  LEU B CA  1 
ATOM   3876 C C   . LEU B 1 84  ? -6.586  26.630 34.903  1.00 28.80  ? 84  LEU B C   1 
ATOM   3877 O O   . LEU B 1 84  ? -6.213  27.666 35.450  1.00 27.86  ? 84  LEU B O   1 
ATOM   3878 C CB  . LEU B 1 84  ? -8.043  26.814 32.851  1.00 23.51  ? 84  LEU B CB  1 
ATOM   3879 C CG  . LEU B 1 84  ? -8.157  27.364 31.433  1.00 27.04  ? 84  LEU B CG  1 
ATOM   3880 C CD1 . LEU B 1 84  ? -9.569  27.328 30.968  1.00 26.04  ? 84  LEU B CD1 1 
ATOM   3881 C CD2 . LEU B 1 84  ? -7.616  28.793 31.327  1.00 29.77  ? 84  LEU B CD2 1 
ATOM   3882 N N   . SER B 1 85  ? -6.939  25.531 35.589  1.00 26.95  ? 85  SER B N   1 
ATOM   3883 C CA  . SER B 1 85  ? -6.932  25.516 37.056  1.00 28.31  ? 85  SER B CA  1 
ATOM   3884 C C   . SER B 1 85  ? -5.514  25.616 37.633  1.00 34.32  ? 85  SER B C   1 
ATOM   3885 O O   . SER B 1 85  ? -5.316  26.313 38.632  1.00 36.50  ? 85  SER B O   1 
ATOM   3886 C CB  . SER B 1 85  ? -7.659  24.296 37.608  1.00 32.62  ? 85  SER B CB  1 
ATOM   3887 O OG  . SER B 1 85  ? -7.170  23.103 37.021  1.00 47.50  ? 85  SER B OG  1 
ATOM   3888 N N   . TRP B 1 86  ? -4.534  24.967 36.981  1.00 28.45  ? 86  TRP B N   1 
ATOM   3889 C CA  . TRP B 1 86  ? -3.141  24.985 37.417  1.00 27.80  ? 86  TRP B CA  1 
ATOM   3890 C C   . TRP B 1 86  ? -2.542  26.381 37.306  1.00 29.01  ? 86  TRP B C   1 
ATOM   3891 O O   . TRP B 1 86  ? -1.831  26.836 38.212  1.00 27.05  ? 86  TRP B O   1 
ATOM   3892 C CB  . TRP B 1 86  ? -2.312  23.994 36.590  1.00 26.61  ? 86  TRP B CB  1 
ATOM   3893 C CG  . TRP B 1 86  ? -1.035  23.577 37.267  1.00 27.69  ? 86  TRP B CG  1 
ATOM   3894 C CD1 . TRP B 1 86  ? -0.855  22.511 38.100  1.00 31.36  ? 86  TRP B CD1 1 
ATOM   3895 C CD2 . TRP B 1 86  ? 0.231   24.242 37.184  1.00 27.22  ? 86  TRP B CD2 1 
ATOM   3896 N NE1 . TRP B 1 86  ? 0.443   22.484 38.559  1.00 31.55  ? 86  TRP B NE1 1 
ATOM   3897 C CE2 . TRP B 1 86  ? 1.143   23.512 37.979  1.00 32.23  ? 86  TRP B CE2 1 
ATOM   3898 C CE3 . TRP B 1 86  ? 0.689   25.389 36.510  1.00 27.53  ? 86  TRP B CE3 1 
ATOM   3899 C CZ2 . TRP B 1 86  ? 2.494   23.874 38.095  1.00 31.33  ? 86  TRP B CZ2 1 
ATOM   3900 C CZ3 . TRP B 1 86  ? 2.015   25.766 36.654  1.00 29.01  ? 86  TRP B CZ3 1 
ATOM   3901 C CH2 . TRP B 1 86  ? 2.908   24.994 37.409  1.00 30.52  ? 86  TRP B CH2 1 
ATOM   3902 N N   . LEU B 1 87  ? -2.826  27.055 36.182  1.00 25.06  ? 87  LEU B N   1 
ATOM   3903 C CA  . LEU B 1 87  ? -2.334  28.403 35.913  1.00 23.72  ? 87  LEU B CA  1 
ATOM   3904 C C   . LEU B 1 87  ? -2.950  29.444 36.860  1.00 27.25  ? 87  LEU B C   1 
ATOM   3905 O O   . LEU B 1 87  ? -2.222  30.292 37.347  1.00 25.52  ? 87  LEU B O   1 
ATOM   3906 C CB  . LEU B 1 87  ? -2.524  28.758 34.436  1.00 22.53  ? 87  LEU B CB  1 
ATOM   3907 C CG  . LEU B 1 87  ? -1.689  27.941 33.450  1.00 26.42  ? 87  LEU B CG  1 
ATOM   3908 C CD1 . LEU B 1 87  ? -2.149  28.166 32.022  1.00 29.72  ? 87  LEU B CD1 1 
ATOM   3909 C CD2 . LEU B 1 87  ? -0.186  28.239 33.589  1.00 25.96  ? 87  LEU B CD2 1 
ATOM   3910 N N   . LYS B 1 88  ? -4.270  29.318 37.185  1.00 24.75  ? 88  LYS B N   1 
ATOM   3911 C CA  . LYS B 1 88  ? -5.000  30.165 38.132  1.00 24.32  ? 88  LYS B CA  1 
ATOM   3912 C C   . LYS B 1 88  ? -4.305  30.158 39.504  1.00 29.67  ? 88  LYS B C   1 
ATOM   3913 O O   . LYS B 1 88  ? -4.106  31.205 40.111  1.00 29.65  ? 88  LYS B O   1 
ATOM   3914 C CB  . LYS B 1 88  ? -6.422  29.629 38.297  1.00 26.89  ? 88  LYS B CB  1 
ATOM   3915 C CG  . LYS B 1 88  ? -7.435  30.252 37.357  1.00 49.20  ? 88  LYS B CG  1 
ATOM   3916 C CD  . LYS B 1 88  ? -8.865  29.858 37.758  1.00 64.11  ? 88  LYS B CD  1 
ATOM   3917 C CE  . LYS B 1 88  ? -9.540  30.804 38.727  1.00 73.10  ? 88  LYS B CE  1 
ATOM   3918 N NZ  . LYS B 1 88  ? -10.071 32.005 38.035  1.00 80.48  ? 88  LYS B NZ  1 
ATOM   3919 N N   . GLN B 1 89  ? -3.928  28.968 39.967  1.00 28.01  ? 89  GLN B N   1 
ATOM   3920 C CA  . GLN B 1 89  ? -3.257  28.726 41.238  1.00 29.71  ? 89  GLN B CA  1 
ATOM   3921 C C   . GLN B 1 89  ? -1.857  29.320 41.264  1.00 35.05  ? 89  GLN B C   1 
ATOM   3922 O O   . GLN B 1 89  ? -1.419  29.838 42.306  1.00 36.34  ? 89  GLN B O   1 
ATOM   3923 C CB  . GLN B 1 89  ? -3.212  27.228 41.536  1.00 31.93  ? 89  GLN B CB  1 
ATOM   3924 C CG  . GLN B 1 89  ? -4.569  26.655 41.895  1.00 50.06  ? 89  GLN B CG  1 
ATOM   3925 C CD  . GLN B 1 89  ? -4.559  25.824 43.135  1.00 78.97  ? 89  GLN B CD  1 
ATOM   3926 O OE1 . GLN B 1 89  ? -3.858  26.118 44.122  1.00 76.66  ? 89  GLN B OE1 1 
ATOM   3927 N NE2 . GLN B 1 89  ? -5.394  24.795 43.119  1.00 73.26  ? 89  GLN B NE2 1 
ATOM   3928 N N   . LEU B 1 90  ? -1.161  29.265 40.119  1.00 30.92  ? 90  LEU B N   1 
ATOM   3929 C CA  . LEU B 1 90  ? 0.173   29.849 39.986  1.00 30.71  ? 90  LEU B CA  1 
ATOM   3930 C C   . LEU B 1 90  ? 0.077   31.372 40.128  1.00 33.98  ? 90  LEU B C   1 
ATOM   3931 O O   . LEU B 1 90  ? 0.843   31.946 40.903  1.00 34.87  ? 90  LEU B O   1 
ATOM   3932 C CB  . LEU B 1 90  ? 0.827   29.456 38.648  1.00 29.94  ? 90  LEU B CB  1 
ATOM   3933 C CG  . LEU B 1 90  ? 2.286   29.845 38.473  1.00 33.59  ? 90  LEU B CG  1 
ATOM   3934 C CD1 . LEU B 1 90  ? 3.196   28.972 39.295  1.00 33.77  ? 90  LEU B CD1 1 
ATOM   3935 C CD2 . LEU B 1 90  ? 2.674   29.793 37.037  1.00 36.60  ? 90  LEU B CD2 1 
ATOM   3936 N N   . GLN B 1 91  ? -0.908  32.001 39.436  1.00 28.81  ? 91  GLN B N   1 
ATOM   3937 C CA  . GLN B 1 91  ? -1.191  33.443 39.477  1.00 28.51  ? 91  GLN B CA  1 
ATOM   3938 C C   . GLN B 1 91  ? -1.502  33.891 40.899  1.00 32.54  ? 91  GLN B C   1 
ATOM   3939 O O   . GLN B 1 91  ? -1.029  34.952 41.315  1.00 31.47  ? 91  GLN B O   1 
ATOM   3940 C CB  . GLN B 1 91  ? -2.344  33.827 38.528  1.00 29.56  ? 91  GLN B CB  1 
ATOM   3941 C CG  . GLN B 1 91  ? -2.076  33.569 37.042  1.00 39.57  ? 91  GLN B CG  1 
ATOM   3942 C CD  . GLN B 1 91  ? -0.900  34.323 36.494  1.00 55.63  ? 91  GLN B CD  1 
ATOM   3943 O OE1 . GLN B 1 91  ? -1.016  35.475 36.095  1.00 61.93  ? 91  GLN B OE1 1 
ATOM   3944 N NE2 . GLN B 1 91  ? 0.243   33.680 36.417  1.00 40.37  ? 91  GLN B NE2 1 
ATOM   3945 N N   . ILE B 1 92  ? -2.247  33.059 41.659  1.00 29.98  ? 92  ILE B N   1 
ATOM   3946 C CA  . ILE B 1 92  ? -2.556  33.325 43.066  1.00 31.15  ? 92  ILE B CA  1 
ATOM   3947 C C   . ILE B 1 92  ? -1.272  33.288 43.950  1.00 36.99  ? 92  ILE B C   1 
ATOM   3948 O O   . ILE B 1 92  ? -1.060  34.222 44.718  1.00 36.49  ? 92  ILE B O   1 
ATOM   3949 C CB  . ILE B 1 92  ? -3.732  32.447 43.592  1.00 34.19  ? 92  ILE B CB  1 
ATOM   3950 C CG1 . ILE B 1 92  ? -5.046  32.871 42.922  1.00 34.00  ? 92  ILE B CG1 1 
ATOM   3951 C CG2 . ILE B 1 92  ? -3.874  32.541 45.119  1.00 35.22  ? 92  ILE B CG2 1 
ATOM   3952 C CD1 . ILE B 1 92  ? -6.152  31.885 42.940  1.00 40.07  ? 92  ILE B CD1 1 
ATOM   3953 N N   . LYS B 1 93  ? -0.414  32.250 43.822  1.00 34.94  ? 93  LYS B N   1 
ATOM   3954 C CA  . LYS B 1 93  ? 0.807   32.180 44.651  1.00 36.48  ? 93  LYS B CA  1 
ATOM   3955 C C   . LYS B 1 93  ? 1.854   33.219 44.318  1.00 41.33  ? 93  LYS B C   1 
ATOM   3956 O O   . LYS B 1 93  ? 2.595   33.656 45.198  1.00 42.22  ? 93  LYS B O   1 
ATOM   3957 C CB  . LYS B 1 93  ? 1.427   30.770 44.701  1.00 38.87  ? 93  LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 93  ? 0.746   29.931 45.774  1.00 63.37  ? 93  LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 93  ? 1.307   28.549 45.949  1.00 78.51  ? 93  LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 93  ? 0.344   27.651 46.698  1.00 94.09  ? 93  LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 93  ? -0.819  27.242 45.857  1.00 109.86 ? 93  LYS B NZ  1 
ATOM   3962 N N   . LEU B 1 94  ? 1.904   33.621 43.061  1.00 36.50  ? 94  LEU B N   1 
ATOM   3963 C CA  . LEU B 1 94  ? 2.893   34.569 42.585  1.00 35.60  ? 94  LEU B CA  1 
ATOM   3964 C C   . LEU B 1 94  ? 2.435   36.019 42.726  1.00 40.37  ? 94  LEU B C   1 
ATOM   3965 O O   . LEU B 1 94  ? 3.246   36.872 43.104  1.00 41.97  ? 94  LEU B O   1 
ATOM   3966 C CB  . LEU B 1 94  ? 3.273   34.232 41.118  1.00 34.21  ? 94  LEU B CB  1 
ATOM   3967 C CG  . LEU B 1 94  ? 4.481   33.296 40.863  1.00 38.11  ? 94  LEU B CG  1 
ATOM   3968 C CD1 . LEU B 1 94  ? 4.450   32.052 41.720  1.00 38.53  ? 94  LEU B CD1 1 
ATOM   3969 C CD2 . LEU B 1 94  ? 4.510   32.848 39.429  1.00 40.14  ? 94  LEU B CD2 1 
ATOM   3970 N N   . HIS B 1 95  ? 1.152   36.305 42.430  1.00 35.06  ? 95  HIS B N   1 
ATOM   3971 C CA  . HIS B 1 95  ? 0.665   37.679 42.424  1.00 34.15  ? 95  HIS B CA  1 
ATOM   3972 C C   . HIS B 1 95  ? -0.456  38.027 43.405  1.00 37.18  ? 95  HIS B C   1 
ATOM   3973 O O   . HIS B 1 95  ? -0.680  39.219 43.631  1.00 37.45  ? 95  HIS B O   1 
ATOM   3974 C CB  . HIS B 1 95  ? 0.311   38.119 40.991  1.00 33.93  ? 95  HIS B CB  1 
ATOM   3975 C CG  . HIS B 1 95  ? 1.291   37.654 39.953  1.00 37.07  ? 95  HIS B CG  1 
ATOM   3976 N ND1 . HIS B 1 95  ? 0.972   36.638 39.066  1.00 38.66  ? 95  HIS B ND1 1 
ATOM   3977 C CD2 . HIS B 1 95  ? 2.566   38.046 39.723  1.00 38.77  ? 95  HIS B CD2 1 
ATOM   3978 C CE1 . HIS B 1 95  ? 2.045   36.469 38.307  1.00 37.75  ? 95  HIS B CE1 1 
ATOM   3979 N NE2 . HIS B 1 95  ? 3.029   37.296 38.661  1.00 38.22  ? 95  HIS B NE2 1 
ATOM   3980 N N   . ASN B 1 96  ? -1.148  37.022 43.991  1.00 31.03  ? 96  ASN B N   1 
ATOM   3981 C CA  . ASN B 1 96  ? -2.277  37.220 44.904  1.00 30.55  ? 96  ASN B CA  1 
ATOM   3982 C C   . ASN B 1 96  ? -3.080  38.477 44.514  1.00 35.63  ? 96  ASN B C   1 
ATOM   3983 O O   . ASN B 1 96  ? -3.014  39.497 45.212  1.00 36.30  ? 96  ASN B O   1 
ATOM   3984 C CB  . ASN B 1 96  ? -1.821  37.219 46.372  1.00 27.50  ? 96  ASN B CB  1 
ATOM   3985 C CG  . ASN B 1 96  ? -2.944  37.220 47.406  1.00 43.61  ? 96  ASN B CG  1 
ATOM   3986 O OD1 . ASN B 1 96  ? -4.068  36.718 47.185  1.00 47.39  ? 96  ASN B OD1 1 
ATOM   3987 N ND2 . ASN B 1 96  ? -2.651  37.786 48.569  1.00 21.79  ? 96  ASN B ND2 1 
ATOM   3988 N N   . PRO B 1 97  ? -3.726  38.480 43.323  1.00 31.62  ? 97  PRO B N   1 
ATOM   3989 C CA  . PRO B 1 97  ? -4.432  39.697 42.883  1.00 31.14  ? 97  PRO B CA  1 
ATOM   3990 C C   . PRO B 1 97  ? -5.624  40.036 43.767  1.00 34.17  ? 97  PRO B C   1 
ATOM   3991 O O   . PRO B 1 97  ? -6.325  39.132 44.227  1.00 33.44  ? 97  PRO B O   1 
ATOM   3992 C CB  . PRO B 1 97  ? -4.877  39.363 41.453  1.00 32.20  ? 97  PRO B CB  1 
ATOM   3993 C CG  . PRO B 1 97  ? -4.081  38.153 41.065  1.00 36.51  ? 97  PRO B CG  1 
ATOM   3994 C CD  . PRO B 1 97  ? -3.871  37.402 42.328  1.00 32.49  ? 97  PRO B CD  1 
ATOM   3995 N N   . PRO B 1 98  ? -5.871  41.332 44.020  1.00 30.42  ? 98  PRO B N   1 
ATOM   3996 C CA  . PRO B 1 98  ? -7.029  41.705 44.859  1.00 31.33  ? 98  PRO B CA  1 
ATOM   3997 C C   . PRO B 1 98  ? -8.396  41.282 44.298  1.00 37.09  ? 98  PRO B C   1 
ATOM   3998 O O   . PRO B 1 98  ? -9.327  41.035 45.070  1.00 37.54  ? 98  PRO B O   1 
ATOM   3999 C CB  . PRO B 1 98  ? -6.917  43.228 44.949  1.00 33.18  ? 98  PRO B CB  1 
ATOM   4000 C CG  . PRO B 1 98  ? -5.483  43.547 44.586  1.00 36.78  ? 98  PRO B CG  1 
ATOM   4001 C CD  . PRO B 1 98  ? -5.118  42.518 43.569  1.00 31.35  ? 98  PRO B CD  1 
ATOM   4002 N N   . THR B 1 99  ? -8.493  41.157 42.955  1.00 33.56  ? 99  THR B N   1 
ATOM   4003 C CA  . THR B 1 99  ? -9.698  40.851 42.185  1.00 33.20  ? 99  THR B CA  1 
ATOM   4004 C C   . THR B 1 99  ? -10.286 39.425 42.241  1.00 40.99  ? 99  THR B C   1 
ATOM   4005 O O   . THR B 1 99  ? -11.380 39.216 41.698  1.00 41.95  ? 99  THR B O   1 
ATOM   4006 C CB  . THR B 1 99  ? -9.539  41.353 40.749  1.00 35.18  ? 99  THR B CB  1 
ATOM   4007 O OG1 . THR B 1 99  ? -8.552  40.586 40.071  1.00 35.52  ? 99  THR B OG1 1 
ATOM   4008 C CG2 . THR B 1 99  ? -9.207  42.824 40.677  1.00 31.82  ? 99  THR B CG2 1 
ATOM   4009 N N   . ILE B 1 100 ? -9.595  38.466 42.880  1.00 39.44  ? 100 ILE B N   1 
ATOM   4010 C CA  . ILE B 1 100 ? -10.024 37.057 42.975  1.00 40.92  ? 100 ILE B CA  1 
ATOM   4011 C C   . ILE B 1 100 ? -11.521 36.808 43.310  1.00 45.01  ? 100 ILE B C   1 
ATOM   4012 O O   . ILE B 1 100 ? -12.213 36.129 42.547  1.00 43.80  ? 100 ILE B O   1 
ATOM   4013 C CB  . ILE B 1 100 ? -9.066  36.192 43.862  1.00 45.50  ? 100 ILE B CB  1 
ATOM   4014 C CG1 . ILE B 1 100 ? -7.593  36.271 43.370  1.00 45.48  ? 100 ILE B CG1 1 
ATOM   4015 C CG2 . ILE B 1 100 ? -9.544  34.724 43.957  1.00 47.45  ? 100 ILE B CG2 1 
ATOM   4016 C CD1 . ILE B 1 100 ? -6.553  35.946 44.473  1.00 57.33  ? 100 ILE B CD1 1 
ATOM   4017 N N   . HIS B 1 101 ? -12.008 37.345 44.436  1.00 42.13  ? 101 HIS B N   1 
ATOM   4018 C CA  . HIS B 1 101 ? -13.391 37.120 44.882  1.00 41.92  ? 101 HIS B CA  1 
ATOM   4019 C C   . HIS B 1 101 ? -14.398 38.218 44.581  1.00 44.29  ? 101 HIS B C   1 
ATOM   4020 O O   . HIS B 1 101 ? -15.543 38.137 45.037  1.00 45.33  ? 101 HIS B O   1 
ATOM   4021 C CB  . HIS B 1 101 ? -13.435 36.682 46.350  1.00 43.94  ? 101 HIS B CB  1 
ATOM   4022 C CG  . HIS B 1 101 ? -12.740 35.391 46.576  1.00 47.54  ? 101 HIS B CG  1 
ATOM   4023 N ND1 . HIS B 1 101 ? -11.394 35.343 46.906  1.00 49.56  ? 101 HIS B ND1 1 
ATOM   4024 C CD2 . HIS B 1 101 ? -13.205 34.135 46.428  1.00 49.50  ? 101 HIS B CD2 1 
ATOM   4025 C CE1 . HIS B 1 101 ? -11.095 34.061 46.980  1.00 49.06  ? 101 HIS B CE1 1 
ATOM   4026 N NE2 . HIS B 1 101 ? -12.152 33.296 46.704  1.00 49.43  ? 101 HIS B NE2 1 
ATOM   4027 N N   . TYR B 1 102 ? -14.004 39.199 43.759  1.00 38.94  ? 102 TYR B N   1 
ATOM   4028 C CA  . TYR B 1 102 ? -14.856 40.307 43.326  1.00 39.32  ? 102 TYR B CA  1 
ATOM   4029 C C   . TYR B 1 102 ? -16.043 39.774 42.496  1.00 44.35  ? 102 TYR B C   1 
ATOM   4030 O O   . TYR B 1 102 ? -15.895 38.728 41.868  1.00 43.92  ? 102 TYR B O   1 
ATOM   4031 C CB  . TYR B 1 102 ? -14.025 41.255 42.438  1.00 40.20  ? 102 TYR B CB  1 
ATOM   4032 C CG  . TYR B 1 102 ? -13.108 42.240 43.147  1.00 42.49  ? 102 TYR B CG  1 
ATOM   4033 C CD1 . TYR B 1 102 ? -12.654 43.384 42.502  1.00 44.23  ? 102 TYR B CD1 1 
ATOM   4034 C CD2 . TYR B 1 102 ? -12.654 42.002 44.447  1.00 43.26  ? 102 TYR B CD2 1 
ATOM   4035 C CE1 . TYR B 1 102 ? -11.808 44.289 43.146  1.00 44.88  ? 102 TYR B CE1 1 
ATOM   4036 C CE2 . TYR B 1 102 ? -11.803 42.897 45.095  1.00 43.92  ? 102 TYR B CE2 1 
ATOM   4037 C CZ  . TYR B 1 102 ? -11.374 44.037 44.438  1.00 49.23  ? 102 TYR B CZ  1 
ATOM   4038 O OH  . TYR B 1 102 ? -10.530 44.927 45.070  1.00 48.75  ? 102 TYR B OH  1 
ATOM   4039 N N   . PRO B 1 103 ? -17.210 40.457 42.427  1.00 43.22  ? 103 PRO B N   1 
ATOM   4040 C CA  . PRO B 1 103 ? -18.288 39.966 41.540  1.00 43.68  ? 103 PRO B CA  1 
ATOM   4041 C C   . PRO B 1 103 ? -17.842 39.959 40.067  1.00 47.87  ? 103 PRO B C   1 
ATOM   4042 O O   . PRO B 1 103 ? -17.069 40.839 39.680  1.00 46.15  ? 103 PRO B O   1 
ATOM   4043 C CB  . PRO B 1 103 ? -19.427 40.975 41.743  1.00 46.27  ? 103 PRO B CB  1 
ATOM   4044 C CG  . PRO B 1 103 ? -19.082 41.730 42.939  1.00 51.45  ? 103 PRO B CG  1 
ATOM   4045 C CD  . PRO B 1 103 ? -17.596 41.719 43.084  1.00 46.09  ? 103 PRO B CD  1 
ATOM   4046 N N   . PRO B 1 104 ? -18.289 38.984 39.233  1.00 46.47  ? 104 PRO B N   1 
ATOM   4047 C CA  . PRO B 1 104 ? -17.831 38.937 37.831  1.00 46.16  ? 104 PRO B CA  1 
ATOM   4048 C C   . PRO B 1 104 ? -17.858 40.253 37.059  1.00 51.26  ? 104 PRO B C   1 
ATOM   4049 O O   . PRO B 1 104 ? -16.879 40.568 36.390  1.00 51.05  ? 104 PRO B O   1 
ATOM   4050 C CB  . PRO B 1 104 ? -18.711 37.852 37.212  1.00 47.58  ? 104 PRO B CB  1 
ATOM   4051 C CG  . PRO B 1 104 ? -18.997 36.936 38.336  1.00 51.96  ? 104 PRO B CG  1 
ATOM   4052 C CD  . PRO B 1 104 ? -19.171 37.837 39.529  1.00 48.57  ? 104 PRO B CD  1 
ATOM   4053 N N   . SER B 1 105 ? -18.937 41.039 37.209  1.00 48.63  ? 105 SER B N   1 
ATOM   4054 C CA  . SER B 1 105 ? -19.106 42.347 36.562  1.00 48.38  ? 105 SER B CA  1 
ATOM   4055 C C   . SER B 1 105 ? -18.155 43.425 37.124  1.00 51.54  ? 105 SER B C   1 
ATOM   4056 O O   . SER B 1 105 ? -17.850 44.390 36.419  1.00 51.85  ? 105 SER B O   1 
ATOM   4057 C CB  . SER B 1 105 ? -20.565 42.803 36.637  1.00 51.77  ? 105 SER B CB  1 
ATOM   4058 O OG  . SER B 1 105 ? -21.164 42.495 37.885  1.00 56.90  ? 105 SER B OG  1 
ATOM   4059 N N   . GLN B 1 106 ? -17.671 43.246 38.373  1.00 46.76  ? 106 GLN B N   1 
ATOM   4060 C CA  . GLN B 1 106 ? -16.738 44.176 39.022  1.00 46.26  ? 106 GLN B CA  1 
ATOM   4061 C C   . GLN B 1 106 ? -15.255 43.944 38.656  1.00 47.53  ? 106 GLN B C   1 
ATOM   4062 O O   . GLN B 1 106 ? -14.364 44.604 39.209  1.00 46.34  ? 106 GLN B O   1 
ATOM   4063 C CB  . GLN B 1 106 ? -16.946 44.199 40.537  1.00 48.33  ? 106 GLN B CB  1 
ATOM   4064 C CG  . GLN B 1 106 ? -17.869 45.322 40.980  1.00 64.95  ? 106 GLN B CG  1 
ATOM   4065 C CD  . GLN B 1 106 ? -18.061 45.341 42.475  1.00 89.66  ? 106 GLN B CD  1 
ATOM   4066 O OE1 . GLN B 1 106 ? -17.106 45.492 43.259  1.00 83.48  ? 106 GLN B OE1 1 
ATOM   4067 N NE2 . GLN B 1 106 ? -19.316 45.219 42.899  1.00 87.58  ? 106 GLN B NE2 1 
ATOM   4068 N N   . GLY B 1 107 ? -15.024 43.021 37.716  1.00 42.05  ? 107 GLY B N   1 
ATOM   4069 C CA  . GLY B 1 107 ? -13.707 42.688 37.195  1.00 39.54  ? 107 GLY B CA  1 
ATOM   4070 C C   . GLY B 1 107 ? -13.010 41.515 37.839  1.00 39.26  ? 107 GLY B C   1 
ATOM   4071 O O   . GLY B 1 107 ? -11.779 41.542 37.979  1.00 37.43  ? 107 GLY B O   1 
ATOM   4072 N N   . GLN B 1 108 ? -13.783 40.465 38.205  1.00 34.23  ? 108 GLN B N   1 
ATOM   4073 C CA  . GLN B 1 108 ? -13.261 39.228 38.799  1.00 33.55  ? 108 GLN B CA  1 
ATOM   4074 C C   . GLN B 1 108 ? -12.120 38.652 37.944  1.00 34.95  ? 108 GLN B C   1 
ATOM   4075 O O   . GLN B 1 108 ? -12.209 38.675 36.702  1.00 32.52  ? 108 GLN B O   1 
ATOM   4076 C CB  . GLN B 1 108 ? -14.387 38.193 38.926  1.00 35.22  ? 108 GLN B CB  1 
ATOM   4077 C CG  . GLN B 1 108 ? -13.990 36.927 39.679  1.00 42.17  ? 108 GLN B CG  1 
ATOM   4078 C CD  . GLN B 1 108 ? -15.144 35.984 39.854  1.00 54.68  ? 108 GLN B CD  1 
ATOM   4079 O OE1 . GLN B 1 108 ? -15.903 35.696 38.918  1.00 46.93  ? 108 GLN B OE1 1 
ATOM   4080 N NE2 . GLN B 1 108 ? -15.261 35.436 41.053  1.00 49.04  ? 108 GLN B NE2 1 
ATOM   4081 N N   . MET B 1 109 ? -11.046 38.163 38.613  1.00 31.03  ? 109 MET B N   1 
ATOM   4082 C CA  . MET B 1 109 ? -9.880  37.601 37.932  1.00 29.64  ? 109 MET B CA  1 
ATOM   4083 C C   . MET B 1 109 ? -10.264 36.381 37.105  1.00 32.99  ? 109 MET B C   1 
ATOM   4084 O O   . MET B 1 109 ? -10.890 35.450 37.627  1.00 31.71  ? 109 MET B O   1 
ATOM   4085 C CB  . MET B 1 109 ? -8.744  37.271 38.909  1.00 31.70  ? 109 MET B CB  1 
ATOM   4086 C CG  . MET B 1 109 ? -7.442  36.888 38.198  1.00 34.85  ? 109 MET B CG  1 
ATOM   4087 S SD  . MET B 1 109 ? -6.288  35.917 39.209  1.00 39.73  ? 109 MET B SD  1 
ATOM   4088 C CE  . MET B 1 109 ? -6.548  34.302 38.518  1.00 36.53  ? 109 MET B CE  1 
ATOM   4089 N N   . ASP B 1 110 ? -9.938  36.430 35.799  1.00 30.00  ? 110 ASP B N   1 
ATOM   4090 C CA  . ASP B 1 110 ? -10.195 35.349 34.854  1.00 29.98  ? 110 ASP B CA  1 
ATOM   4091 C C   . ASP B 1 110 ? -8.974  35.130 33.981  1.00 33.72  ? 110 ASP B C   1 
ATOM   4092 O O   . ASP B 1 110 ? -8.144  36.026 33.847  1.00 32.70  ? 110 ASP B O   1 
ATOM   4093 C CB  . ASP B 1 110 ? -11.471 35.587 34.027  1.00 32.35  ? 110 ASP B CB  1 
ATOM   4094 C CG  . ASP B 1 110 ? -12.104 34.321 33.448  1.00 50.46  ? 110 ASP B CG  1 
ATOM   4095 O OD1 . ASP B 1 110 ? -11.670 33.202 33.829  1.00 51.96  ? 110 ASP B OD1 1 
ATOM   4096 O OD2 . ASP B 1 110 ? -13.044 34.448 32.618  1.00 58.73  ? 110 ASP B OD2 1 
ATOM   4097 N N   . LEU B 1 111 ? -8.855  33.920 33.420  1.00 31.04  ? 111 LEU B N   1 
ATOM   4098 C CA  . LEU B 1 111 ? -7.725  33.468 32.617  1.00 30.82  ? 111 LEU B CA  1 
ATOM   4099 C C   . LEU B 1 111 ? -8.140  32.766 31.349  1.00 34.51  ? 111 LEU B C   1 
ATOM   4100 O O   . LEU B 1 111 ? -9.188  32.100 31.309  1.00 36.53  ? 111 LEU B O   1 
ATOM   4101 C CB  . LEU B 1 111 ? -6.949  32.439 33.446  1.00 31.43  ? 111 LEU B CB  1 
ATOM   4102 C CG  . LEU B 1 111 ? -5.519  32.772 33.790  1.00 37.19  ? 111 LEU B CG  1 
ATOM   4103 C CD1 . LEU B 1 111 ? -5.350  32.854 35.291  1.00 39.26  ? 111 LEU B CD1 1 
ATOM   4104 C CD2 . LEU B 1 111 ? -4.594  31.735 33.235  1.00 36.99  ? 111 LEU B CD2 1 
ATOM   4105 N N   . CYS B 1 112 ? -7.273  32.824 30.340  1.00 27.66  ? 112 CYS B N   1 
ATOM   4106 C CA  . CYS B 1 112 ? -7.458  32.038 29.137  1.00 27.69  ? 112 CYS B CA  1 
ATOM   4107 C C   . CYS B 1 112 ? -6.144  31.695 28.457  1.00 30.08  ? 112 CYS B C   1 
ATOM   4108 O O   . CYS B 1 112 ? -5.211  32.493 28.467  1.00 31.12  ? 112 CYS B O   1 
ATOM   4109 C CB  . CYS B 1 112 ? -8.474  32.645 28.176  1.00 28.86  ? 112 CYS B CB  1 
ATOM   4110 S SG  . CYS B 1 112 ? -7.952  34.203 27.441  1.00 33.39  ? 112 CYS B SG  1 
ATOM   4111 N N   . VAL B 1 113 ? -6.062  30.484 27.918  1.00 24.40  ? 113 VAL B N   1 
ATOM   4112 C CA  . VAL B 1 113 ? -4.904  30.001 27.188  1.00 24.38  ? 113 VAL B CA  1 
ATOM   4113 C C   . VAL B 1 113 ? -5.042  30.542 25.762  1.00 29.19  ? 113 VAL B C   1 
ATOM   4114 O O   . VAL B 1 113 ? -6.129  30.474 25.177  1.00 29.90  ? 113 VAL B O   1 
ATOM   4115 C CB  . VAL B 1 113 ? -4.789  28.447 27.212  1.00 28.78  ? 113 VAL B CB  1 
ATOM   4116 C CG1 . VAL B 1 113 ? -3.423  27.994 26.699  1.00 28.94  ? 113 VAL B CG1 1 
ATOM   4117 C CG2 . VAL B 1 113 ? -5.056  27.876 28.612  1.00 28.61  ? 113 VAL B CG2 1 
ATOM   4118 N N   . THR B 1 114 ? -3.947  31.116 25.226  1.00 24.97  ? 114 THR B N   1 
ATOM   4119 C CA  . THR B 1 114 ? -3.895  31.679 23.868  1.00 23.58  ? 114 THR B CA  1 
ATOM   4120 C C   . THR B 1 114 ? -2.828  30.960 23.038  1.00 23.01  ? 114 THR B C   1 
ATOM   4121 O O   . THR B 1 114 ? -1.986  30.254 23.592  1.00 19.11  ? 114 THR B O   1 
ATOM   4122 C CB  . THR B 1 114 ? -3.699  33.217 23.925  1.00 33.49  ? 114 THR B CB  1 
ATOM   4123 O OG1 . THR B 1 114 ? -2.543  33.517 24.705  1.00 34.26  ? 114 THR B OG1 1 
ATOM   4124 C CG2 . THR B 1 114 ? -4.901  33.953 24.505  1.00 30.14  ? 114 THR B CG2 1 
ATOM   4125 N N   . SER B 1 115 ? -2.864  31.121 21.713  1.00 22.30  ? 115 SER B N   1 
ATOM   4126 C CA  . SER B 1 115 ? -1.870  30.480 20.835  1.00 23.65  ? 115 SER B CA  1 
ATOM   4127 C C   . SER B 1 115 ? -0.630  31.367 20.772  1.00 29.72  ? 115 SER B C   1 
ATOM   4128 O O   . SER B 1 115 ? -0.330  31.988 19.743  1.00 29.54  ? 115 SER B O   1 
ATOM   4129 C CB  . SER B 1 115 ? -2.463  30.181 19.463  1.00 28.01  ? 115 SER B CB  1 
ATOM   4130 O OG  . SER B 1 115 ? -3.446  29.159 19.560  1.00 41.38  ? 115 SER B OG  1 
ATOM   4131 N N   . GLY B 1 116 ? 0.042   31.444 21.930  1.00 27.36  ? 116 GLY B N   1 
ATOM   4132 C CA  . GLY B 1 116 ? 1.184   32.306 22.208  1.00 26.75  ? 116 GLY B CA  1 
ATOM   4133 C C   . GLY B 1 116 ? 0.661   33.552 22.886  1.00 31.64  ? 116 GLY B C   1 
ATOM   4134 O O   . GLY B 1 116 ? -0.536  33.845 22.791  1.00 31.43  ? 116 GLY B O   1 
ATOM   4135 N N   . SER B 1 117 ? 1.534   34.311 23.570  1.00 29.06  ? 117 SER B N   1 
ATOM   4136 C CA  . SER B 1 117 ? 1.091   35.535 24.244  1.00 28.80  ? 117 SER B CA  1 
ATOM   4137 C C   . SER B 1 117 ? 0.739   36.643 23.234  1.00 34.32  ? 117 SER B C   1 
ATOM   4138 O O   . SER B 1 117 ? -0.031  37.548 23.564  1.00 36.04  ? 117 SER B O   1 
ATOM   4139 C CB  . SER B 1 117 ? 2.113   36.013 25.263  1.00 32.96  ? 117 SER B CB  1 
ATOM   4140 O OG  . SER B 1 117 ? 3.241   36.610 24.647  1.00 43.61  ? 117 SER B OG  1 
ATOM   4141 N N   . GLN B 1 118 ? 1.259   36.535 21.990  1.00 29.41  ? 118 GLN B N   1 
ATOM   4142 C CA  . GLN B 1 118 ? 1.010   37.467 20.886  1.00 28.52  ? 118 GLN B CA  1 
ATOM   4143 C C   . GLN B 1 118 ? -0.479  37.480 20.484  1.00 30.62  ? 118 GLN B C   1 
ATOM   4144 O O   . GLN B 1 118 ? -0.999  38.514 20.082  1.00 29.40  ? 118 GLN B O   1 
ATOM   4145 C CB  . GLN B 1 118 ? 1.896   37.088 19.676  1.00 29.54  ? 118 GLN B CB  1 
ATOM   4146 C CG  . GLN B 1 118 ? 1.935   38.101 18.529  1.00 27.76  ? 118 GLN B CG  1 
ATOM   4147 C CD  . GLN B 1 118 ? 2.357   39.468 18.973  1.00 57.25  ? 118 GLN B CD  1 
ATOM   4148 O OE1 . GLN B 1 118 ? 3.451   39.645 19.511  1.00 52.85  ? 118 GLN B OE1 1 
ATOM   4149 N NE2 . GLN B 1 118 ? 1.495   40.461 18.778  1.00 57.67  ? 118 GLN B NE2 1 
ATOM   4150 N N   . GLN B 1 119 ? -1.140  36.323 20.562  1.00 27.83  ? 119 GLN B N   1 
ATOM   4151 C CA  . GLN B 1 119 ? -2.537  36.200 20.187  1.00 28.06  ? 119 GLN B CA  1 
ATOM   4152 C C   . GLN B 1 119 ? -3.419  36.966 21.168  1.00 34.67  ? 119 GLN B C   1 
ATOM   4153 O O   . GLN B 1 119 ? -4.310  37.685 20.728  1.00 34.36  ? 119 GLN B O   1 
ATOM   4154 C CB  . GLN B 1 119 ? -2.946  34.724 20.047  1.00 28.76  ? 119 GLN B CB  1 
ATOM   4155 C CG  . GLN B 1 119 ? -4.174  34.555 19.171  1.00 29.02  ? 119 GLN B CG  1 
ATOM   4156 C CD  . GLN B 1 119 ? -4.939  33.279 19.380  1.00 36.08  ? 119 GLN B CD  1 
ATOM   4157 O OE1 . GLN B 1 119 ? -4.841  32.602 20.422  1.00 25.67  ? 119 GLN B OE1 1 
ATOM   4158 N NE2 . GLN B 1 119 ? -5.763  32.956 18.392  1.00 29.75  ? 119 GLN B NE2 1 
ATOM   4159 N N   . GLY B 1 120 ? -3.117  36.854 22.471  1.00 32.91  ? 120 GLY B N   1 
ATOM   4160 C CA  . GLY B 1 120 ? -3.829  37.557 23.537  1.00 32.48  ? 120 GLY B CA  1 
ATOM   4161 C C   . GLY B 1 120 ? -3.712  39.055 23.365  1.00 35.10  ? 120 GLY B C   1 
ATOM   4162 O O   . GLY B 1 120 ? -4.725  39.754 23.321  1.00 34.77  ? 120 GLY B O   1 
ATOM   4163 N N   . LEU B 1 121 ? -2.471  39.540 23.185  1.00 30.98  ? 121 LEU B N   1 
ATOM   4164 C CA  . LEU B 1 121 ? -2.151  40.953 22.950  1.00 31.28  ? 121 LEU B CA  1 
ATOM   4165 C C   . LEU B 1 121 ? -2.931  41.508 21.757  1.00 35.54  ? 121 LEU B C   1 
ATOM   4166 O O   . LEU B 1 121 ? -3.556  42.563 21.872  1.00 37.14  ? 121 LEU B O   1 
ATOM   4167 C CB  . LEU B 1 121 ? -0.634  41.126 22.707  1.00 31.22  ? 121 LEU B CB  1 
ATOM   4168 C CG  . LEU B 1 121 ? 0.280   40.937 23.917  1.00 35.15  ? 121 LEU B CG  1 
ATOM   4169 C CD1 . LEU B 1 121 ? 1.687   40.672 23.485  1.00 34.49  ? 121 LEU B CD1 1 
ATOM   4170 C CD2 . LEU B 1 121 ? 0.202   42.137 24.874  1.00 39.08  ? 121 LEU B CD2 1 
ATOM   4171 N N   . CYS B 1 122 ? -2.932  40.762 20.643  1.00 30.85  ? 122 CYS B N   1 
ATOM   4172 C CA  . CYS B 1 122 ? -3.609  41.096 19.400  1.00 31.94  ? 122 CYS B CA  1 
ATOM   4173 C C   . CYS B 1 122 ? -5.109  41.290 19.584  1.00 32.64  ? 122 CYS B C   1 
ATOM   4174 O O   . CYS B 1 122 ? -5.641  42.326 19.188  1.00 31.55  ? 122 CYS B O   1 
ATOM   4175 C CB  . CYS B 1 122 ? -3.298  40.050 18.328  1.00 33.61  ? 122 CYS B CB  1 
ATOM   4176 S SG  . CYS B 1 122 ? -4.268  40.218 16.807  1.00 38.75  ? 122 CYS B SG  1 
ATOM   4177 N N   . LYS B 1 123 ? -5.778  40.292 20.183  1.00 28.08  ? 123 LYS B N   1 
ATOM   4178 C CA  . LYS B 1 123 ? -7.221  40.302 20.432  1.00 27.83  ? 123 LYS B CA  1 
ATOM   4179 C C   . LYS B 1 123 ? -7.618  41.442 21.370  1.00 31.93  ? 123 LYS B C   1 
ATOM   4180 O O   . LYS B 1 123 ? -8.688  42.034 21.181  1.00 31.45  ? 123 LYS B O   1 
ATOM   4181 C CB  . LYS B 1 123 ? -7.711  38.943 20.988  1.00 29.09  ? 123 LYS B CB  1 
ATOM   4182 C CG  . LYS B 1 123 ? -7.384  37.702 20.130  1.00 35.96  ? 123 LYS B CG  1 
ATOM   4183 C CD  . LYS B 1 123 ? -7.992  37.700 18.722  1.00 41.16  ? 123 LYS B CD  1 
ATOM   4184 C CE  . LYS B 1 123 ? -6.969  37.453 17.640  1.00 36.10  ? 123 LYS B CE  1 
ATOM   4185 N NZ  . LYS B 1 123 ? -7.563  37.626 16.288  1.00 43.79  ? 123 LYS B NZ  1 
ATOM   4186 N N   . VAL B 1 124 ? -6.730  41.760 22.358  1.00 27.41  ? 124 VAL B N   1 
ATOM   4187 C CA  . VAL B 1 124 ? -6.908  42.827 23.346  1.00 26.72  ? 124 VAL B CA  1 
ATOM   4188 C C   . VAL B 1 124 ? -6.833  44.181 22.648  1.00 32.19  ? 124 VAL B C   1 
ATOM   4189 O O   . VAL B 1 124 ? -7.690  45.031 22.889  1.00 34.07  ? 124 VAL B O   1 
ATOM   4190 C CB  . VAL B 1 124 ? -5.910  42.692 24.525  1.00 29.21  ? 124 VAL B CB  1 
ATOM   4191 C CG1 . VAL B 1 124 ? -5.775  43.995 25.321  1.00 29.55  ? 124 VAL B CG1 1 
ATOM   4192 C CG2 . VAL B 1 124 ? -6.317  41.563 25.447  1.00 28.11  ? 124 VAL B CG2 1 
ATOM   4193 N N   . PHE B 1 125 ? -5.826  44.377 21.779  1.00 26.85  ? 125 PHE B N   1 
ATOM   4194 C CA  . PHE B 1 125 ? -5.667  45.624 21.036  1.00 26.59  ? 125 PHE B CA  1 
ATOM   4195 C C   . PHE B 1 125 ? -6.869  45.876 20.125  1.00 30.74  ? 125 PHE B C   1 
ATOM   4196 O O   . PHE B 1 125 ? -7.369  46.996 20.085  1.00 30.80  ? 125 PHE B O   1 
ATOM   4197 C CB  . PHE B 1 125 ? -4.378  45.600 20.201  1.00 27.84  ? 125 PHE B CB  1 
ATOM   4198 C CG  . PHE B 1 125 ? -3.068  45.588 20.945  1.00 28.54  ? 125 PHE B CG  1 
ATOM   4199 C CD1 . PHE B 1 125 ? -1.939  45.041 20.369  1.00 30.96  ? 125 PHE B CD1 1 
ATOM   4200 C CD2 . PHE B 1 125 ? -2.951  46.178 22.207  1.00 30.54  ? 125 PHE B CD2 1 
ATOM   4201 C CE1 . PHE B 1 125 ? -0.720  45.051 21.050  1.00 31.50  ? 125 PHE B CE1 1 
ATOM   4202 C CE2 . PHE B 1 125 ? -1.734  46.187 22.888  1.00 32.25  ? 125 PHE B CE2 1 
ATOM   4203 C CZ  . PHE B 1 125 ? -0.627  45.623 22.308  1.00 29.97  ? 125 PHE B CZ  1 
ATOM   4204 N N   . GLU B 1 126 ? -7.339  44.823 19.427  1.00 28.24  ? 126 GLU B N   1 
ATOM   4205 C CA  . GLU B 1 126 ? -8.475  44.861 18.491  1.00 29.78  ? 126 GLU B CA  1 
ATOM   4206 C C   . GLU B 1 126 ? -9.825  45.142 19.190  1.00 34.59  ? 126 GLU B C   1 
ATOM   4207 O O   . GLU B 1 126 ? -10.716 45.772 18.601  1.00 34.63  ? 126 GLU B O   1 
ATOM   4208 C CB  . GLU B 1 126 ? -8.520  43.577 17.626  1.00 31.01  ? 126 GLU B CB  1 
ATOM   4209 C CG  . GLU B 1 126 ? -7.372  43.510 16.624  1.00 41.57  ? 126 GLU B CG  1 
ATOM   4210 C CD  . GLU B 1 126 ? -7.235  42.324 15.682  1.00 66.17  ? 126 GLU B CD  1 
ATOM   4211 O OE1 . GLU B 1 126 ? -6.291  42.351 14.858  1.00 68.69  ? 126 GLU B OE1 1 
ATOM   4212 O OE2 . GLU B 1 126 ? -8.052  41.377 15.754  1.00 59.84  ? 126 GLU B OE2 1 
ATOM   4213 N N   . MET B 1 127 ? -9.934  44.692 20.466  1.00 29.73  ? 127 MET B N   1 
ATOM   4214 C CA  . MET B 1 127 ? -11.091 44.843 21.334  1.00 29.01  ? 127 MET B CA  1 
ATOM   4215 C C   . MET B 1 127 ? -11.273 46.302 21.735  1.00 35.63  ? 127 MET B C   1 
ATOM   4216 O O   . MET B 1 127 ? -12.413 46.798 21.708  1.00 37.39  ? 127 MET B O   1 
ATOM   4217 C CB  . MET B 1 127 ? -10.927 43.929 22.558  1.00 30.12  ? 127 MET B CB  1 
ATOM   4218 C CG  . MET B 1 127 ? -11.799 44.271 23.732  1.00 33.88  ? 127 MET B CG  1 
ATOM   4219 S SD  . MET B 1 127 ? -11.355 43.287 25.175  1.00 37.73  ? 127 MET B SD  1 
ATOM   4220 C CE  . MET B 1 127 ? -10.013 44.208 25.840  1.00 33.85  ? 127 MET B CE  1 
ATOM   4221 N N   . ILE B 1 128 ? -10.146 46.985 22.067  1.00 30.59  ? 128 ILE B N   1 
ATOM   4222 C CA  . ILE B 1 128 ? -10.070 48.358 22.564  1.00 31.00  ? 128 ILE B CA  1 
ATOM   4223 C C   . ILE B 1 128 ? -10.062 49.482 21.511  1.00 36.06  ? 128 ILE B C   1 
ATOM   4224 O O   . ILE B 1 128 ? -10.882 50.404 21.593  1.00 36.74  ? 128 ILE B O   1 
ATOM   4225 C CB  . ILE B 1 128 ? -8.861  48.498 23.541  1.00 33.25  ? 128 ILE B CB  1 
ATOM   4226 C CG1 . ILE B 1 128 ? -8.972  47.521 24.704  1.00 32.89  ? 128 ILE B CG1 1 
ATOM   4227 C CG2 . ILE B 1 128 ? -8.680  49.954 24.044  1.00 34.83  ? 128 ILE B CG2 1 
ATOM   4228 C CD1 . ILE B 1 128 ? -7.656  47.216 25.373  1.00 44.44  ? 128 ILE B CD1 1 
ATOM   4229 N N   . ILE B 1 129 ? -9.079  49.452 20.594  1.00 31.65  ? 129 ILE B N   1 
ATOM   4230 C CA  . ILE B 1 129 ? -8.804  50.517 19.630  1.00 31.61  ? 129 ILE B CA  1 
ATOM   4231 C C   . ILE B 1 129 ? -9.805  50.805 18.544  1.00 35.55  ? 129 ILE B C   1 
ATOM   4232 O O   . ILE B 1 129 ? -10.086 49.937 17.721  1.00 36.49  ? 129 ILE B O   1 
ATOM   4233 C CB  . ILE B 1 129 ? -7.344  50.486 19.097  1.00 34.14  ? 129 ILE B CB  1 
ATOM   4234 C CG1 . ILE B 1 129 ? -6.323  50.573 20.246  1.00 33.35  ? 129 ILE B CG1 1 
ATOM   4235 C CG2 . ILE B 1 129 ? -7.093  51.600 18.061  1.00 35.81  ? 129 ILE B CG2 1 
ATOM   4236 C CD1 . ILE B 1 129 ? -5.240  49.583 20.118  1.00 37.89  ? 129 ILE B CD1 1 
ATOM   4237 N N   . ASN B 1 130 ? -10.272 52.066 18.505  1.00 31.83  ? 130 ASN B N   1 
ATOM   4238 C CA  . ASN B 1 130 ? -11.126 52.646 17.467  1.00 32.86  ? 130 ASN B CA  1 
ATOM   4239 C C   . ASN B 1 130 ? -10.221 53.645 16.751  1.00 39.23  ? 130 ASN B C   1 
ATOM   4240 O O   . ASN B 1 130 ? -9.375  54.260 17.417  1.00 38.67  ? 130 ASN B O   1 
ATOM   4241 C CB  . ASN B 1 130 ? -12.310 53.399 18.056  1.00 31.27  ? 130 ASN B CB  1 
ATOM   4242 C CG  . ASN B 1 130 ? -13.381 52.514 18.590  1.00 53.98  ? 130 ASN B CG  1 
ATOM   4243 O OD1 . ASN B 1 130 ? -13.947 51.690 17.862  1.00 37.03  ? 130 ASN B OD1 1 
ATOM   4244 N ND2 . ASN B 1 130 ? -13.698 52.688 19.873  1.00 55.95  ? 130 ASN B ND2 1 
ATOM   4245 N N   . PRO B 1 131 ? -10.351 53.837 15.415  1.00 36.32  ? 131 PRO B N   1 
ATOM   4246 C CA  . PRO B 1 131 ? -9.457  54.795 14.735  1.00 36.11  ? 131 PRO B CA  1 
ATOM   4247 C C   . PRO B 1 131 ? -9.527  56.190 15.349  1.00 40.04  ? 131 PRO B C   1 
ATOM   4248 O O   . PRO B 1 131 ? -10.627 56.742 15.496  1.00 39.61  ? 131 PRO B O   1 
ATOM   4249 C CB  . PRO B 1 131 ? -9.928  54.755 13.276  1.00 38.42  ? 131 PRO B CB  1 
ATOM   4250 C CG  . PRO B 1 131 ? -10.664 53.458 13.138  1.00 42.16  ? 131 PRO B CG  1 
ATOM   4251 C CD  . PRO B 1 131 ? -11.281 53.187 14.464  1.00 37.36  ? 131 PRO B CD  1 
ATOM   4252 N N   . GLY B 1 132 ? -8.363  56.687 15.781  1.00 36.47  ? 132 GLY B N   1 
ATOM   4253 C CA  . GLY B 1 132 ? -8.204  58.004 16.400  1.00 37.33  ? 132 GLY B CA  1 
ATOM   4254 C C   . GLY B 1 132 ? -8.080  58.045 17.914  1.00 40.33  ? 132 GLY B C   1 
ATOM   4255 O O   . GLY B 1 132 ? -8.064  59.131 18.503  1.00 39.19  ? 132 GLY B O   1 
ATOM   4256 N N   . ASP B 1 133 ? -7.998  56.869 18.559  1.00 37.29  ? 133 ASP B N   1 
ATOM   4257 C CA  . ASP B 1 133 ? -7.866  56.733 20.011  1.00 36.57  ? 133 ASP B CA  1 
ATOM   4258 C C   . ASP B 1 133 ? -6.427  56.990 20.452  1.00 42.08  ? 133 ASP B C   1 
ATOM   4259 O O   . ASP B 1 133 ? -5.486  56.663 19.725  1.00 41.75  ? 133 ASP B O   1 
ATOM   4260 C CB  . ASP B 1 133 ? -8.327  55.337 20.478  1.00 37.12  ? 133 ASP B CB  1 
ATOM   4261 C CG  . ASP B 1 133 ? -9.839  55.084 20.520  1.00 51.58  ? 133 ASP B CG  1 
ATOM   4262 O OD1 . ASP B 1 133 ? -10.623 56.068 20.407  1.00 54.62  ? 133 ASP B OD1 1 
ATOM   4263 O OD2 . ASP B 1 133 ? -10.239 53.914 20.724  1.00 54.51  ? 133 ASP B OD2 1 
ATOM   4264 N N   . ASN B 1 134 ? -6.252  57.579 21.637  1.00 39.09  ? 134 ASN B N   1 
ATOM   4265 C CA  . ASN B 1 134 ? -4.927  57.856 22.171  1.00 38.49  ? 134 ASN B CA  1 
ATOM   4266 C C   . ASN B 1 134 ? -4.457  56.682 23.009  1.00 41.60  ? 134 ASN B C   1 
ATOM   4267 O O   . ASN B 1 134 ? -5.232  56.162 23.819  1.00 40.27  ? 134 ASN B O   1 
ATOM   4268 C CB  . ASN B 1 134 ? -4.936  59.134 23.001  1.00 39.82  ? 134 ASN B CB  1 
ATOM   4269 C CG  . ASN B 1 134 ? -5.082  60.387 22.189  1.00 60.35  ? 134 ASN B CG  1 
ATOM   4270 O OD1 . ASN B 1 134 ? -4.493  60.539 21.109  1.00 54.62  ? 134 ASN B OD1 1 
ATOM   4271 N ND2 . ASN B 1 134 ? -5.842  61.335 22.718  1.00 50.44  ? 134 ASN B ND2 1 
ATOM   4272 N N   . VAL B 1 135 ? -3.202  56.233 22.788  1.00 37.86  ? 135 VAL B N   1 
ATOM   4273 C CA  . VAL B 1 135 ? -2.591  55.124 23.539  1.00 36.38  ? 135 VAL B CA  1 
ATOM   4274 C C   . VAL B 1 135 ? -1.208  55.522 24.047  1.00 40.39  ? 135 VAL B C   1 
ATOM   4275 O O   . VAL B 1 135 ? -0.471  56.220 23.344  1.00 42.26  ? 135 VAL B O   1 
ATOM   4276 C CB  . VAL B 1 135 ? -2.622  53.717 22.854  1.00 39.05  ? 135 VAL B CB  1 
ATOM   4277 C CG1 . VAL B 1 135 ? -4.042  53.258 22.564  1.00 38.99  ? 135 VAL B CG1 1 
ATOM   4278 C CG2 . VAL B 1 135 ? -1.788  53.674 21.587  1.00 38.91  ? 135 VAL B CG2 1 
ATOM   4279 N N   . LEU B 1 136 ? -0.877  55.105 25.276  1.00 34.00  ? 136 LEU B N   1 
ATOM   4280 C CA  . LEU B 1 136 ? 0.395   55.418 25.924  1.00 32.80  ? 136 LEU B CA  1 
ATOM   4281 C C   . LEU B 1 136 ? 1.333   54.255 25.842  1.00 35.90  ? 136 LEU B C   1 
ATOM   4282 O O   . LEU B 1 136 ? 0.965   53.112 26.144  1.00 34.58  ? 136 LEU B O   1 
ATOM   4283 C CB  . LEU B 1 136 ? 0.196   55.853 27.385  1.00 33.12  ? 136 LEU B CB  1 
ATOM   4284 C CG  . LEU B 1 136 ? -0.589  57.129 27.617  1.00 38.11  ? 136 LEU B CG  1 
ATOM   4285 C CD1 . LEU B 1 136 ? -1.137  57.161 29.006  1.00 38.72  ? 136 LEU B CD1 1 
ATOM   4286 C CD2 . LEU B 1 136 ? 0.259   58.357 27.346  1.00 39.56  ? 136 LEU B CD2 1 
ATOM   4287 N N   . LEU B 1 137 ? 2.570   54.550 25.445  1.00 33.72  ? 137 LEU B N   1 
ATOM   4288 C CA  . LEU B 1 137 ? 3.619   53.556 25.202  1.00 32.56  ? 137 LEU B CA  1 
ATOM   4289 C C   . LEU B 1 137 ? 4.990   54.220 25.369  1.00 38.62  ? 137 LEU B C   1 
ATOM   4290 O O   . LEU B 1 137 ? 5.103   55.452 25.291  1.00 38.74  ? 137 LEU B O   1 
ATOM   4291 C CB  . LEU B 1 137 ? 3.412   53.086 23.744  1.00 32.09  ? 137 LEU B CB  1 
ATOM   4292 C CG  . LEU B 1 137 ? 4.227   51.975 23.193  1.00 36.38  ? 137 LEU B CG  1 
ATOM   4293 C CD1 . LEU B 1 137 ? 3.344   50.916 22.571  1.00 36.59  ? 137 LEU B CD1 1 
ATOM   4294 C CD2 . LEU B 1 137 ? 5.189   52.502 22.184  1.00 39.05  ? 137 LEU B CD2 1 
ATOM   4295 N N   . ASP B 1 138 ? 6.029   53.406 25.599  1.00 36.76  ? 138 ASP B N   1 
ATOM   4296 C CA  . ASP B 1 138 ? 7.407   53.885 25.726  1.00 37.77  ? 138 ASP B CA  1 
ATOM   4297 C C   . ASP B 1 138 ? 8.292   53.398 24.572  1.00 41.84  ? 138 ASP B C   1 
ATOM   4298 O O   . ASP B 1 138 ? 8.405   52.193 24.357  1.00 41.77  ? 138 ASP B O   1 
ATOM   4299 C CB  . ASP B 1 138 ? 8.005   53.523 27.106  1.00 40.45  ? 138 ASP B CB  1 
ATOM   4300 C CG  . ASP B 1 138 ? 7.869   52.062 27.519  1.00 61.65  ? 138 ASP B CG  1 
ATOM   4301 O OD1 . ASP B 1 138 ? 6.713   51.569 27.615  1.00 64.80  ? 138 ASP B OD1 1 
ATOM   4302 O OD2 . ASP B 1 138 ? 8.911   51.422 27.785  1.00 69.69  ? 138 ASP B OD2 1 
ATOM   4303 N N   . GLU B 1 139 ? 8.872   54.336 23.801  1.00 39.32  ? 139 GLU B N   1 
ATOM   4304 C CA  . GLU B 1 139 ? 9.787   54.033 22.704  1.00 39.48  ? 139 GLU B CA  1 
ATOM   4305 C C   . GLU B 1 139 ? 11.205  54.034 23.301  1.00 45.26  ? 139 GLU B C   1 
ATOM   4306 O O   . GLU B 1 139 ? 11.520  54.934 24.099  1.00 45.33  ? 139 GLU B O   1 
ATOM   4307 C CB  . GLU B 1 139 ? 9.717   55.086 21.592  1.00 41.69  ? 139 GLU B CB  1 
ATOM   4308 C CG  . GLU B 1 139 ? 8.537   54.958 20.647  1.00 54.38  ? 139 GLU B CG  1 
ATOM   4309 C CD  . GLU B 1 139 ? 8.532   56.014 19.554  1.00 80.93  ? 139 GLU B CD  1 
ATOM   4310 O OE1 . GLU B 1 139 ? 8.618   55.637 18.363  1.00 71.21  ? 139 GLU B OE1 1 
ATOM   4311 O OE2 . GLU B 1 139 ? 8.474   57.220 19.887  1.00 81.33  ? 139 GLU B OE2 1 
ATOM   4312 N N   . PRO B 1 140 ? 12.079  53.054 22.942  1.00 41.16  ? 140 PRO B N   1 
ATOM   4313 C CA  . PRO B 1 140 ? 11.838  51.931 22.018  1.00 39.62  ? 140 PRO B CA  1 
ATOM   4314 C C   . PRO B 1 140 ? 10.995  50.811 22.623  1.00 39.45  ? 140 PRO B C   1 
ATOM   4315 O O   . PRO B 1 140 ? 11.065  50.534 23.826  1.00 36.16  ? 140 PRO B O   1 
ATOM   4316 C CB  . PRO B 1 140 ? 13.250  51.519 21.599  1.00 42.02  ? 140 PRO B CB  1 
ATOM   4317 C CG  . PRO B 1 140 ? 14.120  51.880 22.771  1.00 46.49  ? 140 PRO B CG  1 
ATOM   4318 C CD  . PRO B 1 140 ? 13.450  53.021 23.496  1.00 42.44  ? 140 PRO B CD  1 
ATOM   4319 N N   . ALA B 1 141 ? 10.167  50.200 21.772  1.00 37.18  ? 141 ALA B N   1 
ATOM   4320 C CA  . ALA B 1 141 ? 9.219   49.144 22.132  1.00 36.96  ? 141 ALA B CA  1 
ATOM   4321 C C   . ALA B 1 141 ? 9.330   47.902 21.239  1.00 43.23  ? 141 ALA B C   1 
ATOM   4322 O O   . ALA B 1 141 ? 9.964   47.959 20.180  1.00 42.25  ? 141 ALA B O   1 
ATOM   4323 C CB  . ALA B 1 141 ? 7.811   49.692 22.061  1.00 37.47  ? 141 ALA B CB  1 
ATOM   4324 N N   . TYR B 1 142 ? 8.709   46.775 21.677  1.00 41.84  ? 142 TYR B N   1 
ATOM   4325 C CA  . TYR B 1 142 ? 8.675   45.509 20.932  1.00 42.38  ? 142 TYR B CA  1 
ATOM   4326 C C   . TYR B 1 142 ? 8.008   45.754 19.583  1.00 46.05  ? 142 TYR B C   1 
ATOM   4327 O O   . TYR B 1 142 ? 6.881   46.250 19.549  1.00 47.30  ? 142 TYR B O   1 
ATOM   4328 C CB  . TYR B 1 142 ? 7.975   44.394 21.754  1.00 43.55  ? 142 TYR B CB  1 
ATOM   4329 C CG  . TYR B 1 142 ? 7.607   43.136 20.988  1.00 46.26  ? 142 TYR B CG  1 
ATOM   4330 C CD1 . TYR B 1 142 ? 6.324   42.614 21.050  1.00 48.27  ? 142 TYR B CD1 1 
ATOM   4331 C CD2 . TYR B 1 142 ? 8.561   42.436 20.247  1.00 47.29  ? 142 TYR B CD2 1 
ATOM   4332 C CE1 . TYR B 1 142 ? 5.987   41.445 20.375  1.00 48.69  ? 142 TYR B CE1 1 
ATOM   4333 C CE2 . TYR B 1 142 ? 8.231   41.272 19.556  1.00 47.65  ? 142 TYR B CE2 1 
ATOM   4334 C CZ  . TYR B 1 142 ? 6.941   40.782 19.623  1.00 53.79  ? 142 TYR B CZ  1 
ATOM   4335 O OH  . TYR B 1 142 ? 6.608   39.642 18.943  1.00 54.34  ? 142 TYR B OH  1 
ATOM   4336 N N   . SER B 1 143 ? 8.727   45.465 18.480  1.00 40.44  ? 143 SER B N   1 
ATOM   4337 C CA  . SER B 1 143 ? 8.269   45.660 17.094  1.00 39.63  ? 143 SER B CA  1 
ATOM   4338 C C   . SER B 1 143 ? 6.937   44.985 16.775  1.00 39.66  ? 143 SER B C   1 
ATOM   4339 O O   . SER B 1 143 ? 6.155   45.537 15.995  1.00 38.82  ? 143 SER B O   1 
ATOM   4340 C CB  . SER B 1 143 ? 9.326   45.215 16.095  1.00 43.88  ? 143 SER B CB  1 
ATOM   4341 O OG  . SER B 1 143 ? 9.592   43.828 16.198  1.00 56.23  ? 143 SER B OG  1 
ATOM   4342 N N   . GLY B 1 144 ? 6.694   43.824 17.392  1.00 33.35  ? 144 GLY B N   1 
ATOM   4343 C CA  . GLY B 1 144 ? 5.453   43.078 17.251  1.00 32.68  ? 144 GLY B CA  1 
ATOM   4344 C C   . GLY B 1 144 ? 4.242   43.883 17.693  1.00 36.46  ? 144 GLY B C   1 
ATOM   4345 O O   . GLY B 1 144 ? 3.196   43.821 17.043  1.00 36.12  ? 144 GLY B O   1 
ATOM   4346 N N   . THR B 1 145 ? 4.385   44.694 18.770  1.00 32.38  ? 145 THR B N   1 
ATOM   4347 C CA  . THR B 1 145 ? 3.263   45.510 19.225  1.00 32.21  ? 145 THR B CA  1 
ATOM   4348 C C   . THR B 1 145 ? 3.058   46.712 18.348  1.00 36.92  ? 145 THR B C   1 
ATOM   4349 O O   . THR B 1 145 ? 1.911   47.071 18.061  1.00 36.57  ? 145 THR B O   1 
ATOM   4350 C CB  . THR B 1 145 ? 3.170   45.706 20.760  1.00 36.04  ? 145 THR B CB  1 
ATOM   4351 O OG1 . THR B 1 145 ? 3.023   47.086 21.108  1.00 37.92  ? 145 THR B OG1 1 
ATOM   4352 C CG2 . THR B 1 145 ? 4.294   45.098 21.493  1.00 31.81  ? 145 THR B CG2 1 
ATOM   4353 N N   . LEU B 1 146 ? 4.171   47.299 17.862  1.00 33.05  ? 146 LEU B N   1 
ATOM   4354 C CA  . LEU B 1 146 ? 4.125   48.471 16.974  1.00 32.12  ? 146 LEU B CA  1 
ATOM   4355 C C   . LEU B 1 146 ? 3.493   48.088 15.645  1.00 34.42  ? 146 LEU B C   1 
ATOM   4356 O O   . LEU B 1 146 ? 2.633   48.809 15.146  1.00 32.73  ? 146 LEU B O   1 
ATOM   4357 C CB  . LEU B 1 146 ? 5.515   49.048 16.764  1.00 31.78  ? 146 LEU B CB  1 
ATOM   4358 C CG  . LEU B 1 146 ? 6.286   49.465 17.997  1.00 34.42  ? 146 LEU B CG  1 
ATOM   4359 C CD1 . LEU B 1 146 ? 7.712   49.679 17.630  1.00 34.67  ? 146 LEU B CD1 1 
ATOM   4360 C CD2 . LEU B 1 146 ? 5.704   50.746 18.640  1.00 33.95  ? 146 LEU B CD2 1 
ATOM   4361 N N   . GLN B 1 147 ? 3.856   46.900 15.131  1.00 32.39  ? 147 GLN B N   1 
ATOM   4362 C CA  . GLN B 1 147 ? 3.325   46.360 13.886  1.00 33.71  ? 147 GLN B CA  1 
ATOM   4363 C C   . GLN B 1 147 ? 1.847   46.005 13.988  1.00 37.48  ? 147 GLN B C   1 
ATOM   4364 O O   . GLN B 1 147 ? 1.141   46.058 12.980  1.00 35.88  ? 147 GLN B O   1 
ATOM   4365 C CB  . GLN B 1 147 ? 4.181   45.195 13.376  1.00 35.42  ? 147 GLN B CB  1 
ATOM   4366 C CG  . GLN B 1 147 ? 5.517   45.655 12.738  1.00 57.20  ? 147 GLN B CG  1 
ATOM   4367 C CD  . GLN B 1 147 ? 5.347   46.618 11.566  1.00 82.24  ? 147 GLN B CD  1 
ATOM   4368 O OE1 . GLN B 1 147 ? 5.690   47.802 11.651  1.00 75.31  ? 147 GLN B OE1 1 
ATOM   4369 N NE2 . GLN B 1 147 ? 4.715   46.170 10.483  1.00 79.35  ? 147 GLN B NE2 1 
ATOM   4370 N N   . SER B 1 148 ? 1.386   45.697 15.223  1.00 34.79  ? 148 SER B N   1 
ATOM   4371 C CA  . SER B 1 148 ? -0.001  45.395 15.561  1.00 34.05  ? 148 SER B CA  1 
ATOM   4372 C C   . SER B 1 148 ? -0.814  46.681 15.638  1.00 38.30  ? 148 SER B C   1 
ATOM   4373 O O   . SER B 1 148 ? -1.919  46.722 15.094  1.00 39.21  ? 148 SER B O   1 
ATOM   4374 C CB  . SER B 1 148 ? -0.074  44.668 16.903  1.00 36.20  ? 148 SER B CB  1 
ATOM   4375 O OG  . SER B 1 148 ? 0.040   43.262 16.747  1.00 44.26  ? 148 SER B OG  1 
ATOM   4376 N N   . LEU B 1 149 ? -0.278  47.725 16.320  1.00 33.18  ? 149 LEU B N   1 
ATOM   4377 C CA  . LEU B 1 149 ? -0.982  48.991 16.525  1.00 33.21  ? 149 LEU B CA  1 
ATOM   4378 C C   . LEU B 1 149 ? -1.109  49.882 15.298  1.00 41.59  ? 149 LEU B C   1 
ATOM   4379 O O   . LEU B 1 149 ? -2.142  50.528 15.135  1.00 41.70  ? 149 LEU B O   1 
ATOM   4380 C CB  . LEU B 1 149 ? -0.429  49.783 17.732  1.00 32.38  ? 149 LEU B CB  1 
ATOM   4381 C CG  . LEU B 1 149 ? -0.426  49.087 19.108  1.00 34.33  ? 149 LEU B CG  1 
ATOM   4382 C CD1 . LEU B 1 149 ? 0.183   49.969 20.168  1.00 33.56  ? 149 LEU B CD1 1 
ATOM   4383 C CD2 . LEU B 1 149 ? -1.792  48.681 19.539  1.00 33.90  ? 149 LEU B CD2 1 
ATOM   4384 N N   . HIS B 1 150 ? -0.068  49.927 14.449  1.00 41.73  ? 150 HIS B N   1 
ATOM   4385 C CA  . HIS B 1 150 ? -0.004  50.755 13.239  1.00 43.66  ? 150 HIS B CA  1 
ATOM   4386 C C   . HIS B 1 150 ? -1.251  50.677 12.320  1.00 44.36  ? 150 HIS B C   1 
ATOM   4387 O O   . HIS B 1 150 ? -1.794  51.736 11.997  1.00 44.61  ? 150 HIS B O   1 
ATOM   4388 C CB  . HIS B 1 150 ? 1.318   50.528 12.479  1.00 46.50  ? 150 HIS B CB  1 
ATOM   4389 C CG  . HIS B 1 150 ? 1.365   51.192 11.135  1.00 52.44  ? 150 HIS B CG  1 
ATOM   4390 N ND1 . HIS B 1 150 ? 1.334   50.447 9.962   1.00 55.13  ? 150 HIS B ND1 1 
ATOM   4391 C CD2 . HIS B 1 150 ? 1.399   52.513 10.819  1.00 55.75  ? 150 HIS B CD2 1 
ATOM   4392 C CE1 . HIS B 1 150 ? 1.373   51.332 8.977   1.00 55.97  ? 150 HIS B CE1 1 
ATOM   4393 N NE2 . HIS B 1 150 ? 1.400   52.589 9.442   1.00 56.67  ? 150 HIS B NE2 1 
ATOM   4394 N N   . PRO B 1 151 ? -1.771  49.485 11.932  1.00 38.41  ? 151 PRO B N   1 
ATOM   4395 C CA  . PRO B 1 151 ? -2.970  49.455 11.072  1.00 38.65  ? 151 PRO B CA  1 
ATOM   4396 C C   . PRO B 1 151 ? -4.281  49.892 11.753  1.00 40.78  ? 151 PRO B C   1 
ATOM   4397 O O   . PRO B 1 151 ? -5.277  50.148 11.067  1.00 38.71  ? 151 PRO B O   1 
ATOM   4398 C CB  . PRO B 1 151 ? -3.050  47.985 10.645  1.00 39.72  ? 151 PRO B CB  1 
ATOM   4399 C CG  . PRO B 1 151 ? -1.739  47.396 11.005  1.00 42.73  ? 151 PRO B CG  1 
ATOM   4400 C CD  . PRO B 1 151 ? -1.305  48.116 12.198  1.00 37.95  ? 151 PRO B CD  1 
ATOM   4401 N N   . LEU B 1 152 ? -4.281  49.954 13.101  1.00 37.34  ? 152 LEU B N   1 
ATOM   4402 C CA  . LEU B 1 152 ? -5.444  50.309 13.918  1.00 36.57  ? 152 LEU B CA  1 
ATOM   4403 C C   . LEU B 1 152 ? -5.738  51.804 13.963  1.00 39.71  ? 152 LEU B C   1 
ATOM   4404 O O   . LEU B 1 152 ? -6.775  52.188 14.505  1.00 40.70  ? 152 LEU B O   1 
ATOM   4405 C CB  . LEU B 1 152 ? -5.355  49.714 15.339  1.00 35.33  ? 152 LEU B CB  1 
ATOM   4406 C CG  . LEU B 1 152 ? -5.389  48.188 15.453  1.00 38.34  ? 152 LEU B CG  1 
ATOM   4407 C CD1 . LEU B 1 152 ? -4.770  47.745 16.757  1.00 40.79  ? 152 LEU B CD1 1 
ATOM   4408 C CD2 . LEU B 1 152 ? -6.794  47.641 15.358  1.00 37.55  ? 152 LEU B CD2 1 
ATOM   4409 N N   . GLY B 1 153 ? -4.866  52.617 13.366  1.00 33.57  ? 153 GLY B N   1 
ATOM   4410 C CA  . GLY B 1 153 ? -5.042  54.061 13.271  1.00 34.21  ? 153 GLY B CA  1 
ATOM   4411 C C   . GLY B 1 153 ? -5.226  54.781 14.590  1.00 38.92  ? 153 GLY B C   1 
ATOM   4412 O O   . GLY B 1 153 ? -6.123  55.617 14.726  1.00 41.53  ? 153 GLY B O   1 
ATOM   4413 N N   . CYS B 1 154 ? -4.403  54.443 15.568  1.00 34.01  ? 154 CYS B N   1 
ATOM   4414 C CA  . CYS B 1 154 ? -4.429  55.048 16.885  1.00 34.70  ? 154 CYS B CA  1 
ATOM   4415 C C   . CYS B 1 154 ? -3.229  55.970 17.021  1.00 42.29  ? 154 CYS B C   1 
ATOM   4416 O O   . CYS B 1 154 ? -2.243  55.793 16.299  1.00 43.24  ? 154 CYS B O   1 
ATOM   4417 C CB  . CYS B 1 154 ? -4.439  53.975 17.972  1.00 34.27  ? 154 CYS B CB  1 
ATOM   4418 S SG  . CYS B 1 154 ? -2.973  52.897 17.989  1.00 37.30  ? 154 CYS B SG  1 
ATOM   4419 N N   . ASN B 1 155 ? -3.296  56.944 17.948  1.00 39.69  ? 155 ASN B N   1 
ATOM   4420 C CA  . ASN B 1 155 ? -2.199  57.876 18.187  1.00 39.15  ? 155 ASN B CA  1 
ATOM   4421 C C   . ASN B 1 155 ? -1.340  57.364 19.331  1.00 41.90  ? 155 ASN B C   1 
ATOM   4422 O O   . ASN B 1 155 ? -1.815  57.281 20.469  1.00 41.11  ? 155 ASN B O   1 
ATOM   4423 C CB  . ASN B 1 155 ? -2.714  59.296 18.476  1.00 39.49  ? 155 ASN B CB  1 
ATOM   4424 C CG  . ASN B 1 155 ? -3.573  59.872 17.382  1.00 70.26  ? 155 ASN B CG  1 
ATOM   4425 O OD1 . ASN B 1 155 ? -3.139  60.035 16.235  1.00 68.99  ? 155 ASN B OD1 1 
ATOM   4426 N ND2 . ASN B 1 155 ? -4.811  60.209 17.718  1.00 62.03  ? 155 ASN B ND2 1 
ATOM   4427 N N   . ILE B 1 156 ? -0.085  56.978 19.019  1.00 38.36  ? 156 ILE B N   1 
ATOM   4428 C CA  . ILE B 1 156 ? 0.864   56.504 20.025  1.00 37.46  ? 156 ILE B CA  1 
ATOM   4429 C C   . ILE B 1 156 ? 1.628   57.713 20.575  1.00 41.12  ? 156 ILE B C   1 
ATOM   4430 O O   . ILE B 1 156 ? 2.350   58.377 19.838  1.00 39.35  ? 156 ILE B O   1 
ATOM   4431 C CB  . ILE B 1 156 ? 1.805   55.373 19.523  1.00 39.82  ? 156 ILE B CB  1 
ATOM   4432 C CG1 . ILE B 1 156 ? 1.029   54.091 19.152  1.00 38.91  ? 156 ILE B CG1 1 
ATOM   4433 C CG2 . ILE B 1 156 ? 2.885   55.075 20.561  1.00 40.58  ? 156 ILE B CG2 1 
ATOM   4434 C CD1 . ILE B 1 156 ? 1.748   53.139 18.236  1.00 38.70  ? 156 ILE B CD1 1 
ATOM   4435 N N   . ILE B 1 157 ? 1.437   57.992 21.878  1.00 39.45  ? 157 ILE B N   1 
ATOM   4436 C CA  . ILE B 1 157 ? 2.078   59.071 22.627  1.00 39.67  ? 157 ILE B CA  1 
ATOM   4437 C C   . ILE B 1 157 ? 3.252   58.445 23.378  1.00 44.00  ? 157 ILE B C   1 
ATOM   4438 O O   . ILE B 1 157 ? 3.045   57.596 24.251  1.00 42.98  ? 157 ILE B O   1 
ATOM   4439 C CB  . ILE B 1 157 ? 1.071   59.772 23.583  1.00 43.12  ? 157 ILE B CB  1 
ATOM   4440 C CG1 . ILE B 1 157 ? -0.254  60.152 22.858  1.00 44.51  ? 157 ILE B CG1 1 
ATOM   4441 C CG2 . ILE B 1 157 ? 1.723   61.000 24.238  1.00 43.73  ? 157 ILE B CG2 1 
ATOM   4442 C CD1 . ILE B 1 157 ? -1.476  60.470 23.765  1.00 51.58  ? 157 ILE B CD1 1 
ATOM   4443 N N   . ASN B 1 158 ? 4.481   58.826 23.010  1.00 42.19  ? 158 ASN B N   1 
ATOM   4444 C CA  . ASN B 1 158 ? 5.681   58.275 23.646  1.00 42.37  ? 158 ASN B CA  1 
ATOM   4445 C C   . ASN B 1 158 ? 5.962   58.848 25.039  1.00 47.00  ? 158 ASN B C   1 
ATOM   4446 O O   . ASN B 1 158 ? 5.943   60.063 25.220  1.00 48.27  ? 158 ASN B O   1 
ATOM   4447 C CB  . ASN B 1 158 ? 6.906   58.359 22.717  1.00 43.39  ? 158 ASN B CB  1 
ATOM   4448 C CG  . ASN B 1 158 ? 8.220   58.073 23.393  1.00 66.75  ? 158 ASN B CG  1 
ATOM   4449 O OD1 . ASN B 1 158 ? 8.453   57.001 23.959  1.00 65.49  ? 158 ASN B OD1 1 
ATOM   4450 N ND2 . ASN B 1 158 ? 9.088   59.057 23.391  1.00 60.44  ? 158 ASN B ND2 1 
ATOM   4451 N N   . VAL B 1 159 ? 6.211   57.965 26.013  1.00 42.83  ? 159 VAL B N   1 
ATOM   4452 C CA  . VAL B 1 159 ? 6.522   58.322 27.399  1.00 43.69  ? 159 VAL B CA  1 
ATOM   4453 C C   . VAL B 1 159 ? 8.017   58.114 27.601  1.00 48.22  ? 159 VAL B C   1 
ATOM   4454 O O   . VAL B 1 159 ? 8.550   57.058 27.225  1.00 48.28  ? 159 VAL B O   1 
ATOM   4455 C CB  . VAL B 1 159 ? 5.686   57.489 28.414  1.00 48.26  ? 159 VAL B CB  1 
ATOM   4456 C CG1 . VAL B 1 159 ? 5.986   57.899 29.855  1.00 48.52  ? 159 VAL B CG1 1 
ATOM   4457 C CG2 . VAL B 1 159 ? 4.183   57.594 28.125  1.00 48.54  ? 159 VAL B CG2 1 
ATOM   4458 N N   . ALA B 1 160 ? 8.701   59.115 28.182  1.00 44.76  ? 160 ALA B N   1 
ATOM   4459 C CA  . ALA B 1 160 ? 10.139  59.027 28.422  1.00 44.25  ? 160 ALA B CA  1 
ATOM   4460 C C   . ALA B 1 160 ? 10.504  57.884 29.373  1.00 48.08  ? 160 ALA B C   1 
ATOM   4461 O O   . ALA B 1 160 ? 9.752   57.574 30.303  1.00 47.19  ? 160 ALA B O   1 
ATOM   4462 C CB  . ALA B 1 160 ? 10.672  60.345 28.947  1.00 45.86  ? 160 ALA B CB  1 
ATOM   4463 N N   . SER B 1 161 ? 11.642  57.230 29.094  1.00 44.92  ? 161 SER B N   1 
ATOM   4464 C CA  . SER B 1 161 ? 12.162  56.118 29.881  1.00 43.82  ? 161 SER B CA  1 
ATOM   4465 C C   . SER B 1 161 ? 13.686  56.199 30.087  1.00 46.65  ? 161 SER B C   1 
ATOM   4466 O O   . SER B 1 161 ? 14.386  56.898 29.343  1.00 46.91  ? 161 SER B O   1 
ATOM   4467 C CB  . SER B 1 161 ? 11.770  54.787 29.248  1.00 46.57  ? 161 SER B CB  1 
ATOM   4468 O OG  . SER B 1 161 ? 12.335  54.639 27.955  1.00 57.68  ? 161 SER B OG  1 
ATOM   4469 N N   . ASP B 1 162 ? 14.184  55.478 31.109  1.00 40.96  ? 162 ASP B N   1 
ATOM   4470 C CA  . ASP B 1 162 ? 15.597  55.385 31.454  1.00 40.00  ? 162 ASP B CA  1 
ATOM   4471 C C   . ASP B 1 162 ? 15.941  53.937 31.895  1.00 41.85  ? 162 ASP B C   1 
ATOM   4472 O O   . ASP B 1 162 ? 15.165  53.032 31.601  1.00 41.46  ? 162 ASP B O   1 
ATOM   4473 C CB  . ASP B 1 162 ? 15.952  56.448 32.515  1.00 42.34  ? 162 ASP B CB  1 
ATOM   4474 C CG  . ASP B 1 162 ? 15.289  56.292 33.874  1.00 49.80  ? 162 ASP B CG  1 
ATOM   4475 O OD1 . ASP B 1 162 ? 14.303  55.528 33.976  1.00 48.31  ? 162 ASP B OD1 1 
ATOM   4476 O OD2 . ASP B 1 162 ? 15.747  56.944 34.830  1.00 56.18  ? 162 ASP B OD2 1 
ATOM   4477 N N   . GLU B 1 163 ? 17.082  53.724 32.585  1.00 38.29  ? 163 GLU B N   1 
ATOM   4478 C CA  . GLU B 1 163 ? 17.559  52.420 33.083  1.00 38.86  ? 163 GLU B CA  1 
ATOM   4479 C C   . GLU B 1 163 ? 16.536  51.702 33.984  1.00 43.61  ? 163 GLU B C   1 
ATOM   4480 O O   . GLU B 1 163 ? 16.578  50.472 34.087  1.00 44.71  ? 163 GLU B O   1 
ATOM   4481 C CB  . GLU B 1 163 ? 18.893  52.534 33.861  1.00 41.29  ? 163 GLU B CB  1 
ATOM   4482 C CG  . GLU B 1 163 ? 19.748  53.766 33.591  1.00 55.65  ? 163 GLU B CG  1 
ATOM   4483 C CD  . GLU B 1 163 ? 19.402  55.028 34.362  1.00 79.82  ? 163 GLU B CD  1 
ATOM   4484 O OE1 . GLU B 1 163 ? 19.198  56.080 33.711  1.00 60.26  ? 163 GLU B OE1 1 
ATOM   4485 O OE2 . GLU B 1 163 ? 19.356  54.973 35.614  1.00 83.50  ? 163 GLU B OE2 1 
ATOM   4486 N N   . SER B 1 164 ? 15.640  52.467 34.646  1.00 37.97  ? 164 SER B N   1 
ATOM   4487 C CA  . SER B 1 164 ? 14.611  51.940 35.543  1.00 36.21  ? 164 SER B CA  1 
ATOM   4488 C C   . SER B 1 164 ? 13.221  51.932 34.875  1.00 37.29  ? 164 SER B C   1 
ATOM   4489 O O   . SER B 1 164 ? 12.194  51.944 35.566  1.00 36.19  ? 164 SER B O   1 
ATOM   4490 C CB  . SER B 1 164 ? 14.604  52.729 36.847  1.00 40.27  ? 164 SER B CB  1 
ATOM   4491 O OG  . SER B 1 164 ? 15.926  52.855 37.343  1.00 48.69  ? 164 SER B OG  1 
ATOM   4492 N N   . GLY B 1 165 ? 13.223  51.883 33.536  1.00 32.30  ? 165 GLY B N   1 
ATOM   4493 C CA  . GLY B 1 165 ? 12.029  51.882 32.701  1.00 31.51  ? 165 GLY B CA  1 
ATOM   4494 C C   . GLY B 1 165 ? 11.314  53.220 32.614  1.00 37.39  ? 165 GLY B C   1 
ATOM   4495 O O   . GLY B 1 165 ? 11.947  54.278 32.685  1.00 38.42  ? 165 GLY B O   1 
ATOM   4496 N N   . ILE B 1 166 ? 9.971   53.176 32.451  1.00 33.72  ? 166 ILE B N   1 
ATOM   4497 C CA  . ILE B 1 166 ? 9.079   54.329 32.362  1.00 33.61  ? 166 ILE B CA  1 
ATOM   4498 C C   . ILE B 1 166 ? 9.375   55.299 33.502  1.00 39.62  ? 166 ILE B C   1 
ATOM   4499 O O   . ILE B 1 166 ? 9.563   54.871 34.650  1.00 38.65  ? 166 ILE B O   1 
ATOM   4500 C CB  . ILE B 1 166 ? 7.587   53.856 32.349  1.00 36.23  ? 166 ILE B CB  1 
ATOM   4501 C CG1 . ILE B 1 166 ? 7.172   53.403 30.937  1.00 35.64  ? 166 ILE B CG1 1 
ATOM   4502 C CG2 . ILE B 1 166 ? 6.599   54.929 32.901  1.00 38.08  ? 166 ILE B CG2 1 
ATOM   4503 C CD1 . ILE B 1 166 ? 5.879   52.621 30.861  1.00 38.18  ? 166 ILE B CD1 1 
ATOM   4504 N N   . VAL B 1 167 ? 9.451   56.597 33.168  1.00 37.81  ? 167 VAL B N   1 
ATOM   4505 C CA  . VAL B 1 167 ? 9.694   57.664 34.137  1.00 38.61  ? 167 VAL B CA  1 
ATOM   4506 C C   . VAL B 1 167 ? 8.311   58.216 34.531  1.00 46.25  ? 167 VAL B C   1 
ATOM   4507 O O   . VAL B 1 167 ? 7.620   58.763 33.666  1.00 48.53  ? 167 VAL B O   1 
ATOM   4508 C CB  . VAL B 1 167 ? 10.639  58.763 33.579  1.00 41.46  ? 167 VAL B CB  1 
ATOM   4509 C CG1 . VAL B 1 167 ? 10.874  59.861 34.614  1.00 41.65  ? 167 VAL B CG1 1 
ATOM   4510 C CG2 . VAL B 1 167 ? 11.961  58.164 33.102  1.00 40.58  ? 167 VAL B CG2 1 
ATOM   4511 N N   . PRO B 1 168 ? 7.885   58.075 35.808  1.00 42.08  ? 168 PRO B N   1 
ATOM   4512 C CA  . PRO B 1 168 ? 6.543   58.560 36.201  1.00 42.19  ? 168 PRO B CA  1 
ATOM   4513 C C   . PRO B 1 168 ? 6.252   60.046 35.989  1.00 47.05  ? 168 PRO B C   1 
ATOM   4514 O O   . PRO B 1 168 ? 5.102   60.392 35.705  1.00 47.01  ? 168 PRO B O   1 
ATOM   4515 C CB  . PRO B 1 168 ? 6.426   58.153 37.670  1.00 44.37  ? 168 PRO B CB  1 
ATOM   4516 C CG  . PRO B 1 168 ? 7.426   57.052 37.840  1.00 48.41  ? 168 PRO B CG  1 
ATOM   4517 C CD  . PRO B 1 168 ? 8.567   57.416 36.936  1.00 43.63  ? 168 PRO B CD  1 
ATOM   4518 N N   . ASP B 1 169 ? 7.272   60.919 36.104  1.00 44.58  ? 169 ASP B N   1 
ATOM   4519 C CA  . ASP B 1 169 ? 7.095   62.360 35.889  1.00 45.54  ? 169 ASP B CA  1 
ATOM   4520 C C   . ASP B 1 169 ? 6.789   62.721 34.433  1.00 47.35  ? 169 ASP B C   1 
ATOM   4521 O O   . ASP B 1 169 ? 6.053   63.677 34.189  1.00 47.09  ? 169 ASP B O   1 
ATOM   4522 C CB  . ASP B 1 169 ? 8.264   63.169 36.451  1.00 48.61  ? 169 ASP B CB  1 
ATOM   4523 C CG  . ASP B 1 169 ? 8.168   63.358 37.951  1.00 67.60  ? 169 ASP B CG  1 
ATOM   4524 O OD1 . ASP B 1 169 ? 7.374   64.226 38.393  1.00 70.36  ? 169 ASP B OD1 1 
ATOM   4525 O OD2 . ASP B 1 169 ? 8.866   62.624 38.687  1.00 76.31  ? 169 ASP B OD2 1 
ATOM   4526 N N   . SER B 1 170 ? 7.314   61.935 33.475  1.00 42.47  ? 170 SER B N   1 
ATOM   4527 C CA  . SER B 1 170 ? 7.042   62.117 32.043  1.00 42.01  ? 170 SER B CA  1 
ATOM   4528 C C   . SER B 1 170 ? 5.562   61.845 31.785  1.00 43.64  ? 170 SER B C   1 
ATOM   4529 O O   . SER B 1 170 ? 4.901   62.640 31.127  1.00 43.15  ? 170 SER B O   1 
ATOM   4530 C CB  . SER B 1 170 ? 7.896   61.163 31.208  1.00 45.47  ? 170 SER B CB  1 
ATOM   4531 O OG  . SER B 1 170 ? 7.642   61.321 29.819  1.00 55.00  ? 170 SER B OG  1 
ATOM   4532 N N   . LEU B 1 171 ? 5.048   60.731 32.352  1.00 39.41  ? 171 LEU B N   1 
ATOM   4533 C CA  . LEU B 1 171 ? 3.659   60.285 32.288  1.00 38.23  ? 171 LEU B CA  1 
ATOM   4534 C C   . LEU B 1 171 ? 2.750   61.336 32.932  1.00 45.10  ? 171 LEU B C   1 
ATOM   4535 O O   . LEU B 1 171 ? 1.689   61.627 32.386  1.00 45.65  ? 171 LEU B O   1 
ATOM   4536 C CB  . LEU B 1 171 ? 3.524   58.918 32.981  1.00 36.75  ? 171 LEU B CB  1 
ATOM   4537 C CG  . LEU B 1 171 ? 2.134   58.274 33.069  1.00 41.12  ? 171 LEU B CG  1 
ATOM   4538 C CD1 . LEU B 1 171 ? 1.603   57.863 31.700  1.00 40.23  ? 171 LEU B CD1 1 
ATOM   4539 C CD2 . LEU B 1 171 ? 2.169   57.054 33.972  1.00 43.73  ? 171 LEU B CD2 1 
ATOM   4540 N N   . ARG B 1 172 ? 3.195   61.947 34.050  1.00 43.15  ? 172 ARG B N   1 
ATOM   4541 C CA  . ARG B 1 172 ? 2.462   63.005 34.747  1.00 44.67  ? 172 ARG B CA  1 
ATOM   4542 C C   . ARG B 1 172 ? 2.316   64.239 33.832  1.00 51.76  ? 172 ARG B C   1 
ATOM   4543 O O   . ARG B 1 172 ? 1.210   64.740 33.653  1.00 51.44  ? 172 ARG B O   1 
ATOM   4544 C CB  . ARG B 1 172 ? 3.184   63.363 36.057  1.00 45.33  ? 172 ARG B CB  1 
ATOM   4545 C CG  . ARG B 1 172 ? 2.288   63.996 37.116  1.00 56.14  ? 172 ARG B CG  1 
ATOM   4546 C CD  . ARG B 1 172 ? 2.927   63.990 38.499  1.00 71.18  ? 172 ARG B CD  1 
ATOM   4547 N NE  . ARG B 1 172 ? 2.983   62.650 39.096  1.00 79.24  ? 172 ARG B NE  1 
ATOM   4548 C CZ  . ARG B 1 172 ? 4.101   62.053 39.507  1.00 86.44  ? 172 ARG B CZ  1 
ATOM   4549 N NH1 . ARG B 1 172 ? 5.271   62.674 39.404  1.00 75.51  ? 172 ARG B NH1 1 
ATOM   4550 N NH2 . ARG B 1 172 ? 4.055   60.840 40.039  1.00 59.37  ? 172 ARG B NH2 1 
ATOM   4551 N N   . ASP B 1 173 ? 3.432   64.674 33.217  1.00 51.45  ? 173 ASP B N   1 
ATOM   4552 C CA  . ASP B 1 173 ? 3.516   65.809 32.304  1.00 53.19  ? 173 ASP B CA  1 
ATOM   4553 C C   . ASP B 1 173 ? 2.619   65.594 31.083  1.00 56.91  ? 173 ASP B C   1 
ATOM   4554 O O   . ASP B 1 173 ? 1.896   66.512 30.692  1.00 58.71  ? 173 ASP B O   1 
ATOM   4555 C CB  . ASP B 1 173 ? 4.985   66.063 31.899  1.00 56.19  ? 173 ASP B CB  1 
ATOM   4556 C CG  . ASP B 1 173 ? 5.201   67.299 31.036  1.00 80.50  ? 173 ASP B CG  1 
ATOM   4557 O OD1 . ASP B 1 173 ? 5.528   68.374 31.604  1.00 84.87  ? 173 ASP B OD1 1 
ATOM   4558 O OD2 . ASP B 1 173 ? 5.047   67.194 29.788  1.00 88.36  ? 173 ASP B OD2 1 
ATOM   4559 N N   . ILE B 1 174 ? 2.643   64.384 30.504  1.00 51.26  ? 174 ILE B N   1 
ATOM   4560 C CA  . ILE B 1 174 ? 1.817   64.034 29.347  1.00 50.82  ? 174 ILE B CA  1 
ATOM   4561 C C   . ILE B 1 174 ? 0.317   64.119 29.708  1.00 54.71  ? 174 ILE B C   1 
ATOM   4562 O O   . ILE B 1 174 ? -0.412  64.888 29.075  1.00 55.46  ? 174 ILE B O   1 
ATOM   4563 C CB  . ILE B 1 174 ? 2.226   62.655 28.753  1.00 52.45  ? 174 ILE B CB  1 
ATOM   4564 C CG1 . ILE B 1 174 ? 3.581   62.760 28.024  1.00 52.80  ? 174 ILE B CG1 1 
ATOM   4565 C CG2 . ILE B 1 174 ? 1.136   62.085 27.820  1.00 52.39  ? 174 ILE B CG2 1 
ATOM   4566 C CD1 . ILE B 1 174 ? 4.398   61.441 27.990  1.00 61.02  ? 174 ILE B CD1 1 
ATOM   4567 N N   . LEU B 1 175 ? -0.108  63.379 30.762  1.00 49.03  ? 175 LEU B N   1 
ATOM   4568 C CA  . LEU B 1 175 ? -1.488  63.306 31.253  1.00 48.25  ? 175 LEU B CA  1 
ATOM   4569 C C   . LEU B 1 175 ? -2.119  64.643 31.601  1.00 54.75  ? 175 LEU B C   1 
ATOM   4570 O O   . LEU B 1 175 ? -3.345  64.753 31.547  1.00 55.43  ? 175 LEU B O   1 
ATOM   4571 C CB  . LEU B 1 175 ? -1.604  62.340 32.448  1.00 47.09  ? 175 LEU B CB  1 
ATOM   4572 C CG  . LEU B 1 175 ? -1.543  60.833 32.139  1.00 49.55  ? 175 LEU B CG  1 
ATOM   4573 C CD1 . LEU B 1 175 ? -1.316  60.039 33.393  1.00 48.60  ? 175 LEU B CD1 1 
ATOM   4574 C CD2 . LEU B 1 175 ? -2.798  60.345 31.419  1.00 51.32  ? 175 LEU B CD2 1 
ATOM   4575 N N   . SER B 1 176 ? -1.296  65.664 31.930  1.00 52.19  ? 176 SER B N   1 
ATOM   4576 C CA  . SER B 1 176 ? -1.755  67.005 32.303  1.00 53.30  ? 176 SER B CA  1 
ATOM   4577 C C   . SER B 1 176 ? -2.543  67.732 31.194  1.00 56.58  ? 176 SER B C   1 
ATOM   4578 O O   . SER B 1 176 ? -3.242  68.711 31.492  1.00 57.91  ? 176 SER B O   1 
ATOM   4579 C CB  . SER B 1 176 ? -0.596  67.854 32.824  1.00 58.23  ? 176 SER B CB  1 
ATOM   4580 O OG  . SER B 1 176 ? 0.054   68.605 31.810  1.00 70.74  ? 176 SER B OG  1 
ATOM   4581 N N   . ARG B 1 177 ? -2.457  67.243 29.925  1.00 50.57  ? 177 ARG B N   1 
ATOM   4582 C CA  . ARG B 1 177 ? -3.183  67.853 28.807  1.00 50.69  ? 177 ARG B CA  1 
ATOM   4583 C C   . ARG B 1 177 ? -4.713  67.715 28.902  1.00 55.30  ? 177 ARG B C   1 
ATOM   4584 O O   . ARG B 1 177 ? -5.441  68.460 28.241  1.00 56.57  ? 177 ARG B O   1 
ATOM   4585 C CB  . ARG B 1 177 ? -2.587  67.487 27.438  1.00 49.00  ? 177 ARG B CB  1 
ATOM   4586 C CG  . ARG B 1 177 ? -3.049  66.182 26.843  1.00 59.31  ? 177 ARG B CG  1 
ATOM   4587 C CD  . ARG B 1 177 ? -2.445  65.929 25.477  1.00 78.38  ? 177 ARG B CD  1 
ATOM   4588 N NE  . ARG B 1 177 ? -1.044  65.507 25.538  1.00 89.76  ? 177 ARG B NE  1 
ATOM   4589 C CZ  . ARG B 1 177 ? -0.383  64.976 24.514  1.00 103.40 ? 177 ARG B CZ  1 
ATOM   4590 N NH1 . ARG B 1 177 ? -0.992  64.785 23.348  1.00 90.53  ? 177 ARG B NH1 1 
ATOM   4591 N NH2 . ARG B 1 177 ? 0.889   64.621 24.650  1.00 87.92  ? 177 ARG B NH2 1 
ATOM   4592 N N   . TRP B 1 178 ? -5.176  66.793 29.775  1.00 50.36  ? 178 TRP B N   1 
ATOM   4593 C CA  . TRP B 1 178 ? -6.567  66.525 30.122  1.00 50.21  ? 178 TRP B CA  1 
ATOM   4594 C C   . TRP B 1 178 ? -6.731  66.744 31.644  1.00 54.31  ? 178 TRP B C   1 
ATOM   4595 O O   . TRP B 1 178 ? -5.737  66.917 32.363  1.00 53.54  ? 178 TRP B O   1 
ATOM   4596 C CB  . TRP B 1 178 ? -6.946  65.064 29.799  1.00 47.81  ? 178 TRP B CB  1 
ATOM   4597 C CG  . TRP B 1 178 ? -6.726  64.627 28.384  1.00 48.42  ? 178 TRP B CG  1 
ATOM   4598 C CD1 . TRP B 1 178 ? -7.588  64.768 27.338  1.00 51.97  ? 178 TRP B CD1 1 
ATOM   4599 C CD2 . TRP B 1 178 ? -5.611  63.875 27.887  1.00 47.17  ? 178 TRP B CD2 1 
ATOM   4600 N NE1 . TRP B 1 178 ? -7.055  64.198 26.204  1.00 50.92  ? 178 TRP B NE1 1 
ATOM   4601 C CE2 . TRP B 1 178 ? -5.843  63.639 26.513  1.00 51.03  ? 178 TRP B CE2 1 
ATOM   4602 C CE3 . TRP B 1 178 ? -4.417  63.405 28.463  1.00 47.55  ? 178 TRP B CE3 1 
ATOM   4603 C CZ2 . TRP B 1 178 ? -4.927  62.964 25.706  1.00 49.43  ? 178 TRP B CZ2 1 
ATOM   4604 C CZ3 . TRP B 1 178 ? -3.506  62.745 27.660  1.00 48.18  ? 178 TRP B CZ3 1 
ATOM   4605 C CH2 . TRP B 1 178 ? -3.764  62.530 26.298  1.00 48.81  ? 178 TRP B CH2 1 
ATOM   4606 N N   . LYS B 1 179 ? -7.990  66.705 32.127  1.00 51.06  ? 179 LYS B N   1 
ATOM   4607 C CA  . LYS B 1 179 ? -8.361  66.816 33.542  1.00 51.36  ? 179 LYS B CA  1 
ATOM   4608 C C   . LYS B 1 179 ? -8.919  65.451 33.972  1.00 55.53  ? 179 LYS B C   1 
ATOM   4609 O O   . LYS B 1 179 ? -9.567  64.808 33.146  1.00 55.00  ? 179 LYS B O   1 
ATOM   4610 C CB  . LYS B 1 179 ? -9.448  67.902 33.755  1.00 55.29  ? 179 LYS B CB  1 
ATOM   4611 C CG  . LYS B 1 179 ? -9.066  69.326 33.327  1.00 68.02  ? 179 LYS B CG  1 
ATOM   4612 C CD  . LYS B 1 179 ? -8.219  70.062 34.366  1.00 80.16  ? 179 LYS B CD  1 
ATOM   4613 C CE  . LYS B 1 179 ? -7.725  71.387 33.831  1.00 96.76  ? 179 LYS B CE  1 
ATOM   4614 N NZ  . LYS B 1 179 ? -6.527  71.875 34.565  1.00 107.04 ? 179 LYS B NZ  1 
ATOM   4615 N N   . PRO B 1 180 ? -8.739  64.982 35.236  1.00 52.64  ? 180 PRO B N   1 
ATOM   4616 C CA  . PRO B 1 180 ? -9.316  63.673 35.627  1.00 51.81  ? 180 PRO B CA  1 
ATOM   4617 C C   . PRO B 1 180 ? -10.804 63.481 35.272  1.00 57.38  ? 180 PRO B C   1 
ATOM   4618 O O   . PRO B 1 180 ? -11.211 62.372 34.907  1.00 56.19  ? 180 PRO B O   1 
ATOM   4619 C CB  . PRO B 1 180 ? -9.074  63.618 37.139  1.00 53.63  ? 180 PRO B CB  1 
ATOM   4620 C CG  . PRO B 1 180 ? -7.884  64.469 37.352  1.00 58.27  ? 180 PRO B CG  1 
ATOM   4621 C CD  . PRO B 1 180 ? -7.995  65.592 36.357  1.00 54.53  ? 180 PRO B CD  1 
ATOM   4622 N N   . GLU B 1 181 ? -11.600 64.570 35.335  1.00 56.21  ? 181 GLU B N   1 
ATOM   4623 C CA  . GLU B 1 181 ? -13.030 64.586 34.996  1.00 57.48  ? 181 GLU B CA  1 
ATOM   4624 C C   . GLU B 1 181 ? -13.314 64.250 33.515  1.00 60.83  ? 181 GLU B C   1 
ATOM   4625 O O   . GLU B 1 181 ? -14.395 63.737 33.207  1.00 60.12  ? 181 GLU B O   1 
ATOM   4626 C CB  . GLU B 1 181 ? -13.694 65.926 35.397  1.00 61.08  ? 181 GLU B CB  1 
ATOM   4627 C CG  . GLU B 1 181 ? -13.009 67.178 34.861  1.00 76.76  ? 181 GLU B CG  1 
ATOM   4628 C CD  . GLU B 1 181 ? -13.892 68.408 34.740  1.00 110.31 ? 181 GLU B CD  1 
ATOM   4629 O OE1 . GLU B 1 181 ? -14.254 68.767 33.595  1.00 111.42 ? 181 GLU B OE1 1 
ATOM   4630 O OE2 . GLU B 1 181 ? -14.209 69.025 35.784  1.00 106.68 ? 181 GLU B OE2 1 
ATOM   4631 N N   . ASP B 1 182 ? -12.342 64.529 32.612  1.00 56.64  ? 182 ASP B N   1 
ATOM   4632 C CA  . ASP B 1 182 ? -12.454 64.277 31.172  1.00 55.95  ? 182 ASP B CA  1 
ATOM   4633 C C   . ASP B 1 182 ? -12.664 62.807 30.794  1.00 60.50  ? 182 ASP B C   1 
ATOM   4634 O O   . ASP B 1 182 ? -13.290 62.557 29.764  1.00 61.72  ? 182 ASP B O   1 
ATOM   4635 C CB  . ASP B 1 182 ? -11.260 64.853 30.401  1.00 57.09  ? 182 ASP B CB  1 
ATOM   4636 C CG  . ASP B 1 182 ? -11.095 66.355 30.479  1.00 67.61  ? 182 ASP B CG  1 
ATOM   4637 O OD1 . ASP B 1 182 ? -11.933 67.014 31.134  1.00 71.32  ? 182 ASP B OD1 1 
ATOM   4638 O OD2 . ASP B 1 182 ? -10.131 66.877 29.875  1.00 69.30  ? 182 ASP B OD2 1 
ATOM   4639 N N   . ALA B 1 183 ? -12.153 61.840 31.608  1.00 54.95  ? 183 ALA B N   1 
ATOM   4640 C CA  . ALA B 1 183 ? -12.304 60.398 31.355  1.00 52.91  ? 183 ALA B CA  1 
ATOM   4641 C C   . ALA B 1 183 ? -13.777 59.999 31.251  1.00 57.53  ? 183 ALA B C   1 
ATOM   4642 O O   . ALA B 1 183 ? -14.131 59.153 30.430  1.00 55.32  ? 183 ALA B O   1 
ATOM   4643 C CB  . ALA B 1 183 ? -11.613 59.595 32.443  1.00 52.51  ? 183 ALA B CB  1 
ATOM   4644 N N   . LYS B 1 184 ? -14.629 60.668 32.044  1.00 57.66  ? 184 LYS B N   1 
ATOM   4645 C CA  . LYS B 1 184 ? -16.083 60.493 32.094  1.00 59.40  ? 184 LYS B CA  1 
ATOM   4646 C C   . LYS B 1 184 ? -16.789 61.099 30.853  1.00 66.13  ? 184 LYS B C   1 
ATOM   4647 O O   . LYS B 1 184 ? -17.919 60.699 30.544  1.00 66.67  ? 184 LYS B O   1 
ATOM   4648 C CB  . LYS B 1 184 ? -16.649 61.108 33.388  1.00 63.02  ? 184 LYS B CB  1 
ATOM   4649 C CG  . LYS B 1 184 ? -16.038 60.543 34.670  1.00 73.07  ? 184 LYS B CG  1 
ATOM   4650 C CD  . LYS B 1 184 ? -16.460 61.347 35.899  1.00 82.53  ? 184 LYS B CD  1 
ATOM   4651 C CE  . LYS B 1 184 ? -15.692 60.964 37.144  1.00 95.19  ? 184 LYS B CE  1 
ATOM   4652 N NZ  . LYS B 1 184 ? -14.327 61.565 37.174  1.00 110.10 ? 184 LYS B NZ  1 
ATOM   4653 N N   . ASN B 1 185 ? -16.130 62.065 30.157  1.00 63.10  ? 185 ASN B N   1 
ATOM   4654 C CA  . ASN B 1 185 ? -16.652 62.714 28.948  1.00 63.70  ? 185 ASN B CA  1 
ATOM   4655 C C   . ASN B 1 185 ? -16.094 62.017 27.688  1.00 66.95  ? 185 ASN B C   1 
ATOM   4656 O O   . ASN B 1 185 ? -14.897 62.149 27.391  1.00 65.48  ? 185 ASN B O   1 
ATOM   4657 C CB  . ASN B 1 185 ? -16.348 64.220 28.947  1.00 65.35  ? 185 ASN B CB  1 
ATOM   4658 C CG  . ASN B 1 185 ? -16.934 65.014 27.797  1.00 87.02  ? 185 ASN B CG  1 
ATOM   4659 O OD1 . ASN B 1 185 ? -17.646 64.503 26.924  1.00 80.40  ? 185 ASN B OD1 1 
ATOM   4660 N ND2 . ASN B 1 185 ? -16.651 66.305 27.780  1.00 80.19  ? 185 ASN B ND2 1 
ATOM   4661 N N   . PRO B 1 186 ? -16.956 61.279 26.935  1.00 63.70  ? 186 PRO B N   1 
ATOM   4662 C CA  . PRO B 1 186 ? -16.463 60.540 25.752  1.00 62.55  ? 186 PRO B CA  1 
ATOM   4663 C C   . PRO B 1 186 ? -15.717 61.353 24.688  1.00 66.97  ? 186 PRO B C   1 
ATOM   4664 O O   . PRO B 1 186 ? -14.660 60.900 24.208  1.00 66.19  ? 186 PRO B O   1 
ATOM   4665 C CB  . PRO B 1 186 ? -17.716 59.852 25.202  1.00 64.17  ? 186 PRO B CB  1 
ATOM   4666 C CG  . PRO B 1 186 ? -18.868 60.530 25.862  1.00 69.76  ? 186 PRO B CG  1 
ATOM   4667 C CD  . PRO B 1 186 ? -18.387 61.002 27.179  1.00 65.37  ? 186 PRO B CD  1 
ATOM   4668 N N   . GLN B 1 187 ? -16.229 62.558 24.356  1.00 63.53  ? 187 GLN B N   1 
ATOM   4669 C CA  . GLN B 1 187 ? -15.616 63.424 23.345  1.00 63.81  ? 187 GLN B CA  1 
ATOM   4670 C C   . GLN B 1 187 ? -14.283 64.105 23.714  1.00 68.51  ? 187 GLN B C   1 
ATOM   4671 O O   . GLN B 1 187 ? -13.689 64.755 22.849  1.00 69.13  ? 187 GLN B O   1 
ATOM   4672 C CB  . GLN B 1 187 ? -16.622 64.406 22.723  1.00 66.70  ? 187 GLN B CB  1 
ATOM   4673 C CG  . GLN B 1 187 ? -17.288 65.344 23.709  1.00 78.55  ? 187 GLN B CG  1 
ATOM   4674 C CD  . GLN B 1 187 ? -18.775 65.140 23.716  1.00 89.45  ? 187 GLN B CD  1 
ATOM   4675 O OE1 . GLN B 1 187 ? -19.296 64.196 24.323  1.00 87.00  ? 187 GLN B OE1 1 
ATOM   4676 N NE2 . GLN B 1 187 ? -19.482 66.019 23.028  1.00 73.91  ? 187 GLN B NE2 1 
ATOM   4677 N N   . LYS B 1 188 ? -13.796 63.947 24.962  1.00 63.99  ? 188 LYS B N   1 
ATOM   4678 C CA  . LYS B 1 188 ? -12.520 64.549 25.367  1.00 63.34  ? 188 LYS B CA  1 
ATOM   4679 C C   . LYS B 1 188 ? -11.298 63.747 24.854  1.00 65.35  ? 188 LYS B C   1 
ATOM   4680 O O   . LYS B 1 188 ? -10.196 64.316 24.731  1.00 65.38  ? 188 LYS B O   1 
ATOM   4681 C CB  . LYS B 1 188 ? -12.460 64.787 26.883  1.00 65.98  ? 188 LYS B CB  1 
ATOM   4682 C CG  . LYS B 1 188 ? -13.267 65.996 27.360  1.00 84.39  ? 188 LYS B CG  1 
ATOM   4683 C CD  . LYS B 1 188 ? -12.503 67.320 27.264  1.00 94.30  ? 188 LYS B CD  1 
ATOM   4684 C CE  . LYS B 1 188 ? -13.277 68.452 27.895  1.00 106.88 ? 188 LYS B CE  1 
ATOM   4685 N NZ  . LYS B 1 188 ? -12.467 69.696 27.986  1.00 118.24 ? 188 LYS B NZ  1 
ATOM   4686 N N   . ASN B 1 189 ? -11.512 62.433 24.545  1.00 58.00  ? 189 ASN B N   1 
ATOM   4687 C CA  . ASN B 1 189 ? -10.536 61.486 23.995  1.00 55.19  ? 189 ASN B CA  1 
ATOM   4688 C C   . ASN B 1 189 ? -9.271  61.209 24.849  1.00 53.25  ? 189 ASN B C   1 
ATOM   4689 O O   . ASN B 1 189 ? -8.144  61.256 24.345  1.00 51.81  ? 189 ASN B O   1 
ATOM   4690 C CB  . ASN B 1 189 ? -10.230 61.800 22.512  1.00 59.12  ? 189 ASN B CB  1 
ATOM   4691 C CG  . ASN B 1 189 ? -9.911  60.588 21.650  1.00 89.72  ? 189 ASN B CG  1 
ATOM   4692 O OD1 . ASN B 1 189 ? -8.853  60.526 21.016  1.00 87.78  ? 189 ASN B OD1 1 
ATOM   4693 N ND2 . ASN B 1 189 ? -10.826 59.617 21.566  1.00 79.24  ? 189 ASN B ND2 1 
ATOM   4694 N N   . THR B 1 190 ? -9.479  60.876 26.139  1.00 46.69  ? 190 THR B N   1 
ATOM   4695 C CA  . THR B 1 190 ? -8.416  60.540 27.105  1.00 44.19  ? 190 THR B CA  1 
ATOM   4696 C C   . THR B 1 190 ? -7.805  59.164 26.773  1.00 43.76  ? 190 THR B C   1 
ATOM   4697 O O   . THR B 1 190 ? -8.486  58.349 26.138  1.00 42.20  ? 190 THR B O   1 
ATOM   4698 C CB  . THR B 1 190 ? -8.958  60.557 28.547  1.00 51.63  ? 190 THR B CB  1 
ATOM   4699 O OG1 . THR B 1 190 ? -10.108 59.716 28.637  1.00 55.16  ? 190 THR B OG1 1 
ATOM   4700 C CG2 . THR B 1 190 ? -9.263  61.961 29.056  1.00 48.36  ? 190 THR B CG2 1 
ATOM   4701 N N   . PRO B 1 191 ? -6.544  58.857 27.194  1.00 38.15  ? 191 PRO B N   1 
ATOM   4702 C CA  . PRO B 1 191 ? -5.950  57.560 26.826  1.00 36.08  ? 191 PRO B CA  1 
ATOM   4703 C C   . PRO B 1 191 ? -6.721  56.318 27.283  1.00 39.66  ? 191 PRO B C   1 
ATOM   4704 O O   . PRO B 1 191 ? -7.228  56.261 28.403  1.00 40.11  ? 191 PRO B O   1 
ATOM   4705 C CB  . PRO B 1 191 ? -4.532  57.644 27.407  1.00 36.86  ? 191 PRO B CB  1 
ATOM   4706 C CG  . PRO B 1 191 ? -4.248  59.078 27.495  1.00 42.08  ? 191 PRO B CG  1 
ATOM   4707 C CD  . PRO B 1 191 ? -5.559  59.688 27.916  1.00 39.05  ? 191 PRO B CD  1 
ATOM   4708 N N   . LYS B 1 192 ? -6.842  55.338 26.383  1.00 35.28  ? 192 LYS B N   1 
ATOM   4709 C CA  . LYS B 1 192 ? -7.539  54.083 26.652  1.00 34.48  ? 192 LYS B CA  1 
ATOM   4710 C C   . LYS B 1 192 ? -6.700  53.153 27.554  1.00 36.99  ? 192 LYS B C   1 
ATOM   4711 O O   . LYS B 1 192 ? -7.231  52.538 28.488  1.00 36.96  ? 192 LYS B O   1 
ATOM   4712 C CB  . LYS B 1 192 ? -7.940  53.382 25.340  1.00 35.86  ? 192 LYS B CB  1 
ATOM   4713 C CG  . LYS B 1 192 ? -8.981  54.135 24.507  1.00 40.38  ? 192 LYS B CG  1 
ATOM   4714 C CD  . LYS B 1 192 ? -10.401 53.862 24.972  1.00 48.09  ? 192 LYS B CD  1 
ATOM   4715 C CE  . LYS B 1 192 ? -11.429 54.066 23.884  1.00 59.86  ? 192 LYS B CE  1 
ATOM   4716 N NZ  . LYS B 1 192 ? -11.487 52.923 22.928  1.00 68.63  ? 192 LYS B NZ  1 
ATOM   4717 N N   . PHE B 1 193 ? -5.391  53.081 27.297  1.00 31.42  ? 193 PHE B N   1 
ATOM   4718 C CA  . PHE B 1 193 ? -4.486  52.239 28.073  1.00 29.48  ? 193 PHE B CA  1 
ATOM   4719 C C   . PHE B 1 193 ? -3.051  52.710 27.990  1.00 32.47  ? 193 PHE B C   1 
ATOM   4720 O O   . PHE B 1 193 ? -2.707  53.546 27.147  1.00 30.83  ? 193 PHE B O   1 
ATOM   4721 C CB  . PHE B 1 193 ? -4.564  50.769 27.593  1.00 30.22  ? 193 PHE B CB  1 
ATOM   4722 C CG  . PHE B 1 193 ? -4.047  50.471 26.191  1.00 31.50  ? 193 PHE B CG  1 
ATOM   4723 C CD1 . PHE B 1 193 ? -4.931  50.258 25.134  1.00 33.96  ? 193 PHE B CD1 1 
ATOM   4724 C CD2 . PHE B 1 193 ? -2.679  50.352 25.941  1.00 32.85  ? 193 PHE B CD2 1 
ATOM   4725 C CE1 . PHE B 1 193 ? -4.455  49.943 23.852  1.00 34.17  ? 193 PHE B CE1 1 
ATOM   4726 C CE2 . PHE B 1 193 ? -2.208  50.042 24.657  1.00 35.04  ? 193 PHE B CE2 1 
ATOM   4727 C CZ  . PHE B 1 193 ? -3.099  49.835 23.624  1.00 33.04  ? 193 PHE B CZ  1 
ATOM   4728 N N   . LEU B 1 194 ? -2.206  52.098 28.836  1.00 29.73  ? 194 LEU B N   1 
ATOM   4729 C CA  . LEU B 1 194 ? -0.755  52.246 28.873  1.00 29.00  ? 194 LEU B CA  1 
ATOM   4730 C C   . LEU B 1 194 ? -0.225  50.836 28.687  1.00 32.50  ? 194 LEU B C   1 
ATOM   4731 O O   . LEU B 1 194 ? -0.639  49.927 29.418  1.00 31.72  ? 194 LEU B O   1 
ATOM   4732 C CB  . LEU B 1 194 ? -0.240  52.869 30.184  1.00 28.91  ? 194 LEU B CB  1 
ATOM   4733 C CG  . LEU B 1 194 ? 1.290   52.887 30.334  1.00 33.15  ? 194 LEU B CG  1 
ATOM   4734 C CD1 . LEU B 1 194 ? 1.821   54.287 30.520  1.00 33.56  ? 194 LEU B CD1 1 
ATOM   4735 C CD2 . LEU B 1 194 ? 1.739   52.011 31.474  1.00 35.35  ? 194 LEU B CD2 1 
ATOM   4736 N N   . TYR B 1 195 ? 0.632   50.646 27.672  1.00 28.68  ? 195 TYR B N   1 
ATOM   4737 C CA  . TYR B 1 195 ? 1.248   49.356 27.370  1.00 27.54  ? 195 TYR B CA  1 
ATOM   4738 C C   . TYR B 1 195 ? 2.694   49.384 27.863  1.00 32.98  ? 195 TYR B C   1 
ATOM   4739 O O   . TYR B 1 195 ? 3.418   50.331 27.565  1.00 33.82  ? 195 TYR B O   1 
ATOM   4740 C CB  . TYR B 1 195 ? 1.189   49.045 25.858  1.00 27.50  ? 195 TYR B CB  1 
ATOM   4741 C CG  . TYR B 1 195 ? 2.075   47.888 25.447  1.00 27.59  ? 195 TYR B CG  1 
ATOM   4742 C CD1 . TYR B 1 195 ? 1.617   46.572 25.521  1.00 28.92  ? 195 TYR B CD1 1 
ATOM   4743 C CD2 . TYR B 1 195 ? 3.385   48.101 25.019  1.00 28.12  ? 195 TYR B CD2 1 
ATOM   4744 C CE1 . TYR B 1 195 ? 2.438   45.499 25.182  1.00 29.37  ? 195 TYR B CE1 1 
ATOM   4745 C CE2 . TYR B 1 195 ? 4.222   47.035 24.695  1.00 28.76  ? 195 TYR B CE2 1 
ATOM   4746 C CZ  . TYR B 1 195 ? 3.745   45.733 24.784  1.00 38.54  ? 195 TYR B CZ  1 
ATOM   4747 O OH  . TYR B 1 195 ? 4.551   44.675 24.433  1.00 37.66  ? 195 TYR B OH  1 
ATOM   4748 N N   . THR B 1 196 ? 3.123   48.332 28.583  1.00 29.55  ? 196 THR B N   1 
ATOM   4749 C CA  . THR B 1 196 ? 4.488   48.227 29.093  1.00 29.87  ? 196 THR B CA  1 
ATOM   4750 C C   . THR B 1 196 ? 4.967   46.803 29.301  1.00 35.55  ? 196 THR B C   1 
ATOM   4751 O O   . THR B 1 196 ? 4.185   45.938 29.708  1.00 37.39  ? 196 THR B O   1 
ATOM   4752 C CB  . THR B 1 196 ? 4.708   49.115 30.340  1.00 39.30  ? 196 THR B CB  1 
ATOM   4753 O OG1 . THR B 1 196 ? 6.099   49.161 30.658  1.00 37.55  ? 196 THR B OG1 1 
ATOM   4754 C CG2 . THR B 1 196 ? 3.885   48.687 31.556  1.00 36.79  ? 196 THR B CG2 1 
ATOM   4755 N N   . VAL B 1 197 ? 6.265   46.570 29.028  1.00 30.55  ? 197 VAL B N   1 
ATOM   4756 C CA  . VAL B 1 197 ? 6.969   45.309 29.264  1.00 28.72  ? 197 VAL B CA  1 
ATOM   4757 C C   . VAL B 1 197 ? 7.746   45.628 30.533  1.00 31.33  ? 197 VAL B C   1 
ATOM   4758 O O   . VAL B 1 197 ? 8.739   46.336 30.450  1.00 31.25  ? 197 VAL B O   1 
ATOM   4759 C CB  . VAL B 1 197 ? 7.879   44.859 28.081  1.00 31.22  ? 197 VAL B CB  1 
ATOM   4760 C CG1 . VAL B 1 197 ? 8.653   43.589 28.435  1.00 30.70  ? 197 VAL B CG1 1 
ATOM   4761 C CG2 . VAL B 1 197 ? 7.066   44.644 26.809  1.00 30.33  ? 197 VAL B CG2 1 
ATOM   4762 N N   . PRO B 1 198 ? 7.251   45.247 31.724  1.00 28.73  ? 198 PRO B N   1 
ATOM   4763 C CA  . PRO B 1 198 ? 7.904   45.700 32.972  1.00 29.40  ? 198 PRO B CA  1 
ATOM   4764 C C   . PRO B 1 198 ? 9.293   45.164 33.299  1.00 30.90  ? 198 PRO B C   1 
ATOM   4765 O O   . PRO B 1 198 ? 10.049  45.845 33.974  1.00 29.20  ? 198 PRO B O   1 
ATOM   4766 C CB  . PRO B 1 198 ? 6.874   45.371 34.065  1.00 31.35  ? 198 PRO B CB  1 
ATOM   4767 C CG  . PRO B 1 198 ? 5.602   45.040 33.323  1.00 35.39  ? 198 PRO B CG  1 
ATOM   4768 C CD  . PRO B 1 198 ? 6.044   44.457 32.024  1.00 30.08  ? 198 PRO B CD  1 
ATOM   4769 N N   . ASN B 1 199 ? 9.608   43.961 32.833  1.00 28.25  ? 199 ASN B N   1 
ATOM   4770 C CA  . ASN B 1 199 ? 10.877  43.297 33.085  1.00 28.81  ? 199 ASN B CA  1 
ATOM   4771 C C   . ASN B 1 199 ? 11.621  43.041 31.788  1.00 34.22  ? 199 ASN B C   1 
ATOM   4772 O O   . ASN B 1 199 ? 11.110  42.340 30.894  1.00 31.81  ? 199 ASN B O   1 
ATOM   4773 C CB  . ASN B 1 199 ? 10.659  41.976 33.833  1.00 28.46  ? 199 ASN B CB  1 
ATOM   4774 C CG  . ASN B 1 199 ? 10.042  42.140 35.202  1.00 41.44  ? 199 ASN B CG  1 
ATOM   4775 O OD1 . ASN B 1 199 ? 10.694  42.578 36.160  1.00 31.44  ? 199 ASN B OD1 1 
ATOM   4776 N ND2 . ASN B 1 199 ? 8.777   41.759 35.328  1.00 28.43  ? 199 ASN B ND2 1 
ATOM   4777 N N   . GLY B 1 200 ? 12.830  43.606 31.715  1.00 32.67  ? 200 GLY B N   1 
ATOM   4778 C CA  . GLY B 1 200 ? 13.733  43.471 30.579  1.00 32.82  ? 200 GLY B CA  1 
ATOM   4779 C C   . GLY B 1 200 ? 13.082  43.789 29.250  1.00 36.64  ? 200 GLY B C   1 
ATOM   4780 O O   . GLY B 1 200 ? 13.005  42.924 28.379  1.00 37.09  ? 200 GLY B O   1 
ATOM   4781 N N   . ASN B 1 201 ? 12.581  45.022 29.112  1.00 32.39  ? 201 ASN B N   1 
ATOM   4782 C CA  . ASN B 1 201 ? 11.922  45.527 27.921  1.00 32.01  ? 201 ASN B CA  1 
ATOM   4783 C C   . ASN B 1 201 ? 12.665  45.181 26.622  1.00 37.44  ? 201 ASN B C   1 
ATOM   4784 O O   . ASN B 1 201 ? 13.889  45.320 26.544  1.00 38.71  ? 201 ASN B O   1 
ATOM   4785 C CB  . ASN B 1 201 ? 11.748  47.040 28.034  1.00 32.91  ? 201 ASN B CB  1 
ATOM   4786 C CG  . ASN B 1 201 ? 11.219  47.696 26.780  1.00 55.18  ? 201 ASN B CG  1 
ATOM   4787 O OD1 . ASN B 1 201 ? 10.066  47.495 26.389  1.00 51.43  ? 201 ASN B OD1 1 
ATOM   4788 N ND2 . ASN B 1 201 ? 12.067  48.457 26.097  1.00 45.30  ? 201 ASN B ND2 1 
ATOM   4789 N N   . ASN B 1 202 ? 11.917  44.720 25.608  1.00 31.70  ? 202 ASN B N   1 
ATOM   4790 C CA  . ASN B 1 202 ? 12.458  44.453 24.291  1.00 30.42  ? 202 ASN B CA  1 
ATOM   4791 C C   . ASN B 1 202 ? 12.390  45.818 23.560  1.00 36.33  ? 202 ASN B C   1 
ATOM   4792 O O   . ASN B 1 202 ? 11.291  46.382 23.463  1.00 36.69  ? 202 ASN B O   1 
ATOM   4793 C CB  . ASN B 1 202 ? 11.608  43.402 23.594  1.00 24.82  ? 202 ASN B CB  1 
ATOM   4794 C CG  . ASN B 1 202 ? 12.174  42.866 22.308  1.00 48.88  ? 202 ASN B CG  1 
ATOM   4795 O OD1 . ASN B 1 202 ? 13.059  43.452 21.660  1.00 48.31  ? 202 ASN B OD1 1 
ATOM   4796 N ND2 . ASN B 1 202 ? 11.659  41.721 21.906  1.00 39.63  ? 202 ASN B ND2 1 
ATOM   4797 N N   . PRO B 1 203 ? 13.510  46.460 23.163  1.00 33.41  ? 203 PRO B N   1 
ATOM   4798 C CA  . PRO B 1 203 ? 14.904  45.974 23.096  1.00 34.00  ? 203 PRO B CA  1 
ATOM   4799 C C   . PRO B 1 203 ? 15.913  46.384 24.189  1.00 38.64  ? 203 PRO B C   1 
ATOM   4800 O O   . PRO B 1 203 ? 17.069  45.931 24.139  1.00 39.52  ? 203 PRO B O   1 
ATOM   4801 C CB  . PRO B 1 203 ? 15.362  46.573 21.761  1.00 36.18  ? 203 PRO B CB  1 
ATOM   4802 C CG  . PRO B 1 203 ? 14.704  47.944 21.762  1.00 41.01  ? 203 PRO B CG  1 
ATOM   4803 C CD  . PRO B 1 203 ? 13.369  47.753 22.455  1.00 35.59  ? 203 PRO B CD  1 
ATOM   4804 N N   . THR B 1 204 ? 15.525  47.280 25.119  1.00 33.60  ? 204 THR B N   1 
ATOM   4805 C CA  . THR B 1 204 ? 16.422  47.870 26.144  1.00 32.16  ? 204 THR B CA  1 
ATOM   4806 C C   . THR B 1 204 ? 17.040  46.935 27.202  1.00 32.90  ? 204 THR B C   1 
ATOM   4807 O O   . THR B 1 204 ? 18.180  47.137 27.611  1.00 32.53  ? 204 THR B O   1 
ATOM   4808 C CB  . THR B 1 204 ? 15.754  49.082 26.803  1.00 28.22  ? 204 THR B CB  1 
ATOM   4809 O OG1 . THR B 1 204 ? 14.696  48.619 27.649  1.00 30.64  ? 204 THR B OG1 1 
ATOM   4810 C CG2 . THR B 1 204 ? 15.226  50.070 25.793  1.00 14.99  ? 204 THR B CG2 1 
ATOM   4811 N N   . GLY B 1 205 ? 16.254  45.984 27.679  1.00 27.92  ? 205 GLY B N   1 
ATOM   4812 C CA  . GLY B 1 205 ? 16.652  45.085 28.753  1.00 27.51  ? 205 GLY B CA  1 
ATOM   4813 C C   . GLY B 1 205 ? 16.474  45.755 30.108  1.00 31.55  ? 205 GLY B C   1 
ATOM   4814 O O   . GLY B 1 205 ? 16.861  45.187 31.130  1.00 30.15  ? 205 GLY B O   1 
ATOM   4815 N N   . ASN B 1 206 ? 15.856  46.971 30.130  1.00 28.72  ? 206 ASN B N   1 
ATOM   4816 C CA  . ASN B 1 206 ? 15.603  47.751 31.345  1.00 28.74  ? 206 ASN B CA  1 
ATOM   4817 C C   . ASN B 1 206 ? 14.322  47.316 32.060  1.00 32.84  ? 206 ASN B C   1 
ATOM   4818 O O   . ASN B 1 206 ? 13.346  46.933 31.390  1.00 33.05  ? 206 ASN B O   1 
ATOM   4819 C CB  . ASN B 1 206 ? 15.614  49.262 31.055  1.00 29.49  ? 206 ASN B CB  1 
ATOM   4820 C CG  . ASN B 1 206 ? 16.949  49.796 30.566  1.00 57.66  ? 206 ASN B CG  1 
ATOM   4821 O OD1 . ASN B 1 206 ? 17.003  50.703 29.737  1.00 51.39  ? 206 ASN B OD1 1 
ATOM   4822 N ND2 . ASN B 1 206 ? 18.063  49.253 31.057  1.00 51.57  ? 206 ASN B ND2 1 
ATOM   4823 N N   . SER B 1 207 ? 14.338  47.362 33.427  1.00 28.24  ? 207 SER B N   1 
ATOM   4824 C CA  . SER B 1 207 ? 13.217  46.934 34.270  1.00 27.38  ? 207 SER B CA  1 
ATOM   4825 C C   . SER B 1 207 ? 12.693  47.988 35.228  1.00 34.39  ? 207 SER B C   1 
ATOM   4826 O O   . SER B 1 207 ? 13.492  48.718 35.821  1.00 35.17  ? 207 SER B O   1 
ATOM   4827 C CB  . SER B 1 207 ? 13.563  45.665 35.036  1.00 27.75  ? 207 SER B CB  1 
ATOM   4828 O OG  . SER B 1 207 ? 13.810  44.593 34.141  1.00 34.30  ? 207 SER B OG  1 
ATOM   4829 N N   . LEU B 1 208 ? 11.340  48.043 35.397  1.00 31.98  ? 208 LEU B N   1 
ATOM   4830 C CA  . LEU B 1 208 ? 10.636  48.962 36.312  1.00 32.79  ? 208 LEU B CA  1 
ATOM   4831 C C   . LEU B 1 208 ? 10.842  48.567 37.770  1.00 37.74  ? 208 LEU B C   1 
ATOM   4832 O O   . LEU B 1 208 ? 10.968  47.380 38.071  1.00 40.04  ? 208 LEU B O   1 
ATOM   4833 C CB  . LEU B 1 208 ? 9.122   48.981 36.020  1.00 32.62  ? 208 LEU B CB  1 
ATOM   4834 C CG  . LEU B 1 208 ? 8.599   50.045 35.053  1.00 37.01  ? 208 LEU B CG  1 
ATOM   4835 C CD1 . LEU B 1 208 ? 7.193   49.720 34.603  1.00 35.86  ? 208 LEU B CD1 1 
ATOM   4836 C CD2 . LEU B 1 208 ? 8.617   51.419 35.687  1.00 40.34  ? 208 LEU B CD2 1 
ATOM   4837 N N   . THR B 1 209 ? 10.819  49.554 38.672  1.00 32.20  ? 209 THR B N   1 
ATOM   4838 C CA  . THR B 1 209 ? 10.960  49.361 40.116  1.00 31.89  ? 209 THR B CA  1 
ATOM   4839 C C   . THR B 1 209 ? 9.583   49.330 40.808  1.00 38.45  ? 209 THR B C   1 
ATOM   4840 O O   . THR B 1 209 ? 8.587   49.763 40.211  1.00 37.25  ? 209 THR B O   1 
ATOM   4841 C CB  . THR B 1 209 ? 11.881  50.437 40.698  1.00 30.35  ? 209 THR B CB  1 
ATOM   4842 O OG1 . THR B 1 209 ? 11.317  51.724 40.460  1.00 31.88  ? 209 THR B OG1 1 
ATOM   4843 C CG2 . THR B 1 209 ? 13.277  50.387 40.113  1.00 23.14  ? 209 THR B CG2 1 
ATOM   4844 N N   . SER B 1 210 ? 9.530   48.838 42.068  1.00 38.17  ? 210 SER B N   1 
ATOM   4845 C CA  . SER B 1 210 ? 8.288   48.742 42.863  1.00 39.39  ? 210 SER B CA  1 
ATOM   4846 C C   . SER B 1 210 ? 7.616   50.103 43.031  1.00 43.11  ? 210 SER B C   1 
ATOM   4847 O O   . SER B 1 210 ? 6.413   50.232 42.801  1.00 42.06  ? 210 SER B O   1 
ATOM   4848 C CB  . SER B 1 210 ? 8.558   48.145 44.247  1.00 45.91  ? 210 SER B CB  1 
ATOM   4849 O OG  . SER B 1 210 ? 9.263   46.916 44.198  1.00 61.29  ? 210 SER B OG  1 
ATOM   4850 N N   . GLU B 1 211 ? 8.419   51.113 43.416  1.00 39.72  ? 211 GLU B N   1 
ATOM   4851 C CA  . GLU B 1 211 ? 8.031   52.500 43.679  1.00 39.54  ? 211 GLU B CA  1 
ATOM   4852 C C   . GLU B 1 211 ? 7.436   53.151 42.434  1.00 42.47  ? 211 GLU B C   1 
ATOM   4853 O O   . GLU B 1 211 ? 6.366   53.771 42.520  1.00 42.96  ? 211 GLU B O   1 
ATOM   4854 C CB  . GLU B 1 211 ? 9.218   53.313 44.230  1.00 41.57  ? 211 GLU B CB  1 
ATOM   4855 C CG  . GLU B 1 211 ? 10.141  52.554 45.183  1.00 56.25  ? 211 GLU B CG  1 
ATOM   4856 C CD  . GLU B 1 211 ? 11.153  51.614 44.536  1.00 79.09  ? 211 GLU B CD  1 
ATOM   4857 O OE1 . GLU B 1 211 ? 10.965  50.378 44.632  1.00 59.88  ? 211 GLU B OE1 1 
ATOM   4858 O OE2 . GLU B 1 211 ? 12.114  52.112 43.905  1.00 77.26  ? 211 GLU B OE2 1 
ATOM   4859 N N   . ARG B 1 212 ? 8.102   52.958 41.267  1.00 36.90  ? 212 ARG B N   1 
ATOM   4860 C CA  . ARG B 1 212 ? 7.649   53.461 39.966  1.00 35.46  ? 212 ARG B CA  1 
ATOM   4861 C C   . ARG B 1 212 ? 6.284   52.858 39.558  1.00 37.37  ? 212 ARG B C   1 
ATOM   4862 O O   . ARG B 1 212 ? 5.382   53.603 39.178  1.00 36.39  ? 212 ARG B O   1 
ATOM   4863 C CB  . ARG B 1 212 ? 8.712   53.233 38.886  1.00 32.80  ? 212 ARG B CB  1 
ATOM   4864 C CG  . ARG B 1 212 ? 9.853   54.235 38.937  1.00 38.66  ? 212 ARG B CG  1 
ATOM   4865 C CD  . ARG B 1 212 ? 10.671  54.244 37.666  1.00 39.76  ? 212 ARG B CD  1 
ATOM   4866 N NE  . ARG B 1 212 ? 11.710  55.275 37.697  1.00 45.75  ? 212 ARG B NE  1 
ATOM   4867 C CZ  . ARG B 1 212 ? 12.471  55.613 36.657  1.00 52.41  ? 212 ARG B CZ  1 
ATOM   4868 N NH1 . ARG B 1 212 ? 12.305  55.020 35.481  1.00 40.47  ? 212 ARG B NH1 1 
ATOM   4869 N NH2 . ARG B 1 212 ? 13.393  56.558 36.783  1.00 23.21  ? 212 ARG B NH2 1 
ATOM   4870 N N   . LYS B 1 213 ? 6.124   51.527 39.706  1.00 32.59  ? 213 LYS B N   1 
ATOM   4871 C CA  . LYS B 1 213 ? 4.875   50.813 39.412  1.00 31.49  ? 213 LYS B CA  1 
ATOM   4872 C C   . LYS B 1 213 ? 3.712   51.369 40.243  1.00 35.32  ? 213 LYS B C   1 
ATOM   4873 O O   . LYS B 1 213 ? 2.662   51.702 39.673  1.00 35.19  ? 213 LYS B O   1 
ATOM   4874 C CB  . LYS B 1 213 ? 5.031   49.294 39.617  1.00 32.75  ? 213 LYS B CB  1 
ATOM   4875 C CG  . LYS B 1 213 ? 5.830   48.601 38.520  1.00 23.59  ? 213 LYS B CG  1 
ATOM   4876 C CD  . LYS B 1 213 ? 6.037   47.146 38.843  1.00 29.97  ? 213 LYS B CD  1 
ATOM   4877 C CE  . LYS B 1 213 ? 6.782   46.418 37.751  1.00 44.28  ? 213 LYS B CE  1 
ATOM   4878 N NZ  . LYS B 1 213 ? 7.118   45.034 38.147  1.00 53.38  ? 213 LYS B NZ  1 
ATOM   4879 N N   . LYS B 1 214 ? 3.926   51.533 41.570  1.00 31.67  ? 214 LYS B N   1 
ATOM   4880 C CA  . LYS B 1 214 ? 2.956   52.118 42.514  1.00 32.13  ? 214 LYS B CA  1 
ATOM   4881 C C   . LYS B 1 214 ? 2.464   53.465 41.971  1.00 37.04  ? 214 LYS B C   1 
ATOM   4882 O O   . LYS B 1 214 ? 1.253   53.645 41.797  1.00 34.98  ? 214 LYS B O   1 
ATOM   4883 C CB  . LYS B 1 214 ? 3.597   52.305 43.907  1.00 34.93  ? 214 LYS B CB  1 
ATOM   4884 C CG  . LYS B 1 214 ? 3.751   51.016 44.708  1.00 47.36  ? 214 LYS B CG  1 
ATOM   4885 C CD  . LYS B 1 214 ? 4.661   51.227 45.910  1.00 58.92  ? 214 LYS B CD  1 
ATOM   4886 C CE  . LYS B 1 214 ? 4.827   49.987 46.761  1.00 59.51  ? 214 LYS B CE  1 
ATOM   4887 N NZ  . LYS B 1 214 ? 5.630   50.258 47.988  1.00 60.23  ? 214 LYS B NZ  1 
ATOM   4888 N N   . GLU B 1 215 ? 3.433   54.372 41.629  1.00 36.33  ? 215 GLU B N   1 
ATOM   4889 C CA  . GLU B 1 215 ? 3.226   55.705 41.033  1.00 36.60  ? 215 GLU B CA  1 
ATOM   4890 C C   . GLU B 1 215 ? 2.453   55.630 39.706  1.00 36.64  ? 215 GLU B C   1 
ATOM   4891 O O   . GLU B 1 215 ? 1.571   56.453 39.489  1.00 36.11  ? 215 GLU B O   1 
ATOM   4892 C CB  . GLU B 1 215 ? 4.574   56.399 40.783  1.00 38.46  ? 215 GLU B CB  1 
ATOM   4893 C CG  . GLU B 1 215 ? 5.108   57.213 41.943  1.00 52.44  ? 215 GLU B CG  1 
ATOM   4894 C CD  . GLU B 1 215 ? 6.324   58.026 41.544  1.00 83.38  ? 215 GLU B CD  1 
ATOM   4895 O OE1 . GLU B 1 215 ? 7.460   57.543 41.753  1.00 79.72  ? 215 GLU B OE1 1 
ATOM   4896 O OE2 . GLU B 1 215 ? 6.140   59.122 40.967  1.00 84.46  ? 215 GLU B OE2 1 
ATOM   4897 N N   . ILE B 1 216 ? 2.799   54.660 38.822  1.00 30.34  ? 216 ILE B N   1 
ATOM   4898 C CA  . ILE B 1 216 ? 2.127   54.460 37.545  1.00 29.51  ? 216 ILE B CA  1 
ATOM   4899 C C   . ILE B 1 216 ? 0.668   54.062 37.801  1.00 37.38  ? 216 ILE B C   1 
ATOM   4900 O O   . ILE B 1 216 ? -0.234  54.725 37.259  1.00 38.85  ? 216 ILE B O   1 
ATOM   4901 C CB  . ILE B 1 216 ? 2.890   53.497 36.588  1.00 30.86  ? 216 ILE B CB  1 
ATOM   4902 C CG1 . ILE B 1 216 ? 4.258   54.084 36.178  1.00 30.37  ? 216 ILE B CG1 1 
ATOM   4903 C CG2 . ILE B 1 216 ? 2.059   53.159 35.326  1.00 30.59  ? 216 ILE B CG2 1 
ATOM   4904 C CD1 . ILE B 1 216 ? 5.327   53.059 35.979  1.00 33.26  ? 216 ILE B CD1 1 
ATOM   4905 N N   . TYR B 1 217 ? 0.429   53.053 38.690  1.00 33.39  ? 217 TYR B N   1 
ATOM   4906 C CA  . TYR B 1 217 ? -0.935  52.628 39.061  1.00 32.86  ? 217 TYR B CA  1 
ATOM   4907 C C   . TYR B 1 217 ? -1.794  53.800 39.576  1.00 40.47  ? 217 TYR B C   1 
ATOM   4908 O O   . TYR B 1 217 ? -2.960  53.902 39.194  1.00 41.28  ? 217 TYR B O   1 
ATOM   4909 C CB  . TYR B 1 217 ? -0.934  51.479 40.094  1.00 32.38  ? 217 TYR B CB  1 
ATOM   4910 C CG  . TYR B 1 217 ? -2.254  50.734 40.157  1.00 31.85  ? 217 TYR B CG  1 
ATOM   4911 C CD1 . TYR B 1 217 ? -2.519  49.672 39.300  1.00 32.23  ? 217 TYR B CD1 1 
ATOM   4912 C CD2 . TYR B 1 217 ? -3.260  51.125 41.041  1.00 33.95  ? 217 TYR B CD2 1 
ATOM   4913 C CE1 . TYR B 1 217 ? -3.746  49.005 39.325  1.00 32.39  ? 217 TYR B CE1 1 
ATOM   4914 C CE2 . TYR B 1 217 ? -4.505  50.479 41.060  1.00 34.85  ? 217 TYR B CE2 1 
ATOM   4915 C CZ  . TYR B 1 217 ? -4.738  49.414 40.204  1.00 40.99  ? 217 TYR B CZ  1 
ATOM   4916 O OH  . TYR B 1 217 ? -5.945  48.756 40.229  1.00 41.42  ? 217 TYR B OH  1 
ATOM   4917 N N   . GLU B 1 218 ? -1.216  54.688 40.414  1.00 39.25  ? 218 GLU B N   1 
ATOM   4918 C CA  . GLU B 1 218 ? -1.930  55.838 40.972  1.00 40.93  ? 218 GLU B CA  1 
ATOM   4919 C C   . GLU B 1 218 ? -2.457  56.775 39.868  1.00 45.57  ? 218 GLU B C   1 
ATOM   4920 O O   . GLU B 1 218 ? -3.592  57.269 39.977  1.00 46.38  ? 218 GLU B O   1 
ATOM   4921 C CB  . GLU B 1 218 ? -1.122  56.533 42.095  1.00 43.37  ? 218 GLU B CB  1 
ATOM   4922 C CG  . GLU B 1 218 ? -0.480  57.872 41.730  1.00 65.38  ? 218 GLU B CG  1 
ATOM   4923 C CD  . GLU B 1 218 ? 0.944   58.188 42.183  1.00 91.86  ? 218 GLU B CD  1 
ATOM   4924 O OE1 . GLU B 1 218 ? 1.641   58.923 41.443  1.00 62.12  ? 218 GLU B OE1 1 
ATOM   4925 O OE2 . GLU B 1 218 ? 1.358   57.731 43.276  1.00 89.68  ? 218 GLU B OE2 1 
ATOM   4926 N N   . LEU B 1 219 ? -1.678  56.923 38.765  1.00 40.28  ? 219 LEU B N   1 
ATOM   4927 C CA  . LEU B 1 219 ? -2.046  57.753 37.613  1.00 39.58  ? 219 LEU B CA  1 
ATOM   4928 C C   . LEU B 1 219 ? -3.141  57.121 36.751  1.00 42.47  ? 219 LEU B C   1 
ATOM   4929 O O   . LEU B 1 219 ? -4.032  57.838 36.277  1.00 42.14  ? 219 LEU B O   1 
ATOM   4930 C CB  . LEU B 1 219 ? -0.817  58.146 36.789  1.00 39.01  ? 219 LEU B CB  1 
ATOM   4931 C CG  . LEU B 1 219 ? 0.048   59.245 37.430  1.00 44.63  ? 219 LEU B CG  1 
ATOM   4932 C CD1 . LEU B 1 219 ? 1.512   59.075 37.077  1.00 44.17  ? 219 LEU B CD1 1 
ATOM   4933 C CD2 . LEU B 1 219 ? -0.452  60.648 37.062  1.00 48.24  ? 219 LEU B CD2 1 
ATOM   4934 N N   . ALA B 1 220 ? -3.096  55.773 36.586  1.00 37.94  ? 220 ALA B N   1 
ATOM   4935 C CA  . ALA B 1 220 ? -4.109  55.001 35.854  1.00 36.71  ? 220 ALA B CA  1 
ATOM   4936 C C   . ALA B 1 220 ? -5.503  55.098 36.520  1.00 42.54  ? 220 ALA B C   1 
ATOM   4937 O O   . ALA B 1 220 ? -6.496  55.105 35.803  1.00 42.29  ? 220 ALA B O   1 
ATOM   4938 C CB  . ALA B 1 220 ? -3.681  53.551 35.699  1.00 35.82  ? 220 ALA B CB  1 
ATOM   4939 N N   . ARG B 1 221 ? -5.578  55.222 37.869  1.00 40.58  ? 221 ARG B N   1 
ATOM   4940 C CA  . ARG B 1 221 ? -6.851  55.381 38.589  1.00 41.94  ? 221 ARG B CA  1 
ATOM   4941 C C   . ARG B 1 221 ? -7.377  56.767 38.273  1.00 46.64  ? 221 ARG B C   1 
ATOM   4942 O O   . ARG B 1 221 ? -8.507  56.897 37.802  1.00 47.16  ? 221 ARG B O   1 
ATOM   4943 C CB  . ARG B 1 221 ? -6.666  55.322 40.117  1.00 46.73  ? 221 ARG B CB  1 
ATOM   4944 C CG  . ARG B 1 221 ? -6.161  54.016 40.709  1.00 64.02  ? 221 ARG B CG  1 
ATOM   4945 C CD  . ARG B 1 221 ? -5.906  54.169 42.206  1.00 72.71  ? 221 ARG B CD  1 
ATOM   4946 N NE  . ARG B 1 221 ? -7.131  54.416 42.976  1.00 64.41  ? 221 ARG B NE  1 
ATOM   4947 C CZ  . ARG B 1 221 ? -7.752  53.497 43.704  1.00 79.53  ? 221 ARG B CZ  1 
ATOM   4948 N NH1 . ARG B 1 221 ? -7.271  52.264 43.775  1.00 63.40  ? 221 ARG B NH1 1 
ATOM   4949 N NH2 . ARG B 1 221 ? -8.852  53.807 44.379  1.00 75.89  ? 221 ARG B NH2 1 
ATOM   4950 N N   . LYS B 1 222 ? -6.533  57.804 38.559  1.00 42.99  ? 222 LYS B N   1 
ATOM   4951 C CA  . LYS B 1 222 ? -6.779  59.238 38.390  1.00 43.04  ? 222 LYS B CA  1 
ATOM   4952 C C   . LYS B 1 222 ? -7.360  59.587 37.018  1.00 46.83  ? 222 LYS B C   1 
ATOM   4953 O O   . LYS B 1 222 ? -8.361  60.298 36.952  1.00 47.83  ? 222 LYS B O   1 
ATOM   4954 C CB  . LYS B 1 222 ? -5.484  60.032 38.667  1.00 45.11  ? 222 LYS B CB  1 
ATOM   4955 C CG  . LYS B 1 222 ? -5.661  61.547 38.675  1.00 57.37  ? 222 LYS B CG  1 
ATOM   4956 C CD  . LYS B 1 222 ? -4.436  62.259 39.218  1.00 65.30  ? 222 LYS B CD  1 
ATOM   4957 C CE  . LYS B 1 222 ? -4.644  63.759 39.283  1.00 72.03  ? 222 LYS B CE  1 
ATOM   4958 N NZ  . LYS B 1 222 ? -3.541  64.461 39.997  1.00 72.23  ? 222 LYS B NZ  1 
ATOM   4959 N N   . TYR B 1 223 ? -6.750  59.060 35.936  1.00 41.87  ? 223 TYR B N   1 
ATOM   4960 C CA  . TYR B 1 223 ? -7.154  59.312 34.554  1.00 41.20  ? 223 TYR B CA  1 
ATOM   4961 C C   . TYR B 1 223 ? -7.927  58.147 33.913  1.00 44.53  ? 223 TYR B C   1 
ATOM   4962 O O   . TYR B 1 223 ? -8.203  58.177 32.704  1.00 45.70  ? 223 TYR B O   1 
ATOM   4963 C CB  . TYR B 1 223 ? -5.925  59.732 33.727  1.00 42.16  ? 223 TYR B CB  1 
ATOM   4964 C CG  . TYR B 1 223 ? -5.350  61.067 34.153  1.00 45.59  ? 223 TYR B CG  1 
ATOM   4965 C CD1 . TYR B 1 223 ? -5.798  62.257 33.583  1.00 48.62  ? 223 TYR B CD1 1 
ATOM   4966 C CD2 . TYR B 1 223 ? -4.373  61.146 35.142  1.00 46.39  ? 223 TYR B CD2 1 
ATOM   4967 C CE1 . TYR B 1 223 ? -5.277  63.489 33.973  1.00 49.79  ? 223 TYR B CE1 1 
ATOM   4968 C CE2 . TYR B 1 223 ? -3.851  62.375 35.547  1.00 48.48  ? 223 TYR B CE2 1 
ATOM   4969 C CZ  . TYR B 1 223 ? -4.305  63.544 34.957  1.00 56.68  ? 223 TYR B CZ  1 
ATOM   4970 O OH  . TYR B 1 223 ? -3.790  64.757 35.342  1.00 59.41  ? 223 TYR B OH  1 
ATOM   4971 N N   . ASP B 1 224 ? -8.305  57.141 34.732  1.00 38.42  ? 224 ASP B N   1 
ATOM   4972 C CA  . ASP B 1 224 ? -9.066  55.962 34.333  1.00 37.59  ? 224 ASP B CA  1 
ATOM   4973 C C   . ASP B 1 224 ? -8.619  55.302 33.004  1.00 40.41  ? 224 ASP B C   1 
ATOM   4974 O O   . ASP B 1 224 ? -9.302  55.392 31.983  1.00 41.78  ? 224 ASP B O   1 
ATOM   4975 C CB  . ASP B 1 224 ? -10.594 56.198 34.434  1.00 40.84  ? 224 ASP B CB  1 
ATOM   4976 C CG  . ASP B 1 224 ? -11.481 54.982 34.175  1.00 58.31  ? 224 ASP B CG  1 
ATOM   4977 O OD1 . ASP B 1 224 ? -11.193 53.891 34.742  1.00 59.06  ? 224 ASP B OD1 1 
ATOM   4978 O OD2 . ASP B 1 224 ? -12.486 55.130 33.444  1.00 66.59  ? 224 ASP B OD2 1 
ATOM   4979 N N   . PHE B 1 225 ? -7.449  54.668 33.020  1.00 33.61  ? 225 PHE B N   1 
ATOM   4980 C CA  . PHE B 1 225 ? -6.954  53.937 31.858  1.00 31.04  ? 225 PHE B CA  1 
ATOM   4981 C C   . PHE B 1 225 ? -6.427  52.571 32.253  1.00 35.21  ? 225 PHE B C   1 
ATOM   4982 O O   . PHE B 1 225 ? -5.927  52.408 33.371  1.00 36.53  ? 225 PHE B O   1 
ATOM   4983 C CB  . PHE B 1 225 ? -5.945  54.741 31.022  1.00 31.39  ? 225 PHE B CB  1 
ATOM   4984 C CG  . PHE B 1 225 ? -4.718  55.258 31.729  1.00 31.52  ? 225 PHE B CG  1 
ATOM   4985 C CD1 . PHE B 1 225 ? -3.590  54.453 31.883  1.00 32.54  ? 225 PHE B CD1 1 
ATOM   4986 C CD2 . PHE B 1 225 ? -4.652  56.575 32.173  1.00 32.81  ? 225 PHE B CD2 1 
ATOM   4987 C CE1 . PHE B 1 225 ? -2.442  54.941 32.520  1.00 32.21  ? 225 PHE B CE1 1 
ATOM   4988 C CE2 . PHE B 1 225 ? -3.500  57.064 32.798  1.00 34.68  ? 225 PHE B CE2 1 
ATOM   4989 C CZ  . PHE B 1 225 ? -2.402  56.246 32.960  1.00 31.62  ? 225 PHE B CZ  1 
ATOM   4990 N N   . LEU B 1 226 ? -6.561  51.576 31.359  1.00 29.73  ? 226 LEU B N   1 
ATOM   4991 C CA  . LEU B 1 226 ? -6.082  50.222 31.659  1.00 27.49  ? 226 LEU B CA  1 
ATOM   4992 C C   . LEU B 1 226 ? -4.557  50.140 31.583  1.00 30.62  ? 226 LEU B C   1 
ATOM   4993 O O   . LEU B 1 226 ? -3.917  51.079 31.102  1.00 29.54  ? 226 LEU B O   1 
ATOM   4994 C CB  . LEU B 1 226 ? -6.770  49.138 30.784  1.00 26.25  ? 226 LEU B CB  1 
ATOM   4995 C CG  . LEU B 1 226 ? -8.307  49.263 30.533  1.00 29.52  ? 226 LEU B CG  1 
ATOM   4996 C CD1 . LEU B 1 226 ? -8.738  48.375 29.401  1.00 28.75  ? 226 LEU B CD1 1 
ATOM   4997 C CD2 . LEU B 1 226 ? -9.128  48.981 31.773  1.00 27.63  ? 226 LEU B CD2 1 
ATOM   4998 N N   . ILE B 1 227 ? -3.976  49.061 32.137  1.00 27.97  ? 227 ILE B N   1 
ATOM   4999 C CA  . ILE B 1 227 ? -2.540  48.799 32.088  1.00 27.64  ? 227 ILE B CA  1 
ATOM   5000 C C   . ILE B 1 227 ? -2.371  47.452 31.406  1.00 32.17  ? 227 ILE B C   1 
ATOM   5001 O O   . ILE B 1 227 ? -2.919  46.451 31.875  1.00 31.17  ? 227 ILE B O   1 
ATOM   5002 C CB  . ILE B 1 227 ? -1.799  48.888 33.459  1.00 30.99  ? 227 ILE B CB  1 
ATOM   5003 C CG1 . ILE B 1 227 ? -1.829  50.316 34.024  1.00 31.90  ? 227 ILE B CG1 1 
ATOM   5004 C CG2 . ILE B 1 227 ? -0.347  48.412 33.322  1.00 32.73  ? 227 ILE B CG2 1 
ATOM   5005 C CD1 . ILE B 1 227 ? -1.318  50.486 35.507  1.00 36.15  ? 227 ILE B CD1 1 
ATOM   5006 N N   . ILE B 1 228 ? -1.650  47.436 30.274  1.00 29.00  ? 228 ILE B N   1 
ATOM   5007 C CA  . ILE B 1 228 ? -1.380  46.195 29.559  1.00 27.20  ? 228 ILE B CA  1 
ATOM   5008 C C   . ILE B 1 228 ? 0.023   45.733 29.920  1.00 30.95  ? 228 ILE B C   1 
ATOM   5009 O O   . ILE B 1 228 ? 1.017   46.255 29.407  1.00 30.15  ? 228 ILE B O   1 
ATOM   5010 C CB  . ILE B 1 228 ? -1.701  46.233 28.039  1.00 28.80  ? 228 ILE B CB  1 
ATOM   5011 C CG1 . ILE B 1 228 ? -3.186  46.623 27.825  1.00 28.63  ? 228 ILE B CG1 1 
ATOM   5012 C CG2 . ILE B 1 228 ? -1.353  44.870 27.370  1.00 26.56  ? 228 ILE B CG2 1 
ATOM   5013 C CD1 . ILE B 1 228 ? -3.588  46.925 26.395  1.00 30.51  ? 228 ILE B CD1 1 
ATOM   5014 N N   . GLU B 1 229 ? 0.082   44.791 30.872  1.00 27.60  ? 229 GLU B N   1 
ATOM   5015 C CA  . GLU B 1 229 ? 1.309   44.205 31.399  1.00 26.44  ? 229 GLU B CA  1 
ATOM   5016 C C   . GLU B 1 229 ? 1.775   43.041 30.541  1.00 26.75  ? 229 GLU B C   1 
ATOM   5017 O O   . GLU B 1 229 ? 1.374   41.901 30.797  1.00 24.12  ? 229 GLU B O   1 
ATOM   5018 C CB  . GLU B 1 229 ? 1.097   43.764 32.858  1.00 28.04  ? 229 GLU B CB  1 
ATOM   5019 C CG  . GLU B 1 229 ? 2.372   43.285 33.528  1.00 37.88  ? 229 GLU B CG  1 
ATOM   5020 C CD  . GLU B 1 229 ? 2.333   43.254 35.037  1.00 53.37  ? 229 GLU B CD  1 
ATOM   5021 O OE1 . GLU B 1 229 ? 3.231   43.869 35.656  1.00 36.91  ? 229 GLU B OE1 1 
ATOM   5022 O OE2 . GLU B 1 229 ? 1.440   42.578 35.602  1.00 50.19  ? 229 GLU B OE2 1 
ATOM   5023 N N   . ASP B 1 230 ? 2.618   43.325 29.527  1.00 23.90  ? 230 ASP B N   1 
ATOM   5024 C CA  . ASP B 1 230 ? 3.180   42.281 28.662  1.00 24.06  ? 230 ASP B CA  1 
ATOM   5025 C C   . ASP B 1 230 ? 4.490   41.831 29.308  1.00 28.43  ? 230 ASP B C   1 
ATOM   5026 O O   . ASP B 1 230 ? 5.515   42.467 29.109  1.00 28.34  ? 230 ASP B O   1 
ATOM   5027 C CB  . ASP B 1 230 ? 3.393   42.803 27.231  1.00 26.23  ? 230 ASP B CB  1 
ATOM   5028 C CG  . ASP B 1 230 ? 3.858   41.770 26.210  1.00 39.83  ? 230 ASP B CG  1 
ATOM   5029 O OD1 . ASP B 1 230 ? 3.682   40.552 26.464  1.00 40.90  ? 230 ASP B OD1 1 
ATOM   5030 O OD2 . ASP B 1 230 ? 4.363   42.180 25.142  1.00 46.27  ? 230 ASP B OD2 1 
ATOM   5031 N N   . ASP B 1 231 ? 4.439   40.758 30.117  1.00 24.99  ? 231 ASP B N   1 
ATOM   5032 C CA  . ASP B 1 231 ? 5.555   40.265 30.914  1.00 25.18  ? 231 ASP B CA  1 
ATOM   5033 C C   . ASP B 1 231 ? 6.104   38.873 30.473  1.00 30.99  ? 231 ASP B C   1 
ATOM   5034 O O   . ASP B 1 231 ? 5.949   37.904 31.221  1.00 31.12  ? 231 ASP B O   1 
ATOM   5035 C CB  . ASP B 1 231 ? 5.128   40.265 32.403  1.00 27.15  ? 231 ASP B CB  1 
ATOM   5036 C CG  . ASP B 1 231 ? 6.069   40.912 33.408  1.00 39.96  ? 231 ASP B CG  1 
ATOM   5037 O OD1 . ASP B 1 231 ? 7.205   41.267 33.024  1.00 43.33  ? 231 ASP B OD1 1 
ATOM   5038 O OD2 . ASP B 1 231 ? 5.682   41.028 34.589  1.00 42.55  ? 231 ASP B OD2 1 
ATOM   5039 N N   . PRO B 1 232 ? 6.775   38.729 29.301  1.00 27.72  ? 232 PRO B N   1 
ATOM   5040 C CA  . PRO B 1 232 ? 7.313   37.407 28.934  1.00 26.41  ? 232 PRO B CA  1 
ATOM   5041 C C   . PRO B 1 232 ? 8.614   37.047 29.647  1.00 32.98  ? 232 PRO B C   1 
ATOM   5042 O O   . PRO B 1 232 ? 8.928   35.854 29.789  1.00 35.36  ? 232 PRO B O   1 
ATOM   5043 C CB  . PRO B 1 232 ? 7.528   37.501 27.426  1.00 27.58  ? 232 PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 232 ? 7.215   38.917 27.030  1.00 32.75  ? 232 PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 232 ? 7.084   39.737 28.265  1.00 29.24  ? 232 PRO B CD  1 
ATOM   5046 N N   . TYR B 1 233 ? 9.371   38.061 30.102  1.00 28.81  ? 233 TYR B N   1 
ATOM   5047 C CA  . TYR B 1 233 ? 10.652  37.866 30.788  1.00 29.89  ? 233 TYR B CA  1 
ATOM   5048 C C   . TYR B 1 233 ? 10.525  37.911 32.313  1.00 35.26  ? 233 TYR B C   1 
ATOM   5049 O O   . TYR B 1 233 ? 11.539  38.087 32.992  1.00 35.42  ? 233 TYR B O   1 
ATOM   5050 C CB  . TYR B 1 233 ? 11.733  38.852 30.268  1.00 32.00  ? 233 TYR B CB  1 
ATOM   5051 C CG  . TYR B 1 233 ? 11.764  38.972 28.761  1.00 35.67  ? 233 TYR B CG  1 
ATOM   5052 C CD1 . TYR B 1 233 ? 11.308  40.125 28.127  1.00 38.09  ? 233 TYR B CD1 1 
ATOM   5053 C CD2 . TYR B 1 233 ? 12.167  37.903 27.965  1.00 37.03  ? 233 TYR B CD2 1 
ATOM   5054 C CE1 . TYR B 1 233 ? 11.275  40.221 26.738  1.00 39.65  ? 233 TYR B CE1 1 
ATOM   5055 C CE2 . TYR B 1 233 ? 12.154  37.991 26.575  1.00 38.62  ? 233 TYR B CE2 1 
ATOM   5056 C CZ  . TYR B 1 233 ? 11.700  39.151 25.966  1.00 52.00  ? 233 TYR B CZ  1 
ATOM   5057 O OH  . TYR B 1 233 ? 11.674  39.237 24.593  1.00 60.61  ? 233 TYR B OH  1 
ATOM   5058 N N   . TYR B 1 234 ? 9.287   37.716 32.854  1.00 31.94  ? 234 TYR B N   1 
ATOM   5059 C CA  . TYR B 1 234 ? 9.010   37.723 34.298  1.00 31.35  ? 234 TYR B CA  1 
ATOM   5060 C C   . TYR B 1 234 ? 9.848   36.659 35.039  1.00 37.29  ? 234 TYR B C   1 
ATOM   5061 O O   . TYR B 1 234 ? 10.343  36.901 36.145  1.00 36.77  ? 234 TYR B O   1 
ATOM   5062 C CB  . TYR B 1 234 ? 7.500   37.578 34.590  1.00 30.67  ? 234 TYR B CB  1 
ATOM   5063 C CG  . TYR B 1 234 ? 7.197   37.431 36.068  1.00 32.22  ? 234 TYR B CG  1 
ATOM   5064 C CD1 . TYR B 1 234 ? 7.392   38.493 36.948  1.00 34.39  ? 234 TYR B CD1 1 
ATOM   5065 C CD2 . TYR B 1 234 ? 6.817   36.200 36.605  1.00 32.74  ? 234 TYR B CD2 1 
ATOM   5066 C CE1 . TYR B 1 234 ? 7.196   38.340 38.322  1.00 35.88  ? 234 TYR B CE1 1 
ATOM   5067 C CE2 . TYR B 1 234 ? 6.616   36.035 37.978  1.00 33.67  ? 234 TYR B CE2 1 
ATOM   5068 C CZ  . TYR B 1 234 ? 6.804   37.109 38.833  1.00 42.14  ? 234 TYR B CZ  1 
ATOM   5069 O OH  . TYR B 1 234 ? 6.603   36.950 40.187  1.00 43.08  ? 234 TYR B OH  1 
ATOM   5070 N N   . PHE B 1 235 ? 10.018  35.497 34.396  1.00 34.93  ? 235 PHE B N   1 
ATOM   5071 C CA  . PHE B 1 235 ? 10.778  34.376 34.921  1.00 35.23  ? 235 PHE B CA  1 
ATOM   5072 C C   . PHE B 1 235 ? 12.230  34.402 34.446  1.00 43.02  ? 235 PHE B C   1 
ATOM   5073 O O   . PHE B 1 235 ? 12.877  33.358 34.455  1.00 45.59  ? 235 PHE B O   1 
ATOM   5074 C CB  . PHE B 1 235 ? 10.102  33.052 34.528  1.00 35.83  ? 235 PHE B CB  1 
ATOM   5075 C CG  . PHE B 1 235 ? 8.712   32.872 35.077  1.00 36.32  ? 235 PHE B CG  1 
ATOM   5076 C CD1 . PHE B 1 235 ? 8.508   32.607 36.426  1.00 39.50  ? 235 PHE B CD1 1 
ATOM   5077 C CD2 . PHE B 1 235 ? 7.602   32.947 34.242  1.00 37.67  ? 235 PHE B CD2 1 
ATOM   5078 C CE1 . PHE B 1 235 ? 7.213   32.438 36.937  1.00 40.05  ? 235 PHE B CE1 1 
ATOM   5079 C CE2 . PHE B 1 235 ? 6.306   32.767 34.751  1.00 39.92  ? 235 PHE B CE2 1 
ATOM   5080 C CZ  . PHE B 1 235 ? 6.122   32.513 36.097  1.00 38.13  ? 235 PHE B CZ  1 
ATOM   5081 N N   . LEU B 1 236 ? 12.733  35.565 33.999  1.00 39.01  ? 236 LEU B N   1 
ATOM   5082 C CA  . LEU B 1 236 ? 14.122  35.722 33.547  1.00 39.72  ? 236 LEU B CA  1 
ATOM   5083 C C   . LEU B 1 236 ? 14.809  36.926 34.203  1.00 41.83  ? 236 LEU B C   1 
ATOM   5084 O O   . LEU B 1 236 ? 15.737  37.504 33.631  1.00 41.36  ? 236 LEU B O   1 
ATOM   5085 C CB  . LEU B 1 236 ? 14.231  35.779 32.015  1.00 40.25  ? 236 LEU B CB  1 
ATOM   5086 C CG  . LEU B 1 236 ? 14.282  34.444 31.309  1.00 47.23  ? 236 LEU B CG  1 
ATOM   5087 C CD1 . LEU B 1 236 ? 12.883  33.987 30.929  1.00 48.56  ? 236 LEU B CD1 1 
ATOM   5088 C CD2 . LEU B 1 236 ? 15.112  34.541 30.050  1.00 50.79  ? 236 LEU B CD2 1 
ATOM   5089 N N   . GLN B 1 237 ? 14.347  37.294 35.407  1.00 37.26  ? 237 GLN B N   1 
ATOM   5090 C CA  . GLN B 1 237 ? 14.900  38.384 36.199  1.00 37.13  ? 237 GLN B CA  1 
ATOM   5091 C C   . GLN B 1 237 ? 16.242  37.892 36.788  1.00 43.73  ? 237 GLN B C   1 
ATOM   5092 O O   . GLN B 1 237 ? 16.313  36.785 37.332  1.00 43.41  ? 237 GLN B O   1 
ATOM   5093 C CB  . GLN B 1 237 ? 13.908  38.809 37.298  1.00 37.96  ? 237 GLN B CB  1 
ATOM   5094 C CG  . GLN B 1 237 ? 12.641  39.466 36.760  1.00 35.00  ? 237 GLN B CG  1 
ATOM   5095 C CD  . GLN B 1 237 ? 11.673  39.921 37.834  1.00 53.12  ? 237 GLN B CD  1 
ATOM   5096 O OE1 . GLN B 1 237 ? 10.480  39.563 37.812  1.00 56.45  ? 237 GLN B OE1 1 
ATOM   5097 N NE2 . GLN B 1 237 ? 12.141  40.744 38.780  1.00 26.61  ? 237 GLN B NE2 1 
ATOM   5098 N N   . PHE B 1 238 ? 17.319  38.688 36.607  1.00 42.16  ? 238 PHE B N   1 
ATOM   5099 C CA  . PHE B 1 238 ? 18.682  38.348 37.044  1.00 42.27  ? 238 PHE B CA  1 
ATOM   5100 C C   . PHE B 1 238 ? 18.998  38.678 38.493  1.00 54.20  ? 238 PHE B C   1 
ATOM   5101 O O   . PHE B 1 238 ? 19.904  38.070 39.064  1.00 56.19  ? 238 PHE B O   1 
ATOM   5102 C CB  . PHE B 1 238 ? 19.748  38.929 36.097  1.00 41.98  ? 238 PHE B CB  1 
ATOM   5103 C CG  . PHE B 1 238 ? 19.657  38.455 34.666  1.00 40.47  ? 238 PHE B CG  1 
ATOM   5104 C CD1 . PHE B 1 238 ? 19.703  39.356 33.617  1.00 42.08  ? 238 PHE B CD1 1 
ATOM   5105 C CD2 . PHE B 1 238 ? 19.539  37.103 34.369  1.00 40.09  ? 238 PHE B CD2 1 
ATOM   5106 C CE1 . PHE B 1 238 ? 19.626  38.914 32.291  1.00 41.97  ? 238 PHE B CE1 1 
ATOM   5107 C CE2 . PHE B 1 238 ? 19.444  36.667 33.047  1.00 41.52  ? 238 PHE B CE2 1 
ATOM   5108 C CZ  . PHE B 1 238 ? 19.485  37.575 32.017  1.00 39.20  ? 238 PHE B CZ  1 
ATOM   5109 N N   . ASN B 1 239 ? 18.273  39.614 39.101  1.00 55.03  ? 239 ASN B N   1 
ATOM   5110 C CA  . ASN B 1 239 ? 18.525  39.928 40.501  1.00 57.51  ? 239 ASN B CA  1 
ATOM   5111 C C   . ASN B 1 239 ? 17.608  39.199 41.490  1.00 63.97  ? 239 ASN B C   1 
ATOM   5112 O O   . ASN B 1 239 ? 16.447  38.909 41.193  1.00 63.09  ? 239 ASN B O   1 
ATOM   5113 C CB  . ASN B 1 239 ? 18.605  41.427 40.733  1.00 59.46  ? 239 ASN B CB  1 
ATOM   5114 C CG  . ASN B 1 239 ? 19.632  42.065 39.843  1.00 91.59  ? 239 ASN B CG  1 
ATOM   5115 O OD1 . ASN B 1 239 ? 19.350  42.432 38.699  1.00 83.82  ? 239 ASN B OD1 1 
ATOM   5116 N ND2 . ASN B 1 239 ? 20.866  42.135 40.320  1.00 88.30  ? 239 ASN B ND2 1 
ATOM   5117 N N   . SER B 1 240 ? 18.175  38.872 42.651  1.00 62.92  ? 240 SER B N   1 
ATOM   5118 C CA  . SER B 1 240 ? 17.538  38.170 43.759  1.00 63.51  ? 240 SER B CA  1 
ATOM   5119 C C   . SER B 1 240 ? 16.191  38.785 44.219  1.00 65.13  ? 240 SER B C   1 
ATOM   5120 O O   . SER B 1 240 ? 16.139  39.944 44.661  1.00 64.64  ? 240 SER B O   1 
ATOM   5121 C CB  . SER B 1 240 ? 18.507  38.085 44.931  1.00 69.66  ? 240 SER B CB  1 
ATOM   5122 O OG  . SER B 1 240 ? 17.970  37.227 45.919  1.00 82.62  ? 240 SER B OG  1 
ATOM   5123 N N   . GLY B 1 241 ? 15.127  37.999 44.091  1.00 59.57  ? 241 GLY B N   1 
ATOM   5124 C CA  . GLY B 1 241 ? 13.792  38.433 44.473  1.00 58.63  ? 241 GLY B CA  1 
ATOM   5125 C C   . GLY B 1 241 ? 13.099  39.247 43.400  1.00 59.86  ? 241 GLY B C   1 
ATOM   5126 O O   . GLY B 1 241 ? 13.530  40.364 43.081  1.00 60.85  ? 241 GLY B O   1 
ATOM   5127 N N   . ARG B 1 242 ? 12.007  38.686 42.849  1.00 52.02  ? 242 ARG B N   1 
ATOM   5128 C CA  . ARG B 1 242 ? 11.189  39.306 41.802  1.00 49.50  ? 242 ARG B CA  1 
ATOM   5129 C C   . ARG B 1 242 ? 10.395  40.517 42.325  1.00 51.73  ? 242 ARG B C   1 
ATOM   5130 O O   . ARG B 1 242 ? 9.944   40.526 43.472  1.00 52.06  ? 242 ARG B O   1 
ATOM   5131 C CB  . ARG B 1 242 ? 10.267  38.274 41.115  1.00 45.63  ? 242 ARG B CB  1 
ATOM   5132 C CG  . ARG B 1 242 ? 11.023  37.093 40.478  1.00 47.41  ? 242 ARG B CG  1 
ATOM   5133 C CD  . ARG B 1 242 ? 10.132  35.975 39.970  1.00 46.47  ? 242 ARG B CD  1 
ATOM   5134 N NE  . ARG B 1 242 ? 8.994   35.697 40.855  1.00 49.20  ? 242 ARG B NE  1 
ATOM   5135 C CZ  . ARG B 1 242 ? 8.889   34.652 41.669  1.00 60.59  ? 242 ARG B CZ  1 
ATOM   5136 N NH1 . ARG B 1 242 ? 9.855   33.745 41.722  1.00 54.11  ? 242 ARG B NH1 1 
ATOM   5137 N NH2 . ARG B 1 242 ? 7.812   34.501 42.429  1.00 45.26  ? 242 ARG B NH2 1 
ATOM   5138 N N   . VAL B 1 243 ? 10.269  41.550 41.478  1.00 45.84  ? 243 VAL B N   1 
ATOM   5139 C CA  . VAL B 1 243 ? 9.570   42.806 41.766  1.00 44.86  ? 243 VAL B CA  1 
ATOM   5140 C C   . VAL B 1 243 ? 8.043   42.561 41.702  1.00 46.81  ? 243 VAL B C   1 
ATOM   5141 O O   . VAL B 1 243 ? 7.603   41.861 40.789  1.00 46.67  ? 243 VAL B O   1 
ATOM   5142 C CB  . VAL B 1 243 ? 10.006  43.903 40.742  1.00 48.24  ? 243 VAL B CB  1 
ATOM   5143 C CG1 . VAL B 1 243 ? 9.482   45.288 41.127  1.00 48.36  ? 243 VAL B CG1 1 
ATOM   5144 C CG2 . VAL B 1 243 ? 11.527  43.934 40.553  1.00 48.00  ? 243 VAL B CG2 1 
ATOM   5145 N N   . PRO B 1 244 ? 7.211   43.128 42.614  1.00 41.59  ? 244 PRO B N   1 
ATOM   5146 C CA  . PRO B 1 244 ? 5.747   42.931 42.497  1.00 39.68  ? 244 PRO B CA  1 
ATOM   5147 C C   . PRO B 1 244 ? 5.221   43.449 41.158  1.00 37.55  ? 244 PRO B C   1 
ATOM   5148 O O   . PRO B 1 244 ? 5.715   44.457 40.645  1.00 36.00  ? 244 PRO B O   1 
ATOM   5149 C CB  . PRO B 1 244 ? 5.170   43.762 43.654  1.00 42.52  ? 244 PRO B CB  1 
ATOM   5150 C CG  . PRO B 1 244 ? 6.295   43.975 44.575  1.00 48.32  ? 244 PRO B CG  1 
ATOM   5151 C CD  . PRO B 1 244 ? 7.542   44.007 43.753  1.00 43.82  ? 244 PRO B CD  1 
ATOM   5152 N N   . THR B 1 245 ? 4.253   42.733 40.578  1.00 30.56  ? 245 THR B N   1 
ATOM   5153 C CA  . THR B 1 245 ? 3.670   43.057 39.273  1.00 28.01  ? 245 THR B CA  1 
ATOM   5154 C C   . THR B 1 245 ? 2.481   44.022 39.409  1.00 29.77  ? 245 THR B C   1 
ATOM   5155 O O   . THR B 1 245 ? 1.894   44.127 40.492  1.00 29.00  ? 245 THR B O   1 
ATOM   5156 C CB  . THR B 1 245 ? 3.247   41.763 38.531  1.00 26.12  ? 245 THR B CB  1 
ATOM   5157 O OG1 . THR B 1 245 ? 2.252   41.089 39.302  1.00 27.69  ? 245 THR B OG1 1 
ATOM   5158 C CG2 . THR B 1 245 ? 4.408   40.831 38.237  1.00 20.82  ? 245 THR B CG2 1 
ATOM   5159 N N   . PHE B 1 246 ? 2.105   44.689 38.291  1.00 24.31  ? 246 PHE B N   1 
ATOM   5160 C CA  . PHE B 1 246 ? 0.939   45.563 38.233  1.00 24.75  ? 246 PHE B CA  1 
ATOM   5161 C C   . PHE B 1 246 ? -0.347  44.827 38.677  1.00 31.38  ? 246 PHE B C   1 
ATOM   5162 O O   . PHE B 1 246 ? -1.164  45.403 39.406  1.00 31.68  ? 246 PHE B O   1 
ATOM   5163 C CB  . PHE B 1 246 ? 0.766   46.183 36.836  1.00 25.41  ? 246 PHE B CB  1 
ATOM   5164 C CG  . PHE B 1 246 ? 1.566   47.446 36.636  1.00 26.48  ? 246 PHE B CG  1 
ATOM   5165 C CD1 . PHE B 1 246 ? 2.591   47.497 35.694  1.00 28.19  ? 246 PHE B CD1 1 
ATOM   5166 C CD2 . PHE B 1 246 ? 1.330   48.572 37.424  1.00 27.88  ? 246 PHE B CD2 1 
ATOM   5167 C CE1 . PHE B 1 246 ? 3.348   48.653 35.532  1.00 28.84  ? 246 PHE B CE1 1 
ATOM   5168 C CE2 . PHE B 1 246 ? 2.088   49.729 37.258  1.00 29.78  ? 246 PHE B CE2 1 
ATOM   5169 C CZ  . PHE B 1 246 ? 3.093   49.761 36.319  1.00 27.61  ? 246 PHE B CZ  1 
ATOM   5170 N N   . LEU B 1 247 ? -0.491  43.549 38.260  1.00 28.04  ? 247 LEU B N   1 
ATOM   5171 C CA  . LEU B 1 247 ? -1.608  42.671 38.602  1.00 28.25  ? 247 LEU B CA  1 
ATOM   5172 C C   . LEU B 1 247 ? -1.710  42.465 40.119  1.00 33.51  ? 247 LEU B C   1 
ATOM   5173 O O   . LEU B 1 247 ? -2.821  42.426 40.647  1.00 32.37  ? 247 LEU B O   1 
ATOM   5174 C CB  . LEU B 1 247 ? -1.455  41.318 37.874  1.00 27.59  ? 247 LEU B CB  1 
ATOM   5175 C CG  . LEU B 1 247 ? -2.419  40.174 38.259  1.00 31.09  ? 247 LEU B CG  1 
ATOM   5176 C CD1 . LEU B 1 247 ? -3.820  40.434 37.752  1.00 30.77  ? 247 LEU B CD1 1 
ATOM   5177 C CD2 . LEU B 1 247 ? -1.922  38.834 37.744  1.00 30.57  ? 247 LEU B CD2 1 
ATOM   5178 N N   . SER B 1 248 ? -0.550  42.369 40.817  1.00 32.57  ? 248 SER B N   1 
ATOM   5179 C CA  . SER B 1 248 ? -0.494  42.172 42.281  1.00 33.26  ? 248 SER B CA  1 
ATOM   5180 C C   . SER B 1 248 ? -1.105  43.341 43.055  1.00 38.36  ? 248 SER B C   1 
ATOM   5181 O O   . SER B 1 248 ? -1.670  43.141 44.119  1.00 38.68  ? 248 SER B O   1 
ATOM   5182 C CB  . SER B 1 248 ? 0.930   41.875 42.754  1.00 35.12  ? 248 SER B CB  1 
ATOM   5183 O OG  . SER B 1 248 ? 1.711   43.034 42.998  1.00 42.61  ? 248 SER B OG  1 
ATOM   5184 N N   . MET B 1 249 ? -1.005  44.550 42.496  1.00 35.80  ? 249 MET B N   1 
ATOM   5185 C CA  . MET B 1 249 ? -1.505  45.781 43.097  1.00 36.09  ? 249 MET B CA  1 
ATOM   5186 C C   . MET B 1 249 ? -2.823  46.271 42.451  1.00 41.29  ? 249 MET B C   1 
ATOM   5187 O O   . MET B 1 249 ? -3.255  47.400 42.727  1.00 41.48  ? 249 MET B O   1 
ATOM   5188 C CB  . MET B 1 249 ? -0.392  46.868 43.119  1.00 37.82  ? 249 MET B CB  1 
ATOM   5189 C CG  . MET B 1 249 ? 0.173   47.214 41.758  1.00 40.14  ? 249 MET B CG  1 
ATOM   5190 S SD  . MET B 1 249 ? 1.565   48.387 41.782  1.00 44.86  ? 249 MET B SD  1 
ATOM   5191 C CE  . MET B 1 249 ? 2.895   47.327 42.208  1.00 40.68  ? 249 MET B CE  1 
ATOM   5192 N N   . ASP B 1 250 ? -3.474  45.409 41.624  1.00 37.49  ? 250 ASP B N   1 
ATOM   5193 C CA  . ASP B 1 250 ? -4.699  45.762 40.890  1.00 37.19  ? 250 ASP B CA  1 
ATOM   5194 C C   . ASP B 1 250 ? -5.996  45.734 41.709  1.00 44.34  ? 250 ASP B C   1 
ATOM   5195 O O   . ASP B 1 250 ? -6.821  44.825 41.566  1.00 45.51  ? 250 ASP B O   1 
ATOM   5196 C CB  . ASP B 1 250 ? -4.820  45.001 39.560  1.00 37.07  ? 250 ASP B CB  1 
ATOM   5197 C CG  . ASP B 1 250 ? -5.953  45.471 38.658  1.00 40.00  ? 250 ASP B CG  1 
ATOM   5198 O OD1 . ASP B 1 250 ? -6.344  46.666 38.752  1.00 38.34  ? 250 ASP B OD1 1 
ATOM   5199 O OD2 . ASP B 1 250 ? -6.422  44.661 37.832  1.00 44.35  ? 250 ASP B OD2 1 
ATOM   5200 N N   . VAL B 1 251 ? -6.184  46.763 42.534  1.00 41.05  ? 251 VAL B N   1 
ATOM   5201 C CA  . VAL B 1 251 ? -7.333  46.927 43.418  1.00 41.56  ? 251 VAL B CA  1 
ATOM   5202 C C   . VAL B 1 251 ? -8.636  47.193 42.626  1.00 42.88  ? 251 VAL B C   1 
ATOM   5203 O O   . VAL B 1 251 ? -9.697  46.717 43.028  1.00 42.26  ? 251 VAL B O   1 
ATOM   5204 C CB  . VAL B 1 251 ? -7.004  48.032 44.463  1.00 47.57  ? 251 VAL B CB  1 
ATOM   5205 C CG1 . VAL B 1 251 ? -8.203  48.371 45.346  1.00 48.99  ? 251 VAL B CG1 1 
ATOM   5206 C CG2 . VAL B 1 251 ? -5.809  47.627 45.320  1.00 47.50  ? 251 VAL B CG2 1 
ATOM   5207 N N   . ASP B 1 252 ? -8.535  47.923 41.494  1.00 37.89  ? 252 ASP B N   1 
ATOM   5208 C CA  . ASP B 1 252 ? -9.653  48.350 40.629  1.00 36.50  ? 252 ASP B CA  1 
ATOM   5209 C C   . ASP B 1 252 ? -10.078 47.372 39.538  1.00 36.16  ? 252 ASP B C   1 
ATOM   5210 O O   . ASP B 1 252 ? -11.197 47.484 39.036  1.00 34.61  ? 252 ASP B O   1 
ATOM   5211 C CB  . ASP B 1 252 ? -9.323  49.692 39.948  1.00 38.32  ? 252 ASP B CB  1 
ATOM   5212 C CG  . ASP B 1 252 ? -8.836  50.804 40.853  1.00 50.54  ? 252 ASP B CG  1 
ATOM   5213 O OD1 . ASP B 1 252 ? -8.738  50.577 42.085  1.00 51.86  ? 252 ASP B OD1 1 
ATOM   5214 O OD2 . ASP B 1 252 ? -8.549  51.897 40.335  1.00 56.64  ? 252 ASP B OD2 1 
ATOM   5215 N N   . GLY B 1 253 ? -9.182  46.478 39.128  1.00 31.06  ? 253 GLY B N   1 
ATOM   5216 C CA  . GLY B 1 253 ? -9.474  45.559 38.033  1.00 29.39  ? 253 GLY B CA  1 
ATOM   5217 C C   . GLY B 1 253 ? -9.297  46.273 36.708  1.00 31.48  ? 253 GLY B C   1 
ATOM   5218 O O   . GLY B 1 253 ? -10.161 46.209 35.835  1.00 29.62  ? 253 GLY B O   1 
ATOM   5219 N N   . ARG B 1 254 ? -8.184  47.016 36.587  1.00 28.16  ? 254 ARG B N   1 
ATOM   5220 C CA  . ARG B 1 254 ? -7.830  47.785 35.395  1.00 27.23  ? 254 ARG B CA  1 
ATOM   5221 C C   . ARG B 1 254 ? -6.584  47.224 34.691  1.00 29.50  ? 254 ARG B C   1 
ATOM   5222 O O   . ARG B 1 254 ? -6.101  47.842 33.743  1.00 28.02  ? 254 ARG B O   1 
ATOM   5223 C CB  . ARG B 1 254 ? -7.665  49.283 35.719  1.00 25.50  ? 254 ARG B CB  1 
ATOM   5224 C CG  . ARG B 1 254 ? -6.625  49.623 36.799  1.00 30.13  ? 254 ARG B CG  1 
ATOM   5225 C CD  . ARG B 1 254 ? -6.408  51.125 36.955  1.00 27.48  ? 254 ARG B CD  1 
ATOM   5226 N NE  . ARG B 1 254 ? -7.567  51.825 37.528  1.00 32.59  ? 254 ARG B NE  1 
ATOM   5227 C CZ  . ARG B 1 254 ? -8.452  52.528 36.823  1.00 48.14  ? 254 ARG B CZ  1 
ATOM   5228 N NH1 . ARG B 1 254 ? -8.344  52.613 35.501  1.00 28.61  ? 254 ARG B NH1 1 
ATOM   5229 N NH2 . ARG B 1 254 ? -9.457  53.141 37.430  1.00 45.96  ? 254 ARG B NH2 1 
ATOM   5230 N N   . VAL B 1 255 ? -6.103  46.034 35.117  1.00 25.09  ? 255 VAL B N   1 
ATOM   5231 C CA  . VAL B 1 255 ? -4.891  45.422 34.568  1.00 23.78  ? 255 VAL B CA  1 
ATOM   5232 C C   . VAL B 1 255 ? -5.148  44.157 33.736  1.00 28.62  ? 255 VAL B C   1 
ATOM   5233 O O   . VAL B 1 255 ? -5.837  43.244 34.201  1.00 29.50  ? 255 VAL B O   1 
ATOM   5234 C CB  . VAL B 1 255 ? -3.813  45.220 35.681  1.00 26.25  ? 255 VAL B CB  1 
ATOM   5235 C CG1 . VAL B 1 255 ? -2.579  44.503 35.159  1.00 24.86  ? 255 VAL B CG1 1 
ATOM   5236 C CG2 . VAL B 1 255 ? -3.417  46.547 36.325  1.00 26.65  ? 255 VAL B CG2 1 
ATOM   5237 N N   . ILE B 1 256 ? -4.585  44.120 32.508  1.00 24.34  ? 256 ILE B N   1 
ATOM   5238 C CA  . ILE B 1 256 ? -4.602  42.966 31.611  1.00 24.15  ? 256 ILE B CA  1 
ATOM   5239 C C   . ILE B 1 256 ? -3.148  42.502 31.509  1.00 30.49  ? 256 ILE B C   1 
ATOM   5240 O O   . ILE B 1 256 ? -2.307  43.226 30.971  1.00 31.58  ? 256 ILE B O   1 
ATOM   5241 C CB  . ILE B 1 256 ? -5.224  43.243 30.213  1.00 27.33  ? 256 ILE B CB  1 
ATOM   5242 C CG1 . ILE B 1 256 ? -6.708  43.631 30.313  1.00 28.21  ? 256 ILE B CG1 1 
ATOM   5243 C CG2 . ILE B 1 256 ? -5.046  42.027 29.290  1.00 28.32  ? 256 ILE B CG2 1 
ATOM   5244 C CD1 . ILE B 1 256 ? -7.211  44.508 29.162  1.00 32.02  ? 256 ILE B CD1 1 
ATOM   5245 N N   . ARG B 1 257 ? -2.856  41.305 32.038  1.00 27.08  ? 257 ARG B N   1 
ATOM   5246 C CA  . ARG B 1 257 ? -1.528  40.700 32.058  1.00 26.02  ? 257 ARG B CA  1 
ATOM   5247 C C   . ARG B 1 257 ? -1.377  39.566 31.056  1.00 29.58  ? 257 ARG B C   1 
ATOM   5248 O O   . ARG B 1 257 ? -2.184  38.639 31.055  1.00 29.08  ? 257 ARG B O   1 
ATOM   5249 C CB  . ARG B 1 257 ? -1.200  40.185 33.479  1.00 25.22  ? 257 ARG B CB  1 
ATOM   5250 C CG  . ARG B 1 257 ? 0.207   39.605 33.581  1.00 34.70  ? 257 ARG B CG  1 
ATOM   5251 C CD  . ARG B 1 257 ? 0.507   38.918 34.895  1.00 40.56  ? 257 ARG B CD  1 
ATOM   5252 N NE  . ARG B 1 257 ? 1.797   38.234 34.834  1.00 44.03  ? 257 ARG B NE  1 
ATOM   5253 C CZ  . ARG B 1 257 ? 2.970   38.838 34.989  1.00 56.75  ? 257 ARG B CZ  1 
ATOM   5254 N NH1 . ARG B 1 257 ? 4.096   38.146 34.900  1.00 40.43  ? 257 ARG B NH1 1 
ATOM   5255 N NH2 . ARG B 1 257 ? 3.027   40.142 35.223  1.00 47.56  ? 257 ARG B NH2 1 
ATOM   5256 N N   . ALA B 1 258 ? -0.299  39.606 30.252  1.00 26.54  ? 258 ALA B N   1 
ATOM   5257 C CA  . ALA B 1 258 ? 0.061   38.541 29.312  1.00 25.06  ? 258 ALA B CA  1 
ATOM   5258 C C   . ALA B 1 258 ? 1.298   37.822 29.832  1.00 30.25  ? 258 ALA B C   1 
ATOM   5259 O O   . ALA B 1 258 ? 2.265   38.471 30.235  1.00 28.76  ? 258 ALA B O   1 
ATOM   5260 C CB  . ALA B 1 258 ? 0.339   39.110 27.941  1.00 25.14  ? 258 ALA B CB  1 
ATOM   5261 N N   . ASP B 1 259 ? 1.237   36.472 29.868  1.00 29.03  ? 259 ASP B N   1 
ATOM   5262 C CA  . ASP B 1 259 ? 2.321   35.564 30.260  1.00 29.05  ? 259 ASP B CA  1 
ATOM   5263 C C   . ASP B 1 259 ? 2.644   34.631 29.093  1.00 35.74  ? 259 ASP B C   1 
ATOM   5264 O O   . ASP B 1 259 ? 1.750   34.272 28.320  1.00 35.29  ? 259 ASP B O   1 
ATOM   5265 C CB  . ASP B 1 259 ? 1.936   34.737 31.479  1.00 30.69  ? 259 ASP B CB  1 
ATOM   5266 C CG  . ASP B 1 259 ? 1.872   35.517 32.776  1.00 46.88  ? 259 ASP B CG  1 
ATOM   5267 O OD1 . ASP B 1 259 ? 2.952   35.854 33.319  1.00 47.55  ? 259 ASP B OD1 1 
ATOM   5268 O OD2 . ASP B 1 259 ? 0.737   35.736 33.286  1.00 55.00  ? 259 ASP B OD2 1 
ATOM   5269 N N   . SER B 1 260 ? 3.918   34.229 28.976  1.00 34.17  ? 260 SER B N   1 
ATOM   5270 C CA  . SER B 1 260 ? 4.377   33.369 27.897  1.00 34.43  ? 260 SER B CA  1 
ATOM   5271 C C   . SER B 1 260 ? 5.306   32.237 28.366  1.00 39.02  ? 260 SER B C   1 
ATOM   5272 O O   . SER B 1 260 ? 6.196   32.458 29.192  1.00 38.94  ? 260 SER B O   1 
ATOM   5273 C CB  . SER B 1 260 ? 5.070   34.205 26.822  1.00 37.29  ? 260 SER B CB  1 
ATOM   5274 O OG  . SER B 1 260 ? 5.445   33.426 25.698  1.00 45.67  ? 260 SER B OG  1 
ATOM   5275 N N   . PHE B 1 261 ? 5.128   31.042 27.777  1.00 34.66  ? 261 PHE B N   1 
ATOM   5276 C CA  . PHE B 1 261 ? 5.985   29.884 28.031  1.00 34.54  ? 261 PHE B CA  1 
ATOM   5277 C C   . PHE B 1 261 ? 7.152   29.795 27.015  1.00 36.44  ? 261 PHE B C   1 
ATOM   5278 O O   . PHE B 1 261 ? 8.014   28.931 27.157  1.00 35.49  ? 261 PHE B O   1 
ATOM   5279 C CB  . PHE B 1 261 ? 5.155   28.589 27.994  1.00 36.58  ? 261 PHE B CB  1 
ATOM   5280 C CG  . PHE B 1 261 ? 4.313   28.336 29.215  1.00 37.78  ? 261 PHE B CG  1 
ATOM   5281 C CD1 . PHE B 1 261 ? 4.869   28.393 30.488  1.00 40.74  ? 261 PHE B CD1 1 
ATOM   5282 C CD2 . PHE B 1 261 ? 2.972   27.996 29.093  1.00 40.00  ? 261 PHE B CD2 1 
ATOM   5283 C CE1 . PHE B 1 261 ? 4.091   28.159 31.617  1.00 42.13  ? 261 PHE B CE1 1 
ATOM   5284 C CE2 . PHE B 1 261 ? 2.192   27.754 30.223  1.00 43.25  ? 261 PHE B CE2 1 
ATOM   5285 C CZ  . PHE B 1 261 ? 2.759   27.827 31.480  1.00 41.77  ? 261 PHE B CZ  1 
ATOM   5286 N N   . SER B 1 262 ? 7.168   30.693 26.005  1.00 32.35  ? 262 SER B N   1 
ATOM   5287 C CA  . SER B 1 262 ? 8.138   30.753 24.909  1.00 32.06  ? 262 SER B CA  1 
ATOM   5288 C C   . SER B 1 262 ? 9.600   30.829 25.320  1.00 36.87  ? 262 SER B C   1 
ATOM   5289 O O   . SER B 1 262 ? 10.451  30.198 24.675  1.00 36.56  ? 262 SER B O   1 
ATOM   5290 C CB  . SER B 1 262 ? 7.803   31.884 23.945  1.00 33.87  ? 262 SER B CB  1 
ATOM   5291 O OG  . SER B 1 262 ? 6.574   31.626 23.294  1.00 43.37  ? 262 SER B OG  1 
ATOM   5292 N N   . LYS B 1 263 ? 9.901   31.586 26.382  1.00 32.94  ? 263 LYS B N   1 
ATOM   5293 C CA  . LYS B 1 263 ? 11.285  31.732 26.828  1.00 32.83  ? 263 LYS B CA  1 
ATOM   5294 C C   . LYS B 1 263 ? 11.701  30.670 27.852  1.00 35.77  ? 263 LYS B C   1 
ATOM   5295 O O   . LYS B 1 263 ? 12.891  30.471 28.064  1.00 35.53  ? 263 LYS B O   1 
ATOM   5296 C CB  . LYS B 1 263 ? 11.543  33.172 27.334  1.00 35.33  ? 263 LYS B CB  1 
ATOM   5297 C CG  . LYS B 1 263 ? 11.769  34.215 26.216  1.00 45.12  ? 263 LYS B CG  1 
ATOM   5298 C CD  . LYS B 1 263 ? 10.482  34.806 25.614  1.00 53.01  ? 263 LYS B CD  1 
ATOM   5299 C CE  . LYS B 1 263 ? 10.711  35.623 24.345  1.00 68.48  ? 263 LYS B CE  1 
ATOM   5300 N NZ  . LYS B 1 263 ? 11.056  34.795 23.145  1.00 70.24  ? 263 LYS B NZ  1 
ATOM   5301 N N   . ILE B 1 264 ? 10.728  29.942 28.430  1.00 32.29  ? 264 ILE B N   1 
ATOM   5302 C CA  . ILE B 1 264 ? 10.965  28.959 29.493  1.00 32.86  ? 264 ILE B CA  1 
ATOM   5303 C C   . ILE B 1 264 ? 10.631  27.483 29.213  1.00 36.72  ? 264 ILE B C   1 
ATOM   5304 O O   . ILE B 1 264 ? 11.309  26.606 29.757  1.00 36.47  ? 264 ILE B O   1 
ATOM   5305 C CB  . ILE B 1 264 ? 10.415  29.465 30.861  1.00 36.50  ? 264 ILE B CB  1 
ATOM   5306 C CG1 . ILE B 1 264 ? 8.922   29.906 30.751  1.00 36.59  ? 264 ILE B CG1 1 
ATOM   5307 C CG2 . ILE B 1 264 ? 11.291  30.613 31.392  1.00 37.84  ? 264 ILE B CG2 1 
ATOM   5308 C CD1 . ILE B 1 264 ? 8.149   30.032 32.070  1.00 42.31  ? 264 ILE B CD1 1 
ATOM   5309 N N   . ILE B 1 265 ? 9.594   27.199 28.394  1.00 33.39  ? 265 ILE B N   1 
ATOM   5310 C CA  . ILE B 1 265 ? 9.190   25.820 28.079  1.00 33.76  ? 265 ILE B CA  1 
ATOM   5311 C C   . ILE B 1 265 ? 9.317   25.463 26.589  1.00 40.95  ? 265 ILE B C   1 
ATOM   5312 O O   . ILE B 1 265 ? 9.985   24.474 26.265  1.00 43.17  ? 265 ILE B O   1 
ATOM   5313 C CB  . ILE B 1 265 ? 7.850   25.422 28.752  1.00 35.95  ? 265 ILE B CB  1 
ATOM   5314 C CG1 . ILE B 1 265 ? 8.121   24.951 30.180  1.00 36.34  ? 265 ILE B CG1 1 
ATOM   5315 C CG2 . ILE B 1 265 ? 7.093   24.343 27.977  1.00 37.18  ? 265 ILE B CG2 1 
ATOM   5316 C CD1 . ILE B 1 265 ? 7.113   25.435 31.225  1.00 45.23  ? 265 ILE B CD1 1 
ATOM   5317 N N   . SER B 1 266 ? 8.692   26.264 25.696  1.00 36.15  ? 266 SER B N   1 
ATOM   5318 C CA  . SER B 1 266 ? 8.733   26.091 24.241  1.00 35.45  ? 266 SER B CA  1 
ATOM   5319 C C   . SER B 1 266 ? 8.043   27.244 23.524  1.00 38.68  ? 266 SER B C   1 
ATOM   5320 O O   . SER B 1 266 ? 6.927   27.627 23.885  1.00 38.07  ? 266 SER B O   1 
ATOM   5321 C CB  . SER B 1 266 ? 8.100   24.768 23.817  1.00 37.97  ? 266 SER B CB  1 
ATOM   5322 O OG  . SER B 1 266 ? 7.935   24.681 22.413  1.00 43.85  ? 266 SER B OG  1 
ATOM   5323 N N   . SER B 1 267 ? 8.698   27.759 22.482  1.00 34.96  ? 267 SER B N   1 
ATOM   5324 C CA  . SER B 1 267 ? 8.179   28.825 21.633  1.00 34.56  ? 267 SER B CA  1 
ATOM   5325 C C   . SER B 1 267 ? 7.340   28.259 20.462  1.00 35.49  ? 267 SER B C   1 
ATOM   5326 O O   . SER B 1 267 ? 6.343   28.867 20.062  1.00 32.95  ? 267 SER B O   1 
ATOM   5327 C CB  . SER B 1 267 ? 9.329   29.682 21.110  1.00 39.34  ? 267 SER B CB  1 
ATOM   5328 O OG  . SER B 1 267 ? 10.329  28.864 20.519  1.00 49.62  ? 267 SER B OG  1 
ATOM   5329 N N   . GLY B 1 268 ? 7.753   27.097 19.953  1.00 32.13  ? 268 GLY B N   1 
ATOM   5330 C CA  . GLY B 1 268 ? 7.101   26.410 18.841  1.00 32.43  ? 268 GLY B CA  1 
ATOM   5331 C C   . GLY B 1 268 ? 5.785   25.729 19.156  1.00 36.35  ? 268 GLY B C   1 
ATOM   5332 O O   . GLY B 1 268 ? 5.065   25.341 18.234  1.00 36.69  ? 268 GLY B O   1 
ATOM   5333 N N   . LEU B 1 269 ? 5.472   25.545 20.450  1.00 32.29  ? 269 LEU B N   1 
ATOM   5334 C CA  . LEU B 1 269 ? 4.231   24.914 20.864  1.00 32.65  ? 269 LEU B CA  1 
ATOM   5335 C C   . LEU B 1 269 ? 3.052   25.893 20.799  1.00 38.60  ? 269 LEU B C   1 
ATOM   5336 O O   . LEU B 1 269 ? 1.903   25.451 20.729  1.00 39.85  ? 269 LEU B O   1 
ATOM   5337 C CB  . LEU B 1 269 ? 4.343   24.288 22.268  1.00 33.01  ? 269 LEU B CB  1 
ATOM   5338 C CG  . LEU B 1 269 ? 5.101   22.959 22.434  1.00 38.61  ? 269 LEU B CG  1 
ATOM   5339 C CD1 . LEU B 1 269 ? 4.961   22.454 23.854  1.00 38.33  ? 269 LEU B CD1 1 
ATOM   5340 C CD2 . LEU B 1 269 ? 4.610   21.882 21.468  1.00 43.60  ? 269 LEU B CD2 1 
ATOM   5341 N N   . ARG B 1 270 ? 3.336   27.223 20.804  1.00 34.51  ? 270 ARG B N   1 
ATOM   5342 C CA  . ARG B 1 270 ? 2.364   28.337 20.734  1.00 32.27  ? 270 ARG B CA  1 
ATOM   5343 C C   . ARG B 1 270 ? 1.343   28.272 21.875  1.00 35.60  ? 270 ARG B C   1 
ATOM   5344 O O   . ARG B 1 270 ? 0.158   28.013 21.650  1.00 35.90  ? 270 ARG B O   1 
ATOM   5345 C CB  . ARG B 1 270 ? 1.675   28.436 19.344  1.00 27.66  ? 270 ARG B CB  1 
ATOM   5346 C CG  . ARG B 1 270 ? 2.582   28.439 18.108  1.00 29.37  ? 270 ARG B CG  1 
ATOM   5347 C CD  . ARG B 1 270 ? 3.673   29.508 18.121  1.00 36.71  ? 270 ARG B CD  1 
ATOM   5348 N NE  . ARG B 1 270 ? 3.168   30.878 18.282  1.00 34.82  ? 270 ARG B NE  1 
ATOM   5349 C CZ  . ARG B 1 270 ? 3.576   31.717 19.227  1.00 41.09  ? 270 ARG B CZ  1 
ATOM   5350 N NH1 . ARG B 1 270 ? 4.486   31.335 20.117  1.00 18.08  ? 270 ARG B NH1 1 
ATOM   5351 N NH2 . ARG B 1 270 ? 3.072   32.944 19.296  1.00 36.89  ? 270 ARG B NH2 1 
ATOM   5352 N N   . ILE B 1 271 ? 1.826   28.441 23.106  1.00 31.86  ? 271 ILE B N   1 
ATOM   5353 C CA  . ILE B 1 271 ? 1.005   28.390 24.312  1.00 31.85  ? 271 ILE B CA  1 
ATOM   5354 C C   . ILE B 1 271 ? 1.407   29.526 25.251  1.00 35.79  ? 271 ILE B C   1 
ATOM   5355 O O   . ILE B 1 271 ? 2.551   29.577 25.729  1.00 38.77  ? 271 ILE B O   1 
ATOM   5356 C CB  . ILE B 1 271 ? 1.057   26.987 25.023  1.00 35.43  ? 271 ILE B CB  1 
ATOM   5357 C CG1 . ILE B 1 271 ? 0.444   25.839 24.167  1.00 35.91  ? 271 ILE B CG1 1 
ATOM   5358 C CG2 . ILE B 1 271 ? 0.455   27.025 26.447  1.00 36.57  ? 271 ILE B CG2 1 
ATOM   5359 C CD1 . ILE B 1 271 ? -1.131  25.910 23.835  1.00 45.02  ? 271 ILE B CD1 1 
ATOM   5360 N N   . GLY B 1 272 ? 0.449   30.409 25.497  1.00 27.52  ? 272 GLY B N   1 
ATOM   5361 C CA  . GLY B 1 272 ? 0.551   31.524 26.420  1.00 25.47  ? 272 GLY B CA  1 
ATOM   5362 C C   . GLY B 1 272 ? -0.751  31.666 27.184  1.00 27.70  ? 272 GLY B C   1 
ATOM   5363 O O   . GLY B 1 272 ? -1.685  30.879 26.981  1.00 25.11  ? 272 GLY B O   1 
ATOM   5364 N N   . PHE B 1 273 ? -0.839  32.686 28.056  1.00 25.40  ? 273 PHE B N   1 
ATOM   5365 C CA  . PHE B 1 273 ? -2.056  32.936 28.823  1.00 25.37  ? 273 PHE B CA  1 
ATOM   5366 C C   . PHE B 1 273 ? -2.263  34.386 29.182  1.00 31.42  ? 273 PHE B C   1 
ATOM   5367 O O   . PHE B 1 273 ? -1.300  35.122 29.419  1.00 33.04  ? 273 PHE B O   1 
ATOM   5368 C CB  . PHE B 1 273 ? -2.209  31.992 30.039  1.00 27.01  ? 273 PHE B CB  1 
ATOM   5369 C CG  . PHE B 1 273 ? -1.038  31.891 30.991  1.00 28.11  ? 273 PHE B CG  1 
ATOM   5370 C CD1 . PHE B 1 273 ? 0.096   31.165 30.652  1.00 30.74  ? 273 PHE B CD1 1 
ATOM   5371 C CD2 . PHE B 1 273 ? -1.096  32.467 32.252  1.00 30.16  ? 273 PHE B CD2 1 
ATOM   5372 C CE1 . PHE B 1 273 ? 1.173   31.074 31.532  1.00 32.02  ? 273 PHE B CE1 1 
ATOM   5373 C CE2 . PHE B 1 273 ? -0.035  32.341 33.147  1.00 33.06  ? 273 PHE B CE2 1 
ATOM   5374 C CZ  . PHE B 1 273 ? 1.091   31.642 32.784  1.00 31.38  ? 273 PHE B CZ  1 
ATOM   5375 N N   . LEU B 1 274 ? -3.531  34.797 29.203  1.00 26.81  ? 274 LEU B N   1 
ATOM   5376 C CA  . LEU B 1 274 ? -3.965  36.151 29.504  1.00 26.42  ? 274 LEU B CA  1 
ATOM   5377 C C   . LEU B 1 274 ? -4.710  36.143 30.827  1.00 30.69  ? 274 LEU B C   1 
ATOM   5378 O O   . LEU B 1 274 ? -5.523  35.251 31.065  1.00 30.50  ? 274 LEU B O   1 
ATOM   5379 C CB  . LEU B 1 274 ? -4.909  36.590 28.387  1.00 26.98  ? 274 LEU B CB  1 
ATOM   5380 C CG  . LEU B 1 274 ? -4.762  37.998 27.863  1.00 32.58  ? 274 LEU B CG  1 
ATOM   5381 C CD1 . LEU B 1 274 ? -3.418  38.193 27.172  1.00 32.72  ? 274 LEU B CD1 1 
ATOM   5382 C CD2 . LEU B 1 274 ? -5.868  38.289 26.890  1.00 35.50  ? 274 LEU B CD2 1 
ATOM   5383 N N   . THR B 1 275 ? -4.429  37.124 31.693  1.00 27.60  ? 275 THR B N   1 
ATOM   5384 C CA  . THR B 1 275 ? -5.061  37.270 33.004  1.00 27.34  ? 275 THR B CA  1 
ATOM   5385 C C   . THR B 1 275 ? -5.598  38.681 33.081  1.00 31.73  ? 275 THR B C   1 
ATOM   5386 O O   . THR B 1 275 ? -4.891  39.619 32.733  1.00 31.93  ? 275 THR B O   1 
ATOM   5387 C CB  . THR B 1 275 ? -4.064  37.021 34.141  1.00 33.24  ? 275 THR B CB  1 
ATOM   5388 O OG1 . THR B 1 275 ? -3.120  36.020 33.758  1.00 33.65  ? 275 THR B OG1 1 
ATOM   5389 C CG2 . THR B 1 275 ? -4.750  36.657 35.447  1.00 32.91  ? 275 THR B CG2 1 
ATOM   5390 N N   . GLY B 1 276 ? -6.843  38.818 33.515  1.00 27.43  ? 276 GLY B N   1 
ATOM   5391 C CA  . GLY B 1 276 ? -7.510  40.101 33.627  1.00 26.26  ? 276 GLY B CA  1 
ATOM   5392 C C   . GLY B 1 276 ? -8.961  39.994 34.035  1.00 28.51  ? 276 GLY B C   1 
ATOM   5393 O O   . GLY B 1 276 ? -9.414  38.915 34.437  1.00 26.51  ? 276 GLY B O   1 
ATOM   5394 N N   . PRO B 1 277 ? -9.700  41.133 33.949  1.00 26.32  ? 277 PRO B N   1 
ATOM   5395 C CA  . PRO B 1 277 ? -11.108 41.138 34.360  1.00 26.73  ? 277 PRO B CA  1 
ATOM   5396 C C   . PRO B 1 277 ? -11.994 40.276 33.462  1.00 31.23  ? 277 PRO B C   1 
ATOM   5397 O O   . PRO B 1 277 ? -11.865 40.334 32.236  1.00 29.38  ? 277 PRO B O   1 
ATOM   5398 C CB  . PRO B 1 277 ? -11.490 42.625 34.287  1.00 28.83  ? 277 PRO B CB  1 
ATOM   5399 C CG  . PRO B 1 277 ? -10.224 43.365 34.239  1.00 32.59  ? 277 PRO B CG  1 
ATOM   5400 C CD  . PRO B 1 277 ? -9.280  42.483 33.517  1.00 27.78  ? 277 PRO B CD  1 
ATOM   5401 N N   . LYS B 1 278 ? -12.889 39.463 34.092  1.00 29.35  ? 278 LYS B N   1 
ATOM   5402 C CA  . LYS B 1 278 ? -13.838 38.572 33.405  1.00 28.82  ? 278 LYS B CA  1 
ATOM   5403 C C   . LYS B 1 278 ? -14.543 39.263 32.190  1.00 31.67  ? 278 LYS B C   1 
ATOM   5404 O O   . LYS B 1 278 ? -14.472 38.703 31.095  1.00 29.30  ? 278 LYS B O   1 
ATOM   5405 C CB  . LYS B 1 278 ? -14.833 37.952 34.409  1.00 31.39  ? 278 LYS B CB  1 
ATOM   5406 C CG  . LYS B 1 278 ? -15.702 36.830 33.837  1.00 51.31  ? 278 LYS B CG  1 
ATOM   5407 C CD  . LYS B 1 278 ? -16.229 35.892 34.932  1.00 67.89  ? 278 LYS B CD  1 
ATOM   5408 C CE  . LYS B 1 278 ? -15.303 34.732 35.243  1.00 82.09  ? 278 LYS B CE  1 
ATOM   5409 N NZ  . LYS B 1 278 ? -15.806 33.906 36.372  1.00 92.50  ? 278 LYS B NZ  1 
ATOM   5410 N N   . PRO B 1 279 ? -15.138 40.488 32.322  1.00 29.39  ? 279 PRO B N   1 
ATOM   5411 C CA  . PRO B 1 279 ? -15.747 41.133 31.141  1.00 29.85  ? 279 PRO B CA  1 
ATOM   5412 C C   . PRO B 1 279 ? -14.838 41.254 29.898  1.00 34.70  ? 279 PRO B C   1 
ATOM   5413 O O   . PRO B 1 279 ? -15.298 40.972 28.779  1.00 35.23  ? 279 PRO B O   1 
ATOM   5414 C CB  . PRO B 1 279 ? -16.188 42.502 31.675  1.00 31.74  ? 279 PRO B CB  1 
ATOM   5415 C CG  . PRO B 1 279 ? -16.338 42.323 33.111  1.00 35.67  ? 279 PRO B CG  1 
ATOM   5416 C CD  . PRO B 1 279 ? -15.307 41.338 33.527  1.00 30.65  ? 279 PRO B CD  1 
ATOM   5417 N N   . LEU B 1 280 ? -13.555 41.639 30.092  1.00 29.89  ? 280 LEU B N   1 
ATOM   5418 C CA  . LEU B 1 280 ? -12.575 41.781 29.006  1.00 28.98  ? 280 LEU B CA  1 
ATOM   5419 C C   . LEU B 1 280 ? -12.010 40.426 28.525  1.00 33.34  ? 280 LEU B C   1 
ATOM   5420 O O   . LEU B 1 280 ? -11.725 40.248 27.334  1.00 33.25  ? 280 LEU B O   1 
ATOM   5421 C CB  . LEU B 1 280 ? -11.446 42.724 29.424  1.00 28.99  ? 280 LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 280 ? -11.877 44.141 29.862  1.00 35.63  ? 280 LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 280 ? -10.756 44.872 30.594  1.00 35.70  ? 280 LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 280 ? -12.422 44.973 28.692  1.00 37.54  ? 280 LEU B CD2 1 
ATOM   5425 N N   . ILE B 1 281 ? -11.849 39.468 29.450  1.00 29.41  ? 281 ILE B N   1 
ATOM   5426 C CA  . ILE B 1 281 ? -11.348 38.140 29.108  1.00 28.03  ? 281 ILE B CA  1 
ATOM   5427 C C   . ILE B 1 281 ? -12.399 37.409 28.216  1.00 34.60  ? 281 ILE B C   1 
ATOM   5428 O O   . ILE B 1 281 ? -12.026 36.791 27.210  1.00 35.31  ? 281 ILE B O   1 
ATOM   5429 C CB  . ILE B 1 281 ? -10.890 37.352 30.375  1.00 29.64  ? 281 ILE B CB  1 
ATOM   5430 C CG1 . ILE B 1 281 ? -9.656  37.991 31.060  1.00 28.21  ? 281 ILE B CG1 1 
ATOM   5431 C CG2 . ILE B 1 281 ? -10.679 35.861 30.099  1.00 30.27  ? 281 ILE B CG2 1 
ATOM   5432 C CD1 . ILE B 1 281 ? -8.302  37.982 30.274  1.00 22.83  ? 281 ILE B CD1 1 
ATOM   5433 N N   . GLU B 1 282 ? -13.707 37.558 28.545  1.00 30.18  ? 282 GLU B N   1 
ATOM   5434 C CA  . GLU B 1 282 ? -14.826 36.990 27.793  1.00 28.85  ? 282 GLU B CA  1 
ATOM   5435 C C   . GLU B 1 282 ? -14.752 37.453 26.318  1.00 30.27  ? 282 GLU B C   1 
ATOM   5436 O O   . GLU B 1 282 ? -14.666 36.609 25.418  1.00 29.42  ? 282 GLU B O   1 
ATOM   5437 C CB  . GLU B 1 282 ? -16.147 37.386 28.471  1.00 31.14  ? 282 GLU B CB  1 
ATOM   5438 C CG  . GLU B 1 282 ? -17.405 36.816 27.828  1.00 49.59  ? 282 GLU B CG  1 
ATOM   5439 C CD  . GLU B 1 282 ? -18.704 37.475 28.262  1.00 91.51  ? 282 GLU B CD  1 
ATOM   5440 O OE1 . GLU B 1 282 ? -18.796 38.724 28.197  1.00 97.76  ? 282 GLU B OE1 1 
ATOM   5441 O OE2 . GLU B 1 282 ? -19.645 36.736 28.632  1.00 94.38  ? 282 GLU B OE2 1 
ATOM   5442 N N   . ARG B 1 283 ? -14.682 38.792 26.089  1.00 25.61  ? 283 ARG B N   1 
ATOM   5443 C CA  . ARG B 1 283 ? -14.555 39.430 24.766  1.00 24.18  ? 283 ARG B CA  1 
ATOM   5444 C C   . ARG B 1 283 ? -13.429 38.774 23.960  1.00 27.13  ? 283 ARG B C   1 
ATOM   5445 O O   . ARG B 1 283 ? -13.593 38.553 22.760  1.00 26.65  ? 283 ARG B O   1 
ATOM   5446 C CB  . ARG B 1 283 ? -14.238 40.940 24.918  1.00 20.99  ? 283 ARG B CB  1 
ATOM   5447 C CG  . ARG B 1 283 ? -15.356 41.833 25.446  1.00 25.84  ? 283 ARG B CG  1 
ATOM   5448 C CD  . ARG B 1 283 ? -16.650 41.803 24.624  1.00 19.32  ? 283 ARG B CD  1 
ATOM   5449 N NE  . ARG B 1 283 ? -17.599 40.908 25.286  1.00 24.75  ? 283 ARG B NE  1 
ATOM   5450 C CZ  . ARG B 1 283 ? -18.554 40.204 24.686  1.00 37.04  ? 283 ARG B CZ  1 
ATOM   5451 N NH1 . ARG B 1 283 ? -19.363 39.438 25.399  1.00 24.75  ? 283 ARG B NH1 1 
ATOM   5452 N NH2 . ARG B 1 283 ? -18.725 40.282 23.370  1.00 24.45  ? 283 ARG B NH2 1 
ATOM   5453 N N   . VAL B 1 284 ? -12.275 38.479 24.636  1.00 22.07  ? 284 VAL B N   1 
ATOM   5454 C CA  . VAL B 1 284 ? -11.089 37.851 24.040  1.00 20.51  ? 284 VAL B CA  1 
ATOM   5455 C C   . VAL B 1 284 ? -11.344 36.385 23.644  1.00 21.71  ? 284 VAL B C   1 
ATOM   5456 O O   . VAL B 1 284 ? -11.067 36.017 22.505  1.00 19.25  ? 284 VAL B O   1 
ATOM   5457 C CB  . VAL B 1 284 ? -9.821  38.080 24.899  1.00 23.53  ? 284 VAL B CB  1 
ATOM   5458 C CG1 . VAL B 1 284 ? -8.653  37.188 24.461  1.00 22.33  ? 284 VAL B CG1 1 
ATOM   5459 C CG2 . VAL B 1 284 ? -9.426  39.553 24.862  1.00 23.30  ? 284 VAL B CG2 1 
ATOM   5460 N N   . ILE B 1 285 ? -11.946 35.585 24.560  1.00 18.58  ? 285 ILE B N   1 
ATOM   5461 C CA  . ILE B 1 285 ? -12.333 34.177 24.322  1.00 17.25  ? 285 ILE B CA  1 
ATOM   5462 C C   . ILE B 1 285 ? -13.294 34.116 23.148  1.00 20.43  ? 285 ILE B C   1 
ATOM   5463 O O   . ILE B 1 285 ? -13.143 33.244 22.288  1.00 19.54  ? 285 ILE B O   1 
ATOM   5464 C CB  . ILE B 1 285 ? -12.942 33.484 25.587  1.00 19.67  ? 285 ILE B CB  1 
ATOM   5465 C CG1 . ILE B 1 285 ? -11.900 33.411 26.735  1.00 19.26  ? 285 ILE B CG1 1 
ATOM   5466 C CG2 . ILE B 1 285 ? -13.468 32.077 25.240  1.00 19.34  ? 285 ILE B CG2 1 
ATOM   5467 C CD1 . ILE B 1 285 ? -12.432 33.173 28.112  1.00 25.10  ? 285 ILE B CD1 1 
ATOM   5468 N N   . LEU B 1 286 ? -14.227 35.079 23.083  1.00 17.54  ? 286 LEU B N   1 
ATOM   5469 C CA  . LEU B 1 286 ? -15.207 35.142 22.013  1.00 19.03  ? 286 LEU B CA  1 
ATOM   5470 C C   . LEU B 1 286 ? -14.665 35.432 20.608  1.00 27.05  ? 286 LEU B C   1 
ATOM   5471 O O   . LEU B 1 286 ? -15.226 34.921 19.625  1.00 28.18  ? 286 LEU B O   1 
ATOM   5472 C CB  . LEU B 1 286 ? -16.391 36.008 22.398  1.00 19.32  ? 286 LEU B CB  1 
ATOM   5473 C CG  . LEU B 1 286 ? -17.233 35.401 23.505  1.00 23.26  ? 286 LEU B CG  1 
ATOM   5474 C CD1 . LEU B 1 286 ? -18.157 36.421 24.072  1.00 24.31  ? 286 LEU B CD1 1 
ATOM   5475 C CD2 . LEU B 1 286 ? -17.996 34.191 23.016  1.00 24.87  ? 286 LEU B CD2 1 
ATOM   5476 N N   . HIS B 1 287 ? -13.541 36.183 20.518  1.00 23.72  ? 287 HIS B N   1 
ATOM   5477 C CA  . HIS B 1 287 ? -12.861 36.457 19.256  1.00 23.94  ? 287 HIS B CA  1 
ATOM   5478 C C   . HIS B 1 287 ? -12.078 35.202 18.853  1.00 28.43  ? 287 HIS B C   1 
ATOM   5479 O O   . HIS B 1 287 ? -12.152 34.776 17.699  1.00 30.13  ? 287 HIS B O   1 
ATOM   5480 C CB  . HIS B 1 287 ? -11.891 37.640 19.405  1.00 24.80  ? 287 HIS B CB  1 
ATOM   5481 C CG  . HIS B 1 287 ? -11.490 38.281 18.099  1.00 28.30  ? 287 HIS B CG  1 
ATOM   5482 N ND1 . HIS B 1 287 ? -10.782 39.474 18.072  1.00 29.47  ? 287 HIS B ND1 1 
ATOM   5483 C CD2 . HIS B 1 287 ? -11.731 37.890 16.820  1.00 30.12  ? 287 HIS B CD2 1 
ATOM   5484 C CE1 . HIS B 1 287 ? -10.644 39.779 16.794  1.00 29.27  ? 287 HIS B CE1 1 
ATOM   5485 N NE2 . HIS B 1 287 ? -11.179 38.845 16.001  1.00 29.86  ? 287 HIS B NE2 1 
ATOM   5486 N N   . ILE B 1 288 ? -11.337 34.609 19.816  1.00 22.83  ? 288 ILE B N   1 
ATOM   5487 C CA  . ILE B 1 288 ? -10.551 33.398 19.616  1.00 21.55  ? 288 ILE B CA  1 
ATOM   5488 C C   . ILE B 1 288 ? -11.418 32.292 19.044  1.00 28.30  ? 288 ILE B C   1 
ATOM   5489 O O   . ILE B 1 288 ? -11.009 31.666 18.048  1.00 29.25  ? 288 ILE B O   1 
ATOM   5490 C CB  . ILE B 1 288 ? -9.796  32.986 20.895  1.00 22.86  ? 288 ILE B CB  1 
ATOM   5491 C CG1 . ILE B 1 288 ? -8.593  33.937 21.131  1.00 20.95  ? 288 ILE B CG1 1 
ATOM   5492 C CG2 . ILE B 1 288 ? -9.359  31.507 20.845  1.00 23.55  ? 288 ILE B CG2 1 
ATOM   5493 C CD1 . ILE B 1 288 ? -7.961  33.840 22.476  1.00 16.34  ? 288 ILE B CD1 1 
ATOM   5494 N N   . GLN B 1 289 ? -12.632 32.092 19.626  1.00 24.17  ? 289 GLN B N   1 
ATOM   5495 C CA  . GLN B 1 289 ? -13.622 31.103 19.167  1.00 23.72  ? 289 GLN B CA  1 
ATOM   5496 C C   . GLN B 1 289 ? -13.894 31.236 17.646  1.00 28.74  ? 289 GLN B C   1 
ATOM   5497 O O   . GLN B 1 289 ? -14.137 30.218 16.999  1.00 28.17  ? 289 GLN B O   1 
ATOM   5498 C CB  . GLN B 1 289 ? -14.919 31.220 19.987  1.00 24.81  ? 289 GLN B CB  1 
ATOM   5499 C CG  . GLN B 1 289 ? -15.957 30.120 19.759  1.00 29.32  ? 289 GLN B CG  1 
ATOM   5500 C CD  . GLN B 1 289 ? -17.188 30.312 20.624  1.00 50.62  ? 289 GLN B CD  1 
ATOM   5501 O OE1 . GLN B 1 289 ? -18.125 31.043 20.271  1.00 49.48  ? 289 GLN B OE1 1 
ATOM   5502 N NE2 . GLN B 1 289 ? -17.224 29.652 21.777  1.00 38.25  ? 289 GLN B NE2 1 
ATOM   5503 N N   . VAL B 1 290 ? -13.795 32.468 17.067  1.00 25.57  ? 290 VAL B N   1 
ATOM   5504 C CA  . VAL B 1 290 ? -14.002 32.658 15.619  1.00 25.96  ? 290 VAL B CA  1 
ATOM   5505 C C   . VAL B 1 290 ? -12.702 32.699 14.798  1.00 33.15  ? 290 VAL B C   1 
ATOM   5506 O O   . VAL B 1 290 ? -12.765 32.793 13.574  1.00 34.62  ? 290 VAL B O   1 
ATOM   5507 C CB  . VAL B 1 290 ? -15.034 33.752 15.210  1.00 28.92  ? 290 VAL B CB  1 
ATOM   5508 C CG1 . VAL B 1 290 ? -16.401 33.493 15.831  1.00 28.12  ? 290 VAL B CG1 1 
ATOM   5509 C CG2 . VAL B 1 290 ? -14.526 35.164 15.519  1.00 28.76  ? 290 VAL B CG2 1 
ATOM   5510 N N   . SER B 1 291 ? -11.534 32.631 15.451  1.00 30.88  ? 291 SER B N   1 
ATOM   5511 C CA  . SER B 1 291 ? -10.263 32.631 14.711  1.00 31.93  ? 291 SER B CA  1 
ATOM   5512 C C   . SER B 1 291 ? -9.694  31.205 14.679  1.00 36.62  ? 291 SER B C   1 
ATOM   5513 O O   . SER B 1 291 ? -9.924  30.476 13.713  1.00 37.06  ? 291 SER B O   1 
ATOM   5514 C CB  . SER B 1 291 ? -9.240  33.597 15.316  1.00 36.38  ? 291 SER B CB  1 
ATOM   5515 O OG  . SER B 1 291 ? -9.824  34.722 15.953  1.00 48.22  ? 291 SER B OG  1 
ATOM   5516 N N   . THR B 1 292 ? -9.009  30.792 15.767  1.00 30.18  ? 292 THR B N   1 
ATOM   5517 C CA  . THR B 1 292 ? -8.352  29.494 15.891  1.00 27.68  ? 292 THR B CA  1 
ATOM   5518 C C   . THR B 1 292 ? -9.211  28.432 16.558  1.00 29.15  ? 292 THR B C   1 
ATOM   5519 O O   . THR B 1 292 ? -8.782  27.294 16.648  1.00 27.71  ? 292 THR B O   1 
ATOM   5520 C CB  . THR B 1 292 ? -7.049  29.690 16.656  1.00 24.57  ? 292 THR B CB  1 
ATOM   5521 O OG1 . THR B 1 292 ? -7.336  30.431 17.841  1.00 27.89  ? 292 THR B OG1 1 
ATOM   5522 C CG2 . THR B 1 292 ? -6.020  30.418 15.851  1.00 12.80  ? 292 THR B CG2 1 
ATOM   5523 N N   . LEU B 1 293 ? -10.393 28.813 17.061  1.00 27.93  ? 293 LEU B N   1 
ATOM   5524 C CA  . LEU B 1 293 ? -11.367 27.982 17.804  1.00 29.47  ? 293 LEU B CA  1 
ATOM   5525 C C   . LEU B 1 293 ? -10.909 27.726 19.228  1.00 31.68  ? 293 LEU B C   1 
ATOM   5526 O O   . LEU B 1 293 ? -11.673 27.959 20.173  1.00 30.02  ? 293 LEU B O   1 
ATOM   5527 C CB  . LEU B 1 293 ? -11.716 26.631 17.124  1.00 30.98  ? 293 LEU B CB  1 
ATOM   5528 C CG  . LEU B 1 293 ? -12.718 26.623 15.976  1.00 37.77  ? 293 LEU B CG  1 
ATOM   5529 C CD1 . LEU B 1 293 ? -12.815 25.236 15.375  1.00 38.24  ? 293 LEU B CD1 1 
ATOM   5530 C CD2 . LEU B 1 293 ? -14.100 27.001 16.460  1.00 43.30  ? 293 LEU B CD2 1 
ATOM   5531 N N   . HIS B 1 294 ? -9.668  27.203 19.366  1.00 28.22  ? 294 HIS B N   1 
ATOM   5532 C CA  . HIS B 1 294 ? -9.008  26.867 20.628  1.00 27.99  ? 294 HIS B CA  1 
ATOM   5533 C C   . HIS B 1 294 ? -7.491  26.658 20.426  1.00 32.26  ? 294 HIS B C   1 
ATOM   5534 O O   . HIS B 1 294 ? -7.076  26.403 19.291  1.00 31.30  ? 294 HIS B O   1 
ATOM   5535 C CB  . HIS B 1 294 ? -9.648  25.592 21.267  1.00 29.22  ? 294 HIS B CB  1 
ATOM   5536 C CG  . HIS B 1 294 ? -9.540  24.340 20.446  1.00 33.13  ? 294 HIS B CG  1 
ATOM   5537 N ND1 . HIS B 1 294 ? -8.431  23.513 20.531  1.00 35.13  ? 294 HIS B ND1 1 
ATOM   5538 C CD2 . HIS B 1 294 ? -10.418 23.802 19.568  1.00 35.12  ? 294 HIS B CD2 1 
ATOM   5539 C CE1 . HIS B 1 294 ? -8.667  22.509 19.706  1.00 34.81  ? 294 HIS B CE1 1 
ATOM   5540 N NE2 . HIS B 1 294 ? -9.843  22.645 19.096  1.00 35.24  ? 294 HIS B NE2 1 
ATOM   5541 N N   . PRO B 1 295 ? -6.642  26.705 21.498  1.00 29.55  ? 295 PRO B N   1 
ATOM   5542 C CA  . PRO B 1 295 ? -5.216  26.378 21.303  1.00 29.00  ? 295 PRO B CA  1 
ATOM   5543 C C   . PRO B 1 295 ? -5.088  24.845 21.197  1.00 32.19  ? 295 PRO B C   1 
ATOM   5544 O O   . PRO B 1 295 ? -5.878  24.135 21.836  1.00 32.73  ? 295 PRO B O   1 
ATOM   5545 C CB  . PRO B 1 295 ? -4.531  26.927 22.576  1.00 30.47  ? 295 PRO B CB  1 
ATOM   5546 C CG  . PRO B 1 295 ? -5.625  27.597 23.396  1.00 35.19  ? 295 PRO B CG  1 
ATOM   5547 C CD  . PRO B 1 295 ? -6.919  26.989 22.922  1.00 31.28  ? 295 PRO B CD  1 
ATOM   5548 N N   . SER B 1 296 ? -4.140  24.340 20.357  1.00 26.17  ? 296 SER B N   1 
ATOM   5549 C CA  . SER B 1 296 ? -3.881  22.919 20.119  1.00 25.77  ? 296 SER B CA  1 
ATOM   5550 C C   . SER B 1 296 ? -4.110  22.052 21.391  1.00 29.04  ? 296 SER B C   1 
ATOM   5551 O O   . SER B 1 296 ? -3.509  22.327 22.437  1.00 26.83  ? 296 SER B O   1 
ATOM   5552 C CB  . SER B 1 296 ? -2.469  22.728 19.571  1.00 29.13  ? 296 SER B CB  1 
ATOM   5553 O OG  . SER B 1 296 ? -2.120  21.356 19.446  1.00 39.33  ? 296 SER B OG  1 
ATOM   5554 N N   . THR B 1 297 ? -5.022  21.051 21.307  1.00 25.83  ? 297 THR B N   1 
ATOM   5555 C CA  . THR B 1 297 ? -5.337  20.169 22.436  1.00 25.91  ? 297 THR B CA  1 
ATOM   5556 C C   . THR B 1 297 ? -4.096  19.364 22.820  1.00 32.21  ? 297 THR B C   1 
ATOM   5557 O O   . THR B 1 297 ? -3.760  19.287 24.011  1.00 32.56  ? 297 THR B O   1 
ATOM   5558 C CB  . THR B 1 297 ? -6.555  19.268 22.153  1.00 28.94  ? 297 THR B CB  1 
ATOM   5559 O OG1 . THR B 1 297 ? -7.589  20.010 21.505  1.00 32.78  ? 297 THR B OG1 1 
ATOM   5560 C CG2 . THR B 1 297 ? -7.097  18.602 23.407  1.00 20.75  ? 297 THR B CG2 1 
ATOM   5561 N N   . PHE B 1 298 ? -3.388  18.816 21.804  1.00 28.50  ? 298 PHE B N   1 
ATOM   5562 C CA  . PHE B 1 298 ? -2.175  18.027 22.003  1.00 28.46  ? 298 PHE B CA  1 
ATOM   5563 C C   . PHE B 1 298 ? -1.136  18.823 22.812  1.00 32.38  ? 298 PHE B C   1 
ATOM   5564 O O   . PHE B 1 298 ? -0.652  18.329 23.832  1.00 32.79  ? 298 PHE B O   1 
ATOM   5565 C CB  . PHE B 1 298 ? -1.593  17.583 20.642  1.00 30.25  ? 298 PHE B CB  1 
ATOM   5566 C CG  . PHE B 1 298 ? -0.538  16.501 20.701  1.00 31.99  ? 298 PHE B CG  1 
ATOM   5567 C CD1 . PHE B 1 298 ? 0.754   16.784 21.134  1.00 33.36  ? 298 PHE B CD1 1 
ATOM   5568 C CD2 . PHE B 1 298 ? -0.813  15.216 20.257  1.00 34.96  ? 298 PHE B CD2 1 
ATOM   5569 C CE1 . PHE B 1 298 ? 1.727   15.788 21.176  1.00 34.38  ? 298 PHE B CE1 1 
ATOM   5570 C CE2 . PHE B 1 298 ? 0.169   14.221 20.294  1.00 37.30  ? 298 PHE B CE2 1 
ATOM   5571 C CZ  . PHE B 1 298 ? 1.426   14.515 20.762  1.00 34.56  ? 298 PHE B CZ  1 
ATOM   5572 N N   . ASN B 1 299 ? -0.821  20.056 22.363  1.00 27.96  ? 299 ASN B N   1 
ATOM   5573 C CA  . ASN B 1 299 ? 0.201   20.923 22.963  1.00 27.30  ? 299 ASN B CA  1 
ATOM   5574 C C   . ASN B 1 299 ? -0.048  21.317 24.419  1.00 30.02  ? 299 ASN B C   1 
ATOM   5575 O O   . ASN B 1 299 ? 0.909   21.389 25.212  1.00 28.75  ? 299 ASN B O   1 
ATOM   5576 C CB  . ASN B 1 299 ? 0.492   22.128 22.068  1.00 25.10  ? 299 ASN B CB  1 
ATOM   5577 C CG  . ASN B 1 299 ? 1.033   21.755 20.701  1.00 39.77  ? 299 ASN B CG  1 
ATOM   5578 O OD1 . ASN B 1 299 ? 1.287   20.581 20.382  1.00 24.92  ? 299 ASN B OD1 1 
ATOM   5579 N ND2 . ASN B 1 299 ? 1.231   22.755 19.860  1.00 30.62  ? 299 ASN B ND2 1 
ATOM   5580 N N   . GLN B 1 300 ? -1.336  21.515 24.771  1.00 25.09  ? 300 GLN B N   1 
ATOM   5581 C CA  . GLN B 1 300 ? -1.780  21.854 26.125  1.00 24.02  ? 300 GLN B CA  1 
ATOM   5582 C C   . GLN B 1 300 ? -1.599  20.669 27.075  1.00 26.90  ? 300 GLN B C   1 
ATOM   5583 O O   . GLN B 1 300 ? -1.101  20.836 28.186  1.00 25.99  ? 300 GLN B O   1 
ATOM   5584 C CB  . GLN B 1 300 ? -3.258  22.243 26.109  1.00 25.30  ? 300 GLN B CB  1 
ATOM   5585 C CG  . GLN B 1 300 ? -3.543  23.590 25.480  1.00 30.62  ? 300 GLN B CG  1 
ATOM   5586 C CD  . GLN B 1 300 ? -4.968  23.952 25.716  1.00 35.04  ? 300 GLN B CD  1 
ATOM   5587 O OE1 . GLN B 1 300 ? -5.333  24.393 26.793  1.00 32.32  ? 300 GLN B OE1 1 
ATOM   5588 N NE2 . GLN B 1 300 ? -5.815  23.716 24.740  1.00 27.04  ? 300 GLN B NE2 1 
ATOM   5589 N N   . LEU B 1 301 ? -2.023  19.480 26.634  1.00 24.02  ? 301 LEU B N   1 
ATOM   5590 C CA  . LEU B 1 301 ? -1.952  18.234 27.389  1.00 24.77  ? 301 LEU B CA  1 
ATOM   5591 C C   . LEU B 1 301 ? -0.509  17.941 27.777  1.00 30.91  ? 301 LEU B C   1 
ATOM   5592 O O   . LEU B 1 301 ? -0.249  17.579 28.929  1.00 30.39  ? 301 LEU B O   1 
ATOM   5593 C CB  . LEU B 1 301 ? -2.556  17.100 26.545  1.00 25.29  ? 301 LEU B CB  1 
ATOM   5594 C CG  . LEU B 1 301 ? -3.991  16.628 26.872  1.00 30.48  ? 301 LEU B CG  1 
ATOM   5595 C CD1 . LEU B 1 301 ? -5.000  17.711 26.700  1.00 30.53  ? 301 LEU B CD1 1 
ATOM   5596 C CD2 . LEU B 1 301 ? -4.411  15.550 25.910  1.00 35.15  ? 301 LEU B CD2 1 
ATOM   5597 N N   . MET B 1 302 ? 0.433   18.193 26.831  1.00 29.05  ? 302 MET B N   1 
ATOM   5598 C CA  . MET B 1 302 ? 1.875   18.062 27.001  1.00 29.71  ? 302 MET B CA  1 
ATOM   5599 C C   . MET B 1 302 ? 2.384   18.961 28.155  1.00 32.05  ? 302 MET B C   1 
ATOM   5600 O O   . MET B 1 302 ? 3.114   18.488 29.019  1.00 32.22  ? 302 MET B O   1 
ATOM   5601 C CB  . MET B 1 302 ? 2.561   18.475 25.703  1.00 32.76  ? 302 MET B CB  1 
ATOM   5602 C CG  . MET B 1 302 ? 2.882   17.326 24.784  1.00 38.90  ? 302 MET B CG  1 
ATOM   5603 S SD  . MET B 1 302 ? 3.722   17.855 23.242  1.00 44.79  ? 302 MET B SD  1 
ATOM   5604 C CE  . MET B 1 302 ? 5.298   18.452 23.909  1.00 41.71  ? 302 MET B CE  1 
ATOM   5605 N N   . ILE B 1 303 ? 2.005   20.253 28.160  1.00 26.82  ? 303 ILE B N   1 
ATOM   5606 C CA  . ILE B 1 303 ? 2.437   21.216 29.176  1.00 26.03  ? 303 ILE B CA  1 
ATOM   5607 C C   . ILE B 1 303 ? 1.746   20.904 30.506  1.00 28.49  ? 303 ILE B C   1 
ATOM   5608 O O   . ILE B 1 303 ? 2.424   20.806 31.535  1.00 28.35  ? 303 ILE B O   1 
ATOM   5609 C CB  . ILE B 1 303 ? 2.269   22.694 28.671  1.00 28.59  ? 303 ILE B CB  1 
ATOM   5610 C CG1 . ILE B 1 303 ? 3.343   23.041 27.619  1.00 28.76  ? 303 ILE B CG1 1 
ATOM   5611 C CG2 . ILE B 1 303 ? 2.272   23.736 29.809  1.00 28.53  ? 303 ILE B CG2 1 
ATOM   5612 C CD1 . ILE B 1 303 ? 2.971   24.149 26.706  1.00 34.01  ? 303 ILE B CD1 1 
ATOM   5613 N N   . SER B 1 304 ? 0.412   20.708 30.468  1.00 23.55  ? 304 SER B N   1 
ATOM   5614 C CA  . SER B 1 304 ? -0.411  20.387 31.635  1.00 23.05  ? 304 SER B CA  1 
ATOM   5615 C C   . SER B 1 304 ? 0.201   19.226 32.438  1.00 29.01  ? 304 SER B C   1 
ATOM   5616 O O   . SER B 1 304 ? 0.460   19.395 33.626  1.00 28.64  ? 304 SER B O   1 
ATOM   5617 C CB  . SER B 1 304 ? -1.833  20.055 31.203  1.00 23.82  ? 304 SER B CB  1 
ATOM   5618 O OG  . SER B 1 304 ? -2.678  19.965 32.333  1.00 29.30  ? 304 SER B OG  1 
ATOM   5619 N N   . GLN B 1 305 ? 0.508   18.092 31.762  1.00 26.75  ? 305 GLN B N   1 
ATOM   5620 C CA  . GLN B 1 305 ? 1.120   16.898 32.362  1.00 27.55  ? 305 GLN B CA  1 
ATOM   5621 C C   . GLN B 1 305 ? 2.523   17.156 32.910  1.00 30.17  ? 305 GLN B C   1 
ATOM   5622 O O   . GLN B 1 305 ? 2.861   16.613 33.957  1.00 31.45  ? 305 GLN B O   1 
ATOM   5623 C CB  . GLN B 1 305 ? 1.152   15.726 31.371  1.00 29.60  ? 305 GLN B CB  1 
ATOM   5624 C CG  . GLN B 1 305 ? -0.184  14.999 31.237  1.00 45.07  ? 305 GLN B CG  1 
ATOM   5625 C CD  . GLN B 1 305 ? -0.133  13.819 30.294  1.00 67.93  ? 305 GLN B CD  1 
ATOM   5626 O OE1 . GLN B 1 305 ? -1.022  13.647 29.450  1.00 67.26  ? 305 GLN B OE1 1 
ATOM   5627 N NE2 . GLN B 1 305 ? 0.877   12.950 30.436  1.00 54.03  ? 305 GLN B NE2 1 
ATOM   5628 N N   . LEU B 1 306 ? 3.336   17.962 32.211  1.00 24.01  ? 306 LEU B N   1 
ATOM   5629 C CA  . LEU B 1 306 ? 4.676   18.301 32.674  1.00 23.47  ? 306 LEU B CA  1 
ATOM   5630 C C   . LEU B 1 306 ? 4.559   19.137 33.954  1.00 27.83  ? 306 LEU B C   1 
ATOM   5631 O O   . LEU B 1 306 ? 5.126   18.730 34.975  1.00 28.51  ? 306 LEU B O   1 
ATOM   5632 C CB  . LEU B 1 306 ? 5.478   19.052 31.583  1.00 22.74  ? 306 LEU B CB  1 
ATOM   5633 C CG  . LEU B 1 306 ? 6.765   19.814 32.019  1.00 26.30  ? 306 LEU B CG  1 
ATOM   5634 C CD1 . LEU B 1 306 ? 7.960   18.869 32.155  1.00 26.76  ? 306 LEU B CD1 1 
ATOM   5635 C CD2 . LEU B 1 306 ? 7.096   20.918 31.030  1.00 25.55  ? 306 LEU B CD2 1 
ATOM   5636 N N   . LEU B 1 307 ? 3.785   20.273 33.898  1.00 22.39  ? 307 LEU B N   1 
ATOM   5637 C CA  . LEU B 1 307 ? 3.548   21.192 35.018  1.00 20.92  ? 307 LEU B CA  1 
ATOM   5638 C C   . LEU B 1 307 ? 2.966   20.475 36.220  1.00 27.06  ? 307 LEU B C   1 
ATOM   5639 O O   . LEU B 1 307 ? 3.448   20.703 37.329  1.00 27.26  ? 307 LEU B O   1 
ATOM   5640 C CB  . LEU B 1 307 ? 2.625   22.366 34.648  1.00 19.24  ? 307 LEU B CB  1 
ATOM   5641 C CG  . LEU B 1 307 ? 3.091   23.419 33.636  1.00 21.67  ? 307 LEU B CG  1 
ATOM   5642 C CD1 . LEU B 1 307 ? 1.942   24.357 33.295  1.00 23.29  ? 307 LEU B CD1 1 
ATOM   5643 C CD2 . LEU B 1 307 ? 4.276   24.236 34.145  1.00 20.85  ? 307 LEU B CD2 1 
ATOM   5644 N N   . HIS B 1 308 ? 1.940   19.601 36.011  1.00 25.13  ? 308 HIS B N   1 
ATOM   5645 C CA  . HIS B 1 308 ? 1.305   18.834 37.094  1.00 25.90  ? 308 HIS B CA  1 
ATOM   5646 C C   . HIS B 1 308 ? 2.264   17.892 37.788  1.00 35.37  ? 308 HIS B C   1 
ATOM   5647 O O   . HIS B 1 308 ? 2.310   17.922 39.013  1.00 38.12  ? 308 HIS B O   1 
ATOM   5648 C CB  . HIS B 1 308 ? 0.054   18.103 36.638  1.00 25.98  ? 308 HIS B CB  1 
ATOM   5649 C CG  . HIS B 1 308 ? -1.182  18.954 36.640  1.00 28.76  ? 308 HIS B CG  1 
ATOM   5650 N ND1 . HIS B 1 308 ? -1.378  19.956 35.696  1.00 29.95  ? 308 HIS B ND1 1 
ATOM   5651 C CD2 . HIS B 1 308 ? -2.275  18.888 37.433  1.00 30.04  ? 308 HIS B CD2 1 
ATOM   5652 C CE1 . HIS B 1 308 ? -2.573  20.464 35.953  1.00 28.72  ? 308 HIS B CE1 1 
ATOM   5653 N NE2 . HIS B 1 308 ? -3.147  19.854 36.988  1.00 29.50  ? 308 HIS B NE2 1 
ATOM   5654 N N   . GLU B 1 309 ? 3.071   17.103 37.031  1.00 32.43  ? 309 GLU B N   1 
ATOM   5655 C CA  . GLU B 1 309 ? 4.073   16.198 37.609  1.00 33.21  ? 309 GLU B CA  1 
ATOM   5656 C C   . GLU B 1 309 ? 5.161   17.006 38.348  1.00 36.76  ? 309 GLU B C   1 
ATOM   5657 O O   . GLU B 1 309 ? 5.560   16.631 39.457  1.00 37.64  ? 309 GLU B O   1 
ATOM   5658 C CB  . GLU B 1 309 ? 4.669   15.255 36.535  1.00 35.02  ? 309 GLU B CB  1 
ATOM   5659 C CG  . GLU B 1 309 ? 5.978   14.567 36.929  1.00 53.25  ? 309 GLU B CG  1 
ATOM   5660 C CD  . GLU B 1 309 ? 5.893   13.364 37.858  1.00 86.23  ? 309 GLU B CD  1 
ATOM   5661 O OE1 . GLU B 1 309 ? 5.293   12.343 37.449  1.00 91.10  ? 309 GLU B OE1 1 
ATOM   5662 O OE2 . GLU B 1 309 ? 6.490   13.413 38.960  1.00 78.21  ? 309 GLU B OE2 1 
ATOM   5663 N N   . TRP B 1 310 ? 5.599   18.128 37.760  1.00 31.30  ? 310 TRP B N   1 
ATOM   5664 C CA  . TRP B 1 310 ? 6.612   18.976 38.385  1.00 31.35  ? 310 TRP B CA  1 
ATOM   5665 C C   . TRP B 1 310 ? 6.166   19.559 39.726  1.00 38.21  ? 310 TRP B C   1 
ATOM   5666 O O   . TRP B 1 310 ? 6.917   19.553 40.695  1.00 41.01  ? 310 TRP B O   1 
ATOM   5667 C CB  . TRP B 1 310 ? 7.001   20.155 37.466  1.00 28.10  ? 310 TRP B CB  1 
ATOM   5668 C CG  . TRP B 1 310 ? 8.199   19.968 36.582  1.00 27.98  ? 310 TRP B CG  1 
ATOM   5669 C CD1 . TRP B 1 310 ? 9.077   18.930 36.586  1.00 31.49  ? 310 TRP B CD1 1 
ATOM   5670 C CD2 . TRP B 1 310 ? 8.645   20.866 35.557  1.00 26.83  ? 310 TRP B CD2 1 
ATOM   5671 N NE1 . TRP B 1 310 ? 10.043  19.123 35.625  1.00 30.32  ? 310 TRP B NE1 1 
ATOM   5672 C CE2 . TRP B 1 310 ? 9.807   20.304 34.984  1.00 30.35  ? 310 TRP B CE2 1 
ATOM   5673 C CE3 . TRP B 1 310 ? 8.158   22.083 35.046  1.00 26.81  ? 310 TRP B CE3 1 
ATOM   5674 C CZ2 . TRP B 1 310 ? 10.505  20.923 33.946  1.00 28.93  ? 310 TRP B CZ2 1 
ATOM   5675 C CZ3 . TRP B 1 310 ? 8.842   22.684 33.998  1.00 27.51  ? 310 TRP B CZ3 1 
ATOM   5676 C CH2 . TRP B 1 310 ? 9.980   22.087 33.438  1.00 28.52  ? 310 TRP B CH2 1 
ATOM   5677 N N   . GLY B 1 311 ? 4.969   20.098 39.747  1.00 33.57  ? 311 GLY B N   1 
ATOM   5678 C CA  . GLY B 1 311 ? 4.455   20.867 40.868  1.00 33.82  ? 311 GLY B CA  1 
ATOM   5679 C C   . GLY B 1 311 ? 5.022   22.274 40.730  1.00 39.08  ? 311 GLY B C   1 
ATOM   5680 O O   . GLY B 1 311 ? 5.844   22.516 39.834  1.00 38.83  ? 311 GLY B O   1 
ATOM   5681 N N   . GLU B 1 312 ? 4.644   23.219 41.616  1.00 36.28  ? 312 GLU B N   1 
ATOM   5682 C CA  . GLU B 1 312 ? 5.229   24.578 41.575  1.00 35.42  ? 312 GLU B CA  1 
ATOM   5683 C C   . GLU B 1 312 ? 6.747   24.529 41.834  1.00 38.65  ? 312 GLU B C   1 
ATOM   5684 O O   . GLU B 1 312 ? 7.492   25.229 41.154  1.00 38.16  ? 312 GLU B O   1 
ATOM   5685 C CB  . GLU B 1 312 ? 4.523   25.570 42.518  1.00 37.00  ? 312 GLU B CB  1 
ATOM   5686 C CG  . GLU B 1 312 ? 4.537   25.224 44.009  1.00 54.30  ? 312 GLU B CG  1 
ATOM   5687 C CD  . GLU B 1 312 ? 4.171   26.328 44.993  1.00 90.23  ? 312 GLU B CD  1 
ATOM   5688 O OE1 . GLU B 1 312 ? 4.330   27.522 44.647  1.00 99.98  ? 312 GLU B OE1 1 
ATOM   5689 O OE2 . GLU B 1 312 ? 3.854   25.991 46.157  1.00 85.20  ? 312 GLU B OE2 1 
ATOM   5690 N N   . GLU B 1 313 ? 7.184   23.622 42.752  1.00 35.36  ? 313 GLU B N   1 
ATOM   5691 C CA  . GLU B 1 313 ? 8.576   23.344 43.139  1.00 35.97  ? 313 GLU B CA  1 
ATOM   5692 C C   . GLU B 1 313 ? 9.406   22.980 41.898  1.00 37.28  ? 313 GLU B C   1 
ATOM   5693 O O   . GLU B 1 313 ? 10.454  23.585 41.647  1.00 35.42  ? 313 GLU B O   1 
ATOM   5694 C CB  . GLU B 1 313 ? 8.659   22.170 44.161  1.00 38.92  ? 313 GLU B CB  1 
ATOM   5695 C CG  . GLU B 1 313 ? 7.878   22.344 45.456  1.00 53.34  ? 313 GLU B CG  1 
ATOM   5696 C CD  . GLU B 1 313 ? 6.424   21.893 45.473  1.00 86.55  ? 313 GLU B CD  1 
ATOM   5697 O OE1 . GLU B 1 313 ? 5.772   21.881 44.401  1.00 75.56  ? 313 GLU B OE1 1 
ATOM   5698 O OE2 . GLU B 1 313 ? 5.922   21.595 46.582  1.00 90.51  ? 313 GLU B OE2 1 
ATOM   5699 N N   . GLY B 1 314 ? 8.903   22.010 41.132  1.00 33.13  ? 314 GLY B N   1 
ATOM   5700 C CA  . GLY B 1 314 ? 9.552   21.515 39.926  1.00 32.92  ? 314 GLY B CA  1 
ATOM   5701 C C   . GLY B 1 314 ? 9.748   22.596 38.891  1.00 35.17  ? 314 GLY B C   1 
ATOM   5702 O O   . GLY B 1 314 ? 10.818  22.690 38.270  1.00 33.07  ? 314 GLY B O   1 
ATOM   5703 N N   . PHE B 1 315 ? 8.681   23.427 38.735  1.00 31.14  ? 315 PHE B N   1 
ATOM   5704 C CA  . PHE B 1 315 ? 8.574   24.563 37.825  1.00 28.99  ? 315 PHE B CA  1 
ATOM   5705 C C   . PHE B 1 315 ? 9.641   25.599 38.145  1.00 33.71  ? 315 PHE B C   1 
ATOM   5706 O O   . PHE B 1 315 ? 10.395  25.990 37.253  1.00 33.51  ? 315 PHE B O   1 
ATOM   5707 C CB  . PHE B 1 315 ? 7.156   25.175 37.904  1.00 29.30  ? 315 PHE B CB  1 
ATOM   5708 C CG  . PHE B 1 315 ? 6.954   26.386 37.032  1.00 29.23  ? 315 PHE B CG  1 
ATOM   5709 C CD1 . PHE B 1 315 ? 6.960   26.275 35.646  1.00 30.97  ? 315 PHE B CD1 1 
ATOM   5710 C CD2 . PHE B 1 315 ? 6.793   27.645 37.593  1.00 31.06  ? 315 PHE B CD2 1 
ATOM   5711 C CE1 . PHE B 1 315 ? 6.834   27.410 34.837  1.00 31.03  ? 315 PHE B CE1 1 
ATOM   5712 C CE2 . PHE B 1 315 ? 6.664   28.782 36.780  1.00 32.65  ? 315 PHE B CE2 1 
ATOM   5713 C CZ  . PHE B 1 315 ? 6.681   28.657 35.410  1.00 29.52  ? 315 PHE B CZ  1 
ATOM   5714 N N   . MET B 1 316 ? 9.735   25.983 39.436  1.00 30.62  ? 316 MET B N   1 
ATOM   5715 C CA  . MET B 1 316 ? 10.643  26.979 39.991  1.00 30.49  ? 316 MET B CA  1 
ATOM   5716 C C   . MET B 1 316 ? 12.107  26.586 39.824  1.00 33.14  ? 316 MET B C   1 
ATOM   5717 O O   . MET B 1 316 ? 12.945  27.423 39.492  1.00 31.65  ? 316 MET B O   1 
ATOM   5718 C CB  . MET B 1 316 ? 10.268  27.213 41.458  1.00 34.05  ? 316 MET B CB  1 
ATOM   5719 C CG  . MET B 1 316 ? 9.619   28.564 41.733  1.00 38.32  ? 316 MET B CG  1 
ATOM   5720 S SD  . MET B 1 316 ? 8.339   29.135 40.576  1.00 42.52  ? 316 MET B SD  1 
ATOM   5721 C CE  . MET B 1 316 ? 9.059   30.635 40.007  1.00 38.58  ? 316 MET B CE  1 
ATOM   5722 N N   . ALA B 1 317 ? 12.388  25.293 40.003  1.00 30.83  ? 317 ALA B N   1 
ATOM   5723 C CA  . ALA B 1 317 ? 13.697  24.669 39.831  1.00 31.19  ? 317 ALA B CA  1 
ATOM   5724 C C   . ALA B 1 317 ? 14.129  24.803 38.356  1.00 33.62  ? 317 ALA B C   1 
ATOM   5725 O O   . ALA B 1 317 ? 15.279  25.194 38.086  1.00 34.35  ? 317 ALA B O   1 
ATOM   5726 C CB  . ALA B 1 317 ? 13.627  23.197 40.239  1.00 32.84  ? 317 ALA B CB  1 
ATOM   5727 N N   . HIS B 1 318 ? 13.194  24.525 37.416  1.00 27.50  ? 318 HIS B N   1 
ATOM   5728 C CA  . HIS B 1 318 ? 13.438  24.684 35.995  1.00 27.40  ? 318 HIS B CA  1 
ATOM   5729 C C   . HIS B 1 318 ? 13.706  26.157 35.638  1.00 32.49  ? 318 HIS B C   1 
ATOM   5730 O O   . HIS B 1 318 ? 14.670  26.392 34.912  1.00 32.86  ? 318 HIS B O   1 
ATOM   5731 C CB  . HIS B 1 318 ? 12.277  24.164 35.170  1.00 27.71  ? 318 HIS B CB  1 
ATOM   5732 C CG  . HIS B 1 318 ? 12.477  24.344 33.697  1.00 30.22  ? 318 HIS B CG  1 
ATOM   5733 N ND1 . HIS B 1 318 ? 13.096  23.376 32.933  1.00 32.63  ? 318 HIS B ND1 1 
ATOM   5734 C CD2 . HIS B 1 318 ? 12.119  25.367 32.895  1.00 30.28  ? 318 HIS B CD2 1 
ATOM   5735 C CE1 . HIS B 1 318 ? 13.101  23.842 31.698  1.00 30.92  ? 318 HIS B CE1 1 
ATOM   5736 N NE2 . HIS B 1 318 ? 12.527  25.037 31.629  1.00 30.20  ? 318 HIS B NE2 1 
ATOM   5737 N N   . VAL B 1 319 ? 12.882  27.140 36.129  1.00 28.04  ? 319 VAL B N   1 
ATOM   5738 C CA  . VAL B 1 319 ? 13.157  28.559 35.837  1.00 28.08  ? 319 VAL B CA  1 
ATOM   5739 C C   . VAL B 1 319 ? 14.527  28.999 36.361  1.00 33.25  ? 319 VAL B C   1 
ATOM   5740 O O   . VAL B 1 319 ? 15.246  29.717 35.655  1.00 32.12  ? 319 VAL B O   1 
ATOM   5741 C CB  . VAL B 1 319 ? 12.022  29.632 35.981  1.00 31.82  ? 319 VAL B CB  1 
ATOM   5742 C CG1 . VAL B 1 319 ? 10.623  29.027 35.870  1.00 31.47  ? 319 VAL B CG1 1 
ATOM   5743 C CG2 . VAL B 1 319 ? 12.166  30.476 37.243  1.00 32.06  ? 319 VAL B CG2 1 
ATOM   5744 N N   . ASP B 1 320 ? 14.918  28.482 37.549  1.00 31.41  ? 320 ASP B N   1 
ATOM   5745 C CA  . ASP B 1 320 ? 16.232  28.727 38.146  1.00 32.45  ? 320 ASP B CA  1 
ATOM   5746 C C   . ASP B 1 320 ? 17.370  28.184 37.271  1.00 36.23  ? 320 ASP B C   1 
ATOM   5747 O O   . ASP B 1 320 ? 18.391  28.864 37.131  1.00 35.22  ? 320 ASP B O   1 
ATOM   5748 C CB  . ASP B 1 320 ? 16.294  28.186 39.577  1.00 35.79  ? 320 ASP B CB  1 
ATOM   5749 C CG  . ASP B 1 320 ? 15.513  29.028 40.572  1.00 55.50  ? 320 ASP B CG  1 
ATOM   5750 O OD1 . ASP B 1 320 ? 14.644  29.828 40.129  1.00 57.93  ? 320 ASP B OD1 1 
ATOM   5751 O OD2 . ASP B 1 320 ? 15.762  28.889 41.796  1.00 61.72  ? 320 ASP B OD2 1 
ATOM   5752 N N   . ARG B 1 321 ? 17.171  26.992 36.641  1.00 33.66  ? 321 ARG B N   1 
ATOM   5753 C CA  . ARG B 1 321 ? 18.148  26.399 35.717  1.00 34.68  ? 321 ARG B CA  1 
ATOM   5754 C C   . ARG B 1 321 ? 18.279  27.300 34.460  1.00 39.79  ? 321 ARG B C   1 
ATOM   5755 O O   . ARG B 1 321 ? 19.388  27.667 34.075  1.00 40.59  ? 321 ARG B O   1 
ATOM   5756 C CB  . ARG B 1 321 ? 17.739  24.976 35.315  1.00 36.39  ? 321 ARG B CB  1 
ATOM   5757 C CG  . ARG B 1 321 ? 17.920  23.912 36.400  1.00 52.19  ? 321 ARG B CG  1 
ATOM   5758 C CD  . ARG B 1 321 ? 17.643  22.491 35.881  1.00 62.49  ? 321 ARG B CD  1 
ATOM   5759 N NE  . ARG B 1 321 ? 16.212  22.183 35.725  1.00 69.19  ? 321 ARG B NE  1 
ATOM   5760 C CZ  . ARG B 1 321 ? 15.505  21.419 36.557  1.00 80.27  ? 321 ARG B CZ  1 
ATOM   5761 N NH1 . ARG B 1 321 ? 16.083  20.869 37.621  1.00 67.13  ? 321 ARG B NH1 1 
ATOM   5762 N NH2 . ARG B 1 321 ? 14.213  21.205 36.336  1.00 62.79  ? 321 ARG B NH2 1 
ATOM   5763 N N   . VAL B 1 322 ? 17.143  27.697 33.868  1.00 35.68  ? 322 VAL B N   1 
ATOM   5764 C CA  . VAL B 1 322 ? 17.074  28.580 32.705  1.00 35.04  ? 322 VAL B CA  1 
ATOM   5765 C C   . VAL B 1 322 ? 17.801  29.915 32.983  1.00 39.59  ? 322 VAL B C   1 
ATOM   5766 O O   . VAL B 1 322 ? 18.741  30.228 32.246  1.00 39.37  ? 322 VAL B O   1 
ATOM   5767 C CB  . VAL B 1 322 ? 15.605  28.732 32.192  1.00 37.86  ? 322 VAL B CB  1 
ATOM   5768 C CG1 . VAL B 1 322 ? 15.399  30.014 31.384  1.00 37.06  ? 322 VAL B CG1 1 
ATOM   5769 C CG2 . VAL B 1 322 ? 15.187  27.505 31.384  1.00 37.46  ? 322 VAL B CG2 1 
ATOM   5770 N N   . ILE B 1 323 ? 17.413  30.651 34.082  1.00 35.51  ? 323 ILE B N   1 
ATOM   5771 C CA  . ILE B 1 323 ? 18.014  31.939 34.509  1.00 34.79  ? 323 ILE B CA  1 
ATOM   5772 C C   . ILE B 1 323 ? 19.545  31.835 34.622  1.00 41.12  ? 323 ILE B C   1 
ATOM   5773 O O   . ILE B 1 323 ? 20.257  32.744 34.185  1.00 40.27  ? 323 ILE B O   1 
ATOM   5774 C CB  . ILE B 1 323 ? 17.357  32.501 35.810  1.00 37.06  ? 323 ILE B CB  1 
ATOM   5775 C CG1 . ILE B 1 323 ? 15.890  32.877 35.572  1.00 36.91  ? 323 ILE B CG1 1 
ATOM   5776 C CG2 . ILE B 1 323 ? 18.088  33.717 36.343  1.00 37.17  ? 323 ILE B CG2 1 
ATOM   5777 C CD1 . ILE B 1 323 ? 15.009  33.039 36.869  1.00 43.12  ? 323 ILE B CD1 1 
ATOM   5778 N N   . ASP B 1 324 ? 20.036  30.705 35.169  1.00 40.02  ? 324 ASP B N   1 
ATOM   5779 C CA  . ASP B 1 324 ? 21.453  30.423 35.375  1.00 41.56  ? 324 ASP B CA  1 
ATOM   5780 C C   . ASP B 1 324 ? 22.281  30.514 34.098  1.00 46.56  ? 324 ASP B C   1 
ATOM   5781 O O   . ASP B 1 324 ? 23.364  31.104 34.106  1.00 46.83  ? 324 ASP B O   1 
ATOM   5782 C CB  . ASP B 1 324 ? 21.630  29.061 36.039  1.00 44.46  ? 324 ASP B CB  1 
ATOM   5783 C CG  . ASP B 1 324 ? 22.608  29.096 37.185  1.00 59.85  ? 324 ASP B CG  1 
ATOM   5784 O OD1 . ASP B 1 324 ? 22.241  29.627 38.261  1.00 61.72  ? 324 ASP B OD1 1 
ATOM   5785 O OD2 . ASP B 1 324 ? 23.743  28.591 37.012  1.00 66.63  ? 324 ASP B OD2 1 
ATOM   5786 N N   . PHE B 1 325 ? 21.742  29.970 33.002  1.00 43.15  ? 325 PHE B N   1 
ATOM   5787 C CA  . PHE B 1 325 ? 22.362  29.970 31.688  1.00 43.28  ? 325 PHE B CA  1 
ATOM   5788 C C   . PHE B 1 325 ? 22.427  31.392 31.102  1.00 48.06  ? 325 PHE B C   1 
ATOM   5789 O O   . PHE B 1 325 ? 23.520  31.835 30.732  1.00 49.21  ? 325 PHE B O   1 
ATOM   5790 C CB  . PHE B 1 325 ? 21.599  29.009 30.762  1.00 45.01  ? 325 PHE B CB  1 
ATOM   5791 C CG  . PHE B 1 325 ? 21.944  29.154 29.300  1.00 46.82  ? 325 PHE B CG  1 
ATOM   5792 C CD1 . PHE B 1 325 ? 23.086  28.556 28.777  1.00 50.18  ? 325 PHE B CD1 1 
ATOM   5793 C CD2 . PHE B 1 325 ? 21.128  29.894 28.445  1.00 47.74  ? 325 PHE B CD2 1 
ATOM   5794 C CE1 . PHE B 1 325 ? 23.412  28.706 27.430  1.00 50.80  ? 325 PHE B CE1 1 
ATOM   5795 C CE2 . PHE B 1 325 ? 21.465  30.053 27.100  1.00 50.22  ? 325 PHE B CE2 1 
ATOM   5796 C CZ  . PHE B 1 325 ? 22.604  29.460 26.603  1.00 48.85  ? 325 PHE B CZ  1 
ATOM   5797 N N   . TYR B 1 326 ? 21.268  32.102 31.023  1.00 43.18  ? 326 TYR B N   1 
ATOM   5798 C CA  . TYR B 1 326 ? 21.185  33.456 30.467  1.00 42.94  ? 326 TYR B CA  1 
ATOM   5799 C C   . TYR B 1 326 ? 22.020  34.484 31.231  1.00 46.87  ? 326 TYR B C   1 
ATOM   5800 O O   . TYR B 1 326 ? 22.515  35.437 30.634  1.00 45.94  ? 326 TYR B O   1 
ATOM   5801 C CB  . TYR B 1 326 ? 19.723  33.925 30.265  1.00 44.20  ? 326 TYR B CB  1 
ATOM   5802 C CG  . TYR B 1 326 ? 18.957  33.173 29.187  1.00 47.17  ? 326 TYR B CG  1 
ATOM   5803 C CD1 . TYR B 1 326 ? 19.230  33.378 27.836  1.00 49.01  ? 326 TYR B CD1 1 
ATOM   5804 C CD2 . TYR B 1 326 ? 17.934  32.287 29.518  1.00 48.28  ? 326 TYR B CD2 1 
ATOM   5805 C CE1 . TYR B 1 326 ? 18.526  32.696 26.843  1.00 49.21  ? 326 TYR B CE1 1 
ATOM   5806 C CE2 . TYR B 1 326 ? 17.206  31.619 28.532  1.00 49.03  ? 326 TYR B CE2 1 
ATOM   5807 C CZ  . TYR B 1 326 ? 17.512  31.820 27.195  1.00 57.47  ? 326 TYR B CZ  1 
ATOM   5808 O OH  . TYR B 1 326 ? 16.809  31.153 26.217  1.00 59.62  ? 326 TYR B OH  1 
ATOM   5809 N N   . SER B 1 327 ? 22.206  34.272 32.537  1.00 45.25  ? 327 SER B N   1 
ATOM   5810 C CA  . SER B 1 327 ? 23.018  35.139 33.393  1.00 46.17  ? 327 SER B CA  1 
ATOM   5811 C C   . SER B 1 327 ? 24.506  35.020 32.978  1.00 49.81  ? 327 SER B C   1 
ATOM   5812 O O   . SER B 1 327 ? 25.200  36.037 32.885  1.00 49.88  ? 327 SER B O   1 
ATOM   5813 C CB  . SER B 1 327 ? 22.826  34.758 34.862  1.00 51.02  ? 327 SER B CB  1 
ATOM   5814 O OG  . SER B 1 327 ? 23.107  35.854 35.717  1.00 62.25  ? 327 SER B OG  1 
ATOM   5815 N N   . ASN B 1 328 ? 24.969  33.779 32.692  1.00 44.49  ? 328 ASN B N   1 
ATOM   5816 C CA  . ASN B 1 328 ? 26.325  33.501 32.233  1.00 44.11  ? 328 ASN B CA  1 
ATOM   5817 C C   . ASN B 1 328 ? 26.518  34.101 30.845  1.00 45.61  ? 328 ASN B C   1 
ATOM   5818 O O   . ASN B 1 328 ? 27.539  34.753 30.599  1.00 45.70  ? 328 ASN B O   1 
ATOM   5819 C CB  . ASN B 1 328 ? 26.591  32.002 32.239  1.00 45.72  ? 328 ASN B CB  1 
ATOM   5820 C CG  . ASN B 1 328 ? 26.729  31.392 33.625  1.00 69.96  ? 328 ASN B CG  1 
ATOM   5821 O OD1 . ASN B 1 328 ? 26.649  30.169 33.790  1.00 59.17  ? 328 ASN B OD1 1 
ATOM   5822 N ND2 . ASN B 1 328 ? 26.966  32.213 34.655  1.00 63.87  ? 328 ASN B ND2 1 
ATOM   5823 N N   . GLN B 1 329 ? 25.494  33.952 29.969  1.00 39.23  ? 329 GLN B N   1 
ATOM   5824 C CA  . GLN B 1 329 ? 25.445  34.550 28.628  1.00 37.42  ? 329 GLN B CA  1 
ATOM   5825 C C   . GLN B 1 329 ? 25.529  36.095 28.701  1.00 39.23  ? 329 GLN B C   1 
ATOM   5826 O O   . GLN B 1 329 ? 26.219  36.717 27.895  1.00 39.77  ? 329 GLN B O   1 
ATOM   5827 C CB  . GLN B 1 329 ? 24.151  34.150 27.917  1.00 37.06  ? 329 GLN B CB  1 
ATOM   5828 C CG  . GLN B 1 329 ? 24.103  32.693 27.504  1.00 36.69  ? 329 GLN B CG  1 
ATOM   5829 C CD  . GLN B 1 329 ? 25.015  32.322 26.357  1.00 39.87  ? 329 GLN B CD  1 
ATOM   5830 O OE1 . GLN B 1 329 ? 25.956  31.545 26.528  1.00 36.99  ? 329 GLN B OE1 1 
ATOM   5831 N NE2 . GLN B 1 329 ? 24.679  32.755 25.143  1.00 19.39  ? 329 GLN B NE2 1 
ATOM   5832 N N   . LYS B 1 330 ? 24.834  36.698 29.677  1.00 32.92  ? 330 LYS B N   1 
ATOM   5833 C CA  . LYS B 1 330 ? 24.834  38.143 29.922  1.00 31.22  ? 330 LYS B CA  1 
ATOM   5834 C C   . LYS B 1 330 ? 26.239  38.598 30.337  1.00 32.89  ? 330 LYS B C   1 
ATOM   5835 O O   . LYS B 1 330 ? 26.695  39.635 29.856  1.00 33.03  ? 330 LYS B O   1 
ATOM   5836 C CB  . LYS B 1 330 ? 23.777  38.500 30.984  1.00 32.20  ? 330 LYS B CB  1 
ATOM   5837 C CG  . LYS B 1 330 ? 23.640  39.972 31.326  1.00 34.75  ? 330 LYS B CG  1 
ATOM   5838 C CD  . LYS B 1 330 ? 23.100  40.155 32.749  1.00 44.84  ? 330 LYS B CD  1 
ATOM   5839 C CE  . LYS B 1 330 ? 24.129  39.850 33.828  1.00 53.79  ? 330 LYS B CE  1 
ATOM   5840 N NZ  . LYS B 1 330 ? 23.549  39.093 34.972  1.00 55.17  ? 330 LYS B NZ  1 
ATOM   5841 N N   . ASP B 1 331 ? 26.935  37.811 31.181  1.00 27.95  ? 331 ASP B N   1 
ATOM   5842 C CA  . ASP B 1 331 ? 28.298  38.136 31.629  1.00 28.36  ? 331 ASP B CA  1 
ATOM   5843 C C   . ASP B 1 331 ? 29.291  38.132 30.460  1.00 32.81  ? 331 ASP B C   1 
ATOM   5844 O O   . ASP B 1 331 ? 30.112  39.048 30.347  1.00 31.69  ? 331 ASP B O   1 
ATOM   5845 C CB  . ASP B 1 331 ? 28.760  37.200 32.754  1.00 30.52  ? 331 ASP B CB  1 
ATOM   5846 C CG  . ASP B 1 331 ? 27.933  37.261 34.028  1.00 45.97  ? 331 ASP B CG  1 
ATOM   5847 O OD1 . ASP B 1 331 ? 27.478  38.376 34.396  1.00 44.92  ? 331 ASP B OD1 1 
ATOM   5848 O OD2 . ASP B 1 331 ? 27.781  36.202 34.690  1.00 59.11  ? 331 ASP B OD2 1 
ATOM   5849 N N   . ALA B 1 332 ? 29.184  37.113 29.580  1.00 30.10  ? 332 ALA B N   1 
ATOM   5850 C CA  . ALA B 1 332 ? 29.998  36.943 28.383  1.00 29.77  ? 332 ALA B CA  1 
ATOM   5851 C C   . ALA B 1 332 ? 29.796  38.136 27.428  1.00 33.60  ? 332 ALA B C   1 
ATOM   5852 O O   . ALA B 1 332 ? 30.785  38.753 27.040  1.00 33.96  ? 332 ALA B O   1 
ATOM   5853 C CB  . ALA B 1 332 ? 29.637  35.631 27.695  1.00 29.93  ? 332 ALA B CB  1 
ATOM   5854 N N   . ILE B 1 333 ? 28.530  38.498 27.108  1.00 30.17  ? 333 ILE B N   1 
ATOM   5855 C CA  . ILE B 1 333 ? 28.241  39.617 26.211  1.00 31.14  ? 333 ILE B CA  1 
ATOM   5856 C C   . ILE B 1 333 ? 28.815  40.942 26.774  1.00 37.18  ? 333 ILE B C   1 
ATOM   5857 O O   . ILE B 1 333 ? 29.339  41.758 26.011  1.00 38.31  ? 333 ILE B O   1 
ATOM   5858 C CB  . ILE B 1 333 ? 26.734  39.720 25.778  1.00 33.81  ? 333 ILE B CB  1 
ATOM   5859 C CG1 . ILE B 1 333 ? 26.567  40.541 24.478  1.00 34.20  ? 333 ILE B CG1 1 
ATOM   5860 C CG2 . ILE B 1 333 ? 25.822  40.284 26.880  1.00 34.15  ? 333 ILE B CG2 1 
ATOM   5861 C CD1 . ILE B 1 333 ? 26.321  39.742 23.299  1.00 43.84  ? 333 ILE B CD1 1 
ATOM   5862 N N   . LEU B 1 334 ? 28.730  41.128 28.107  1.00 32.07  ? 334 LEU B N   1 
ATOM   5863 C CA  . LEU B 1 334 ? 29.227  42.309 28.799  1.00 31.06  ? 334 LEU B CA  1 
ATOM   5864 C C   . LEU B 1 334 ? 30.746  42.398 28.759  1.00 34.14  ? 334 LEU B C   1 
ATOM   5865 O O   . LEU B 1 334 ? 31.289  43.494 28.648  1.00 33.12  ? 334 LEU B O   1 
ATOM   5866 C CB  . LEU B 1 334 ? 28.716  42.301 30.243  1.00 30.81  ? 334 LEU B CB  1 
ATOM   5867 C CG  . LEU B 1 334 ? 27.559  43.239 30.635  1.00 33.65  ? 334 LEU B CG  1 
ATOM   5868 C CD1 . LEU B 1 334 ? 26.979  43.999 29.458  1.00 32.64  ? 334 LEU B CD1 1 
ATOM   5869 C CD2 . LEU B 1 334 ? 26.499  42.511 31.423  1.00 33.59  ? 334 LEU B CD2 1 
ATOM   5870 N N   . ALA B 1 335 ? 31.431  41.239 28.824  1.00 32.76  ? 335 ALA B N   1 
ATOM   5871 C CA  . ALA B 1 335 ? 32.901  41.138 28.757  1.00 33.38  ? 335 ALA B CA  1 
ATOM   5872 C C   . ALA B 1 335 ? 33.367  41.501 27.342  1.00 38.83  ? 335 ALA B C   1 
ATOM   5873 O O   . ALA B 1 335 ? 34.229  42.376 27.191  1.00 37.56  ? 335 ALA B O   1 
ATOM   5874 C CB  . ALA B 1 335 ? 33.356  39.736 29.131  1.00 33.85  ? 335 ALA B CB  1 
ATOM   5875 N N   . ALA B 1 336 ? 32.738  40.877 26.309  1.00 37.30  ? 336 ALA B N   1 
ATOM   5876 C CA  . ALA B 1 336 ? 33.026  41.134 24.897  1.00 38.40  ? 336 ALA B CA  1 
ATOM   5877 C C   . ALA B 1 336 ? 32.751  42.616 24.565  1.00 47.04  ? 336 ALA B C   1 
ATOM   5878 O O   . ALA B 1 336 ? 33.555  43.234 23.864  1.00 49.14  ? 336 ALA B O   1 
ATOM   5879 C CB  . ALA B 1 336 ? 32.214  40.208 24.007  1.00 37.93  ? 336 ALA B CB  1 
ATOM   5880 N N   . ALA B 1 337 ? 31.672  43.201 25.138  1.00 43.76  ? 337 ALA B N   1 
ATOM   5881 C CA  . ALA B 1 337 ? 31.332  44.619 24.978  1.00 43.83  ? 337 ALA B CA  1 
ATOM   5882 C C   . ALA B 1 337 ? 32.408  45.496 25.611  1.00 49.64  ? 337 ALA B C   1 
ATOM   5883 O O   . ALA B 1 337 ? 32.795  46.496 25.004  1.00 50.76  ? 337 ALA B O   1 
ATOM   5884 C CB  . ALA B 1 337 ? 29.980  44.923 25.603  1.00 43.58  ? 337 ALA B CB  1 
ATOM   5885 N N   . ASP B 1 338 ? 32.918  45.106 26.806  1.00 45.71  ? 338 ASP B N   1 
ATOM   5886 C CA  . ASP B 1 338 ? 33.963  45.855 27.526  1.00 45.77  ? 338 ASP B CA  1 
ATOM   5887 C C   . ASP B 1 338 ? 35.267  45.910 26.733  1.00 47.38  ? 338 ASP B C   1 
ATOM   5888 O O   . ASP B 1 338 ? 35.820  46.983 26.531  1.00 45.66  ? 338 ASP B O   1 
ATOM   5889 C CB  . ASP B 1 338 ? 34.210  45.265 28.939  1.00 48.03  ? 338 ASP B CB  1 
ATOM   5890 C CG  . ASP B 1 338 ? 33.225  45.681 30.032  1.00 54.00  ? 338 ASP B CG  1 
ATOM   5891 O OD1 . ASP B 1 338 ? 32.505  46.696 29.842  1.00 51.19  ? 338 ASP B OD1 1 
ATOM   5892 O OD2 . ASP B 1 338 ? 33.208  45.020 31.096  1.00 62.06  ? 338 ASP B OD2 1 
ATOM   5893 N N   . LYS B 1 339 ? 35.715  44.743 26.256  1.00 44.21  ? 339 LYS B N   1 
ATOM   5894 C CA  . LYS B 1 339 ? 36.934  44.512 25.482  1.00 44.20  ? 339 LYS B CA  1 
ATOM   5895 C C   . LYS B 1 339 ? 37.062  45.365 24.214  1.00 46.44  ? 339 LYS B C   1 
ATOM   5896 O O   . LYS B 1 339 ? 38.125  45.938 23.987  1.00 47.17  ? 339 LYS B O   1 
ATOM   5897 C CB  . LYS B 1 339 ? 37.011  43.014 25.120  1.00 45.94  ? 339 LYS B CB  1 
ATOM   5898 C CG  . LYS B 1 339 ? 38.342  42.525 24.567  1.00 50.98  ? 339 LYS B CG  1 
ATOM   5899 C CD  . LYS B 1 339 ? 38.292  41.014 24.471  1.00 62.76  ? 339 LYS B CD  1 
ATOM   5900 C CE  . LYS B 1 339 ? 39.588  40.352 24.092  1.00 70.19  ? 339 LYS B CE  1 
ATOM   5901 N NZ  . LYS B 1 339 ? 39.386  38.899 23.840  1.00 77.60  ? 339 LYS B NZ  1 
ATOM   5902 N N   . TRP B 1 340 ? 36.000  45.434 23.394  1.00 41.52  ? 340 TRP B N   1 
ATOM   5903 C CA  . TRP B 1 340 ? 36.023  46.085 22.088  1.00 41.71  ? 340 TRP B CA  1 
ATOM   5904 C C   . TRP B 1 340 ? 35.286  47.403 21.947  1.00 44.67  ? 340 TRP B C   1 
ATOM   5905 O O   . TRP B 1 340 ? 35.762  48.261 21.212  1.00 44.81  ? 340 TRP B O   1 
ATOM   5906 C CB  . TRP B 1 340 ? 35.529  45.103 21.003  1.00 40.63  ? 340 TRP B CB  1 
ATOM   5907 C CG  . TRP B 1 340 ? 36.204  43.764 21.034  1.00 42.53  ? 340 TRP B CG  1 
ATOM   5908 C CD1 . TRP B 1 340 ? 35.704  42.599 21.546  1.00 44.81  ? 340 TRP B CD1 1 
ATOM   5909 C CD2 . TRP B 1 340 ? 37.532  43.470 20.588  1.00 43.80  ? 340 TRP B CD2 1 
ATOM   5910 N NE1 . TRP B 1 340 ? 36.632  41.589 21.425  1.00 44.96  ? 340 TRP B NE1 1 
ATOM   5911 C CE2 . TRP B 1 340 ? 37.766  42.097 20.844  1.00 48.11  ? 340 TRP B CE2 1 
ATOM   5912 C CE3 . TRP B 1 340 ? 38.546  44.231 19.980  1.00 45.70  ? 340 TRP B CE3 1 
ATOM   5913 C CZ2 . TRP B 1 340 ? 38.980  41.476 20.525  1.00 48.78  ? 340 TRP B CZ2 1 
ATOM   5914 C CZ3 . TRP B 1 340 ? 39.744  43.613 19.662  1.00 48.17  ? 340 TRP B CZ3 1 
ATOM   5915 C CH2 . TRP B 1 340 ? 39.958  42.258 19.946  1.00 49.10  ? 340 TRP B CH2 1 
ATOM   5916 N N   . LEU B 1 341 ? 34.104  47.541 22.562  1.00 41.32  ? 341 LEU B N   1 
ATOM   5917 C CA  . LEU B 1 341 ? 33.229  48.717 22.410  1.00 41.41  ? 341 LEU B CA  1 
ATOM   5918 C C   . LEU B 1 341 ? 33.539  49.933 23.296  1.00 43.50  ? 341 LEU B C   1 
ATOM   5919 O O   . LEU B 1 341 ? 33.073  51.033 22.991  1.00 41.93  ? 341 LEU B O   1 
ATOM   5920 C CB  . LEU B 1 341 ? 31.738  48.323 22.522  1.00 41.01  ? 341 LEU B CB  1 
ATOM   5921 C CG  . LEU B 1 341 ? 31.122  47.464 21.391  1.00 45.84  ? 341 LEU B CG  1 
ATOM   5922 C CD1 . LEU B 1 341 ? 31.489  46.017 21.525  1.00 46.33  ? 341 LEU B CD1 1 
ATOM   5923 C CD2 . LEU B 1 341 ? 29.622  47.505 21.454  1.00 46.64  ? 341 LEU B CD2 1 
ATOM   5924 N N   . THR B 1 342 ? 34.313  49.746 24.382  1.00 39.78  ? 342 THR B N   1 
ATOM   5925 C CA  . THR B 1 342 ? 34.670  50.851 25.279  1.00 39.52  ? 342 THR B CA  1 
ATOM   5926 C C   . THR B 1 342 ? 35.373  51.924 24.472  1.00 41.97  ? 342 THR B C   1 
ATOM   5927 O O   . THR B 1 342 ? 36.294  51.612 23.713  1.00 42.89  ? 342 THR B O   1 
ATOM   5928 C CB  . THR B 1 342 ? 35.463  50.373 26.525  1.00 47.84  ? 342 THR B CB  1 
ATOM   5929 O OG1 . THR B 1 342 ? 34.737  49.339 27.195  1.00 51.85  ? 342 THR B OG1 1 
ATOM   5930 C CG2 . THR B 1 342 ? 35.703  51.497 27.535  1.00 38.19  ? 342 THR B CG2 1 
ATOM   5931 N N   . GLY B 1 343 ? 34.860  53.148 24.587  1.00 36.46  ? 343 GLY B N   1 
ATOM   5932 C CA  . GLY B 1 343 ? 35.330  54.329 23.870  1.00 36.60  ? 343 GLY B CA  1 
ATOM   5933 C C   . GLY B 1 343 ? 34.506  54.628 22.632  1.00 40.60  ? 343 GLY B C   1 
ATOM   5934 O O   . GLY B 1 343 ? 34.442  55.779 22.198  1.00 41.92  ? 343 GLY B O   1 
ATOM   5935 N N   . LEU B 1 344 ? 33.823  53.591 22.083  1.00 34.81  ? 344 LEU B N   1 
ATOM   5936 C CA  . LEU B 1 344 ? 33.006  53.655 20.858  1.00 32.56  ? 344 LEU B CA  1 
ATOM   5937 C C   . LEU B 1 344 ? 31.503  53.599 21.102  1.00 35.32  ? 344 LEU B C   1 
ATOM   5938 O O   . LEU B 1 344 ? 30.745  53.930 20.199  1.00 32.53  ? 344 LEU B O   1 
ATOM   5939 C CB  . LEU B 1 344 ? 33.386  52.491 19.910  1.00 31.46  ? 344 LEU B CB  1 
ATOM   5940 C CG  . LEU B 1 344 ? 34.864  52.211 19.695  1.00 35.41  ? 344 LEU B CG  1 
ATOM   5941 C CD1 . LEU B 1 344 ? 35.039  50.930 18.938  1.00 35.15  ? 344 LEU B CD1 1 
ATOM   5942 C CD2 . LEU B 1 344 ? 35.570  53.379 18.978  1.00 34.86  ? 344 LEU B CD2 1 
ATOM   5943 N N   . ALA B 1 345 ? 31.066  53.107 22.275  1.00 33.67  ? 345 ALA B N   1 
ATOM   5944 C CA  . ALA B 1 345 ? 29.648  52.942 22.590  1.00 32.88  ? 345 ALA B CA  1 
ATOM   5945 C C   . ALA B 1 345 ? 29.345  53.062 24.087  1.00 37.69  ? 345 ALA B C   1 
ATOM   5946 O O   . ALA B 1 345 ? 30.262  53.181 24.903  1.00 37.51  ? 345 ALA B O   1 
ATOM   5947 C CB  . ALA B 1 345 ? 29.158  51.599 22.068  1.00 32.92  ? 345 ALA B CB  1 
ATOM   5948 N N   . GLU B 1 346 ? 28.044  53.086 24.426  1.00 34.70  ? 346 GLU B N   1 
ATOM   5949 C CA  . GLU B 1 346 ? 27.502  53.157 25.783  1.00 34.76  ? 346 GLU B CA  1 
ATOM   5950 C C   . GLU B 1 346 ? 26.337  52.185 25.898  1.00 38.29  ? 346 GLU B C   1 
ATOM   5951 O O   . GLU B 1 346 ? 25.590  51.990 24.936  1.00 37.10  ? 346 GLU B O   1 
ATOM   5952 C CB  . GLU B 1 346 ? 27.033  54.574 26.118  1.00 36.84  ? 346 GLU B CB  1 
ATOM   5953 C CG  . GLU B 1 346 ? 28.174  55.571 26.240  1.00 51.50  ? 346 GLU B CG  1 
ATOM   5954 C CD  . GLU B 1 346 ? 27.935  56.769 27.133  1.00 76.97  ? 346 GLU B CD  1 
ATOM   5955 O OE1 . GLU B 1 346 ? 26.881  57.434 26.989  1.00 79.36  ? 346 GLU B OE1 1 
ATOM   5956 O OE2 . GLU B 1 346 ? 28.833  57.060 27.956  1.00 70.07  ? 346 GLU B OE2 1 
ATOM   5957 N N   . TRP B 1 347 ? 26.208  51.544 27.068  1.00 35.50  ? 347 TRP B N   1 
ATOM   5958 C CA  . TRP B 1 347 ? 25.161  50.554 27.326  1.00 34.45  ? 347 TRP B CA  1 
ATOM   5959 C C   . TRP B 1 347 ? 24.833  50.446 28.806  1.00 40.19  ? 347 TRP B C   1 
ATOM   5960 O O   . TRP B 1 347 ? 25.654  50.792 29.651  1.00 40.88  ? 347 TRP B O   1 
ATOM   5961 C CB  . TRP B 1 347 ? 25.540  49.168 26.741  1.00 32.39  ? 347 TRP B CB  1 
ATOM   5962 C CG  . TRP B 1 347 ? 26.812  48.583 27.282  1.00 34.04  ? 347 TRP B CG  1 
ATOM   5963 C CD1 . TRP B 1 347 ? 26.935  47.710 28.321  1.00 36.85  ? 347 TRP B CD1 1 
ATOM   5964 C CD2 . TRP B 1 347 ? 28.152  48.836 26.808  1.00 35.11  ? 347 TRP B CD2 1 
ATOM   5965 N NE1 . TRP B 1 347 ? 28.263  47.377 28.509  1.00 37.24  ? 347 TRP B NE1 1 
ATOM   5966 C CE2 . TRP B 1 347 ? 29.031  48.064 27.602  1.00 39.27  ? 347 TRP B CE2 1 
ATOM   5967 C CE3 . TRP B 1 347 ? 28.693  49.632 25.773  1.00 36.49  ? 347 TRP B CE3 1 
ATOM   5968 C CZ2 . TRP B 1 347 ? 30.417  48.067 27.400  1.00 39.11  ? 347 TRP B CZ2 1 
ATOM   5969 C CZ3 . TRP B 1 347 ? 30.060  49.623 25.569  1.00 38.42  ? 347 TRP B CZ3 1 
ATOM   5970 C CH2 . TRP B 1 347 ? 30.906  48.847 26.371  1.00 39.51  ? 347 TRP B CH2 1 
ATOM   5971 N N   . HIS B 1 348 ? 23.620  49.976 29.110  1.00 37.41  ? 348 HIS B N   1 
ATOM   5972 C CA  . HIS B 1 348 ? 23.162  49.701 30.468  1.00 37.31  ? 348 HIS B CA  1 
ATOM   5973 C C   . HIS B 1 348 ? 23.184  48.194 30.686  1.00 39.31  ? 348 HIS B C   1 
ATOM   5974 O O   . HIS B 1 348 ? 22.925  47.431 29.747  1.00 38.21  ? 348 HIS B O   1 
ATOM   5975 C CB  . HIS B 1 348 ? 21.746  50.256 30.711  1.00 38.00  ? 348 HIS B CB  1 
ATOM   5976 C CG  . HIS B 1 348 ? 21.690  51.750 30.731  1.00 42.68  ? 348 HIS B CG  1 
ATOM   5977 N ND1 . HIS B 1 348 ? 22.573  52.500 31.498  1.00 45.74  ? 348 HIS B ND1 1 
ATOM   5978 C CD2 . HIS B 1 348 ? 20.845  52.591 30.093  1.00 44.51  ? 348 HIS B CD2 1 
ATOM   5979 C CE1 . HIS B 1 348 ? 22.255  53.763 31.274  1.00 45.39  ? 348 HIS B CE1 1 
ATOM   5980 N NE2 . HIS B 1 348 ? 21.217  53.868 30.443  1.00 45.05  ? 348 HIS B NE2 1 
ATOM   5981 N N   . VAL B 1 349 ? 23.506  47.759 31.910  1.00 35.33  ? 349 VAL B N   1 
ATOM   5982 C CA  . VAL B 1 349 ? 23.490  46.330 32.225  1.00 34.68  ? 349 VAL B CA  1 
ATOM   5983 C C   . VAL B 1 349 ? 22.027  45.829 32.194  1.00 37.62  ? 349 VAL B C   1 
ATOM   5984 O O   . VAL B 1 349 ? 21.177  46.427 32.868  1.00 37.55  ? 349 VAL B O   1 
ATOM   5985 C CB  . VAL B 1 349 ? 24.187  46.011 33.572  1.00 38.49  ? 349 VAL B CB  1 
ATOM   5986 C CG1 . VAL B 1 349 ? 24.116  44.518 33.895  1.00 37.51  ? 349 VAL B CG1 1 
ATOM   5987 C CG2 . VAL B 1 349 ? 25.632  46.492 33.559  1.00 39.25  ? 349 VAL B CG2 1 
ATOM   5988 N N   . PRO B 1 350 ? 21.707  44.786 31.386  1.00 32.95  ? 350 PRO B N   1 
ATOM   5989 C CA  . PRO B 1 350 ? 20.320  44.280 31.355  1.00 31.89  ? 350 PRO B CA  1 
ATOM   5990 C C   . PRO B 1 350 ? 19.899  43.647 32.687  1.00 36.91  ? 350 PRO B C   1 
ATOM   5991 O O   . PRO B 1 350 ? 20.649  42.836 33.254  1.00 36.74  ? 350 PRO B O   1 
ATOM   5992 C CB  . PRO B 1 350 ? 20.340  43.232 30.231  1.00 33.17  ? 350 PRO B CB  1 
ATOM   5993 C CG  . PRO B 1 350 ? 21.642  43.432 29.506  1.00 38.18  ? 350 PRO B CG  1 
ATOM   5994 C CD  . PRO B 1 350 ? 22.588  43.989 30.510  1.00 34.45  ? 350 PRO B CD  1 
ATOM   5995 N N   . ALA B 1 351 ? 18.712  44.051 33.203  1.00 34.01  ? 351 ALA B N   1 
ATOM   5996 C CA  . ALA B 1 351 ? 18.135  43.530 34.451  1.00 34.20  ? 351 ALA B CA  1 
ATOM   5997 C C   . ALA B 1 351 ? 17.442  42.153 34.245  1.00 37.67  ? 351 ALA B C   1 
ATOM   5998 O O   . ALA B 1 351 ? 17.373  41.341 35.173  1.00 35.80  ? 351 ALA B O   1 
ATOM   5999 C CB  . ALA B 1 351 ? 17.155  44.534 35.036  1.00 34.57  ? 351 ALA B CB  1 
ATOM   6000 N N   . ALA B 1 352 ? 16.934  41.907 33.025  1.00 34.73  ? 352 ALA B N   1 
ATOM   6001 C CA  . ALA B 1 352 ? 16.223  40.689 32.656  1.00 34.73  ? 352 ALA B CA  1 
ATOM   6002 C C   . ALA B 1 352 ? 16.256  40.459 31.143  1.00 37.81  ? 352 ALA B C   1 
ATOM   6003 O O   . ALA B 1 352 ? 16.648  41.343 30.373  1.00 36.56  ? 352 ALA B O   1 
ATOM   6004 C CB  . ALA B 1 352 ? 14.763  40.775 33.141  1.00 35.42  ? 352 ALA B CB  1 
ATOM   6005 N N   . GLY B 1 353 ? 15.847  39.261 30.742  1.00 36.15  ? 353 GLY B N   1 
ATOM   6006 C CA  . GLY B 1 353 ? 15.716  38.880 29.341  1.00 36.47  ? 353 GLY B CA  1 
ATOM   6007 C C   . GLY B 1 353 ? 16.947  38.342 28.653  1.00 40.67  ? 353 GLY B C   1 
ATOM   6008 O O   . GLY B 1 353 ? 17.771  37.688 29.292  1.00 39.86  ? 353 GLY B O   1 
ATOM   6009 N N   . MET B 1 354 ? 17.064  38.642 27.325  1.00 38.37  ? 354 MET B N   1 
ATOM   6010 C CA  . MET B 1 354 ? 18.127  38.183 26.407  1.00 39.13  ? 354 MET B CA  1 
ATOM   6011 C C   . MET B 1 354 ? 18.760  39.247 25.481  1.00 40.64  ? 354 MET B C   1 
ATOM   6012 O O   . MET B 1 354 ? 19.522  38.890 24.580  1.00 39.32  ? 354 MET B O   1 
ATOM   6013 C CB  . MET B 1 354 ? 17.656  36.948 25.605  1.00 42.17  ? 354 MET B CB  1 
ATOM   6014 C CG  . MET B 1 354 ? 16.288  37.122 24.959  1.00 46.19  ? 354 MET B CG  1 
ATOM   6015 S SD  . MET B 1 354 ? 15.716  35.650 24.080  1.00 51.11  ? 354 MET B SD  1 
ATOM   6016 C CE  . MET B 1 354 ? 15.350  34.549 25.464  1.00 47.86  ? 354 MET B CE  1 
ATOM   6017 N N   . PHE B 1 355 ? 18.509  40.543 25.734  1.00 37.46  ? 355 PHE B N   1 
ATOM   6018 C CA  . PHE B 1 355 ? 19.073  41.592 24.875  1.00 37.52  ? 355 PHE B CA  1 
ATOM   6019 C C   . PHE B 1 355 ? 20.016  42.599 25.537  1.00 40.62  ? 355 PHE B C   1 
ATOM   6020 O O   . PHE B 1 355 ? 19.823  42.966 26.691  1.00 41.19  ? 355 PHE B O   1 
ATOM   6021 C CB  . PHE B 1 355 ? 17.961  42.337 24.097  1.00 39.22  ? 355 PHE B CB  1 
ATOM   6022 C CG  . PHE B 1 355 ? 16.999  41.436 23.362  1.00 41.40  ? 355 PHE B CG  1 
ATOM   6023 C CD1 . PHE B 1 355 ? 17.438  40.616 22.320  1.00 45.56  ? 355 PHE B CD1 1 
ATOM   6024 C CD2 . PHE B 1 355 ? 15.656  41.397 23.712  1.00 42.82  ? 355 PHE B CD2 1 
ATOM   6025 C CE1 . PHE B 1 355 ? 16.548  39.771 21.649  1.00 45.75  ? 355 PHE B CE1 1 
ATOM   6026 C CE2 . PHE B 1 355 ? 14.771  40.541 23.049  1.00 45.27  ? 355 PHE B CE2 1 
ATOM   6027 C CZ  . PHE B 1 355 ? 15.221  39.740 22.017  1.00 43.56  ? 355 PHE B CZ  1 
ATOM   6028 N N   . LEU B 1 356 ? 21.022  43.063 24.763  1.00 35.03  ? 356 LEU B N   1 
ATOM   6029 C CA  . LEU B 1 356 ? 21.947  44.134 25.113  1.00 33.73  ? 356 LEU B CA  1 
ATOM   6030 C C   . LEU B 1 356 ? 21.725  45.259 24.101  1.00 34.96  ? 356 LEU B C   1 
ATOM   6031 O O   . LEU B 1 356 ? 21.859  45.034 22.899  1.00 34.19  ? 356 LEU B O   1 
ATOM   6032 C CB  . LEU B 1 356 ? 23.410  43.655 25.104  1.00 34.43  ? 356 LEU B CB  1 
ATOM   6033 C CG  . LEU B 1 356 ? 24.457  44.678 25.578  1.00 38.81  ? 356 LEU B CG  1 
ATOM   6034 C CD1 . LEU B 1 356 ? 24.310  44.999 27.076  1.00 38.26  ? 356 LEU B CD1 1 
ATOM   6035 C CD2 . LEU B 1 356 ? 25.847  44.197 25.259  1.00 41.36  ? 356 LEU B CD2 1 
ATOM   6036 N N   . TRP B 1 357 ? 21.326  46.443 24.594  1.00 31.28  ? 357 TRP B N   1 
ATOM   6037 C CA  . TRP B 1 357 ? 21.004  47.648 23.813  1.00 30.64  ? 357 TRP B CA  1 
ATOM   6038 C C   . TRP B 1 357 ? 22.223  48.575 23.786  1.00 33.27  ? 357 TRP B C   1 
ATOM   6039 O O   . TRP B 1 357 ? 22.573  49.180 24.807  1.00 32.93  ? 357 TRP B O   1 
ATOM   6040 C CB  . TRP B 1 357 ? 19.773  48.315 24.455  1.00 28.78  ? 357 TRP B CB  1 
ATOM   6041 C CG  . TRP B 1 357 ? 19.142  49.479 23.738  1.00 29.70  ? 357 TRP B CG  1 
ATOM   6042 C CD1 . TRP B 1 357 ? 18.865  50.699 24.277  1.00 32.67  ? 357 TRP B CD1 1 
ATOM   6043 C CD2 . TRP B 1 357 ? 18.528  49.470 22.433  1.00 29.42  ? 357 TRP B CD2 1 
ATOM   6044 N NE1 . TRP B 1 357 ? 18.170  51.472 23.373  1.00 32.06  ? 357 TRP B NE1 1 
ATOM   6045 C CE2 . TRP B 1 357 ? 17.956  50.745 22.231  1.00 33.11  ? 357 TRP B CE2 1 
ATOM   6046 C CE3 . TRP B 1 357 ? 18.445  48.523 21.393  1.00 30.41  ? 357 TRP B CE3 1 
ATOM   6047 C CZ2 . TRP B 1 357 ? 17.295  51.090 21.045  1.00 32.49  ? 357 TRP B CZ2 1 
ATOM   6048 C CZ3 . TRP B 1 357 ? 17.814  48.879 20.204  1.00 31.34  ? 357 TRP B CZ3 1 
ATOM   6049 C CH2 . TRP B 1 357 ? 17.241  50.144 20.042  1.00 32.06  ? 357 TRP B CH2 1 
ATOM   6050 N N   . ILE B 1 358 ? 22.890  48.646 22.621  1.00 29.08  ? 358 ILE B N   1 
ATOM   6051 C CA  . ILE B 1 358 ? 24.123  49.417 22.403  1.00 29.07  ? 358 ILE B CA  1 
ATOM   6052 C C   . ILE B 1 358 ? 23.876  50.755 21.675  1.00 34.65  ? 358 ILE B C   1 
ATOM   6053 O O   . ILE B 1 358 ? 23.259  50.766 20.615  1.00 35.12  ? 358 ILE B O   1 
ATOM   6054 C CB  . ILE B 1 358 ? 25.153  48.519 21.643  1.00 31.38  ? 358 ILE B CB  1 
ATOM   6055 C CG1 . ILE B 1 358 ? 25.569  47.285 22.474  1.00 29.56  ? 358 ILE B CG1 1 
ATOM   6056 C CG2 . ILE B 1 358 ? 26.373  49.308 21.165  1.00 33.96  ? 358 ILE B CG2 1 
ATOM   6057 C CD1 . ILE B 1 358 ? 25.620  46.059 21.689  1.00 28.99  ? 358 ILE B CD1 1 
ATOM   6058 N N   . LYS B 1 359 ? 24.390  51.867 22.228  1.00 31.62  ? 359 LYS B N   1 
ATOM   6059 C CA  . LYS B 1 359 ? 24.317  53.190 21.601  1.00 31.60  ? 359 LYS B CA  1 
ATOM   6060 C C   . LYS B 1 359 ? 25.684  53.516 21.063  1.00 37.25  ? 359 LYS B C   1 
ATOM   6061 O O   . LYS B 1 359 ? 26.601  53.706 21.858  1.00 36.84  ? 359 LYS B O   1 
ATOM   6062 C CB  . LYS B 1 359 ? 23.930  54.282 22.608  1.00 33.20  ? 359 LYS B CB  1 
ATOM   6063 C CG  . LYS B 1 359 ? 23.764  55.647 21.940  1.00 34.38  ? 359 LYS B CG  1 
ATOM   6064 C CD  . LYS B 1 359 ? 23.424  56.734 22.923  1.00 33.88  ? 359 LYS B CD  1 
ATOM   6065 C CE  . LYS B 1 359 ? 22.973  57.959 22.181  1.00 47.09  ? 359 LYS B CE  1 
ATOM   6066 N NZ  . LYS B 1 359 ? 22.729  59.091 23.113  1.00 65.31  ? 359 LYS B NZ  1 
ATOM   6067 N N   . VAL B 1 360 ? 25.821  53.618 19.737  1.00 35.30  ? 360 VAL B N   1 
ATOM   6068 C CA  . VAL B 1 360 ? 27.100  53.974 19.120  1.00 36.61  ? 360 VAL B CA  1 
ATOM   6069 C C   . VAL B 1 360 ? 27.332  55.483 19.301  1.00 44.60  ? 360 VAL B C   1 
ATOM   6070 O O   . VAL B 1 360 ? 26.511  56.293 18.875  1.00 44.76  ? 360 VAL B O   1 
ATOM   6071 C CB  . VAL B 1 360 ? 27.267  53.485 17.657  1.00 39.87  ? 360 VAL B CB  1 
ATOM   6072 C CG1 . VAL B 1 360 ? 28.692  53.704 17.182  1.00 40.34  ? 360 VAL B CG1 1 
ATOM   6073 C CG2 . VAL B 1 360 ? 26.889  52.005 17.517  1.00 38.89  ? 360 VAL B CG2 1 
ATOM   6074 N N   . LYS B 1 361 ? 28.431  55.836 19.996  1.00 43.50  ? 361 LYS B N   1 
ATOM   6075 C CA  . LYS B 1 361 ? 28.831  57.193 20.378  1.00 43.93  ? 361 LYS B CA  1 
ATOM   6076 C C   . LYS B 1 361 ? 28.844  58.263 19.307  1.00 51.92  ? 361 LYS B C   1 
ATOM   6077 O O   . LYS B 1 361 ? 28.219  59.304 19.519  1.00 53.89  ? 361 LYS B O   1 
ATOM   6078 C CB  . LYS B 1 361 ? 30.141  57.197 21.166  1.00 46.01  ? 361 LYS B CB  1 
ATOM   6079 C CG  . LYS B 1 361 ? 29.986  56.946 22.662  1.00 47.81  ? 361 LYS B CG  1 
ATOM   6080 C CD  . LYS B 1 361 ? 31.035  57.734 23.436  1.00 57.96  ? 361 LYS B CD  1 
ATOM   6081 C CE  . LYS B 1 361 ? 31.066  57.433 24.912  1.00 69.11  ? 361 LYS B CE  1 
ATOM   6082 N NZ  . LYS B 1 361 ? 31.859  56.211 25.228  1.00 76.07  ? 361 LYS B NZ  1 
ATOM   6083 N N   . GLY B 1 362 ? 29.540  58.029 18.194  1.00 49.80  ? 362 GLY B N   1 
ATOM   6084 C CA  . GLY B 1 362 ? 29.689  59.023 17.124  1.00 51.28  ? 362 GLY B CA  1 
ATOM   6085 C C   . GLY B 1 362 ? 28.585  59.139 16.089  1.00 56.49  ? 362 GLY B C   1 
ATOM   6086 O O   . GLY B 1 362 ? 28.010  60.214 15.904  1.00 53.97  ? 362 GLY B O   1 
ATOM   6087 N N   . ILE B 1 363 ? 28.306  58.030 15.394  1.00 56.93  ? 363 ILE B N   1 
ATOM   6088 C CA  . ILE B 1 363 ? 27.328  57.910 14.310  1.00 58.46  ? 363 ILE B CA  1 
ATOM   6089 C C   . ILE B 1 363 ? 25.873  58.279 14.683  1.00 62.64  ? 363 ILE B C   1 
ATOM   6090 O O   . ILE B 1 363 ? 25.475  58.173 15.851  1.00 61.74  ? 363 ILE B O   1 
ATOM   6091 C CB  . ILE B 1 363 ? 27.403  56.560 13.527  1.00 62.27  ? 363 ILE B CB  1 
ATOM   6092 C CG1 . ILE B 1 363 ? 28.423  55.511 14.067  1.00 62.96  ? 363 ILE B CG1 1 
ATOM   6093 C CG2 . ILE B 1 363 ? 27.436  56.774 12.010  1.00 64.62  ? 363 ILE B CG2 1 
ATOM   6094 C CD1 . ILE B 1 363 ? 29.912  55.712 13.850  1.00 68.97  ? 363 ILE B CD1 1 
ATOM   6095 N N   . ASN B 1 364 ? 25.097  58.718 13.665  1.00 59.69  ? 364 ASN B N   1 
ATOM   6096 C CA  . ASN B 1 364 ? 23.697  59.123 13.775  1.00 59.19  ? 364 ASN B CA  1 
ATOM   6097 C C   . ASN B 1 364 ? 22.762  58.015 13.287  1.00 59.44  ? 364 ASN B C   1 
ATOM   6098 O O   . ASN B 1 364 ? 21.692  57.835 13.868  1.00 57.86  ? 364 ASN B O   1 
ATOM   6099 C CB  . ASN B 1 364 ? 23.451  60.428 12.988  1.00 65.06  ? 364 ASN B CB  1 
ATOM   6100 C CG  . ASN B 1 364 ? 24.276  61.621 13.437  1.00 92.76  ? 364 ASN B CG  1 
ATOM   6101 O OD1 . ASN B 1 364 ? 24.478  61.881 14.635  1.00 86.53  ? 364 ASN B OD1 1 
ATOM   6102 N ND2 . ASN B 1 364 ? 24.741  62.397 12.472  1.00 85.58  ? 364 ASN B ND2 1 
ATOM   6103 N N   . ASP B 1 365 ? 23.164  57.285 12.219  1.00 54.17  ? 365 ASP B N   1 
ATOM   6104 C CA  . ASP B 1 365 ? 22.399  56.179 11.629  1.00 51.90  ? 365 ASP B CA  1 
ATOM   6105 C C   . ASP B 1 365 ? 23.261  54.919 11.534  1.00 51.15  ? 365 ASP B C   1 
ATOM   6106 O O   . ASP B 1 365 ? 24.239  54.885 10.792  1.00 51.86  ? 365 ASP B O   1 
ATOM   6107 C CB  . ASP B 1 365 ? 21.814  56.572 10.256  1.00 54.56  ? 365 ASP B CB  1 
ATOM   6108 C CG  . ASP B 1 365 ? 21.063  55.454 9.563   1.00 68.63  ? 365 ASP B CG  1 
ATOM   6109 O OD1 . ASP B 1 365 ? 21.607  54.893 8.576   1.00 69.95  ? 365 ASP B OD1 1 
ATOM   6110 O OD2 . ASP B 1 365 ? 19.961  55.096 10.040  1.00 76.61  ? 365 ASP B OD2 1 
ATOM   6111 N N   . VAL B 1 366 ? 22.886  53.893 12.290  1.00 43.73  ? 366 VAL B N   1 
ATOM   6112 C CA  . VAL B 1 366 ? 23.589  52.613 12.369  1.00 42.95  ? 366 VAL B CA  1 
ATOM   6113 C C   . VAL B 1 366 ? 23.124  51.579 11.295  1.00 46.59  ? 366 VAL B C   1 
ATOM   6114 O O   . VAL B 1 366 ? 23.741  50.525 11.146  1.00 44.73  ? 366 VAL B O   1 
ATOM   6115 C CB  . VAL B 1 366 ? 23.542  52.091 13.838  1.00 46.07  ? 366 VAL B CB  1 
ATOM   6116 C CG1 . VAL B 1 366 ? 22.378  51.123 14.084  1.00 45.29  ? 366 VAL B CG1 1 
ATOM   6117 C CG2 . VAL B 1 366 ? 24.866  51.482 14.250  1.00 45.94  ? 366 VAL B CG2 1 
ATOM   6118 N N   . LYS B 1 367 ? 22.079  51.943 10.514  1.00 45.44  ? 367 LYS B N   1 
ATOM   6119 C CA  . LYS B 1 367 ? 21.399  51.142 9.481   1.00 46.45  ? 367 LYS B CA  1 
ATOM   6120 C C   . LYS B 1 367 ? 22.204  50.488 8.354   1.00 53.56  ? 367 LYS B C   1 
ATOM   6121 O O   . LYS B 1 367 ? 22.115  49.270 8.235   1.00 53.24  ? 367 LYS B O   1 
ATOM   6122 C CB  . LYS B 1 367 ? 20.126  51.830 8.947   1.00 49.42  ? 367 LYS B CB  1 
ATOM   6123 C CG  . LYS B 1 367 ? 19.018  50.841 8.561   1.00 61.53  ? 367 LYS B CG  1 
ATOM   6124 C CD  . LYS B 1 367 ? 17.768  51.536 8.040   1.00 74.23  ? 367 LYS B CD  1 
ATOM   6125 C CE  . LYS B 1 367 ? 16.787  50.575 7.401   1.00 90.24  ? 367 LYS B CE  1 
ATOM   6126 N NZ  . LYS B 1 367 ? 17.152  50.247 5.993   1.00 102.14 ? 367 LYS B NZ  1 
ATOM   6127 N N   . GLU B 1 368 ? 22.921  51.247 7.491   1.00 53.06  ? 368 GLU B N   1 
ATOM   6128 C CA  . GLU B 1 368 ? 23.667  50.586 6.405   1.00 54.52  ? 368 GLU B CA  1 
ATOM   6129 C C   . GLU B 1 368 ? 24.849  49.765 6.936   1.00 59.18  ? 368 GLU B C   1 
ATOM   6130 O O   . GLU B 1 368 ? 25.163  48.713 6.389   1.00 59.63  ? 368 GLU B O   1 
ATOM   6131 C CB  . GLU B 1 368 ? 24.053  51.545 5.259   1.00 57.62  ? 368 GLU B CB  1 
ATOM   6132 C CG  . GLU B 1 368 ? 25.321  52.366 5.475   1.00 76.82  ? 368 GLU B CG  1 
ATOM   6133 C CD  . GLU B 1 368 ? 25.765  53.252 4.322   1.00 111.12 ? 368 GLU B CD  1 
ATOM   6134 O OE1 . GLU B 1 368 ? 26.136  54.419 4.589   1.00 102.08 ? 368 GLU B OE1 1 
ATOM   6135 O OE2 . GLU B 1 368 ? 25.767  52.779 3.160   1.00 112.59 ? 368 GLU B OE2 1 
ATOM   6136 N N   . LEU B 1 369 ? 25.453  50.230 8.040   1.00 55.32  ? 369 LEU B N   1 
ATOM   6137 C CA  . LEU B 1 369 ? 26.566  49.600 8.746   1.00 54.37  ? 369 LEU B CA  1 
ATOM   6138 C C   . LEU B 1 369 ? 26.177  48.177 9.181   1.00 56.49  ? 369 LEU B C   1 
ATOM   6139 O O   . LEU B 1 369 ? 26.970  47.255 9.005   1.00 56.05  ? 369 LEU B O   1 
ATOM   6140 C CB  . LEU B 1 369 ? 26.890  50.480 9.968   1.00 53.99  ? 369 LEU B CB  1 
ATOM   6141 C CG  . LEU B 1 369 ? 28.085  50.123 10.827  1.00 58.98  ? 369 LEU B CG  1 
ATOM   6142 C CD1 . LEU B 1 369 ? 28.842  51.355 11.209  1.00 60.10  ? 369 LEU B CD1 1 
ATOM   6143 C CD2 . LEU B 1 369 ? 27.655  49.431 12.095  1.00 61.03  ? 369 LEU B CD2 1 
ATOM   6144 N N   . ILE B 1 370 ? 24.941  48.009 9.707   1.00 52.09  ? 370 ILE B N   1 
ATOM   6145 C CA  . ILE B 1 370 ? 24.395  46.753 10.245  1.00 51.30  ? 370 ILE B CA  1 
ATOM   6146 C C   . ILE B 1 370 ? 23.715  45.802 9.231   1.00 56.34  ? 370 ILE B C   1 
ATOM   6147 O O   . ILE B 1 370 ? 23.838  44.581 9.374   1.00 55.30  ? 370 ILE B O   1 
ATOM   6148 C CB  . ILE B 1 370 ? 23.578  47.043 11.553  1.00 53.17  ? 370 ILE B CB  1 
ATOM   6149 C CG1 . ILE B 1 370 ? 24.502  47.364 12.753  1.00 53.17  ? 370 ILE B CG1 1 
ATOM   6150 C CG2 . ILE B 1 370 ? 22.546  45.974 11.917  1.00 53.78  ? 370 ILE B CG2 1 
ATOM   6151 C CD1 . ILE B 1 370 ? 25.600  46.332 13.091  1.00 57.29  ? 370 ILE B CD1 1 
ATOM   6152 N N   . GLU B 1 371 ? 23.021  46.359 8.213   1.00 54.29  ? 371 GLU B N   1 
ATOM   6153 C CA  . GLU B 1 371 ? 22.305  45.604 7.166   1.00 54.24  ? 371 GLU B CA  1 
ATOM   6154 C C   . GLU B 1 371 ? 23.168  45.292 5.923   1.00 59.58  ? 371 GLU B C   1 
ATOM   6155 O O   . GLU B 1 371 ? 22.813  44.402 5.142   1.00 60.93  ? 371 GLU B O   1 
ATOM   6156 C CB  . GLU B 1 371 ? 21.042  46.362 6.714   1.00 55.16  ? 371 GLU B CB  1 
ATOM   6157 C CG  . GLU B 1 371 ? 19.920  46.394 7.734   1.00 64.29  ? 371 GLU B CG  1 
ATOM   6158 C CD  . GLU B 1 371 ? 18.738  47.288 7.401   1.00 86.00  ? 371 GLU B CD  1 
ATOM   6159 O OE1 . GLU B 1 371 ? 18.670  47.803 6.259   1.00 95.87  ? 371 GLU B OE1 1 
ATOM   6160 O OE2 . GLU B 1 371 ? 17.871  47.471 8.288   1.00 67.67  ? 371 GLU B OE2 1 
ATOM   6161 N N   . GLU B 1 372 ? 24.257  46.035 5.710   1.00 54.38  ? 372 GLU B N   1 
ATOM   6162 C CA  . GLU B 1 372 ? 25.073  45.819 4.524   1.00 55.17  ? 372 GLU B CA  1 
ATOM   6163 C C   . GLU B 1 372 ? 26.503  45.402 4.867   1.00 57.70  ? 372 GLU B C   1 
ATOM   6164 O O   . GLU B 1 372 ? 26.897  44.263 4.593   1.00 57.22  ? 372 GLU B O   1 
ATOM   6165 C CB  . GLU B 1 372 ? 25.035  47.056 3.591   1.00 57.71  ? 372 GLU B CB  1 
ATOM   6166 C CG  . GLU B 1 372 ? 23.678  47.288 2.939   1.00 72.14  ? 372 GLU B CG  1 
ATOM   6167 C CD  . GLU B 1 372 ? 23.388  48.700 2.458   1.00 100.55 ? 372 GLU B CD  1 
ATOM   6168 O OE1 . GLU B 1 372 ? 22.619  49.411 3.146   1.00 96.05  ? 372 GLU B OE1 1 
ATOM   6169 O OE2 . GLU B 1 372 ? 23.875  49.074 1.365   1.00 96.44  ? 372 GLU B OE2 1 
ATOM   6170 N N   . LYS B 1 373 ? 27.268  46.327 5.470   1.00 52.26  ? 373 LYS B N   1 
ATOM   6171 C CA  . LYS B 1 373 ? 28.663  46.150 5.857   1.00 51.22  ? 373 LYS B CA  1 
ATOM   6172 C C   . LYS B 1 373 ? 28.885  44.970 6.809   1.00 51.98  ? 373 LYS B C   1 
ATOM   6173 O O   . LYS B 1 373 ? 29.874  44.246 6.660   1.00 52.09  ? 373 LYS B O   1 
ATOM   6174 C CB  . LYS B 1 373 ? 29.228  47.462 6.445   1.00 53.24  ? 373 LYS B CB  1 
ATOM   6175 C CG  . LYS B 1 373 ? 29.455  48.577 5.423   1.00 62.48  ? 373 LYS B CG  1 
ATOM   6176 C CD  . LYS B 1 373 ? 28.267  49.528 5.321   1.00 70.75  ? 373 LYS B CD  1 
ATOM   6177 C CE  . LYS B 1 373 ? 28.315  50.358 4.062   1.00 82.98  ? 373 LYS B CE  1 
ATOM   6178 N NZ  . LYS B 1 373 ? 27.033  50.284 3.306   1.00 90.84  ? 373 LYS B NZ  1 
ATOM   6179 N N   . ALA B 1 374 ? 27.968  44.774 7.772   1.00 46.70  ? 374 ALA B N   1 
ATOM   6180 C CA  . ALA B 1 374 ? 28.069  43.705 8.772   1.00 46.17  ? 374 ALA B CA  1 
ATOM   6181 C C   . ALA B 1 374 ? 27.722  42.295 8.259   1.00 48.90  ? 374 ALA B C   1 
ATOM   6182 O O   . ALA B 1 374 ? 28.372  41.328 8.665   1.00 47.18  ? 374 ALA B O   1 
ATOM   6183 C CB  . ALA B 1 374 ? 27.247  44.049 10.003  1.00 45.84  ? 374 ALA B CB  1 
ATOM   6184 N N   . VAL B 1 375 ? 26.697  42.181 7.385   1.00 45.74  ? 375 VAL B N   1 
ATOM   6185 C CA  . VAL B 1 375 ? 26.289  40.904 6.794   1.00 46.13  ? 375 VAL B CA  1 
ATOM   6186 C C   . VAL B 1 375 ? 27.415  40.394 5.867   1.00 52.21  ? 375 VAL B C   1 
ATOM   6187 O O   . VAL B 1 375 ? 27.824  39.239 5.986   1.00 51.43  ? 375 VAL B O   1 
ATOM   6188 C CB  . VAL B 1 375 ? 24.899  40.972 6.119   1.00 49.63  ? 375 VAL B CB  1 
ATOM   6189 C CG1 . VAL B 1 375 ? 24.439  39.591 5.675   1.00 49.24  ? 375 VAL B CG1 1 
ATOM   6190 C CG2 . VAL B 1 375 ? 23.866  41.591 7.060   1.00 48.35  ? 375 VAL B CG2 1 
ATOM   6191 N N   . LYS B 1 376 ? 27.973  41.283 5.022   1.00 51.49  ? 376 LYS B N   1 
ATOM   6192 C CA  . LYS B 1 376 ? 29.118  40.989 4.159   1.00 54.11  ? 376 LYS B CA  1 
ATOM   6193 C C   . LYS B 1 376 ? 30.221  40.389 5.030   1.00 62.61  ? 376 LYS B C   1 
ATOM   6194 O O   . LYS B 1 376 ? 30.781  39.350 4.682   1.00 64.65  ? 376 LYS B O   1 
ATOM   6195 C CB  . LYS B 1 376 ? 29.619  42.276 3.465   1.00 57.38  ? 376 LYS B CB  1 
ATOM   6196 C CG  . LYS B 1 376 ? 30.992  42.160 2.799   1.00 74.95  ? 376 LYS B CG  1 
ATOM   6197 C CD  . LYS B 1 376 ? 32.069  42.866 3.624   1.00 89.58  ? 376 LYS B CD  1 
ATOM   6198 C CE  . LYS B 1 376 ? 33.472  42.488 3.210   1.00 98.18  ? 376 LYS B CE  1 
ATOM   6199 N NZ  . LYS B 1 376 ? 34.492  43.296 3.933   1.00 102.23 ? 376 LYS B NZ  1 
ATOM   6200 N N   . MET B 1 377 ? 30.492  41.020 6.184   1.00 60.06  ? 377 MET B N   1 
ATOM   6201 C CA  . MET B 1 377 ? 31.501  40.550 7.122   1.00 60.91  ? 377 MET B CA  1 
ATOM   6202 C C   . MET B 1 377 ? 31.128  39.297 7.947   1.00 61.94  ? 377 MET B C   1 
ATOM   6203 O O   . MET B 1 377 ? 31.960  38.810 8.710   1.00 60.99  ? 377 MET B O   1 
ATOM   6204 C CB  . MET B 1 377 ? 32.054  41.706 7.959   1.00 64.04  ? 377 MET B CB  1 
ATOM   6205 C CG  . MET B 1 377 ? 33.194  42.402 7.266   1.00 70.60  ? 377 MET B CG  1 
ATOM   6206 S SD  . MET B 1 377 ? 34.233  43.360 8.387   1.00 76.92  ? 377 MET B SD  1 
ATOM   6207 C CE  . MET B 1 377 ? 35.636  43.706 7.310   1.00 75.62  ? 377 MET B CE  1 
ATOM   6208 N N   . GLY B 1 378 ? 29.902  38.787 7.766   1.00 57.24  ? 378 GLY B N   1 
ATOM   6209 C CA  . GLY B 1 378 ? 29.396  37.573 8.406   1.00 56.08  ? 378 GLY B CA  1 
ATOM   6210 C C   . GLY B 1 378 ? 28.818  37.651 9.811   1.00 58.11  ? 378 GLY B C   1 
ATOM   6211 O O   . GLY B 1 378 ? 28.705  36.611 10.469  1.00 58.13  ? 378 GLY B O   1 
ATOM   6212 N N   . VAL B 1 379 ? 28.425  38.865 10.284  1.00 51.98  ? 379 VAL B N   1 
ATOM   6213 C CA  . VAL B 1 379 ? 27.849  39.084 11.622  1.00 49.49  ? 379 VAL B CA  1 
ATOM   6214 C C   . VAL B 1 379 ? 26.438  39.679 11.514  1.00 53.67  ? 379 VAL B C   1 
ATOM   6215 O O   . VAL B 1 379 ? 26.219  40.660 10.798  1.00 53.43  ? 379 VAL B O   1 
ATOM   6216 C CB  . VAL B 1 379 ? 28.809  39.883 12.556  1.00 52.38  ? 379 VAL B CB  1 
ATOM   6217 C CG1 . VAL B 1 379 ? 28.122  40.369 13.832  1.00 50.65  ? 379 VAL B CG1 1 
ATOM   6218 C CG2 . VAL B 1 379 ? 30.043  39.061 12.902  1.00 52.86  ? 379 VAL B CG2 1 
ATOM   6219 N N   . LEU B 1 380 ? 25.482  39.061 12.217  1.00 50.14  ? 380 LEU B N   1 
ATOM   6220 C CA  . LEU B 1 380 ? 24.079  39.465 12.226  1.00 48.89  ? 380 LEU B CA  1 
ATOM   6221 C C   . LEU B 1 380 ? 23.670  40.073 13.537  1.00 49.83  ? 380 LEU B C   1 
ATOM   6222 O O   . LEU B 1 380 ? 23.910  39.489 14.594  1.00 47.83  ? 380 LEU B O   1 
ATOM   6223 C CB  . LEU B 1 380 ? 23.173  38.272 11.900  1.00 48.98  ? 380 LEU B CB  1 
ATOM   6224 C CG  . LEU B 1 380 ? 23.303  37.727 10.490  1.00 55.12  ? 380 LEU B CG  1 
ATOM   6225 C CD1 . LEU B 1 380 ? 22.631  36.378 10.365  1.00 54.73  ? 380 LEU B CD1 1 
ATOM   6226 C CD2 . LEU B 1 380 ? 22.785  38.738 9.451   1.00 59.31  ? 380 LEU B CD2 1 
ATOM   6227 N N   . MET B 1 381 ? 23.057  41.266 13.451  1.00 45.82  ? 381 MET B N   1 
ATOM   6228 C CA  . MET B 1 381 ? 22.528  42.083 14.549  1.00 44.46  ? 381 MET B CA  1 
ATOM   6229 C C   . MET B 1 381 ? 21.349  42.907 13.991  1.00 46.22  ? 381 MET B C   1 
ATOM   6230 O O   . MET B 1 381 ? 21.145  42.906 12.773  1.00 46.70  ? 381 MET B O   1 
ATOM   6231 C CB  . MET B 1 381 ? 23.620  43.014 15.096  1.00 47.44  ? 381 MET B CB  1 
ATOM   6232 C CG  . MET B 1 381 ? 24.570  42.361 16.053  1.00 52.11  ? 381 MET B CG  1 
ATOM   6233 S SD  . MET B 1 381 ? 26.034  43.400 16.260  1.00 58.55  ? 381 MET B SD  1 
ATOM   6234 C CE  . MET B 1 381 ? 27.126  42.295 17.141  1.00 55.67  ? 381 MET B CE  1 
ATOM   6235 N N   . LEU B 1 382 ? 20.591  43.613 14.860  1.00 40.28  ? 382 LEU B N   1 
ATOM   6236 C CA  . LEU B 1 382 ? 19.458  44.445 14.437  1.00 39.41  ? 382 LEU B CA  1 
ATOM   6237 C C   . LEU B 1 382 ? 19.623  45.955 14.682  1.00 43.19  ? 382 LEU B C   1 
ATOM   6238 O O   . LEU B 1 382 ? 19.946  46.350 15.803  1.00 43.17  ? 382 LEU B O   1 
ATOM   6239 C CB  . LEU B 1 382 ? 18.155  43.983 15.106  1.00 38.45  ? 382 LEU B CB  1 
ATOM   6240 C CG  . LEU B 1 382 ? 17.465  42.764 14.524  1.00 42.44  ? 382 LEU B CG  1 
ATOM   6241 C CD1 . LEU B 1 382 ? 16.433  42.272 15.463  1.00 41.19  ? 382 LEU B CD1 1 
ATOM   6242 C CD2 . LEU B 1 382 ? 16.792  43.086 13.200  1.00 45.44  ? 382 LEU B CD2 1 
ATOM   6243 N N   . PRO B 1 383 ? 19.315  46.834 13.705  1.00 38.99  ? 383 PRO B N   1 
ATOM   6244 C CA  . PRO B 1 383 ? 19.381  48.269 13.997  1.00 39.23  ? 383 PRO B CA  1 
ATOM   6245 C C   . PRO B 1 383 ? 18.133  48.747 14.739  1.00 42.14  ? 383 PRO B C   1 
ATOM   6246 O O   . PRO B 1 383 ? 17.044  48.224 14.521  1.00 41.27  ? 383 PRO B O   1 
ATOM   6247 C CB  . PRO B 1 383 ? 19.509  48.925 12.609  1.00 41.75  ? 383 PRO B CB  1 
ATOM   6248 C CG  . PRO B 1 383 ? 19.376  47.822 11.599  1.00 45.28  ? 383 PRO B CG  1 
ATOM   6249 C CD  . PRO B 1 383 ? 18.879  46.598 12.313  1.00 40.17  ? 383 PRO B CD  1 
ATOM   6250 N N   . GLY B 1 384 ? 18.316  49.768 15.572  1.00 38.45  ? 384 GLY B N   1 
ATOM   6251 C CA  . GLY B 1 384 ? 17.295  50.381 16.409  1.00 38.04  ? 384 GLY B CA  1 
ATOM   6252 C C   . GLY B 1 384 ? 16.021  50.863 15.749  1.00 42.94  ? 384 GLY B C   1 
ATOM   6253 O O   . GLY B 1 384 ? 14.997  50.926 16.432  1.00 42.19  ? 384 GLY B O   1 
ATOM   6254 N N   . ASN B 1 385 ? 16.069  51.211 14.437  1.00 40.45  ? 385 ASN B N   1 
ATOM   6255 C CA  . ASN B 1 385 ? 14.962  51.720 13.609  1.00 41.04  ? 385 ASN B CA  1 
ATOM   6256 C C   . ASN B 1 385 ? 13.641  50.977 13.840  1.00 47.49  ? 385 ASN B C   1 
ATOM   6257 O O   . ASN B 1 385 ? 12.616  51.614 14.079  1.00 49.01  ? 385 ASN B O   1 
ATOM   6258 C CB  . ASN B 1 385 ? 15.341  51.679 12.123  1.00 42.22  ? 385 ASN B CB  1 
ATOM   6259 C CG  . ASN B 1 385 ? 16.645  52.379 11.823  1.00 85.37  ? 385 ASN B CG  1 
ATOM   6260 O OD1 . ASN B 1 385 ? 17.720  51.773 11.872  1.00 83.86  ? 385 ASN B OD1 1 
ATOM   6261 N ND2 . ASN B 1 385 ? 16.586  53.680 11.531  1.00 80.16  ? 385 ASN B ND2 1 
ATOM   6262 N N   . ALA B 1 386 ? 13.684  49.634 13.837  1.00 42.70  ? 386 ALA B N   1 
ATOM   6263 C CA  . ALA B 1 386 ? 12.559  48.722 14.017  1.00 41.51  ? 386 ALA B CA  1 
ATOM   6264 C C   . ALA B 1 386 ? 11.735  48.915 15.290  1.00 43.98  ? 386 ALA B C   1 
ATOM   6265 O O   . ALA B 1 386 ? 10.578  48.506 15.318  1.00 44.56  ? 386 ALA B O   1 
ATOM   6266 C CB  . ALA B 1 386 ? 13.071  47.287 13.975  1.00 41.91  ? 386 ALA B CB  1 
ATOM   6267 N N   . PHE B 1 387 ? 12.334  49.467 16.346  1.00 37.29  ? 387 PHE B N   1 
ATOM   6268 C CA  . PHE B 1 387 ? 11.715  49.590 17.659  1.00 35.31  ? 387 PHE B CA  1 
ATOM   6269 C C   . PHE B 1 387 ? 11.065  50.947 17.921  1.00 38.37  ? 387 PHE B C   1 
ATOM   6270 O O   . PHE B 1 387 ? 10.741  51.282 19.065  1.00 35.86  ? 387 PHE B O   1 
ATOM   6271 C CB  . PHE B 1 387 ? 12.733  49.201 18.736  1.00 36.26  ? 387 PHE B CB  1 
ATOM   6272 C CG  . PHE B 1 387 ? 13.442  47.894 18.440  1.00 36.72  ? 387 PHE B CG  1 
ATOM   6273 C CD1 . PHE B 1 387 ? 14.623  47.874 17.718  1.00 39.14  ? 387 PHE B CD1 1 
ATOM   6274 C CD2 . PHE B 1 387 ? 12.919  46.686 18.872  1.00 37.56  ? 387 PHE B CD2 1 
ATOM   6275 C CE1 . PHE B 1 387 ? 15.263  46.666 17.433  1.00 39.73  ? 387 PHE B CE1 1 
ATOM   6276 C CE2 . PHE B 1 387 ? 13.572  45.483 18.605  1.00 39.68  ? 387 PHE B CE2 1 
ATOM   6277 C CZ  . PHE B 1 387 ? 14.737  45.480 17.884  1.00 38.19  ? 387 PHE B CZ  1 
ATOM   6278 N N   . TYR B 1 388 ? 10.820  51.697 16.839  1.00 35.97  ? 388 TYR B N   1 
ATOM   6279 C CA  . TYR B 1 388 ? 10.213  53.019 16.883  1.00 36.44  ? 388 TYR B CA  1 
ATOM   6280 C C   . TYR B 1 388 ? 9.001   53.113 15.972  1.00 41.54  ? 388 TYR B C   1 
ATOM   6281 O O   . TYR B 1 388 ? 8.951   52.440 14.939  1.00 40.79  ? 388 TYR B O   1 
ATOM   6282 C CB  . TYR B 1 388 ? 11.257  54.084 16.487  1.00 38.09  ? 388 TYR B CB  1 
ATOM   6283 C CG  . TYR B 1 388 ? 12.326  54.276 17.539  1.00 38.69  ? 388 TYR B CG  1 
ATOM   6284 C CD1 . TYR B 1 388 ? 12.117  55.121 18.629  1.00 39.81  ? 388 TYR B CD1 1 
ATOM   6285 C CD2 . TYR B 1 388 ? 13.525  53.574 17.478  1.00 39.60  ? 388 TYR B CD2 1 
ATOM   6286 C CE1 . TYR B 1 388 ? 13.081  55.273 19.621  1.00 39.96  ? 388 TYR B CE1 1 
ATOM   6287 C CE2 . TYR B 1 388 ? 14.493  53.708 18.474  1.00 40.71  ? 388 TYR B CE2 1 
ATOM   6288 C CZ  . TYR B 1 388 ? 14.269  54.571 19.535  1.00 49.29  ? 388 TYR B CZ  1 
ATOM   6289 O OH  . TYR B 1 388 ? 15.221  54.747 20.500  1.00 53.41  ? 388 TYR B OH  1 
ATOM   6290 N N   . VAL B 1 389 ? 8.035   53.977 16.337  1.00 40.13  ? 389 VAL B N   1 
ATOM   6291 C CA  . VAL B 1 389 ? 6.832   54.263 15.537  1.00 40.59  ? 389 VAL B CA  1 
ATOM   6292 C C   . VAL B 1 389 ? 7.289   54.860 14.199  1.00 46.71  ? 389 VAL B C   1 
ATOM   6293 O O   . VAL B 1 389 ? 6.851   54.398 13.140  1.00 47.59  ? 389 VAL B O   1 
ATOM   6294 C CB  . VAL B 1 389 ? 5.844   55.173 16.302  1.00 43.96  ? 389 VAL B CB  1 
ATOM   6295 C CG1 . VAL B 1 389 ? 4.704   55.670 15.408  1.00 44.09  ? 389 VAL B CG1 1 
ATOM   6296 C CG2 . VAL B 1 389 ? 5.304   54.443 17.526  1.00 43.04  ? 389 VAL B CG2 1 
ATOM   6297 N N   . ASP B 1 390 ? 8.236   55.817 14.258  1.00 44.58  ? 390 ASP B N   1 
ATOM   6298 C CA  . ASP B 1 390 ? 8.838   56.441 13.082  1.00 46.14  ? 390 ASP B CA  1 
ATOM   6299 C C   . ASP B 1 390 ? 10.157  55.711 12.813  1.00 50.81  ? 390 ASP B C   1 
ATOM   6300 O O   . ASP B 1 390 ? 11.228  56.156 13.248  1.00 51.06  ? 390 ASP B O   1 
ATOM   6301 C CB  . ASP B 1 390 ? 9.047   57.959 13.313  1.00 48.91  ? 390 ASP B CB  1 
ATOM   6302 C CG  . ASP B 1 390 ? 9.531   58.765 12.115  1.00 59.31  ? 390 ASP B CG  1 
ATOM   6303 O OD1 . ASP B 1 390 ? 9.445   60.012 12.169  1.00 61.11  ? 390 ASP B OD1 1 
ATOM   6304 O OD2 . ASP B 1 390 ? 10.024  58.150 11.133  1.00 61.87  ? 390 ASP B OD2 1 
ATOM   6305 N N   . SER B 1 391 ? 10.062  54.570 12.108  1.00 47.25  ? 391 SER B N   1 
ATOM   6306 C CA  . SER B 1 391 ? 11.195  53.704 11.768  1.00 47.30  ? 391 SER B CA  1 
ATOM   6307 C C   . SER B 1 391 ? 12.087  54.261 10.669  1.00 54.17  ? 391 SER B C   1 
ATOM   6308 O O   . SER B 1 391 ? 13.163  53.708 10.430  1.00 54.61  ? 391 SER B O   1 
ATOM   6309 C CB  . SER B 1 391 ? 10.728  52.290 11.427  1.00 50.11  ? 391 SER B CB  1 
ATOM   6310 O OG  . SER B 1 391 ? 9.406   52.260 10.920  1.00 61.10  ? 391 SER B OG  1 
ATOM   6311 N N   . SER B 1 392 ? 11.650  55.357 10.010  1.00 51.79  ? 392 SER B N   1 
ATOM   6312 C CA  . SER B 1 392 ? 12.384  56.027 8.938   1.00 52.38  ? 392 SER B CA  1 
ATOM   6313 C C   . SER B 1 392 ? 13.412  57.016 9.492   1.00 55.76  ? 392 SER B C   1 
ATOM   6314 O O   . SER B 1 392 ? 14.364  57.383 8.791   1.00 58.90  ? 392 SER B O   1 
ATOM   6315 C CB  . SER B 1 392 ? 11.420  56.714 7.973   1.00 57.68  ? 392 SER B CB  1 
ATOM   6316 O OG  . SER B 1 392 ? 10.432  57.455 8.668   1.00 69.32  ? 392 SER B OG  1 
ATOM   6317 N N   . ALA B 1 393 ? 13.226  57.445 10.745  1.00 47.96  ? 393 ALA B N   1 
ATOM   6318 C CA  . ALA B 1 393 ? 14.149  58.344 11.429  1.00 46.76  ? 393 ALA B CA  1 
ATOM   6319 C C   . ALA B 1 393 ? 15.479  57.597 11.696  1.00 49.80  ? 393 ALA B C   1 
ATOM   6320 O O   . ALA B 1 393 ? 15.464  56.377 11.935  1.00 48.85  ? 393 ALA B O   1 
ATOM   6321 C CB  . ALA B 1 393 ? 13.534  58.810 12.743  1.00 46.68  ? 393 ALA B CB  1 
ATOM   6322 N N   . PRO B 1 394 ? 16.636  58.286 11.634  1.00 45.66  ? 394 PRO B N   1 
ATOM   6323 C CA  . PRO B 1 394 ? 17.903  57.591 11.904  1.00 44.65  ? 394 PRO B CA  1 
ATOM   6324 C C   . PRO B 1 394 ? 18.060  57.193 13.378  1.00 46.59  ? 394 PRO B C   1 
ATOM   6325 O O   . PRO B 1 394 ? 17.552  57.899 14.258  1.00 44.81  ? 394 PRO B O   1 
ATOM   6326 C CB  . PRO B 1 394 ? 18.956  58.600 11.458  1.00 47.69  ? 394 PRO B CB  1 
ATOM   6327 C CG  . PRO B 1 394 ? 18.306  59.923 11.568  1.00 52.85  ? 394 PRO B CG  1 
ATOM   6328 C CD  . PRO B 1 394 ? 16.851  59.719 11.337  1.00 48.35  ? 394 PRO B CD  1 
ATOM   6329 N N   . SER B 1 395 ? 18.744  56.047 13.640  1.00 42.88  ? 395 SER B N   1 
ATOM   6330 C CA  . SER B 1 395 ? 18.959  55.518 14.993  1.00 41.56  ? 395 SER B CA  1 
ATOM   6331 C C   . SER B 1 395 ? 20.422  55.150 15.261  1.00 44.37  ? 395 SER B C   1 
ATOM   6332 O O   . SER B 1 395 ? 20.987  54.364 14.498  1.00 44.00  ? 395 SER B O   1 
ATOM   6333 C CB  . SER B 1 395 ? 18.072  54.300 15.235  1.00 43.49  ? 395 SER B CB  1 
ATOM   6334 O OG  . SER B 1 395 ? 18.103  53.903 16.598  1.00 50.62  ? 395 SER B OG  1 
ATOM   6335 N N   . PRO B 1 396 ? 21.051  55.658 16.351  1.00 39.88  ? 396 PRO B N   1 
ATOM   6336 C CA  . PRO B 1 396 ? 22.453  55.283 16.622  1.00 39.76  ? 396 PRO B CA  1 
ATOM   6337 C C   . PRO B 1 396 ? 22.575  53.954 17.388  1.00 42.14  ? 396 PRO B C   1 
ATOM   6338 O O   . PRO B 1 396 ? 23.689  53.457 17.595  1.00 42.10  ? 396 PRO B O   1 
ATOM   6339 C CB  . PRO B 1 396 ? 22.960  56.462 17.456  1.00 41.61  ? 396 PRO B CB  1 
ATOM   6340 C CG  . PRO B 1 396 ? 21.763  56.888 18.237  1.00 45.25  ? 396 PRO B CG  1 
ATOM   6341 C CD  . PRO B 1 396 ? 20.543  56.594 17.377  1.00 40.46  ? 396 PRO B CD  1 
ATOM   6342 N N   . TYR B 1 397 ? 21.422  53.394 17.821  1.00 35.81  ? 397 TYR B N   1 
ATOM   6343 C CA  . TYR B 1 397 ? 21.326  52.170 18.620  1.00 33.45  ? 397 TYR B CA  1 
ATOM   6344 C C   . TYR B 1 397 ? 21.244  50.895 17.809  1.00 35.94  ? 397 TYR B C   1 
ATOM   6345 O O   . TYR B 1 397 ? 20.692  50.876 16.704  1.00 35.42  ? 397 TYR B O   1 
ATOM   6346 C CB  . TYR B 1 397 ? 20.068  52.202 19.509  1.00 32.84  ? 397 TYR B CB  1 
ATOM   6347 C CG  . TYR B 1 397 ? 20.018  53.307 20.532  1.00 33.85  ? 397 TYR B CG  1 
ATOM   6348 C CD1 . TYR B 1 397 ? 19.372  54.508 20.258  1.00 35.97  ? 397 TYR B CD1 1 
ATOM   6349 C CD2 . TYR B 1 397 ? 20.584  53.143 21.794  1.00 34.11  ? 397 TYR B CD2 1 
ATOM   6350 C CE1 . TYR B 1 397 ? 19.321  55.535 21.200  1.00 36.85  ? 397 TYR B CE1 1 
ATOM   6351 C CE2 . TYR B 1 397 ? 20.513  54.152 22.755  1.00 34.91  ? 397 TYR B CE2 1 
ATOM   6352 C CZ  . TYR B 1 397 ? 19.897  55.355 22.446  1.00 43.95  ? 397 TYR B CZ  1 
ATOM   6353 O OH  . TYR B 1 397 ? 19.849  56.376 23.366  1.00 48.52  ? 397 TYR B OH  1 
ATOM   6354 N N   . LEU B 1 398 ? 21.703  49.802 18.413  1.00 31.71  ? 398 LEU B N   1 
ATOM   6355 C CA  . LEU B 1 398 ? 21.553  48.466 17.859  1.00 31.03  ? 398 LEU B CA  1 
ATOM   6356 C C   . LEU B 1 398 ? 21.252  47.455 18.974  1.00 33.37  ? 398 LEU B C   1 
ATOM   6357 O O   . LEU B 1 398 ? 21.667  47.664 20.124  1.00 32.66  ? 398 LEU B O   1 
ATOM   6358 C CB  . LEU B 1 398 ? 22.689  48.053 16.899  1.00 31.82  ? 398 LEU B CB  1 
ATOM   6359 C CG  . LEU B 1 398 ? 24.094  47.962 17.432  1.00 37.09  ? 398 LEU B CG  1 
ATOM   6360 C CD1 . LEU B 1 398 ? 24.387  46.538 17.948  1.00 37.79  ? 398 LEU B CD1 1 
ATOM   6361 C CD2 . LEU B 1 398 ? 25.081  48.280 16.341  1.00 39.94  ? 398 LEU B CD2 1 
ATOM   6362 N N   . ARG B 1 399 ? 20.475  46.404 18.648  1.00 29.09  ? 399 ARG B N   1 
ATOM   6363 C CA  . ARG B 1 399 ? 20.111  45.367 19.615  1.00 28.36  ? 399 ARG B CA  1 
ATOM   6364 C C   . ARG B 1 399 ? 20.894  44.063 19.358  1.00 33.87  ? 399 ARG B C   1 
ATOM   6365 O O   . ARG B 1 399 ? 20.795  43.466 18.276  1.00 33.28  ? 399 ARG B O   1 
ATOM   6366 C CB  . ARG B 1 399 ? 18.591  45.128 19.630  1.00 24.81  ? 399 ARG B CB  1 
ATOM   6367 C CG  . ARG B 1 399 ? 18.132  44.196 20.750  1.00 28.46  ? 399 ARG B CG  1 
ATOM   6368 C CD  . ARG B 1 399 ? 16.767  43.601 20.493  1.00 32.32  ? 399 ARG B CD  1 
ATOM   6369 N NE  . ARG B 1 399 ? 16.796  42.493 19.535  1.00 35.09  ? 399 ARG B NE  1 
ATOM   6370 C CZ  . ARG B 1 399 ? 15.710  41.889 19.059  1.00 40.73  ? 399 ARG B CZ  1 
ATOM   6371 N NH1 . ARG B 1 399 ? 14.497  42.265 19.463  1.00 17.03  ? 399 ARG B NH1 1 
ATOM   6372 N NH2 . ARG B 1 399 ? 15.825  40.896 18.188  1.00 20.12  ? 399 ARG B NH2 1 
ATOM   6373 N N   . ALA B 1 400 ? 21.656  43.634 20.371  1.00 31.17  ? 400 ALA B N   1 
ATOM   6374 C CA  . ALA B 1 400 ? 22.451  42.409 20.346  1.00 31.73  ? 400 ALA B CA  1 
ATOM   6375 C C   . ALA B 1 400 ? 21.808  41.357 21.253  1.00 35.58  ? 400 ALA B C   1 
ATOM   6376 O O   . ALA B 1 400 ? 21.475  41.656 22.406  1.00 33.72  ? 400 ALA B O   1 
ATOM   6377 C CB  . ALA B 1 400 ? 23.872  42.700 20.815  1.00 33.36  ? 400 ALA B CB  1 
ATOM   6378 N N   . SER B 1 401 ? 21.628  40.129 20.734  1.00 34.06  ? 401 SER B N   1 
ATOM   6379 C CA  . SER B 1 401 ? 21.029  39.039 21.505  1.00 34.30  ? 401 SER B CA  1 
ATOM   6380 C C   . SER B 1 401 ? 22.092  38.084 22.005  1.00 39.19  ? 401 SER B C   1 
ATOM   6381 O O   . SER B 1 401 ? 22.948  37.637 21.238  1.00 38.96  ? 401 SER B O   1 
ATOM   6382 C CB  . SER B 1 401 ? 19.966  38.296 20.694  1.00 38.48  ? 401 SER B CB  1 
ATOM   6383 O OG  . SER B 1 401 ? 19.384  37.238 21.441  1.00 47.59  ? 401 SER B OG  1 
ATOM   6384 N N   . PHE B 1 402 ? 22.023  37.769 23.301  1.00 36.80  ? 402 PHE B N   1 
ATOM   6385 C CA  . PHE B 1 402 ? 22.948  36.839 23.950  1.00 37.01  ? 402 PHE B CA  1 
ATOM   6386 C C   . PHE B 1 402 ? 22.303  35.483 24.277  1.00 40.64  ? 402 PHE B C   1 
ATOM   6387 O O   . PHE B 1 402 ? 22.839  34.757 25.109  1.00 40.52  ? 402 PHE B O   1 
ATOM   6388 C CB  . PHE B 1 402 ? 23.572  37.487 25.207  1.00 38.88  ? 402 PHE B CB  1 
ATOM   6389 C CG  . PHE B 1 402 ? 22.614  38.006 26.266  1.00 39.31  ? 402 PHE B CG  1 
ATOM   6390 C CD1 . PHE B 1 402 ? 22.102  37.156 27.244  1.00 41.18  ? 402 PHE B CD1 1 
ATOM   6391 C CD2 . PHE B 1 402 ? 22.299  39.357 26.337  1.00 40.82  ? 402 PHE B CD2 1 
ATOM   6392 C CE1 . PHE B 1 402 ? 21.260  37.637 28.245  1.00 41.16  ? 402 PHE B CE1 1 
ATOM   6393 C CE2 . PHE B 1 402 ? 21.477  39.844 27.357  1.00 43.15  ? 402 PHE B CE2 1 
ATOM   6394 C CZ  . PHE B 1 402 ? 20.961  38.978 28.303  1.00 40.69  ? 402 PHE B CZ  1 
ATOM   6395 N N   . SER B 1 403 ? 21.168  35.135 23.637  1.00 37.50  ? 403 SER B N   1 
ATOM   6396 C CA  . SER B 1 403 ? 20.474  33.882 23.928  1.00 38.06  ? 403 SER B CA  1 
ATOM   6397 C C   . SER B 1 403 ? 21.135  32.622 23.373  1.00 45.12  ? 403 SER B C   1 
ATOM   6398 O O   . SER B 1 403 ? 20.917  31.537 23.917  1.00 44.99  ? 403 SER B O   1 
ATOM   6399 C CB  . SER B 1 403 ? 19.018  33.955 23.495  1.00 41.45  ? 403 SER B CB  1 
ATOM   6400 O OG  . SER B 1 403 ? 18.894  34.118 22.094  1.00 52.13  ? 403 SER B OG  1 
ATOM   6401 N N   . SER B 1 404 ? 21.955  32.747 22.318  1.00 43.94  ? 404 SER B N   1 
ATOM   6402 C CA  . SER B 1 404 ? 22.539  31.560 21.684  1.00 44.57  ? 404 SER B CA  1 
ATOM   6403 C C   . SER B 1 404 ? 24.031  31.586 21.366  1.00 48.28  ? 404 SER B C   1 
ATOM   6404 O O   . SER B 1 404 ? 24.674  30.530 21.422  1.00 47.10  ? 404 SER B O   1 
ATOM   6405 C CB  . SER B 1 404 ? 21.745  31.196 20.434  1.00 48.98  ? 404 SER B CB  1 
ATOM   6406 O OG  . SER B 1 404 ? 21.493  32.344 19.638  1.00 61.77  ? 404 SER B OG  1 
ATOM   6407 N N   . ALA B 1 405 ? 24.573  32.761 20.986  1.00 45.62  ? 405 ALA B N   1 
ATOM   6408 C CA  . ALA B 1 405 ? 25.987  32.903 20.620  1.00 46.25  ? 405 ALA B CA  1 
ATOM   6409 C C   . ALA B 1 405 ? 26.942  32.425 21.731  1.00 49.70  ? 405 ALA B C   1 
ATOM   6410 O O   . ALA B 1 405 ? 26.654  32.607 22.917  1.00 49.59  ? 405 ALA B O   1 
ATOM   6411 C CB  . ALA B 1 405 ? 26.283  34.342 20.234  1.00 46.76  ? 405 ALA B CB  1 
ATOM   6412 N N   . SER B 1 406 ? 28.040  31.768 21.343  1.00 45.60  ? 406 SER B N   1 
ATOM   6413 C CA  . SER B 1 406 ? 29.031  31.268 22.287  1.00 46.37  ? 406 SER B CA  1 
ATOM   6414 C C   . SER B 1 406 ? 29.896  32.431 22.781  1.00 55.56  ? 406 SER B C   1 
ATOM   6415 O O   . SER B 1 406 ? 30.004  33.426 22.058  1.00 55.52  ? 406 SER B O   1 
ATOM   6416 C CB  . SER B 1 406 ? 29.897  30.192 21.634  1.00 48.12  ? 406 SER B CB  1 
ATOM   6417 O OG  . SER B 1 406 ? 30.848  30.707 20.717  1.00 49.80  ? 406 SER B OG  1 
ATOM   6418 N N   . PRO B 1 407 ? 30.543  32.341 23.975  1.00 55.25  ? 407 PRO B N   1 
ATOM   6419 C CA  . PRO B 1 407 ? 31.395  33.450 24.443  1.00 56.25  ? 407 PRO B CA  1 
ATOM   6420 C C   . PRO B 1 407 ? 32.458  33.924 23.440  1.00 61.74  ? 407 PRO B C   1 
ATOM   6421 O O   . PRO B 1 407 ? 32.776  35.118 23.394  1.00 62.97  ? 407 PRO B O   1 
ATOM   6422 C CB  . PRO B 1 407 ? 32.018  32.881 25.720  1.00 58.81  ? 407 PRO B CB  1 
ATOM   6423 C CG  . PRO B 1 407 ? 30.988  31.942 26.223  1.00 62.57  ? 407 PRO B CG  1 
ATOM   6424 C CD  . PRO B 1 407 ? 30.516  31.258 24.976  1.00 57.70  ? 407 PRO B CD  1 
ATOM   6425 N N   . GLU B 1 408 ? 32.966  33.001 22.613  1.00 57.64  ? 408 GLU B N   1 
ATOM   6426 C CA  . GLU B 1 408 ? 33.947  33.289 21.567  1.00 57.92  ? 408 GLU B CA  1 
ATOM   6427 C C   . GLU B 1 408 ? 33.278  33.773 20.277  1.00 59.73  ? 408 GLU B C   1 
ATOM   6428 O O   . GLU B 1 408 ? 33.902  34.521 19.527  1.00 59.63  ? 408 GLU B O   1 
ATOM   6429 C CB  . GLU B 1 408 ? 34.948  32.132 21.344  1.00 60.76  ? 408 GLU B CB  1 
ATOM   6430 C CG  . GLU B 1 408 ? 34.379  30.718 21.460  1.00 76.04  ? 408 GLU B CG  1 
ATOM   6431 C CD  . GLU B 1 408 ? 34.088  30.185 22.858  1.00 103.26 ? 408 GLU B CD  1 
ATOM   6432 O OE1 . GLU B 1 408 ? 34.777  30.600 23.820  1.00 117.53 ? 408 GLU B OE1 1 
ATOM   6433 O OE2 . GLU B 1 408 ? 33.175  29.337 22.988  1.00 84.74  ? 408 GLU B OE2 1 
ATOM   6434 N N   . GLN B 1 409 ? 31.990  33.410 20.049  1.00 54.16  ? 409 GLN B N   1 
ATOM   6435 C CA  . GLN B 1 409 ? 31.206  33.906 18.902  1.00 52.26  ? 409 GLN B CA  1 
ATOM   6436 C C   . GLN B 1 409 ? 30.955  35.402 19.125  1.00 52.93  ? 409 GLN B C   1 
ATOM   6437 O O   . GLN B 1 409 ? 31.001  36.181 18.175  1.00 51.99  ? 409 GLN B O   1 
ATOM   6438 C CB  . GLN B 1 409 ? 29.863  33.175 18.779  1.00 52.57  ? 409 GLN B CB  1 
ATOM   6439 C CG  . GLN B 1 409 ? 29.855  32.037 17.767  1.00 63.22  ? 409 GLN B CG  1 
ATOM   6440 C CD  . GLN B 1 409 ? 28.512  31.341 17.700  1.00 78.65  ? 409 GLN B CD  1 
ATOM   6441 O OE1 . GLN B 1 409 ? 27.477  31.924 17.340  1.00 75.77  ? 409 GLN B OE1 1 
ATOM   6442 N NE2 . GLN B 1 409 ? 28.506  30.062 18.018  1.00 66.25  ? 409 GLN B NE2 1 
ATOM   6443 N N   . MET B 1 410 ? 30.735  35.787 20.404  1.00 48.01  ? 410 MET B N   1 
ATOM   6444 C CA  . MET B 1 410 ? 30.515  37.149 20.888  1.00 47.24  ? 410 MET B CA  1 
ATOM   6445 C C   . MET B 1 410 ? 31.759  38.002 20.694  1.00 51.44  ? 410 MET B C   1 
ATOM   6446 O O   . MET B 1 410 ? 31.660  39.124 20.177  1.00 51.18  ? 410 MET B O   1 
ATOM   6447 C CB  . MET B 1 410 ? 30.109  37.127 22.368  1.00 49.28  ? 410 MET B CB  1 
ATOM   6448 C CG  . MET B 1 410 ? 28.680  36.740 22.565  1.00 52.76  ? 410 MET B CG  1 
ATOM   6449 S SD  . MET B 1 410 ? 28.345  36.206 24.239  1.00 57.86  ? 410 MET B SD  1 
ATOM   6450 C CE  . MET B 1 410 ? 26.620  35.813 24.060  1.00 53.51  ? 410 MET B CE  1 
ATOM   6451 N N   . ASP B 1 411 ? 32.931  37.456 21.080  1.00 47.58  ? 411 ASP B N   1 
ATOM   6452 C CA  . ASP B 1 411 ? 34.219  38.123 20.953  1.00 47.64  ? 411 ASP B CA  1 
ATOM   6453 C C   . ASP B 1 411 ? 34.504  38.443 19.490  1.00 50.53  ? 411 ASP B C   1 
ATOM   6454 O O   . ASP B 1 411 ? 34.749  39.604 19.167  1.00 51.76  ? 411 ASP B O   1 
ATOM   6455 C CB  . ASP B 1 411 ? 35.327  37.244 21.530  1.00 50.72  ? 411 ASP B CB  1 
ATOM   6456 C CG  . ASP B 1 411 ? 36.534  38.036 21.976  1.00 63.17  ? 411 ASP B CG  1 
ATOM   6457 O OD1 . ASP B 1 411 ? 37.376  38.374 21.109  1.00 63.32  ? 411 ASP B OD1 1 
ATOM   6458 O OD2 . ASP B 1 411 ? 36.643  38.313 23.197  1.00 71.11  ? 411 ASP B OD2 1 
ATOM   6459 N N   . VAL B 1 412 ? 34.403  37.429 18.607  1.00 44.77  ? 412 VAL B N   1 
ATOM   6460 C CA  . VAL B 1 412 ? 34.607  37.547 17.159  1.00 44.67  ? 412 VAL B CA  1 
ATOM   6461 C C   . VAL B 1 412 ? 33.694  38.623 16.552  1.00 49.39  ? 412 VAL B C   1 
ATOM   6462 O O   . VAL B 1 412 ? 34.181  39.473 15.808  1.00 49.65  ? 412 VAL B O   1 
ATOM   6463 C CB  . VAL B 1 412 ? 34.456  36.172 16.435  1.00 47.74  ? 412 VAL B CB  1 
ATOM   6464 C CG1 . VAL B 1 412 ? 34.365  36.330 14.916  1.00 47.23  ? 412 VAL B CG1 1 
ATOM   6465 C CG2 . VAL B 1 412 ? 35.599  35.229 16.803  1.00 48.52  ? 412 VAL B CG2 1 
ATOM   6466 N N   . ALA B 1 413 ? 32.390  38.586 16.887  1.00 45.63  ? 413 ALA B N   1 
ATOM   6467 C CA  . ALA B 1 413 ? 31.373  39.507 16.384  1.00 45.32  ? 413 ALA B CA  1 
ATOM   6468 C C   . ALA B 1 413 ? 31.554  40.960 16.822  1.00 51.32  ? 413 ALA B C   1 
ATOM   6469 O O   . ALA B 1 413 ? 31.448  41.860 15.979  1.00 50.78  ? 413 ALA B O   1 
ATOM   6470 C CB  . ALA B 1 413 ? 29.990  39.012 16.751  1.00 44.75  ? 413 ALA B CB  1 
ATOM   6471 N N   . PHE B 1 414 ? 31.828  41.195 18.125  1.00 48.88  ? 414 PHE B N   1 
ATOM   6472 C CA  . PHE B 1 414 ? 32.031  42.547 18.658  1.00 48.59  ? 414 PHE B CA  1 
ATOM   6473 C C   . PHE B 1 414 ? 33.337  43.174 18.161  1.00 52.76  ? 414 PHE B C   1 
ATOM   6474 O O   . PHE B 1 414 ? 33.478  44.401 18.165  1.00 52.94  ? 414 PHE B O   1 
ATOM   6475 C CB  . PHE B 1 414 ? 31.927  42.576 20.193  1.00 49.93  ? 414 PHE B CB  1 
ATOM   6476 C CG  . PHE B 1 414 ? 30.536  42.720 20.756  1.00 50.46  ? 414 PHE B CG  1 
ATOM   6477 C CD1 . PHE B 1 414 ? 29.478  43.121 19.951  1.00 53.82  ? 414 PHE B CD1 1 
ATOM   6478 C CD2 . PHE B 1 414 ? 30.291  42.502 22.100  1.00 52.99  ? 414 PHE B CD2 1 
ATOM   6479 C CE1 . PHE B 1 414 ? 28.184  43.258 20.477  1.00 53.70  ? 414 PHE B CE1 1 
ATOM   6480 C CE2 . PHE B 1 414 ? 28.997  42.643 22.625  1.00 55.18  ? 414 PHE B CE2 1 
ATOM   6481 C CZ  . PHE B 1 414 ? 27.954  43.024 21.810  1.00 52.23  ? 414 PHE B CZ  1 
ATOM   6482 N N   . GLN B 1 415 ? 34.271  42.335 17.710  1.00 48.76  ? 415 GLN B N   1 
ATOM   6483 C CA  . GLN B 1 415 ? 35.531  42.770 17.125  1.00 49.74  ? 415 GLN B CA  1 
ATOM   6484 C C   . GLN B 1 415 ? 35.249  43.326 15.704  1.00 52.04  ? 415 GLN B C   1 
ATOM   6485 O O   . GLN B 1 415 ? 35.856  44.320 15.300  1.00 53.14  ? 415 GLN B O   1 
ATOM   6486 C CB  . GLN B 1 415 ? 36.506  41.589 17.103  1.00 52.46  ? 415 GLN B CB  1 
ATOM   6487 C CG  . GLN B 1 415 ? 37.790  41.812 16.332  1.00 84.96  ? 415 GLN B CG  1 
ATOM   6488 C CD  . GLN B 1 415 ? 38.653  40.582 16.423  1.00 121.24 ? 415 GLN B CD  1 
ATOM   6489 O OE1 . GLN B 1 415 ? 39.615  40.534 17.194  1.00 119.25 ? 415 GLN B OE1 1 
ATOM   6490 N NE2 . GLN B 1 415 ? 38.297  39.536 15.680  1.00 118.45 ? 415 GLN B NE2 1 
ATOM   6491 N N   . VAL B 1 416 ? 34.299  42.698 14.975  1.00 45.73  ? 416 VAL B N   1 
ATOM   6492 C CA  . VAL B 1 416 ? 33.848  43.114 13.637  1.00 44.84  ? 416 VAL B CA  1 
ATOM   6493 C C   . VAL B 1 416 ? 33.084  44.439 13.774  1.00 46.37  ? 416 VAL B C   1 
ATOM   6494 O O   . VAL B 1 416 ? 33.303  45.356 12.975  1.00 46.35  ? 416 VAL B O   1 
ATOM   6495 C CB  . VAL B 1 416 ? 33.016  42.014 12.911  1.00 48.30  ? 416 VAL B CB  1 
ATOM   6496 C CG1 . VAL B 1 416 ? 32.436  42.513 11.586  1.00 48.28  ? 416 VAL B CG1 1 
ATOM   6497 C CG2 . VAL B 1 416 ? 33.846  40.756 12.687  1.00 48.61  ? 416 VAL B CG2 1 
ATOM   6498 N N   . LEU B 1 417 ? 32.230  44.548 14.820  1.00 40.73  ? 417 LEU B N   1 
ATOM   6499 C CA  . LEU B 1 417 ? 31.458  45.759 15.128  1.00 39.01  ? 417 LEU B CA  1 
ATOM   6500 C C   . LEU B 1 417 ? 32.397  46.948 15.303  1.00 42.31  ? 417 LEU B C   1 
ATOM   6501 O O   . LEU B 1 417 ? 32.213  47.968 14.632  1.00 42.77  ? 417 LEU B O   1 
ATOM   6502 C CB  . LEU B 1 417 ? 30.613  45.588 16.404  1.00 37.61  ? 417 LEU B CB  1 
ATOM   6503 C CG  . LEU B 1 417 ? 29.157  46.113 16.405  1.00 41.07  ? 417 LEU B CG  1 
ATOM   6504 C CD1 . LEU B 1 417 ? 28.727  46.532 17.812  1.00 40.18  ? 417 LEU B CD1 1 
ATOM   6505 C CD2 . LEU B 1 417 ? 28.933  47.295 15.454  1.00 42.30  ? 417 LEU B CD2 1 
ATOM   6506 N N   . ALA B 1 418 ? 33.422  46.791 16.160  1.00 36.63  ? 418 ALA B N   1 
ATOM   6507 C CA  . ALA B 1 418 ? 34.388  47.841 16.421  1.00 36.16  ? 418 ALA B CA  1 
ATOM   6508 C C   . ALA B 1 418 ? 35.045  48.357 15.151  1.00 40.56  ? 418 ALA B C   1 
ATOM   6509 O O   . ALA B 1 418 ? 35.117  49.570 14.994  1.00 41.25  ? 418 ALA B O   1 
ATOM   6510 C CB  . ALA B 1 418 ? 35.432  47.369 17.416  1.00 37.21  ? 418 ALA B CB  1 
ATOM   6511 N N   . GLN B 1 419 ? 35.465  47.463 14.222  1.00 36.83  ? 419 GLN B N   1 
ATOM   6512 C CA  . GLN B 1 419 ? 36.119  47.889 12.981  1.00 37.41  ? 419 GLN B CA  1 
ATOM   6513 C C   . GLN B 1 419 ? 35.185  48.720 12.103  1.00 42.32  ? 419 GLN B C   1 
ATOM   6514 O O   . GLN B 1 419 ? 35.601  49.749 11.564  1.00 42.39  ? 419 GLN B O   1 
ATOM   6515 C CB  . GLN B 1 419 ? 36.702  46.707 12.202  1.00 38.85  ? 419 GLN B CB  1 
ATOM   6516 C CG  . GLN B 1 419 ? 37.818  47.145 11.264  1.00 43.36  ? 419 GLN B CG  1 
ATOM   6517 C CD  . GLN B 1 419 ? 38.080  46.135 10.191  1.00 67.58  ? 419 GLN B CD  1 
ATOM   6518 O OE1 . GLN B 1 419 ? 38.967  45.289 10.314  1.00 67.66  ? 419 GLN B OE1 1 
ATOM   6519 N NE2 . GLN B 1 419 ? 37.320  46.206 9.106   1.00 57.15  ? 419 GLN B NE2 1 
ATOM   6520 N N   . LEU B 1 420 ? 33.914  48.291 11.996  1.00 38.51  ? 420 LEU B N   1 
ATOM   6521 C CA  . LEU B 1 420 ? 32.887  48.987 11.219  1.00 37.54  ? 420 LEU B CA  1 
ATOM   6522 C C   . LEU B 1 420 ? 32.604  50.376 11.786  1.00 39.32  ? 420 LEU B C   1 
ATOM   6523 O O   . LEU B 1 420 ? 32.493  51.334 11.007  1.00 40.28  ? 420 LEU B O   1 
ATOM   6524 C CB  . LEU B 1 420 ? 31.612  48.147 11.118  1.00 36.50  ? 420 LEU B CB  1 
ATOM   6525 C CG  . LEU B 1 420 ? 31.756  46.842 10.320  1.00 42.31  ? 420 LEU B CG  1 
ATOM   6526 C CD1 . LEU B 1 420 ? 30.515  45.992 10.442  1.00 41.87  ? 420 LEU B CD1 1 
ATOM   6527 C CD2 . LEU B 1 420 ? 32.074  47.113 8.858   1.00 46.27  ? 420 LEU B CD2 1 
ATOM   6528 N N   . ILE B 1 421 ? 32.551  50.494 13.145  1.00 31.01  ? 421 ILE B N   1 
ATOM   6529 C CA  . ILE B 1 421 ? 32.359  51.752 13.870  1.00 27.76  ? 421 ILE B CA  1 
ATOM   6530 C C   . ILE B 1 421 ? 33.538  52.668 13.552  1.00 32.87  ? 421 ILE B C   1 
ATOM   6531 O O   . ILE B 1 421 ? 33.327  53.796 13.114  1.00 34.76  ? 421 ILE B O   1 
ATOM   6532 C CB  . ILE B 1 421 ? 32.126  51.529 15.398  1.00 28.16  ? 421 ILE B CB  1 
ATOM   6533 C CG1 . ILE B 1 421 ? 30.732  50.873 15.636  1.00 26.22  ? 421 ILE B CG1 1 
ATOM   6534 C CG2 . ILE B 1 421 ? 32.270  52.846 16.196  1.00 27.04  ? 421 ILE B CG2 1 
ATOM   6535 C CD1 . ILE B 1 421 ? 30.405  50.413 17.047  1.00 25.28  ? 421 ILE B CD1 1 
ATOM   6536 N N   . LYS B 1 422 ? 34.764  52.148 13.671  1.00 28.13  ? 422 LYS B N   1 
ATOM   6537 C CA  . LYS B 1 422 ? 35.996  52.868 13.385  1.00 29.16  ? 422 LYS B CA  1 
ATOM   6538 C C   . LYS B 1 422 ? 36.078  53.398 11.958  1.00 37.89  ? 422 LYS B C   1 
ATOM   6539 O O   . LYS B 1 422 ? 36.699  54.440 11.744  1.00 39.92  ? 422 LYS B O   1 
ATOM   6540 C CB  . LYS B 1 422 ? 37.202  51.978 13.680  1.00 31.49  ? 422 LYS B CB  1 
ATOM   6541 C CG  . LYS B 1 422 ? 37.627  51.964 15.148  1.00 28.96  ? 422 LYS B CG  1 
ATOM   6542 C CD  . LYS B 1 422 ? 38.379  50.690 15.500  1.00 35.01  ? 422 LYS B CD  1 
ATOM   6543 C CE  . LYS B 1 422 ? 39.816  50.674 15.043  1.00 40.98  ? 422 LYS B CE  1 
ATOM   6544 N NZ  . LYS B 1 422 ? 40.385  49.299 15.086  1.00 49.07  ? 422 LYS B NZ  1 
ATOM   6545 N N   . GLU B 1 423 ? 35.471  52.679 10.981  1.00 36.29  ? 423 GLU B N   1 
ATOM   6546 C CA  . GLU B 1 423 ? 35.438  53.051 9.556   1.00 37.44  ? 423 GLU B CA  1 
ATOM   6547 C C   . GLU B 1 423 ? 34.564  54.289 9.329   1.00 41.89  ? 423 GLU B C   1 
ATOM   6548 O O   . GLU B 1 423 ? 34.988  55.208 8.618   1.00 43.69  ? 423 GLU B O   1 
ATOM   6549 C CB  . GLU B 1 423 ? 34.913  51.891 8.705   1.00 38.62  ? 423 GLU B CB  1 
ATOM   6550 C CG  . GLU B 1 423 ? 35.947  50.836 8.365   1.00 53.30  ? 423 GLU B CG  1 
ATOM   6551 C CD  . GLU B 1 423 ? 35.394  49.465 8.013   1.00 73.65  ? 423 GLU B CD  1 
ATOM   6552 O OE1 . GLU B 1 423 ? 34.629  49.364 7.025   1.00 62.40  ? 423 GLU B OE1 1 
ATOM   6553 O OE2 . GLU B 1 423 ? 35.754  48.486 8.707   1.00 66.15  ? 423 GLU B OE2 1 
ATOM   6554 N N   . SER B 1 424 ? 33.351  54.301 9.927   1.00 36.15  ? 424 SER B N   1 
ATOM   6555 C CA  . SER B 1 424 ? 32.380  55.389 9.842   1.00 36.66  ? 424 SER B CA  1 
ATOM   6556 C C   . SER B 1 424 ? 32.871  56.664 10.515  1.00 44.94  ? 424 SER B C   1 
ATOM   6557 O O   . SER B 1 424 ? 32.555  57.765 10.045  1.00 48.20  ? 424 SER B O   1 
ATOM   6558 C CB  . SER B 1 424 ? 31.060  54.978 10.469  1.00 39.80  ? 424 SER B CB  1 
ATOM   6559 O OG  . SER B 1 424 ? 30.336  54.067 9.656   1.00 54.44  ? 424 SER B OG  1 
ATOM   6560 N N   . LEU B 1 425 ? 33.646  56.529 11.610  1.00 39.09  ? 425 LEU B N   1 
ATOM   6561 C CA  . LEU B 1 425 ? 34.202  57.666 12.343  1.00 37.43  ? 425 LEU B CA  1 
ATOM   6562 C C   . LEU B 1 425 ? 35.315  58.357 11.568  1.00 46.10  ? 425 LEU B C   1 
ATOM   6563 O O   . LEU B 1 425 ? 35.595  59.529 11.829  1.00 47.31  ? 425 LEU B O   1 
ATOM   6564 C CB  . LEU B 1 425 ? 34.693  57.233 13.727  1.00 35.63  ? 425 LEU B CB  1 
ATOM   6565 C CG  . LEU B 1 425 ? 33.630  56.761 14.713  1.00 36.71  ? 425 LEU B CG  1 
ATOM   6566 C CD1 . LEU B 1 425 ? 34.249  56.098 15.886  1.00 35.83  ? 425 LEU B CD1 1 
ATOM   6567 C CD2 . LEU B 1 425 ? 32.796  57.891 15.209  1.00 37.67  ? 425 LEU B CD2 1 
ATOM   6568 N N   . LEU B 1 426 ? 35.933  57.650 10.607  1.00 46.07  ? 426 LEU B N   1 
ATOM   6569 C CA  . LEU B 1 426 ? 37.002  58.189 9.775   1.00 49.27  ? 426 LEU B CA  1 
ATOM   6570 C C   . LEU B 1 426 ? 36.484  59.164 8.707   1.00 59.96  ? 426 LEU B C   1 
ATOM   6571 O O   . LEU B 1 426 ? 37.224  60.053 8.270   1.00 60.98  ? 426 LEU B O   1 
ATOM   6572 C CB  . LEU B 1 426 ? 37.800  57.056 9.133   1.00 49.61  ? 426 LEU B CB  1 
ATOM   6573 C CG  . LEU B 1 426 ? 38.934  56.476 9.965   1.00 54.53  ? 426 LEU B CG  1 
ATOM   6574 C CD1 . LEU B 1 426 ? 39.468  55.228 9.327   1.00 55.03  ? 426 LEU B CD1 1 
ATOM   6575 C CD2 . LEU B 1 426 ? 40.093  57.468 10.105  1.00 59.48  ? 426 LEU B CD2 1 
ATOM   6576 N N   . VAL B 1 427 ? 35.219  59.005 8.299   1.00 60.11  ? 427 VAL B N   1 
ATOM   6577 C CA  . VAL B 1 427 ? 34.598  59.870 7.300   1.00 62.90  ? 427 VAL B CA  1 
ATOM   6578 C C   . VAL B 1 427 ? 33.793  61.046 7.953   1.00 70.30  ? 427 VAL B C   1 
ATOM   6579 O O   . VAL B 1 427 ? 33.001  60.791 8.873   1.00 68.84  ? 427 VAL B O   1 
ATOM   6580 C CB  . VAL B 1 427 ? 33.820  59.042 6.232   1.00 66.92  ? 427 VAL B CB  1 
ATOM   6581 C CG1 . VAL B 1 427 ? 32.489  58.503 6.757   1.00 64.79  ? 427 VAL B CG1 1 
ATOM   6582 C CG2 . VAL B 1 427 ? 33.628  59.828 4.939   1.00 68.30  ? 427 VAL B CG2 1 
ATOM   6583 N N   . PRO B 1 428 ? 34.003  62.329 7.529   1.00 69.84  ? 428 PRO B N   1 
ATOM   6584 C CA  . PRO B 1 428 ? 33.262  63.448 8.158   1.00 73.26  ? 428 PRO B CA  1 
ATOM   6585 C C   . PRO B 1 428 ? 31.751  63.421 7.910   1.00 104.13 ? 428 PRO B C   1 
ATOM   6586 O O   . PRO B 1 428 ? 30.945  63.756 8.781   1.00 61.16  ? 428 PRO B O   1 
ATOM   6587 C CB  . PRO B 1 428 ? 33.920  64.698 7.551   1.00 75.98  ? 428 PRO B CB  1 
ATOM   6588 C CG  . PRO B 1 428 ? 35.231  64.221 6.962   1.00 80.03  ? 428 PRO B CG  1 
ATOM   6589 C CD  . PRO B 1 428 ? 34.935  62.832 6.497   1.00 74.09  ? 428 PRO B CD  1 
HETATM 6590 C C1  . 0X1 C 2 .   ? -16.160 22.310 16.767  1.00 33.19  ? 501 0X1 A C1  1 
HETATM 6591 C C2  . 0X1 C 2 .   ? -16.588 22.006 18.045  1.00 34.28  ? 501 0X1 A C2  1 
HETATM 6592 C C3  . 0X1 C 2 .   ? -18.715 21.306 17.184  1.00 35.28  ? 501 0X1 A C3  1 
HETATM 6593 C C4  . 0X1 C 2 .   ? -14.945 25.674 8.959   1.00 35.40  ? 501 0X1 A C4  1 
HETATM 6594 C C5  . 0X1 C 2 .   ? -15.791 23.951 10.356  1.00 35.25  ? 501 0X1 A C5  1 
HETATM 6595 C C6  . 0X1 C 2 .   ? -17.019 22.120 15.704  1.00 36.14  ? 501 0X1 A C6  1 
HETATM 6596 C C7  . 0X1 C 2 .   ? -14.822 24.911 10.105  1.00 35.69  ? 501 0X1 A C7  1 
HETATM 6597 C C8  . 0X1 C 2 .   ? -18.297 21.631 15.906  1.00 39.16  ? 501 0X1 A C8  1 
HETATM 6598 C C9  . 0X1 C 2 .   ? -17.856 21.495 18.247  1.00 34.71  ? 501 0X1 A C9  1 
HETATM 6599 C C10 . 0X1 C 2 .   ? -16.798 23.812 9.419   1.00 34.75  ? 501 0X1 A C10 1 
HETATM 6600 C C11 . 0X1 C 2 .   ? -16.839 24.625 8.308   1.00 34.24  ? 501 0X1 A C11 1 
HETATM 6601 C C12 . 0X1 C 2 .   ? -18.730 21.801 13.504  1.00 42.32  ? 501 0X1 A C12 1 
HETATM 6602 C C13 . 0X1 C 2 .   ? -15.724 23.092 11.593  1.00 35.76  ? 501 0X1 A C13 1 
HETATM 6603 C C14 . 0X1 C 2 .   ? -16.584 22.472 14.366  1.00 38.17  ? 501 0X1 A C14 1 
HETATM 6604 C C15 . 0X1 C 2 .   ? -17.372 22.344 13.289  1.00 39.30  ? 501 0X1 A C15 1 
HETATM 6605 C C16 . 0X1 C 2 .   ? -17.953 24.491 7.324   1.00 37.02  ? 501 0X1 A C16 1 
HETATM 6606 C C17 . 0X1 C 2 .   ? -13.645 25.117 11.009  1.00 33.88  ? 501 0X1 A C17 1 
HETATM 6607 N N18 . 0X1 C 2 .   ? -15.934 25.577 8.064   1.00 33.36  ? 501 0X1 A N18 1 
HETATM 6608 N N19 . 0X1 C 2 .   ? -17.058 22.670 11.997  1.00 36.63  ? 501 0X1 A N19 1 
HETATM 6609 N N20 . 0X1 C 2 .   ? -19.124 21.472 14.764  1.00 43.29  ? 501 0X1 A N20 1 
HETATM 6610 O O21 . 0X1 C 2 .   ? -10.585 23.605 9.927   1.00 37.53  ? 501 0X1 A O21 1 
HETATM 6611 O O22 . 0X1 C 2 .   ? -11.182 22.800 12.227  1.00 39.12  ? 501 0X1 A O22 1 
HETATM 6612 O O23 . 0X1 C 2 .   ? -10.935 25.291 11.737  1.00 38.23  ? 501 0X1 A O23 1 
HETATM 6613 O O24 . 0X1 C 2 .   ? -17.796 22.876 9.607   1.00 38.21  ? 501 0X1 A O24 1 
HETATM 6614 C C25 . 0X1 C 2 .   ? -20.425 21.035 14.681  1.00 46.48  ? 501 0X1 A C25 1 
HETATM 6615 O O26 . 0X1 C 2 .   ? -12.852 23.945 10.857  1.00 35.95  ? 501 0X1 A O26 1 
HETATM 6616 P P27 . 0X1 C 2 .   ? -11.262 23.917 11.216  1.00 37.32  ? 501 0X1 A P27 1 
HETATM 6617 O O28 . 0X1 C 2 .   ? -15.751 22.172 19.147  1.00 34.90  ? 501 0X1 A O28 1 
HETATM 6618 C C29 . 0X1 C 2 .   ? -15.521 23.491 19.507  1.00 35.51  ? 501 0X1 A C29 1 
HETATM 6619 C C30 . 0X1 C 2 .   ? -14.451 23.767 20.337  1.00 35.95  ? 501 0X1 A C30 1 
HETATM 6620 C C31 . 0X1 C 2 .   ? -14.175 25.069 20.708  1.00 39.21  ? 501 0X1 A C31 1 
HETATM 6621 C C32 . 0X1 C 2 .   ? -14.974 26.093 20.248  1.00 40.78  ? 501 0X1 A C32 1 
HETATM 6622 C C33 . 0X1 C 2 .   ? -16.057 25.813 19.437  1.00 39.47  ? 501 0X1 A C33 1 
HETATM 6623 C C34 . 0X1 C 2 .   ? -16.339 24.512 19.068  1.00 37.70  ? 501 0X1 A C34 1 
HETATM 6624 N N35 . 0X1 C 2 .   ? -20.704 21.113 13.332  1.00 45.85  ? 501 0X1 A N35 1 
HETATM 6625 O O36 . 0X1 C 2 .   ? -21.196 20.661 15.559  1.00 48.95  ? 501 0X1 A O36 1 
HETATM 6626 N N37 . 0X1 C 2 .   ? -19.651 21.599 12.621  1.00 44.36  ? 501 0X1 A N37 1 
HETATM 6627 C C1  . 0X1 D 2 .   ? 9.830   35.321 16.947  1.00 41.30  ? 501 0X1 B C1  1 
HETATM 6628 C C2  . 0X1 D 2 .   ? 10.564  35.026 15.815  1.00 42.27  ? 501 0X1 B C2  1 
HETATM 6629 C C3  . 0X1 D 2 .   ? 12.209  36.621 16.384  1.00 43.42  ? 501 0X1 B C3  1 
HETATM 6630 C C4  . 0X1 D 2 .   ? 5.280   39.081 23.360  1.00 35.23  ? 501 0X1 B C4  1 
HETATM 6631 C C5  . 0X1 D 2 .   ? 7.268   38.470 22.240  1.00 38.70  ? 501 0X1 B C5  1 
HETATM 6632 C C6  . 0X1 D 2 .   ? 10.293  36.304 17.793  1.00 41.20  ? 501 0X1 B C6  1 
HETATM 6633 C C7  . 0X1 D 2 .   ? 5.929   38.246 22.473  1.00 36.08  ? 501 0X1 B C7  1 
HETATM 6634 C C8  . 0X1 D 2 .   ? 11.473  36.951 17.499  1.00 43.87  ? 501 0X1 B C8  1 
HETATM 6635 C C9  . 0X1 D 2 .   ? 11.752  35.651 15.526  1.00 41.26  ? 501 0X1 B C9  1 
HETATM 6636 C C10 . 0X1 D 2 .   ? 7.863   39.538 22.898  1.00 38.63  ? 501 0X1 B C10 1 
HETATM 6637 C C11 . 0X1 D 2 .   ? 7.125   40.328 23.759  1.00 34.25  ? 501 0X1 B C11 1 
HETATM 6638 C C12 . 0X1 D 2 .   ? 11.226  38.303 19.503  1.00 44.41  ? 501 0X1 B C12 1 
HETATM 6639 C C13 . 0X1 D 2 .   ? 7.985   37.581 21.286  1.00 38.67  ? 501 0X1 B C13 1 
HETATM 6640 C C14 . 0X1 D 2 .   ? 9.534   36.667 18.981  1.00 40.46  ? 501 0X1 B C14 1 
HETATM 6641 C C15 . 0X1 D 2 .   ? 9.949   37.617 19.833  1.00 41.18  ? 501 0X1 B C15 1 
HETATM 6642 C C16 . 0X1 D 2 .   ? 7.767   41.486 24.448  1.00 30.42  ? 501 0X1 B C16 1 
HETATM 6643 C C17 . 0X1 D 2 .   ? 5.195   37.151 21.788  1.00 34.42  ? 501 0X1 B C17 1 
HETATM 6644 N N18 . 0X1 D 2 .   ? 5.831   40.111 24.014  1.00 33.73  ? 501 0X1 B N18 1 
HETATM 6645 N N19 . 0X1 D 2 .   ? 9.314   38.044 20.975  1.00 39.43  ? 501 0X1 B N19 1 
HETATM 6646 N N20 . 0X1 D 2 .   ? 11.908  37.941 18.381  1.00 46.45  ? 501 0X1 B N20 1 
HETATM 6647 O O21 . 0X1 D 2 .   ? 4.352   34.269 23.626  1.00 34.78  ? 501 0X1 B O21 1 
HETATM 6648 O O22 . 0X1 D 2 .   ? 5.687   33.612 21.567  1.00 37.40  ? 501 0X1 B O22 1 
HETATM 6649 O O23 . 0X1 D 2 .   ? 3.578   34.908 21.286  1.00 39.29  ? 501 0X1 B O23 1 
HETATM 6650 O O24 . 0X1 D 2 .   ? 9.201   39.837 22.727  1.00 38.52  ? 501 0X1 B O24 1 
HETATM 6651 C C25 . 0X1 D 2 .   ? 13.035  38.701 18.294  1.00 46.73  ? 501 0X1 B C25 1 
HETATM 6652 O O26 . 0X1 D 2 .   ? 5.592   35.957 22.421  1.00 35.68  ? 501 0X1 B O26 1 
HETATM 6653 P P27 . 0X1 D 2 .   ? 4.728   34.583 22.204  1.00 35.94  ? 501 0X1 B P27 1 
HETATM 6654 O O28 . 0X1 D 2 .   ? 10.133  34.059 14.934  1.00 45.31  ? 501 0X1 B O28 1 
HETATM 6655 C C29 . 0X1 D 2 .   ? 9.064   34.452 14.138  1.00 48.33  ? 501 0X1 B C29 1 
HETATM 6656 C C30 . 0X1 D 2 .   ? 8.426   33.461 13.437  1.00 48.65  ? 501 0X1 B C30 1 
HETATM 6657 C C31 . 0X1 D 2 .   ? 7.358   33.804 12.641  1.00 48.67  ? 501 0X1 B C31 1 
HETATM 6658 C C32 . 0X1 D 2 .   ? 6.932   35.115 12.541  1.00 48.88  ? 501 0X1 B C32 1 
HETATM 6659 C C33 . 0X1 D 2 .   ? 7.571   36.112 13.239  1.00 49.56  ? 501 0X1 B C33 1 
HETATM 6660 C C34 . 0X1 D 2 .   ? 8.641   35.767 14.033  1.00 49.97  ? 501 0X1 B C34 1 
HETATM 6661 N N35 . 0X1 D 2 .   ? 12.937  39.513 19.412  1.00 44.62  ? 501 0X1 B N35 1 
HETATM 6662 O O36 . 0X1 D 2 .   ? 13.915  38.674 17.440  1.00 45.84  ? 501 0X1 B O36 1 
HETATM 6663 N N37 . 0X1 D 2 .   ? 11.824  39.253 20.149  1.00 43.57  ? 501 0X1 B N37 1 
HETATM 6664 O O   . HOH E 3 .   ? -7.162  21.162 11.984  1.00 33.91  ? 601 HOH A O   1 
HETATM 6665 O O   . HOH E 3 .   ? -26.242 17.399 14.847  1.00 21.64  ? 602 HOH A O   1 
HETATM 6666 O O   . HOH E 3 .   ? 7.379   15.695 2.749   1.00 35.52  ? 603 HOH A O   1 
HETATM 6667 O O   . HOH E 3 .   ? 5.189   42.342 12.195  1.00 25.79  ? 604 HOH A O   1 
HETATM 6668 O O   . HOH E 3 .   ? 1.524   42.623 9.536   1.00 32.24  ? 605 HOH A O   1 
HETATM 6669 O O   . HOH E 3 .   ? -4.430  41.761 6.428   1.00 26.23  ? 606 HOH A O   1 
HETATM 6670 O O   . HOH E 3 .   ? -31.067 17.218 24.424  1.00 42.97  ? 607 HOH A O   1 
HETATM 6671 O O   . HOH E 3 .   ? -7.442  2.183  1.056   1.00 35.04  ? 608 HOH A O   1 
HETATM 6672 O O   . HOH E 3 .   ? 2.829   50.404 3.973   1.00 35.93  ? 609 HOH A O   1 
HETATM 6673 O O   . HOH E 3 .   ? -35.387 26.324 -3.361  1.00 28.80  ? 610 HOH A O   1 
HETATM 6674 O O   . HOH E 3 .   ? -20.071 16.299 -3.036  1.00 28.38  ? 611 HOH A O   1 
HETATM 6675 O O   . HOH E 3 .   ? -29.795 1.527  4.474   1.00 21.50  ? 612 HOH A O   1 
HETATM 6676 O O   . HOH E 3 .   ? -33.746 9.935  25.664  1.00 25.30  ? 613 HOH A O   1 
HETATM 6677 O O   . HOH E 3 .   ? -49.808 8.197  27.444  1.00 45.55  ? 614 HOH A O   1 
HETATM 6678 O O   . HOH E 3 .   ? -6.269  44.466 12.887  1.00 26.00  ? 615 HOH A O   1 
HETATM 6679 O O   . HOH E 3 .   ? -33.508 15.563 24.629  1.00 38.39  ? 616 HOH A O   1 
HETATM 6680 O O   . HOH E 3 .   ? 11.067  22.065 1.376   1.00 27.43  ? 617 HOH A O   1 
HETATM 6681 O O   . HOH E 3 .   ? -15.921 9.739  -4.394  1.00 28.65  ? 618 HOH A O   1 
HETATM 6682 O O   . HOH E 3 .   ? -19.151 19.743 -5.645  1.00 48.01  ? 619 HOH A O   1 
HETATM 6683 O O   . HOH E 3 .   ? -7.654  36.426 -17.298 1.00 43.69  ? 620 HOH A O   1 
HETATM 6684 O O   . HOH E 3 .   ? -45.265 16.652 0.053   1.00 49.13  ? 621 HOH A O   1 
HETATM 6685 O O   . HOH E 3 .   ? 12.216  2.661  15.639  1.00 42.37  ? 622 HOH A O   1 
HETATM 6686 O O   . HOH E 3 .   ? 11.983  25.662 14.437  1.00 33.92  ? 623 HOH A O   1 
HETATM 6687 O O   . HOH E 3 .   ? 10.527  10.339 11.776  1.00 42.56  ? 624 HOH A O   1 
HETATM 6688 O O   . HOH E 3 .   ? 11.267  32.676 11.649  1.00 38.39  ? 625 HOH A O   1 
HETATM 6689 O O   . HOH E 3 .   ? -30.658 13.611 24.491  1.00 61.49  ? 626 HOH A O   1 
HETATM 6690 O O   . HOH E 3 .   ? -7.387  43.244 8.558   1.00 35.50  ? 627 HOH A O   1 
HETATM 6691 O O   . HOH E 3 .   ? -32.589 26.981 -14.609 1.00 39.90  ? 628 HOH A O   1 
HETATM 6692 O O   . HOH E 3 .   ? -7.210  49.321 -0.099  1.00 57.87  ? 629 HOH A O   1 
HETATM 6693 O O   . HOH E 3 .   ? -30.479 29.963 -16.430 1.00 56.53  ? 630 HOH A O   1 
HETATM 6694 O O   . HOH E 3 .   ? 5.584   27.401 10.523  1.00 30.30  ? 631 HOH A O   1 
HETATM 6695 O O   . HOH E 3 .   ? -33.271 17.255 3.637   1.00 28.30  ? 632 HOH A O   1 
HETATM 6696 O O   . HOH E 3 .   ? -36.987 42.428 -14.964 1.00 49.83  ? 633 HOH A O   1 
HETATM 6697 O O   . HOH E 3 .   ? -21.891 17.649 6.280   1.00 39.34  ? 634 HOH A O   1 
HETATM 6698 O O   . HOH E 3 .   ? -15.159 6.406  -5.236  1.00 51.94  ? 635 HOH A O   1 
HETATM 6699 O O   . HOH E 3 .   ? 5.901   33.688 5.647   1.00 36.40  ? 636 HOH A O   1 
HETATM 6700 O O   . HOH E 3 .   ? -12.426 1.652  6.409   1.00 18.51  ? 637 HOH A O   1 
HETATM 6701 O O   . HOH E 3 .   ? -5.093  37.870 -16.197 1.00 55.28  ? 638 HOH A O   1 
HETATM 6702 O O   . HOH E 3 .   ? -35.778 11.192 26.831  1.00 41.29  ? 639 HOH A O   1 
HETATM 6703 O O   . HOH E 3 .   ? -0.723  35.083 -17.770 1.00 50.48  ? 640 HOH A O   1 
HETATM 6704 O O   . HOH E 3 .   ? -4.434  37.083 -21.787 1.00 36.27  ? 641 HOH A O   1 
HETATM 6705 O O   . HOH E 3 .   ? -45.257 12.495 -4.556  1.00 45.44  ? 642 HOH A O   1 
HETATM 6706 O O   . HOH E 3 .   ? -47.787 9.390  31.180  1.00 32.72  ? 643 HOH A O   1 
HETATM 6707 O O   . HOH E 3 .   ? 16.634  14.503 15.020  1.00 39.20  ? 644 HOH A O   1 
HETATM 6708 O O   . HOH E 3 .   ? -21.921 5.122  24.205  1.00 44.20  ? 645 HOH A O   1 
HETATM 6709 O O   . HOH E 3 .   ? -43.388 21.875 7.997   1.00 51.58  ? 646 HOH A O   1 
HETATM 6710 O O   . HOH E 3 .   ? -32.382 24.394 21.409  1.00 50.92  ? 647 HOH A O   1 
HETATM 6711 O O   . HOH E 3 .   ? -33.818 31.022 25.366  1.00 53.63  ? 648 HOH A O   1 
HETATM 6712 O O   . HOH E 3 .   ? -10.430 19.866 2.690   1.00 31.00  ? 649 HOH A O   1 
HETATM 6713 O O   . HOH E 3 .   ? 0.493   26.290 -16.872 1.00 44.86  ? 650 HOH A O   1 
HETATM 6714 O O   . HOH E 3 .   ? -42.929 28.915 -5.900  1.00 24.81  ? 651 HOH A O   1 
HETATM 6715 O O   . HOH E 3 .   ? -19.040 48.265 -4.522  1.00 71.04  ? 652 HOH A O   1 
HETATM 6716 O O   . HOH E 3 .   ? -37.477 41.520 -7.380  1.00 45.27  ? 653 HOH A O   1 
HETATM 6717 O O   . HOH E 3 .   ? -4.281  52.014 4.236   1.00 52.83  ? 654 HOH A O   1 
HETATM 6718 O O   . HOH E 3 .   ? -32.465 1.857  3.911   1.00 43.81  ? 655 HOH A O   1 
HETATM 6719 O O   . HOH E 3 .   ? 13.010  31.058 12.892  1.00 41.15  ? 656 HOH A O   1 
HETATM 6720 O O   . HOH E 3 .   ? -40.484 28.729 -17.837 1.00 41.08  ? 657 HOH A O   1 
HETATM 6721 O O   . HOH E 3 .   ? -6.922  37.931 -19.973 1.00 59.61  ? 658 HOH A O   1 
HETATM 6722 O O   . HOH E 3 .   ? -9.488  40.073 -14.237 1.00 47.65  ? 659 HOH A O   1 
HETATM 6723 O O   . HOH E 3 .   ? -34.038 34.079 -0.243  1.00 44.45  ? 660 HOH A O   1 
HETATM 6724 O O   . HOH E 3 .   ? -12.300 18.489 -7.914  1.00 32.50  ? 661 HOH A O   1 
HETATM 6725 O O   . HOH E 3 .   ? 0.940   52.093 5.726   1.00 44.88  ? 662 HOH A O   1 
HETATM 6726 O O   . HOH E 3 .   ? 7.971   27.663 -10.068 1.00 46.67  ? 663 HOH A O   1 
HETATM 6727 O O   . HOH E 3 .   ? 14.484  18.631 10.843  1.00 24.83  ? 664 HOH A O   1 
HETATM 6728 O O   . HOH E 3 .   ? -31.046 25.641 18.243  1.00 59.27  ? 665 HOH A O   1 
HETATM 6729 O O   . HOH E 3 .   ? -44.983 14.918 11.210  1.00 41.66  ? 666 HOH A O   1 
HETATM 6730 O O   . HOH E 3 .   ? -18.837 -3.508 5.946   1.00 40.49  ? 667 HOH A O   1 
HETATM 6731 O O   . HOH E 3 .   ? -12.801 11.626 11.125  1.00 31.52  ? 668 HOH A O   1 
HETATM 6732 O O   . HOH E 3 .   ? 6.718   4.125  21.595  1.00 41.94  ? 669 HOH A O   1 
HETATM 6733 O O   . HOH E 3 .   ? -46.432 20.493 5.973   1.00 63.90  ? 670 HOH A O   1 
HETATM 6734 O O   . HOH E 3 .   ? 4.476   5.927  21.208  1.00 49.37  ? 671 HOH A O   1 
HETATM 6735 O O   . HOH E 3 .   ? -17.308 0.562  0.547   1.00 40.09  ? 672 HOH A O   1 
HETATM 6736 O O   . HOH E 3 .   ? 23.570  32.146 4.508   1.00 42.28  ? 673 HOH A O   1 
HETATM 6737 O O   . HOH E 3 .   ? -9.757  49.605 7.242   1.00 37.99  ? 674 HOH A O   1 
HETATM 6738 O O   . HOH E 3 .   ? 20.905  40.056 1.870   1.00 37.41  ? 675 HOH A O   1 
HETATM 6739 O O   . HOH E 3 .   ? 21.519  36.729 1.377   1.00 58.74  ? 676 HOH A O   1 
HETATM 6740 O O   . HOH E 3 .   ? -4.113  4.934  -2.733  1.00 39.21  ? 677 HOH A O   1 
HETATM 6741 O O   . HOH E 3 .   ? -31.074 29.534 -19.070 1.00 47.13  ? 678 HOH A O   1 
HETATM 6742 O O   . HOH E 3 .   ? 21.788  31.984 7.241   1.00 43.70  ? 679 HOH A O   1 
HETATM 6743 O O   . HOH E 3 .   ? -35.420 25.861 -7.550  1.00 36.04  ? 680 HOH A O   1 
HETATM 6744 O O   . HOH E 3 .   ? -11.140 37.230 -17.116 1.00 46.95  ? 681 HOH A O   1 
HETATM 6745 O O   . HOH E 3 .   ? 21.060  32.662 10.637  1.00 40.57  ? 682 HOH A O   1 
HETATM 6746 O O   . HOH E 3 .   ? 20.155  34.584 6.169   1.00 58.57  ? 683 HOH A O   1 
HETATM 6747 O O   . HOH E 3 .   ? -1.718  36.978 -20.777 1.00 41.57  ? 684 HOH A O   1 
HETATM 6748 O O   . HOH E 3 .   ? -3.463  19.895 -18.699 1.00 34.60  ? 685 HOH A O   1 
HETATM 6749 O O   . HOH E 3 .   ? -26.895 7.937  20.348  1.00 60.86  ? 686 HOH A O   1 
HETATM 6750 O O   . HOH E 3 .   ? -10.712 20.440 -8.755  1.00 40.89  ? 687 HOH A O   1 
HETATM 6751 O O   . HOH E 3 .   ? -21.797 17.475 -10.877 1.00 48.50  ? 688 HOH A O   1 
HETATM 6752 O O   . HOH E 3 .   ? 20.989  36.984 5.316   1.00 68.64  ? 689 HOH A O   1 
HETATM 6753 O O   . HOH E 3 .   ? -6.777  41.030 -20.096 1.00 60.31  ? 690 HOH A O   1 
HETATM 6754 O O   . HOH E 3 .   ? -9.553  45.429 8.572   1.00 45.92  ? 691 HOH A O   1 
HETATM 6755 O O   . HOH E 3 .   ? -28.963 46.200 -1.767  1.00 41.55  ? 692 HOH A O   1 
HETATM 6756 O O   . HOH E 3 .   ? -32.949 14.132 27.548  1.00 46.75  ? 693 HOH A O   1 
HETATM 6757 O O   . HOH E 3 .   ? -33.218 29.108 0.404   1.00 62.72  ? 694 HOH A O   1 
HETATM 6758 O O   . HOH F 3 .   ? -5.680  34.371 15.641  1.00 3.00   ? 601 HOH B O   1 
HETATM 6759 O O   . HOH F 3 .   ? 9.814   60.065 38.157  1.00 23.39  ? 602 HOH B O   1 
HETATM 6760 O O   . HOH F 3 .   ? -8.556  23.655 24.965  1.00 27.85  ? 603 HOH B O   1 
HETATM 6761 O O   . HOH F 3 .   ? -6.217  30.190 20.252  1.00 18.52  ? 604 HOH B O   1 
HETATM 6762 O O   . HOH F 3 .   ? 22.808  34.924 20.663  1.00 28.74  ? 605 HOH B O   1 
HETATM 6763 O O   . HOH F 3 .   ? -8.273  57.623 23.070  1.00 18.19  ? 606 HOH B O   1 
HETATM 6764 O O   . HOH F 3 .   ? -4.719  6.685  27.911  1.00 32.21  ? 607 HOH B O   1 
HETATM 6765 O O   . HOH F 3 .   ? 8.772   40.981 30.708  1.00 26.00  ? 608 HOH B O   1 
HETATM 6766 O O   . HOH F 3 .   ? -11.000 19.706 27.564  1.00 14.10  ? 609 HOH B O   1 
HETATM 6767 O O   . HOH F 3 .   ? -15.372 26.624 24.290  1.00 19.24  ? 610 HOH B O   1 
HETATM 6768 O O   . HOH F 3 .   ? 5.774   34.911 31.532  1.00 16.26  ? 611 HOH B O   1 
HETATM 6769 O O   . HOH F 3 .   ? 13.480  42.438 36.095  1.00 23.27  ? 612 HOH B O   1 
HETATM 6770 O O   . HOH F 3 .   ? -3.613  44.890 13.823  1.00 17.46  ? 613 HOH B O   1 
HETATM 6771 O O   . HOH F 3 .   ? 14.061  54.947 13.755  1.00 29.09  ? 614 HOH B O   1 
HETATM 6772 O O   . HOH F 3 .   ? 4.809   29.178 23.199  1.00 36.44  ? 615 HOH B O   1 
HETATM 6773 O O   . HOH F 3 .   ? -13.534 46.905 45.982  1.00 34.45  ? 616 HOH B O   1 
HETATM 6774 O O   . HOH F 3 .   ? -13.865 27.959 26.357  1.00 16.10  ? 617 HOH B O   1 
HETATM 6775 O O   . HOH F 3 .   ? -2.912  16.928 32.862  1.00 18.88  ? 618 HOH B O   1 
HETATM 6776 O O   . HOH F 3 .   ? -5.591  7.939  18.621  1.00 28.58  ? 619 HOH B O   1 
HETATM 6777 O O   . HOH F 3 .   ? 25.860  65.226 13.698  1.00 50.67  ? 620 HOH B O   1 
HETATM 6778 O O   . HOH F 3 .   ? -20.932 36.598 17.201  1.00 21.81  ? 621 HOH B O   1 
HETATM 6779 O O   . HOH F 3 .   ? 2.140   47.087 10.287  1.00 39.20  ? 622 HOH B O   1 
HETATM 6780 O O   . HOH F 3 .   ? 9.840   60.899 42.205  1.00 46.30  ? 623 HOH B O   1 
HETATM 6781 O O   . HOH F 3 .   ? 39.336  48.438 17.967  1.00 32.45  ? 624 HOH B O   1 
HETATM 6782 O O   . HOH F 3 .   ? 28.852  50.498 31.930  1.00 47.40  ? 625 HOH B O   1 
HETATM 6783 O O   . HOH F 3 .   ? 29.108  51.695 29.212  1.00 35.53  ? 626 HOH B O   1 
HETATM 6784 O O   . HOH F 3 .   ? -17.736 35.937 18.185  1.00 33.04  ? 627 HOH B O   1 
HETATM 6785 O O   . HOH F 3 .   ? -1.679  26.182 19.497  1.00 41.29  ? 628 HOH B O   1 
HETATM 6786 O O   . HOH F 3 .   ? 25.157  57.532 9.714   1.00 35.85  ? 629 HOH B O   1 
HETATM 6787 O O   . HOH F 3 .   ? 0.998   57.194 16.307  1.00 27.24  ? 630 HOH B O   1 
HETATM 6788 O O   . HOH F 3 .   ? -12.966 44.765 17.688  1.00 37.88  ? 631 HOH B O   1 
HETATM 6789 O O   . HOH F 3 .   ? -11.147 17.470 25.614  1.00 22.75  ? 632 HOH B O   1 
HETATM 6790 O O   . HOH F 3 .   ? 3.908   39.839 42.048  1.00 22.74  ? 633 HOH B O   1 
HETATM 6791 O O   . HOH F 3 .   ? -8.727  25.908 40.089  1.00 51.57  ? 634 HOH B O   1 
HETATM 6792 O O   . HOH F 3 .   ? -20.708 35.679 41.474  1.00 25.55  ? 635 HOH B O   1 
HETATM 6793 O O   . HOH F 3 .   ? 21.283  49.696 27.402  1.00 39.56  ? 636 HOH B O   1 
HETATM 6794 O O   . HOH F 3 .   ? -13.687 41.147 13.929  1.00 27.09  ? 637 HOH B O   1 
HETATM 6795 O O   . HOH F 3 .   ? 14.911  41.146 26.951  1.00 34.74  ? 638 HOH B O   1 
HETATM 6796 O O   . HOH F 3 .   ? -4.629  65.843 23.329  1.00 46.94  ? 639 HOH B O   1 
HETATM 6797 O O   . HOH F 3 .   ? -16.514 50.495 16.867  1.00 36.91  ? 640 HOH B O   1 
HETATM 6798 O O   . HOH F 3 .   ? 3.759   56.068 8.073   1.00 49.68  ? 641 HOH B O   1 
HETATM 6799 O O   . HOH F 3 .   ? -10.065 1.700  17.502  1.00 57.37  ? 642 HOH B O   1 
HETATM 6800 O O   . HOH F 3 .   ? -6.001  51.075 47.207  1.00 34.11  ? 643 HOH B O   1 
HETATM 6801 O O   . HOH F 3 .   ? 4.328   59.677 47.813  1.00 42.62  ? 644 HOH B O   1 
HETATM 6802 O O   . HOH F 3 .   ? -16.102 34.536 43.995  1.00 43.77  ? 645 HOH B O   1 
HETATM 6803 O O   . HOH F 3 .   ? -11.374 57.084 18.018  1.00 40.54  ? 646 HOH B O   1 
HETATM 6804 O O   . HOH F 3 .   ? -3.151  61.415 48.244  1.00 41.61  ? 647 HOH B O   1 
HETATM 6805 O O   . HOH F 3 .   ? -10.132 30.926 34.978  1.00 35.12  ? 648 HOH B O   1 
HETATM 6806 O O   . HOH F 3 .   ? -14.227 27.234 40.859  1.00 41.14  ? 649 HOH B O   1 
HETATM 6807 O O   . HOH F 3 .   ? -6.144  68.143 24.612  1.00 57.35  ? 650 HOH B O   1 
HETATM 6808 O O   . HOH F 3 .   ? 5.702   60.246 20.350  1.00 36.18  ? 651 HOH B O   1 
HETATM 6809 O O   . HOH F 3 .   ? 34.158  62.473 11.155  1.00 36.99  ? 652 HOH B O   1 
HETATM 6810 O O   . HOH F 3 .   ? -1.850  53.426 14.430  1.00 30.97  ? 653 HOH B O   1 
HETATM 6811 O O   . HOH F 3 .   ? -13.204 50.244 15.664  1.00 32.58  ? 654 HOH B O   1 
HETATM 6812 O O   . HOH F 3 .   ? -15.398 45.103 45.562  1.00 41.68  ? 655 HOH B O   1 
HETATM 6813 O O   . HOH F 3 .   ? 6.460   39.412 41.260  1.00 21.03  ? 656 HOH B O   1 
HETATM 6814 O O   . HOH F 3 .   ? 9.103   63.883 41.810  1.00 35.95  ? 657 HOH B O   1 
HETATM 6815 O O   . HOH F 3 .   ? 15.118  29.231 27.167  1.00 32.22  ? 658 HOH B O   1 
HETATM 6816 O O   . HOH F 3 .   ? -1.269  60.733 40.475  1.00 26.14  ? 659 HOH B O   1 
HETATM 6817 O O   . HOH F 3 .   ? 21.063  46.606 27.584  1.00 29.84  ? 660 HOH B O   1 
HETATM 6818 O O   . HOH F 3 .   ? 23.645  31.990 38.437  1.00 29.52  ? 661 HOH B O   1 
HETATM 6819 O O   . HOH F 3 .   ? 20.781  46.551 35.837  1.00 34.39  ? 662 HOH B O   1 
HETATM 6820 O O   . HOH F 3 .   ? -4.241  57.557 42.926  1.00 51.90  ? 663 HOH B O   1 
HETATM 6821 O O   . HOH F 3 .   ? -2.969  49.487 45.044  1.00 34.52  ? 664 HOH B O   1 
HETATM 6822 O O   . HOH F 3 .   ? 22.882  60.536 18.013  1.00 34.90  ? 665 HOH B O   1 
HETATM 6823 O O   . HOH F 3 .   ? -9.330  70.175 16.202  1.00 44.84  ? 666 HOH B O   1 
HETATM 6824 O O   . HOH F 3 .   ? 13.652  27.723 43.514  1.00 39.79  ? 667 HOH B O   1 
HETATM 6825 O O   . HOH F 3 .   ? 3.717   70.469 31.679  1.00 49.42  ? 668 HOH B O   1 
HETATM 6826 O O   . HOH F 3 .   ? -10.469 47.968 16.347  1.00 28.93  ? 669 HOH B O   1 
HETATM 6827 O O   . HOH F 3 .   ? -11.373 41.475 19.764  1.00 31.40  ? 670 HOH B O   1 
HETATM 6828 O O   . HOH F 3 .   ? -13.516 55.872 15.158  1.00 41.22  ? 671 HOH B O   1 
HETATM 6829 O O   . HOH F 3 .   ? -1.271  41.395 46.109  1.00 31.87  ? 672 HOH B O   1 
HETATM 6830 O O   . HOH F 3 .   ? -12.898 48.222 43.816  1.00 55.44  ? 673 HOH B O   1 
HETATM 6831 O O   . HOH F 3 .   ? -7.217  63.496 21.260  1.00 38.56  ? 674 HOH B O   1 
HETATM 6832 O O   . HOH F 3 .   ? 14.915  64.812 33.484  1.00 40.91  ? 675 HOH B O   1 
HETATM 6833 O O   . HOH F 3 .   ? 22.929  39.426 39.057  1.00 38.89  ? 676 HOH B O   1 
HETATM 6834 O O   . HOH F 3 .   ? -6.405  61.399 15.292  1.00 37.33  ? 677 HOH B O   1 
HETATM 6835 O O   . HOH F 3 .   ? 30.291  63.891 11.883  1.00 38.69  ? 678 HOH B O   1 
HETATM 6836 O O   . HOH F 3 .   ? -1.921  50.450 48.351  1.00 44.30  ? 679 HOH B O   1 
HETATM 6837 O O   . HOH F 3 .   ? -14.537 52.864 13.346  1.00 36.46  ? 680 HOH B O   1 
HETATM 6838 O O   . HOH F 3 .   ? 28.771  40.715 42.271  1.00 42.48  ? 681 HOH B O   1 
HETATM 6839 O O   . HOH F 3 .   ? -13.044 50.225 47.266  1.00 43.92  ? 682 HOH B O   1 
HETATM 6840 O O   . HOH F 3 .   ? 27.650  41.815 39.650  1.00 53.16  ? 683 HOH B O   1 
HETATM 6841 O O   . HOH F 3 .   ? -2.625  8.086  28.707  1.00 38.76  ? 684 HOH B O   1 
HETATM 6842 O O   . HOH F 3 .   ? -6.228  7.935  29.824  1.00 29.84  ? 685 HOH B O   1 
HETATM 6843 O O   . HOH F 3 .   ? -9.184  42.111 47.629  1.00 42.63  ? 686 HOH B O   1 
HETATM 6844 O O   . HOH F 3 .   ? 6.408   61.972 13.086  1.00 41.34  ? 687 HOH B O   1 
HETATM 6845 O O   . HOH F 3 .   ? 5.833   43.105 36.699  1.00 28.47  ? 688 HOH B O   1 
HETATM 6846 O O   . HOH F 3 .   ? -16.492 32.258 42.538  1.00 57.47  ? 689 HOH B O   1 
HETATM 6847 O O   . HOH F 3 .   ? 32.386  61.603 12.878  1.00 47.47  ? 690 HOH B O   1 
HETATM 6848 O O   . HOH F 3 .   ? -13.428 45.311 48.139  1.00 57.99  ? 691 HOH B O   1 
HETATM 6849 O O   . HOH F 3 .   ? 28.147  62.070 12.217  1.00 47.48  ? 692 HOH B O   1 
HETATM 6850 O O   . HOH F 3 .   ? -17.652 47.140 46.803  1.00 58.94  ? 693 HOH B O   1 
HETATM 6851 O O   . HOH F 3 .   ? 36.120  42.060 29.495  1.00 55.90  ? 694 HOH B O   1 
HETATM 6852 O O   . HOH F 3 .   ? 3.076   50.191 50.243  1.00 41.18  ? 695 HOH B O   1 
HETATM 6853 O O   . HOH F 3 .   ? 8.479   63.978 44.447  1.00 54.46  ? 696 HOH B O   1 
HETATM 6854 O O   . HOH F 3 .   ? -13.352 33.129 37.544  1.00 41.55  ? 697 HOH B O   1 
HETATM 6855 O O   . HOH F 3 .   ? 35.890  31.929 18.385  1.00 54.77  ? 698 HOH B O   1 
HETATM 6856 O O   . HOH F 3 .   ? -10.470 16.825 23.062  1.00 28.57  ? 699 HOH B O   1 
HETATM 6857 O O   . HOH F 3 .   ? -19.136 31.302 17.780  1.00 30.95  ? 700 HOH B O   1 
HETATM 6858 O O   . HOH F 3 .   ? 10.631  47.663 31.899  1.00 30.28  ? 701 HOH B O   1 
HETATM 6859 O O   . HOH F 3 .   ? 20.180  42.726 8.992   1.00 53.65  ? 702 HOH B O   1 
HETATM 6860 O O   . HOH F 3 .   ? 3.467   51.985 14.912  1.00 44.89  ? 703 HOH B O   1 
HETATM 6861 O O   . HOH F 3 .   ? 11.957  10.474 30.001  1.00 53.50  ? 704 HOH B O   1 
HETATM 6862 O O   . HOH F 3 .   ? -12.928 14.973 22.981  1.00 44.85  ? 705 HOH B O   1 
HETATM 6863 O O   . HOH F 3 .   ? 30.815  52.164 1.534   1.00 49.35  ? 706 HOH B O   1 
HETATM 6864 O O   . HOH F 3 .   ? 30.087  33.633 33.238  1.00 37.43  ? 707 HOH B O   1 
HETATM 6865 O O   . HOH F 3 .   ? 38.924  35.877 22.213  1.00 52.73  ? 708 HOH B O   1 
HETATM 6866 O O   . HOH F 3 .   ? 7.232   53.067 47.232  1.00 52.87  ? 709 HOH B O   1 
HETATM 6867 O O   . HOH F 3 .   ? -10.810 39.041 46.074  1.00 31.94  ? 710 HOH B O   1 
HETATM 6868 O O   . HOH F 3 .   ? 22.160  42.641 1.344   1.00 51.21  ? 711 HOH B O   1 
HETATM 6869 O O   . HOH F 3 .   ? 20.350  20.112 29.625  1.00 53.12  ? 712 HOH B O   1 
HETATM 6870 O O   . HOH F 3 .   ? 3.041   63.479 54.477  1.00 30.37  ? 713 HOH B O   1 
HETATM 6871 O O   . HOH F 3 .   ? 7.738   69.099 44.805  1.00 45.82  ? 714 HOH B O   1 
HETATM 6872 O O   . HOH F 3 .   ? 10.911  44.487 44.689  1.00 46.76  ? 715 HOH B O   1 
HETATM 6873 O O   . HOH F 3 .   ? 31.683  55.698 18.253  1.00 36.06  ? 716 HOH B O   1 
HETATM 6874 O O   . HOH F 3 .   ? 6.384   52.195 50.074  1.00 42.82  ? 717 HOH B O   1 
HETATM 6875 O O   . HOH F 3 .   ? -2.631  57.191 12.084  1.00 68.87  ? 718 HOH B O   1 
HETATM 6876 O O   . HOH F 3 .   ? 11.224  42.017 46.290  1.00 56.59  ? 719 HOH B O   1 
HETATM 6877 O O   . HOH F 3 .   ? 20.862  49.792 34.605  1.00 42.70  ? 720 HOH B O   1 
HETATM 6878 O O   . HOH F 3 .   ? -12.494 30.786 31.432  1.00 46.87  ? 721 HOH B O   1 
HETATM 6879 O O   . HOH F 3 .   ? 18.429  48.204 33.292  1.00 25.37  ? 722 HOH B O   1 
HETATM 6880 O O   . HOH F 3 .   ? -13.962 40.745 21.172  1.00 34.12  ? 723 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 1.0287 1.1219 0.7868 -0.1830 -0.0607 0.2295  1   MET A N   
2    C CA  . MET A 1   ? 0.9893 1.0800 0.7894 -0.1626 -0.0671 0.2265  1   MET A CA  
3    C C   . MET A 1   ? 1.0088 1.0814 0.8358 -0.1525 -0.0621 0.2335  1   MET A C   
4    O O   . MET A 1   ? 1.0021 1.0677 0.8297 -0.1557 -0.0449 0.2227  1   MET A O   
5    C CB  . MET A 1   ? 0.9867 1.0876 0.8013 -0.1566 -0.0568 0.1987  1   MET A CB  
6    C CG  . MET A 1   ? 1.0418 1.1601 0.8436 -0.1606 -0.0656 0.1918  1   MET A CG  
7    S SD  . MET A 1   ? 1.0834 1.2077 0.9139 -0.1449 -0.0875 0.2017  1   MET A SD  
8    C CE  . MET A 1   ? 0.9911 1.1116 0.8617 -0.1278 -0.0763 0.1806  1   MET A CE  
9    N N   . ASN A 2   ? 0.9353 1.0005 0.7863 -0.1405 -0.0768 0.2508  2   ASN A N   
10   C CA  . ASN A 2   ? 0.9073 0.9551 0.7874 -0.1299 -0.0729 0.2568  2   ASN A CA  
11   C C   . ASN A 2   ? 0.8867 0.9368 0.8025 -0.1141 -0.0685 0.2379  2   ASN A C   
12   O O   . ASN A 2   ? 0.8805 0.9329 0.8206 -0.1021 -0.0806 0.2421  2   ASN A O   
13   C CB  . ASN A 2   ? 0.9167 0.9541 0.8054 -0.1259 -0.0901 0.2854  2   ASN A CB  
14   C CG  . ASN A 2   ? 1.1321 1.1510 1.0544 -0.1142 -0.0863 0.2908  2   ASN A CG  
15   O OD1 . ASN A 2   ? 1.0462 1.0554 0.9720 -0.1160 -0.0702 0.2814  2   ASN A OD1 
16   N ND2 . ASN A 2   ? 1.0180 1.0322 0.9675 -0.1022 -0.1011 0.3053  2   ASN A ND2 
17   N N   . TYR A 3   ? 0.7877 0.8384 0.7058 -0.1150 -0.0513 0.2165  3   TYR A N   
18   C CA  . TYR A 3   ? 0.7338 0.7866 0.6812 -0.1022 -0.0457 0.1975  3   TYR A CA  
19   C C   . TYR A 3   ? 0.7695 0.8086 0.7512 -0.0888 -0.0474 0.2029  3   TYR A C   
20   O O   . TYR A 3   ? 0.7363 0.7778 0.7431 -0.0773 -0.0480 0.1919  3   TYR A O   
21   C CB  . TYR A 3   ? 0.7208 0.7775 0.6619 -0.1072 -0.0280 0.1749  3   TYR A CB  
22   C CG  . TYR A 3   ? 0.7313 0.8030 0.6451 -0.1182 -0.0255 0.1647  3   TYR A CG  
23   C CD1 . TYR A 3   ? 0.7601 0.8331 0.6478 -0.1327 -0.0136 0.1604  3   TYR A CD1 
24   C CD2 . TYR A 3   ? 0.7325 0.8170 0.6470 -0.1147 -0.0343 0.1588  3   TYR A CD2 
25   C CE1 . TYR A 3   ? 0.7672 0.8538 0.6306 -0.1435 -0.0100 0.1494  3   TYR A CE1 
26   C CE2 . TYR A 3   ? 0.7514 0.8493 0.6414 -0.1255 -0.0315 0.1485  3   TYR A CE2 
27   C CZ  . TYR A 3   ? 0.8438 0.9424 0.7083 -0.1398 -0.0191 0.1435  3   TYR A CZ  
28   O OH  . TYR A 3   ? 0.8447 0.9563 0.6857 -0.1510 -0.0153 0.1319  3   TYR A OH  
29   N N   . ALA A 4   ? 0.7528 0.7772 0.7351 -0.0911 -0.0482 0.2201  4   ALA A N   
30   C CA  . ALA A 4   ? 0.7427 0.7517 0.7564 -0.0803 -0.0489 0.2269  4   ALA A CA  
31   C C   . ALA A 4   ? 0.7715 0.7824 0.8128 -0.0668 -0.0626 0.2327  4   ALA A C   
32   O O   . ALA A 4   ? 0.7480 0.7504 0.8203 -0.0560 -0.0597 0.2278  4   ALA A O   
33   C CB  . ALA A 4   ? 0.7826 0.7764 0.7873 -0.0873 -0.0492 0.2472  4   ALA A CB  
34   N N   . ARG A 5   ? 0.7265 0.7493 0.7573 -0.0682 -0.0770 0.2418  5   ARG A N   
35   C CA  . ARG A 5   ? 0.7146 0.7417 0.7723 -0.0561 -0.0904 0.2469  5   ARG A CA  
36   C C   . ARG A 5   ? 0.7289 0.7680 0.8012 -0.0487 -0.0865 0.2247  5   ARG A C   
37   O O   . ARG A 5   ? 0.7149 0.7575 0.8137 -0.0381 -0.0947 0.2253  5   ARG A O   
38   C CB  . ARG A 5   ? 0.7459 0.7800 0.7900 -0.0603 -0.1093 0.2686  5   ARG A CB  
39   C CG  . ARG A 5   ? 0.8677 0.9208 0.8812 -0.0702 -0.1139 0.2629  5   ARG A CG  
40   C CD  . ARG A 5   ? 0.9751 1.0358 0.9791 -0.0733 -0.1348 0.2848  5   ARG A CD  
41   N NE  . ARG A 5   ? 0.9851 1.0493 1.0259 -0.0591 -0.1481 0.2904  5   ARG A NE  
42   C CZ  . ARG A 5   ? 1.0619 1.1435 1.1089 -0.0559 -0.1574 0.2839  5   ARG A CZ  
43   N NH1 . ARG A 5   ? 0.8762 0.9605 0.9597 -0.0430 -0.1683 0.2889  5   ARG A NH1 
44   N NH2 . ARG A 5   ? 0.7954 0.8918 0.8136 -0.0660 -0.1551 0.2718  5   ARG A NH2 
45   N N   . PHE A 6   ? 0.6616 0.7066 0.7183 -0.0542 -0.0737 0.2053  6   PHE A N   
46   C CA  . PHE A 6   ? 0.6260 0.6811 0.6926 -0.0488 -0.0689 0.1843  6   PHE A CA  
47   C C   . PHE A 6   ? 0.6226 0.6694 0.7042 -0.0443 -0.0541 0.1676  6   PHE A C   
48   O O   . PHE A 6   ? 0.5894 0.6424 0.6797 -0.0399 -0.0495 0.1508  6   PHE A O   
49   C CB  . PHE A 6   ? 0.6557 0.7260 0.6938 -0.0585 -0.0682 0.1751  6   PHE A CB  
50   C CG  . PHE A 6   ? 0.7079 0.7887 0.7288 -0.0644 -0.0832 0.1895  6   PHE A CG  
51   C CD1 . PHE A 6   ? 0.7809 0.8627 0.7688 -0.0780 -0.0842 0.1995  6   PHE A CD1 
52   C CD2 . PHE A 6   ? 0.7326 0.8227 0.7699 -0.0571 -0.0964 0.1930  6   PHE A CD2 
53   C CE1 . PHE A 6   ? 0.8152 0.9074 0.7846 -0.0847 -0.0990 0.2129  6   PHE A CE1 
54   C CE2 . PHE A 6   ? 0.7931 0.8943 0.8146 -0.0631 -0.1116 0.2064  6   PHE A CE2 
55   C CZ  . PHE A 6   ? 0.7982 0.9003 0.7850 -0.0770 -0.1133 0.2166  6   PHE A CZ  
56   N N   . ILE A 7   ? 0.5705 0.6032 0.6545 -0.0461 -0.0470 0.1727  7   ILE A N   
57   C CA  . ILE A 7   ? 0.5439 0.5682 0.6422 -0.0427 -0.0340 0.1586  7   ILE A CA  
58   C C   . ILE A 7   ? 0.5633 0.5743 0.6917 -0.0333 -0.0361 0.1656  7   ILE A C   
59   O O   . ILE A 7   ? 0.5776 0.5801 0.7084 -0.0337 -0.0427 0.1840  7   ILE A O   
60   C CB  . ILE A 7   ? 0.5996 0.6194 0.6788 -0.0532 -0.0222 0.1554  7   ILE A CB  
61   C CG1 . ILE A 7   ? 0.6637 0.6738 0.7306 -0.0603 -0.0252 0.1759  7   ILE A CG1 
62   C CG2 . ILE A 7   ? 0.5839 0.6172 0.6395 -0.0612 -0.0176 0.1434  7   ILE A CG2 
63   C CD1 . ILE A 7   ? 0.8517 0.8536 0.9050 -0.0708 -0.0118 0.1745  7   ILE A CD1 
64   N N   . THR A 8   ? 0.4772 0.4863 0.6284 -0.0250 -0.0312 0.1516  8   THR A N   
65   C CA  . THR A 8   ? 0.4691 0.4653 0.6500 -0.0168 -0.0311 0.1557  8   THR A CA  
66   C C   . THR A 8   ? 0.5042 0.4849 0.6874 -0.0205 -0.0214 0.1571  8   THR A C   
67   O O   . THR A 8   ? 0.4814 0.4628 0.6450 -0.0290 -0.0139 0.1528  8   THR A O   
68   C CB  . THR A 8   ? 0.5127 0.5116 0.7157 -0.0084 -0.0279 0.1397  8   THR A CB  
69   O OG1 . THR A 8   ? 0.5501 0.5528 0.7431 -0.0117 -0.0181 0.1219  8   THR A OG1 
70   C CG2 . THR A 8   ? 0.4444 0.4553 0.6553 -0.0028 -0.0380 0.1410  8   THR A CG2 
71   N N   . ALA A 9   ? 0.4592 0.4263 0.6686 -0.0143 -0.0208 0.1621  9   ALA A N   
72   C CA  . ALA A 9   ? 0.4620 0.4140 0.6771 -0.0176 -0.0113 0.1622  9   ALA A CA  
73   C C   . ALA A 9   ? 0.5001 0.4543 0.7144 -0.0195 0.0006  0.1405  9   ALA A C   
74   O O   . ALA A 9   ? 0.4990 0.4488 0.7032 -0.0267 0.0087  0.1375  9   ALA A O   
75   C CB  . ALA A 9   ? 0.4762 0.4135 0.7219 -0.0101 -0.0129 0.1699  9   ALA A CB  
76   N N   . ALA A 10  ? 0.4307 0.3926 0.6545 -0.0138 0.0011  0.1260  10  ALA A N   
77   C CA  . ALA A 10  ? 0.4116 0.3767 0.6339 -0.0153 0.0100  0.1066  10  ALA A CA  
78   C C   . ALA A 10  ? 0.4592 0.4353 0.6560 -0.0227 0.0123  0.1012  10  ALA A C   
79   O O   . ALA A 10  ? 0.4262 0.4009 0.6191 -0.0273 0.0203  0.0918  10  ALA A O   
80   C CB  . ALA A 10  ? 0.4046 0.3758 0.6402 -0.0083 0.0086  0.0950  10  ALA A CB  
81   N N   . SER A 11  ? 0.4457 0.4330 0.6264 -0.0240 0.0053  0.1066  11  SER A N   
82   C CA  . SER A 11  ? 0.4469 0.4448 0.6047 -0.0311 0.0080  0.1008  11  SER A CA  
83   C C   . SER A 11  ? 0.5239 0.5166 0.6685 -0.0400 0.0135  0.1075  11  SER A C   
84   O O   . SER A 11  ? 0.5179 0.5141 0.6552 -0.0450 0.0214  0.0970  11  SER A O   
85   C CB  . SER A 11  ? 0.5065 0.5168 0.6510 -0.0311 -0.0005 0.1048  11  SER A CB  
86   O OG  . SER A 11  ? 0.6345 0.6550 0.7588 -0.0379 0.0032  0.0971  11  SER A OG  
87   N N   . ALA A 12  ? 0.4991 0.4830 0.6422 -0.0419 0.0095  0.1252  12  ALA A N   
88   C CA  . ALA A 12  ? 0.5117 0.4890 0.6418 -0.0513 0.0151  0.1334  12  ALA A CA  
89   C C   . ALA A 12  ? 0.5323 0.5013 0.6740 -0.0532 0.0261  0.1238  12  ALA A C   
90   O O   . ALA A 12  ? 0.5214 0.4925 0.6513 -0.0615 0.0340  0.1197  12  ALA A O   
91   C CB  . ALA A 12  ? 0.5517 0.5189 0.6818 -0.0518 0.0077  0.1551  12  ALA A CB  
92   N N   . ALA A 13  ? 0.4886 0.4492 0.6541 -0.0459 0.0269  0.1190  13  ALA A N   
93   C CA  . ALA A 13  ? 0.4808 0.4332 0.6605 -0.0470 0.0360  0.1091  13  ALA A CA  
94   C C   . ALA A 13  ? 0.5275 0.4896 0.7017 -0.0508 0.0429  0.0920  13  ALA A C   
95   O O   . ALA A 13  ? 0.5342 0.4917 0.7123 -0.0560 0.0508  0.0872  13  ALA A O   
96   C CB  . ALA A 13  ? 0.4832 0.4281 0.6873 -0.0384 0.0346  0.1045  13  ALA A CB  
97   N N   . ARG A 14  ? 0.4788 0.4540 0.6456 -0.0482 0.0398  0.0831  14  ARG A N   
98   C CA  . ARG A 14  ? 0.4657 0.4510 0.6292 -0.0505 0.0445  0.0674  14  ARG A CA  
99   C C   . ARG A 14  ? 0.5495 0.5377 0.7025 -0.0599 0.0522  0.0664  14  ARG A C   
100  O O   . ARG A 14  ? 0.5575 0.5471 0.6947 -0.0655 0.0523  0.0761  14  ARG A O   
101  C CB  . ARG A 14  ? 0.4350 0.4327 0.5901 -0.0469 0.0392  0.0618  14  ARG A CB  
102  C CG  . ARG A 14  ? 0.3911 0.3876 0.5580 -0.0383 0.0332  0.0594  14  ARG A CG  
103  C CD  . ARG A 14  ? 0.3431 0.3515 0.5034 -0.0356 0.0297  0.0510  14  ARG A CD  
104  N NE  . ARG A 14  ? 0.3557 0.3641 0.5239 -0.0286 0.0232  0.0530  14  ARG A NE  
105  C CZ  . ARG A 14  ? 0.4504 0.4545 0.6331 -0.0237 0.0238  0.0459  14  ARG A CZ  
106  N NH1 . ARG A 14  ? 0.2980 0.2976 0.4876 -0.0252 0.0293  0.0366  14  ARG A NH1 
107  N NH2 . ARG A 14  ? 0.2225 0.2274 0.4133 -0.0179 0.0188  0.0476  14  ARG A NH2 
108  N N   . ASN A 15  ? 0.5205 0.5098 0.6829 -0.0621 0.0585  0.0545  15  ASN A N   
109  C CA  . ASN A 15  ? 0.5272 0.5204 0.6851 -0.0707 0.0669  0.0506  15  ASN A CA  
110  C C   . ASN A 15  ? 0.5712 0.5774 0.7317 -0.0703 0.0687  0.0351  15  ASN A C   
111  O O   . ASN A 15  ? 0.5155 0.5241 0.6843 -0.0639 0.0641  0.0271  15  ASN A O   
112  C CB  . ASN A 15  ? 0.5201 0.5029 0.6910 -0.0745 0.0730  0.0510  15  ASN A CB  
113  C CG  . ASN A 15  ? 0.7829 0.7509 0.9551 -0.0747 0.0718  0.0661  15  ASN A CG  
114  O OD1 . ASN A 15  ? 0.7901 0.7551 0.9488 -0.0799 0.0725  0.0789  15  ASN A OD1 
115  N ND2 . ASN A 15  ? 0.6398 0.5977 0.8289 -0.0699 0.0705  0.0647  15  ASN A ND2 
116  N N   . PRO A 16  ? 0.5816 0.5960 0.7365 -0.0774 0.0757  0.0305  16  PRO A N   
117  C CA  . PRO A 16  ? 0.5821 0.6082 0.7436 -0.0763 0.0771  0.0161  16  PRO A CA  
118  C C   . PRO A 16  ? 0.6580 0.6832 0.8389 -0.0750 0.0780  0.0068  16  PRO A C   
119  O O   . PRO A 16  ? 0.6502 0.6669 0.8386 -0.0778 0.0810  0.0098  16  PRO A O   
120  C CB  . PRO A 16  ? 0.6092 0.6432 0.7621 -0.0850 0.0859  0.0140  16  PRO A CB  
121  C CG  . PRO A 16  ? 0.6783 0.7050 0.8146 -0.0908 0.0877  0.0282  16  PRO A CG  
122  C CD  . PRO A 16  ? 0.6210 0.6341 0.7642 -0.0870 0.0831  0.0376  16  PRO A CD  
123  N N   . SER A 17  ? 0.6375 0.6713 0.8261 -0.0711 0.0749  -0.0042 17  SER A N   
124  C CA  . SER A 17  ? 0.6446 0.6798 0.8502 -0.0700 0.0736  -0.0134 17  SER A CA  
125  C C   . SER A 17  ? 0.7611 0.8009 0.9772 -0.0772 0.0816  -0.0183 17  SER A C   
126  O O   . SER A 17  ? 0.7538 0.8017 0.9671 -0.0813 0.0876  -0.0207 17  SER A O   
127  C CB  . SER A 17  ? 0.6663 0.7094 0.8757 -0.0645 0.0673  -0.0218 17  SER A CB  
128  O OG  . SER A 17  ? 0.7531 0.7966 0.9765 -0.0637 0.0638  -0.0288 17  SER A OG  
129  N N   . PRO A 18  ? 0.7698 0.8049 0.9989 -0.0795 0.0826  -0.0208 18  PRO A N   
130  C CA  . PRO A 18  ? 0.7915 0.8316 1.0331 -0.0869 0.0904  -0.0258 18  PRO A CA  
131  C C   . PRO A 18  ? 0.9010 0.9557 1.1566 -0.0868 0.0902  -0.0373 18  PRO A C   
132  O O   . PRO A 18  ? 0.9000 0.9613 1.1656 -0.0931 0.0981  -0.0418 18  PRO A O   
133  C CB  . PRO A 18  ? 0.8111 0.8422 1.0631 -0.0886 0.0896  -0.0263 18  PRO A CB  
134  C CG  . PRO A 18  ? 0.8577 0.8771 1.1004 -0.0831 0.0839  -0.0192 18  PRO A CG  
135  C CD  . PRO A 18  ? 0.7863 0.8117 1.0198 -0.0764 0.0774  -0.0200 18  PRO A CD  
136  N N   . ILE A 19  ? 0.9049 0.9644 1.1624 -0.0800 0.0815  -0.0418 19  ILE A N   
137  C CA  . ILE A 19  ? 0.9230 0.9954 1.1957 -0.0783 0.0790  -0.0515 19  ILE A CA  
138  C C   . ILE A 19  ? 1.0281 1.1070 1.2930 -0.0755 0.0805  -0.0526 19  ILE A C   
139  O O   . ILE A 19  ? 1.0198 1.1069 1.2953 -0.0715 0.0761  -0.0592 19  ILE A O   
140  C CB  . ILE A 19  ? 0.9555 1.0283 1.2368 -0.0736 0.0676  -0.0557 19  ILE A CB  
141  C CG1 . ILE A 19  ? 0.9608 1.0225 1.2394 -0.0751 0.0652  -0.0528 19  ILE A CG1 
142  C CG2 . ILE A 19  ? 0.9601 1.0455 1.2638 -0.0742 0.0649  -0.0648 19  ILE A CG2 
143  C CD1 . ILE A 19  ? 1.0065 1.0600 1.2715 -0.0696 0.0583  -0.0489 19  ILE A CD1 
144  N N   . ARG A 20  ? 1.0264 1.1013 1.2732 -0.0781 0.0864  -0.0460 20  ARG A N   
145  C CA  . ARG A 20  ? 1.0376 1.1182 1.2747 -0.0769 0.0885  -0.0475 20  ARG A CA  
146  C C   . ARG A 20  ? 1.1349 1.2149 1.3547 -0.0841 0.0982  -0.0426 20  ARG A C   
147  O O   . ARG A 20  ? 1.1371 1.2142 1.3386 -0.0824 0.0955  -0.0368 20  ARG A O   
148  C CB  . ARG A 20  ? 1.0291 1.1068 1.2572 -0.0689 0.0784  -0.0454 20  ARG A CB  
149  C CG  . ARG A 20  ? 1.1238 1.2100 1.3641 -0.0643 0.0745  -0.0541 20  ARG A CG  
150  C CD  . ARG A 20  ? 1.1488 1.2323 1.3770 -0.0583 0.0674  -0.0518 20  ARG A CD  
151  N NE  . ARG A 20  ? 1.1266 1.2141 1.3433 -0.0602 0.0727  -0.0527 20  ARG A NE  
152  C CZ  . ARG A 20  ? 1.1409 1.2241 1.3375 -0.0605 0.0719  -0.0457 20  ARG A CZ  
153  N NH1 . ARG A 20  ? 0.9504 1.0249 1.1386 -0.0582 0.0663  -0.0372 20  ARG A NH1 
154  N NH2 . ARG A 20  ? 0.8757 0.9636 1.0617 -0.0634 0.0766  -0.0476 20  ARG A NH2 
155  N N   . THR A 21  ? 1.1189 1.2026 1.3431 -0.0927 0.1094  -0.0450 21  THR A N   
156  C CA  . THR A 21  ? 1.1243 1.2129 1.3694 -0.0976 0.1159  -0.0516 21  THR A CA  
157  C C   . THR A 21  ? 1.1752 1.2742 1.4475 -0.0932 0.1120  -0.0633 21  THR A C   
158  O O   . THR A 21  ? 1.1564 1.2566 1.4320 -0.0852 0.1022  -0.0652 21  THR A O   
159  C CB  . THR A 21  ? 1.2391 1.3170 1.4819 -0.1021 0.1175  -0.0436 21  THR A CB  
160  O OG1 . THR A 21  ? 1.2480 1.3137 1.4725 -0.0985 0.1108  -0.0319 21  THR A OG1 
161  C CG2 . THR A 21  ? 1.2334 1.3121 1.4725 -0.1133 0.1312  -0.0424 21  THR A CG2 
162  N N   . MET A 22  ? 1.1463 1.2531 1.4390 -0.0988 0.1197  -0.0706 22  MET A N   
163  C CA  . MET A 22  ? 1.1369 1.2554 1.4596 -0.0958 0.1165  -0.0815 22  MET A CA  
164  C C   . MET A 22  ? 1.1878 1.3162 1.5184 -0.0920 0.1178  -0.0895 22  MET A C   
165  O O   . MET A 22  ? 1.1872 1.3267 1.5367 -0.0957 0.1271  -0.0991 22  MET A O   
166  C CB  . MET A 22  ? 1.1544 1.2695 1.4859 -0.0894 0.1021  -0.0800 22  MET A CB  
167  C CG  . MET A 22  ? 1.2055 1.3084 1.5264 -0.0921 0.1002  -0.0722 22  MET A CG  
168  S SD  . MET A 22  ? 1.2700 1.3736 1.6022 -0.1032 0.1125  -0.0738 22  MET A SD  
169  C CE  . MET A 22  ? 1.2434 1.3302 1.5463 -0.1070 0.1174  -0.0603 22  MET A CE  
170  N N   . THR A 23  ? 1.1359 1.2598 1.4528 -0.0849 0.1093  -0.0860 23  THR A N   
171  C CA  . THR A 23  ? 1.3464 1.4764 1.6673 -0.0805 0.1091  -0.0922 23  THR A CA  
172  C C   . THR A 23  ? 1.5898 1.7214 1.8938 -0.0871 0.1221  -0.0939 23  THR A C   
173  O O   . THR A 23  ? 1.0927 1.2279 1.3977 -0.0960 0.1346  -0.0967 23  THR A O   
174  C CB  . THR A 23  ? 1.4109 1.5340 1.7205 -0.0718 0.0956  -0.0867 23  THR A CB  
175  O OG1 . THR A 23  ? 1.4042 1.5161 1.6866 -0.0729 0.0937  -0.0762 23  THR A OG1 
176  C CG2 . THR A 23  ? 1.3666 1.4900 1.6935 -0.0658 0.0828  -0.0871 23  THR A CG2 
177  N N   . LYS A 31  ? 0.9337 1.1847 1.5447 -0.1034 0.1977  -0.2056 31  LYS A N   
178  C CA  . LYS A 31  ? 0.9147 1.1635 1.5387 -0.0896 0.1790  -0.2019 31  LYS A CA  
179  C C   . LYS A 31  ? 0.9328 1.1897 1.5936 -0.0819 0.1617  -0.1996 31  LYS A C   
180  O O   . LYS A 31  ? 0.9208 1.1745 1.5889 -0.0712 0.1439  -0.1938 31  LYS A O   
181  C CB  . LYS A 31  ? 0.9497 1.2022 1.5879 -0.0859 0.1870  -0.2130 31  LYS A CB  
182  C CG  . LYS A 31  ? 1.1380 1.4069 1.8187 -0.0900 0.2049  -0.2315 31  LYS A CG  
183  C CD  . LYS A 31  ? 1.2554 1.5251 1.9437 -0.0874 0.2143  -0.2426 31  LYS A CD  
184  C CE  . LYS A 31  ? 1.3215 1.6074 2.0563 -0.0904 0.2322  -0.2624 31  LYS A CE  
185  N NZ  . LYS A 31  ? 1.3726 1.6578 2.1147 -0.0878 0.2414  -0.2738 31  LYS A NZ  
186  N N   . SER A 32  ? 0.8656 1.1324 1.5477 -0.0882 0.1666  -0.2037 32  SER A N   
187  C CA  . SER A 32  ? 0.8382 1.1140 1.5539 -0.0830 0.1504  -0.2019 32  SER A CA  
188  C C   . SER A 32  ? 0.8450 1.1126 1.5350 -0.0878 0.1421  -0.1906 32  SER A C   
189  O O   . SER A 32  ? 0.8486 1.1255 1.5619 -0.0912 0.1393  -0.1928 32  SER A O   
190  C CB  . SER A 32  ? 0.8841 1.1799 1.6516 -0.0857 0.1609  -0.2168 32  SER A CB  
191  O OG  . SER A 32  ? 1.0151 1.3145 1.7764 -0.0990 0.1811  -0.2231 32  SER A OG  
192  N N   . MET A 33  ? 0.7490 0.9992 1.3923 -0.0880 0.1383  -0.1791 33  MET A N   
193  C CA  . MET A 33  ? 0.7162 0.9551 1.3306 -0.0916 0.1310  -0.1679 33  MET A CA  
194  C C   . MET A 33  ? 0.6861 0.9244 1.3092 -0.0839 0.1080  -0.1611 33  MET A C   
195  O O   . MET A 33  ? 0.6761 0.9139 1.3049 -0.0746 0.0956  -0.1589 33  MET A O   
196  C CB  . MET A 33  ? 0.7518 0.9732 1.3180 -0.0924 0.1334  -0.1584 33  MET A CB  
197  C CG  . MET A 33  ? 0.8199 1.0378 1.3650 -0.1033 0.1534  -0.1601 33  MET A CG  
198  S SD  . MET A 33  ? 0.8935 1.1034 1.4214 -0.1133 0.1568  -0.1526 33  MET A SD  
199  C CE  . MET A 33  ? 0.8739 1.0845 1.3880 -0.1263 0.1819  -0.1576 33  MET A CE  
200  N N   . ILE A 34  ? 0.5990 0.8363 1.2203 -0.0886 0.1024  -0.1574 34  ILE A N   
201  C CA  . ILE A 34  ? 0.5698 0.8051 1.1920 -0.0836 0.0811  -0.1506 34  ILE A CA  
202  C C   . ILE A 34  ? 0.5997 0.8161 1.1772 -0.0852 0.0785  -0.1399 34  ILE A C   
203  O O   . ILE A 34  ? 0.6025 0.8131 1.1659 -0.0933 0.0871  -0.1384 34  ILE A O   
204  C CB  . ILE A 34  ? 0.6012 0.8502 1.2564 -0.0875 0.0749  -0.1554 34  ILE A CB  
205  C CG1 . ILE A 34  ? 0.5975 0.8661 1.3013 -0.0843 0.0761  -0.1659 34  ILE A CG1 
206  C CG2 . ILE A 34  ? 0.6053 0.8501 1.2527 -0.0845 0.0531  -0.1477 34  ILE A CG2 
207  C CD1 . ILE A 34  ? 0.6128 0.8976 1.3529 -0.0898 0.0749  -0.1728 34  ILE A CD1 
208  N N   . SER A 35  ? 0.5335 0.7400 1.0898 -0.0778 0.0679  -0.1327 35  SER A N   
209  C CA  . SER A 35  ? 0.5249 0.7141 1.0413 -0.0782 0.0651  -0.1231 35  SER A CA  
210  C C   . SER A 35  ? 0.5335 0.7178 1.0430 -0.0770 0.0481  -0.1176 35  SER A C   
211  O O   . SER A 35  ? 0.5228 0.7084 1.0363 -0.0705 0.0333  -0.1151 35  SER A O   
212  C CB  . SER A 35  ? 0.5779 0.7585 1.0717 -0.0726 0.0668  -0.1192 35  SER A CB  
213  O OG  . SER A 35  ? 0.7118 0.8768 1.1695 -0.0731 0.0656  -0.1104 35  SER A OG  
214  N N   . LEU A 36  ? 0.4598 0.6379 0.9581 -0.0840 0.0509  -0.1158 36  LEU A N   
215  C CA  . LEU A 36  ? 0.4395 0.6110 0.9264 -0.0852 0.0383  -0.1118 36  LEU A CA  
216  C C   . LEU A 36  ? 0.4605 0.6144 0.9133 -0.0871 0.0447  -0.1051 36  LEU A C   
217  O O   . LEU A 36  ? 0.4405 0.5865 0.8821 -0.0905 0.0402  -0.1030 36  LEU A O   
218  C CB  . LEU A 36  ? 0.4383 0.6186 0.9470 -0.0927 0.0370  -0.1173 36  LEU A CB  
219  C CG  . LEU A 36  ? 0.4828 0.6815 1.0278 -0.0910 0.0279  -0.1233 36  LEU A CG  
220  C CD1 . LEU A 36  ? 0.4868 0.6975 1.0589 -0.0964 0.0413  -0.1314 36  LEU A CD1 
221  C CD2 . LEU A 36  ? 0.4994 0.7014 1.0494 -0.0936 0.0117  -0.1232 36  LEU A CD2 
222  N N   . ALA A 37  ? 0.4228 0.5710 0.8603 -0.0853 0.0553  -0.1022 37  ALA A N   
223  C CA  . ALA A 37  ? 0.4362 0.5689 0.8438 -0.0865 0.0616  -0.0950 37  ALA A CA  
224  C C   . ALA A 37  ? 0.5214 0.6451 0.9086 -0.0798 0.0510  -0.0894 37  ALA A C   
225  O O   . ALA A 37  ? 0.5192 0.6351 0.8964 -0.0806 0.0441  -0.0869 37  ALA A O   
226  C CB  . ALA A 37  ? 0.4480 0.5802 0.8480 -0.0882 0.0759  -0.0942 37  ALA A CB  
227  N N   . GLY A 38  ? 0.5088 0.6342 0.8914 -0.0739 0.0506  -0.0884 38  GLY A N   
228  C CA  . GLY A 38  ? 0.5069 0.6248 0.8710 -0.0675 0.0423  -0.0835 38  GLY A CA  
229  C C   . GLY A 38  ? 0.5571 0.6756 0.9246 -0.0647 0.0271  -0.0834 38  GLY A C   
230  O O   . GLY A 38  ? 0.5516 0.6807 0.9410 -0.0637 0.0198  -0.0873 38  GLY A O   
231  N N   . GLY A 39  ? 0.5135 0.6208 0.8597 -0.0641 0.0225  -0.0787 39  GLY A N   
232  C CA  . GLY A 39  ? 0.5092 0.6142 0.8503 -0.0626 0.0091  -0.0777 39  GLY A CA  
233  C C   . GLY A 39  ? 0.5404 0.6446 0.8747 -0.0560 0.0021  -0.0748 39  GLY A C   
234  O O   . GLY A 39  ? 0.5423 0.6383 0.8587 -0.0548 -0.0040 -0.0714 39  GLY A O   
235  N N   . LEU A 40  ? 0.4692 0.5814 0.8185 -0.0521 0.0037  -0.0767 40  LEU A N   
236  C CA  . LEU A 40  ? 0.4442 0.5558 0.7911 -0.0459 -0.0024 -0.0746 40  LEU A CA  
237  C C   . LEU A 40  ? 0.4799 0.5951 0.8366 -0.0449 -0.0179 -0.0735 40  LEU A C   
238  O O   . LEU A 40  ? 0.4852 0.6101 0.8639 -0.0470 -0.0224 -0.0767 40  LEU A O   
239  C CB  . LEU A 40  ? 0.4321 0.5509 0.7944 -0.0426 0.0052  -0.0783 40  LEU A CB  
240  C CG  . LEU A 40  ? 0.4877 0.6046 0.8399 -0.0445 0.0203  -0.0794 40  LEU A CG  
241  C CD1 . LEU A 40  ? 0.5014 0.6251 0.8672 -0.0416 0.0263  -0.0843 40  LEU A CD1 
242  C CD2 . LEU A 40  ? 0.4851 0.5902 0.8079 -0.0438 0.0218  -0.0736 40  LEU A CD2 
243  N N   . PRO A 41  ? 0.4115 0.5193 0.7520 -0.0424 -0.0267 -0.0688 41  PRO A N   
244  C CA  . PRO A 41  ? 0.4138 0.5244 0.7610 -0.0423 -0.0425 -0.0662 41  PRO A CA  
245  C C   . PRO A 41  ? 0.4645 0.5846 0.8397 -0.0372 -0.0477 -0.0670 41  PRO A C   
246  O O   . PRO A 41  ? 0.4617 0.5832 0.8449 -0.0329 -0.0388 -0.0693 41  PRO A O   
247  C CB  . PRO A 41  ? 0.4365 0.5355 0.7570 -0.0414 -0.0473 -0.0609 41  PRO A CB  
248  C CG  . PRO A 41  ? 0.4759 0.5699 0.7867 -0.0377 -0.0356 -0.0611 41  PRO A CG  
249  C CD  . PRO A 41  ? 0.4151 0.5123 0.7313 -0.0400 -0.0230 -0.0652 41  PRO A CD  
250  N N   . ASN A 42  ? 0.4114 0.5382 0.8025 -0.0378 -0.0620 -0.0652 42  ASN A N   
251  C CA  . ASN A 42  ? 0.4063 0.5420 0.8279 -0.0322 -0.0681 -0.0653 42  ASN A CA  
252  C C   . ASN A 42  ? 0.4881 0.6157 0.9025 -0.0261 -0.0724 -0.0600 42  ASN A C   
253  O O   . ASN A 42  ? 0.4704 0.5895 0.8642 -0.0272 -0.0827 -0.0531 42  ASN A O   
254  C CB  . ASN A 42  ? 0.3858 0.5315 0.8279 -0.0344 -0.0838 -0.0638 42  ASN A CB  
255  C CG  . ASN A 42  ? 0.6153 0.7733 1.0978 -0.0288 -0.0865 -0.0664 42  ASN A CG  
256  O OD1 . ASN A 42  ? 0.5217 0.6777 1.0143 -0.0221 -0.0901 -0.0634 42  ASN A OD1 
257  N ND2 . ASN A 42  ? 0.5280 0.6990 1.0362 -0.0314 -0.0828 -0.0730 42  ASN A ND2 
258  N N   . PRO A 43  ? 0.4797 0.6096 0.9101 -0.0205 -0.0633 -0.0638 43  PRO A N   
259  C CA  . PRO A 43  ? 0.4933 0.6150 0.9182 -0.0151 -0.0661 -0.0596 43  PRO A CA  
260  C C   . PRO A 43  ? 0.5485 0.6717 0.9929 -0.0111 -0.0833 -0.0532 43  PRO A C   
261  O O   . PRO A 43  ? 0.5847 0.6984 1.0189 -0.0081 -0.0889 -0.0472 43  PRO A O   
262  C CB  . PRO A 43  ? 0.5080 0.6326 0.9448 -0.0119 -0.0499 -0.0675 43  PRO A CB  
263  C CG  . PRO A 43  ? 0.5550 0.6928 1.0187 -0.0137 -0.0439 -0.0748 43  PRO A CG  
264  C CD  . PRO A 43  ? 0.4960 0.6356 0.9498 -0.0199 -0.0494 -0.0727 43  PRO A CD  
265  N N   . ASN A 44  ? 0.4396 0.5745 0.9119 -0.0114 -0.0925 -0.0537 44  ASN A N   
266  C CA  . ASN A 44  ? 0.4310 0.5681 0.9234 -0.0078 -0.1111 -0.0461 44  ASN A CA  
267  C C   . ASN A 44  ? 0.4829 0.6115 0.9458 -0.0127 -0.1271 -0.0355 44  ASN A C   
268  O O   . ASN A 44  ? 0.4981 0.6269 0.9714 -0.0111 -0.1446 -0.0269 44  ASN A O   
269  C CB  . ASN A 44  ? 0.4344 0.5882 0.9686 -0.0064 -0.1163 -0.0500 44  ASN A CB  
270  C CG  . ASN A 44  ? 0.7299 0.8923 1.2958 -0.0019 -0.1003 -0.0609 44  ASN A CG  
271  O OD1 . ASN A 44  ? 0.6826 0.8421 1.2632 0.0045  -0.0961 -0.0623 44  ASN A OD1 
272  N ND2 . ASN A 44  ? 0.6148 0.7883 1.1931 -0.0059 -0.0907 -0.0695 44  ASN A ND2 
273  N N   . MET A 45  ? 0.4335 0.5542 0.8597 -0.0190 -0.1208 -0.0362 45  MET A N   
274  C CA  . MET A 45  ? 0.4421 0.5541 0.8361 -0.0256 -0.1319 -0.0288 45  MET A CA  
275  C C   . MET A 45  ? 0.4816 0.5788 0.8470 -0.0247 -0.1284 -0.0244 45  MET A C   
276  O O   . MET A 45  ? 0.4842 0.5734 0.8247 -0.0296 -0.1381 -0.0174 45  MET A O   
277  C CB  . MET A 45  ? 0.4734 0.5871 0.8491 -0.0338 -0.1262 -0.0342 45  MET A CB  
278  C CG  . MET A 45  ? 0.5194 0.6475 0.9203 -0.0367 -0.1307 -0.0385 45  MET A CG  
279  S SD  . MET A 45  ? 0.5912 0.7267 1.0060 -0.0389 -0.1568 -0.0295 45  MET A SD  
280  C CE  . MET A 45  ? 0.5424 0.6923 1.0099 -0.0298 -0.1583 -0.0320 45  MET A CE  
281  N N   . PHE A 46  ? 0.4298 0.5238 0.7979 -0.0194 -0.1140 -0.0290 46  PHE A N   
282  C CA  . PHE A 46  ? 0.4260 0.5073 0.7701 -0.0184 -0.1086 -0.0265 46  PHE A CA  
283  C C   . PHE A 46  ? 0.4387 0.5132 0.7873 -0.0150 -0.1211 -0.0174 46  PHE A C   
284  O O   . PHE A 46  ? 0.4159 0.4960 0.7961 -0.0094 -0.1270 -0.0162 46  PHE A O   
285  C CB  . PHE A 46  ? 0.4483 0.5299 0.7951 -0.0147 -0.0903 -0.0346 46  PHE A CB  
286  C CG  . PHE A 46  ? 0.4771 0.5621 0.8133 -0.0186 -0.0777 -0.0415 46  PHE A CG  
287  C CD1 . PHE A 46  ? 0.5211 0.6042 0.8375 -0.0253 -0.0805 -0.0404 46  PHE A CD1 
288  C CD2 . PHE A 46  ? 0.5046 0.5941 0.8501 -0.0163 -0.0629 -0.0488 46  PHE A CD2 
289  C CE1 . PHE A 46  ? 0.5308 0.6156 0.8395 -0.0285 -0.0690 -0.0460 46  PHE A CE1 
290  C CE2 . PHE A 46  ? 0.5373 0.6287 0.8726 -0.0201 -0.0521 -0.0534 46  PHE A CE2 
291  C CZ  . PHE A 46  ? 0.5172 0.6059 0.8355 -0.0258 -0.0554 -0.0516 46  PHE A CZ  
292  N N   . PRO A 47  ? 0.3927 0.4551 0.7116 -0.0188 -0.1256 -0.0107 47  PRO A N   
293  C CA  . PRO A 47  ? 0.3918 0.4463 0.7131 -0.0168 -0.1387 -0.0003 47  PRO A CA  
294  C C   . PRO A 47  ? 0.4045 0.4539 0.7418 -0.0091 -0.1329 -0.0008 47  PRO A C   
295  O O   . PRO A 47  ? 0.3960 0.4415 0.7486 -0.0056 -0.1445 0.0073  47  PRO A O   
296  C CB  . PRO A 47  ? 0.4223 0.4659 0.7043 -0.0251 -0.1430 0.0056  47  PRO A CB  
297  C CG  . PRO A 47  ? 0.4663 0.5093 0.7285 -0.0280 -0.1269 -0.0033 47  PRO A CG  
298  C CD  . PRO A 47  ? 0.4020 0.4573 0.6849 -0.0257 -0.1192 -0.0121 47  PRO A CD  
299  N N   . PHE A 48  ? 0.3387 0.3877 0.6725 -0.0069 -0.1156 -0.0098 48  PHE A N   
300  C CA  . PHE A 48  ? 0.3335 0.3781 0.6815 -0.0007 -0.1086 -0.0122 48  PHE A CA  
301  C C   . PHE A 48  ? 0.3721 0.4275 0.7605 0.0057  -0.1055 -0.0187 48  PHE A C   
302  O O   . PHE A 48  ? 0.3645 0.4308 0.7619 0.0050  -0.0981 -0.0265 48  PHE A O   
303  C CB  . PHE A 48  ? 0.3512 0.3912 0.6770 -0.0022 -0.0928 -0.0188 48  PHE A CB  
304  C CG  . PHE A 48  ? 0.3745 0.4064 0.6636 -0.0089 -0.0939 -0.0146 48  PHE A CG  
305  C CD1 . PHE A 48  ? 0.4296 0.4497 0.7030 -0.0111 -0.1020 -0.0058 48  PHE A CD1 
306  C CD2 . PHE A 48  ? 0.3964 0.4320 0.6676 -0.0133 -0.0864 -0.0194 48  PHE A CD2 
307  C CE1 . PHE A 48  ? 0.4533 0.4665 0.6937 -0.0181 -0.1016 -0.0032 48  PHE A CE1 
308  C CE2 . PHE A 48  ? 0.4403 0.4688 0.6807 -0.0194 -0.0863 -0.0168 48  PHE A CE2 
309  C CZ  . PHE A 48  ? 0.4359 0.4536 0.6610 -0.0220 -0.0933 -0.0094 48  PHE A CZ  
310  N N   . LYS A 49  ? 0.3216 0.3737 0.7356 0.0116  -0.1113 -0.0154 49  LYS A N   
311  C CA  . LYS A 49  ? 0.3161 0.3786 0.7731 0.0179  -0.1097 -0.0213 49  LYS A CA  
312  C C   . LYS A 49  ? 0.3655 0.4281 0.8425 0.0229  -0.0945 -0.0318 49  LYS A C   
313  O O   . LYS A 49  ? 0.3462 0.4202 0.8460 0.0246  -0.0841 -0.0426 49  LYS A O   
314  C CB  . LYS A 49  ? 0.3597 0.4231 0.8417 0.0212  -0.1299 -0.0105 49  LYS A CB  
315  C CG  . LYS A 49  ? 0.5551 0.6231 1.0222 0.0152  -0.1444 -0.0027 49  LYS A CG  
316  C CD  . LYS A 49  ? 0.6487 0.7324 1.1275 0.0132  -0.1383 -0.0121 49  LYS A CD  
317  C CE  . LYS A 49  ? 0.7161 0.8043 1.1793 0.0062  -0.1513 -0.0062 49  LYS A CE  
318  N NZ  . LYS A 49  ? 0.7751 0.8754 1.2408 0.0027  -0.1413 -0.0164 49  LYS A NZ  
319  N N   . THR A 50  ? 0.3354 0.3853 0.8053 0.0246  -0.0932 -0.0292 50  THR A N   
320  C CA  . THR A 50  ? 0.3330 0.3811 0.8188 0.0283  -0.0789 -0.0395 50  THR A CA  
321  C C   . THR A 50  ? 0.4019 0.4368 0.8568 0.0254  -0.0745 -0.0373 50  THR A C   
322  O O   . THR A 50  ? 0.4162 0.4416 0.8469 0.0224  -0.0853 -0.0260 50  THR A O   
323  C CB  . THR A 50  ? 0.4096 0.4563 0.9390 0.0360  -0.0845 -0.0386 50  THR A CB  
324  O OG1 . THR A 50  ? 0.4224 0.4554 0.9463 0.0372  -0.1001 -0.0241 50  THR A OG1 
325  C CG2 . THR A 50  ? 0.3681 0.4290 0.9356 0.0397  -0.0892 -0.0413 50  THR A CG2 
326  N N   . ALA A 51  ? 0.3518 0.3863 0.8071 0.0255  -0.0587 -0.0485 51  ALA A N   
327  C CA  . ALA A 51  ? 0.3561 0.3795 0.7847 0.0225  -0.0540 -0.0477 51  ALA A CA  
328  C C   . ALA A 51  ? 0.4269 0.4470 0.8739 0.0252  -0.0426 -0.0577 51  ALA A C   
329  O O   . ALA A 51  ? 0.4266 0.4561 0.8966 0.0269  -0.0317 -0.0697 51  ALA A O   
330  C CB  . ALA A 51  ? 0.3521 0.3792 0.7455 0.0164  -0.0459 -0.0510 51  ALA A CB  
331  N N   . VAL A 52  ? 0.3716 0.3783 0.8088 0.0247  -0.0445 -0.0532 52  VAL A N   
332  C CA  . VAL A 52  ? 0.3692 0.3706 0.8204 0.0261  -0.0339 -0.0625 52  VAL A CA  
333  C C   . VAL A 52  ? 0.4067 0.3989 0.8252 0.0209  -0.0304 -0.0610 52  VAL A C   
334  O O   . VAL A 52  ? 0.4150 0.3960 0.8181 0.0196  -0.0408 -0.0489 52  VAL A O   
335  C CB  . VAL A 52  ? 0.4337 0.4284 0.9259 0.0331  -0.0390 -0.0610 52  VAL A CB  
336  C CG1 . VAL A 52  ? 0.4473 0.4331 0.9429 0.0358  -0.0591 -0.0429 52  VAL A CG1 
337  C CG2 . VAL A 52  ? 0.4329 0.4177 0.9330 0.0332  -0.0291 -0.0688 52  VAL A CG2 
338  N N   . ILE A 53  ? 0.3367 0.3350 0.7434 0.0171  -0.0158 -0.0734 53  ILE A N   
339  C CA  . ILE A 53  ? 0.3242 0.3175 0.7023 0.0118  -0.0104 -0.0749 53  ILE A CA  
340  C C   . ILE A 53  ? 0.3936 0.3829 0.7868 0.0117  0.0006  -0.0864 53  ILE A C   
341  O O   . ILE A 53  ? 0.3726 0.3704 0.7832 0.0121  0.0116  -0.0994 53  ILE A O   
342  C CB  . ILE A 53  ? 0.3412 0.3460 0.6922 0.0069  -0.0040 -0.0789 53  ILE A CB  
343  C CG1 . ILE A 53  ? 0.3426 0.3500 0.6801 0.0067  -0.0144 -0.0682 53  ILE A CG1 
344  C CG2 . ILE A 53  ? 0.3309 0.3332 0.6558 0.0016  0.0020  -0.0818 53  ILE A CG2 
345  C CD1 . ILE A 53  ? 0.4348 0.4553 0.7620 0.0044  -0.0085 -0.0729 53  ILE A CD1 
346  N N   . THR A 54  ? 0.3722 0.3482 0.7584 0.0103  -0.0019 -0.0820 54  THR A N   
347  C CA  . THR A 54  ? 0.3833 0.3537 0.7816 0.0091  0.0084  -0.0928 54  THR A CA  
348  C C   . THR A 54  ? 0.4393 0.4167 0.8110 0.0020  0.0192  -0.1024 54  THR A C   
349  O O   . THR A 54  ? 0.3895 0.3694 0.7323 -0.0015 0.0156  -0.0962 54  THR A O   
350  C CB  . THR A 54  ? 0.4236 0.3758 0.8311 0.0109  0.0012  -0.0841 54  THR A CB  
351  O OG1 . THR A 54  ? 0.4934 0.4390 0.8691 0.0060  -0.0039 -0.0748 54  THR A OG1 
352  C CG2 . THR A 54  ? 0.3133 0.2586 0.7472 0.0179  -0.0114 -0.0728 54  THR A CG2 
353  N N   . VAL A 55  ? 0.4588 0.4398 0.8415 -0.0003 0.0322  -0.1178 55  VAL A N   
354  C CA  . VAL A 55  ? 0.4858 0.4751 0.8462 -0.0076 0.0425  -0.1284 55  VAL A CA  
355  C C   . VAL A 55  ? 0.6201 0.6000 0.9834 -0.0113 0.0486  -0.1357 55  VAL A C   
356  O O   . VAL A 55  ? 0.6277 0.5931 1.0063 -0.0081 0.0437  -0.1300 55  VAL A O   
357  C CB  . VAL A 55  ? 0.5256 0.5303 0.8904 -0.0097 0.0532  -0.1411 55  VAL A CB  
358  C CG1 . VAL A 55  ? 0.5174 0.5321 0.8547 -0.0178 0.0611  -0.1489 55  VAL A CG1 
359  C CG2 . VAL A 55  ? 0.5116 0.5237 0.8785 -0.0058 0.0472  -0.1337 55  VAL A CG2 
360  N N   . GLU A 56  ? 0.6304 0.6182 0.9781 -0.0185 0.0585  -0.1475 56  GLU A N   
361  C CA  . GLU A 56  ? 0.6651 0.6469 1.0134 -0.0237 0.0657  -0.1570 56  GLU A CA  
362  C C   . GLU A 56  ? 0.7970 0.7812 1.1686 -0.0257 0.0795  -0.1756 56  GLU A C   
363  O O   . GLU A 56  ? 0.8120 0.8088 1.1719 -0.0323 0.0890  -0.1881 56  GLU A O   
364  C CB  . GLU A 56  ? 0.6759 0.6656 0.9922 -0.0312 0.0666  -0.1581 56  GLU A CB  
365  C CG  . GLU A 56  ? 0.7523 0.7598 1.0512 -0.0356 0.0714  -0.1643 56  GLU A CG  
366  C CD  . GLU A 56  ? 1.0739 1.0896 1.3460 -0.0431 0.0724  -0.1667 56  GLU A CD  
367  O OE1 . GLU A 56  ? 0.9551 0.9804 1.2217 -0.0500 0.0812  -0.1798 56  GLU A OE1 
368  O OE2 . GLU A 56  ? 1.0811 1.0945 1.3379 -0.0426 0.0642  -0.1556 56  GLU A OE2 
369  N N   . ASN A 57  ? 0.7902 0.7627 1.1949 -0.0206 0.0811  -0.1782 57  ASN A N   
370  C CA  . ASN A 57  ? 0.8079 0.7642 1.2306 -0.0130 0.0700  -0.1639 57  ASN A CA  
371  C C   . ASN A 57  ? 0.8798 0.8332 1.3430 -0.0061 0.0729  -0.1690 57  ASN A C   
372  O O   . ASN A 57  ? 0.8805 0.8393 1.3606 -0.0085 0.0867  -0.1868 57  ASN A O   
373  C CB  . ASN A 57  ? 0.8625 0.8034 1.2841 -0.0160 0.0698  -0.1626 57  ASN A CB  
374  C CG  . ASN A 57  ? 1.2103 1.1324 1.6568 -0.0091 0.0611  -0.1508 57  ASN A CG  
375  O OD1 . ASN A 57  ? 1.1772 1.0943 1.6189 -0.0044 0.0475  -0.1332 57  ASN A OD1 
376  N ND2 . ASN A 57  ? 1.1017 1.0131 1.5764 -0.0084 0.0687  -0.1603 57  ASN A ND2 
377  N N   . GLY A 58  ? 0.8349 0.7806 1.3136 0.0020  0.0600  -0.1537 58  GLY A N   
378  C CA  . GLY A 58  ? 0.8330 0.7767 1.3533 0.0098  0.0600  -0.1559 58  GLY A CA  
379  C C   . GLY A 58  ? 0.8640 0.8253 1.3874 0.0110  0.0633  -0.1611 58  GLY A C   
380  O O   . GLY A 58  ? 0.8717 0.8346 1.4275 0.0179  0.0608  -0.1605 58  GLY A O   
381  N N   . LYS A 59  ? 0.7913 0.7659 1.2814 0.0039  0.0687  -0.1661 59  LYS A N   
382  C CA  . LYS A 59  ? 0.7689 0.7603 1.2529 0.0028  0.0724  -0.1701 59  LYS A CA  
383  C C   . LYS A 59  ? 0.7707 0.7623 1.2465 0.0079  0.0561  -0.1513 59  LYS A C   
384  O O   . LYS A 59  ? 0.7530 0.7360 1.2089 0.0081  0.0448  -0.1372 59  LYS A O   
385  C CB  . LYS A 59  ? 0.7967 0.7995 1.2453 -0.0068 0.0814  -0.1786 59  LYS A CB  
386  C CG  . LYS A 59  ? 0.9170 0.9207 1.3685 -0.0139 0.0971  -0.1977 59  LYS A CG  
387  C CD  . LYS A 59  ? 0.9650 0.9757 1.3769 -0.0232 0.0998  -0.2000 59  LYS A CD  
388  C CE  . LYS A 59  ? 1.0175 1.0305 1.4290 -0.0317 0.1145  -0.2192 59  LYS A CE  
389  N NZ  . LYS A 59  ? 1.1073 1.1296 1.4806 -0.0410 0.1156  -0.2207 59  LYS A NZ  
390  N N   . THR A 60  ? 0.6955 0.6970 1.1880 0.0116  0.0555  -0.1518 60  THR A N   
391  C CA  . THR A 60  ? 0.6709 0.6736 1.1603 0.0161  0.0406  -0.1358 60  THR A CA  
392  C C   . THR A 60  ? 0.6658 0.6843 1.1485 0.0144  0.0437  -0.1386 60  THR A C   
393  O O   . THR A 60  ? 0.6772 0.7048 1.1835 0.0149  0.0538  -0.1506 60  THR A O   
394  C CB  . THR A 60  ? 0.7876 0.7799 1.3132 0.0247  0.0296  -0.1272 60  THR A CB  
395  O OG1 . THR A 60  ? 0.7939 0.7700 1.3090 0.0250  0.0208  -0.1162 60  THR A OG1 
396  C CG2 . THR A 60  ? 0.7713 0.7693 1.3061 0.0296  0.0166  -0.1156 60  THR A CG2 
397  N N   . ILE A 61  ? 0.5648 0.5861 1.0164 0.0122  0.0356  -0.1277 61  ILE A N   
398  C CA  . ILE A 61  ? 0.5281 0.5618 0.9707 0.0108  0.0355  -0.1264 61  ILE A CA  
399  C C   . ILE A 61  ? 0.5165 0.5487 0.9785 0.0173  0.0212  -0.1146 61  ILE A C   
400  O O   . ILE A 61  ? 0.5111 0.5326 0.9692 0.0200  0.0080  -0.1018 61  ILE A O   
401  C CB  . ILE A 61  ? 0.5608 0.5970 0.9616 0.0051  0.0343  -0.1210 61  ILE A CB  
402  C CG1 . ILE A 61  ? 0.5612 0.6046 0.9463 -0.0020 0.0489  -0.1338 61  ILE A CG1 
403  C CG2 . ILE A 61  ? 0.5717 0.6148 0.9622 0.0053  0.0274  -0.1126 61  ILE A CG2 
404  C CD1 . ILE A 61  ? 0.6586 0.7012 1.0078 -0.0068 0.0470  -0.1288 61  ILE A CD1 
405  N N   . GLN A 62  ? 0.4378 0.4812 0.9201 0.0190  0.0235  -0.1188 62  GLN A N   
406  C CA  . GLN A 62  ? 0.4194 0.4637 0.9221 0.0246  0.0096  -0.1085 62  GLN A CA  
407  C C   . GLN A 62  ? 0.4321 0.4889 0.9282 0.0223  0.0095  -0.1079 62  GLN A C   
408  O O   . GLN A 62  ? 0.4451 0.5128 0.9477 0.0194  0.0227  -0.1198 62  GLN A O   
409  C CB  . GLN A 62  ? 0.4406 0.4848 0.9912 0.0313  0.0099  -0.1137 62  GLN A CB  
410  C CG  . GLN A 62  ? 0.7600 0.7887 1.3229 0.0358  0.0020  -0.1071 62  GLN A CG  
411  C CD  . GLN A 62  ? 1.0442 1.0720 1.6499 0.0402  0.0113  -0.1193 62  GLN A CD  
412  O OE1 . GLN A 62  ? 0.9912 1.0202 1.5966 0.0364  0.0280  -0.1346 62  GLN A OE1 
413  N NE2 . GLN A 62  ? 0.9385 0.9642 1.5827 0.0480  0.0004  -0.1130 62  GLN A NE2 
414  N N   . PHE A 63  ? 0.3354 0.3903 0.8185 0.0229  -0.0051 -0.0944 63  PHE A N   
415  C CA  . PHE A 63  ? 0.3043 0.3701 0.7846 0.0210  -0.0066 -0.0933 63  PHE A CA  
416  C C   . PHE A 63  ? 0.3226 0.3913 0.8367 0.0267  -0.0194 -0.0875 63  PHE A C   
417  O O   . PHE A 63  ? 0.3217 0.3824 0.8326 0.0290  -0.0354 -0.0745 63  PHE A O   
418  C CB  . PHE A 63  ? 0.3162 0.3793 0.7567 0.0163  -0.0123 -0.0842 63  PHE A CB  
419  C CG  . PHE A 63  ? 0.3232 0.3857 0.7309 0.0107  -0.0015 -0.0884 63  PHE A CG  
420  C CD1 . PHE A 63  ? 0.3481 0.4115 0.7571 0.0090  0.0119  -0.0994 63  PHE A CD1 
421  C CD2 . PHE A 63  ? 0.3467 0.4075 0.7229 0.0069  -0.0055 -0.0813 63  PHE A CD2 
422  C CE1 . PHE A 63  ? 0.3542 0.4177 0.7331 0.0036  0.0198  -0.1021 63  PHE A CE1 
423  C CE2 . PHE A 63  ? 0.3742 0.4349 0.7232 0.0024  0.0030  -0.0842 63  PHE A CE2 
424  C CZ  . PHE A 63  ? 0.3490 0.4115 0.6993 0.0007  0.0149  -0.0941 63  PHE A CZ  
425  N N   . GLY A 64  ? 0.2525 0.3326 0.7994 0.0286  -0.0120 -0.0973 64  GLY A N   
426  C CA  . GLY A 64  ? 0.2516 0.3377 0.8356 0.0339  -0.0231 -0.0936 64  GLY A CA  
427  C C   . GLY A 64  ? 0.3039 0.3970 0.8759 0.0311  -0.0329 -0.0860 64  GLY A C   
428  O O   . GLY A 64  ? 0.2970 0.3889 0.8323 0.0253  -0.0306 -0.0836 64  GLY A O   
429  N N   . GLU A 65  ? 0.2696 0.3702 0.8743 0.0351  -0.0440 -0.0824 65  GLU A N   
430  C CA  . GLU A 65  ? 0.2693 0.3774 0.8682 0.0323  -0.0548 -0.0757 65  GLU A CA  
431  C C   . GLU A 65  ? 0.3192 0.4351 0.8956 0.0252  -0.0418 -0.0831 65  GLU A C   
432  O O   . GLU A 65  ? 0.2963 0.4094 0.8405 0.0204  -0.0472 -0.0762 65  GLU A O   
433  C CB  . GLU A 65  ? 0.2909 0.4099 0.9373 0.0377  -0.0649 -0.0751 65  GLU A CB  
434  C CG  . GLU A 65  ? 0.4520 0.5662 1.1008 0.0402  -0.0894 -0.0586 65  GLU A CG  
435  C CD  . GLU A 65  ? 0.8902 0.9908 1.5476 0.0459  -0.0997 -0.0494 65  GLU A CD  
436  O OE1 . GLU A 65  ? 1.0933 1.1887 1.7642 0.0495  -0.0878 -0.0573 65  GLU A OE1 
437  O OE2 . GLU A 65  ? 0.7895 0.8844 1.4407 0.0463  -0.1200 -0.0343 65  GLU A OE2 
438  N N   . GLU A 66  ? 0.2968 0.4214 0.8890 0.0240  -0.0240 -0.0971 66  GLU A N   
439  C CA  . GLU A 66  ? 0.2963 0.4282 0.8704 0.0170  -0.0105 -0.1041 66  GLU A CA  
440  C C   . GLU A 66  ? 0.3682 0.4918 0.8995 0.0120  -0.0010 -0.1044 66  GLU A C   
441  O O   . GLU A 66  ? 0.3361 0.4603 0.8409 0.0066  0.0005  -0.1016 66  GLU A O   
442  C CB  . GLU A 66  ? 0.3094 0.4547 0.9175 0.0165  0.0042  -0.1183 66  GLU A CB  
443  C CG  . GLU A 66  ? 0.4224 0.5784 1.0739 0.0209  -0.0061 -0.1176 66  GLU A CG  
444  C CD  . GLU A 66  ? 0.7343 0.8963 1.3801 0.0178  -0.0175 -0.1103 66  GLU A CD  
445  O OE1 . GLU A 66  ? 0.7299 0.8943 1.3511 0.0108  -0.0090 -0.1125 66  GLU A OE1 
446  O OE2 . GLU A 66  ? 0.6562 0.8207 1.3230 0.0221  -0.0353 -0.1022 66  GLU A OE2 
447  N N   . MET A 67  ? 0.3705 0.4860 0.8960 0.0136  0.0046  -0.1074 67  MET A N   
448  C CA  . MET A 67  ? 0.3892 0.4972 0.8765 0.0092  0.0121  -0.1074 67  MET A CA  
449  C C   . MET A 67  ? 0.4106 0.5099 0.8655 0.0080  -0.0008 -0.0942 67  MET A C   
450  O O   . MET A 67  ? 0.3787 0.4765 0.8031 0.0032  0.0041  -0.0930 67  MET A O   
451  C CB  . MET A 67  ? 0.4435 0.5449 0.9364 0.0116  0.0180  -0.1130 67  MET A CB  
452  C CG  . MET A 67  ? 0.5215 0.6169 0.9783 0.0068  0.0259  -0.1144 67  MET A CG  
453  S SD  . MET A 67  ? 0.6050 0.7100 1.0464 -0.0015 0.0454  -0.1260 67  MET A SD  
454  C CE  . MET A 67  ? 0.5701 0.6770 1.0359 -0.0013 0.0595  -0.1416 67  MET A CE  
455  N N   . MET A 68  ? 0.3751 0.4689 0.8378 0.0121  -0.0170 -0.0844 68  MET A N   
456  C CA  . MET A 68  ? 0.3742 0.4600 0.8090 0.0102  -0.0295 -0.0726 68  MET A CA  
457  C C   . MET A 68  ? 0.3916 0.4837 0.8150 0.0057  -0.0307 -0.0710 68  MET A C   
458  O O   . MET A 68  ? 0.4005 0.4875 0.7929 0.0017  -0.0306 -0.0670 68  MET A O   
459  C CB  . MET A 68  ? 0.4195 0.4989 0.8670 0.0144  -0.0466 -0.0627 68  MET A CB  
460  C CG  . MET A 68  ? 0.4852 0.5543 0.9004 0.0114  -0.0578 -0.0513 68  MET A CG  
461  S SD  . MET A 68  ? 0.5563 0.6140 0.9379 0.0089  -0.0493 -0.0517 68  MET A SD  
462  C CE  . MET A 68  ? 0.5319 0.5762 0.9100 0.0106  -0.0644 -0.0397 68  MET A CE  
463  N N   . LYS A 69  ? 0.3193 0.4225 0.7691 0.0061  -0.0309 -0.0748 69  LYS A N   
464  C CA  . LYS A 69  ? 0.2981 0.4077 0.7408 0.0013  -0.0311 -0.0745 69  LYS A CA  
465  C C   . LYS A 69  ? 0.3249 0.4347 0.7445 -0.0036 -0.0158 -0.0797 69  LYS A C   
466  O O   . LYS A 69  ? 0.3178 0.4251 0.7146 -0.0078 -0.0167 -0.0759 69  LYS A O   
467  C CB  . LYS A 69  ? 0.3199 0.4424 0.7994 0.0026  -0.0328 -0.0789 69  LYS A CB  
468  C CG  . LYS A 69  ? 0.4039 0.5272 0.8997 0.0054  -0.0521 -0.0705 69  LYS A CG  
469  C CD  . LYS A 69  ? 0.4474 0.5852 0.9795 0.0060  -0.0544 -0.0750 69  LYS A CD  
470  C CE  . LYS A 69  ? 0.4608 0.6026 1.0329 0.0133  -0.0621 -0.0749 69  LYS A CE  
471  N NZ  . LYS A 69  ? 0.5861 0.7436 1.1965 0.0139  -0.0644 -0.0797 69  LYS A NZ  
472  N N   . ARG A 70  ? 0.2552 0.3672 0.6799 -0.0035 -0.0021 -0.0880 70  ARG A N   
473  C CA  . ARG A 70  ? 0.2346 0.3468 0.6367 -0.0085 0.0114  -0.0920 70  ARG A CA  
474  C C   . ARG A 70  ? 0.2751 0.3765 0.6428 -0.0095 0.0084  -0.0851 70  ARG A C   
475  O O   . ARG A 70  ? 0.2618 0.3615 0.6076 -0.0134 0.0108  -0.0821 70  ARG A O   
476  C CB  . ARG A 70  ? 0.2060 0.3234 0.6209 -0.0091 0.0259  -0.1029 70  ARG A CB  
477  C CG  . ARG A 70  ? 0.2597 0.3788 0.6519 -0.0157 0.0393  -0.1064 70  ARG A CG  
478  C CD  . ARG A 70  ? 0.2837 0.4062 0.6799 -0.0178 0.0533  -0.1169 70  ARG A CD  
479  N NE  . ARG A 70  ? 0.3726 0.4946 0.7389 -0.0245 0.0626  -0.1168 70  ARG A NE  
480  C CZ  . ARG A 70  ? 0.5583 0.6829 0.9172 -0.0291 0.0751  -0.1249 70  ARG A CZ  
481  N NH1 . ARG A 70  ? 0.5011 0.6288 0.8815 -0.0276 0.0814  -0.1352 70  ARG A NH1 
482  N NH2 . ARG A 70  ? 0.2900 0.4140 0.6205 -0.0354 0.0812  -0.1227 70  ARG A NH2 
483  N N   . ALA A 71  ? 0.2338 0.3279 0.5991 -0.0059 0.0031  -0.0827 71  ALA A N   
484  C CA  . ALA A 71  ? 0.2195 0.3039 0.5564 -0.0066 0.0004  -0.0772 71  ALA A CA  
485  C C   . ALA A 71  ? 0.2638 0.3432 0.5819 -0.0084 -0.0089 -0.0687 71  ALA A C   
486  O O   . ALA A 71  ? 0.2669 0.3414 0.5604 -0.0107 -0.0067 -0.0660 71  ALA A O   
487  C CB  . ALA A 71  ? 0.2276 0.3053 0.5711 -0.0026 -0.0042 -0.0762 71  ALA A CB  
488  N N   . LEU A 72  ? 0.2036 0.2846 0.5339 -0.0078 -0.0191 -0.0649 72  LEU A N   
489  C CA  . LEU A 72  ? 0.1943 0.2707 0.5078 -0.0105 -0.0281 -0.0581 72  LEU A CA  
490  C C   . LEU A 72  ? 0.2532 0.3345 0.5624 -0.0147 -0.0239 -0.0597 72  LEU A C   
491  O O   . LEU A 72  ? 0.2648 0.3427 0.5611 -0.0178 -0.0298 -0.0557 72  LEU A O   
492  C CB  . LEU A 72  ? 0.1982 0.2737 0.5251 -0.0088 -0.0429 -0.0526 72  LEU A CB  
493  C CG  . LEU A 72  ? 0.2604 0.3281 0.5892 -0.0053 -0.0501 -0.0481 72  LEU A CG  
494  C CD1 . LEU A 72  ? 0.2703 0.3374 0.6106 -0.0046 -0.0663 -0.0407 72  LEU A CD1 
495  C CD2 . LEU A 72  ? 0.2881 0.3455 0.5871 -0.0074 -0.0484 -0.0448 72  LEU A CD2 
496  N N   . GLN A 73  ? 0.2048 0.2935 0.5243 -0.0156 -0.0129 -0.0659 73  GLN A N   
497  C CA  . GLN A 73  ? 0.1920 0.2851 0.5103 -0.0198 -0.0072 -0.0677 73  GLN A CA  
498  C C   . GLN A 73  ? 0.2161 0.3065 0.5139 -0.0226 0.0038  -0.0681 73  GLN A C   
499  O O   . GLN A 73  ? 0.2146 0.3028 0.5039 -0.0212 0.0086  -0.0691 73  GLN A O   
500  C CB  . GLN A 73  ? 0.1992 0.3035 0.5469 -0.0198 -0.0033 -0.0739 73  GLN A CB  
501  C CG  . GLN A 73  ? 0.2120 0.3219 0.5634 -0.0248 0.0028  -0.0763 73  GLN A CG  
502  C CD  . GLN A 73  ? 0.3975 0.5048 0.7423 -0.0277 -0.0061 -0.0720 73  GLN A CD  
503  O OE1 . GLN A 73  ? 0.4399 0.5390 0.7612 -0.0298 -0.0065 -0.0680 73  GLN A OE1 
504  N NE2 . GLN A 73  ? 0.1195 0.2343 0.4860 -0.0282 -0.0133 -0.0734 73  GLN A NE2 
505  N N   . TYR A 74  ? 0.1546 0.2449 0.4454 -0.0267 0.0073  -0.0670 74  TYR A N   
506  C CA  . TYR A 74  ? 0.1549 0.2427 0.4289 -0.0295 0.0167  -0.0658 74  TYR A CA  
507  C C   . TYR A 74  ? 0.2277 0.3214 0.5065 -0.0306 0.0276  -0.0708 74  TYR A C   
508  O O   . TYR A 74  ? 0.2056 0.3070 0.5052 -0.0303 0.0305  -0.0766 74  TYR A O   
509  C CB  . TYR A 74  ? 0.1675 0.2547 0.4404 -0.0339 0.0190  -0.0644 74  TYR A CB  
510  C CG  . TYR A 74  ? 0.2074 0.2877 0.4710 -0.0347 0.0113  -0.0606 74  TYR A CG  
511  C CD1 . TYR A 74  ? 0.2447 0.3166 0.4886 -0.0339 0.0103  -0.0565 74  TYR A CD1 
512  C CD2 . TYR A 74  ? 0.2098 0.2925 0.4844 -0.0373 0.0062  -0.0620 74  TYR A CD2 
513  C CE1 . TYR A 74  ? 0.2500 0.3156 0.4857 -0.0356 0.0052  -0.0547 74  TYR A CE1 
514  C CE2 . TYR A 74  ? 0.2182 0.2946 0.4828 -0.0396 0.0005  -0.0599 74  TYR A CE2 
515  C CZ  . TYR A 74  ? 0.2937 0.3613 0.5388 -0.0388 0.0006  -0.0567 74  TYR A CZ  
516  O OH  . TYR A 74  ? 0.2031 0.2644 0.4388 -0.0417 -0.0034 -0.0562 74  TYR A OH  
517  N N   . SER A 75  ? 0.2150 0.3059 0.4751 -0.0323 0.0337  -0.0687 75  SER A N   
518  C CA  . SER A 75  ? 0.2296 0.3256 0.4883 -0.0351 0.0442  -0.0731 75  SER A CA  
519  C C   . SER A 75  ? 0.2949 0.3881 0.5328 -0.0395 0.0500  -0.0679 75  SER A C   
520  O O   . SER A 75  ? 0.2685 0.3549 0.4948 -0.0386 0.0452  -0.0612 75  SER A O   
521  C CB  . SER A 75  ? 0.2726 0.3691 0.5315 -0.0320 0.0438  -0.0769 75  SER A CB  
522  O OG  . SER A 75  ? 0.3185 0.4078 0.5622 -0.0291 0.0368  -0.0717 75  SER A OG  
523  N N   . PRO A 76  ? 0.2675 0.3655 0.5008 -0.0446 0.0603  -0.0708 76  PRO A N   
524  C CA  . PRO A 76  ? 0.2590 0.3539 0.4721 -0.0492 0.0643  -0.0640 76  PRO A CA  
525  C C   . PRO A 76  ? 0.2970 0.3857 0.4911 -0.0467 0.0582  -0.0567 76  PRO A C   
526  O O   . PRO A 76  ? 0.2773 0.3663 0.4688 -0.0434 0.0547  -0.0590 76  PRO A O   
527  C CB  . PRO A 76  ? 0.2837 0.3855 0.4936 -0.0557 0.0757  -0.0696 76  PRO A CB  
528  C CG  . PRO A 76  ? 0.3327 0.4415 0.5666 -0.0550 0.0796  -0.0798 76  PRO A CG  
529  C CD  . PRO A 76  ? 0.2745 0.3809 0.5208 -0.0471 0.0690  -0.0805 76  PRO A CD  
530  N N   . SER A 77  ? 0.2677 0.3510 0.4505 -0.0483 0.0574  -0.0481 77  SER A N   
531  C CA  . SER A 77  ? 0.2693 0.3472 0.4374 -0.0460 0.0518  -0.0404 77  SER A CA  
532  C C   . SER A 77  ? 0.3640 0.4458 0.5185 -0.0473 0.0525  -0.0407 77  SER A C   
533  O O   . SER A 77  ? 0.3695 0.4493 0.5191 -0.0433 0.0464  -0.0390 77  SER A O   
534  C CB  . SER A 77  ? 0.2841 0.3561 0.4455 -0.0484 0.0525  -0.0312 77  SER A CB  
535  O OG  . SER A 77  ? 0.3158 0.3828 0.4886 -0.0467 0.0504  -0.0310 77  SER A OG  
536  N N   . ALA A 78  ? 0.3473 0.4348 0.4954 -0.0536 0.0602  -0.0434 78  ALA A N   
537  C CA  . ALA A 78  ? 0.3631 0.4554 0.4964 -0.0570 0.0618  -0.0446 78  ALA A CA  
538  C C   . ALA A 78  ? 0.4105 0.5070 0.5509 -0.0546 0.0622  -0.0549 78  ALA A C   
539  O O   . ALA A 78  ? 0.4107 0.5101 0.5396 -0.0564 0.0617  -0.0563 78  ALA A O   
540  C CB  . ALA A 78  ? 0.3885 0.4852 0.5109 -0.0662 0.0709  -0.0445 78  ALA A CB  
541  N N   . GLY A 79  ? 0.3522 0.4488 0.5120 -0.0510 0.0627  -0.0617 79  GLY A N   
542  C CA  . GLY A 79  ? 0.3358 0.4349 0.5065 -0.0482 0.0630  -0.0709 79  GLY A CA  
543  C C   . GLY A 79  ? 0.3678 0.4722 0.5568 -0.0501 0.0710  -0.0805 79  GLY A C   
544  O O   . GLY A 79  ? 0.3763 0.4838 0.5666 -0.0551 0.0779  -0.0809 79  GLY A O   
545  N N   . ILE A 80  ? 0.2792 0.3845 0.4844 -0.0461 0.0702  -0.0882 80  ILE A N   
546  C CA  . ILE A 80  ? 0.2578 0.3688 0.4854 -0.0470 0.0777  -0.0984 80  ILE A CA  
547  C C   . ILE A 80  ? 0.2960 0.4139 0.5156 -0.0554 0.0907  -0.1068 80  ILE A C   
548  O O   . ILE A 80  ? 0.2809 0.3988 0.4822 -0.0584 0.0916  -0.1072 80  ILE A O   
549  C CB  . ILE A 80  ? 0.2894 0.3986 0.5387 -0.0400 0.0722  -0.1030 80  ILE A CB  
550  C CG1 . ILE A 80  ? 0.3061 0.4124 0.5469 -0.0388 0.0708  -0.1056 80  ILE A CG1 
551  C CG2 . ILE A 80  ? 0.2798 0.3834 0.5357 -0.0340 0.0603  -0.0948 80  ILE A CG2 
552  C CD1 . ILE A 80  ? 0.3341 0.4394 0.5975 -0.0343 0.0705  -0.1133 80  ILE A CD1 
553  N N   . PRO A 81  ? 0.2571 0.3813 0.4883 -0.0603 0.1011  -0.1134 81  PRO A N   
554  C CA  . PRO A 81  ? 0.2635 0.3941 0.4835 -0.0702 0.1147  -0.1215 81  PRO A CA  
555  C C   . PRO A 81  ? 0.3240 0.4570 0.5429 -0.0720 0.1198  -0.1321 81  PRO A C   
556  O O   . PRO A 81  ? 0.3476 0.4828 0.5424 -0.0799 0.1247  -0.1331 81  PRO A O   
557  C CB  . PRO A 81  ? 0.2748 0.4118 0.5149 -0.0739 0.1251  -0.1286 81  PRO A CB  
558  C CG  . PRO A 81  ? 0.3148 0.4499 0.5811 -0.0649 0.1164  -0.1266 81  PRO A CG  
559  C CD  . PRO A 81  ? 0.2597 0.3861 0.5135 -0.0584 0.1015  -0.1140 81  PRO A CD  
560  N N   . GLU A 82  ? 0.2504 0.3826 0.4949 -0.0650 0.1180  -0.1394 82  GLU A N   
561  C CA  . GLU A 82  ? 0.2514 0.3845 0.4996 -0.0660 0.1230  -0.1504 82  GLU A CA  
562  C C   . GLU A 82  ? 0.3516 0.4802 0.5750 -0.0661 0.1157  -0.1447 82  GLU A C   
563  O O   . GLU A 82  ? 0.3724 0.5042 0.5847 -0.0725 0.1229  -0.1530 82  GLU A O   
564  C CB  . GLU A 82  ? 0.2554 0.3875 0.5395 -0.0580 0.1221  -0.1581 82  GLU A CB  
565  C CG  . GLU A 82  ? 0.3793 0.5048 0.6768 -0.0476 0.1070  -0.1476 82  GLU A CG  
566  C CD  . GLU A 82  ? 0.6376 0.7665 0.9543 -0.0453 0.1055  -0.1450 82  GLU A CD  
567  O OE1 . GLU A 82  ? 0.5685 0.6977 0.8696 -0.0483 0.1039  -0.1369 82  GLU A OE1 
568  O OE2 . GLU A 82  ? 0.4994 0.6303 0.8483 -0.0402 0.1052  -0.1506 82  GLU A OE2 
569  N N   . LEU A 83  ? 0.3118 0.4339 0.5264 -0.0599 0.1021  -0.1313 83  LEU A N   
570  C CA  . LEU A 83  ? 0.3107 0.4294 0.5036 -0.0599 0.0948  -0.1252 83  LEU A CA  
571  C C   . LEU A 83  ? 0.4018 0.5247 0.5658 -0.0688 0.0979  -0.1212 83  LEU A C   
572  O O   . LEU A 83  ? 0.4265 0.5521 0.5753 -0.0739 0.0996  -0.1250 83  LEU A O   
573  C CB  . LEU A 83  ? 0.2930 0.4040 0.4862 -0.0515 0.0810  -0.1132 83  LEU A CB  
574  C CG  . LEU A 83  ? 0.3358 0.4427 0.5153 -0.0494 0.0730  -0.1086 83  LEU A CG  
575  C CD1 . LEU A 83  ? 0.3262 0.4332 0.5118 -0.0503 0.0769  -0.1193 83  LEU A CD1 
576  C CD2 . LEU A 83  ? 0.3347 0.4339 0.5193 -0.0416 0.0618  -0.0993 83  LEU A CD2 
577  N N   . LEU A 84  ? 0.3601 0.4839 0.5171 -0.0715 0.0986  -0.1136 84  LEU A N   
578  C CA  . LEU A 84  ? 0.3722 0.4991 0.5023 -0.0802 0.1007  -0.1073 84  LEU A CA  
579  C C   . LEU A 84  ? 0.4439 0.5783 0.5623 -0.0915 0.1131  -0.1184 84  LEU A C   
580  O O   . LEU A 84  ? 0.4727 0.6098 0.5666 -0.0981 0.1114  -0.1153 84  LEU A O   
581  C CB  . LEU A 84  ? 0.3764 0.5013 0.5053 -0.0809 0.1004  -0.0979 84  LEU A CB  
582  C CG  . LEU A 84  ? 0.4354 0.5529 0.5638 -0.0732 0.0880  -0.0843 84  LEU A CG  
583  C CD1 . LEU A 84  ? 0.4401 0.5554 0.5736 -0.0740 0.0899  -0.0785 84  LEU A CD1 
584  C CD2 . LEU A 84  ? 0.4923 0.6085 0.5975 -0.0746 0.0802  -0.0741 84  LEU A CD2 
585  N N   . SER A 85  ? 0.3921 0.5306 0.5287 -0.0942 0.1253  -0.1317 85  SER A N   
586  C CA  . SER A 85  ? 0.4222 0.5680 0.5490 -0.1060 0.1393  -0.1448 85  SER A CA  
587  C C   . SER A 85  ? 0.4992 0.6463 0.6206 -0.1075 0.1393  -0.1535 85  SER A C   
588  O O   . SER A 85  ? 0.5169 0.6692 0.6144 -0.1186 0.1445  -0.1576 85  SER A O   
589  C CB  . SER A 85  ? 0.4704 0.6204 0.6223 -0.1080 0.1532  -0.1582 85  SER A CB  
590  O OG  . SER A 85  ? 0.6158 0.7629 0.8011 -0.0968 0.1500  -0.1634 85  SER A OG  
591  N N   . TRP A 86  ? 0.4395 0.5816 0.5817 -0.0972 0.1328  -0.1558 86  TRP A N   
592  C CA  . TRP A 86  ? 0.4471 0.5888 0.5879 -0.0976 0.1324  -0.1640 86  TRP A CA  
593  C C   . TRP A 86  ? 0.5285 0.6709 0.6399 -0.1009 0.1227  -0.1543 86  TRP A C   
594  O O   . TRP A 86  ? 0.5415 0.6885 0.6378 -0.1091 0.1266  -0.1621 86  TRP A O   
595  C CB  . TRP A 86  ? 0.4113 0.5456 0.5803 -0.0853 0.1258  -0.1648 86  TRP A CB  
596  C CG  . TRP A 86  ? 0.4251 0.5585 0.6029 -0.0861 0.1303  -0.1778 86  TRP A CG  
597  C CD1 . TRP A 86  ? 0.4626 0.5966 0.6654 -0.0864 0.1415  -0.1933 86  TRP A CD1 
598  C CD2 . TRP A 86  ? 0.4237 0.5551 0.5879 -0.0868 0.1240  -0.1769 86  TRP A CD2 
599  N NE1 . TRP A 86  ? 0.4531 0.5847 0.6584 -0.0872 0.1428  -0.2021 86  TRP A NE1 
600  C CE2 . TRP A 86  ? 0.4706 0.6007 0.6519 -0.0877 0.1321  -0.1923 86  TRP A CE2 
601  C CE3 . TRP A 86  ? 0.4354 0.5659 0.5777 -0.0862 0.1122  -0.1647 86  TRP A CE3 
602  C CZ2 . TRP A 86  ? 0.4635 0.5911 0.6383 -0.0890 0.1292  -0.1959 86  TRP A CZ2 
603  C CZ3 . TRP A 86  ? 0.4521 0.5816 0.5886 -0.0875 0.1091  -0.1685 86  TRP A CZ3 
604  C CH2 . TRP A 86  ? 0.4657 0.5938 0.6172 -0.0894 0.1177  -0.1841 86  TRP A CH2 
605  N N   . LEU A 87  ? 0.4737 0.6118 0.5786 -0.0946 0.1102  -0.1379 87  LEU A N   
606  C CA  . LEU A 87  ? 0.4738 0.6125 0.5557 -0.0960 0.0996  -0.1269 87  LEU A CA  
607  C C   . LEU A 87  ? 0.5564 0.7023 0.6097 -0.1083 0.1029  -0.1239 87  LEU A C   
608  O O   . LEU A 87  ? 0.5501 0.7005 0.5846 -0.1140 0.0990  -0.1236 87  LEU A O   
609  C CB  . LEU A 87  ? 0.4545 0.5865 0.5413 -0.0858 0.0870  -0.1117 87  LEU A CB  
610  C CG  . LEU A 87  ? 0.4891 0.6140 0.5976 -0.0750 0.0813  -0.1130 87  LEU A CG  
611  C CD1 . LEU A 87  ? 0.5042 0.6227 0.6172 -0.0668 0.0716  -0.0998 87  LEU A CD1 
612  C CD2 . LEU A 87  ? 0.4801 0.6052 0.5849 -0.0750 0.0776  -0.1173 87  LEU A CD2 
613  N N   . LYS A 88  ? 0.5383 0.6856 0.5882 -0.1135 0.1104  -0.1225 88  LYS A N   
614  C CA  . LYS A 88  ? 0.5674 0.7206 0.5893 -0.1267 0.1151  -0.1194 88  LYS A CA  
615  C C   . LYS A 88  ? 0.6430 0.8040 0.6511 -0.1386 0.1243  -0.1344 88  LYS A C   
616  O O   . LYS A 88  ? 0.6544 0.8206 0.6346 -0.1481 0.1206  -0.1300 88  LYS A O   
617  C CB  . LYS A 88  ? 0.6076 0.7604 0.6345 -0.1304 0.1252  -0.1198 88  LYS A CB  
618  C CG  . LYS A 88  ? 0.8578 1.0049 0.8812 -0.1260 0.1167  -0.1018 88  LYS A CG  
619  C CD  . LYS A 88  ? 1.0005 1.1483 1.0242 -0.1328 0.1281  -0.1026 88  LYS A CD  
620  C CE  . LYS A 88  ? 1.1844 1.3359 1.1750 -0.1475 0.1318  -0.0963 88  LYS A CE  
621  N NZ  . LYS A 88  ? 1.3300 1.4758 1.3054 -0.1454 0.1188  -0.0752 88  LYS A NZ  
622  N N   . GLN A 89  ? 0.5931 0.7548 0.6223 -0.1382 0.1359  -0.1521 89  GLN A N   
623  C CA  . GLN A 89  ? 0.6010 0.7690 0.6235 -0.1489 0.1474  -0.1700 89  GLN A CA  
624  C C   . GLN A 89  ? 0.6540 0.8231 0.6671 -0.1485 0.1382  -0.1705 89  GLN A C   
625  O O   . GLN A 89  ? 0.6892 0.8654 0.6805 -0.1611 0.1426  -0.1785 89  GLN A O   
626  C CB  . GLN A 89  ? 0.6071 0.7736 0.6622 -0.1452 0.1605  -0.1875 89  GLN A CB  
627  C CG  . GLN A 89  ? 0.7697 0.9385 0.8334 -0.1496 0.1737  -0.1924 89  GLN A CG  
628  C CD  . GLN A 89  ? 1.0513 1.2248 1.1295 -0.1569 0.1922  -0.2155 89  GLN A CD  
629  O OE1 . GLN A 89  ? 1.0456 1.2242 1.1060 -0.1683 0.1991  -0.2268 89  GLN A OE1 
630  N NE2 . GLN A 89  ? 0.9047 1.0770 1.0171 -0.1506 0.2005  -0.2239 89  GLN A NE2 
631  N N   . LEU A 90  ? 0.5514 0.7140 0.5803 -0.1352 0.1260  -0.1626 90  LEU A N   
632  C CA  . LEU A 90  ? 0.5291 0.6925 0.5519 -0.1339 0.1167  -0.1621 90  LEU A CA  
633  C C   . LEU A 90  ? 0.5476 0.7171 0.5390 -0.1409 0.1063  -0.1491 90  LEU A C   
634  O O   . LEU A 90  ? 0.5297 0.7059 0.5043 -0.1499 0.1055  -0.1548 90  LEU A O   
635  C CB  . LEU A 90  ? 0.5058 0.6602 0.5519 -0.1187 0.1068  -0.1556 90  LEU A CB  
636  C CG  . LEU A 90  ? 0.5680 0.7222 0.6135 -0.1168 0.0993  -0.1574 90  LEU A CG  
637  C CD1 . LEU A 90  ? 0.5772 0.7311 0.6351 -0.1205 0.1102  -0.1768 90  LEU A CD1 
638  C CD2 . LEU A 90  ? 0.5732 0.7192 0.6340 -0.1034 0.0880  -0.1463 90  LEU A CD2 
639  N N   . GLN A 91  ? 0.4946 0.6619 0.4790 -0.1375 0.0987  -0.1319 91  GLN A N   
640  C CA  . GLN A 91  ? 0.4895 0.6614 0.4476 -0.1428 0.0876  -0.1165 91  GLN A CA  
641  C C   . GLN A 91  ? 0.5705 0.7514 0.4995 -0.1602 0.0948  -0.1221 91  GLN A C   
642  O O   . GLN A 91  ? 0.5921 0.7799 0.4988 -0.1673 0.0860  -0.1165 91  GLN A O   
643  C CB  . GLN A 91  ? 0.4886 0.6545 0.4490 -0.1359 0.0809  -0.0987 91  GLN A CB  
644  C CG  . GLN A 91  ? 0.4954 0.6528 0.4802 -0.1201 0.0725  -0.0917 91  GLN A CG  
645  C CD  . GLN A 91  ? 0.7401 0.8988 0.7251 -0.1151 0.0600  -0.0867 91  GLN A CD  
646  O OE1 . GLN A 91  ? 0.7313 0.8917 0.7064 -0.1141 0.0487  -0.0725 91  GLN A OE1 
647  N NE2 . GLN A 91  ? 0.6437 0.8015 0.6427 -0.1114 0.0618  -0.0980 91  GLN A NE2 
648  N N   . ILE A 92  ? 0.5238 0.7053 0.4535 -0.1676 0.1108  -0.1338 92  ILE A N   
649  C CA  . ILE A 92  ? 0.5536 0.7435 0.4553 -0.1858 0.1207  -0.1419 92  ILE A CA  
650  C C   . ILE A 92  ? 0.6380 0.8349 0.5329 -0.1940 0.1245  -0.1587 92  ILE A C   
651  O O   . ILE A 92  ? 0.6543 0.8594 0.5190 -0.2069 0.1204  -0.1568 92  ILE A O   
652  C CB  . ILE A 92  ? 0.5963 0.7851 0.5030 -0.1915 0.1381  -0.1505 92  ILE A CB  
653  C CG1 . ILE A 92  ? 0.6009 0.7844 0.5039 -0.1879 0.1329  -0.1316 92  ILE A CG1 
654  C CG2 . ILE A 92  ? 0.6422 0.8397 0.5221 -0.2116 0.1520  -0.1641 92  ILE A CG2 
655  C CD1 . ILE A 92  ? 0.6754 0.8558 0.5952 -0.1877 0.1473  -0.1379 92  ILE A CD1 
656  N N   . LYS A 93  ? 0.5906 0.7841 0.5131 -0.1870 0.1313  -0.1744 93  LYS A N   
657  C CA  . LYS A 93  ? 0.6020 0.8007 0.5203 -0.1948 0.1358  -0.1912 93  LYS A CA  
658  C C   . LYS A 93  ? 0.6608 0.8631 0.5686 -0.1932 0.1193  -0.1827 93  LYS A C   
659  O O   . LYS A 93  ? 0.6931 0.9035 0.5833 -0.2050 0.1202  -0.1921 93  LYS A O   
660  C CB  . LYS A 93  ? 0.6294 0.8223 0.5817 -0.1879 0.1478  -0.2097 93  LYS A CB  
661  C CG  . LYS A 93  ? 1.0899 1.2852 1.0459 -0.1979 0.1686  -0.2282 93  LYS A CG  
662  C CD  . LYS A 93  ? 1.3050 1.4941 1.2988 -0.1900 0.1797  -0.2458 93  LYS A CD  
663  C CE  . LYS A 93  ? 1.5285 1.7192 1.5344 -0.1962 0.1997  -0.2613 93  LYS A CE  
664  N NZ  . LYS A 93  ? 1.6133 1.8003 1.6319 -0.1878 0.1986  -0.2493 93  LYS A NZ  
665  N N   . LEU A 94  ? 0.5887 0.7857 0.5077 -0.1794 0.1047  -0.1657 94  LEU A N   
666  C CA  . LEU A 94  ? 0.5705 0.7708 0.4852 -0.1760 0.0891  -0.1571 94  LEU A CA  
667  C C   . LEU A 94  ? 0.6600 0.8679 0.5459 -0.1828 0.0758  -0.1398 94  LEU A C   
668  O O   . LEU A 94  ? 0.6756 0.8922 0.5474 -0.1890 0.0669  -0.1391 94  LEU A O   
669  C CB  . LEU A 94  ? 0.5273 0.7177 0.4708 -0.1577 0.0811  -0.1489 94  LEU A CB  
670  C CG  . LEU A 94  ? 0.5541 0.7388 0.5228 -0.1509 0.0855  -0.1625 94  LEU A CG  
671  C CD1 . LEU A 94  ? 0.5531 0.7356 0.5328 -0.1557 0.1031  -0.1822 94  LEU A CD1 
672  C CD2 . LEU A 94  ? 0.5555 0.7297 0.5489 -0.1347 0.0793  -0.1530 94  LEU A CD2 
673  N N   . HIS A 95  ? 0.6248 0.8298 0.5034 -0.1816 0.0740  -0.1255 95  HIS A N   
674  C CA  . HIS A 95  ? 0.6457 0.8558 0.5005 -0.1862 0.0599  -0.1062 95  HIS A CA  
675  C C   . HIS A 95  ? 0.7411 0.9552 0.5661 -0.2011 0.0652  -0.1022 95  HIS A C   
676  O O   . HIS A 95  ? 0.7542 0.9742 0.5554 -0.2079 0.0528  -0.0875 95  HIS A O   
677  C CB  . HIS A 95  ? 0.6395 0.8421 0.5116 -0.1703 0.0471  -0.0870 95  HIS A CB  
678  C CG  . HIS A 95  ? 0.6612 0.8584 0.5625 -0.1560 0.0439  -0.0911 95  HIS A CG  
679  N ND1 . HIS A 95  ? 0.6647 0.8511 0.5915 -0.1441 0.0497  -0.0929 95  HIS A ND1 
680  C CD2 . HIS A 95  ? 0.6805 0.8821 0.5880 -0.1534 0.0360  -0.0941 95  HIS A CD2 
681  C CE1 . HIS A 95  ? 0.6400 0.8239 0.5856 -0.1348 0.0449  -0.0959 95  HIS A CE1 
682  N NE2 . HIS A 95  ? 0.6515 0.8441 0.5870 -0.1399 0.0371  -0.0969 95  HIS A NE2 
683  N N   . ASN A 96  ? 0.7194 0.9304 0.5457 -0.2067 0.0833  -0.1148 96  ASN A N   
684  C CA  . ASN A 96  ? 0.7493 0.9631 0.5478 -0.2219 0.0916  -0.1126 96  ASN A CA  
685  C C   . ASN A 96  ? 0.8197 1.0327 0.5991 -0.2222 0.0756  -0.0864 96  ASN A C   
686  O O   . ASN A 96  ? 0.8466 1.0678 0.5950 -0.2350 0.0673  -0.0788 96  ASN A O   
687  C CB  . ASN A 96  ? 0.7918 1.0160 0.5642 -0.2414 0.1015  -0.1299 96  ASN A CB  
688  C CG  . ASN A 96  ? 1.1711 1.3979 0.9150 -0.2590 0.1143  -0.1321 96  ASN A CG  
689  O OD1 . ASN A 96  ? 1.0931 1.3134 0.8448 -0.2567 0.1234  -0.1291 96  ASN A OD1 
690  N ND2 . ASN A 96  ? 1.0721 1.3091 0.7817 -0.2782 0.1159  -0.1381 96  ASN A ND2 
691  N N   . PRO A 97  ? 0.7545 0.9578 0.5542 -0.2075 0.0693  -0.0718 97  PRO A N   
692  C CA  . PRO A 97  ? 0.7565 0.9578 0.5428 -0.2063 0.0538  -0.0468 97  PRO A CA  
693  C C   . PRO A 97  ? 0.8222 1.0241 0.5771 -0.2221 0.0592  -0.0392 97  PRO A C   
694  O O   . PRO A 97  ? 0.8090 1.0085 0.5635 -0.2283 0.0766  -0.0505 97  PRO A O   
695  C CB  . PRO A 97  ? 0.7534 0.9431 0.5716 -0.1878 0.0506  -0.0381 97  PRO A CB  
696  C CG  . PRO A 97  ? 0.7847 0.9721 0.6317 -0.1783 0.0595  -0.0568 97  PRO A CG  
697  C CD  . PRO A 97  ? 0.7471 0.9407 0.5826 -0.1918 0.0756  -0.0771 97  PRO A CD  
698  N N   . PRO A 98  ? 0.8124 1.0178 0.5414 -0.2292 0.0444  -0.0197 98  PRO A N   
699  C CA  . PRO A 98  ? 0.8450 1.0501 0.5410 -0.2456 0.0489  -0.0105 98  PRO A CA  
700  C C   . PRO A 98  ? 0.8983 1.0911 0.6054 -0.2407 0.0570  -0.0025 98  PRO A C   
701  O O   . PRO A 98  ? 0.9205 1.1124 0.6072 -0.2546 0.0697  -0.0045 98  PRO A O   
702  C CB  . PRO A 98  ? 0.8871 1.0969 0.5607 -0.2497 0.0268  0.0124  98  PRO A CB  
703  C CG  . PRO A 98  ? 0.9219 1.1392 0.6103 -0.2411 0.0148  0.0077  98  PRO A CG  
704  C CD  . PRO A 98  ? 0.8288 1.0389 0.5577 -0.2233 0.0226  -0.0046 98  PRO A CD  
705  N N   . THR A 99  ? 0.8378 1.0216 0.5776 -0.2218 0.0507  0.0052  99  THR A N   
706  C CA  . THR A 99  ? 0.8355 1.0071 0.5903 -0.2147 0.0552  0.0143  99  THR A CA  
707  C C   . THR A 99  ? 0.8939 1.0618 0.6657 -0.2144 0.0760  -0.0034 99  THR A C   
708  O O   . THR A 99  ? 0.8824 1.0411 0.6642 -0.2106 0.0799  0.0043  99  THR A O   
709  C CB  . THR A 99  ? 0.9011 1.0652 0.6831 -0.1958 0.0400  0.0288  99  THR A CB  
710  O OG1 . THR A 99  ? 0.8658 1.0311 0.6766 -0.1829 0.0413  0.0139  99  THR A OG1 
711  C CG2 . THR A 99  ? 0.8769 1.0437 0.6447 -0.1961 0.0193  0.0496  99  THR A CG2 
712  N N   . ILE A 100 ? 0.8678 1.0427 0.6443 -0.2185 0.0891  -0.0268 100 ILE A N   
713  C CA  . ILE A 100 ? 0.8620 1.0349 0.6596 -0.2173 0.1082  -0.0451 100 ILE A CA  
714  C C   . ILE A 100 ? 0.9665 1.1350 0.7550 -0.2267 0.1208  -0.0415 100 ILE A C   
715  O O   . ILE A 100 ? 0.9495 1.1107 0.7632 -0.2172 0.1250  -0.0406 100 ILE A O   
716  C CB  . ILE A 100 ? 0.8974 1.0788 0.6992 -0.2227 0.1210  -0.0708 100 ILE A CB  
717  C CG1 . ILE A 100 ? 0.8765 1.0607 0.6926 -0.2119 0.1098  -0.0752 100 ILE A CG1 
718  C CG2 . ILE A 100 ? 0.8922 1.0713 0.7221 -0.2191 0.1393  -0.0881 100 ILE A CG2 
719  C CD1 . ILE A 100 ? 0.9599 1.1536 0.7676 -0.2220 0.1187  -0.0962 100 ILE A CD1 
720  N N   . HIS A 101 ? 0.9868 1.1600 0.7391 -0.2462 0.1269  -0.0399 101 HIS A N   
721  C CA  . HIS A 101 ? 1.0130 1.1825 0.7534 -0.2578 0.1407  -0.0377 101 HIS A CA  
722  C C   . HIS A 101 ? 1.0546 1.2161 0.7740 -0.2619 0.1302  -0.0112 101 HIS A C   
723  O O   . HIS A 101 ? 1.0863 1.2448 0.7902 -0.2744 0.1417  -0.0082 101 HIS A O   
724  C CB  . HIS A 101 ? 1.0561 1.2347 0.7774 -0.2770 0.1612  -0.0584 101 HIS A CB  
725  C CG  . HIS A 101 ? 1.0807 1.2639 0.8343 -0.2703 0.1748  -0.0846 101 HIS A CG  
726  N ND1 . HIS A 101 ? 1.0975 1.2876 0.8541 -0.2684 0.1721  -0.0981 101 HIS A ND1 
727  C CD2 . HIS A 101 ? 1.0866 1.2676 0.8730 -0.2639 0.1891  -0.0977 101 HIS A CD2 
728  C CE1 . HIS A 101 ? 1.0709 1.2620 0.8614 -0.2610 0.1852  -0.1184 101 HIS A CE1 
729  N NE2 . HIS A 101 ? 1.0668 1.2531 0.8767 -0.2578 0.1951  -0.1188 101 HIS A NE2 
730  N N   . TYR A 102 ? 0.9636 1.1207 0.6862 -0.2506 0.1091  0.0080  102 TYR A N   
731  C CA  . TYR A 102 ? 0.9653 1.1133 0.6743 -0.2511 0.0962  0.0350  102 TYR A CA  
732  C C   . TYR A 102 ? 0.9760 1.1123 0.7084 -0.2437 0.1038  0.0393  102 TYR A C   
733  O O   . TYR A 102 ? 0.9429 1.0784 0.7087 -0.2319 0.1110  0.0249  102 TYR A O   
734  C CB  . TYR A 102 ? 0.9661 1.1127 0.6861 -0.2364 0.0732  0.0500  102 TYR A CB  
735  C CG  . TYR A 102 ? 1.0100 1.1663 0.7032 -0.2440 0.0593  0.0559  102 TYR A CG  
736  C CD1 . TYR A 102 ? 1.0305 1.1854 0.7277 -0.2345 0.0375  0.0751  102 TYR A CD1 
737  C CD2 . TYR A 102 ? 1.0411 1.2090 0.7076 -0.2607 0.0683  0.0409  102 TYR A CD2 
738  C CE1 . TYR A 102 ? 1.0548 1.2201 0.7296 -0.2415 0.0236  0.0806  102 TYR A CE1 
739  C CE2 . TYR A 102 ? 1.0699 1.2476 0.7112 -0.2686 0.0550  0.0459  102 TYR A CE2 
740  C CZ  . TYR A 102 ? 1.1440 1.3209 0.7901 -0.2587 0.0320  0.0660  102 TYR A CZ  
741  O OH  . TYR A 102 ? 1.1609 1.3488 0.7843 -0.2665 0.0177  0.0711  102 TYR A OH  
742  N N   . PRO A 103 ? 0.9285 1.0553 0.6458 -0.2502 0.1016  0.0591  103 PRO A N   
743  C CA  . PRO A 103 ? 0.9005 1.0160 0.6430 -0.2424 0.1080  0.0627  103 PRO A CA  
744  C C   . PRO A 103 ? 0.9064 1.0156 0.6850 -0.2203 0.0952  0.0671  103 PRO A C   
745  O O   . PRO A 103 ? 0.8925 1.0022 0.6698 -0.2129 0.0779  0.0784  103 PRO A O   
746  C CB  . PRO A 103 ? 0.9567 1.0624 0.6726 -0.2537 0.1042  0.0864  103 PRO A CB  
747  C CG  . PRO A 103 ? 1.0518 1.1653 0.7259 -0.2706 0.1004  0.0915  103 PRO A CG  
748  C CD  . PRO A 103 ? 0.9834 1.1087 0.6614 -0.2644 0.0921  0.0801  103 PRO A CD  
749  N N   . PRO A 104 ? 0.8533 0.9577 0.6647 -0.2100 0.1033  0.0578  104 PRO A N   
750  C CA  . PRO A 104 ? 0.8234 0.9223 0.6672 -0.1903 0.0920  0.0605  104 PRO A CA  
751  C C   . PRO A 104 ? 0.8892 0.9793 0.7316 -0.1830 0.0736  0.0838  104 PRO A C   
752  O O   . PRO A 104 ? 0.8603 0.9520 0.7167 -0.1706 0.0613  0.0847  104 PRO A O   
753  C CB  . PRO A 104 ? 0.8230 0.9166 0.6937 -0.1857 0.1041  0.0516  104 PRO A CB  
754  C CG  . PRO A 104 ? 0.8919 0.9938 0.7538 -0.1988 0.1225  0.0346  104 PRO A CG  
755  C CD  . PRO A 104 ? 0.8755 0.9803 0.6968 -0.2162 0.1231  0.0433  104 PRO A CD  
756  N N   . SER A 105 ? 0.8820 0.9629 0.7075 -0.1913 0.0721  0.1026  105 SER A N   
757  C CA  . SER A 105 ? 0.8886 0.9598 0.7128 -0.1858 0.0552  0.1268  105 SER A CA  
758  C C   . SER A 105 ? 0.9608 1.0396 0.7628 -0.1890 0.0398  0.1369  105 SER A C   
759  O O   . SER A 105 ? 0.9569 1.0311 0.7675 -0.1798 0.0234  0.1530  105 SER A O   
760  C CB  . SER A 105 ? 0.9566 1.0151 0.7694 -0.1948 0.0592  0.1433  105 SER A CB  
761  O OG  . SER A 105 ? 1.0901 1.1529 0.8728 -0.2138 0.0723  0.1394  105 SER A OG  
762  N N   . GLN A 106 ? 0.9375 1.0286 0.7129 -0.2021 0.0451  0.1268  106 GLN A N   
763  C CA  . GLN A 106 ? 0.9549 1.0555 0.7078 -0.2070 0.0310  0.1341  106 GLN A CA  
764  C C   . GLN A 106 ? 0.9693 1.0799 0.7414 -0.1949 0.0241  0.1206  106 GLN A C   
765  O O   . GLN A 106 ? 0.9803 1.1005 0.7368 -0.1984 0.0128  0.1238  106 GLN A O   
766  C CB  . GLN A 106 ? 1.0091 1.1178 0.7212 -0.2288 0.0393  0.1307  106 GLN A CB  
767  C CG  . GLN A 106 ? 1.3985 1.4997 1.0802 -0.2414 0.0319  0.1560  106 GLN A CG  
768  C CD  . GLN A 106 ? 1.7777 1.8872 1.4160 -0.2646 0.0406  0.1521  106 GLN A CD  
769  O OE1 . GLN A 106 ? 1.7764 1.8991 1.3961 -0.2716 0.0369  0.1438  106 GLN A OE1 
770  N NE2 . GLN A 106 ? 1.6752 1.7768 1.2951 -0.2780 0.0525  0.1582  106 GLN A NE2 
771  N N   . GLY A 107 ? 0.8789 0.9871 0.6837 -0.1815 0.0306  0.1064  107 GLY A N   
772  C CA  . GLY A 107 ? 0.8386 0.9540 0.6637 -0.1696 0.0256  0.0937  107 GLY A CA  
773  C C   . GLY A 107 ? 0.8367 0.9618 0.6623 -0.1735 0.0389  0.0689  107 GLY A C   
774  O O   . GLY A 107 ? 0.8248 0.9591 0.6499 -0.1717 0.0337  0.0606  107 GLY A O   
775  N N   . GLN A 108 ? 0.7564 0.8794 0.5860 -0.1783 0.0562  0.0566  108 GLN A N   
776  C CA  . GLN A 108 ? 0.7281 0.8591 0.5635 -0.1813 0.0707  0.0325  108 GLN A CA  
777  C C   . GLN A 108 ? 0.7018 0.8345 0.5666 -0.1658 0.0665  0.0210  108 GLN A C   
778  O O   . GLN A 108 ? 0.6668 0.7918 0.5551 -0.1523 0.0600  0.0271  108 GLN A O   
779  C CB  . GLN A 108 ? 0.7443 0.8714 0.5874 -0.1861 0.0883  0.0237  108 GLN A CB  
780  C CG  . GLN A 108 ? 0.9876 1.1233 0.8367 -0.1911 0.1046  -0.0009 108 GLN A CG  
781  C CD  . GLN A 108 ? 1.3336 1.4668 1.1920 -0.1963 0.1217  -0.0091 108 GLN A CD  
782  O OE1 . GLN A 108 ? 1.2406 1.3656 1.1195 -0.1882 0.1216  -0.0036 108 GLN A OE1 
783  N NE2 . GLN A 108 ? 1.3430 1.4840 1.1883 -0.2103 0.1375  -0.0241 108 GLN A NE2 
784  N N   . MET A 109 ? 0.6316 0.7740 0.4941 -0.1688 0.0707  0.0043  109 MET A N   
785  C CA  . MET A 109 ? 0.5913 0.7352 0.4785 -0.1561 0.0676  -0.0069 109 MET A CA  
786  C C   . MET A 109 ? 0.6014 0.7391 0.5187 -0.1463 0.0760  -0.0158 109 MET A C   
787  O O   . MET A 109 ? 0.5916 0.7302 0.5120 -0.1522 0.0904  -0.0267 109 MET A O   
788  C CB  . MET A 109 ? 0.6288 0.7833 0.5071 -0.1631 0.0724  -0.0237 109 MET A CB  
789  C CG  . MET A 109 ? 0.6526 0.8080 0.5540 -0.1506 0.0672  -0.0327 109 MET A CG  
790  S SD  . MET A 109 ? 0.7046 0.8687 0.6077 -0.1565 0.0786  -0.0577 109 MET A SD  
791  C CE  . MET A 109 ? 0.6369 0.7944 0.5749 -0.1462 0.0902  -0.0707 109 MET A CE  
792  N N   . ASP A 110 ? 0.5450 0.6768 0.4844 -0.1320 0.0668  -0.0108 110 ASP A N   
793  C CA  . ASP A 110 ? 0.5266 0.6525 0.4942 -0.1220 0.0717  -0.0178 110 ASP A CA  
794  C C   . ASP A 110 ? 0.5485 0.6740 0.5346 -0.1099 0.0640  -0.0226 110 ASP A C   
795  O O   . ASP A 110 ? 0.5341 0.6617 0.5137 -0.1075 0.0533  -0.0164 110 ASP A O   
796  C CB  . ASP A 110 ? 0.5588 0.6751 0.5333 -0.1186 0.0700  -0.0048 110 ASP A CB  
797  C CG  . ASP A 110 ? 0.7506 0.8631 0.7489 -0.1138 0.0788  -0.0137 110 ASP A CG  
798  O OD1 . ASP A 110 ? 0.7624 0.8799 0.7718 -0.1139 0.0871  -0.0296 110 ASP A OD1 
799  O OD2 . ASP A 110 ? 0.8362 0.9406 0.8431 -0.1102 0.0772  -0.0047 110 ASP A OD2 
800  N N   . LEU A 111 ? 0.4941 0.6173 0.5034 -0.1030 0.0693  -0.0336 111 LEU A N   
801  C CA  . LEU A 111 ? 0.4712 0.5931 0.4981 -0.0927 0.0640  -0.0395 111 LEU A CA  
802  C C   . LEU A 111 ? 0.4893 0.6036 0.5388 -0.0830 0.0628  -0.0387 111 LEU A C   
803  O O   . LEU A 111 ? 0.4861 0.5982 0.5434 -0.0844 0.0697  -0.0404 111 LEU A O   
804  C CB  . LEU A 111 ? 0.4744 0.6021 0.5064 -0.0958 0.0728  -0.0569 111 LEU A CB  
805  C CG  . LEU A 111 ? 0.5417 0.6742 0.5674 -0.0961 0.0683  -0.0620 111 LEU A CG  
806  C CD1 . LEU A 111 ? 0.5667 0.7075 0.5751 -0.1085 0.0768  -0.0714 111 LEU A CD1 
807  C CD2 . LEU A 111 ? 0.5677 0.6974 0.6153 -0.0875 0.0682  -0.0716 111 LEU A CD2 
808  N N   . CYS A 112 ? 0.4325 0.5436 0.4931 -0.0738 0.0547  -0.0379 112 CYS A N   
809  C CA  . CYS A 112 ? 0.4239 0.5284 0.5047 -0.0653 0.0532  -0.0390 112 CYS A CA  
810  C C   . CYS A 112 ? 0.4153 0.5185 0.5060 -0.0582 0.0477  -0.0438 112 CYS A C   
811  O O   . CYS A 112 ? 0.4113 0.5163 0.4944 -0.0574 0.0418  -0.0411 112 CYS A O   
812  C CB  . CYS A 112 ? 0.4449 0.5423 0.5280 -0.0624 0.0491  -0.0273 112 CYS A CB  
813  S SG  . CYS A 112 ? 0.5046 0.5992 0.5810 -0.0581 0.0375  -0.0144 112 CYS A SG  
814  N N   . VAL A 113 ? 0.3264 0.4267 0.4342 -0.0537 0.0497  -0.0509 113 VAL A N   
815  C CA  . VAL A 113 ? 0.2973 0.3947 0.4148 -0.0474 0.0448  -0.0546 113 VAL A CA  
816  C C   . VAL A 113 ? 0.3913 0.4820 0.5118 -0.0417 0.0373  -0.0460 113 VAL A C   
817  O O   . VAL A 113 ? 0.4108 0.4977 0.5362 -0.0408 0.0378  -0.0418 113 VAL A O   
818  C CB  . VAL A 113 ? 0.3138 0.4104 0.4486 -0.0452 0.0487  -0.0643 113 VAL A CB  
819  C CG1 . VAL A 113 ? 0.2944 0.3877 0.4358 -0.0403 0.0439  -0.0677 113 VAL A CG1 
820  C CG2 . VAL A 113 ? 0.3140 0.4171 0.4497 -0.0513 0.0586  -0.0735 113 VAL A CG2 
821  N N   . THR A 114 ? 0.3435 0.4329 0.4616 -0.0384 0.0313  -0.0441 114 THR A N   
822  C CA  . THR A 114 ? 0.3242 0.4077 0.4456 -0.0336 0.0255  -0.0377 114 THR A CA  
823  C C   . THR A 114 ? 0.3605 0.4402 0.4895 -0.0295 0.0227  -0.0423 114 THR A C   
824  O O   . THR A 114 ? 0.3467 0.4283 0.4773 -0.0302 0.0241  -0.0491 114 THR A O   
825  C CB  . THR A 114 ? 0.3990 0.4850 0.5114 -0.0340 0.0211  -0.0298 114 THR A CB  
826  O OG1 . THR A 114 ? 0.4179 0.5103 0.5236 -0.0362 0.0199  -0.0334 114 THR A OG1 
827  C CG2 . THR A 114 ? 0.3271 0.4144 0.4319 -0.0379 0.0224  -0.0220 114 THR A CG2 
828  N N   . SER A 115 ? 0.3352 0.4089 0.4686 -0.0260 0.0191  -0.0390 115 SER A N   
829  C CA  . SER A 115 ? 0.3336 0.4027 0.4713 -0.0234 0.0164  -0.0424 115 SER A CA  
830  C C   . SER A 115 ? 0.3999 0.4711 0.5328 -0.0229 0.0140  -0.0421 115 SER A C   
831  O O   . SER A 115 ? 0.3967 0.4649 0.5306 -0.0210 0.0116  -0.0395 115 SER A O   
832  C CB  . SER A 115 ? 0.3679 0.4302 0.5106 -0.0215 0.0146  -0.0403 115 SER A CB  
833  O OG  . SER A 115 ? 0.4463 0.5078 0.5952 -0.0223 0.0163  -0.0418 115 SER A OG  
834  N N   . GLY A 116 ? 0.3677 0.4445 0.4965 -0.0252 0.0153  -0.0458 116 GLY A N   
835  C CA  . GLY A 116 ? 0.3707 0.4521 0.4948 -0.0262 0.0132  -0.0464 116 GLY A CA  
836  C C   . GLY A 116 ? 0.4419 0.5303 0.5589 -0.0284 0.0121  -0.0412 116 GLY A C   
837  O O   . GLY A 116 ? 0.4551 0.5427 0.5712 -0.0287 0.0130  -0.0362 116 GLY A O   
838  N N   . SER A 117 ? 0.3962 0.4917 0.5079 -0.0306 0.0098  -0.0417 117 SER A N   
839  C CA  . SER A 117 ? 0.4002 0.5028 0.5041 -0.0333 0.0067  -0.0350 117 SER A CA  
840  C C   . SER A 117 ? 0.4224 0.5232 0.5324 -0.0290 0.0018  -0.0261 117 SER A C   
841  O O   . SER A 117 ? 0.4184 0.5221 0.5247 -0.0300 -0.0012 -0.0179 117 SER A O   
842  C CB  . SER A 117 ? 0.4587 0.5706 0.5551 -0.0378 0.0049  -0.0388 117 SER A CB  
843  O OG  . SER A 117 ? 0.5954 0.7094 0.6974 -0.0356 0.0008  -0.0393 117 SER A OG  
844  N N   . GLN A 118 ? 0.3552 0.4508 0.4749 -0.0248 0.0014  -0.0279 118 GLN A N   
845  C CA  . GLN A 118 ? 0.3545 0.4475 0.4835 -0.0206 -0.0014 -0.0222 118 GLN A CA  
846  C C   . GLN A 118 ? 0.4135 0.5001 0.5450 -0.0191 -0.0001 -0.0161 118 GLN A C   
847  O O   . GLN A 118 ? 0.4207 0.5068 0.5583 -0.0167 -0.0030 -0.0088 118 GLN A O   
848  C CB  . GLN A 118 ? 0.3649 0.4529 0.5014 -0.0183 0.0003  -0.0279 118 GLN A CB  
849  C CG  . GLN A 118 ? 0.5609 0.6480 0.7089 -0.0147 -0.0013 -0.0249 118 GLN A CG  
850  C CD  . GLN A 118 ? 0.7530 0.8498 0.9052 -0.0142 -0.0067 -0.0203 118 GLN A CD  
851  O OE1 . GLN A 118 ? 0.7963 0.9005 0.9464 -0.0163 -0.0086 -0.0238 118 GLN A OE1 
852  N NE2 . GLN A 118 ? 0.4814 0.5783 0.6408 -0.0114 -0.0097 -0.0121 118 GLN A NE2 
853  N N   . GLN A 119 ? 0.3445 0.4261 0.4733 -0.0204 0.0042  -0.0193 119 GLN A N   
854  C CA  . GLN A 119 ? 0.3236 0.3992 0.4551 -0.0199 0.0062  -0.0149 119 GLN A CA  
855  C C   . GLN A 119 ? 0.3702 0.4494 0.4951 -0.0225 0.0050  -0.0068 119 GLN A C   
856  O O   . GLN A 119 ? 0.3598 0.4350 0.4893 -0.0210 0.0038  0.0007  119 GLN A O   
857  C CB  . GLN A 119 ? 0.3287 0.3998 0.4608 -0.0210 0.0105  -0.0209 119 GLN A CB  
858  C CG  . GLN A 119 ? 0.3736 0.4375 0.5120 -0.0200 0.0123  -0.0184 119 GLN A CG  
859  C CD  . GLN A 119 ? 0.5227 0.5850 0.6619 -0.0221 0.0159  -0.0222 119 GLN A CD  
860  O OE1 . GLN A 119 ? 0.4537 0.5206 0.5892 -0.0246 0.0180  -0.0258 119 GLN A OE1 
861  N NE2 . GLN A 119 ? 0.3337 0.3896 0.4793 -0.0215 0.0169  -0.0222 119 GLN A NE2 
862  N N   . GLY A 120 ? 0.3399 0.4264 0.4539 -0.0270 0.0053  -0.0085 120 GLY A N   
863  C CA  . GLY A 120 ? 0.3544 0.4452 0.4577 -0.0315 0.0040  -0.0010 120 GLY A CA  
864  C C   . GLY A 120 ? 0.4247 0.5181 0.5298 -0.0296 -0.0036 0.0092  120 GLY A C   
865  O O   . GLY A 120 ? 0.4169 0.5070 0.5220 -0.0296 -0.0055 0.0193  120 GLY A O   
866  N N   . LEU A 121 ? 0.4072 0.5061 0.5161 -0.0275 -0.0080 0.0066  121 LEU A N   
867  C CA  . LEU A 121 ? 0.4262 0.5295 0.5416 -0.0247 -0.0160 0.0150  121 LEU A CA  
868  C C   . LEU A 121 ? 0.4881 0.5827 0.6189 -0.0188 -0.0166 0.0215  121 LEU A C   
869  O O   . LEU A 121 ? 0.4933 0.5878 0.6269 -0.0179 -0.0219 0.0329  121 LEU A O   
870  C CB  . LEU A 121 ? 0.4237 0.5335 0.5447 -0.0232 -0.0185 0.0081  121 LEU A CB  
871  C CG  . LEU A 121 ? 0.4981 0.6178 0.6060 -0.0292 -0.0195 0.0025  121 LEU A CG  
872  C CD1 . LEU A 121 ? 0.4973 0.6195 0.6123 -0.0277 -0.0187 -0.0070 121 LEU A CD1 
873  C CD2 . LEU A 121 ? 0.5360 0.6655 0.6364 -0.0327 -0.0281 0.0116  121 LEU A CD2 
874  N N   . CYS A 122 ? 0.4307 0.5176 0.5710 -0.0155 -0.0110 0.0142  122 CYS A N   
875  C CA  . CYS A 122 ? 0.4292 0.5071 0.5843 -0.0109 -0.0095 0.0168  122 CYS A CA  
876  C C   . CYS A 122 ? 0.4288 0.5003 0.5824 -0.0120 -0.0087 0.0257  122 CYS A C   
877  O O   . CYS A 122 ? 0.4183 0.4864 0.5828 -0.0088 -0.0120 0.0345  122 CYS A O   
878  C CB  . CYS A 122 ? 0.4417 0.5134 0.6015 -0.0097 -0.0034 0.0061  122 CYS A CB  
879  S SG  . CYS A 122 ? 0.4989 0.5587 0.6738 -0.0063 0.0007  0.0064  122 CYS A SG  
880  N N   . LYS A 123 ? 0.3465 0.4160 0.4885 -0.0166 -0.0040 0.0234  123 LYS A N   
881  C CA  . LYS A 123 ? 0.3323 0.3957 0.4716 -0.0190 -0.0017 0.0307  123 LYS A CA  
882  C C   . LYS A 123 ? 0.3912 0.4580 0.5227 -0.0215 -0.0077 0.0438  123 LYS A C   
883  O O   . LYS A 123 ? 0.4139 0.4737 0.5495 -0.0212 -0.0084 0.0538  123 LYS A O   
884  C CB  . LYS A 123 ? 0.3589 0.4218 0.4886 -0.0239 0.0051  0.0238  123 LYS A CB  
885  C CG  . LYS A 123 ? 0.5986 0.6585 0.7350 -0.0222 0.0096  0.0121  123 LYS A CG  
886  C CD  . LYS A 123 ? 0.7265 0.7768 0.8761 -0.0190 0.0116  0.0115  123 LYS A CD  
887  C CE  . LYS A 123 ? 0.9072 0.9563 1.0640 -0.0155 0.0112  0.0036  123 LYS A CE  
888  N NZ  . LYS A 123 ? 1.0263 1.0665 1.1951 -0.0134 0.0136  0.0027  123 LYS A NZ  
889  N N   . VAL A 124 ? 0.3244 0.4019 0.4447 -0.0244 -0.0124 0.0442  124 VAL A N   
890  C CA  . VAL A 124 ? 0.3222 0.4051 0.4321 -0.0279 -0.0199 0.0567  124 VAL A CA  
891  C C   . VAL A 124 ? 0.3744 0.4559 0.5011 -0.0215 -0.0284 0.0671  124 VAL A C   
892  O O   . VAL A 124 ? 0.3888 0.4666 0.5151 -0.0221 -0.0332 0.0809  124 VAL A O   
893  C CB  . VAL A 124 ? 0.3557 0.4509 0.4491 -0.0336 -0.0222 0.0517  124 VAL A CB  
894  C CG1 . VAL A 124 ? 0.3624 0.4655 0.4478 -0.0364 -0.0330 0.0642  124 VAL A CG1 
895  C CG2 . VAL A 124 ? 0.3527 0.4487 0.4296 -0.0412 -0.0138 0.0445  124 VAL A CG2 
896  N N   . PHE A 125 ? 0.3161 0.4001 0.4585 -0.0155 -0.0298 0.0604  125 PHE A N   
897  C CA  . PHE A 125 ? 0.3211 0.4047 0.4844 -0.0087 -0.0365 0.0678  125 PHE A CA  
898  C C   . PHE A 125 ? 0.3615 0.4316 0.5394 -0.0048 -0.0332 0.0736  125 PHE A C   
899  O O   . PHE A 125 ? 0.3772 0.4449 0.5658 -0.0019 -0.0400 0.0867  125 PHE A O   
900  C CB  . PHE A 125 ? 0.3408 0.4291 0.5183 -0.0042 -0.0354 0.0566  125 PHE A CB  
901  C CG  . PHE A 125 ? 0.3726 0.4741 0.5409 -0.0072 -0.0393 0.0511  125 PHE A CG  
902  C CD1 . PHE A 125 ? 0.4100 0.5141 0.5838 -0.0058 -0.0350 0.0381  125 PHE A CD1 
903  C CD2 . PHE A 125 ? 0.4188 0.5298 0.5727 -0.0121 -0.0474 0.0591  125 PHE A CD2 
904  C CE1 . PHE A 125 ? 0.4202 0.5358 0.5869 -0.0089 -0.0382 0.0328  125 PHE A CE1 
905  C CE2 . PHE A 125 ? 0.4547 0.5781 0.6010 -0.0156 -0.0508 0.0531  125 PHE A CE2 
906  C CZ  . PHE A 125 ? 0.4145 0.5398 0.5680 -0.0137 -0.0460 0.0398  125 PHE A CZ  
907  N N   . GLU A 126 ? 0.2936 0.3550 0.4725 -0.0051 -0.0234 0.0642  126 GLU A N   
908  C CA  . GLU A 126 ? 0.2894 0.3376 0.4815 -0.0026 -0.0185 0.0665  126 GLU A CA  
909  C C   . GLU A 126 ? 0.3853 0.4271 0.5687 -0.0066 -0.0197 0.0798  126 GLU A C   
910  O O   . GLU A 126 ? 0.3990 0.4305 0.5967 -0.0037 -0.0194 0.0874  126 GLU A O   
911  C CB  . GLU A 126 ? 0.2900 0.3327 0.4832 -0.0032 -0.0088 0.0521  126 GLU A CB  
912  C CG  . GLU A 126 ? 0.4802 0.5253 0.6852 0.0008  -0.0071 0.0410  126 GLU A CG  
913  C CD  . GLU A 126 ? 0.7723 0.8126 0.9774 -0.0003 0.0009  0.0273  126 GLU A CD  
914  O OE1 . GLU A 126 ? 0.5577 0.5995 0.7707 0.0020  0.0024  0.0191  126 GLU A OE1 
915  O OE2 . GLU A 126 ? 0.6713 0.7066 0.8684 -0.0039 0.0053  0.0250  126 GLU A OE2 
916  N N   . MET A 127 ? 0.3546 0.4024 0.5149 -0.0137 -0.0205 0.0825  127 MET A N   
917  C CA  . MET A 127 ? 0.3703 0.4135 0.5172 -0.0198 -0.0207 0.0944  127 MET A CA  
918  C C   . MET A 127 ? 0.4630 0.5067 0.6124 -0.0185 -0.0318 0.1123  127 MET A C   
919  O O   . MET A 127 ? 0.4921 0.5263 0.6431 -0.0197 -0.0330 0.1251  127 MET A O   
920  C CB  . MET A 127 ? 0.3990 0.4506 0.5205 -0.0285 -0.0173 0.0891  127 MET A CB  
921  C CG  . MET A 127 ? 0.4592 0.5089 0.5616 -0.0371 -0.0171 0.1007  127 MET A CG  
922  S SD  . MET A 127 ? 0.5068 0.5681 0.5810 -0.0478 -0.0121 0.0919  127 MET A SD  
923  C CE  . MET A 127 ? 0.4731 0.5477 0.5387 -0.0480 -0.0243 0.0964  127 MET A CE  
924  N N   . ILE A 128 ? 0.4152 0.4704 0.5653 -0.0164 -0.0406 0.1134  128 ILE A N   
925  C CA  . ILE A 128 ? 0.4292 0.4883 0.5812 -0.0155 -0.0536 0.1302  128 ILE A CA  
926  C C   . ILE A 128 ? 0.5102 0.5642 0.6939 -0.0055 -0.0593 0.1371  128 ILE A C   
927  O O   . ILE A 128 ? 0.5265 0.5730 0.7173 -0.0042 -0.0654 0.1535  128 ILE A O   
928  C CB  . ILE A 128 ? 0.4653 0.5411 0.6020 -0.0195 -0.0606 0.1276  128 ILE A CB  
929  C CG1 . ILE A 128 ? 0.4723 0.5527 0.5780 -0.0303 -0.0547 0.1215  128 ILE A CG1 
930  C CG2 . ILE A 128 ? 0.4920 0.5741 0.6317 -0.0186 -0.0760 0.1448  128 ILE A CG2 
931  C CD1 . ILE A 128 ? 0.5290 0.6240 0.6231 -0.0337 -0.0563 0.1107  128 ILE A CD1 
932  N N   . ILE A 129 ? 0.4667 0.5252 0.6696 0.0012  -0.0576 0.1250  129 ILE A N   
933  C CA  . ILE A 129 ? 0.4638 0.5205 0.6992 0.0106  -0.0621 0.1283  129 ILE A CA  
934  C C   . ILE A 129 ? 0.5188 0.5594 0.7777 0.0160  -0.0565 0.1308  129 ILE A C   
935  O O   . ILE A 129 ? 0.5150 0.5477 0.7769 0.0160  -0.0447 0.1179  129 ILE A O   
936  C CB  . ILE A 129 ? 0.4807 0.5484 0.7281 0.0145  -0.0613 0.1142  129 ILE A CB  
937  C CG1 . ILE A 129 ? 0.4942 0.5784 0.7232 0.0097  -0.0697 0.1149  129 ILE A CG1 
938  C CG2 . ILE A 129 ? 0.4678 0.5342 0.7515 0.0240  -0.0642 0.1159  129 ILE A CG2 
939  C CD1 . ILE A 129 ? 0.5578 0.6492 0.7779 0.0074  -0.0627 0.0969  129 ILE A CD1 
940  N N   . ASN A 130 ? 0.4875 0.5240 0.7650 0.0208  -0.0656 0.1471  130 ASN A N   
941  C CA  . ASN A 130 ? 0.4950 0.5168 0.8019 0.0274  -0.0623 0.1512  130 ASN A CA  
942  C C   . ASN A 130 ? 0.5629 0.5916 0.9030 0.0365  -0.0675 0.1493  130 ASN A C   
943  O O   . ASN A 130 ? 0.5533 0.5962 0.8917 0.0371  -0.0789 0.1552  130 ASN A O   
944  C CB  . ASN A 130 ? 0.4994 0.5115 0.8049 0.0261  -0.0702 0.1733  130 ASN A CB  
945  C CG  . ASN A 130 ? 0.6859 0.6888 0.9645 0.0173  -0.0632 0.1755  130 ASN A CG  
946  O OD1 . ASN A 130 ? 0.7265 0.7193 1.0074 0.0162  -0.0505 0.1641  130 ASN A OD1 
947  N ND2 . ASN A 130 ? 0.4568 0.4630 0.7101 0.0102  -0.0715 0.1905  130 ASN A ND2 
948  N N   . PRO A 131 ? 0.5309 0.5510 0.9017 0.0431  -0.0590 0.1400  131 PRO A N   
949  C CA  . PRO A 131 ? 0.5233 0.5512 0.9276 0.0514  -0.0627 0.1367  131 PRO A CA  
950  C C   . PRO A 131 ? 0.5713 0.6037 0.9928 0.0564  -0.0794 0.1578  131 PRO A C   
951  O O   . PRO A 131 ? 0.5817 0.6020 1.0112 0.0581  -0.0838 0.1737  131 PRO A O   
952  C CB  . PRO A 131 ? 0.5408 0.5550 0.9730 0.0560  -0.0493 0.1247  131 PRO A CB  
953  C CG  . PRO A 131 ? 0.5921 0.5959 0.9996 0.0488  -0.0378 0.1162  131 PRO A CG  
954  C CD  . PRO A 131 ? 0.5477 0.5513 0.9248 0.0426  -0.0454 0.1313  131 PRO A CD  
955  N N   . GLY A 132 ? 0.5210 0.5710 0.9456 0.0578  -0.0893 0.1585  132 GLY A N   
956  C CA  . GLY A 132 ? 0.5377 0.5962 0.9784 0.0622  -0.1074 0.1778  132 GLY A CA  
957  C C   . GLY A 132 ? 0.6111 0.6803 1.0168 0.0543  -0.1212 0.1916  132 GLY A C   
958  O O   . GLY A 132 ? 0.6302 0.7063 1.0453 0.0566  -0.1379 0.2097  132 GLY A O   
959  N N   . ASP A 133 ? 0.5656 0.6367 0.9316 0.0447  -0.1144 0.1830  133 ASP A N   
960  C CA  . ASP A 133 ? 0.5763 0.6574 0.9056 0.0353  -0.1243 0.1925  133 ASP A CA  
961  C C   . ASP A 133 ? 0.6165 0.7185 0.9448 0.0345  -0.1326 0.1867  133 ASP A C   
962  O O   . ASP A 133 ? 0.6064 0.7143 0.9491 0.0379  -0.1248 0.1692  133 ASP A O   
963  C CB  . ASP A 133 ? 0.5998 0.6748 0.8913 0.0256  -0.1122 0.1834  133 ASP A CB  
964  C CG  . ASP A 133 ? 0.7892 0.8460 1.0714 0.0227  -0.1069 0.1929  133 ASP A CG  
965  O OD1 . ASP A 133 ? 0.8261 0.8740 1.1261 0.0269  -0.1146 0.2103  133 ASP A OD1 
966  O OD2 . ASP A 133 ? 0.8603 0.9121 1.1182 0.0159  -0.0955 0.1834  133 ASP A OD2 
967  N N   . ASN A 134 ? 0.5707 0.6840 0.8813 0.0291  -0.1482 0.2014  134 ASN A N   
968  C CA  . ASN A 134 ? 0.5505 0.6845 0.8582 0.0269  -0.1572 0.1966  134 ASN A CA  
969  C C   . ASN A 134 ? 0.5844 0.7246 0.8520 0.0158  -0.1498 0.1835  134 ASN A C   
970  O O   . ASN A 134 ? 0.5920 0.7260 0.8275 0.0073  -0.1478 0.1890  134 ASN A O   
971  C CB  . ASN A 134 ? 0.5382 0.6824 0.8487 0.0262  -0.1790 0.2189  134 ASN A CB  
972  C CG  . ASN A 134 ? 0.8535 0.9959 1.2107 0.0384  -0.1884 0.2306  134 ASN A CG  
973  O OD1 . ASN A 134 ? 0.7946 0.9391 1.1872 0.0473  -0.1821 0.2181  134 ASN A OD1 
974  N ND2 . ASN A 134 ? 0.7987 0.9374 1.1573 0.0386  -0.2039 0.2551  134 ASN A ND2 
975  N N   . VAL A 135 ? 0.5132 0.6646 0.7841 0.0158  -0.1446 0.1656  135 VAL A N   
976  C CA  . VAL A 135 ? 0.5014 0.6590 0.7391 0.0062  -0.1374 0.1517  135 VAL A CA  
977  C C   . VAL A 135 ? 0.5368 0.7145 0.7751 0.0035  -0.1462 0.1465  135 VAL A C   
978  O O   . VAL A 135 ? 0.5075 0.6929 0.7773 0.0108  -0.1501 0.1436  135 VAL A O   
979  C CB  . VAL A 135 ? 0.5290 0.6757 0.7608 0.0061  -0.1179 0.1326  135 VAL A CB  
980  C CG1 . VAL A 135 ? 0.5326 0.6610 0.7578 0.0061  -0.1100 0.1380  135 VAL A CG1 
981  C CG2 . VAL A 135 ? 0.5030 0.6504 0.7649 0.0141  -0.1106 0.1184  135 VAL A CG2 
982  N N   . LEU A 136 ? 0.5111 0.6975 0.7153 -0.0076 -0.1490 0.1448  136 LEU A N   
983  C CA  . LEU A 136 ? 0.5107 0.7163 0.7104 -0.0125 -0.1573 0.1394  136 LEU A CA  
984  C C   . LEU A 136 ? 0.5784 0.7859 0.7687 -0.0159 -0.1434 0.1172  136 LEU A C   
985  O O   . LEU A 136 ? 0.5577 0.7565 0.7244 -0.0212 -0.1315 0.1089  136 LEU A O   
986  C CB  . LEU A 136 ? 0.5324 0.7473 0.7010 -0.0237 -0.1703 0.1520  136 LEU A CB  
987  C CG  . LEU A 136 ? 0.6124 0.8281 0.7888 -0.0216 -0.1878 0.1765  136 LEU A CG  
988  C CD1 . LEU A 136 ? 0.6452 0.8634 0.7808 -0.0350 -0.1952 0.1881  136 LEU A CD1 
989  C CD2 . LEU A 136 ? 0.6428 0.8746 0.8507 -0.0155 -0.2037 0.1823  136 LEU A CD2 
990  N N   . LEU A 137 ? 0.5702 0.7894 0.7808 -0.0129 -0.1452 0.1077  137 LEU A N   
991  C CA  . LEU A 137 ? 0.5597 0.7807 0.7672 -0.0151 -0.1329 0.0873  137 LEU A CA  
992  C C   . LEU A 137 ? 0.6142 0.8543 0.8354 -0.0164 -0.1417 0.0824  137 LEU A C   
993  O O   . LEU A 137 ? 0.5981 0.8486 0.8404 -0.0124 -0.1557 0.0937  137 LEU A O   
994  C CB  . LEU A 137 ? 0.5429 0.7500 0.7728 -0.0060 -0.1197 0.0791  137 LEU A CB  
995  C CG  . LEU A 137 ? 0.5882 0.7920 0.8168 -0.0069 -0.1054 0.0597  137 LEU A CG  
996  C CD1 . LEU A 137 ? 0.5866 0.7722 0.8086 -0.0049 -0.0919 0.0551  137 LEU A CD1 
997  C CD2 . LEU A 137 ? 0.6118 0.8222 0.8726 -0.0008 -0.1046 0.0526  137 LEU A CD2 
998  N N   . ASP A 138 ? 0.5823 0.8268 0.7926 -0.0220 -0.1337 0.0659  138 ASP A N   
999  C CA  . ASP A 138 ? 0.5832 0.8450 0.8057 -0.0243 -0.1396 0.0585  138 ASP A CA  
1000 C C   . ASP A 138 ? 0.5873 0.8458 0.8310 -0.0196 -0.1269 0.0426  138 ASP A C   
1001 O O   . ASP A 138 ? 0.5568 0.8040 0.7873 -0.0215 -0.1128 0.0308  138 ASP A O   
1002 C CB  . ASP A 138 ? 0.6294 0.9017 0.8214 -0.0370 -0.1428 0.0531  138 ASP A CB  
1003 C CG  . ASP A 138 ? 0.8629 1.1233 1.0269 -0.0432 -0.1279 0.0411  138 ASP A CG  
1004 O OD1 . ASP A 138 ? 0.8785 1.1258 1.0279 -0.0428 -0.1229 0.0467  138 ASP A OD1 
1005 O OD2 . ASP A 138 ? 0.9907 1.2554 1.1482 -0.0487 -0.1216 0.0263  138 ASP A OD2 
1006 N N   . GLU A 139 ? 0.5339 0.8019 0.8111 -0.0134 -0.1319 0.0430  139 GLU A N   
1007 C CA  . GLU A 139 ? 0.5018 0.7690 0.8004 -0.0101 -0.1206 0.0284  139 GLU A CA  
1008 C C   . GLU A 139 ? 0.5213 0.8041 0.8165 -0.0179 -0.1232 0.0180  139 GLU A C   
1009 O O   . GLU A 139 ? 0.5267 0.8263 0.8238 -0.0213 -0.1380 0.0248  139 GLU A O   
1010 C CB  . GLU A 139 ? 0.5169 0.7873 0.8563 -0.0001 -0.1235 0.0328  139 GLU A CB  
1011 C CG  . GLU A 139 ? 0.6555 0.9084 1.0044 0.0079  -0.1162 0.0377  139 GLU A CG  
1012 C CD  . GLU A 139 ? 1.0017 1.2582 1.3935 0.0174  -0.1178 0.0401  139 GLU A CD  
1013 O OE1 . GLU A 139 ? 0.9502 1.1975 1.3567 0.0210  -0.1037 0.0293  139 GLU A OE1 
1014 O OE2 . GLU A 139 ? 0.9987 1.2676 1.4102 0.0209  -0.1332 0.0526  139 GLU A OE2 
1015 N N   . PRO A 140 ? 0.4411 0.7189 0.7312 -0.0213 -0.1096 0.0019  140 PRO A N   
1016 C CA  . PRO A 140 ? 0.4163 0.6752 0.7022 -0.0187 -0.0929 -0.0067 140 PRO A CA  
1017 C C   . PRO A 140 ? 0.4648 0.7092 0.7191 -0.0218 -0.0873 -0.0055 140 PRO A C   
1018 O O   . PRO A 140 ? 0.4779 0.7265 0.7086 -0.0292 -0.0913 -0.0053 140 PRO A O   
1019 C CB  . PRO A 140 ? 0.4236 0.6863 0.7162 -0.0227 -0.0844 -0.0221 140 PRO A CB  
1020 C CG  . PRO A 140 ? 0.4853 0.7647 0.7695 -0.0307 -0.0939 -0.0239 140 PRO A CG  
1021 C CD  . PRO A 140 ? 0.4466 0.7381 0.7340 -0.0292 -0.1110 -0.0087 140 PRO A CD  
1022 N N   . ALA A 141 ? 0.4001 0.6279 0.6551 -0.0166 -0.0779 -0.0052 141 ALA A N   
1023 C CA  . ALA A 141 ? 0.3933 0.6070 0.6235 -0.0184 -0.0720 -0.0039 141 ALA A CA  
1024 C C   . ALA A 141 ? 0.4337 0.6323 0.6604 -0.0177 -0.0575 -0.0146 141 ALA A C   
1025 O O   . ALA A 141 ? 0.4144 0.6116 0.6583 -0.0150 -0.0516 -0.0214 141 ALA A O   
1026 C CB  . ALA A 141 ? 0.4071 0.6152 0.6401 -0.0132 -0.0772 0.0101  141 ALA A CB  
1027 N N   . TYR A 142 ? 0.3835 0.5712 0.5876 -0.0205 -0.0520 -0.0158 142 TYR A N   
1028 C CA  . TYR A 142 ? 0.3584 0.5313 0.5568 -0.0200 -0.0402 -0.0238 142 TYR A CA  
1029 C C   . TYR A 142 ? 0.3924 0.5567 0.6074 -0.0131 -0.0365 -0.0208 142 TYR A C   
1030 O O   . TYR A 142 ? 0.3872 0.5489 0.6056 -0.0093 -0.0405 -0.0111 142 TYR A O   
1031 C CB  . TYR A 142 ? 0.3612 0.5261 0.5361 -0.0236 -0.0369 -0.0239 142 TYR A CB  
1032 C CG  . TYR A 142 ? 0.3520 0.5016 0.5227 -0.0220 -0.0271 -0.0288 142 TYR A CG  
1033 C CD1 . TYR A 142 ? 0.3723 0.5130 0.5350 -0.0205 -0.0252 -0.0238 142 TYR A CD1 
1034 C CD2 . TYR A 142 ? 0.3474 0.4915 0.5212 -0.0228 -0.0201 -0.0382 142 TYR A CD2 
1035 C CE1 . TYR A 142 ? 0.3680 0.4960 0.5274 -0.0195 -0.0175 -0.0281 142 TYR A CE1 
1036 C CE2 . TYR A 142 ? 0.3507 0.4812 0.5196 -0.0219 -0.0128 -0.0414 142 TYR A CE2 
1037 C CZ  . TYR A 142 ? 0.4531 0.5761 0.6153 -0.0201 -0.0119 -0.0365 142 TYR A CZ  
1038 O OH  . TYR A 142 ? 0.4851 0.5960 0.6434 -0.0194 -0.0060 -0.0394 142 TYR A OH  
1039 N N   . SER A 143 ? 0.3495 0.5095 0.5749 -0.0123 -0.0288 -0.0294 143 SER A N   
1040 C CA  . SER A 143 ? 0.3541 0.5061 0.5954 -0.0073 -0.0230 -0.0301 143 SER A CA  
1041 C C   . SER A 143 ? 0.3923 0.5305 0.6241 -0.0053 -0.0194 -0.0262 143 SER A C   
1042 O O   . SER A 143 ? 0.3753 0.5088 0.6205 -0.0007 -0.0184 -0.0223 143 SER A O   
1043 C CB  . SER A 143 ? 0.4041 0.5531 0.6508 -0.0097 -0.0140 -0.0413 143 SER A CB  
1044 O OG  . SER A 143 ? 0.5143 0.6542 0.7406 -0.0143 -0.0084 -0.0470 143 SER A OG  
1045 N N   . GLY A 144 ? 0.3559 0.4883 0.5665 -0.0089 -0.0177 -0.0273 144 GLY A N   
1046 C CA  . GLY A 144 ? 0.3582 0.4791 0.5592 -0.0080 -0.0145 -0.0243 144 GLY A CA  
1047 C C   . GLY A 144 ? 0.4148 0.5365 0.6184 -0.0050 -0.0203 -0.0131 144 GLY A C   
1048 O O   . GLY A 144 ? 0.4202 0.5324 0.6262 -0.0026 -0.0172 -0.0103 144 GLY A O   
1049 N N   . THR A 145 ? 0.3587 0.4915 0.5612 -0.0060 -0.0291 -0.0064 145 THR A N   
1050 C CA  . THR A 145 ? 0.3455 0.4789 0.5495 -0.0038 -0.0358 0.0062  145 THR A CA  
1051 C C   . THR A 145 ? 0.3557 0.4901 0.5851 0.0025  -0.0389 0.0115  145 THR A C   
1052 O O   . THR A 145 ? 0.3547 0.4819 0.5903 0.0059  -0.0396 0.0195  145 THR A O   
1053 C CB  . THR A 145 ? 0.3747 0.5167 0.5611 -0.0090 -0.0432 0.0124  145 THR A CB  
1054 O OG1 . THR A 145 ? 0.3872 0.5379 0.5837 -0.0069 -0.0540 0.0238  145 THR A OG1 
1055 C CG2 . THR A 145 ? 0.3245 0.4740 0.4992 -0.0146 -0.0423 0.0032  145 THR A CG2 
1056 N N   . LEU A 146 ? 0.2896 0.4323 0.5356 0.0040  -0.0396 0.0062  146 LEU A N   
1057 C CA  . LEU A 146 ? 0.2794 0.4245 0.5548 0.0103  -0.0414 0.0091  146 LEU A CA  
1058 C C   . LEU A 146 ? 0.3066 0.4375 0.5910 0.0134  -0.0308 0.0040  146 LEU A C   
1059 O O   . LEU A 146 ? 0.2864 0.4124 0.5877 0.0185  -0.0318 0.0105  146 LEU A O   
1060 C CB  . LEU A 146 ? 0.2715 0.4292 0.5630 0.0101  -0.0424 0.0018  146 LEU A CB  
1061 C CG  . LEU A 146 ? 0.3455 0.5188 0.6297 0.0061  -0.0526 0.0046  146 LEU A CG  
1062 C CD1 . LEU A 146 ? 0.3502 0.5334 0.6465 0.0042  -0.0500 -0.0063 146 LEU A CD1 
1063 C CD2 . LEU A 146 ? 0.3921 0.5744 0.6870 0.0093  -0.0665 0.0194  146 LEU A CD2 
1064 N N   . GLN A 147 ? 0.2584 0.3818 0.5293 0.0096  -0.0212 -0.0070 147 GLN A N   
1065 C CA  . GLN A 147 ? 0.2530 0.3633 0.5271 0.0104  -0.0111 -0.0132 147 GLN A CA  
1066 C C   . GLN A 147 ? 0.3054 0.4053 0.5715 0.0113  -0.0111 -0.0062 147 GLN A C   
1067 O O   . GLN A 147 ? 0.3007 0.3911 0.5771 0.0134  -0.0051 -0.0082 147 GLN A O   
1068 C CB  . GLN A 147 ? 0.2667 0.3728 0.5268 0.0052  -0.0029 -0.0251 147 GLN A CB  
1069 C CG  . GLN A 147 ? 0.6341 0.7471 0.9064 0.0040  0.0007  -0.0338 147 GLN A CG  
1070 C CD  . GLN A 147 ? 1.0043 1.1162 1.3024 0.0076  0.0062  -0.0376 147 GLN A CD  
1071 O OE1 . GLN A 147 ? 0.9976 1.1010 1.2956 0.0052  0.0161  -0.0463 147 GLN A OE1 
1072 N NE2 . GLN A 147 ? 0.8850 1.0063 1.2065 0.0127  -0.0001 -0.0317 147 GLN A NE2 
1073 N N   . SER A 148 ? 0.2597 0.3617 0.5082 0.0091  -0.0171 0.0014  148 SER A N   
1074 C CA  . SER A 148 ? 0.2593 0.3530 0.4988 0.0089  -0.0175 0.0089  148 SER A CA  
1075 C C   . SER A 148 ? 0.3047 0.3984 0.5606 0.0137  -0.0239 0.0213  148 SER A C   
1076 O O   . SER A 148 ? 0.2964 0.3796 0.5584 0.0156  -0.0207 0.0246  148 SER A O   
1077 C CB  . SER A 148 ? 0.3171 0.4144 0.5325 0.0039  -0.0208 0.0116  148 SER A CB  
1078 O OG  . SER A 148 ? 0.4327 0.5244 0.6337 0.0002  -0.0139 0.0026  148 SER A OG  
1079 N N   . LEU A 149 ? 0.2742 0.3796 0.5374 0.0151  -0.0335 0.0285  149 LEU A N   
1080 C CA  . LEU A 149 ? 0.2987 0.4050 0.5775 0.0196  -0.0421 0.0427  149 LEU A CA  
1081 C C   . LEU A 149 ? 0.3734 0.4756 0.6849 0.0267  -0.0395 0.0420  149 LEU A C   
1082 O O   . LEU A 149 ? 0.3650 0.4600 0.6891 0.0305  -0.0422 0.0522  149 LEU A O   
1083 C CB  . LEU A 149 ? 0.3069 0.4277 0.5811 0.0180  -0.0550 0.0520  149 LEU A CB  
1084 C CG  . LEU A 149 ? 0.3708 0.4959 0.6129 0.0102  -0.0579 0.0538  149 LEU A CG  
1085 C CD1 . LEU A 149 ? 0.3926 0.5330 0.6317 0.0079  -0.0706 0.0615  149 LEU A CD1 
1086 C CD2 . LEU A 149 ? 0.3910 0.5059 0.6173 0.0077  -0.0566 0.0621  149 LEU A CD2 
1087 N N   . HIS A 150 ? 0.3459 0.4522 0.6717 0.0279  -0.0336 0.0297  150 HIS A N   
1088 C CA  . HIS A 150 ? 0.3501 0.4538 0.7086 0.0337  -0.0288 0.0254  150 HIS A CA  
1089 C C   . HIS A 150 ? 0.3847 0.4724 0.7527 0.0362  -0.0212 0.0255  150 HIS A C   
1090 O O   . HIS A 150 ? 0.3768 0.4620 0.7714 0.0423  -0.0242 0.0328  150 HIS A O   
1091 C CB  . HIS A 150 ? 0.3559 0.4652 0.7211 0.0320  -0.0206 0.0096  150 HIS A CB  
1092 C CG  . HIS A 150 ? 0.4082 0.5138 0.8047 0.0363  -0.0122 0.0018  150 HIS A CG  
1093 N ND1 . HIS A 150 ? 0.4313 0.5262 0.8247 0.0333  0.0016  -0.0113 150 HIS A ND1 
1094 C CD2 . HIS A 150 ? 0.4387 0.5501 0.8701 0.0429  -0.0157 0.0054  150 HIS A CD2 
1095 C CE1 . HIS A 150 ? 0.4261 0.5206 0.8516 0.0376  0.0073  -0.0166 150 HIS A CE1 
1096 N NE2 . HIS A 150 ? 0.4343 0.5385 0.8853 0.0440  -0.0026 -0.0070 150 HIS A NE2 
1097 N N   . PRO A 151 ? 0.3345 0.4112 0.6826 0.0316  -0.0123 0.0184  151 PRO A N   
1098 C CA  . PRO A 151 ? 0.3371 0.3991 0.6947 0.0332  -0.0053 0.0179  151 PRO A CA  
1099 C C   . PRO A 151 ? 0.4045 0.4602 0.7617 0.0352  -0.0122 0.0338  151 PRO A C   
1100 O O   . PRO A 151 ? 0.4046 0.4486 0.7761 0.0375  -0.0075 0.0351  151 PRO A O   
1101 C CB  . PRO A 151 ? 0.3489 0.4038 0.6826 0.0266  0.0039  0.0065  151 PRO A CB  
1102 C CG  . PRO A 151 ? 0.3951 0.4600 0.7132 0.0229  0.0032  -0.0004 151 PRO A CG  
1103 C CD  . PRO A 151 ? 0.3385 0.4154 0.6573 0.0249  -0.0083 0.0101  151 PRO A CD  
1104 N N   . LEU A 152 ? 0.3816 0.4448 0.7219 0.0334  -0.0228 0.0455  152 LEU A N   
1105 C CA  . LEU A 152 ? 0.3977 0.4557 0.7317 0.0334  -0.0299 0.0618  152 LEU A CA  
1106 C C   . LEU A 152 ? 0.4619 0.5203 0.8232 0.0402  -0.0390 0.0760  152 LEU A C   
1107 O O   . LEU A 152 ? 0.4859 0.5374 0.8445 0.0403  -0.0445 0.0907  152 LEU A O   
1108 C CB  . LEU A 152 ? 0.4002 0.4655 0.7022 0.0271  -0.0362 0.0675  152 LEU A CB  
1109 C CG  . LEU A 152 ? 0.4414 0.5037 0.7174 0.0206  -0.0280 0.0568  152 LEU A CG  
1110 C CD1 . LEU A 152 ? 0.4674 0.5406 0.7188 0.0152  -0.0334 0.0583  152 LEU A CD1 
1111 C CD2 . LEU A 152 ? 0.4453 0.4944 0.7142 0.0184  -0.0228 0.0602  152 LEU A CD2 
1112 N N   . GLY A 153 ? 0.4045 0.4704 0.7929 0.0456  -0.0402 0.0717  153 GLY A N   
1113 C CA  . GLY A 153 ? 0.4099 0.4775 0.8310 0.0533  -0.0490 0.0838  153 GLY A CA  
1114 C C   . GLY A 153 ? 0.4609 0.5359 0.8732 0.0530  -0.0657 0.1038  153 GLY A C   
1115 O O   . GLY A 153 ? 0.4572 0.5250 0.8835 0.0568  -0.0727 0.1194  153 GLY A O   
1116 N N   . CYS A 154 ? 0.4260 0.5146 0.8141 0.0476  -0.0720 0.1035  154 CYS A N   
1117 C CA  . CYS A 154 ? 0.4443 0.5422 0.8188 0.0451  -0.0879 0.1206  154 CYS A CA  
1118 C C   . CYS A 154 ? 0.5052 0.6210 0.8994 0.0486  -0.0982 0.1212  154 CYS A C   
1119 O O   . CYS A 154 ? 0.5089 0.6308 0.9160 0.0502  -0.0909 0.1055  154 CYS A O   
1120 C CB  . CYS A 154 ? 0.4500 0.5503 0.7817 0.0352  -0.0868 0.1187  154 CYS A CB  
1121 S SG  . CYS A 154 ? 0.4791 0.5904 0.7946 0.0303  -0.0787 0.0976  154 CYS A SG  
1122 N N   . ASN A 155 ? 0.4633 0.5878 0.8587 0.0489  -0.1153 0.1392  155 ASN A N   
1123 C CA  . ASN A 155 ? 0.4579 0.6012 0.8721 0.0516  -0.1274 0.1414  155 ASN A CA  
1124 C C   . ASN A 155 ? 0.4860 0.6437 0.8666 0.0422  -0.1322 0.1376  155 ASN A C   
1125 O O   . ASN A 155 ? 0.5076 0.6661 0.8582 0.0353  -0.1402 0.1491  155 ASN A O   
1126 C CB  . ASN A 155 ? 0.4956 0.6414 0.9334 0.0574  -0.1448 0.1635  155 ASN A CB  
1127 C CG  . ASN A 155 ? 0.7181 0.8494 1.1937 0.0672  -0.1403 0.1675  155 ASN A CG  
1128 O OD1 . ASN A 155 ? 0.5954 0.7266 1.1040 0.0737  -0.1309 0.1541  155 ASN A OD1 
1129 N ND2 . ASN A 155 ? 0.6302 0.7485 1.1017 0.0677  -0.1461 0.1856  155 ASN A ND2 
1130 N N   . ILE A 156 ? 0.3898 0.5580 0.7745 0.0412  -0.1261 0.1205  156 ILE A N   
1131 C CA  . ILE A 156 ? 0.3719 0.5538 0.7288 0.0325  -0.1295 0.1145  156 ILE A CA  
1132 C C   . ILE A 156 ? 0.4397 0.6412 0.8122 0.0334  -0.1473 0.1239  156 ILE A C   
1133 O O   . ILE A 156 ? 0.4244 0.6345 0.8316 0.0397  -0.1484 0.1189  156 ILE A O   
1134 C CB  . ILE A 156 ? 0.3758 0.5580 0.7255 0.0295  -0.1142 0.0922  156 ILE A CB  
1135 C CG1 . ILE A 156 ? 0.3599 0.5242 0.6896 0.0272  -0.0992 0.0845  156 ILE A CG1 
1136 C CG2 . ILE A 156 ? 0.3753 0.5726 0.7020 0.0211  -0.1191 0.0866  156 ILE A CG2 
1137 C CD1 . ILE A 156 ? 0.3152 0.4760 0.6462 0.0266  -0.0842 0.0650  156 ILE A CD1 
1138 N N   . ILE A 157 ? 0.4186 0.6275 0.7651 0.0263  -0.1608 0.1369  157 ILE A N   
1139 C CA  . ILE A 157 ? 0.4252 0.6537 0.7793 0.0248  -0.1800 0.1474  157 ILE A CA  
1140 C C   . ILE A 157 ? 0.4948 0.7370 0.8242 0.0151  -0.1783 0.1336  157 ILE A C   
1141 O O   . ILE A 157 ? 0.4948 0.7336 0.7856 0.0056  -0.1743 0.1310  157 ILE A O   
1142 C CB  . ILE A 157 ? 0.4820 0.7092 0.8212 0.0218  -0.1966 0.1717  157 ILE A CB  
1143 C CG1 . ILE A 157 ? 0.4827 0.6915 0.8419 0.0305  -0.1951 0.1846  157 ILE A CG1 
1144 C CG2 . ILE A 157 ? 0.5048 0.7531 0.8553 0.0208  -0.2185 0.1840  157 ILE A CG2 
1145 C CD1 . ILE A 157 ? 0.4719 0.6722 0.8062 0.0255  -0.2056 0.2071  157 ILE A CD1 
1146 N N   . ASN A 158 ? 0.4657 0.7228 0.8190 0.0173  -0.1799 0.1235  158 ASN A N   
1147 C CA  . ASN A 158 ? 0.4716 0.7416 0.8060 0.0083  -0.1780 0.1097  158 ASN A CA  
1148 C C   . ASN A 158 ? 0.5713 0.8580 0.8851 -0.0007 -0.1963 0.1204  158 ASN A C   
1149 O O   . ASN A 158 ? 0.5769 0.8754 0.9105 0.0024  -0.2139 0.1350  158 ASN A O   
1150 C CB  . ASN A 158 ? 0.4451 0.7237 0.8103 0.0126  -0.1710 0.0937  158 ASN A CB  
1151 C CG  . ASN A 158 ? 0.8463 1.1410 1.1985 0.0036  -0.1727 0.0821  158 ASN A CG  
1152 O OD1 . ASN A 158 ? 0.7033 0.9936 1.0229 -0.0048 -0.1640 0.0720  158 ASN A OD1 
1153 N ND2 . ASN A 158 ? 0.8384 1.1525 1.2169 0.0050  -0.1848 0.0836  158 ASN A ND2 
1154 N N   . VAL A 159 ? 0.5575 0.8451 0.8321 -0.0122 -0.1919 0.1127  159 VAL A N   
1155 C CA  . VAL A 159 ? 0.5902 0.8931 0.8385 -0.0235 -0.2061 0.1191  159 VAL A CA  
1156 C C   . VAL A 159 ? 0.6524 0.9709 0.9032 -0.0289 -0.2042 0.1019  159 VAL A C   
1157 O O   . VAL A 159 ? 0.6526 0.9640 0.8993 -0.0298 -0.1873 0.0838  159 VAL A O   
1158 C CB  . VAL A 159 ? 0.6619 0.9546 0.8646 -0.0338 -0.2010 0.1214  159 VAL A CB  
1159 C CG1 . VAL A 159 ? 0.6878 0.9964 0.8614 -0.0470 -0.2156 0.1277  159 VAL A CG1 
1160 C CG2 . VAL A 159 ? 0.6702 0.9455 0.8714 -0.0286 -0.2002 0.1368  159 VAL A CG2 
1161 N N   . ALA A 160 ? 0.6038 0.9433 0.8620 -0.0329 -0.2220 0.1079  160 ALA A N   
1162 C CA  . ALA A 160 ? 0.5900 0.9460 0.8520 -0.0389 -0.2217 0.0923  160 ALA A CA  
1163 C C   . ALA A 160 ? 0.6278 0.9815 0.8490 -0.0520 -0.2115 0.0782  160 ALA A C   
1164 O O   . ALA A 160 ? 0.6238 0.9727 0.8104 -0.0600 -0.2133 0.0848  160 ALA A O   
1165 C CB  . ALA A 160 ? 0.6178 0.9976 0.8948 -0.0413 -0.2445 0.1031  160 ALA A CB  
1166 N N   . SER A 161 ? 0.5763 0.9325 0.8029 -0.0542 -0.1997 0.0585  161 SER A N   
1167 C CA  . SER A 161 ? 0.5773 0.9309 0.7722 -0.0655 -0.1885 0.0428  161 SER A CA  
1168 C C   . SER A 161 ? 0.6303 1.0001 0.8336 -0.0720 -0.1893 0.0279  161 SER A C   
1169 O O   . SER A 161 ? 0.6230 1.0037 0.8602 -0.0661 -0.1943 0.0270  161 SER A O   
1170 C CB  . SER A 161 ? 0.6034 0.9346 0.7910 -0.0615 -0.1675 0.0327  161 SER A CB  
1171 O OG  . SER A 161 ? 0.7217 1.0484 0.9401 -0.0524 -0.1583 0.0242  161 SER A OG  
1172 N N   . ASP A 162 ? 0.5866 0.9582 0.7601 -0.0844 -0.1837 0.0158  162 ASP A N   
1173 C CA  . ASP A 162 ? 0.5754 0.9604 0.7518 -0.0927 -0.1825 -0.0001 162 ASP A CA  
1174 C C   . ASP A 162 ? 0.6054 0.9776 0.7570 -0.1002 -0.1642 -0.0178 162 ASP A C   
1175 O O   . ASP A 162 ? 0.5878 0.9405 0.7297 -0.0957 -0.1514 -0.0184 162 ASP A O   
1176 C CB  . ASP A 162 ? 0.6205 1.0291 0.7890 -0.1028 -0.2028 0.0065  162 ASP A CB  
1177 C CG  . ASP A 162 ? 0.7762 1.1856 0.9027 -0.1151 -0.2078 0.0115  162 ASP A CG  
1178 O OD1 . ASP A 162 ? 0.7655 1.1571 0.8714 -0.1141 -0.1975 0.0138  162 ASP A OD1 
1179 O OD2 . ASP A 162 ? 0.9000 1.3285 1.0145 -0.1264 -0.2221 0.0130  162 ASP A OD2 
1180 N N   . GLU A 163 ? 0.5607 0.9435 0.7039 -0.1114 -0.1630 -0.0322 163 GLU A N   
1181 C CA  . GLU A 163 ? 0.5474 0.9195 0.6705 -0.1193 -0.1464 -0.0500 163 GLU A CA  
1182 C C   . GLU A 163 ? 0.5903 0.9514 0.6790 -0.1249 -0.1409 -0.0482 163 GLU A C   
1183 O O   . GLU A 163 ? 0.5828 0.9293 0.6603 -0.1268 -0.1248 -0.0602 163 GLU A O   
1184 C CB  . GLU A 163 ? 0.5760 0.9639 0.6956 -0.1320 -0.1487 -0.0645 163 GLU A CB  
1185 C CG  . GLU A 163 ? 0.7573 1.1671 0.9033 -0.1318 -0.1636 -0.0617 163 GLU A CG  
1186 C CD  . GLU A 163 ? 1.1247 1.5550 1.2635 -0.1373 -0.1857 -0.0476 163 GLU A CD  
1187 O OE1 . GLU A 163 ? 1.1546 1.5942 1.3192 -0.1284 -0.1989 -0.0338 163 GLU A OE1 
1188 O OE2 . GLU A 163 ? 1.0774 1.5147 1.1855 -0.1508 -0.1900 -0.0505 163 GLU A OE2 
1189 N N   . SER A 164 ? 0.5465 0.9151 0.6194 -0.1282 -0.1544 -0.0331 164 SER A N   
1190 C CA  . SER A 164 ? 0.5555 0.9156 0.5952 -0.1349 -0.1500 -0.0302 164 SER A CA  
1191 C C   . SER A 164 ? 0.5807 0.9263 0.6233 -0.1239 -0.1493 -0.0143 164 SER A C   
1192 O O   . SER A 164 ? 0.5701 0.9125 0.5882 -0.1288 -0.1514 -0.0053 164 SER A O   
1193 C CB  . SER A 164 ? 0.6491 1.0270 0.6631 -0.1495 -0.1644 -0.0256 164 SER A CB  
1194 O OG  . SER A 164 ? 0.7865 1.1794 0.8016 -0.1593 -0.1666 -0.0400 164 SER A OG  
1195 N N   . GLY A 165 ? 0.5232 0.8598 0.5954 -0.1100 -0.1450 -0.0121 165 GLY A N   
1196 C CA  . GLY A 165 ? 0.5110 0.8334 0.5918 -0.0985 -0.1432 0.0010  165 GLY A CA  
1197 C C   . GLY A 165 ? 0.5649 0.8957 0.6542 -0.0944 -0.1613 0.0219  165 GLY A C   
1198 O O   . GLY A 165 ? 0.5762 0.9243 0.6799 -0.0953 -0.1759 0.0266  165 GLY A O   
1199 N N   . ILE A 166 ? 0.4978 0.8160 0.5797 -0.0899 -0.1607 0.0351  166 ILE A N   
1200 C CA  . ILE A 166 ? 0.4997 0.8213 0.5882 -0.0855 -0.1766 0.0569  166 ILE A CA  
1201 C C   . ILE A 166 ? 0.5872 0.9286 0.6600 -0.0966 -0.1951 0.0652  166 ILE A C   
1202 O O   . ILE A 166 ? 0.6084 0.9544 0.6491 -0.1103 -0.1929 0.0579  166 ILE A O   
1203 C CB  . ILE A 166 ? 0.5365 0.8400 0.6094 -0.0833 -0.1700 0.0667  166 ILE A CB  
1204 C CG1 . ILE A 166 ? 0.5067 0.7937 0.6058 -0.0693 -0.1585 0.0649  166 ILE A CG1 
1205 C CG2 . ILE A 166 ? 0.5743 0.8819 0.6371 -0.0856 -0.1871 0.0898  166 ILE A CG2 
1206 C CD1 . ILE A 166 ? 0.5330 0.8015 0.6174 -0.0680 -0.1475 0.0681  166 ILE A CD1 
1207 N N   . VAL A 167 ? 0.5441 0.8976 0.6408 -0.0910 -0.2132 0.0798  167 VAL A N   
1208 C CA  . VAL A 167 ? 0.5696 0.9431 0.6551 -0.1005 -0.2342 0.0909  167 VAL A CA  
1209 C C   . VAL A 167 ? 0.6459 1.0131 0.7142 -0.1015 -0.2447 0.1137  167 VAL A C   
1210 O O   . VAL A 167 ? 0.6328 0.9920 0.7262 -0.0890 -0.2493 0.1281  167 VAL A O   
1211 C CB  . VAL A 167 ? 0.6153 1.0071 0.7393 -0.0940 -0.2491 0.0939  167 VAL A CB  
1212 C CG1 . VAL A 167 ? 0.6423 1.0561 0.7544 -0.1045 -0.2728 0.1062  167 VAL A CG1 
1213 C CG2 . VAL A 167 ? 0.5908 0.9869 0.7319 -0.0933 -0.2367 0.0711  167 VAL A CG2 
1214 N N   . PRO A 168 ? 0.6468 1.0164 0.6723 -0.1168 -0.2476 0.1170  168 PRO A N   
1215 C CA  . PRO A 168 ? 0.6697 1.0319 0.6755 -0.1192 -0.2566 0.1393  168 PRO A CA  
1216 C C   . PRO A 168 ? 0.7390 1.1107 0.7653 -0.1134 -0.2814 0.1643  168 PRO A C   
1217 O O   . PRO A 168 ? 0.7412 1.1004 0.7699 -0.1076 -0.2854 0.1828  168 PRO A O   
1218 C CB  . PRO A 168 ? 0.7207 1.0878 0.6768 -0.1392 -0.2549 0.1344  168 PRO A CB  
1219 C CG  . PRO A 168 ? 0.7663 1.1344 0.7178 -0.1439 -0.2368 0.1067  168 PRO A CG  
1220 C CD  . PRO A 168 ? 0.6844 1.0621 0.6768 -0.1332 -0.2409 0.0996  168 PRO A CD  
1221 N N   . ASP A 169 ? 0.7065 1.0999 0.7499 -0.1147 -0.2980 0.1649  169 ASP A N   
1222 C CA  . ASP A 169 ? 0.7252 1.1300 0.7931 -0.1086 -0.3233 0.1884  169 ASP A CA  
1223 C C   . ASP A 169 ? 0.7397 1.1344 0.8575 -0.0882 -0.3216 0.1951  169 ASP A C   
1224 O O   . ASP A 169 ? 0.7400 1.1330 0.8735 -0.0815 -0.3374 0.2183  169 ASP A O   
1225 C CB  . ASP A 169 ? 0.7742 1.2063 0.8477 -0.1162 -0.3415 0.1861  169 ASP A CB  
1226 C CG  . ASP A 169 ? 1.0622 1.5061 1.0870 -0.1366 -0.3540 0.1924  169 ASP A CG  
1227 O OD1 . ASP A 169 ? 1.1273 1.5729 1.1402 -0.1397 -0.3730 0.2175  169 ASP A OD1 
1228 O OD2 . ASP A 169 ? 1.1659 1.6165 1.1639 -0.1501 -0.3444 0.1724  169 ASP A OD2 
1229 N N   . SER A 170 ? 0.6688 1.0556 0.8104 -0.0790 -0.3020 0.1751  170 SER A N   
1230 C CA  . SER A 170 ? 0.6406 1.0164 0.8272 -0.0609 -0.2960 0.1773  170 SER A CA  
1231 C C   . SER A 170 ? 0.6748 1.0273 0.8513 -0.0562 -0.2893 0.1902  170 SER A C   
1232 O O   . SER A 170 ? 0.6644 1.0112 0.8694 -0.0451 -0.2978 0.2069  170 SER A O   
1233 C CB  . SER A 170 ? 0.6574 1.0287 0.8609 -0.0558 -0.2748 0.1519  170 SER A CB  
1234 O OG  . SER A 170 ? 0.7873 1.1475 1.0312 -0.0400 -0.2675 0.1525  170 SER A OG  
1235 N N   . LEU A 171 ? 0.6233 0.9629 0.7600 -0.0654 -0.2740 0.1821  171 LEU A N   
1236 C CA  . LEU A 171 ? 0.6212 0.9394 0.7415 -0.0641 -0.2653 0.1915  171 LEU A CA  
1237 C C   . LEU A 171 ? 0.7054 1.0248 0.8135 -0.0680 -0.2857 0.2193  171 LEU A C   
1238 O O   . LEU A 171 ? 0.6992 1.0032 0.8196 -0.0598 -0.2860 0.2340  171 LEU A O   
1239 C CB  . LEU A 171 ? 0.6152 0.9250 0.6948 -0.0756 -0.2466 0.1751  171 LEU A CB  
1240 C CG  . LEU A 171 ? 0.6710 0.9600 0.7286 -0.0772 -0.2351 0.1813  171 LEU A CG  
1241 C CD1 . LEU A 171 ? 0.6477 0.9189 0.7362 -0.0622 -0.2219 0.1780  171 LEU A CD1 
1242 C CD2 . LEU A 171 ? 0.6809 0.9672 0.6990 -0.0906 -0.2196 0.1650  171 LEU A CD2 
1243 N N   . ARG A 172 ? 0.6930 1.0308 0.7785 -0.0805 -0.3033 0.2267  172 ARG A N   
1244 C CA  . ARG A 172 ? 0.7271 1.0688 0.7980 -0.0862 -0.3255 0.2543  172 ARG A CA  
1245 C C   . ARG A 172 ? 0.7833 1.1269 0.9034 -0.0704 -0.3425 0.2731  172 ARG A C   
1246 O O   . ARG A 172 ? 0.7892 1.1198 0.9132 -0.0658 -0.3496 0.2948  172 ARG A O   
1247 C CB  . ARG A 172 ? 0.7374 1.1010 0.7754 -0.1035 -0.3405 0.2546  172 ARG A CB  
1248 C CG  . ARG A 172 ? 0.8720 1.2357 0.8717 -0.1166 -0.3569 0.2789  172 ARG A CG  
1249 C CD  . ARG A 172 ? 1.0572 1.4398 1.0139 -0.1373 -0.3647 0.2730  172 ARG A CD  
1250 N NE  . ARG A 172 ? 1.2176 1.5934 1.1374 -0.1492 -0.3407 0.2495  172 ARG A NE  
1251 C CZ  . ARG A 172 ? 1.3981 1.7864 1.3090 -0.1571 -0.3321 0.2251  172 ARG A CZ  
1252 N NH1 . ARG A 172 ? 1.2397 1.6484 1.1739 -0.1552 -0.3454 0.2205  172 ARG A NH1 
1253 N NH2 . ARG A 172 ? 1.1927 1.5731 1.0730 -0.1670 -0.3100 0.2050  172 ARG A NH2 
1254 N N   . ASP A 173 ? 0.7402 1.0991 0.8996 -0.0619 -0.3474 0.2638  173 ASP A N   
1255 C CA  . ASP A 173 ? 0.7444 1.1085 0.9574 -0.0464 -0.3620 0.2771  173 ASP A CA  
1256 C C   . ASP A 173 ? 0.7432 1.0840 0.9858 -0.0311 -0.3480 0.2792  173 ASP A C   
1257 O O   . ASP A 173 ? 0.7467 1.0819 1.0155 -0.0220 -0.3611 0.3006  173 ASP A O   
1258 C CB  . ASP A 173 ? 0.7642 1.1494 1.0106 -0.0423 -0.3642 0.2604  173 ASP A CB  
1259 C CG  . ASP A 173 ? 1.0060 1.4006 1.3107 -0.0273 -0.3797 0.2722  173 ASP A CG  
1260 O OD1 . ASP A 173 ? 1.0527 1.4666 1.3650 -0.0303 -0.4052 0.2881  173 ASP A OD1 
1261 O OD2 . ASP A 173 ? 1.0898 1.4731 1.4335 -0.0129 -0.3663 0.2646  173 ASP A OD2 
1262 N N   . ILE A 174 ? 0.6522 0.9790 0.8902 -0.0289 -0.3220 0.2573  174 ILE A N   
1263 C CA  . ILE A 174 ? 0.6229 0.9274 0.8848 -0.0162 -0.3064 0.2557  174 ILE A CA  
1264 C C   . ILE A 174 ? 0.6806 0.9667 0.9199 -0.0188 -0.3091 0.2765  174 ILE A C   
1265 O O   . ILE A 174 ? 0.6938 0.9704 0.9632 -0.0082 -0.3163 0.2933  174 ILE A O   
1266 C CB  . ILE A 174 ? 0.6256 0.9212 0.8826 -0.0155 -0.2794 0.2277  174 ILE A CB  
1267 C CG1 . ILE A 174 ? 0.6042 0.9143 0.8952 -0.0095 -0.2762 0.2097  174 ILE A CG1 
1268 C CG2 . ILE A 174 ? 0.6204 0.8911 0.8877 -0.0067 -0.2627 0.2268  174 ILE A CG2 
1269 C CD1 . ILE A 174 ? 0.6694 0.9784 0.9425 -0.0150 -0.2556 0.1827  174 ILE A CD1 
1270 N N   . LEU A 175 ? 0.6297 0.9115 0.8174 -0.0336 -0.3037 0.2756  175 LEU A N   
1271 C CA  . LEU A 175 ? 0.6486 0.9136 0.8074 -0.0394 -0.3039 0.2930  175 LEU A CA  
1272 C C   . LEU A 175 ? 0.7394 1.0061 0.9040 -0.0389 -0.3289 0.3243  175 LEU A C   
1273 O O   . LEU A 175 ? 0.7374 0.9858 0.8960 -0.0379 -0.3284 0.3408  175 LEU A O   
1274 C CB  . LEU A 175 ? 0.6580 0.9231 0.7604 -0.0573 -0.2944 0.2840  175 LEU A CB  
1275 C CG  . LEU A 175 ? 0.6746 0.9287 0.7654 -0.0582 -0.2672 0.2583  175 LEU A CG  
1276 C CD1 . LEU A 175 ? 0.6830 0.9440 0.7253 -0.0758 -0.2607 0.2469  175 LEU A CD1 
1277 C CD2 . LEU A 175 ? 0.6735 0.9035 0.7693 -0.0519 -0.2536 0.2627  175 LEU A CD2 
1278 N N   . SER A 176 ? 0.7359 1.0242 0.9140 -0.0394 -0.3510 0.3330  176 SER A N   
1279 C CA  . SER A 176 ? 0.7824 1.0756 0.9682 -0.0391 -0.3783 0.3639  176 SER A CA  
1280 C C   . SER A 176 ? 0.8627 1.1408 1.0972 -0.0216 -0.3826 0.3803  176 SER A C   
1281 O O   . SER A 176 ? 0.8788 1.1541 1.1162 -0.0213 -0.4030 0.4087  176 SER A O   
1282 C CB  . SER A 176 ? 0.8313 1.1529 1.0244 -0.0431 -0.4005 0.3666  176 SER A CB  
1283 O OG  . SER A 176 ? 0.9149 1.2462 1.1678 -0.0269 -0.4083 0.3658  176 SER A OG  
1284 N N   . ARG A 177 ? 0.8116 1.0790 1.0833 -0.0077 -0.3631 0.3625  177 ARG A N   
1285 C CA  . ARG A 177 ? 0.8185 1.0707 1.1384 0.0087  -0.3638 0.3741  177 ARG A CA  
1286 C C   . ARG A 177 ? 0.9166 1.1430 1.2173 0.0067  -0.3592 0.3913  177 ARG A C   
1287 O O   . ARG A 177 ? 0.9156 1.1292 1.2515 0.0180  -0.3654 0.4080  177 ARG A O   
1288 C CB  . ARG A 177 ? 0.7746 1.0254 1.1402 0.0227  -0.3458 0.3501  177 ARG A CB  
1289 C CG  . ARG A 177 ? 0.9050 1.1364 1.2573 0.0229  -0.3172 0.3297  177 ARG A CG  
1290 C CD  . ARG A 177 ? 1.0090 1.2393 1.4057 0.0357  -0.3012 0.3080  177 ARG A CD  
1291 N NE  . ARG A 177 ? 1.0400 1.2893 1.4345 0.0323  -0.2961 0.2856  177 ARG A NE  
1292 C CZ  . ARG A 177 ? 1.1260 1.3750 1.5445 0.0389  -0.2784 0.2623  177 ARG A CZ  
1293 N NH1 . ARG A 177 ? 0.8947 1.1259 1.3402 0.0489  -0.2638 0.2568  177 ARG A NH1 
1294 N NH2 . ARG A 177 ? 0.9493 1.2152 1.3638 0.0346  -0.2749 0.2440  177 ARG A NH2 
1295 N N   . TRP A 178 ? 0.9043 1.1239 1.1499 -0.0084 -0.3489 0.3873  178 TRP A N   
1296 C CA  . TRP A 178 ? 0.9329 1.1304 1.1497 -0.0146 -0.3436 0.4019  178 TRP A CA  
1297 C C   . TRP A 178 ? 1.0191 1.2248 1.1820 -0.0333 -0.3583 0.4180  178 TRP A C   
1298 O O   . TRP A 178 ? 1.0177 1.2455 1.1639 -0.0417 -0.3686 0.4130  178 TRP A O   
1299 C CB  . TRP A 178 ? 0.9012 1.0838 1.0993 -0.0172 -0.3143 0.3784  178 TRP A CB  
1300 C CG  . TRP A 178 ? 0.8826 1.0576 1.1237 -0.0022 -0.2969 0.3586  178 TRP A CG  
1301 C CD1 . TRP A 178 ? 0.9144 1.0694 1.1882 0.0094  -0.2892 0.3629  178 TRP A CD1 
1302 C CD2 . TRP A 178 ? 0.8480 1.0337 1.0994 0.0008  -0.2832 0.3301  178 TRP A CD2 
1303 N NE1 . TRP A 178 ? 0.8716 1.0256 1.1756 0.0193  -0.2722 0.3388  178 TRP A NE1 
1304 C CE2 . TRP A 178 ? 0.8727 1.0450 1.1631 0.0143  -0.2684 0.3190  178 TRP A CE2 
1305 C CE3 . TRP A 178 ? 0.8554 1.0605 1.0868 -0.0071 -0.2820 0.3129  178 TRP A CE3 
1306 C CZ2 . TRP A 178 ? 0.8319 1.0096 1.1402 0.0197  -0.2531 0.2926  178 TRP A CZ2 
1307 C CZ3 . TRP A 178 ? 0.8433 1.0531 1.0946 -0.0010 -0.2670 0.2873  178 TRP A CZ3 
1308 C CH2 . TRP A 178 ? 0.8292 1.0255 1.1175 0.0121  -0.2530 0.2778  178 TRP A CH2 
1309 N N   . LYS A 179 ? 1.0090 1.1968 1.1437 -0.0409 -0.3580 0.4364  179 LYS A N   
1310 C CA  . LYS A 179 ? 1.0469 1.2383 1.1257 -0.0606 -0.3685 0.4521  179 LYS A CA  
1311 C C   . LYS A 179 ? 1.0877 1.2676 1.1233 -0.0727 -0.3428 0.4346  179 LYS A C   
1312 O O   . LYS A 179 ? 1.0529 1.2144 1.1048 -0.0647 -0.3236 0.4252  179 LYS A O   
1313 C CB  . LYS A 179 ? 1.1157 1.2938 1.1957 -0.0607 -0.3879 0.4888  179 LYS A CB  
1314 C CG  . LYS A 179 ? 1.2422 1.4294 1.3693 -0.0476 -0.4147 0.5097  179 LYS A CG  
1315 C CD  . LYS A 179 ? 1.3935 1.6063 1.4989 -0.0587 -0.4404 0.5211  179 LYS A CD  
1316 C CE  . LYS A 179 ? 1.4817 1.7068 1.6394 -0.0446 -0.4663 0.5382  179 LYS A CE  
1317 N NZ  . LYS A 179 ? 1.5440 1.7976 1.6832 -0.0552 -0.4894 0.5433  179 LYS A NZ  
1318 N N   . PRO A 180 ? 1.0644 1.2544 1.0462 -0.0923 -0.3415 0.4297  180 PRO A N   
1319 C CA  . PRO A 180 ? 1.0610 1.2401 1.0060 -0.1033 -0.3162 0.4126  180 PRO A CA  
1320 C C   . PRO A 180 ? 1.1507 1.3035 1.0942 -0.1020 -0.3057 0.4248  180 PRO A C   
1321 O O   . PRO A 180 ? 1.1247 1.2661 1.0657 -0.1012 -0.2819 0.4062  180 PRO A O   
1322 C CB  . PRO A 180 ? 1.1109 1.3042 1.0000 -0.1255 -0.3228 0.4145  180 PRO A CB  
1323 C CG  . PRO A 180 ? 1.1641 1.3808 1.0658 -0.1240 -0.3448 0.4179  180 PRO A CG  
1324 C CD  . PRO A 180 ? 1.1053 1.3175 1.0585 -0.1057 -0.3621 0.4381  180 PRO A CD  
1325 N N   . GLU A 181 ? 1.1631 1.3063 1.1112 -0.1011 -0.3238 0.4564  181 GLU A N   
1326 C CA  . GLU A 181 ? 1.1813 1.2987 1.1310 -0.0997 -0.3168 0.4721  181 GLU A CA  
1327 C C   . GLU A 181 ? 1.2021 1.3041 1.2024 -0.0804 -0.3019 0.4603  181 GLU A C   
1328 O O   . GLU A 181 ? 1.2044 1.2860 1.2017 -0.0810 -0.2864 0.4605  181 GLU A O   
1329 C CB  . GLU A 181 ? 1.2465 1.3577 1.1921 -0.1028 -0.3423 0.5103  181 GLU A CB  
1330 C CG  . GLU A 181 ? 1.4061 1.5276 1.3971 -0.0881 -0.3673 0.5253  181 GLU A CG  
1331 C CD  . GLU A 181 ? 1.7912 1.8982 1.7984 -0.0837 -0.3879 0.5621  181 GLU A CD  
1332 O OE1 . GLU A 181 ? 1.8169 1.9096 1.8749 -0.0659 -0.3861 0.5664  181 GLU A OE1 
1333 O OE2 . GLU A 181 ? 1.7544 1.8643 1.7242 -0.0983 -0.4061 0.5868  181 GLU A OE2 
1334 N N   . ASP A 182 ? 1.1268 1.2391 1.1724 -0.0645 -0.3059 0.4492  182 ASP A N   
1335 C CA  . ASP A 182 ? 1.0904 1.1906 1.1851 -0.0466 -0.2926 0.4366  182 ASP A CA  
1336 C C   . ASP A 182 ? 1.0973 1.1892 1.1824 -0.0481 -0.2641 0.4088  182 ASP A C   
1337 O O   . ASP A 182 ? 1.0732 1.1481 1.1866 -0.0380 -0.2517 0.4041  182 ASP A O   
1338 C CB  . ASP A 182 ? 1.0943 1.2101 1.2355 -0.0317 -0.3023 0.4288  182 ASP A CB  
1339 C CG  . ASP A 182 ? 1.2973 1.4202 1.4629 -0.0259 -0.3305 0.4560  182 ASP A CG  
1340 O OD1 . ASP A 182 ? 1.3675 1.4829 1.5117 -0.0338 -0.3449 0.4835  182 ASP A OD1 
1341 O OD2 . ASP A 182 ? 1.3515 1.4877 1.5581 -0.0137 -0.3384 0.4501  182 ASP A OD2 
1342 N N   . ALA A 183 ? 1.0459 1.1495 1.0925 -0.0607 -0.2539 0.3903  183 ALA A N   
1343 C CA  . ALA A 183 ? 1.0157 1.1134 1.0521 -0.0629 -0.2281 0.3640  183 ALA A CA  
1344 C C   . ALA A 183 ? 1.0763 1.1514 1.1020 -0.0669 -0.2154 0.3711  183 ALA A C   
1345 O O   . ALA A 183 ? 1.0441 1.1088 1.0844 -0.0612 -0.1967 0.3544  183 ALA A O   
1346 C CB  . ALA A 183 ? 1.0238 1.1374 1.0190 -0.0775 -0.2222 0.3478  183 ALA A CB  
1347 N N   . LYS A 184 ? 1.0770 1.1447 1.0783 -0.0769 -0.2264 0.3969  184 LYS A N   
1348 C CA  . LYS A 184 ? 1.0978 1.1439 1.0861 -0.0828 -0.2172 0.4087  184 LYS A CA  
1349 C C   . LYS A 184 ? 1.1559 1.1827 1.1902 -0.0672 -0.2184 0.4200  184 LYS A C   
1350 O O   . LYS A 184 ? 1.1559 1.1635 1.1897 -0.0688 -0.2055 0.4220  184 LYS A O   
1351 C CB  . LYS A 184 ? 1.1784 1.2243 1.1230 -0.0999 -0.2301 0.4336  184 LYS A CB  
1352 C CG  . LYS A 184 ? 1.3778 1.4418 1.2745 -0.1174 -0.2273 0.4219  184 LYS A CG  
1353 C CD  . LYS A 184 ? 1.5924 1.6582 1.4470 -0.1344 -0.2434 0.4480  184 LYS A CD  
1354 C CE  . LYS A 184 ? 1.7335 1.8197 1.5438 -0.1514 -0.2435 0.4364  184 LYS A CE  
1355 N NZ  . LYS A 184 ? 1.7946 1.9023 1.6182 -0.1458 -0.2617 0.4343  184 LYS A NZ  
1356 N N   . ASN A 185 ? 1.1173 1.1494 1.1925 -0.0526 -0.2334 0.4265  185 ASN A N   
1357 C CA  . ASN A 185 ? 1.1190 1.1346 1.2432 -0.0369 -0.2349 0.4354  185 ASN A CA  
1358 C C   . ASN A 185 ? 1.1386 1.1555 1.2989 -0.0236 -0.2188 0.4068  185 ASN A C   
1359 O O   . ASN A 185 ? 1.1170 1.1509 1.2959 -0.0164 -0.2241 0.3953  185 ASN A O   
1360 C CB  . ASN A 185 ? 1.1726 1.1927 1.3220 -0.0293 -0.2613 0.4613  185 ASN A CB  
1361 C CG  . ASN A 185 ? 1.4816 1.4838 1.6834 -0.0134 -0.2644 0.4730  185 ASN A CG  
1362 O OD1 . ASN A 185 ? 1.4112 1.3956 1.6313 -0.0081 -0.2466 0.4628  185 ASN A OD1 
1363 N ND2 . ASN A 185 ? 1.3682 1.3749 1.5965 -0.0058 -0.2874 0.4949  185 ASN A ND2 
1364 N N   . PRO A 186 ? 1.0868 1.0863 1.2568 -0.0211 -0.1992 0.3952  186 PRO A N   
1365 C CA  . PRO A 186 ? 1.0425 1.0433 1.2420 -0.0105 -0.1835 0.3678  186 PRO A CA  
1366 C C   . PRO A 186 ? 1.0679 1.0727 1.3182 0.0059  -0.1910 0.3657  186 PRO A C   
1367 O O   . PRO A 186 ? 1.0255 1.0435 1.2880 0.0111  -0.1853 0.3442  186 PRO A O   
1368 C CB  . PRO A 186 ? 1.0634 1.0429 1.2641 -0.0120 -0.1648 0.3619  186 PRO A CB  
1369 C CG  . PRO A 186 ? 1.1608 1.1251 1.3463 -0.0193 -0.1728 0.3896  186 PRO A CG  
1370 C CD  . PRO A 186 ? 1.1298 1.1088 1.2810 -0.0296 -0.1898 0.4053  186 PRO A CD  
1371 N N   . GLN A 187 ? 1.0451 1.0391 1.3256 0.0138  -0.2038 0.3880  187 GLN A N   
1372 C CA  . GLN A 187 ? 1.0263 1.0233 1.3597 0.0297  -0.2107 0.3872  187 GLN A CA  
1373 C C   . GLN A 187 ? 1.0533 1.0744 1.3953 0.0330  -0.2287 0.3898  187 GLN A C   
1374 O O   . GLN A 187 ? 1.0426 1.0684 1.4303 0.0461  -0.2326 0.3858  187 GLN A O   
1375 C CB  . GLN A 187 ? 1.0657 1.0414 1.4355 0.0384  -0.2157 0.4072  187 GLN A CB  
1376 C CG  . GLN A 187 ? 1.3664 1.3357 1.7189 0.0321  -0.2353 0.4411  187 GLN A CG  
1377 C CD  . GLN A 187 ? 1.6579 1.6017 1.9982 0.0263  -0.2254 0.4516  187 GLN A CD  
1378 O OE1 . GLN A 187 ? 1.6022 1.5427 1.8997 0.0131  -0.2138 0.4456  187 GLN A OE1 
1379 N NE2 . GLN A 187 ? 1.5853 1.5102 1.9651 0.0360  -0.2290 0.4665  187 GLN A NE2 
1380 N N   . LYS A 188 ? 0.9953 1.0321 1.2949 0.0208  -0.2385 0.3948  188 LYS A N   
1381 C CA  . LYS A 188 ? 0.9805 1.0415 1.2853 0.0222  -0.2556 0.3962  188 LYS A CA  
1382 C C   . LYS A 188 ? 0.9652 1.0416 1.2780 0.0256  -0.2434 0.3657  188 LYS A C   
1383 O O   . LYS A 188 ? 0.9517 1.0461 1.2862 0.0312  -0.2545 0.3631  188 LYS A O   
1384 C CB  . LYS A 188 ? 1.0409 1.1129 1.2981 0.0072  -0.2713 0.4132  188 LYS A CB  
1385 C CG  . LYS A 188 ? 1.2554 1.3184 1.5139 0.0060  -0.2923 0.4482  188 LYS A CG  
1386 C CD  . LYS A 188 ? 1.3744 1.4522 1.6683 0.0154  -0.3170 0.4636  188 LYS A CD  
1387 C CE  . LYS A 188 ? 1.5502 1.6207 1.8381 0.0119  -0.3399 0.5001  188 LYS A CE  
1388 N NZ  . LYS A 188 ? 1.6612 1.7497 1.9784 0.0190  -0.3665 0.5158  188 LYS A NZ  
1389 N N   . ASN A 189 ? 0.8728 0.9420 1.1690 0.0219  -0.2208 0.3433  189 ASN A N   
1390 C CA  . ASN A 189 ? 0.8165 0.8955 1.1171 0.0242  -0.2059 0.3139  189 ASN A CA  
1391 C C   . ASN A 189 ? 0.8025 0.9047 1.0778 0.0165  -0.2117 0.3043  189 ASN A C   
1392 O O   . ASN A 189 ? 0.7433 0.8588 1.0403 0.0226  -0.2114 0.2900  189 ASN A O   
1393 C CB  . ASN A 189 ? 0.8302 0.9059 1.1841 0.0394  -0.2004 0.3034  189 ASN A CB  
1394 C CG  . ASN A 189 ? 1.1742 1.2468 1.5318 0.0412  -0.1784 0.2752  189 ASN A CG  
1395 O OD1 . ASN A 189 ? 1.0897 1.1736 1.4680 0.0468  -0.1750 0.2589  189 ASN A OD1 
1396 N ND2 . ASN A 189 ? 1.0918 1.1484 1.4308 0.0365  -0.1634 0.2694  189 ASN A ND2 
1397 N N   . THR A 190 ? 0.7807 0.8870 1.0092 0.0023  -0.2154 0.3110  190 THR A N   
1398 C CA  . THR A 190 ? 0.7756 0.9023 0.9744 -0.0075 -0.2196 0.3019  190 THR A CA  
1399 C C   . THR A 190 ? 0.7833 0.9126 0.9738 -0.0089 -0.1994 0.2725  190 THR A C   
1400 O O   . THR A 190 ? 0.7657 0.8797 0.9589 -0.0067 -0.1827 0.2630  190 THR A O   
1401 C CB  . THR A 190 ? 0.9347 1.0628 1.0853 -0.0235 -0.2270 0.3168  190 THR A CB  
1402 O OG1 . THR A 190 ? 0.9704 1.0806 1.0993 -0.0294 -0.2114 0.3151  190 THR A OG1 
1403 C CG2 . THR A 190 ? 0.9496 1.0799 1.1035 -0.0241 -0.2510 0.3465  190 THR A CG2 
1404 N N   . PRO A 191 ? 0.7182 0.8659 0.8987 -0.0129 -0.2005 0.2581  191 PRO A N   
1405 C CA  . PRO A 191 ? 0.6789 0.8274 0.8534 -0.0137 -0.1817 0.2315  191 PRO A CA  
1406 C C   . PRO A 191 ? 0.7184 0.8563 0.8590 -0.0231 -0.1661 0.2238  191 PRO A C   
1407 O O   . PRO A 191 ? 0.7452 0.8840 0.8516 -0.0348 -0.1698 0.2332  191 PRO A O   
1408 C CB  . PRO A 191 ? 0.6936 0.8637 0.8604 -0.0182 -0.1888 0.2221  191 PRO A CB  
1409 C CG  . PRO A 191 ? 0.7733 0.9540 0.9606 -0.0140 -0.2102 0.2404  191 PRO A CG  
1410 C CD  . PRO A 191 ? 0.7487 0.9171 0.9261 -0.0164 -0.2189 0.2649  191 PRO A CD  
1411 N N   . LYS A 192 ? 0.6273 0.7550 0.7786 -0.0182 -0.1488 0.2070  192 LYS A N   
1412 C CA  . LYS A 192 ? 0.6064 0.7243 0.7325 -0.0254 -0.1331 0.1978  192 LYS A CA  
1413 C C   . LYS A 192 ? 0.6350 0.7649 0.7327 -0.0351 -0.1273 0.1819  192 LYS A C   
1414 O O   . LYS A 192 ? 0.6473 0.7752 0.7140 -0.0459 -0.1216 0.1816  192 LYS A O   
1415 C CB  . LYS A 192 ? 0.5982 0.7019 0.7472 -0.0169 -0.1184 0.1860  192 LYS A CB  
1416 C CG  . LYS A 192 ? 0.5728 0.6615 0.7475 -0.0090 -0.1209 0.2003  192 LYS A CG  
1417 C CD  . LYS A 192 ? 0.6083 0.6830 0.7631 -0.0160 -0.1172 0.2123  192 LYS A CD  
1418 C CE  . LYS A 192 ? 0.7291 0.7856 0.9106 -0.0081 -0.1118 0.2172  192 LYS A CE  
1419 N NZ  . LYS A 192 ? 0.8690 0.9184 1.0587 -0.0053 -0.0945 0.1966  192 LYS A NZ  
1420 N N   . PHE A 193 ? 0.5496 0.6915 0.6587 -0.0317 -0.1280 0.1684  193 PHE A N   
1421 C CA  . PHE A 193 ? 0.5289 0.6817 0.6154 -0.0400 -0.1224 0.1525  193 PHE A CA  
1422 C C   . PHE A 193 ? 0.5547 0.7233 0.6543 -0.0374 -0.1302 0.1455  193 PHE A C   
1423 O O   . PHE A 193 ? 0.5363 0.7071 0.6664 -0.0278 -0.1375 0.1500  193 PHE A O   
1424 C CB  . PHE A 193 ? 0.5284 0.6724 0.6128 -0.0394 -0.1038 0.1336  193 PHE A CB  
1425 C CG  . PHE A 193 ? 0.5242 0.6635 0.6387 -0.0283 -0.0971 0.1220  193 PHE A CG  
1426 C CD1 . PHE A 193 ? 0.5602 0.6845 0.6919 -0.0214 -0.0899 0.1232  193 PHE A CD1 
1427 C CD2 . PHE A 193 ? 0.5307 0.6804 0.6547 -0.0261 -0.0969 0.1090  193 PHE A CD2 
1428 C CE1 . PHE A 193 ? 0.5432 0.6635 0.6996 -0.0129 -0.0828 0.1115  193 PHE A CE1 
1429 C CE2 . PHE A 193 ? 0.5437 0.6887 0.6925 -0.0175 -0.0898 0.0981  193 PHE A CE2 
1430 C CZ  . PHE A 193 ? 0.5141 0.6446 0.6780 -0.0112 -0.0827 0.0993  193 PHE A CZ  
1431 N N   . LEU A 194 ? 0.5046 0.6838 0.5826 -0.0462 -0.1270 0.1328  194 LEU A N   
1432 C CA  . LEU A 194 ? 0.4886 0.6825 0.5746 -0.0460 -0.1309 0.1219  194 LEU A CA  
1433 C C   . LEU A 194 ? 0.5113 0.7013 0.5923 -0.0472 -0.1142 0.1004  194 LEU A C   
1434 O O   . LEU A 194 ? 0.5109 0.6968 0.5672 -0.0552 -0.1050 0.0943  194 LEU A O   
1435 C CB  . LEU A 194 ? 0.5132 0.7234 0.5763 -0.0571 -0.1436 0.1273  194 LEU A CB  
1436 C CG  . LEU A 194 ? 0.5698 0.7956 0.6389 -0.0588 -0.1462 0.1137  194 LEU A CG  
1437 C CD1 . LEU A 194 ? 0.5772 0.8183 0.6592 -0.0578 -0.1659 0.1263  194 LEU A CD1 
1438 C CD2 . LEU A 194 ? 0.6314 0.8628 0.6688 -0.0717 -0.1388 0.1001  194 LEU A CD2 
1439 N N   . TYR A 195 ? 0.4356 0.6260 0.5413 -0.0391 -0.1099 0.0894  195 TYR A N   
1440 C CA  . TYR A 195 ? 0.4084 0.5946 0.5126 -0.0392 -0.0957 0.0704  195 TYR A CA  
1441 C C   . TYR A 195 ? 0.4856 0.6862 0.5872 -0.0439 -0.0985 0.0596  195 TYR A C   
1442 O O   . TYR A 195 ? 0.4772 0.6881 0.5967 -0.0405 -0.1082 0.0626  195 TYR A O   
1443 C CB  . TYR A 195 ? 0.3856 0.5609 0.5164 -0.0285 -0.0880 0.0653  195 TYR A CB  
1444 C CG  . TYR A 195 ? 0.3641 0.5369 0.4958 -0.0284 -0.0763 0.0471  195 TYR A CG  
1445 C CD1 . TYR A 195 ? 0.3753 0.5380 0.4935 -0.0310 -0.0645 0.0389  195 TYR A CD1 
1446 C CD2 . TYR A 195 ? 0.3533 0.5343 0.4995 -0.0264 -0.0773 0.0385  195 TYR A CD2 
1447 C CE1 . TYR A 195 ? 0.3631 0.5232 0.4824 -0.0310 -0.0552 0.0238  195 TYR A CE1 
1448 C CE2 . TYR A 195 ? 0.3390 0.5168 0.4844 -0.0272 -0.0671 0.0231  195 TYR A CE2 
1449 C CZ  . TYR A 195 ? 0.4083 0.5754 0.5401 -0.0294 -0.0566 0.0164  195 TYR A CZ  
1450 O OH  . TYR A 195 ? 0.3892 0.5525 0.5215 -0.0298 -0.0478 0.0028  195 TYR A OH  
1451 N N   . THR A 196 ? 0.4603 0.6613 0.5423 -0.0515 -0.0895 0.0463  196 THR A N   
1452 C CA  . THR A 196 ? 0.4601 0.6731 0.5386 -0.0569 -0.0903 0.0343  196 THR A CA  
1453 C C   . THR A 196 ? 0.4924 0.6998 0.5615 -0.0605 -0.0762 0.0170  196 THR A C   
1454 O O   . THR A 196 ? 0.4808 0.6796 0.5352 -0.0637 -0.0676 0.0146  196 THR A O   
1455 C CB  . THR A 196 ? 0.5874 0.8159 0.6484 -0.0666 -0.1031 0.0412  196 THR A CB  
1456 O OG1 . THR A 196 ? 0.6012 0.8421 0.6648 -0.0708 -0.1050 0.0297  196 THR A OG1 
1457 C CG2 . THR A 196 ? 0.5368 0.7635 0.5656 -0.0775 -0.0998 0.0430  196 THR A CG2 
1458 N N   . VAL A 197 ? 0.4445 0.6567 0.5238 -0.0601 -0.0740 0.0052  197 VAL A N   
1459 C CA  . VAL A 197 ? 0.4384 0.6464 0.5116 -0.0638 -0.0623 -0.0112 197 VAL A CA  
1460 C C   . VAL A 197 ? 0.4967 0.7188 0.5541 -0.0747 -0.0671 -0.0165 197 VAL A C   
1461 O O   . VAL A 197 ? 0.4877 0.7210 0.5551 -0.0753 -0.0744 -0.0179 197 VAL A O   
1462 C CB  . VAL A 197 ? 0.4669 0.6696 0.5612 -0.0569 -0.0567 -0.0198 197 VAL A CB  
1463 C CG1 . VAL A 197 ? 0.4526 0.6505 0.5403 -0.0612 -0.0460 -0.0352 197 VAL A CG1 
1464 C CG2 . VAL A 197 ? 0.4514 0.6412 0.5599 -0.0473 -0.0530 -0.0143 197 VAL A CG2 
1465 N N   . PRO A 198 ? 0.4626 0.6858 0.4957 -0.0841 -0.0639 -0.0186 198 PRO A N   
1466 C CA  . PRO A 198 ? 0.4820 0.7197 0.4977 -0.0961 -0.0694 -0.0228 198 PRO A CA  
1467 C C   . PRO A 198 ? 0.5287 0.7709 0.5465 -0.1010 -0.0638 -0.0400 198 PRO A C   
1468 O O   . PRO A 198 ? 0.5461 0.8025 0.5574 -0.1088 -0.0715 -0.0424 198 PRO A O   
1469 C CB  . PRO A 198 ? 0.5226 0.7583 0.5116 -0.1051 -0.0651 -0.0211 198 PRO A CB  
1470 C CG  . PRO A 198 ? 0.5694 0.7914 0.5644 -0.0968 -0.0611 -0.0117 198 PRO A CG  
1471 C CD  . PRO A 198 ? 0.4839 0.6964 0.5042 -0.0853 -0.0554 -0.0170 198 PRO A CD  
1472 N N   . ASN A 199 ? 0.4571 0.6874 0.4840 -0.0969 -0.0511 -0.0514 199 ASN A N   
1473 C CA  . ASN A 199 ? 0.4414 0.6724 0.4718 -0.1010 -0.0442 -0.0677 199 ASN A CA  
1474 C C   . ASN A 199 ? 0.4699 0.6941 0.5240 -0.0917 -0.0418 -0.0701 199 ASN A C   
1475 O O   . ASN A 199 ? 0.4407 0.6514 0.5039 -0.0836 -0.0355 -0.0683 199 ASN A O   
1476 C CB  . ASN A 199 ? 0.4220 0.6443 0.4410 -0.1061 -0.0305 -0.0799 199 ASN A CB  
1477 C CG  . ASN A 199 ? 0.6111 0.8405 0.6050 -0.1176 -0.0301 -0.0808 199 ASN A CG  
1478 O OD1 . ASN A 199 ? 0.6387 0.8803 0.6200 -0.1283 -0.0335 -0.0870 199 ASN A OD1 
1479 N ND2 . ASN A 199 ? 0.3852 0.6073 0.3710 -0.1165 -0.0256 -0.0752 199 ASN A ND2 
1480 N N   . GLY A 200 ? 0.4478 0.6819 0.5108 -0.0941 -0.0467 -0.0748 200 GLY A N   
1481 C CA  . GLY A 200 ? 0.4395 0.6692 0.5235 -0.0879 -0.0441 -0.0787 200 GLY A CA  
1482 C C   . GLY A 200 ? 0.4880 0.7109 0.5876 -0.0767 -0.0461 -0.0678 200 GLY A C   
1483 O O   . GLY A 200 ? 0.4792 0.6882 0.5865 -0.0709 -0.0377 -0.0704 200 GLY A O   
1484 N N   . ASN A 201 ? 0.4423 0.6748 0.5467 -0.0741 -0.0574 -0.0556 201 ASN A N   
1485 C CA  . ASN A 201 ? 0.4273 0.6549 0.5483 -0.0640 -0.0601 -0.0451 201 ASN A CA  
1486 C C   . ASN A 201 ? 0.4595 0.6799 0.6001 -0.0582 -0.0533 -0.0512 201 ASN A C   
1487 O O   . ASN A 201 ? 0.4628 0.6899 0.6118 -0.0613 -0.0529 -0.0593 201 ASN A O   
1488 C CB  . ASN A 201 ? 0.4307 0.6729 0.5594 -0.0631 -0.0747 -0.0332 201 ASN A CB  
1489 C CG  . ASN A 201 ? 0.5895 0.8279 0.7404 -0.0526 -0.0774 -0.0237 201 ASN A CG  
1490 O OD1 . ASN A 201 ? 0.5969 0.8241 0.7461 -0.0474 -0.0748 -0.0164 201 ASN A OD1 
1491 N ND2 . ASN A 201 ? 0.3621 0.6095 0.5358 -0.0495 -0.0815 -0.0250 201 ASN A ND2 
1492 N N   . ASN A 202 ? 0.3853 0.5922 0.5322 -0.0507 -0.0477 -0.0476 202 ASN A N   
1493 C CA  . ASN A 202 ? 0.3710 0.5704 0.5343 -0.0459 -0.0412 -0.0521 202 ASN A CA  
1494 C C   . ASN A 202 ? 0.4361 0.6448 0.6205 -0.0405 -0.0488 -0.0446 202 ASN A C   
1495 O O   . ASN A 202 ? 0.4487 0.6566 0.6352 -0.0360 -0.0539 -0.0339 202 ASN A O   
1496 C CB  . ASN A 202 ? 0.3741 0.5562 0.5334 -0.0413 -0.0329 -0.0513 202 ASN A CB  
1497 C CG  . ASN A 202 ? 0.4370 0.6093 0.6071 -0.0383 -0.0250 -0.0568 202 ASN A CG  
1498 O OD1 . ASN A 202 ? 0.2524 0.4304 0.4369 -0.0382 -0.0251 -0.0601 202 ASN A OD1 
1499 N ND2 . ASN A 202 ? 0.2767 0.4344 0.4398 -0.0366 -0.0181 -0.0580 202 ASN A ND2 
1500 N N   . PRO A 203 ? 0.3679 0.5866 0.5691 -0.0413 -0.0505 -0.0495 203 PRO A N   
1501 C CA  . PRO A 203 ? 0.3547 0.5746 0.5577 -0.0467 -0.0445 -0.0617 203 PRO A CA  
1502 C C   . PRO A 203 ? 0.3668 0.6021 0.5662 -0.0548 -0.0504 -0.0671 203 PRO A C   
1503 O O   . PRO A 203 ? 0.3409 0.5759 0.5421 -0.0595 -0.0446 -0.0776 203 PRO A O   
1504 C CB  . PRO A 203 ? 0.3742 0.5962 0.6022 -0.0420 -0.0421 -0.0631 203 PRO A CB  
1505 C CG  . PRO A 203 ? 0.4364 0.6702 0.6795 -0.0370 -0.0534 -0.0522 203 PRO A CG  
1506 C CD  . PRO A 203 ? 0.3858 0.6136 0.6110 -0.0355 -0.0576 -0.0424 203 PRO A CD  
1507 N N   . THR A 204 ? 0.3191 0.5678 0.5139 -0.0569 -0.0623 -0.0598 204 THR A N   
1508 C CA  . THR A 204 ? 0.3134 0.5795 0.5054 -0.0652 -0.0702 -0.0640 204 THR A CA  
1509 C C   . THR A 204 ? 0.3529 0.6167 0.5243 -0.0749 -0.0644 -0.0752 204 THR A C   
1510 O O   . THR A 204 ? 0.3390 0.6130 0.5135 -0.0818 -0.0655 -0.0841 204 THR A O   
1511 C CB  . THR A 204 ? 0.4032 0.6838 0.5943 -0.0653 -0.0856 -0.0514 204 THR A CB  
1512 O OG1 . THR A 204 ? 0.4469 0.7206 0.6134 -0.0675 -0.0859 -0.0456 204 THR A OG1 
1513 C CG2 . THR A 204 ? 0.3757 0.6595 0.5919 -0.0557 -0.0918 -0.0407 204 THR A CG2 
1514 N N   . GLY A 205 ? 0.3074 0.5588 0.4592 -0.0756 -0.0586 -0.0751 205 GLY A N   
1515 C CA  . GLY A 205 ? 0.3093 0.5579 0.4427 -0.0843 -0.0525 -0.0857 205 GLY A CA  
1516 C C   . GLY A 205 ? 0.3658 0.6294 0.4830 -0.0930 -0.0618 -0.0841 205 GLY A C   
1517 O O   . GLY A 205 ? 0.3901 0.6544 0.4922 -0.1020 -0.0573 -0.0943 205 GLY A O   
1518 N N   . ASN A 206 ? 0.2992 0.5744 0.4193 -0.0908 -0.0749 -0.0709 206 ASN A N   
1519 C CA  . ASN A 206 ? 0.3139 0.6041 0.4172 -0.0994 -0.0862 -0.0663 206 ASN A CA  
1520 C C   . ASN A 206 ? 0.3815 0.6640 0.4611 -0.1014 -0.0842 -0.0602 206 ASN A C   
1521 O O   . ASN A 206 ? 0.3530 0.6222 0.4356 -0.0931 -0.0797 -0.0531 206 ASN A O   
1522 C CB  . ASN A 206 ? 0.2959 0.6029 0.4152 -0.0965 -0.1026 -0.0544 206 ASN A CB  
1523 C CG  . ASN A 206 ? 0.5597 0.8783 0.7018 -0.0971 -0.1053 -0.0618 206 ASN A CG  
1524 O OD1 . ASN A 206 ? 0.5385 0.8635 0.7056 -0.0896 -0.1120 -0.0548 206 ASN A OD1 
1525 N ND2 . ASN A 206 ? 0.4201 0.7419 0.5559 -0.1062 -0.0995 -0.0769 206 ASN A ND2 
1526 N N   . SER A 207 ? 0.3686 0.6598 0.4245 -0.1134 -0.0868 -0.0640 207 SER A N   
1527 C CA  . SER A 207 ? 0.3904 0.6759 0.4215 -0.1181 -0.0835 -0.0605 207 SER A CA  
1528 C C   . SER A 207 ? 0.5041 0.8041 0.5161 -0.1266 -0.0974 -0.0496 207 SER A C   
1529 O O   . SER A 207 ? 0.5394 0.8558 0.5481 -0.1347 -0.1071 -0.0521 207 SER A O   
1530 C CB  . SER A 207 ? 0.4320 0.7103 0.4490 -0.1260 -0.0688 -0.0778 207 SER A CB  
1531 O OG  . SER A 207 ? 0.5370 0.7996 0.5698 -0.1179 -0.0564 -0.0854 207 SER A OG  
1532 N N   . LEU A 208 ? 0.4664 0.7600 0.4644 -0.1256 -0.0984 -0.0376 208 LEU A N   
1533 C CA  . LEU A 208 ? 0.4917 0.7959 0.4677 -0.1341 -0.1111 -0.0248 208 LEU A CA  
1534 C C   . LEU A 208 ? 0.5921 0.9027 0.5373 -0.1509 -0.1061 -0.0368 208 LEU A C   
1535 O O   . LEU A 208 ? 0.5835 0.8847 0.5228 -0.1539 -0.0898 -0.0525 208 LEU A O   
1536 C CB  . LEU A 208 ? 0.4906 0.7832 0.4611 -0.1283 -0.1110 -0.0091 208 LEU A CB  
1537 C CG  . LEU A 208 ? 0.5395 0.8326 0.5311 -0.1168 -0.1243 0.0103  208 LEU A CG  
1538 C CD1 . LEU A 208 ? 0.5381 0.8154 0.5277 -0.1103 -0.1191 0.0210  208 LEU A CD1 
1539 C CD2 . LEU A 208 ? 0.5995 0.9096 0.5833 -0.1231 -0.1441 0.0242  208 LEU A CD2 
1540 N N   . THR A 209 ? 0.5873 0.9138 0.5131 -0.1620 -0.1202 -0.0292 209 THR A N   
1541 C CA  . THR A 209 ? 0.6094 0.9441 0.5025 -0.1801 -0.1171 -0.0398 209 THR A CA  
1542 C C   . THR A 209 ? 0.6887 1.0184 0.5529 -0.1870 -0.1159 -0.0294 209 THR A C   
1543 O O   . THR A 209 ? 0.6826 1.0061 0.5523 -0.1783 -0.1226 -0.0108 209 THR A O   
1544 C CB  . THR A 209 ? 0.7065 1.0629 0.5947 -0.1900 -0.1336 -0.0393 209 THR A CB  
1545 O OG1 . THR A 209 ? 0.7345 1.0993 0.6247 -0.1866 -0.1538 -0.0161 209 THR A OG1 
1546 C CG2 . THR A 209 ? 0.6589 1.0204 0.5748 -0.1851 -0.1328 -0.0518 209 THR A CG2 
1547 N N   . SER A 210 ? 0.6702 1.0026 0.5040 -0.2032 -0.1066 -0.0421 210 SER A N   
1548 C CA  . SER A 210 ? 0.6919 1.0205 0.4943 -0.2131 -0.1029 -0.0352 210 SER A CA  
1549 C C   . SER A 210 ? 0.7503 1.0881 0.5381 -0.2165 -0.1239 -0.0106 210 SER A C   
1550 O O   . SER A 210 ? 0.7420 1.0704 0.5247 -0.2124 -0.1250 0.0053  210 SER A O   
1551 C CB  . SER A 210 ? 0.7740 1.1080 0.5468 -0.2322 -0.0908 -0.0549 210 SER A CB  
1552 O OG  . SER A 210 ? 0.9210 1.2468 0.7089 -0.2295 -0.0721 -0.0778 210 SER A OG  
1553 N N   . GLU A 211 ? 0.7215 1.0776 0.5046 -0.2238 -0.1411 -0.0073 211 GLU A N   
1554 C CA  . GLU A 211 ? 0.7427 1.1112 0.5131 -0.2285 -0.1644 0.0157  211 GLU A CA  
1555 C C   . GLU A 211 ? 0.7509 1.1121 0.5509 -0.2098 -0.1757 0.0378  211 GLU A C   
1556 O O   . GLU A 211 ? 0.7611 1.1194 0.5484 -0.2107 -0.1856 0.0588  211 GLU A O   
1557 C CB  . GLU A 211 ? 0.7781 1.1686 0.5453 -0.2384 -0.1798 0.0113  211 GLU A CB  
1558 C CG  . GLU A 211 ? 0.9971 1.3939 0.7466 -0.2538 -0.1663 -0.0157 211 GLU A CG  
1559 C CD  . GLU A 211 ? 1.3870 1.7773 1.1672 -0.2442 -0.1511 -0.0370 211 GLU A CD  
1560 O OE1 . GLU A 211 ? 1.3266 1.7026 1.1047 -0.2439 -0.1296 -0.0526 211 GLU A OE1 
1561 O OE2 . GLU A 211 ? 1.3631 1.7622 1.1706 -0.2368 -0.1608 -0.0374 211 GLU A OE2 
1562 N N   . ARG A 212 ? 0.6565 1.0136 0.4956 -0.1936 -0.1728 0.0323  212 ARG A N   
1563 C CA  . ARG A 212 ? 0.6320 0.9817 0.5041 -0.1752 -0.1804 0.0490  212 ARG A CA  
1564 C C   . ARG A 212 ? 0.6478 0.9772 0.5171 -0.1684 -0.1691 0.0568  212 ARG A C   
1565 O O   . ARG A 212 ? 0.6419 0.9674 0.5164 -0.1623 -0.1802 0.0781  212 ARG A O   
1566 C CB  . ARG A 212 ? 0.6094 0.9590 0.5204 -0.1621 -0.1763 0.0376  212 ARG A CB  
1567 C CG  . ARG A 212 ? 0.6663 1.0366 0.5912 -0.1642 -0.1934 0.0385  212 ARG A CG  
1568 C CD  . ARG A 212 ? 0.6971 1.0662 0.6639 -0.1493 -0.1912 0.0330  212 ARG A CD  
1569 N NE  . ARG A 212 ? 0.7766 1.1666 0.7596 -0.1512 -0.2079 0.0344  212 ARG A NE  
1570 C CZ  . ARG A 212 ? 0.8769 1.2708 0.8979 -0.1397 -0.2101 0.0320  212 ARG A CZ  
1571 N NH1 . ARG A 212 ? 0.6828 1.0606 0.7277 -0.1259 -0.1970 0.0285  212 ARG A NH1 
1572 N NH2 . ARG A 212 ? 0.6194 1.0339 0.6549 -0.1428 -0.2254 0.0327  212 ARG A NH2 
1573 N N   . LYS A 213 ? 0.5675 0.8847 0.4290 -0.1702 -0.1476 0.0397  213 LYS A N   
1574 C CA  . LYS A 213 ? 0.5423 0.8414 0.4004 -0.1653 -0.1352 0.0439  213 LYS A CA  
1575 C C   . LYS A 213 ? 0.6240 0.9233 0.4502 -0.1763 -0.1421 0.0609  213 LYS A C   
1576 O O   . LYS A 213 ? 0.6184 0.9073 0.4513 -0.1686 -0.1457 0.0782  213 LYS A O   
1577 C CB  . LYS A 213 ? 0.5426 0.8321 0.3968 -0.1677 -0.1123 0.0213  213 LYS A CB  
1578 C CG  . LYS A 213 ? 0.5253 0.8080 0.4128 -0.1541 -0.1038 0.0087  213 LYS A CG  
1579 C CD  . LYS A 213 ? 0.5238 0.7986 0.4072 -0.1576 -0.0834 -0.0130 213 LYS A CD  
1580 C CE  . LYS A 213 ? 0.5234 0.7897 0.4376 -0.1446 -0.0754 -0.0234 213 LYS A CE  
1581 N NZ  . LYS A 213 ? 0.5843 0.8438 0.4961 -0.1484 -0.0573 -0.0440 213 LYS A NZ  
1582 N N   . LYS A 214 ? 0.6254 0.9366 0.4168 -0.1949 -0.1446 0.0565  214 LYS A N   
1583 C CA  . LYS A 214 ? 0.6671 0.9806 0.4222 -0.2090 -0.1520 0.0720  214 LYS A CA  
1584 C C   . LYS A 214 ? 0.7413 1.0568 0.5076 -0.2013 -0.1748 0.1004  214 LYS A C   
1585 O O   . LYS A 214 ? 0.7306 1.0347 0.4908 -0.1992 -0.1758 0.1173  214 LYS A O   
1586 C CB  . LYS A 214 ? 0.7291 1.0591 0.4492 -0.2300 -0.1551 0.0620  214 LYS A CB  
1587 C CG  . LYS A 214 ? 0.9598 1.2866 0.6612 -0.2415 -0.1316 0.0362  214 LYS A CG  
1588 C CD  . LYS A 214 ? 1.1488 1.4931 0.8221 -0.2610 -0.1350 0.0233  214 LYS A CD  
1589 C CE  . LYS A 214 ? 1.3360 1.6772 0.9931 -0.2728 -0.1110 -0.0037 214 LYS A CE  
1590 N NZ  . LYS A 214 ? 1.5039 1.8621 1.1321 -0.2932 -0.1138 -0.0167 214 LYS A NZ  
1591 N N   . GLU A 215 ? 0.7175 1.0470 0.5045 -0.1960 -0.1922 0.1048  215 GLU A N   
1592 C CA  . GLU A 215 ? 0.7289 1.0630 0.5353 -0.1869 -0.2151 0.1297  215 GLU A CA  
1593 C C   . GLU A 215 ? 0.7760 1.0925 0.6154 -0.1678 -0.2110 0.1399  215 GLU A C   
1594 O O   . GLU A 215 ? 0.7785 1.0904 0.6205 -0.1640 -0.2238 0.1634  215 GLU A O   
1595 C CB  . GLU A 215 ? 0.7387 1.0910 0.5690 -0.1832 -0.2292 0.1257  215 GLU A CB  
1596 C CG  . GLU A 215 ? 0.9385 1.3117 0.7412 -0.2003 -0.2467 0.1298  215 GLU A CG  
1597 C CD  . GLU A 215 ? 1.2586 1.6499 1.0913 -0.1946 -0.2626 0.1287  215 GLU A CD  
1598 O OE1 . GLU A 215 ? 1.1206 1.5207 0.9558 -0.1992 -0.2548 0.1065  215 GLU A OE1 
1599 O OE2 . GLU A 215 ? 1.2859 1.6819 1.1429 -0.1847 -0.2820 0.1494  215 GLU A OE2 
1600 N N   . ILE A 216 ? 0.7228 1.0295 0.5877 -0.1561 -0.1937 0.1225  216 ILE A N   
1601 C CA  . ILE A 216 ? 0.7031 0.9930 0.5986 -0.1390 -0.1876 0.1285  216 ILE A CA  
1602 C C   . ILE A 216 ? 0.7633 1.0374 0.6378 -0.1428 -0.1791 0.1379  216 ILE A C   
1603 O O   . ILE A 216 ? 0.7689 1.0345 0.6550 -0.1352 -0.1873 0.1577  216 ILE A O   
1604 C CB  . ILE A 216 ? 0.7129 0.9971 0.6366 -0.1279 -0.1719 0.1075  216 ILE A CB  
1605 C CG1 . ILE A 216 ? 0.7100 1.0092 0.6591 -0.1229 -0.1819 0.1018  216 ILE A CG1 
1606 C CG2 . ILE A 216 ? 0.7099 0.9758 0.6594 -0.1126 -0.1634 0.1121  216 ILE A CG2 
1607 C CD1 . ILE A 216 ? 0.7919 1.0907 0.7505 -0.1215 -0.1666 0.0772  216 ILE A CD1 
1608 N N   . TYR A 217 ? 0.7243 0.9953 0.5682 -0.1554 -0.1633 0.1241  217 TYR A N   
1609 C CA  . TYR A 217 ? 0.7385 0.9961 0.5600 -0.1614 -0.1536 0.1309  217 TYR A CA  
1610 C C   . TYR A 217 ? 0.8122 1.0711 0.6136 -0.1687 -0.1708 0.1575  217 TYR A C   
1611 O O   . TYR A 217 ? 0.7989 1.0436 0.6031 -0.1642 -0.1694 0.1719  217 TYR A O   
1612 C CB  . TYR A 217 ? 0.7671 1.0251 0.5588 -0.1761 -0.1350 0.1106  217 TYR A CB  
1613 C CG  . TYR A 217 ? 0.8062 1.0486 0.5862 -0.1785 -0.1196 0.1119  217 TYR A CG  
1614 C CD1 . TYR A 217 ? 0.8046 1.0339 0.6081 -0.1670 -0.1035 0.1004  217 TYR A CD1 
1615 C CD2 . TYR A 217 ? 0.8520 1.0929 0.5977 -0.1926 -0.1219 0.1254  217 TYR A CD2 
1616 C CE1 . TYR A 217 ? 0.8207 1.0367 0.6161 -0.1691 -0.0901 0.1017  217 TYR A CE1 
1617 C CE2 . TYR A 217 ? 0.8685 1.0953 0.6052 -0.1951 -0.1075 0.1267  217 TYR A CE2 
1618 C CZ  . TYR A 217 ? 0.9478 1.1626 0.7106 -0.1831 -0.0916 0.1145  217 TYR A CZ  
1619 O OH  . TYR A 217 ? 0.9929 1.1950 0.7489 -0.1856 -0.0776 0.1151  217 TYR A OH  
1620 N N   . GLU A 218 ? 0.8018 1.0774 0.5837 -0.1799 -0.1877 0.1645  218 GLU A N   
1621 C CA  . GLU A 218 ? 0.8322 1.1107 0.5928 -0.1882 -0.2067 0.1911  218 GLU A CA  
1622 C C   . GLU A 218 ? 0.8583 1.1288 0.6534 -0.1713 -0.2212 0.2142  218 GLU A C   
1623 O O   . GLU A 218 ? 0.8773 1.1378 0.6611 -0.1735 -0.2273 0.2357  218 GLU A O   
1624 C CB  . GLU A 218 ? 0.8826 1.1823 0.6158 -0.2042 -0.2221 0.1920  218 GLU A CB  
1625 C CG  . GLU A 218 ? 1.0882 1.4017 0.8440 -0.1971 -0.2486 0.2085  218 GLU A CG  
1626 C CD  . GLU A 218 ? 1.3932 1.7288 1.1481 -0.2036 -0.2580 0.1959  218 GLU A CD  
1627 O OE1 . GLU A 218 ? 1.2692 1.6138 1.0601 -0.1913 -0.2722 0.2008  218 GLU A OE1 
1628 O OE2 . GLU A 218 ? 1.3505 1.6949 1.0703 -0.2214 -0.2510 0.1809  218 GLU A OE2 
1629 N N   . LEU A 219 ? 0.7779 1.0511 0.6161 -0.1545 -0.2242 0.2084  219 LEU A N   
1630 C CA  . LEU A 219 ? 0.7646 1.0306 0.6421 -0.1372 -0.2354 0.2260  219 LEU A CA  
1631 C C   . LEU A 219 ? 0.7972 1.0407 0.6888 -0.1272 -0.2197 0.2269  219 LEU A C   
1632 O O   . LEU A 219 ? 0.7921 1.0253 0.6973 -0.1202 -0.2285 0.2480  219 LEU A O   
1633 C CB  . LEU A 219 ? 0.7364 1.0141 0.6540 -0.1245 -0.2423 0.2177  219 LEU A CB  
1634 C CG  . LEU A 219 ? 0.8139 1.1138 0.7280 -0.1310 -0.2655 0.2265  219 LEU A CG  
1635 C CD1 . LEU A 219 ? 0.7918 1.1059 0.7294 -0.1262 -0.2638 0.2064  219 LEU A CD1 
1636 C CD2 . LEU A 219 ? 0.8339 1.1343 0.7693 -0.1230 -0.2886 0.2555  219 LEU A CD2 
1637 N N   . ALA A 220 ? 0.7340 0.9701 0.6214 -0.1276 -0.1970 0.2046  220 ALA A N   
1638 C CA  . ALA A 220 ? 0.7089 0.9252 0.6062 -0.1204 -0.1801 0.2014  220 ALA A CA  
1639 C C   . ALA A 220 ? 0.7739 0.9789 0.6420 -0.1305 -0.1784 0.2172  220 ALA A C   
1640 O O   . ALA A 220 ? 0.7616 0.9501 0.6437 -0.1229 -0.1720 0.2242  220 ALA A O   
1641 C CB  . ALA A 220 ? 0.6905 0.9048 0.5872 -0.1206 -0.1587 0.1741  220 ALA A CB  
1642 N N   . ARG A 221 ? 0.7528 0.9665 0.5798 -0.1486 -0.1834 0.2221  221 ARG A N   
1643 C CA  . ARG A 221 ? 0.7787 0.9830 0.5735 -0.1608 -0.1827 0.2383  221 ARG A CA  
1644 C C   . ARG A 221 ? 0.8473 1.0479 0.6538 -0.1552 -0.2046 0.2685  221 ARG A C   
1645 O O   . ARG A 221 ? 0.8459 1.0295 0.6606 -0.1503 -0.2023 0.2826  221 ARG A O   
1646 C CB  . ARG A 221 ? 0.8003 1.0168 0.5468 -0.1830 -0.1831 0.2346  221 ARG A CB  
1647 C CG  . ARG A 221 ? 0.8633 1.0848 0.5941 -0.1916 -0.1621 0.2052  221 ARG A CG  
1648 C CD  . ARG A 221 ? 0.8548 1.0900 0.5395 -0.2140 -0.1647 0.2023  221 ARG A CD  
1649 N NE  . ARG A 221 ? 0.8700 1.0980 0.5177 -0.2292 -0.1640 0.2182  221 ARG A NE  
1650 C CZ  . ARG A 221 ? 1.1277 1.3509 0.7472 -0.2430 -0.1440 0.2059  221 ARG A CZ  
1651 N NH1 . ARG A 221 ? 0.9696 1.1946 0.5952 -0.2428 -0.1236 0.1774  221 ARG A NH1 
1652 N NH2 . ARG A 221 ? 1.0766 1.2932 0.6624 -0.2573 -0.1441 0.2219  221 ARG A NH2 
1653 N N   . LYS A 222 ? 0.8126 1.0295 0.6215 -0.1561 -0.2262 0.2781  222 LYS A N   
1654 C CA  . LYS A 222 ? 0.8312 1.0494 0.6531 -0.1513 -0.2511 0.3070  222 LYS A CA  
1655 C C   . LYS A 222 ? 0.8643 1.0668 0.7322 -0.1314 -0.2518 0.3171  222 LYS A C   
1656 O O   . LYS A 222 ? 0.8742 1.0646 0.7426 -0.1304 -0.2610 0.3415  222 LYS A O   
1657 C CB  . LYS A 222 ? 0.8614 1.1024 0.6905 -0.1518 -0.2706 0.3071  222 LYS A CB  
1658 C CG  . LYS A 222 ? 1.0152 1.2612 0.8547 -0.1491 -0.2992 0.3377  222 LYS A CG  
1659 C CD  . LYS A 222 ? 1.1736 1.4445 1.0109 -0.1543 -0.3182 0.3368  222 LYS A CD  
1660 C CE  . LYS A 222 ? 1.4423 1.7192 1.2897 -0.1523 -0.3481 0.3683  222 LYS A CE  
1661 N NZ  . LYS A 222 ? 1.5991 1.9020 1.4371 -0.1611 -0.3680 0.3685  222 LYS A NZ  
1662 N N   . TYR A 223 ? 0.7816 0.9834 0.6868 -0.1164 -0.2411 0.2980  223 TYR A N   
1663 C CA  . TYR A 223 ? 0.7499 0.9381 0.7005 -0.0977 -0.2396 0.3030  223 TYR A CA  
1664 C C   . TYR A 223 ? 0.7747 0.9443 0.7298 -0.0936 -0.2157 0.2896  223 TYR A C   
1665 O O   . TYR A 223 ? 0.7489 0.9070 0.7409 -0.0789 -0.2113 0.2895  223 TYR A O   
1666 C CB  . TYR A 223 ? 0.7325 0.9334 0.7241 -0.0842 -0.2468 0.2940  223 TYR A CB  
1667 C CG  . TYR A 223 ? 0.7723 0.9898 0.7697 -0.0852 -0.2731 0.3119  223 TYR A CG  
1668 C CD1 . TYR A 223 ? 0.8055 1.0183 0.8340 -0.0746 -0.2901 0.3356  223 TYR A CD1 
1669 C CD2 . TYR A 223 ? 0.7962 1.0344 0.7686 -0.0974 -0.2814 0.3054  223 TYR A CD2 
1670 C CE1 . TYR A 223 ? 0.8364 1.0654 0.8723 -0.0753 -0.3158 0.3532  223 TYR A CE1 
1671 C CE2 . TYR A 223 ? 0.8306 1.0854 0.8079 -0.0992 -0.3069 0.3223  223 TYR A CE2 
1672 C CZ  . TYR A 223 ? 0.9236 1.1741 0.9331 -0.0879 -0.3247 0.3466  223 TYR A CZ  
1673 O OH  . TYR A 223 ? 0.9494 1.2172 0.9664 -0.0892 -0.3511 0.3640  223 TYR A OH  
1674 N N   . ASP A 224 ? 0.7400 0.9070 0.6581 -0.1072 -0.2006 0.2786  224 ASP A N   
1675 C CA  . ASP A 224 ? 0.7258 0.8774 0.6433 -0.1061 -0.1781 0.2653  224 ASP A CA  
1676 C C   . ASP A 224 ? 0.7234 0.8704 0.6796 -0.0902 -0.1665 0.2469  224 ASP A C   
1677 O O   . ASP A 224 ? 0.7172 0.8500 0.7009 -0.0791 -0.1636 0.2525  224 ASP A O   
1678 C CB  . ASP A 224 ? 0.7799 0.9135 0.6867 -0.1100 -0.1766 0.2848  224 ASP A CB  
1679 C CG  . ASP A 224 ? 0.9137 1.0328 0.8169 -0.1112 -0.1536 0.2712  224 ASP A CG  
1680 O OD1 . ASP A 224 ? 0.9181 1.0430 0.7998 -0.1201 -0.1394 0.2518  224 ASP A OD1 
1681 O OD2 . ASP A 224 ? 0.9534 1.0557 0.8766 -0.1033 -0.1500 0.2800  224 ASP A OD2 
1682 N N   . PHE A 225 ? 0.6374 0.7965 0.5957 -0.0898 -0.1605 0.2254  225 PHE A N   
1683 C CA  . PHE A 225 ? 0.5944 0.7497 0.5838 -0.0772 -0.1488 0.2071  225 PHE A CA  
1684 C C   . PHE A 225 ? 0.6325 0.7918 0.6056 -0.0834 -0.1324 0.1829  225 PHE A C   
1685 O O   . PHE A 225 ? 0.6367 0.8075 0.5816 -0.0956 -0.1331 0.1774  225 PHE A O   
1686 C CB  . PHE A 225 ? 0.5990 0.7630 0.6235 -0.0649 -0.1604 0.2075  225 PHE A CB  
1687 C CG  . PHE A 225 ? 0.6160 0.8004 0.6326 -0.0701 -0.1729 0.2053  225 PHE A CG  
1688 C CD1 . PHE A 225 ? 0.6299 0.8243 0.6422 -0.0727 -0.1644 0.1831  225 PHE A CD1 
1689 C CD2 . PHE A 225 ? 0.6449 0.8383 0.6616 -0.0719 -0.1940 0.2256  225 PHE A CD2 
1690 C CE1 . PHE A 225 ? 0.6416 0.8548 0.6477 -0.0781 -0.1756 0.1802  225 PHE A CE1 
1691 C CE2 . PHE A 225 ? 0.6841 0.8975 0.6947 -0.0772 -0.2062 0.2230  225 PHE A CE2 
1692 C CZ  . PHE A 225 ? 0.6466 0.8697 0.6520 -0.0804 -0.1965 0.1998  225 PHE A CZ  
1693 N N   . LEU A 226 ? 0.5708 0.7207 0.5624 -0.0752 -0.1177 0.1685  226 LEU A N   
1694 C CA  . LEU A 226 ? 0.5506 0.7021 0.5325 -0.0791 -0.1018 0.1459  226 LEU A CA  
1695 C C   . LEU A 226 ? 0.5471 0.7117 0.5377 -0.0768 -0.1033 0.1308  226 LEU A C   
1696 O O   . LEU A 226 ? 0.5264 0.6965 0.5397 -0.0685 -0.1136 0.1348  226 LEU A O   
1697 C CB  . LEU A 226 ? 0.5305 0.6669 0.5284 -0.0719 -0.0869 0.1377  226 LEU A CB  
1698 C CG  . LEU A 226 ? 0.6053 0.7279 0.5953 -0.0751 -0.0826 0.1500  226 LEU A CG  
1699 C CD1 . LEU A 226 ? 0.5947 0.7046 0.6025 -0.0680 -0.0688 0.1398  226 LEU A CD1 
1700 C CD2 . LEU A 226 ? 0.6217 0.7471 0.5754 -0.0906 -0.0777 0.1508  226 LEU A CD2 
1701 N N   . ILE A 227 ? 0.4775 0.6474 0.4511 -0.0845 -0.0929 0.1135  227 ILE A N   
1702 C CA  . ILE A 227 ? 0.4615 0.6421 0.4430 -0.0829 -0.0927 0.0981  227 ILE A CA  
1703 C C   . ILE A 227 ? 0.4874 0.6597 0.4809 -0.0775 -0.0768 0.0804  227 ILE A C   
1704 O O   . ILE A 227 ? 0.4819 0.6490 0.4612 -0.0833 -0.0646 0.0723  227 ILE A O   
1705 C CB  . ILE A 227 ? 0.5191 0.7144 0.4734 -0.0965 -0.0962 0.0926  227 ILE A CB  
1706 C CG1 . ILE A 227 ? 0.5519 0.7572 0.4960 -0.1015 -0.1152 0.1115  227 ILE A CG1 
1707 C CG2 . ILE A 227 ? 0.5035 0.7073 0.4680 -0.0947 -0.0928 0.0741  227 ILE A CG2 
1708 C CD1 . ILE A 227 ? 0.6422 0.8620 0.5530 -0.1179 -0.1193 0.1078  227 ILE A CD1 
1709 N N   . ILE A 228 ? 0.4217 0.5928 0.4422 -0.0666 -0.0772 0.0747  228 ILE A N   
1710 C CA  . ILE A 228 ? 0.4006 0.5639 0.4327 -0.0615 -0.0639 0.0590  228 ILE A CA  
1711 C C   . ILE A 228 ? 0.4699 0.6426 0.5001 -0.0645 -0.0615 0.0435  228 ILE A C   
1712 O O   . ILE A 228 ? 0.4615 0.6405 0.5074 -0.0597 -0.0676 0.0417  228 ILE A O   
1713 C CB  . ILE A 228 ? 0.4065 0.5591 0.4661 -0.0492 -0.0624 0.0615  228 ILE A CB  
1714 C CG1 . ILE A 228 ? 0.4081 0.5502 0.4681 -0.0477 -0.0634 0.0761  228 ILE A CG1 
1715 C CG2 . ILE A 228 ? 0.3778 0.5234 0.4455 -0.0457 -0.0498 0.0454  228 ILE A CG2 
1716 C CD1 . ILE A 228 ? 0.4485 0.5808 0.5352 -0.0368 -0.0634 0.0803  228 ILE A CD1 
1717 N N   . GLU A 229 ? 0.4226 0.5965 0.4339 -0.0732 -0.0523 0.0325  229 GLU A N   
1718 C CA  . GLU A 229 ? 0.4122 0.5934 0.4195 -0.0777 -0.0482 0.0168  229 GLU A CA  
1719 C C   . GLU A 229 ? 0.4423 0.6149 0.4663 -0.0707 -0.0380 0.0038  229 GLU A C   
1720 O O   . GLU A 229 ? 0.4218 0.5878 0.4412 -0.0726 -0.0270 -0.0045 229 GLU A O   
1721 C CB  . GLU A 229 ? 0.4443 0.6305 0.4248 -0.0908 -0.0425 0.0106  229 GLU A CB  
1722 C CG  . GLU A 229 ? 0.5195 0.7138 0.4951 -0.0969 -0.0386 -0.0056 229 GLU A CG  
1723 C CD  . GLU A 229 ? 0.6885 0.8913 0.6365 -0.1116 -0.0360 -0.0106 229 GLU A CD  
1724 O OE1 . GLU A 229 ? 0.6486 0.8635 0.5878 -0.1184 -0.0432 -0.0132 229 GLU A OE1 
1725 O OE2 . GLU A 229 ? 0.5212 0.7190 0.4565 -0.1171 -0.0263 -0.0132 229 GLU A OE2 
1726 N N   . ASP A 230 ? 0.4017 0.5746 0.4455 -0.0629 -0.0417 0.0024  230 ASP A N   
1727 C CA  . ASP A 230 ? 0.3949 0.5598 0.4531 -0.0571 -0.0334 -0.0087 230 ASP A CA  
1728 C C   . ASP A 230 ? 0.4868 0.6585 0.5406 -0.0625 -0.0306 -0.0221 230 ASP A C   
1729 O O   . ASP A 230 ? 0.4954 0.6746 0.5568 -0.0619 -0.0364 -0.0235 230 ASP A O   
1730 C CB  . ASP A 230 ? 0.4036 0.5648 0.4837 -0.0474 -0.0373 -0.0040 230 ASP A CB  
1731 C CG  . ASP A 230 ? 0.5494 0.7009 0.6419 -0.0421 -0.0292 -0.0135 230 ASP A CG  
1732 O OD1 . ASP A 230 ? 0.5874 0.7327 0.6739 -0.0440 -0.0209 -0.0211 230 ASP A OD1 
1733 O OD2 . ASP A 230 ? 0.5645 0.7148 0.6733 -0.0362 -0.0311 -0.0130 230 ASP A OD2 
1734 N N   . ASP A 231 ? 0.4447 0.6140 0.4874 -0.0683 -0.0214 -0.0322 231 ASP A N   
1735 C CA  . ASP A 231 ? 0.4423 0.6169 0.4797 -0.0748 -0.0173 -0.0458 231 ASP A CA  
1736 C C   . ASP A 231 ? 0.4962 0.6610 0.5450 -0.0712 -0.0075 -0.0578 231 ASP A C   
1737 O O   . ASP A 231 ? 0.5095 0.6715 0.5527 -0.0754 0.0012  -0.0667 231 ASP A O   
1738 C CB  . ASP A 231 ? 0.4809 0.6623 0.4962 -0.0861 -0.0146 -0.0487 231 ASP A CB  
1739 C CG  . ASP A 231 ? 0.6092 0.8040 0.6121 -0.0958 -0.0193 -0.0539 231 ASP A CG  
1740 O OD1 . ASP A 231 ? 0.6136 0.8129 0.6269 -0.0939 -0.0237 -0.0574 231 ASP A OD1 
1741 O OD2 . ASP A 231 ? 0.6594 0.8603 0.6417 -0.1062 -0.0179 -0.0553 231 ASP A OD2 
1742 N N   . PRO A 232 ? 0.4392 0.5986 0.5042 -0.0639 -0.0084 -0.0584 232 PRO A N   
1743 C CA  . PRO A 232 ? 0.4198 0.5692 0.4936 -0.0614 -0.0003 -0.0681 232 PRO A CA  
1744 C C   . PRO A 232 ? 0.4606 0.6134 0.5335 -0.0670 0.0031  -0.0804 232 PRO A C   
1745 O O   . PRO A 232 ? 0.4412 0.5862 0.5188 -0.0669 0.0106  -0.0890 232 PRO A O   
1746 C CB  . PRO A 232 ? 0.4331 0.5756 0.5214 -0.0531 -0.0028 -0.0632 232 PRO A CB  
1747 C CG  . PRO A 232 ? 0.4954 0.6453 0.5856 -0.0511 -0.0116 -0.0528 232 PRO A CG  
1748 C CD  . PRO A 232 ? 0.4555 0.6174 0.5320 -0.0583 -0.0164 -0.0506 232 PRO A CD  
1749 N N   . TYR A 233 ? 0.4422 0.6067 0.5104 -0.0721 -0.0027 -0.0812 233 TYR A N   
1750 C CA  . TYR A 233 ? 0.4377 0.6066 0.5049 -0.0786 0.0000  -0.0932 233 TYR A CA  
1751 C C   . TYR A 233 ? 0.4856 0.6630 0.5363 -0.0891 0.0026  -0.1003 233 TYR A C   
1752 O O   . TYR A 233 ? 0.4794 0.6637 0.5269 -0.0962 0.0031  -0.1096 233 TYR A O   
1753 C CB  . TYR A 233 ? 0.4441 0.6209 0.5191 -0.0783 -0.0073 -0.0918 233 TYR A CB  
1754 C CG  . TYR A 233 ? 0.4416 0.6114 0.5316 -0.0691 -0.0095 -0.0847 233 TYR A CG  
1755 C CD1 . TYR A 233 ? 0.4553 0.6313 0.5501 -0.0650 -0.0179 -0.0736 233 TYR A CD1 
1756 C CD2 . TYR A 233 ? 0.4480 0.6047 0.5474 -0.0648 -0.0029 -0.0889 233 TYR A CD2 
1757 C CE1 . TYR A 233 ? 0.4551 0.6247 0.5641 -0.0572 -0.0184 -0.0688 233 TYR A CE1 
1758 C CE2 . TYR A 233 ? 0.4555 0.6059 0.5660 -0.0578 -0.0041 -0.0832 233 TYR A CE2 
1759 C CZ  . TYR A 233 ? 0.5530 0.7099 0.6684 -0.0542 -0.0110 -0.0740 233 TYR A CZ  
1760 O OH  . TYR A 233 ? 0.5383 0.6891 0.6653 -0.0482 -0.0107 -0.0701 233 TYR A OH  
1761 N N   . TYR A 234 ? 0.4561 0.6328 0.4959 -0.0910 0.0054  -0.0968 234 TYR A N   
1762 C CA  . TYR A 234 ? 0.4767 0.6607 0.4984 -0.1021 0.0095  -0.1036 234 TYR A CA  
1763 C C   . TYR A 234 ? 0.5566 0.7373 0.5817 -0.1072 0.0206  -0.1212 234 TYR A C   
1764 O O   . TYR A 234 ? 0.5653 0.7546 0.5782 -0.1179 0.0227  -0.1307 234 TYR A O   
1765 C CB  . TYR A 234 ? 0.4918 0.6733 0.5035 -0.1027 0.0123  -0.0967 234 TYR A CB  
1766 C CG  . TYR A 234 ? 0.5336 0.7216 0.5262 -0.1151 0.0191  -0.1053 234 TYR A CG  
1767 C CD1 . TYR A 234 ? 0.5809 0.7822 0.5536 -0.1257 0.0126  -0.1038 234 TYR A CD1 
1768 C CD2 . TYR A 234 ? 0.5406 0.7222 0.5360 -0.1171 0.0324  -0.1165 234 TYR A CD2 
1769 C CE1 . TYR A 234 ? 0.5989 0.8064 0.5519 -0.1390 0.0199  -0.1134 234 TYR A CE1 
1770 C CE2 . TYR A 234 ? 0.5724 0.7602 0.5512 -0.1296 0.0407  -0.1270 234 TYR A CE2 
1771 C CZ  . TYR A 234 ? 0.6769 0.8775 0.6330 -0.1410 0.0348  -0.1257 234 TYR A CZ  
1772 O OH  . TYR A 234 ? 0.7147 0.9217 0.6517 -0.1549 0.0435  -0.1366 234 TYR A OH  
1773 N N   . PHE A 235 ? 0.5266 0.6944 0.5687 -0.0998 0.0272  -0.1253 235 PHE A N   
1774 C CA  . PHE A 235 ? 0.5422 0.7036 0.5931 -0.1022 0.0375  -0.1404 235 PHE A CA  
1775 C C   . PHE A 235 ? 0.6368 0.7960 0.6985 -0.1010 0.0355  -0.1452 235 PHE A C   
1776 O O   . PHE A 235 ? 0.6457 0.7957 0.7196 -0.1001 0.0430  -0.1548 235 PHE A O   
1777 C CB  . PHE A 235 ? 0.5569 0.7056 0.6216 -0.0949 0.0447  -0.1410 235 PHE A CB  
1778 C CG  . PHE A 235 ? 0.5913 0.7421 0.6474 -0.0973 0.0493  -0.1393 235 PHE A CG  
1779 C CD1 . PHE A 235 ? 0.6431 0.7994 0.6898 -0.1074 0.0585  -0.1513 235 PHE A CD1 
1780 C CD2 . PHE A 235 ? 0.6176 0.7648 0.6751 -0.0905 0.0453  -0.1266 235 PHE A CD2 
1781 C CE1 . PHE A 235 ? 0.6568 0.8150 0.6954 -0.1106 0.0639  -0.1501 235 PHE A CE1 
1782 C CE2 . PHE A 235 ? 0.6571 0.8059 0.7072 -0.0934 0.0502  -0.1252 235 PHE A CE2 
1783 C CZ  . PHE A 235 ? 0.6439 0.7983 0.6845 -0.1035 0.0595  -0.1368 235 PHE A CZ  
1784 N N   . LEU A 236 ? 0.6050 0.7726 0.6637 -0.1012 0.0256  -0.1383 236 LEU A N   
1785 C CA  . LEU A 236 ? 0.5940 0.7613 0.6624 -0.1013 0.0237  -0.1427 236 LEU A CA  
1786 C C   . LEU A 236 ? 0.6744 0.8579 0.7324 -0.1104 0.0170  -0.1453 236 LEU A C   
1787 O O   . LEU A 236 ? 0.6690 0.8565 0.7346 -0.1098 0.0117  -0.1443 236 LEU A O   
1788 C CB  . LEU A 236 ? 0.5731 0.7329 0.6545 -0.0911 0.0189  -0.1323 236 LEU A CB  
1789 C CG  . LEU A 236 ? 0.6169 0.7597 0.7111 -0.0840 0.0253  -0.1331 236 LEU A CG  
1790 C CD1 . LEU A 236 ? 0.6169 0.7541 0.7104 -0.0776 0.0253  -0.1244 236 LEU A CD1 
1791 C CD2 . LEU A 236 ? 0.6283 0.7652 0.7334 -0.0793 0.0224  -0.1293 236 LEU A CD2 
1792 N N   . GLN A 237 ? 0.6644 0.8578 0.7050 -0.1196 0.0175  -0.1490 237 GLN A N   
1793 C CA  . GLN A 237 ? 0.6806 0.8905 0.7081 -0.1301 0.0107  -0.1518 237 GLN A CA  
1794 C C   . GLN A 237 ? 0.7306 0.9404 0.7624 -0.1378 0.0177  -0.1690 237 GLN A C   
1795 O O   . GLN A 237 ? 0.7245 0.9254 0.7586 -0.1403 0.0297  -0.1811 237 GLN A O   
1796 C CB  . GLN A 237 ? 0.7158 0.9349 0.7202 -0.1388 0.0096  -0.1499 237 GLN A CB  
1797 C CG  . GLN A 237 ? 0.7747 0.9952 0.7738 -0.1326 0.0009  -0.1315 237 GLN A CG  
1798 C CD  . GLN A 237 ? 0.9678 1.1969 0.9421 -0.1425 -0.0005 -0.1286 237 GLN A CD  
1799 O OE1 . GLN A 237 ? 0.9956 1.2185 0.9646 -0.1402 0.0035  -0.1229 237 GLN A OE1 
1800 N NE2 . GLN A 237 ? 0.7497 0.9935 0.7075 -0.1546 -0.0065 -0.1321 237 GLN A NE2 
1801 N N   . PHE A 238 ? 0.6943 0.9138 0.7297 -0.1411 0.0104  -0.1702 238 PHE A N   
1802 C CA  . PHE A 238 ? 0.6970 0.9158 0.7386 -0.1483 0.0168  -0.1862 238 PHE A CA  
1803 C C   . PHE A 238 ? 0.8109 1.0411 0.8354 -0.1631 0.0194  -0.1993 238 PHE A C   
1804 O O   . PHE A 238 ? 0.8305 1.0550 0.8591 -0.1692 0.0302  -0.2155 238 PHE A O   
1805 C CB  . PHE A 238 ? 0.6987 0.9211 0.7549 -0.1455 0.0100  -0.1836 238 PHE A CB  
1806 C CG  . PHE A 238 ? 0.6881 0.8968 0.7616 -0.1324 0.0107  -0.1741 238 PHE A CG  
1807 C CD1 . PHE A 238 ? 0.7065 0.9211 0.7873 -0.1259 0.0006  -0.1614 238 PHE A CD1 
1808 C CD2 . PHE A 238 ? 0.6980 0.8879 0.7807 -0.1270 0.0212  -0.1780 238 PHE A CD2 
1809 C CE1 . PHE A 238 ? 0.7009 0.9028 0.7955 -0.1153 0.0023  -0.1540 238 PHE A CE1 
1810 C CE2 . PHE A 238 ? 0.7162 0.8938 0.8117 -0.1163 0.0211  -0.1689 238 PHE A CE2 
1811 C CZ  . PHE A 238 ? 0.6847 0.8683 0.7848 -0.1110 0.0122  -0.1575 238 PHE A CZ  
1812 N N   . ASN A 239 ? 0.7824 1.0283 0.7876 -0.1698 0.0098  -0.1927 239 ASN A N   
1813 C CA  . ASN A 239 ? 0.8005 1.0587 0.7867 -0.1859 0.0115  -0.2057 239 ASN A CA  
1814 C C   . ASN A 239 ? 0.8253 1.0839 0.7905 -0.1938 0.0189  -0.2102 239 ASN A C   
1815 O O   . ASN A 239 ? 0.8016 1.0576 0.7599 -0.1884 0.0168  -0.1975 239 ASN A O   
1816 C CB  . ASN A 239 ? 0.8739 1.1516 0.8538 -0.1932 -0.0031 -0.2023 239 ASN A CB  
1817 C CG  . ASN A 239 ? 1.2625 1.5387 1.2659 -0.1878 -0.0056 -0.2041 239 ASN A CG  
1818 O OD1 . ASN A 239 ? 1.2150 1.4930 1.2313 -0.1780 -0.0152 -0.1902 239 ASN A OD1 
1819 N ND2 . ASN A 239 ? 1.1724 1.4409 1.1850 -0.1923 0.0058  -0.2211 239 ASN A ND2 
1820 N N   . SER A 240 ? 0.7897 1.0507 0.7467 -0.2070 0.0293  -0.2299 240 SER A N   
1821 C CA  . SER A 240 ? 0.7995 1.0616 0.7375 -0.2189 0.0409  -0.2424 240 SER A CA  
1822 C C   . SER A 240 ? 0.8363 1.1050 0.7507 -0.2219 0.0358  -0.2298 240 SER A C   
1823 O O   . SER A 240 ? 0.8531 1.1373 0.7468 -0.2301 0.0227  -0.2213 240 SER A O   
1824 C CB  . SER A 240 ? 0.8681 1.1410 0.7938 -0.2364 0.0447  -0.2617 240 SER A CB  
1825 O OG  . SER A 240 ? 1.0198 1.3005 0.9176 -0.2507 0.0501  -0.2685 240 SER A OG  
1826 N N   . GLY A 241 ? 0.7537 1.0104 0.6716 -0.2161 0.0465  -0.2291 241 GLY A N   
1827 C CA  . GLY A 241 ? 0.7401 0.9995 0.6384 -0.2180 0.0449  -0.2177 241 GLY A CA  
1828 C C   . GLY A 241 ? 0.7176 0.9774 0.6190 -0.2059 0.0292  -0.1932 241 GLY A C   
1829 O O   . GLY A 241 ? 0.7150 0.9859 0.6122 -0.2066 0.0136  -0.1828 241 GLY A O   
1830 N N   . ARG A 242 ? 0.6121 0.8604 0.5217 -0.1955 0.0337  -0.1843 242 ARG A N   
1831 C CA  . ARG A 242 ? 0.5733 0.8193 0.4875 -0.1836 0.0217  -0.1622 242 ARG A CA  
1832 C C   . ARG A 242 ? 0.6045 0.8626 0.4914 -0.1920 0.0101  -0.1481 242 ARG A C   
1833 O O   . ARG A 242 ? 0.6093 0.8728 0.4718 -0.2056 0.0159  -0.1540 242 ARG A O   
1834 C CB  . ARG A 242 ? 0.5410 0.7715 0.4706 -0.1720 0.0310  -0.1591 242 ARG A CB  
1835 C CG  . ARG A 242 ? 0.6130 0.8307 0.5705 -0.1626 0.0399  -0.1697 242 ARG A CG  
1836 C CD  . ARG A 242 ? 0.6915 0.8951 0.6644 -0.1522 0.0484  -0.1676 242 ARG A CD  
1837 N NE  . ARG A 242 ? 0.7939 0.9987 0.7524 -0.1594 0.0573  -0.1704 242 ARG A NE  
1838 C CZ  . ARG A 242 ? 0.9171 1.1181 0.8793 -0.1647 0.0727  -0.1868 242 ARG A CZ  
1839 N NH1 . ARG A 242 ? 0.7224 0.9169 0.7036 -0.1627 0.0807  -0.2013 242 ARG A NH1 
1840 N NH2 . ARG A 242 ? 0.7437 0.9469 0.6922 -0.1719 0.0809  -0.1888 242 ARG A NH2 
1841 N N   . VAL A 243 ? 0.5466 0.8090 0.4381 -0.1844 -0.0064 -0.1296 243 VAL A N   
1842 C CA  . VAL A 243 ? 0.5623 0.8356 0.4329 -0.1899 -0.0210 -0.1124 243 VAL A CA  
1843 C C   . VAL A 243 ? 0.6339 0.8985 0.4959 -0.1873 -0.0167 -0.1014 243 VAL A C   
1844 O O   . VAL A 243 ? 0.6188 0.8702 0.5011 -0.1742 -0.0110 -0.0985 243 VAL A O   
1845 C CB  . VAL A 243 ? 0.5935 0.8726 0.4806 -0.1799 -0.0390 -0.0968 243 VAL A CB  
1846 C CG1 . VAL A 243 ? 0.6096 0.9015 0.4775 -0.1861 -0.0564 -0.0789 243 VAL A CG1 
1847 C CG2 . VAL A 243 ? 0.5791 0.8640 0.4822 -0.1796 -0.0407 -0.1086 243 VAL A CG2 
1848 N N   . PRO A 244 ? 0.6136 0.8851 0.4456 -0.1998 -0.0198 -0.0944 244 PRO A N   
1849 C CA  . PRO A 244 ? 0.6055 0.8681 0.4302 -0.1975 -0.0156 -0.0830 244 PRO A CA  
1850 C C   . PRO A 244 ? 0.6158 0.8714 0.4605 -0.1813 -0.0267 -0.0631 244 PRO A C   
1851 O O   . PRO A 244 ? 0.6143 0.8770 0.4665 -0.1767 -0.0424 -0.0521 244 PRO A O   
1852 C CB  . PRO A 244 ? 0.6630 0.9363 0.4505 -0.2148 -0.0214 -0.0761 244 PRO A CB  
1853 C CG  . PRO A 244 ? 0.7399 1.0262 0.5138 -0.2282 -0.0221 -0.0908 244 PRO A CG  
1854 C CD  . PRO A 244 ? 0.6625 0.9500 0.4650 -0.2172 -0.0277 -0.0956 244 PRO A CD  
1855 N N   . THR A 245 ? 0.5379 0.7802 0.3934 -0.1727 -0.0180 -0.0598 245 THR A N   
1856 C CA  . THR A 245 ? 0.5034 0.7371 0.3791 -0.1575 -0.0255 -0.0433 245 THR A CA  
1857 C C   . THR A 245 ? 0.5559 0.7904 0.4147 -0.1607 -0.0351 -0.0228 245 THR A C   
1858 O O   . THR A 245 ? 0.5711 0.8099 0.4019 -0.1745 -0.0323 -0.0223 245 THR A O   
1859 C CB  . THR A 245 ? 0.5311 0.7500 0.4275 -0.1471 -0.0116 -0.0506 245 THR A CB  
1860 O OG1 . THR A 245 ? 0.4939 0.7090 0.3751 -0.1552 0.0008  -0.0550 245 THR A OG1 
1861 C CG2 . THR A 245 ? 0.4466 0.6626 0.3626 -0.1423 -0.0037 -0.0681 245 THR A CG2 
1862 N N   . PHE A 246 ? 0.5143 0.7437 0.3905 -0.1482 -0.0457 -0.0061 246 PHE A N   
1863 C CA  . PHE A 246 ? 0.5307 0.7579 0.3964 -0.1489 -0.0550 0.0151  246 PHE A CA  
1864 C C   . PHE A 246 ? 0.6301 0.8481 0.4813 -0.1546 -0.0418 0.0146  246 PHE A C   
1865 O O   . PHE A 246 ? 0.6481 0.8683 0.4742 -0.1651 -0.0455 0.0257  246 PHE A O   
1866 C CB  . PHE A 246 ? 0.5234 0.7443 0.4169 -0.1329 -0.0650 0.0295  246 PHE A CB  
1867 C CG  . PHE A 246 ? 0.5338 0.7664 0.4348 -0.1307 -0.0830 0.0391  246 PHE A CG  
1868 C CD1 . PHE A 246 ? 0.5323 0.7668 0.4608 -0.1202 -0.0858 0.0331  246 PHE A CD1 
1869 C CD2 . PHE A 246 ? 0.5775 0.8199 0.4577 -0.1400 -0.0973 0.0538  246 PHE A CD2 
1870 C CE1 . PHE A 246 ? 0.5413 0.7880 0.4793 -0.1183 -0.1019 0.0409  246 PHE A CE1 
1871 C CE2 . PHE A 246 ? 0.6098 0.8645 0.4996 -0.1377 -0.1150 0.0627  246 PHE A CE2 
1872 C CZ  . PHE A 246 ? 0.5567 0.8139 0.4766 -0.1267 -0.1169 0.0557  246 PHE A CZ  
1873 N N   . LEU A 247 ? 0.6010 0.8091 0.4678 -0.1484 -0.0266 0.0014  247 LEU A N   
1874 C CA  . LEU A 247 ? 0.6114 0.8113 0.4706 -0.1528 -0.0120 -0.0026 247 LEU A CA  
1875 C C   . LEU A 247 ? 0.7046 0.9124 0.5329 -0.1711 -0.0035 -0.0122 247 LEU A C   
1876 O O   . LEU A 247 ? 0.7149 0.9196 0.5255 -0.1794 0.0024  -0.0069 247 LEU A O   
1877 C CB  . LEU A 247 ? 0.5836 0.7744 0.4690 -0.1425 0.0008  -0.0168 247 LEU A CB  
1878 C CG  . LEU A 247 ? 0.6530 0.8373 0.5364 -0.1465 0.0175  -0.0257 247 LEU A CG  
1879 C CD1 . LEU A 247 ? 0.6607 0.8364 0.5432 -0.1440 0.0165  -0.0099 247 LEU A CD1 
1880 C CD2 . LEU A 247 ? 0.6650 0.8434 0.5738 -0.1378 0.0280  -0.0418 247 LEU A CD2 
1881 N N   . SER A 248 ? 0.6788 0.8967 0.5003 -0.1783 -0.0024 -0.0267 248 SER A N   
1882 C CA  . SER A 248 ? 0.7091 0.9353 0.5014 -0.1968 0.0065  -0.0389 248 SER A CA  
1883 C C   . SER A 248 ? 0.8049 1.0383 0.5632 -0.2103 -0.0041 -0.0229 248 SER A C   
1884 O O   . SER A 248 ? 0.8338 1.0699 0.5650 -0.2260 0.0055  -0.0281 248 SER A O   
1885 C CB  . SER A 248 ? 0.7494 0.9840 0.5445 -0.2007 0.0092  -0.0578 248 SER A CB  
1886 O OG  . SER A 248 ? 0.9025 1.1489 0.6864 -0.2053 -0.0073 -0.0506 248 SER A OG  
1887 N N   . MET A 249 ? 0.7721 1.0086 0.5327 -0.2046 -0.0239 -0.0033 249 MET A N   
1888 C CA  . MET A 249 ? 0.8068 1.0498 0.5382 -0.2156 -0.0381 0.0159  249 MET A CA  
1889 C C   . MET A 249 ? 0.8428 1.0746 0.5774 -0.2088 -0.0441 0.0389  249 MET A C   
1890 O O   . MET A 249 ? 0.8538 1.0891 0.5706 -0.2144 -0.0593 0.0591  249 MET A O   
1891 C CB  . MET A 249 ? 0.8423 1.0989 0.5735 -0.2159 -0.0576 0.0218  249 MET A CB  
1892 C CG  . MET A 249 ? 0.8601 1.1138 0.6288 -0.1963 -0.0684 0.0288  249 MET A CG  
1893 S SD  . MET A 249 ? 0.9196 1.1907 0.6927 -0.1967 -0.0896 0.0331  249 MET A SD  
1894 C CE  . MET A 249 ? 0.8635 1.1404 0.6408 -0.2014 -0.0750 0.0024  249 MET A CE  
1895 N N   . ASP A 250 ? 0.7705 0.9889 0.5279 -0.1975 -0.0324 0.0358  250 ASP A N   
1896 C CA  . ASP A 250 ? 0.7698 0.9762 0.5345 -0.1902 -0.0360 0.0550  250 ASP A CA  
1897 C C   . ASP A 250 ? 0.8505 1.0525 0.5856 -0.2045 -0.0282 0.0621  250 ASP A C   
1898 O O   . ASP A 250 ? 0.8483 1.0412 0.5891 -0.2039 -0.0125 0.0552  250 ASP A O   
1899 C CB  . ASP A 250 ? 0.7561 0.9508 0.5579 -0.1722 -0.0294 0.0503  250 ASP A CB  
1900 C CG  . ASP A 250 ? 0.8949 1.0773 0.7087 -0.1633 -0.0348 0.0698  250 ASP A CG  
1901 O OD1 . ASP A 250 ? 0.9111 1.0944 0.7135 -0.1659 -0.0494 0.0904  250 ASP A OD1 
1902 O OD2 . ASP A 250 ? 0.9545 1.1263 0.7902 -0.1535 -0.0251 0.0648  250 ASP A OD2 
1903 N N   . VAL A 251 ? 0.8258 1.0345 0.5298 -0.2176 -0.0400 0.0767  251 VAL A N   
1904 C CA  . VAL A 251 ? 0.8550 1.0608 0.5250 -0.2339 -0.0351 0.0861  251 VAL A CA  
1905 C C   . VAL A 251 ? 0.9058 1.0962 0.5862 -0.2261 -0.0370 0.1061  251 VAL A C   
1906 O O   . VAL A 251 ? 0.9181 1.1012 0.5840 -0.2350 -0.0236 0.1059  251 VAL A O   
1907 C CB  . VAL A 251 ? 0.9343 1.1527 0.5675 -0.2502 -0.0502 0.0972  251 VAL A CB  
1908 C CG1 . VAL A 251 ? 0.9740 1.1887 0.5687 -0.2680 -0.0477 0.1110  251 VAL A CG1 
1909 C CG2 . VAL A 251 ? 0.9313 1.1642 0.5525 -0.2602 -0.0448 0.0744  251 VAL A CG2 
1910 N N   . ASP A 252 ? 0.8338 1.0193 0.5412 -0.2098 -0.0525 0.1218  252 ASP A N   
1911 C CA  . ASP A 252 ? 0.8232 0.9939 0.5448 -0.2008 -0.0570 0.1417  252 ASP A CA  
1912 C C   . ASP A 252 ? 0.8389 0.9975 0.5935 -0.1867 -0.0435 0.1319  252 ASP A C   
1913 O O   . ASP A 252 ? 0.8476 0.9932 0.6079 -0.1838 -0.0413 0.1442  252 ASP A O   
1914 C CB  . ASP A 252 ? 0.8394 1.0111 0.5765 -0.1901 -0.0804 0.1629  252 ASP A CB  
1915 C CG  . ASP A 252 ? 0.9338 1.1186 0.6438 -0.2016 -0.0984 0.1755  252 ASP A CG  
1916 O OD1 . ASP A 252 ? 0.9414 1.1351 0.6162 -0.2196 -0.0927 0.1674  252 ASP A OD1 
1917 O OD2 . ASP A 252 ? 1.0035 1.1901 0.7283 -0.1930 -0.1180 0.1931  252 ASP A OD2 
1918 N N   . GLY A 253 ? 0.7517 0.9140 0.5282 -0.1780 -0.0359 0.1113  253 GLY A N   
1919 C CA  . GLY A 253 ? 0.7141 0.8660 0.5224 -0.1644 -0.0255 0.1024  253 GLY A CA  
1920 C C   . GLY A 253 ? 0.7408 0.8869 0.5792 -0.1475 -0.0387 0.1144  253 GLY A C   
1921 O O   . GLY A 253 ? 0.7282 0.8617 0.5841 -0.1393 -0.0364 0.1217  253 GLY A O   
1922 N N   . ARG A 254 ? 0.6816 0.8373 0.5261 -0.1430 -0.0525 0.1164  254 ARG A N   
1923 C CA  . ARG A 254 ? 0.6438 0.7968 0.5179 -0.1277 -0.0655 0.1263  254 ARG A CA  
1924 C C   . ARG A 254 ? 0.6254 0.7832 0.5239 -0.1173 -0.0630 0.1090  254 ARG A C   
1925 O O   . ARG A 254 ? 0.6217 0.7795 0.5445 -0.1057 -0.0728 0.1145  254 ARG A O   
1926 C CB  . ARG A 254 ? 0.6536 0.8132 0.5187 -0.1303 -0.0857 0.1469  254 ARG A CB  
1927 C CG  . ARG A 254 ? 0.7326 0.9092 0.5748 -0.1414 -0.0931 0.1422  254 ARG A CG  
1928 C CD  . ARG A 254 ? 0.8321 1.0161 0.6714 -0.1420 -0.1154 0.1635  254 ARG A CD  
1929 N NE  . ARG A 254 ? 0.8997 1.0775 0.7157 -0.1511 -0.1221 0.1854  254 ARG A NE  
1930 C CZ  . ARG A 254 ? 0.9708 1.1366 0.8027 -0.1429 -0.1299 0.2056  254 ARG A CZ  
1931 N NH1 . ARG A 254 ? 0.7554 0.9144 0.6267 -0.1254 -0.1311 0.2053  254 ARG A NH1 
1932 N NH2 . ARG A 254 ? 0.7127 0.8726 0.5209 -0.1526 -0.1359 0.2258  254 ARG A NH2 
1933 N N   . VAL A 255 ? 0.5346 0.6958 0.4281 -0.1215 -0.0494 0.0884  255 VAL A N   
1934 C CA  . VAL A 255 ? 0.4993 0.6643 0.4128 -0.1134 -0.0464 0.0718  255 VAL A CA  
1935 C C   . VAL A 255 ? 0.5372 0.6919 0.4707 -0.1052 -0.0326 0.0594  255 VAL A C   
1936 O O   . VAL A 255 ? 0.5416 0.6922 0.4662 -0.1110 -0.0199 0.0522  255 VAL A O   
1937 C CB  . VAL A 255 ? 0.5431 0.7217 0.4384 -0.1239 -0.0450 0.0582  255 VAL A CB  
1938 C CG1 . VAL A 255 ? 0.5167 0.6978 0.4323 -0.1164 -0.0407 0.0410  255 VAL A CG1 
1939 C CG2 . VAL A 255 ? 0.5606 0.7508 0.4394 -0.1310 -0.0613 0.0709  255 VAL A CG2 
1940 N N   . ILE A 256 ? 0.4636 0.6148 0.4241 -0.0922 -0.0353 0.0568  256 ILE A N   
1941 C CA  . ILE A 256 ? 0.4321 0.5749 0.4121 -0.0842 -0.0248 0.0449  256 ILE A CA  
1942 C C   . ILE A 256 ? 0.4711 0.6204 0.4595 -0.0815 -0.0238 0.0302  256 ILE A C   
1943 O O   . ILE A 256 ? 0.4597 0.6132 0.4595 -0.0759 -0.0329 0.0330  256 ILE A O   
1944 C CB  . ILE A 256 ? 0.4541 0.5858 0.4567 -0.0728 -0.0274 0.0538  256 ILE A CB  
1945 C CG1 . ILE A 256 ? 0.4688 0.5924 0.4641 -0.0758 -0.0273 0.0681  256 ILE A CG1 
1946 C CG2 . ILE A 256 ? 0.4408 0.5654 0.4611 -0.0658 -0.0176 0.0405  256 ILE A CG2 
1947 C CD1 . ILE A 256 ? 0.5207 0.6357 0.5359 -0.0662 -0.0349 0.0817  256 ILE A CD1 
1948 N N   . ARG A 257 ? 0.4204 0.5704 0.4043 -0.0859 -0.0124 0.0145  257 ARG A N   
1949 C CA  . ARG A 257 ? 0.3999 0.5545 0.3908 -0.0845 -0.0097 -0.0002 257 ARG A CA  
1950 C C   . ARG A 257 ? 0.4136 0.5591 0.4252 -0.0756 -0.0026 -0.0091 257 ARG A C   
1951 O O   . ARG A 257 ? 0.4207 0.5597 0.4345 -0.0757 0.0062  -0.0127 257 ARG A O   
1952 C CB  . ARG A 257 ? 0.3917 0.5538 0.3638 -0.0965 -0.0023 -0.0123 257 ARG A CB  
1953 C CG  . ARG A 257 ? 0.3467 0.5129 0.3261 -0.0958 0.0003  -0.0273 257 ARG A CG  
1954 C CD  . ARG A 257 ? 0.2605 0.4321 0.2259 -0.1068 0.0103  -0.0419 257 ARG A CD  
1955 N NE  . ARG A 257 ? 0.2890 0.4614 0.2662 -0.1046 0.0139  -0.0563 257 ARG A NE  
1956 C CZ  . ARG A 257 ? 0.5554 0.7355 0.5311 -0.1065 0.0071  -0.0590 257 ARG A CZ  
1957 N NH1 . ARG A 257 ? 0.3872 0.5662 0.3746 -0.1047 0.0115  -0.0720 257 ARG A NH1 
1958 N NH2 . ARG A 257 ? 0.4082 0.5972 0.3719 -0.1104 -0.0045 -0.0483 257 ARG A NH2 
1959 N N   . ALA A 258 ? 0.3446 0.4904 0.3705 -0.0690 -0.0062 -0.0134 258 ALA A N   
1960 C CA  . ALA A 258 ? 0.3226 0.4602 0.3658 -0.0616 -0.0007 -0.0216 258 ALA A CA  
1961 C C   . ALA A 258 ? 0.3756 0.5166 0.4206 -0.0637 0.0033  -0.0356 258 ALA A C   
1962 O O   . ALA A 258 ? 0.3642 0.5121 0.4080 -0.0651 -0.0020 -0.0373 258 ALA A O   
1963 C CB  . ALA A 258 ? 0.3195 0.4522 0.3789 -0.0524 -0.0068 -0.0145 258 ALA A CB  
1964 N N   . ASP A 259 ? 0.3488 0.4847 0.3982 -0.0639 0.0126  -0.0455 259 ASP A N   
1965 C CA  . ASP A 259 ? 0.3583 0.4944 0.4122 -0.0653 0.0178  -0.0588 259 ASP A CA  
1966 C C   . ASP A 259 ? 0.4146 0.5409 0.4861 -0.0570 0.0192  -0.0615 259 ASP A C   
1967 O O   . ASP A 259 ? 0.3972 0.5167 0.4756 -0.0523 0.0199  -0.0567 259 ASP A O   
1968 C CB  . ASP A 259 ? 0.3999 0.5381 0.4466 -0.0726 0.0276  -0.0685 259 ASP A CB  
1969 C CG  . ASP A 259 ? 0.6473 0.7958 0.6735 -0.0834 0.0275  -0.0690 259 ASP A CG  
1970 O OD1 . ASP A 259 ? 0.6670 0.8223 0.6878 -0.0878 0.0254  -0.0750 259 ASP A OD1 
1971 O OD2 . ASP A 259 ? 0.7687 0.9186 0.7834 -0.0884 0.0301  -0.0642 259 ASP A OD2 
1972 N N   . SER A 260 ? 0.3852 0.5106 0.4630 -0.0561 0.0196  -0.0692 260 SER A N   
1973 C CA  . SER A 260 ? 0.3803 0.4963 0.4724 -0.0495 0.0202  -0.0710 260 SER A CA  
1974 C C   . SER A 260 ? 0.4276 0.5402 0.5262 -0.0508 0.0258  -0.0825 260 SER A C   
1975 O O   . SER A 260 ? 0.4267 0.5448 0.5206 -0.0561 0.0274  -0.0896 260 SER A O   
1976 C CB  . SER A 260 ? 0.4356 0.5512 0.5315 -0.0456 0.0134  -0.0656 260 SER A CB  
1977 O OG  . SER A 260 ? 0.5794 0.6855 0.6860 -0.0404 0.0140  -0.0665 260 SER A OG  
1978 N N   . PHE A 261 ? 0.3705 0.4739 0.4809 -0.0461 0.0283  -0.0840 261 PHE A N   
1979 C CA  . PHE A 261 ? 0.3666 0.4645 0.4871 -0.0458 0.0324  -0.0929 261 PHE A CA  
1980 C C   . PHE A 261 ? 0.3834 0.4746 0.5092 -0.0425 0.0283  -0.0913 261 PHE A C   
1981 O O   . PHE A 261 ? 0.3726 0.4580 0.5063 -0.0424 0.0307  -0.0973 261 PHE A O   
1982 C CB  . PHE A 261 ? 0.3918 0.4840 0.5239 -0.0428 0.0363  -0.0946 261 PHE A CB  
1983 C CG  . PHE A 261 ? 0.4323 0.5305 0.5630 -0.0474 0.0437  -0.1007 261 PHE A CG  
1984 C CD1 . PHE A 261 ? 0.4892 0.5928 0.6158 -0.0539 0.0498  -0.1109 261 PHE A CD1 
1985 C CD2 . PHE A 261 ? 0.4619 0.5602 0.5956 -0.0462 0.0455  -0.0972 261 PHE A CD2 
1986 C CE1 . PHE A 261 ? 0.5069 0.6162 0.6311 -0.0595 0.0581  -0.1176 261 PHE A CE1 
1987 C CE2 . PHE A 261 ? 0.4993 0.6033 0.6316 -0.0514 0.0536  -0.1035 261 PHE A CE2 
1988 C CZ  . PHE A 261 ? 0.4851 0.5946 0.6124 -0.0582 0.0601  -0.1138 261 PHE A CZ  
1989 N N   . SER A 262 ? 0.3200 0.4116 0.4420 -0.0402 0.0226  -0.0835 262 SER A N   
1990 C CA  . SER A 262 ? 0.3180 0.4040 0.4434 -0.0380 0.0195  -0.0816 262 SER A CA  
1991 C C   . SER A 262 ? 0.3905 0.4773 0.5165 -0.0416 0.0208  -0.0883 262 SER A C   
1992 O O   . SER A 262 ? 0.3943 0.4725 0.5254 -0.0405 0.0209  -0.0891 262 SER A O   
1993 C CB  . SER A 262 ? 0.3537 0.4424 0.4760 -0.0359 0.0148  -0.0737 262 SER A CB  
1994 O OG  . SER A 262 ? 0.4626 0.5472 0.5864 -0.0323 0.0141  -0.0680 262 SER A OG  
1995 N N   . LYS A 263 ? 0.3498 0.4466 0.4698 -0.0466 0.0216  -0.0928 263 LYS A N   
1996 C CA  . LYS A 263 ? 0.3575 0.4560 0.4783 -0.0509 0.0230  -0.1002 263 LYS A CA  
1997 C C   . LYS A 263 ? 0.4265 0.5211 0.5520 -0.0540 0.0296  -0.1103 263 LYS A C   
1998 O O   . LYS A 263 ? 0.4111 0.5033 0.5402 -0.0570 0.0317  -0.1168 263 LYS A O   
1999 C CB  . LYS A 263 ? 0.3923 0.5046 0.5052 -0.0555 0.0193  -0.1002 263 LYS A CB  
2000 C CG  . LYS A 263 ? 0.5291 0.6443 0.6440 -0.0526 0.0134  -0.0927 263 LYS A CG  
2001 C CD  . LYS A 263 ? 0.6046 0.7216 0.7178 -0.0481 0.0093  -0.0826 263 LYS A CD  
2002 C CE  . LYS A 263 ? 0.7385 0.8558 0.8581 -0.0444 0.0053  -0.0766 263 LYS A CE  
2003 N NZ  . LYS A 263 ? 0.8094 0.9143 0.9347 -0.0411 0.0081  -0.0765 263 LYS A NZ  
2004 N N   . ILE A 264 ? 0.4084 0.5019 0.5357 -0.0532 0.0334  -0.1120 264 ILE A N   
2005 C CA  . ILE A 264 ? 0.4201 0.5110 0.5544 -0.0560 0.0408  -0.1228 264 ILE A CA  
2006 C C   . ILE A 264 ? 0.4666 0.5463 0.6160 -0.0506 0.0434  -0.1229 264 ILE A C   
2007 O O   . ILE A 264 ? 0.4708 0.5449 0.6313 -0.0516 0.0484  -0.1312 264 ILE A O   
2008 C CB  . ILE A 264 ? 0.4680 0.5705 0.5922 -0.0631 0.0454  -0.1296 264 ILE A CB  
2009 C CG1 . ILE A 264 ? 0.4784 0.5862 0.5943 -0.0618 0.0434  -0.1215 264 ILE A CG1 
2010 C CG2 . ILE A 264 ? 0.4656 0.5778 0.5787 -0.0701 0.0434  -0.1335 264 ILE A CG2 
2011 C CD1 . ILE A 264 ? 0.6146 0.7307 0.7216 -0.0689 0.0499  -0.1281 264 ILE A CD1 
2012 N N   . ILE A 265 ? 0.3981 0.4750 0.5494 -0.0453 0.0398  -0.1143 265 ILE A N   
2013 C CA  . ILE A 265 ? 0.3840 0.4519 0.5502 -0.0402 0.0404  -0.1133 265 ILE A CA  
2014 C C   . ILE A 265 ? 0.4148 0.4732 0.5834 -0.0350 0.0332  -0.1034 265 ILE A C   
2015 O O   . ILE A 265 ? 0.4156 0.4640 0.5951 -0.0327 0.0321  -0.1032 265 ILE A O   
2016 C CB  . ILE A 265 ? 0.4194 0.4924 0.5897 -0.0402 0.0449  -0.1158 265 ILE A CB  
2017 C CG1 . ILE A 265 ? 0.4500 0.5261 0.6275 -0.0448 0.0542  -0.1290 265 ILE A CG1 
2018 C CG2 . ILE A 265 ? 0.3950 0.4612 0.5787 -0.0340 0.0418  -0.1103 265 ILE A CG2 
2019 C CD1 . ILE A 265 ? 0.6234 0.7105 0.7919 -0.0504 0.0605  -0.1339 265 ILE A CD1 
2020 N N   . SER A 266 ? 0.3416 0.4028 0.5002 -0.0337 0.0285  -0.0952 266 SER A N   
2021 C CA  . SER A 266 ? 0.3305 0.3840 0.4881 -0.0304 0.0226  -0.0868 266 SER A CA  
2022 C C   . SER A 266 ? 0.3745 0.4332 0.5218 -0.0301 0.0197  -0.0806 266 SER A C   
2023 O O   . SER A 266 ? 0.3777 0.4427 0.5227 -0.0299 0.0206  -0.0793 266 SER A O   
2024 C CB  . SER A 266 ? 0.3773 0.4234 0.5458 -0.0265 0.0203  -0.0838 266 SER A CB  
2025 O OG  . SER A 266 ? 0.4692 0.5093 0.6335 -0.0246 0.0145  -0.0757 266 SER A OG  
2026 N N   . SER A 267 ? 0.3116 0.3672 0.4540 -0.0302 0.0167  -0.0768 267 SER A N   
2027 C CA  . SER A 267 ? 0.2971 0.3563 0.4332 -0.0294 0.0143  -0.0713 267 SER A CA  
2028 C C   . SER A 267 ? 0.3549 0.4072 0.4919 -0.0266 0.0115  -0.0657 267 SER A C   
2029 O O   . SER A 267 ? 0.3493 0.4047 0.4844 -0.0253 0.0107  -0.0621 267 SER A O   
2030 C CB  . SER A 267 ? 0.3198 0.3800 0.4524 -0.0314 0.0137  -0.0717 267 SER A CB  
2031 O OG  . SER A 267 ? 0.4037 0.4540 0.5374 -0.0323 0.0135  -0.0720 267 SER A OG  
2032 N N   . GLY A 268 ? 0.3147 0.3577 0.4548 -0.0261 0.0097  -0.0649 268 GLY A N   
2033 C CA  . GLY A 268 ? 0.3116 0.3482 0.4515 -0.0248 0.0062  -0.0600 268 GLY A CA  
2034 C C   . GLY A 268 ? 0.3644 0.4027 0.5112 -0.0225 0.0053  -0.0592 268 GLY A C   
2035 O O   . GLY A 268 ? 0.3596 0.3945 0.5058 -0.0219 0.0021  -0.0554 268 GLY A O   
2036 N N   . LEU A 269 ? 0.3140 0.3576 0.4675 -0.0219 0.0086  -0.0635 269 LEU A N   
2037 C CA  . LEU A 269 ? 0.2980 0.3445 0.4598 -0.0203 0.0092  -0.0638 269 LEU A CA  
2038 C C   . LEU A 269 ? 0.3374 0.3901 0.4938 -0.0207 0.0109  -0.0616 269 LEU A C   
2039 O O   . LEU A 269 ? 0.3308 0.3847 0.4927 -0.0198 0.0108  -0.0604 269 LEU A O   
2040 C CB  . LEU A 269 ? 0.2961 0.3459 0.4681 -0.0204 0.0138  -0.0705 269 LEU A CB  
2041 C CG  . LEU A 269 ? 0.3422 0.3850 0.5269 -0.0187 0.0120  -0.0724 269 LEU A CG  
2042 C CD1 . LEU A 269 ? 0.3426 0.3896 0.5399 -0.0189 0.0182  -0.0806 269 LEU A CD1 
2043 C CD2 . LEU A 269 ? 0.3498 0.3869 0.5420 -0.0161 0.0053  -0.0667 269 LEU A CD2 
2044 N N   . ARG A 270 ? 0.2871 0.3439 0.4343 -0.0221 0.0120  -0.0605 270 ARG A N   
2045 C CA  . ARG A 270 ? 0.2869 0.3485 0.4291 -0.0223 0.0127  -0.0569 270 ARG A CA  
2046 C C   . ARG A 270 ? 0.3503 0.4181 0.4942 -0.0236 0.0166  -0.0583 270 ARG A C   
2047 O O   . ARG A 270 ? 0.3454 0.4128 0.4925 -0.0231 0.0171  -0.0560 270 ARG A O   
2048 C CB  . ARG A 270 ? 0.2587 0.3154 0.4007 -0.0209 0.0101  -0.0521 270 ARG A CB  
2049 C CG  . ARG A 270 ? 0.2726 0.3228 0.4114 -0.0210 0.0074  -0.0513 270 ARG A CG  
2050 C CD  . ARG A 270 ? 0.3048 0.3577 0.4393 -0.0218 0.0081  -0.0520 270 ARG A CD  
2051 N NE  . ARG A 270 ? 0.3616 0.4206 0.4951 -0.0212 0.0088  -0.0493 270 ARG A NE  
2052 C CZ  . ARG A 270 ? 0.4832 0.5497 0.6148 -0.0221 0.0092  -0.0498 270 ARG A CZ  
2053 N NH1 . ARG A 270 ? 0.1410 0.2099 0.2713 -0.0239 0.0101  -0.0543 270 ARG A NH1 
2054 N NH2 . ARG A 270 ? 0.3813 0.4529 0.5128 -0.0214 0.0082  -0.0456 270 ARG A NH2 
2055 N N   . ILE A 271 ? 0.3065 0.3798 0.4480 -0.0262 0.0200  -0.0631 271 ILE A N   
2056 C CA  . ILE A 271 ? 0.3164 0.3959 0.4572 -0.0292 0.0251  -0.0660 271 ILE A CA  
2057 C C   . ILE A 271 ? 0.4163 0.5033 0.5455 -0.0334 0.0264  -0.0667 271 ILE A C   
2058 O O   . ILE A 271 ? 0.4206 0.5093 0.5481 -0.0352 0.0269  -0.0717 271 ILE A O   
2059 C CB  . ILE A 271 ? 0.3527 0.4316 0.5056 -0.0294 0.0295  -0.0737 271 ILE A CB  
2060 C CG1 . ILE A 271 ? 0.3366 0.4098 0.5024 -0.0255 0.0268  -0.0719 271 ILE A CG1 
2061 C CG2 . ILE A 271 ? 0.3726 0.4591 0.5235 -0.0342 0.0371  -0.0793 271 ILE A CG2 
2062 C CD1 . ILE A 271 ? 0.2929 0.3676 0.4602 -0.0256 0.0274  -0.0678 271 ILE A CD1 
2063 N N   . GLY A 272 ? 0.3966 0.4877 0.5180 -0.0355 0.0266  -0.0613 272 GLY A N   
2064 C CA  . GLY A 272 ? 0.4035 0.5025 0.5122 -0.0403 0.0265  -0.0598 272 GLY A CA  
2065 C C   . GLY A 272 ? 0.4512 0.5536 0.5535 -0.0446 0.0306  -0.0575 272 GLY A C   
2066 O O   . GLY A 272 ? 0.4354 0.5344 0.5452 -0.0434 0.0340  -0.0579 272 GLY A O   
2067 N N   . PHE A 273 ? 0.4130 0.5224 0.5011 -0.0502 0.0302  -0.0548 273 PHE A N   
2068 C CA  . PHE A 273 ? 0.4143 0.5267 0.4930 -0.0558 0.0341  -0.0514 273 PHE A CA  
2069 C C   . PHE A 273 ? 0.4631 0.5804 0.5264 -0.0596 0.0285  -0.0414 273 PHE A C   
2070 O O   . PHE A 273 ? 0.4730 0.5954 0.5303 -0.0608 0.0233  -0.0410 273 PHE A O   
2071 C CB  . PHE A 273 ? 0.4390 0.5553 0.5164 -0.0620 0.0441  -0.0626 273 PHE A CB  
2072 C CG  . PHE A 273 ? 0.4542 0.5761 0.5267 -0.0666 0.0466  -0.0727 273 PHE A CG  
2073 C CD1 . PHE A 273 ? 0.4896 0.6082 0.5747 -0.0621 0.0462  -0.0800 273 PHE A CD1 
2074 C CD2 . PHE A 273 ? 0.4958 0.6258 0.5508 -0.0764 0.0501  -0.0754 273 PHE A CD2 
2075 C CE1 . PHE A 273 ? 0.5153 0.6383 0.5971 -0.0667 0.0492  -0.0900 273 PHE A CE1 
2076 C CE2 . PHE A 273 ? 0.5452 0.6804 0.5958 -0.0816 0.0534  -0.0864 273 PHE A CE2 
2077 C CZ  . PHE A 273 ? 0.5171 0.6486 0.5822 -0.0765 0.0532  -0.0939 273 PHE A CZ  
2078 N N   . LEU A 274 ? 0.3928 0.5083 0.4507 -0.0617 0.0292  -0.0329 274 LEU A N   
2079 C CA  . LEU A 274 ? 0.3892 0.5077 0.4334 -0.0652 0.0232  -0.0208 274 LEU A CA  
2080 C C   . LEU A 274 ? 0.4552 0.5784 0.4821 -0.0757 0.0295  -0.0214 274 LEU A C   
2081 O O   . LEU A 274 ? 0.4564 0.5770 0.4864 -0.0781 0.0383  -0.0262 274 LEU A O   
2082 C CB  . LEU A 274 ? 0.3805 0.4908 0.4335 -0.0593 0.0194  -0.0096 274 LEU A CB  
2083 C CG  . LEU A 274 ? 0.4344 0.5449 0.4870 -0.0561 0.0091  0.0028  274 LEU A CG  
2084 C CD1 . LEU A 274 ? 0.4299 0.5422 0.4927 -0.0501 0.0039  -0.0010 274 LEU A CD1 
2085 C CD2 . LEU A 274 ? 0.4379 0.5392 0.4998 -0.0515 0.0081  0.0122  274 LEU A CD2 
2086 N N   . THR A 275 ? 0.4210 0.5516 0.4295 -0.0828 0.0250  -0.0170 275 THR A N   
2087 C CA  . THR A 275 ? 0.4262 0.5621 0.4133 -0.0950 0.0304  -0.0170 275 THR A CA  
2088 C C   . THR A 275 ? 0.4765 0.6132 0.4493 -0.0979 0.0204  0.0005  275 THR A C   
2089 O O   . THR A 275 ? 0.4655 0.6053 0.4391 -0.0943 0.0093  0.0073  275 THR A O   
2090 C CB  . THR A 275 ? 0.4922 0.6373 0.4681 -0.1029 0.0345  -0.0300 275 THR A CB  
2091 O OG1 . THR A 275 ? 0.5086 0.6521 0.5028 -0.0967 0.0384  -0.0433 275 THR A OG1 
2092 C CG2 . THR A 275 ? 0.4690 0.6182 0.4273 -0.1157 0.0455  -0.0363 275 THR A CG2 
2093 N N   . GLY A 276 ? 0.4573 0.5907 0.4188 -0.1041 0.0245  0.0080  276 GLY A N   
2094 C CA  . GLY A 276 ? 0.4806 0.6128 0.4284 -0.1074 0.0153  0.0265  276 GLY A CA  
2095 C C   . GLY A 276 ? 0.5564 0.6835 0.4920 -0.1154 0.0226  0.0330  276 GLY A C   
2096 O O   . GLY A 276 ? 0.5436 0.6702 0.4801 -0.1198 0.0359  0.0213  276 GLY A O   
2097 N N   . PRO A 277 ? 0.5396 0.6628 0.4647 -0.1178 0.0143  0.0518  277 PRO A N   
2098 C CA  . PRO A 277 ? 0.5656 0.6828 0.4776 -0.1265 0.0214  0.0593  277 PRO A CA  
2099 C C   . PRO A 277 ? 0.6121 0.7190 0.5460 -0.1195 0.0297  0.0562  277 PRO A C   
2100 O O   . PRO A 277 ? 0.6007 0.7015 0.5573 -0.1072 0.0241  0.0590  277 PRO A O   
2101 C CB  . PRO A 277 ? 0.6107 0.7246 0.5116 -0.1278 0.0076  0.0821  277 PRO A CB  
2102 C CG  . PRO A 277 ? 0.6616 0.7834 0.5653 -0.1227 -0.0060 0.0843  277 PRO A CG  
2103 C CD  . PRO A 277 ? 0.5677 0.6913 0.4946 -0.1125 -0.0021 0.0675  277 PRO A CD  
2104 N N   . LYS A 278 ? 0.5543 0.6601 0.4815 -0.1282 0.0433  0.0499  278 LYS A N   
2105 C CA  . LYS A 278 ? 0.5311 0.6288 0.4772 -0.1243 0.0525  0.0458  278 LYS A CA  
2106 C C   . LYS A 278 ? 0.5384 0.6240 0.4989 -0.1156 0.0448  0.0610  278 LYS A C   
2107 O O   . LYS A 278 ? 0.4956 0.5767 0.4805 -0.1053 0.0452  0.0551  278 LYS A O   
2108 C CB  . LYS A 278 ? 0.5893 0.6884 0.5217 -0.1376 0.0672  0.0406  278 LYS A CB  
2109 C CG  . LYS A 278 ? 0.8183 0.9123 0.7726 -0.1345 0.0781  0.0324  278 LYS A CG  
2110 C CD  . LYS A 278 ? 1.0365 1.1367 0.9837 -0.1465 0.0947  0.0192  278 LYS A CD  
2111 C CE  . LYS A 278 ? 1.2071 1.3163 1.1680 -0.1437 0.1016  -0.0016 278 LYS A CE  
2112 N NZ  . LYS A 278 ? 1.3743 1.4901 1.3299 -0.1558 0.1185  -0.0150 278 LYS A NZ  
2113 N N   . PRO A 279 ? 0.4983 0.5783 0.4453 -0.1193 0.0369  0.0803  279 PRO A N   
2114 C CA  . PRO A 279 ? 0.4886 0.5562 0.4530 -0.1106 0.0305  0.0934  279 PRO A CA  
2115 C C   . PRO A 279 ? 0.5611 0.6279 0.5500 -0.0962 0.0226  0.0897  279 PRO A C   
2116 O O   . PRO A 279 ? 0.5575 0.6162 0.5679 -0.0886 0.0251  0.0869  279 PRO A O   
2117 C CB  . PRO A 279 ? 0.5272 0.5916 0.4723 -0.1165 0.0205  0.1146  279 PRO A CB  
2118 C CG  . PRO A 279 ? 0.6056 0.6774 0.5209 -0.1318 0.0273  0.1124  279 PRO A CG  
2119 C CD  . PRO A 279 ? 0.5371 0.6210 0.4531 -0.1322 0.0338  0.0914  279 PRO A CD  
2120 N N   . LEU A 280 ? 0.5231 0.5987 0.5081 -0.0935 0.0138  0.0884  280 LEU A N   
2121 C CA  . LEU A 280 ? 0.4925 0.5687 0.4985 -0.0812 0.0066  0.0846  280 LEU A CA  
2122 C C   . LEU A 280 ? 0.5380 0.6163 0.5586 -0.0763 0.0146  0.0658  280 LEU A C   
2123 O O   . LEU A 280 ? 0.5418 0.6144 0.5832 -0.0668 0.0130  0.0633  280 LEU A O   
2124 C CB  . LEU A 280 ? 0.4866 0.5720 0.4845 -0.0807 -0.0052 0.0895  280 LEU A CB  
2125 C CG  . LEU A 280 ? 0.5455 0.6304 0.5290 -0.0855 -0.0160 0.1094  280 LEU A CG  
2126 C CD1 . LEU A 280 ? 0.5524 0.6497 0.5268 -0.0867 -0.0268 0.1109  280 LEU A CD1 
2127 C CD2 . LEU A 280 ? 0.5390 0.6120 0.5417 -0.0771 -0.0224 0.1240  280 LEU A CD2 
2128 N N   . ILE A 281 ? 0.4757 0.5616 0.4862 -0.0830 0.0232  0.0527  281 ILE A N   
2129 C CA  . ILE A 281 ? 0.4495 0.5372 0.4743 -0.0788 0.0304  0.0356  281 ILE A CA  
2130 C C   . ILE A 281 ? 0.4744 0.5532 0.5160 -0.0754 0.0365  0.0339  281 ILE A C   
2131 O O   . ILE A 281 ? 0.4284 0.5045 0.4878 -0.0675 0.0362  0.0267  281 ILE A O   
2132 C CB  . ILE A 281 ? 0.4891 0.5865 0.5015 -0.0872 0.0387  0.0225  281 ILE A CB  
2133 C CG1 . ILE A 281 ? 0.4999 0.6065 0.4990 -0.0896 0.0321  0.0215  281 ILE A CG1 
2134 C CG2 . ILE A 281 ? 0.4681 0.5662 0.4976 -0.0836 0.0471  0.0064  281 ILE A CG2 
2135 C CD1 . ILE A 281 ? 0.5753 0.6838 0.5893 -0.0797 0.0252  0.0156  281 ILE A CD1 
2136 N N   . GLU A 282 ? 0.4643 0.5382 0.4989 -0.0820 0.0414  0.0415  282 GLU A N   
2137 C CA  . GLU A 282 ? 0.4653 0.5307 0.5139 -0.0808 0.0473  0.0413  282 GLU A CA  
2138 C C   . GLU A 282 ? 0.4913 0.5480 0.5583 -0.0704 0.0402  0.0462  282 GLU A C   
2139 O O   . GLU A 282 ? 0.4667 0.5211 0.5506 -0.0652 0.0426  0.0371  282 GLU A O   
2140 C CB  . GLU A 282 ? 0.5096 0.5707 0.5439 -0.0907 0.0522  0.0518  282 GLU A CB  
2141 C CG  . GLU A 282 ? 0.6723 0.7237 0.7195 -0.0909 0.0580  0.0541  282 GLU A CG  
2142 C CD  . GLU A 282 ? 0.9748 1.0219 1.0059 -0.1020 0.0636  0.0646  282 GLU A CD  
2143 O OE1 . GLU A 282 ? 0.7515 0.7948 0.7679 -0.1047 0.0565  0.0802  282 GLU A OE1 
2144 O OE2 . GLU A 282 ? 0.9972 1.0450 1.0308 -0.1085 0.0749  0.0574  282 GLU A OE2 
2145 N N   . ARG A 283 ? 0.4343 0.4870 0.4983 -0.0676 0.0311  0.0598  283 ARG A N   
2146 C CA  . ARG A 283 ? 0.4155 0.4602 0.4977 -0.0582 0.0249  0.0642  283 ARG A CA  
2147 C C   . ARG A 283 ? 0.4452 0.4937 0.5403 -0.0506 0.0235  0.0515  283 ARG A C   
2148 O O   . ARG A 283 ? 0.4247 0.4666 0.5363 -0.0452 0.0245  0.0476  283 ARG A O   
2149 C CB  . ARG A 283 ? 0.4101 0.4530 0.4886 -0.0562 0.0145  0.0799  283 ARG A CB  
2150 C CG  . ARG A 283 ? 0.4938 0.5313 0.5588 -0.0635 0.0137  0.0957  283 ARG A CG  
2151 C CD  . ARG A 283 ? 0.5522 0.5763 0.6296 -0.0631 0.0187  0.1007  283 ARG A CD  
2152 N NE  . ARG A 283 ? 0.5449 0.5688 0.6141 -0.0717 0.0300  0.0946  283 ARG A NE  
2153 C CZ  . ARG A 283 ? 0.5896 0.6045 0.6706 -0.0724 0.0371  0.0927  283 ARG A CZ  
2154 N NH1 . ARG A 283 ? 0.5562 0.5730 0.6309 -0.0807 0.0474  0.0867  283 ARG A NH1 
2155 N NH2 . ARG A 283 ? 0.2252 0.2296 0.3257 -0.0653 0.0346  0.0959  283 ARG A NH2 
2156 N N   . VAL A 284 ? 0.3768 0.4356 0.4633 -0.0514 0.0217  0.0447  284 VAL A N   
2157 C CA  . VAL A 284 ? 0.3452 0.4077 0.4410 -0.0456 0.0204  0.0332  284 VAL A CA  
2158 C C   . VAL A 284 ? 0.3876 0.4487 0.4923 -0.0455 0.0278  0.0213  284 VAL A C   
2159 O O   . VAL A 284 ? 0.3858 0.4428 0.5037 -0.0398 0.0267  0.0165  284 VAL A O   
2160 C CB  . VAL A 284 ? 0.3820 0.4550 0.4665 -0.0472 0.0167  0.0299  284 VAL A CB  
2161 C CG1 . VAL A 284 ? 0.3538 0.4299 0.4463 -0.0429 0.0174  0.0170  284 VAL A CG1 
2162 C CG2 . VAL A 284 ? 0.3862 0.4608 0.4678 -0.0452 0.0071  0.0413  284 VAL A CG2 
2163 N N   . ILE A 285 ? 0.3263 0.3909 0.4246 -0.0521 0.0351  0.0168  285 ILE A N   
2164 C CA  . ILE A 285 ? 0.2977 0.3624 0.4068 -0.0524 0.0416  0.0062  285 ILE A CA  
2165 C C   . ILE A 285 ? 0.3167 0.3723 0.4390 -0.0499 0.0422  0.0088  285 ILE A C   
2166 O O   . ILE A 285 ? 0.2892 0.3435 0.4238 -0.0463 0.0421  0.0012  285 ILE A O   
2167 C CB  . ILE A 285 ? 0.3340 0.4050 0.4362 -0.0605 0.0504  0.0006  285 ILE A CB  
2168 C CG1 . ILE A 285 ? 0.3385 0.4185 0.4291 -0.0633 0.0509  -0.0049 285 ILE A CG1 
2169 C CG2 . ILE A 285 ? 0.3216 0.3932 0.4398 -0.0599 0.0561  -0.0096 285 ILE A CG2 
2170 C CD1 . ILE A 285 ? 0.4043 0.4902 0.4831 -0.0731 0.0598  -0.0081 285 ILE A CD1 
2171 N N   . LEU A 286 ? 0.2806 0.3293 0.4000 -0.0521 0.0423  0.0199  286 LEU A N   
2172 C CA  . LEU A 286 ? 0.2821 0.3212 0.4147 -0.0502 0.0434  0.0221  286 LEU A CA  
2173 C C   . LEU A 286 ? 0.3336 0.3678 0.4778 -0.0426 0.0379  0.0202  286 LEU A C   
2174 O O   . LEU A 286 ? 0.3132 0.3426 0.4691 -0.0413 0.0398  0.0150  286 LEU A O   
2175 C CB  . LEU A 286 ? 0.2937 0.3251 0.4222 -0.0543 0.0449  0.0347  286 LEU A CB  
2176 C CG  . LEU A 286 ? 0.3479 0.3816 0.4659 -0.0635 0.0524  0.0367  286 LEU A CG  
2177 C CD1 . LEU A 286 ? 0.3609 0.3852 0.4737 -0.0671 0.0522  0.0514  286 LEU A CD1 
2178 C CD2 . LEU A 286 ? 0.3547 0.3900 0.4838 -0.0663 0.0601  0.0258  286 LEU A CD2 
2179 N N   . HIS A 287 ? 0.2984 0.3345 0.4393 -0.0382 0.0316  0.0236  287 HIS A N   
2180 C CA  . HIS A 287 ? 0.2860 0.3185 0.4374 -0.0318 0.0276  0.0206  287 HIS A CA  
2181 C C   . HIS A 287 ? 0.3495 0.3864 0.5035 -0.0305 0.0283  0.0082  287 HIS A C   
2182 O O   . HIS A 287 ? 0.3415 0.3736 0.5048 -0.0285 0.0286  0.0028  287 HIS A O   
2183 C CB  . HIS A 287 ? 0.2922 0.3277 0.4407 -0.0281 0.0211  0.0269  287 HIS A CB  
2184 C CG  . HIS A 287 ? 0.3297 0.3598 0.4917 -0.0221 0.0184  0.0264  287 HIS A CG  
2185 N ND1 . HIS A 287 ? 0.3519 0.3840 0.5169 -0.0182 0.0126  0.0327  287 HIS A ND1 
2186 C CD2 . HIS A 287 ? 0.3446 0.3682 0.5182 -0.0202 0.0213  0.0197  287 HIS A CD2 
2187 C CE1 . HIS A 287 ? 0.3400 0.3665 0.5195 -0.0138 0.0132  0.0291  287 HIS A CE1 
2188 N NE2 . HIS A 287 ? 0.3396 0.3605 0.5232 -0.0153 0.0186  0.0210  287 HIS A NE2 
2189 N N   . ILE A 288 ? 0.3085 0.3540 0.4542 -0.0322 0.0284  0.0037  288 ILE A N   
2190 C CA  . ILE A 288 ? 0.3018 0.3511 0.4502 -0.0311 0.0284  -0.0066 288 ILE A CA  
2191 C C   . ILE A 288 ? 0.3601 0.4067 0.5177 -0.0326 0.0315  -0.0119 288 ILE A C   
2192 O O   . ILE A 288 ? 0.3608 0.4054 0.5242 -0.0305 0.0293  -0.0176 288 ILE A O   
2193 C CB  . ILE A 288 ? 0.3404 0.3986 0.4801 -0.0333 0.0292  -0.0104 288 ILE A CB  
2194 C CG1 . ILE A 288 ? 0.3486 0.4101 0.4814 -0.0311 0.0244  -0.0077 288 ILE A CG1 
2195 C CG2 . ILE A 288 ? 0.3331 0.3942 0.4791 -0.0328 0.0304  -0.0205 288 ILE A CG2 
2196 C CD1 . ILE A 288 ? 0.5057 0.5755 0.6279 -0.0347 0.0255  -0.0102 288 ILE A CD1 
2197 N N   . GLN A 289 ? 0.3152 0.3613 0.4735 -0.0370 0.0364  -0.0094 289 GLN A N   
2198 C CA  . GLN A 289 ? 0.3076 0.3521 0.4757 -0.0396 0.0400  -0.0137 289 GLN A CA  
2199 C C   . GLN A 289 ? 0.3499 0.3864 0.5267 -0.0377 0.0379  -0.0147 289 GLN A C   
2200 O O   . GLN A 289 ? 0.3447 0.3813 0.5300 -0.0392 0.0384  -0.0206 289 GLN A O   
2201 C CB  . GLN A 289 ? 0.3319 0.3763 0.4976 -0.0453 0.0462  -0.0090 289 GLN A CB  
2202 C CG  . GLN A 289 ? 0.5132 0.5608 0.6891 -0.0493 0.0512  -0.0157 289 GLN A CG  
2203 C CD  . GLN A 289 ? 0.6438 0.6921 0.8152 -0.0560 0.0586  -0.0114 289 GLN A CD  
2204 O OE1 . GLN A 289 ? 0.5885 0.6295 0.7613 -0.0587 0.0612  -0.0054 289 GLN A OE1 
2205 N NE2 . GLN A 289 ? 0.4259 0.4823 0.5906 -0.0593 0.0627  -0.0142 289 GLN A NE2 
2206 N N   . VAL A 290 ? 0.2948 0.3250 0.4704 -0.0347 0.0356  -0.0095 290 VAL A N   
2207 C CA  . VAL A 290 ? 0.2934 0.3159 0.4771 -0.0333 0.0349  -0.0118 290 VAL A CA  
2208 C C   . VAL A 290 ? 0.3401 0.3627 0.5223 -0.0295 0.0307  -0.0162 290 VAL A C   
2209 O O   . VAL A 290 ? 0.3229 0.3397 0.5103 -0.0292 0.0308  -0.0198 290 VAL A O   
2210 C CB  . VAL A 290 ? 0.3508 0.3638 0.5400 -0.0337 0.0376  -0.0047 290 VAL A CB  
2211 C CG1 . VAL A 290 ? 0.3520 0.3637 0.5428 -0.0389 0.0426  -0.0014 290 VAL A CG1 
2212 C CG2 . VAL A 290 ? 0.3513 0.3627 0.5376 -0.0300 0.0350  0.0042  290 VAL A CG2 
2213 N N   . SER A 291 ? 0.3200 0.3491 0.4951 -0.0275 0.0279  -0.0166 291 SER A N   
2214 C CA  . SER A 291 ? 0.3303 0.3596 0.5035 -0.0248 0.0246  -0.0208 291 SER A CA  
2215 C C   . SER A 291 ? 0.3832 0.4164 0.5544 -0.0259 0.0224  -0.0276 291 SER A C   
2216 O O   . SER A 291 ? 0.3874 0.4177 0.5616 -0.0276 0.0215  -0.0323 291 SER A O   
2217 C CB  . SER A 291 ? 0.3984 0.4313 0.5666 -0.0218 0.0224  -0.0166 291 SER A CB  
2218 O OG  . SER A 291 ? 0.5943 0.6268 0.7623 -0.0214 0.0228  -0.0079 291 SER A OG  
2219 N N   . THR A 292 ? 0.3362 0.3760 0.5029 -0.0254 0.0214  -0.0280 292 THR A N   
2220 C CA  . THR A 292 ? 0.3236 0.3669 0.4906 -0.0255 0.0189  -0.0335 292 THR A CA  
2221 C C   . THR A 292 ? 0.3828 0.4303 0.5563 -0.0277 0.0205  -0.0359 292 THR A C   
2222 O O   . THR A 292 ? 0.3803 0.4306 0.5573 -0.0273 0.0178  -0.0400 292 THR A O   
2223 C CB  . THR A 292 ? 0.3227 0.3703 0.4835 -0.0237 0.0176  -0.0337 292 THR A CB  
2224 O OG1 . THR A 292 ? 0.2739 0.3257 0.4310 -0.0245 0.0204  -0.0299 292 THR A OG1 
2225 C CG2 . THR A 292 ? 0.3155 0.3599 0.4722 -0.0218 0.0154  -0.0333 292 THR A CG2 
2226 N N   . LEU A 293 ? 0.3177 0.3655 0.4942 -0.0302 0.0250  -0.0332 293 LEU A N   
2227 C CA  . LEU A 293 ? 0.2986 0.3515 0.4824 -0.0331 0.0287  -0.0357 293 LEU A CA  
2228 C C   . LEU A 293 ? 0.3555 0.4157 0.5368 -0.0333 0.0312  -0.0377 293 LEU A C   
2229 O O   . LEU A 293 ? 0.3775 0.4410 0.5578 -0.0367 0.0370  -0.0368 293 LEU A O   
2230 C CB  . LEU A 293 ? 0.2909 0.3449 0.4860 -0.0340 0.0258  -0.0410 293 LEU A CB  
2231 C CG  . LEU A 293 ? 0.3394 0.3876 0.5381 -0.0357 0.0238  -0.0414 293 LEU A CG  
2232 C CD1 . LEU A 293 ? 0.3300 0.3824 0.5408 -0.0379 0.0212  -0.0462 293 LEU A CD1 
2233 C CD2 . LEU A 293 ? 0.3831 0.4266 0.5817 -0.0381 0.0291  -0.0373 293 LEU A CD2 
2234 N N   . HIS A 294 ? 0.2944 0.3564 0.4741 -0.0306 0.0277  -0.0409 294 HIS A N   
2235 C CA  . HIS A 294 ? 0.2965 0.3646 0.4751 -0.0309 0.0305  -0.0445 294 HIS A CA  
2236 C C   . HIS A 294 ? 0.3193 0.3864 0.4952 -0.0277 0.0257  -0.0466 294 HIS A C   
2237 O O   . HIS A 294 ? 0.2914 0.3536 0.4686 -0.0256 0.0203  -0.0461 294 HIS A O   
2238 C CB  . HIS A 294 ? 0.3130 0.3867 0.5056 -0.0326 0.0341  -0.0506 294 HIS A CB  
2239 C CG  . HIS A 294 ? 0.3505 0.4235 0.5567 -0.0301 0.0283  -0.0537 294 HIS A CG  
2240 N ND1 . HIS A 294 ? 0.3647 0.4383 0.5760 -0.0271 0.0242  -0.0570 294 HIS A ND1 
2241 C CD2 . HIS A 294 ? 0.3697 0.4414 0.5846 -0.0309 0.0255  -0.0535 294 HIS A CD2 
2242 C CE1 . HIS A 294 ? 0.3537 0.4263 0.5760 -0.0260 0.0183  -0.0576 294 HIS A CE1 
2243 N NE2 . HIS A 294 ? 0.3599 0.4320 0.5844 -0.0284 0.0187  -0.0560 294 HIS A NE2 
2244 N N   . PRO A 295 ? 0.2947 0.3659 0.4668 -0.0280 0.0280  -0.0496 295 PRO A N   
2245 C CA  . PRO A 295 ? 0.2945 0.3639 0.4660 -0.0253 0.0239  -0.0521 295 PRO A CA  
2246 C C   . PRO A 295 ? 0.3280 0.3973 0.5141 -0.0236 0.0218  -0.0567 295 PRO A C   
2247 O O   . PRO A 295 ? 0.3210 0.3948 0.5182 -0.0248 0.0257  -0.0602 295 PRO A O   
2248 C CB  . PRO A 295 ? 0.3194 0.3939 0.4834 -0.0273 0.0279  -0.0546 295 PRO A CB  
2249 C CG  . PRO A 295 ? 0.3870 0.4659 0.5453 -0.0315 0.0335  -0.0526 295 PRO A CG  
2250 C CD  . PRO A 295 ? 0.3302 0.4077 0.4979 -0.0318 0.0348  -0.0516 295 PRO A CD  
2251 N N   . SER A 296 ? 0.2703 0.3345 0.4574 -0.0212 0.0155  -0.0561 296 SER A N   
2252 C CA  . SER A 296 ? 0.2612 0.3241 0.4616 -0.0192 0.0110  -0.0582 296 SER A CA  
2253 C C   . SER A 296 ? 0.3128 0.3816 0.5286 -0.0190 0.0158  -0.0643 296 SER A C   
2254 O O   . SER A 296 ? 0.3312 0.4025 0.5447 -0.0197 0.0210  -0.0684 296 SER A O   
2255 C CB  . SER A 296 ? 0.2920 0.3486 0.4872 -0.0177 0.0055  -0.0567 296 SER A CB  
2256 O OG  . SER A 296 ? 0.3276 0.3819 0.5355 -0.0158 0.0001  -0.0572 296 SER A OG  
2257 N N   . THR A 297 ? 0.2583 0.3302 0.4904 -0.0185 0.0147  -0.0658 297 THR A N   
2258 C CA  . THR A 297 ? 0.2522 0.3307 0.5034 -0.0183 0.0201  -0.0727 297 THR A CA  
2259 C C   . THR A 297 ? 0.3117 0.3875 0.5726 -0.0151 0.0178  -0.0757 297 THR A C   
2260 O O   . THR A 297 ? 0.3126 0.3920 0.5790 -0.0159 0.0255  -0.0826 297 THR A O   
2261 C CB  . THR A 297 ? 0.2930 0.3761 0.5624 -0.0183 0.0185  -0.0735 297 THR A CB  
2262 O OG1 . THR A 297 ? 0.3160 0.3986 0.5751 -0.0213 0.0188  -0.0695 297 THR A OG1 
2263 C CG2 . THR A 297 ? 0.2162 0.3077 0.5048 -0.0193 0.0274  -0.0818 297 THR A CG2 
2264 N N   . PHE A 298 ? 0.2672 0.3362 0.5288 -0.0124 0.0077  -0.0706 298 PHE A N   
2265 C CA  . PHE A 298 ? 0.2606 0.3247 0.5311 -0.0093 0.0039  -0.0712 298 PHE A CA  
2266 C C   . PHE A 298 ? 0.3089 0.3713 0.5678 -0.0106 0.0104  -0.0750 298 PHE A C   
2267 O O   . PHE A 298 ? 0.3076 0.3713 0.5792 -0.0097 0.0153  -0.0816 298 PHE A O   
2268 C CB  . PHE A 298 ? 0.2818 0.3376 0.5466 -0.0081 -0.0082 -0.0629 298 PHE A CB  
2269 C CG  . PHE A 298 ? 0.3068 0.3565 0.5843 -0.0049 -0.0145 -0.0612 298 PHE A CG  
2270 C CD1 . PHE A 298 ? 0.3629 0.4065 0.6335 -0.0047 -0.0122 -0.0623 298 PHE A CD1 
2271 C CD2 . PHE A 298 ? 0.3381 0.3877 0.6347 -0.0023 -0.0237 -0.0578 298 PHE A CD2 
2272 C CE1 . PHE A 298 ? 0.3785 0.4149 0.6616 -0.0019 -0.0178 -0.0601 298 PHE A CE1 
2273 C CE2 . PHE A 298 ? 0.3792 0.4220 0.6886 0.0009  -0.0305 -0.0546 298 PHE A CE2 
2274 C CZ  . PHE A 298 ? 0.3608 0.3964 0.6632 0.0011  -0.0272 -0.0556 298 PHE A CZ  
2275 N N   . ASN A 299 ? 0.2670 0.3271 0.5033 -0.0129 0.0106  -0.0715 299 ASN A N   
2276 C CA  . ASN A 299 ? 0.2715 0.3308 0.4952 -0.0146 0.0151  -0.0742 299 ASN A CA  
2277 C C   . ASN A 299 ? 0.3289 0.3960 0.5539 -0.0175 0.0254  -0.0822 299 ASN A C   
2278 O O   . ASN A 299 ? 0.3234 0.3903 0.5478 -0.0186 0.0293  -0.0876 299 ASN A O   
2279 C CB  . ASN A 299 ? 0.2621 0.3188 0.4653 -0.0162 0.0125  -0.0685 299 ASN A CB  
2280 C CG  . ASN A 299 ? 0.4198 0.4682 0.6187 -0.0150 0.0040  -0.0623 299 ASN A CG  
2281 O OD1 . ASN A 299 ? 0.3586 0.4025 0.5681 -0.0131 -0.0016 -0.0606 299 ASN A OD1 
2282 N ND2 . ASN A 299 ? 0.2235 0.2697 0.4069 -0.0165 0.0029  -0.0586 299 ASN A ND2 
2283 N N   . GLN A 300 ? 0.2589 0.3326 0.4852 -0.0195 0.0301  -0.0833 300 GLN A N   
2284 C CA  . GLN A 300 ? 0.2553 0.3367 0.4808 -0.0238 0.0404  -0.0906 300 GLN A CA  
2285 C C   . GLN A 300 ? 0.3144 0.3981 0.5623 -0.0229 0.0459  -0.1002 300 GLN A C   
2286 O O   . GLN A 300 ? 0.3074 0.3939 0.5542 -0.0261 0.0536  -0.1084 300 GLN A O   
2287 C CB  . GLN A 300 ? 0.2676 0.3539 0.4900 -0.0265 0.0436  -0.0882 300 GLN A CB  
2288 C CG  . GLN A 300 ? 0.2725 0.3574 0.4740 -0.0282 0.0408  -0.0800 300 GLN A CG  
2289 C CD  . GLN A 300 ? 0.3070 0.3961 0.5060 -0.0318 0.0457  -0.0784 300 GLN A CD  
2290 O OE1 . GLN A 300 ? 0.2269 0.3216 0.4190 -0.0370 0.0535  -0.0818 300 GLN A OE1 
2291 N NE2 . GLN A 300 ? 0.1036 0.1902 0.3082 -0.0300 0.0415  -0.0735 300 GLN A NE2 
2292 N N   . LEU A 301 ? 0.2654 0.3480 0.5350 -0.0187 0.0417  -0.0994 301 LEU A N   
2293 C CA  . LEU A 301 ? 0.2540 0.3386 0.5516 -0.0163 0.0452  -0.1074 301 LEU A CA  
2294 C C   . LEU A 301 ? 0.2905 0.3686 0.5932 -0.0141 0.0440  -0.1103 301 LEU A C   
2295 O O   . LEU A 301 ? 0.2758 0.3560 0.5963 -0.0141 0.0514  -0.1200 301 LEU A O   
2296 C CB  . LEU A 301 ? 0.2518 0.3358 0.5695 -0.0116 0.0365  -0.1025 301 LEU A CB  
2297 C CG  . LEU A 301 ? 0.3051 0.3982 0.6435 -0.0123 0.0414  -0.1072 301 LEU A CG  
2298 C CD1 . LEU A 301 ? 0.3103 0.4116 0.6454 -0.0184 0.0564  -0.1169 301 LEU A CD1 
2299 C CD2 . LEU A 301 ? 0.3087 0.4022 0.6426 -0.0121 0.0335  -0.0989 301 LEU A CD2 
2300 N N   . MET A 302 ? 0.2785 0.3484 0.5667 -0.0125 0.0354  -0.1024 302 MET A N   
2301 C CA  . MET A 302 ? 0.2932 0.3553 0.5831 -0.0111 0.0338  -0.1038 302 MET A CA  
2302 C C   . MET A 302 ? 0.3289 0.3949 0.6090 -0.0162 0.0444  -0.1134 302 MET A C   
2303 O O   . MET A 302 ? 0.3613 0.4250 0.6553 -0.0160 0.0494  -0.1215 302 MET A O   
2304 C CB  . MET A 302 ? 0.3340 0.3881 0.6054 -0.0104 0.0241  -0.0934 302 MET A CB  
2305 C CG  . MET A 302 ? 0.4015 0.4482 0.6825 -0.0062 0.0126  -0.0847 302 MET A CG  
2306 S SD  . MET A 302 ? 0.4789 0.5157 0.7353 -0.0075 0.0045  -0.0752 302 MET A SD  
2307 C CE  . MET A 302 ? 0.4390 0.4687 0.7002 -0.0078 0.0083  -0.0803 302 MET A CE  
2308 N N   . ILE A 303 ? 0.2282 0.2999 0.4850 -0.0211 0.0475  -0.1123 303 ILE A N   
2309 C CA  . ILE A 303 ? 0.1992 0.2760 0.4416 -0.0273 0.0559  -0.1198 303 ILE A CA  
2310 C C   . ILE A 303 ? 0.2385 0.3232 0.4918 -0.0312 0.0677  -0.1313 303 ILE A C   
2311 O O   . ILE A 303 ? 0.2401 0.3260 0.4973 -0.0347 0.0755  -0.1420 303 ILE A O   
2312 C CB  . ILE A 303 ? 0.2267 0.3065 0.4422 -0.0305 0.0526  -0.1123 303 ILE A CB  
2313 C CG1 . ILE A 303 ? 0.2289 0.3010 0.4358 -0.0276 0.0434  -0.1045 303 ILE A CG1 
2314 C CG2 . ILE A 303 ? 0.2190 0.3068 0.4185 -0.0380 0.0603  -0.1187 303 ILE A CG2 
2315 C CD1 . ILE A 303 ? 0.2673 0.3399 0.4566 -0.0275 0.0373  -0.0943 303 ILE A CD1 
2316 N N   . SER A 304 ? 0.2016 0.2913 0.4616 -0.0312 0.0698  -0.1302 304 SER A N   
2317 C CA  . SER A 304 ? 0.2141 0.3117 0.4854 -0.0357 0.0824  -0.1419 304 SER A CA  
2318 C C   . SER A 304 ? 0.3049 0.4006 0.6074 -0.0324 0.0874  -0.1525 304 SER A C   
2319 O O   . SER A 304 ? 0.3392 0.4399 0.6474 -0.0377 0.1000  -0.1659 304 SER A O   
2320 C CB  . SER A 304 ? 0.2518 0.3552 0.5236 -0.0370 0.0840  -0.1383 304 SER A CB  
2321 O OG  . SER A 304 ? 0.3835 0.4864 0.6828 -0.0311 0.0808  -0.1377 304 SER A OG  
2322 N N   . GLN A 305 ? 0.2550 0.3431 0.5773 -0.0242 0.0776  -0.1467 305 GLN A N   
2323 C CA  . GLN A 305 ? 0.2636 0.3483 0.6183 -0.0199 0.0803  -0.1547 305 GLN A CA  
2324 C C   . GLN A 305 ? 0.3336 0.4130 0.6840 -0.0223 0.0848  -0.1620 305 GLN A C   
2325 O O   . GLN A 305 ? 0.3354 0.4157 0.7060 -0.0235 0.0952  -0.1753 305 GLN A O   
2326 C CB  . GLN A 305 ? 0.2716 0.3493 0.6466 -0.0111 0.0666  -0.1442 305 GLN A CB  
2327 C CG  . GLN A 305 ? 0.4134 0.4975 0.8058 -0.0083 0.0638  -0.1412 305 GLN A CG  
2328 C CD  . GLN A 305 ? 0.7909 0.8840 1.2113 -0.0095 0.0763  -0.1547 305 GLN A CD  
2329 O OE1 . GLN A 305 ? 0.7684 0.8709 1.1820 -0.0150 0.0851  -0.1594 305 GLN A OE1 
2330 N NE2 . GLN A 305 ? 0.7077 0.7981 1.1617 -0.0045 0.0775  -0.1610 305 GLN A NE2 
2331 N N   . LEU A 306 ? 0.2743 0.3484 0.5993 -0.0233 0.0777  -0.1540 306 LEU A N   
2332 C CA  . LEU A 306 ? 0.2713 0.3408 0.5887 -0.0265 0.0811  -0.1600 306 LEU A CA  
2333 C C   . LEU A 306 ? 0.3635 0.4427 0.6699 -0.0358 0.0951  -0.1738 306 LEU A C   
2334 O O   . LEU A 306 ? 0.3679 0.4462 0.6865 -0.0386 0.1044  -0.1869 306 LEU A O   
2335 C CB  . LEU A 306 ? 0.2569 0.3213 0.5486 -0.0265 0.0708  -0.1484 306 LEU A CB  
2336 C CG  . LEU A 306 ? 0.3066 0.3686 0.5847 -0.0313 0.0735  -0.1534 306 LEU A CG  
2337 C CD1 . LEU A 306 ? 0.3024 0.3529 0.6007 -0.0278 0.0727  -0.1563 306 LEU A CD1 
2338 C CD2 . LEU A 306 ? 0.3197 0.3813 0.5711 -0.0325 0.0651  -0.1427 306 LEU A CD2 
2339 N N   . LEU A 307 ? 0.3359 0.4240 0.6198 -0.0410 0.0967  -0.1708 307 LEU A N   
2340 C CA  . LEU A 307 ? 0.3439 0.4417 0.6113 -0.0513 0.1086  -0.1814 307 LEU A CA  
2341 C C   . LEU A 307 ? 0.3976 0.5004 0.6872 -0.0544 0.1229  -0.1968 307 LEU A C   
2342 O O   . LEU A 307 ? 0.4079 0.5149 0.6924 -0.0626 0.1344  -0.2106 307 LEU A O   
2343 C CB  . LEU A 307 ? 0.3379 0.4426 0.5777 -0.0557 0.1057  -0.1721 307 LEU A CB  
2344 C CG  . LEU A 307 ? 0.3756 0.4776 0.5913 -0.0546 0.0939  -0.1591 307 LEU A CG  
2345 C CD1 . LEU A 307 ? 0.3798 0.4875 0.5748 -0.0577 0.0913  -0.1498 307 LEU A CD1 
2346 C CD2 . LEU A 307 ? 0.3796 0.4821 0.5816 -0.0600 0.0952  -0.1649 307 LEU A CD2 
2347 N N   . HIS A 308 ? 0.3387 0.4412 0.6545 -0.0481 0.1223  -0.1955 308 HIS A N   
2348 C CA  . HIS A 308 ? 0.3430 0.4506 0.6858 -0.0500 0.1362  -0.2107 308 HIS A CA  
2349 C C   . HIS A 308 ? 0.3503 0.4521 0.7176 -0.0483 0.1424  -0.2234 308 HIS A C   
2350 O O   . HIS A 308 ? 0.3337 0.4405 0.7124 -0.0545 0.1579  -0.2406 308 HIS A O   
2351 C CB  . HIS A 308 ? 0.3496 0.4592 0.7182 -0.0431 0.1327  -0.2057 308 HIS A CB  
2352 C CG  . HIS A 308 ? 0.4058 0.5220 0.8053 -0.0450 0.1475  -0.2219 308 HIS A CG  
2353 N ND1 . HIS A 308 ? 0.4307 0.5422 0.8702 -0.0375 0.1483  -0.2284 308 HIS A ND1 
2354 C CD2 . HIS A 308 ? 0.4421 0.5686 0.8375 -0.0542 0.1628  -0.2334 308 HIS A CD2 
2355 C CE1 . HIS A 308 ? 0.4327 0.5526 0.8938 -0.0417 0.1641  -0.2441 308 HIS A CE1 
2356 N NE2 . HIS A 308 ? 0.4450 0.5742 0.8797 -0.0523 0.1738  -0.2481 308 HIS A NE2 
2357 N N   . GLU A 309 ? 0.3058 0.3962 0.6809 -0.0406 0.1307  -0.2150 309 GLU A N   
2358 C CA  . GLU A 309 ? 0.3087 0.3902 0.7079 -0.0375 0.1337  -0.2235 309 GLU A CA  
2359 C C   . GLU A 309 ? 0.3593 0.4413 0.7383 -0.0470 0.1425  -0.2349 309 GLU A C   
2360 O O   . GLU A 309 ? 0.3435 0.4261 0.7392 -0.0511 0.1561  -0.2522 309 GLU A O   
2361 C CB  . GLU A 309 ? 0.3185 0.3875 0.7260 -0.0275 0.1170  -0.2078 309 GLU A CB  
2362 C CG  . GLU A 309 ? 0.5369 0.5957 0.9825 -0.0208 0.1175  -0.2127 309 GLU A CG  
2363 C CD  . GLU A 309 ? 0.9688 1.0298 1.4538 -0.0137 0.1180  -0.2144 309 GLU A CD  
2364 O OE1 . GLU A 309 ? 0.9264 0.9900 1.4121 -0.0088 0.1073  -0.2017 309 GLU A OE1 
2365 O OE2 . GLU A 309 ? 0.9894 1.0497 1.5067 -0.0130 0.1291  -0.2289 309 GLU A OE2 
2366 N N   . TRP A 310 ? 0.3378 0.4203 0.6818 -0.0508 0.1349  -0.2257 310 TRP A N   
2367 C CA  . TRP A 310 ? 0.3614 0.4458 0.6813 -0.0600 0.1395  -0.2332 310 TRP A CA  
2368 C C   . TRP A 310 ? 0.4126 0.5094 0.7168 -0.0725 0.1542  -0.2479 310 TRP A C   
2369 O O   . TRP A 310 ? 0.4161 0.5138 0.7213 -0.0800 0.1651  -0.2637 310 TRP A O   
2370 C CB  . TRP A 310 ? 0.3553 0.4396 0.6436 -0.0600 0.1260  -0.2172 310 TRP A CB  
2371 C CG  . TRP A 310 ? 0.3763 0.4488 0.6674 -0.0539 0.1151  -0.2081 310 TRP A CG  
2372 C CD1 . TRP A 310 ? 0.4213 0.4823 0.7380 -0.0488 0.1151  -0.2114 310 TRP A CD1 
2373 C CD2 . TRP A 310 ? 0.3678 0.4389 0.6355 -0.0529 0.1030  -0.1941 310 TRP A CD2 
2374 N NE1 . TRP A 310 ? 0.4121 0.4642 0.7203 -0.0454 0.1039  -0.1999 310 TRP A NE1 
2375 C CE2 . TRP A 310 ? 0.4201 0.4786 0.6989 -0.0478 0.0968  -0.1897 310 TRP A CE2 
2376 C CE3 . TRP A 310 ? 0.3797 0.4585 0.6193 -0.0559 0.0972  -0.1848 310 TRP A CE3 
2377 C CZ2 . TRP A 310 ? 0.4028 0.4572 0.6650 -0.0462 0.0860  -0.1775 310 TRP A CZ2 
2378 C CZ3 . TRP A 310 ? 0.3952 0.4700 0.6212 -0.0533 0.0861  -0.1729 310 TRP A CZ3 
2379 C CH2 . TRP A 310 ? 0.3998 0.4629 0.6366 -0.0489 0.0812  -0.1699 310 TRP A CH2 
2380 N N   . GLY A 311 ? 0.3558 0.4616 0.6430 -0.0756 0.1540  -0.2419 311 GLY A N   
2381 C CA  . GLY A 311 ? 0.3575 0.4751 0.6219 -0.0885 0.1655  -0.2513 311 GLY A CA  
2382 C C   . GLY A 311 ? 0.4260 0.5473 0.6528 -0.0959 0.1591  -0.2456 311 GLY A C   
2383 O O   . GLY A 311 ? 0.4029 0.5180 0.6247 -0.0904 0.1467  -0.2351 311 GLY A O   
2384 N N   . GLU A 312 ? 0.4113 0.5431 0.6114 -0.1091 0.1671  -0.2524 312 GLU A N   
2385 C CA  . GLU A 312 ? 0.4078 0.5448 0.5731 -0.1173 0.1606  -0.2477 312 GLU A CA  
2386 C C   . GLU A 312 ? 0.4117 0.5447 0.5794 -0.1189 0.1599  -0.2558 312 GLU A C   
2387 O O   . GLU A 312 ? 0.3783 0.5101 0.5320 -0.1167 0.1473  -0.2448 312 GLU A O   
2388 C CB  . GLU A 312 ? 0.4497 0.5986 0.5864 -0.1324 0.1697  -0.2540 312 GLU A CB  
2389 C CG  . GLU A 312 ? 0.6198 0.7725 0.7379 -0.1317 0.1620  -0.2368 312 GLU A CG  
2390 C CD  . GLU A 312 ? 1.0575 1.2207 1.1463 -0.1465 0.1700  -0.2398 312 GLU A CD  
2391 O OE1 . GLU A 312 ? 1.0362 1.2044 1.1236 -0.1578 0.1858  -0.2583 312 GLU A OE1 
2392 O OE2 . GLU A 312 ? 1.0499 1.2155 1.1184 -0.1470 0.1613  -0.2237 312 GLU A OE2 
2393 N N   . GLU A 313 ? 0.3703 0.5008 0.5584 -0.1223 0.1736  -0.2752 313 GLU A N   
2394 C CA  . GLU A 313 ? 0.3706 0.4961 0.5648 -0.1247 0.1756  -0.2860 313 GLU A CA  
2395 C C   . GLU A 313 ? 0.4251 0.5386 0.6351 -0.1119 0.1625  -0.2734 313 GLU A C   
2396 O O   . GLU A 313 ? 0.4121 0.5247 0.6086 -0.1138 0.1549  -0.2697 313 GLU A O   
2397 C CB  . GLU A 313 ? 0.3957 0.5189 0.6157 -0.1289 0.1937  -0.3087 313 GLU A CB  
2398 C CG  . GLU A 313 ? 0.5407 0.6755 0.7387 -0.1463 0.2081  -0.3264 313 GLU A CG  
2399 C CD  . GLU A 313 ? 0.9040 1.0392 1.1274 -0.1504 0.2284  -0.3478 313 GLU A CD  
2400 O OE1 . GLU A 313 ? 0.7753 0.9002 1.0376 -0.1409 0.2324  -0.3540 313 GLU A OE1 
2401 O OE2 . GLU A 313 ? 0.9508 1.0968 1.1555 -0.1637 0.2404  -0.3584 313 GLU A OE2 
2402 N N   . GLY A 314 ? 0.3942 0.4992 0.6318 -0.0998 0.1598  -0.2668 314 GLY A N   
2403 C CA  . GLY A 314 ? 0.3721 0.4647 0.6253 -0.0877 0.1474  -0.2537 314 GLY A CA  
2404 C C   . GLY A 314 ? 0.3766 0.4706 0.6053 -0.0851 0.1322  -0.2354 314 GLY A C   
2405 O O   . GLY A 314 ? 0.3567 0.4429 0.5864 -0.0811 0.1240  -0.2289 314 GLY A O   
2406 N N   . PHE A 315 ? 0.3399 0.4434 0.5471 -0.0879 0.1293  -0.2274 315 PHE A N   
2407 C CA  . PHE A 315 ? 0.3376 0.4441 0.5217 -0.0862 0.1160  -0.2107 315 PHE A CA  
2408 C C   . PHE A 315 ? 0.3822 0.4951 0.5431 -0.0952 0.1139  -0.2138 315 PHE A C   
2409 O O   . PHE A 315 ? 0.3646 0.4757 0.5176 -0.0920 0.1031  -0.2033 315 PHE A O   
2410 C CB  . PHE A 315 ? 0.3663 0.4804 0.5370 -0.0872 0.1148  -0.2024 315 PHE A CB  
2411 C CG  . PHE A 315 ? 0.3892 0.5071 0.5363 -0.0866 0.1025  -0.1867 315 PHE A CG  
2412 C CD1 . PHE A 315 ? 0.4307 0.5414 0.5834 -0.0767 0.0911  -0.1723 315 PHE A CD1 
2413 C CD2 . PHE A 315 ? 0.4255 0.5541 0.5456 -0.0964 0.1021  -0.1863 315 PHE A CD2 
2414 C CE1 . PHE A 315 ? 0.4364 0.5505 0.5707 -0.0759 0.0807  -0.1590 315 PHE A CE1 
2415 C CE2 . PHE A 315 ? 0.4619 0.5939 0.5642 -0.0951 0.0901  -0.1713 315 PHE A CE2 
2416 C CZ  . PHE A 315 ? 0.4257 0.5502 0.5365 -0.0846 0.0801  -0.1584 315 PHE A CZ  
2417 N N   . MET A 316 ? 0.3460 0.4674 0.4959 -0.1071 0.1244  -0.2286 316 MET A N   
2418 C CA  . MET A 316 ? 0.3446 0.4737 0.4726 -0.1171 0.1224  -0.2330 316 MET A CA  
2419 C C   . MET A 316 ? 0.3708 0.4918 0.5129 -0.1155 0.1222  -0.2396 316 MET A C   
2420 O O   . MET A 316 ? 0.3726 0.4958 0.5031 -0.1166 0.1131  -0.2336 316 MET A O   
2421 C CB  . MET A 316 ? 0.3983 0.5390 0.5081 -0.1318 0.1335  -0.2470 316 MET A CB  
2422 C CG  . MET A 316 ? 0.4523 0.6018 0.5413 -0.1356 0.1321  -0.2380 316 MET A CG  
2423 S SD  . MET A 316 ? 0.4939 0.6462 0.5648 -0.1291 0.1130  -0.2126 316 MET A SD  
2424 C CE  . MET A 316 ? 0.4698 0.6343 0.5119 -0.1416 0.1067  -0.2142 316 MET A CE  
2425 N N   . ALA A 317 ? 0.3162 0.4270 0.4858 -0.1120 0.1315  -0.2506 317 ALA A N   
2426 C CA  . ALA A 317 ? 0.3054 0.4051 0.4928 -0.1095 0.1321  -0.2562 317 ALA A CA  
2427 C C   . ALA A 317 ? 0.3403 0.4316 0.5304 -0.0992 0.1180  -0.2382 317 ALA A C   
2428 O O   . ALA A 317 ? 0.3181 0.4060 0.5064 -0.1007 0.1141  -0.2383 317 ALA A O   
2429 C CB  . ALA A 317 ? 0.3108 0.4003 0.5302 -0.1057 0.1435  -0.2683 317 ALA A CB  
2430 N N   . HIS A 318 ? 0.2935 0.3823 0.4867 -0.0899 0.1107  -0.2235 318 HIS A N   
2431 C CA  . HIS A 318 ? 0.2882 0.3701 0.4810 -0.0814 0.0982  -0.2069 318 HIS A CA  
2432 C C   . HIS A 318 ? 0.3647 0.4563 0.5326 -0.0858 0.0899  -0.1996 318 HIS A C   
2433 O O   . HIS A 318 ? 0.3713 0.4579 0.5393 -0.0838 0.0836  -0.1942 318 HIS A O   
2434 C CB  . HIS A 318 ? 0.2879 0.3658 0.4889 -0.0719 0.0929  -0.1944 318 HIS A CB  
2435 C CG  . HIS A 318 ? 0.3266 0.3987 0.5231 -0.0652 0.0807  -0.1784 318 HIS A CG  
2436 N ND1 . HIS A 318 ? 0.3504 0.4090 0.5611 -0.0599 0.0771  -0.1744 318 HIS A ND1 
2437 C CD2 . HIS A 318 ? 0.3436 0.4216 0.5229 -0.0639 0.0724  -0.1664 318 HIS A CD2 
2438 C CE1 . HIS A 318 ? 0.3330 0.3902 0.5334 -0.0562 0.0673  -0.1609 318 HIS A CE1 
2439 N NE2 . HIS A 318 ? 0.3330 0.4016 0.5160 -0.0580 0.0644  -0.1561 318 HIS A NE2 
2440 N N   . VAL A 319 ? 0.3209 0.4260 0.4682 -0.0920 0.0897  -0.1990 319 VAL A N   
2441 C CA  . VAL A 319 ? 0.3189 0.4338 0.4453 -0.0957 0.0806  -0.1913 319 VAL A CA  
2442 C C   . VAL A 319 ? 0.3901 0.5076 0.5135 -0.1029 0.0813  -0.2005 319 VAL A C   
2443 O O   . VAL A 319 ? 0.3820 0.5004 0.5019 -0.1014 0.0730  -0.1932 319 VAL A O   
2444 C CB  . VAL A 319 ? 0.3670 0.4946 0.4719 -0.1000 0.0773  -0.1849 319 VAL A CB  
2445 C CG1 . VAL A 319 ? 0.3593 0.4840 0.4691 -0.0946 0.0794  -0.1790 319 VAL A CG1 
2446 C CG2 . VAL A 319 ? 0.3843 0.5240 0.4722 -0.1133 0.0830  -0.1968 319 VAL A CG2 
2447 N N   . ASP A 320 ? 0.3678 0.4854 0.4958 -0.1104 0.0922  -0.2174 320 ASP A N   
2448 C CA  . ASP A 320 ? 0.3830 0.5023 0.5101 -0.1184 0.0946  -0.2288 320 ASP A CA  
2449 C C   . ASP A 320 ? 0.4230 0.5289 0.5673 -0.1123 0.0921  -0.2262 320 ASP A C   
2450 O O   . ASP A 320 ? 0.4265 0.5357 0.5661 -0.1172 0.0889  -0.2285 320 ASP A O   
2451 C CB  . ASP A 320 ? 0.4290 0.5511 0.5572 -0.1286 0.1082  -0.2487 320 ASP A CB  
2452 C CG  . ASP A 320 ? 0.6552 0.7943 0.7564 -0.1402 0.1084  -0.2523 320 ASP A CG  
2453 O OD1 . ASP A 320 ? 0.6848 0.8344 0.7696 -0.1472 0.1013  -0.2513 320 ASP A OD1 
2454 O OD2 . ASP A 320 ? 0.7545 0.8970 0.8508 -0.1423 0.1147  -0.2548 320 ASP A OD2 
2455 N N   . ARG A 321 ? 0.3588 0.4502 0.5222 -0.1022 0.0927  -0.2203 321 ARG A N   
2456 C CA  . ARG A 321 ? 0.3426 0.4195 0.5209 -0.0964 0.0898  -0.2156 321 ARG A CA  
2457 C C   . ARG A 321 ? 0.3805 0.4599 0.5482 -0.0924 0.0781  -0.2000 321 ARG A C   
2458 O O   . ARG A 321 ? 0.3824 0.4567 0.5527 -0.0930 0.0754  -0.1983 321 ARG A O   
2459 C CB  . ARG A 321 ? 0.3284 0.3902 0.5292 -0.0875 0.0926  -0.2129 321 ARG A CB  
2460 C CG  . ARG A 321 ? 0.4529 0.5089 0.6720 -0.0907 0.1049  -0.2295 321 ARG A CG  
2461 C CD  . ARG A 321 ? 0.6243 0.6641 0.8700 -0.0810 0.1059  -0.2256 321 ARG A CD  
2462 N NE  . ARG A 321 ? 0.7425 0.7855 0.9921 -0.0747 0.1046  -0.2194 321 ARG A NE  
2463 C CZ  . ARG A 321 ? 0.9521 1.0000 1.2107 -0.0766 0.1141  -0.2304 321 ARG A CZ  
2464 N NH1 . ARG A 321 ? 0.8500 0.9005 1.1133 -0.0849 0.1262  -0.2488 321 ARG A NH1 
2465 N NH2 . ARG A 321 ? 0.7515 0.8022 1.0145 -0.0709 0.1125  -0.2240 321 ARG A NH2 
2466 N N   . VAL A 322 ? 0.3198 0.4071 0.4759 -0.0890 0.0721  -0.1896 322 VAL A N   
2467 C CA  . VAL A 322 ? 0.2997 0.3905 0.4468 -0.0853 0.0620  -0.1759 322 VAL A CA  
2468 C C   . VAL A 322 ? 0.3742 0.4787 0.5084 -0.0934 0.0586  -0.1794 322 VAL A C   
2469 O O   . VAL A 322 ? 0.3692 0.4725 0.5052 -0.0930 0.0542  -0.1756 322 VAL A O   
2470 C CB  . VAL A 322 ? 0.3118 0.4056 0.4529 -0.0792 0.0572  -0.1643 322 VAL A CB  
2471 C CG1 . VAL A 322 ? 0.2880 0.3856 0.4215 -0.0757 0.0478  -0.1516 322 VAL A CG1 
2472 C CG2 . VAL A 322 ? 0.2986 0.3795 0.4545 -0.0716 0.0595  -0.1611 322 VAL A CG2 
2473 N N   . ILE A 323 ? 0.3537 0.4714 0.4755 -0.1016 0.0609  -0.1872 323 ILE A N   
2474 C CA  . ILE A 323 ? 0.3792 0.5116 0.4885 -0.1105 0.0568  -0.1911 323 ILE A CA  
2475 C C   . ILE A 323 ? 0.4362 0.5637 0.5552 -0.1148 0.0602  -0.2007 323 ILE A C   
2476 O O   . ILE A 323 ? 0.4321 0.5659 0.5492 -0.1167 0.0539  -0.1976 323 ILE A O   
2477 C CB  . ILE A 323 ? 0.4459 0.5916 0.5391 -0.1205 0.0601  -0.1998 323 ILE A CB  
2478 C CG1 . ILE A 323 ? 0.4645 0.6151 0.5467 -0.1174 0.0569  -0.1897 323 ILE A CG1 
2479 C CG2 . ILE A 323 ? 0.4591 0.6203 0.5398 -0.1304 0.0544  -0.2038 323 ILE A CG2 
2480 C CD1 . ILE A 323 ? 0.6121 0.7724 0.6781 -0.1279 0.0633  -0.1990 323 ILE A CD1 
2481 N N   . ASP A 324 ? 0.3991 0.5149 0.5304 -0.1162 0.0702  -0.2122 324 ASP A N   
2482 C CA  . ASP A 324 ? 0.4075 0.5159 0.5497 -0.1206 0.0748  -0.2218 324 ASP A CA  
2483 C C   . ASP A 324 ? 0.4392 0.5384 0.5896 -0.1143 0.0693  -0.2111 324 ASP A C   
2484 O O   . ASP A 324 ? 0.4457 0.5472 0.5974 -0.1196 0.0684  -0.2149 324 ASP A O   
2485 C CB  . ASP A 324 ? 0.4450 0.5405 0.6024 -0.1217 0.0868  -0.2348 324 ASP A CB  
2486 C CG  . ASP A 324 ? 0.6051 0.6901 0.7761 -0.1257 0.0921  -0.2442 324 ASP A CG  
2487 O OD1 . ASP A 324 ? 0.6250 0.7197 0.7892 -0.1359 0.0930  -0.2543 324 ASP A OD1 
2488 O OD2 . ASP A 324 ? 0.6688 0.7356 0.8570 -0.1191 0.0948  -0.2409 324 ASP A OD2 
2489 N N   . PHE A 325 ? 0.3589 0.4483 0.5138 -0.1041 0.0659  -0.1980 325 PHE A N   
2490 C CA  . PHE A 325 ? 0.3463 0.4273 0.5060 -0.0994 0.0612  -0.1878 325 PHE A CA  
2491 C C   . PHE A 325 ? 0.4290 0.5247 0.5787 -0.1011 0.0532  -0.1815 325 PHE A C   
2492 O O   . PHE A 325 ? 0.4594 0.5545 0.6128 -0.1041 0.0524  -0.1823 325 PHE A O   
2493 C CB  . PHE A 325 ? 0.3517 0.4190 0.5173 -0.0894 0.0594  -0.1762 325 PHE A CB  
2494 C CG  . PHE A 325 ? 0.3557 0.4180 0.5201 -0.0854 0.0535  -0.1643 325 PHE A CG  
2495 C CD1 . PHE A 325 ? 0.3798 0.4292 0.5515 -0.0868 0.0555  -0.1638 325 PHE A CD1 
2496 C CD2 . PHE A 325 ? 0.3778 0.4482 0.5336 -0.0812 0.0469  -0.1540 325 PHE A CD2 
2497 C CE1 . PHE A 325 ? 0.3802 0.4257 0.5491 -0.0847 0.0513  -0.1539 325 PHE A CE1 
2498 C CE2 . PHE A 325 ? 0.4011 0.4674 0.5562 -0.0785 0.0430  -0.1448 325 PHE A CE2 
2499 C CZ  . PHE A 325 ? 0.3724 0.4266 0.5333 -0.0806 0.0455  -0.1451 325 PHE A CZ  
2500 N N   . TYR A 326 ? 0.3563 0.4648 0.4952 -0.0992 0.0474  -0.1753 326 TYR A N   
2501 C CA  . TYR A 326 ? 0.3404 0.4631 0.4729 -0.0998 0.0391  -0.1686 326 TYR A CA  
2502 C C   . TYR A 326 ? 0.3607 0.4984 0.4896 -0.1095 0.0374  -0.1776 326 TYR A C   
2503 O O   . TYR A 326 ? 0.3511 0.4984 0.4816 -0.1103 0.0313  -0.1737 326 TYR A O   
2504 C CB  . TYR A 326 ? 0.3564 0.4867 0.4800 -0.0949 0.0332  -0.1585 326 TYR A CB  
2505 C CG  . TYR A 326 ? 0.3923 0.5106 0.5205 -0.0853 0.0321  -0.1474 326 TYR A CG  
2506 C CD1 . TYR A 326 ? 0.4105 0.5286 0.5420 -0.0811 0.0274  -0.1387 326 TYR A CD1 
2507 C CD2 . TYR A 326 ? 0.4057 0.5134 0.5358 -0.0809 0.0361  -0.1465 326 TYR A CD2 
2508 C CE1 . TYR A 326 ? 0.4218 0.5290 0.5558 -0.0737 0.0267  -0.1296 326 TYR A CE1 
2509 C CE2 . TYR A 326 ? 0.4032 0.5007 0.5371 -0.0730 0.0344  -0.1366 326 TYR A CE2 
2510 C CZ  . TYR A 326 ? 0.5028 0.5998 0.6373 -0.0698 0.0297  -0.1283 326 TYR A CZ  
2511 O OH  . TYR A 326 ? 0.5516 0.6387 0.6881 -0.0632 0.0283  -0.1196 326 TYR A OH  
2512 N N   . SER A 327 ? 0.3012 0.4415 0.4265 -0.1173 0.0430  -0.1904 327 SER A N   
2513 C CA  . SER A 327 ? 0.3188 0.4734 0.4397 -0.1281 0.0418  -0.2007 327 SER A CA  
2514 C C   . SER A 327 ? 0.3964 0.5446 0.5300 -0.1310 0.0447  -0.2061 327 SER A C   
2515 O O   . SER A 327 ? 0.3840 0.5452 0.5182 -0.1358 0.0392  -0.2070 327 SER A O   
2516 C CB  . SER A 327 ? 0.3856 0.5431 0.4985 -0.1365 0.0487  -0.2142 327 SER A CB  
2517 O OG  . SER A 327 ? 0.5669 0.7356 0.6762 -0.1484 0.0494  -0.2271 327 SER A OG  
2518 N N   . ASN A 328 ? 0.3729 0.5012 0.5176 -0.1278 0.0527  -0.2084 328 ASN A N   
2519 C CA  . ASN A 328 ? 0.3832 0.5021 0.5395 -0.1306 0.0564  -0.2121 328 ASN A CA  
2520 C C   . ASN A 328 ? 0.4172 0.5378 0.5762 -0.1258 0.0502  -0.2002 328 ASN A C   
2521 O O   . ASN A 328 ? 0.4291 0.5551 0.5934 -0.1312 0.0497  -0.2037 328 ASN A O   
2522 C CB  . ASN A 328 ? 0.4610 0.5566 0.6282 -0.1277 0.0653  -0.2148 328 ASN A CB  
2523 C CG  . ASN A 328 ? 1.0626 1.1542 1.2332 -0.1333 0.0740  -0.2296 328 ASN A CG  
2524 O OD1 . ASN A 328 ? 1.0482 1.1242 1.2313 -0.1351 0.0815  -0.2363 328 ASN A OD1 
2525 N ND2 . ASN A 328 ? 1.0320 1.1361 1.1923 -0.1362 0.0740  -0.2350 328 ASN A ND2 
2526 N N   . GLN A 329 ? 0.3489 0.4659 0.5049 -0.1166 0.0462  -0.1874 329 GLN A N   
2527 C CA  . GLN A 329 ? 0.3473 0.4662 0.5059 -0.1121 0.0413  -0.1769 329 GLN A CA  
2528 C C   . GLN A 329 ? 0.4126 0.5538 0.5703 -0.1160 0.0340  -0.1776 329 GLN A C   
2529 O O   . GLN A 329 ? 0.4122 0.5572 0.5778 -0.1186 0.0336  -0.1781 329 GLN A O   
2530 C CB  . GLN A 329 ? 0.3545 0.4664 0.5093 -0.1022 0.0385  -0.1645 329 GLN A CB  
2531 C CG  . GLN A 329 ? 0.4863 0.5763 0.6444 -0.0976 0.0438  -0.1614 329 GLN A CG  
2532 C CD  . GLN A 329 ? 0.5855 0.6624 0.7489 -0.0977 0.0462  -0.1573 329 GLN A CD  
2533 O OE1 . GLN A 329 ? 0.4984 0.5612 0.6674 -0.1008 0.0516  -0.1613 329 GLN A OE1 
2534 N NE2 . GLN A 329 ? 0.4531 0.5333 0.6151 -0.0947 0.0427  -0.1492 329 GLN A NE2 
2535 N N   . LYS A 330 ? 0.3650 0.5210 0.5135 -0.1174 0.0285  -0.1780 330 LYS A N   
2536 C CA  . LYS A 330 ? 0.3541 0.5324 0.5012 -0.1214 0.0196  -0.1776 330 LYS A CA  
2537 C C   . LYS A 330 ? 0.4204 0.6069 0.5740 -0.1315 0.0210  -0.1892 330 LYS A C   
2538 O O   . LYS A 330 ? 0.4223 0.6213 0.5843 -0.1327 0.0155  -0.1875 330 LYS A O   
2539 C CB  . LYS A 330 ? 0.3779 0.5675 0.5107 -0.1234 0.0147  -0.1770 330 LYS A CB  
2540 C CG  . LYS A 330 ? 0.4055 0.6181 0.5358 -0.1270 0.0031  -0.1736 330 LYS A CG  
2541 C CD  . LYS A 330 ? 0.5046 0.7285 0.6176 -0.1336 -0.0007 -0.1763 330 LYS A CD  
2542 C CE  . LYS A 330 ? 0.5579 0.7913 0.6660 -0.1466 0.0010  -0.1912 330 LYS A CE  
2543 N NZ  . LYS A 330 ? 0.5548 0.7734 0.6597 -0.1505 0.0139  -0.2037 330 LYS A NZ  
2544 N N   . ASP A 331 ? 0.3891 0.5686 0.5409 -0.1386 0.0286  -0.2016 331 ASP A N   
2545 C CA  . ASP A 331 ? 0.4003 0.5858 0.5582 -0.1491 0.0312  -0.2143 331 ASP A CA  
2546 C C   . ASP A 331 ? 0.4456 0.6232 0.6179 -0.1480 0.0346  -0.2126 331 ASP A C   
2547 O O   . ASP A 331 ? 0.4341 0.6250 0.6142 -0.1541 0.0316  -0.2170 331 ASP A O   
2548 C CB  . ASP A 331 ? 0.4409 0.6160 0.5958 -0.1558 0.0409  -0.2280 331 ASP A CB  
2549 C CG  . ASP A 331 ? 0.5932 0.7775 0.7332 -0.1600 0.0397  -0.2332 331 ASP A CG  
2550 O OD1 . ASP A 331 ? 0.6214 0.8259 0.7520 -0.1632 0.0299  -0.2302 331 ASP A OD1 
2551 O OD2 . ASP A 331 ? 0.6529 0.8245 0.7913 -0.1609 0.0486  -0.2405 331 ASP A OD2 
2552 N N   . ALA A 332 ? 0.4059 0.5627 0.5811 -0.1406 0.0403  -0.2056 332 ALA A N   
2553 C CA  . ALA A 332 ? 0.4040 0.5496 0.5893 -0.1398 0.0447  -0.2025 332 ALA A CA  
2554 C C   . ALA A 332 ? 0.4450 0.6030 0.6361 -0.1362 0.0386  -0.1942 332 ALA A C   
2555 O O   . ALA A 332 ? 0.4489 0.6072 0.6500 -0.1401 0.0417  -0.1965 332 ALA A O   
2556 C CB  . ALA A 332 ? 0.4128 0.5333 0.5967 -0.1337 0.0509  -0.1964 332 ALA A CB  
2557 N N   . ILE A 333 ? 0.3831 0.5509 0.5693 -0.1292 0.0308  -0.1852 333 ILE A N   
2558 C CA  . ILE A 333 ? 0.3744 0.5553 0.5689 -0.1253 0.0247  -0.1780 333 ILE A CA  
2559 C C   . ILE A 333 ? 0.4220 0.6272 0.6245 -0.1320 0.0176  -0.1841 333 ILE A C   
2560 O O   . ILE A 333 ? 0.4274 0.6423 0.6441 -0.1328 0.0162  -0.1838 333 ILE A O   
2561 C CB  . ILE A 333 ? 0.4082 0.5890 0.5968 -0.1151 0.0192  -0.1657 333 ILE A CB  
2562 C CG1 . ILE A 333 ? 0.4027 0.5895 0.6029 -0.1100 0.0168  -0.1586 333 ILE A CG1 
2563 C CG2 . ILE A 333 ? 0.4179 0.6128 0.5974 -0.1148 0.0106  -0.1641 333 ILE A CG2 
2564 C CD1 . ILE A 333 ? 0.4890 0.6573 0.6880 -0.1050 0.0234  -0.1529 333 ILE A CD1 
2565 N N   . LEU A 334 ? 0.3463 0.5616 0.5399 -0.1376 0.0133  -0.1902 334 LEU A N   
2566 C CA  . LEU A 334 ? 0.3338 0.5728 0.5318 -0.1453 0.0051  -0.1960 334 LEU A CA  
2567 C C   . LEU A 334 ? 0.4063 0.6473 0.6164 -0.1546 0.0106  -0.2077 334 LEU A C   
2568 O O   . LEU A 334 ? 0.3943 0.6547 0.6172 -0.1585 0.0043  -0.2099 334 LEU A O   
2569 C CB  . LEU A 334 ? 0.3353 0.5818 0.5166 -0.1503 0.0007  -0.2000 334 LEU A CB  
2570 C CG  . LEU A 334 ? 0.3782 0.6414 0.5516 -0.1470 -0.0123 -0.1901 334 LEU A CG  
2571 C CD1 . LEU A 334 ? 0.3613 0.6288 0.5473 -0.1367 -0.0185 -0.1767 334 LEU A CD1 
2572 C CD2 . LEU A 334 ? 0.3869 0.6419 0.5407 -0.1457 -0.0105 -0.1883 334 LEU A CD2 
2573 N N   . ALA A 335 ? 0.3920 0.6129 0.5999 -0.1580 0.0222  -0.2148 335 ALA A N   
2574 C CA  . ALA A 335 ? 0.4119 0.6303 0.6307 -0.1673 0.0294  -0.2259 335 ALA A CA  
2575 C C   . ALA A 335 ? 0.4930 0.7104 0.7268 -0.1647 0.0320  -0.2210 335 ALA A C   
2576 O O   . ALA A 335 ? 0.5193 0.7518 0.7671 -0.1712 0.0304  -0.2270 335 ALA A O   
2577 C CB  . ALA A 335 ? 0.4275 0.6217 0.6409 -0.1702 0.0409  -0.2324 335 ALA A CB  
2578 N N   . ALA A 336 ? 0.4336 0.6348 0.6646 -0.1557 0.0357  -0.2105 336 ALA A N   
2579 C CA  . ALA A 336 ? 0.4337 0.6322 0.6760 -0.1533 0.0395  -0.2057 336 ALA A CA  
2580 C C   . ALA A 336 ? 0.4807 0.7045 0.7370 -0.1510 0.0303  -0.2029 336 ALA A C   
2581 O O   . ALA A 336 ? 0.4703 0.7018 0.7429 -0.1547 0.0332  -0.2064 336 ALA A O   
2582 C CB  . ALA A 336 ? 0.4400 0.6178 0.6731 -0.1445 0.0437  -0.1949 336 ALA A CB  
2583 N N   . ALA A 337 ? 0.4309 0.6678 0.6820 -0.1455 0.0192  -0.1970 337 ALA A N   
2584 C CA  . ALA A 337 ? 0.4183 0.6794 0.6835 -0.1426 0.0083  -0.1930 337 ALA A CA  
2585 C C   . ALA A 337 ? 0.4943 0.7766 0.7722 -0.1527 0.0036  -0.2033 337 ALA A C   
2586 O O   . ALA A 337 ? 0.4837 0.7823 0.7826 -0.1529 0.0002  -0.2036 337 ALA A O   
2587 C CB  . ALA A 337 ? 0.4206 0.6883 0.6744 -0.1359 -0.0025 -0.1838 337 ALA A CB  
2588 N N   . ASP A 338 ? 0.4689 0.7511 0.7354 -0.1615 0.0039  -0.2126 338 ASP A N   
2589 C CA  . ASP A 338 ? 0.4828 0.7848 0.7589 -0.1727 -0.0004 -0.2239 338 ASP A CA  
2590 C C   . ASP A 338 ? 0.5106 0.8107 0.8054 -0.1788 0.0091  -0.2319 338 ASP A C   
2591 O O   . ASP A 338 ? 0.5041 0.8255 0.8188 -0.1825 0.0037  -0.2353 338 ASP A O   
2592 C CB  . ASP A 338 ? 0.5357 0.8342 0.7940 -0.1815 0.0007  -0.2336 338 ASP A CB  
2593 C CG  . ASP A 338 ? 0.8419 1.1532 1.0839 -0.1811 -0.0112 -0.2297 338 ASP A CG  
2594 O OD1 . ASP A 338 ? 0.8693 1.1972 1.1162 -0.1754 -0.0236 -0.2195 338 ASP A OD1 
2595 O OD2 . ASP A 338 ? 0.9685 1.2735 1.1936 -0.1874 -0.0079 -0.2373 338 ASP A OD2 
2596 N N   . LYS A 339 ? 0.4461 0.7206 0.7349 -0.1798 0.0230  -0.2341 339 LYS A N   
2597 C CA  . LYS A 339 ? 0.4379 0.7040 0.7394 -0.1863 0.0345  -0.2407 339 LYS A CA  
2598 C C   . LYS A 339 ? 0.5040 0.7807 0.8263 -0.1833 0.0352  -0.2371 339 LYS A C   
2599 O O   . LYS A 339 ? 0.5225 0.8103 0.8627 -0.1914 0.0384  -0.2457 339 LYS A O   
2600 C CB  . LYS A 339 ? 0.4481 0.6819 0.7355 -0.1851 0.0471  -0.2386 339 LYS A CB  
2601 C CG  . LYS A 339 ? 0.3572 0.5773 0.6522 -0.1940 0.0600  -0.2458 339 LYS A CG  
2602 C CD  . LYS A 339 ? 0.3483 0.5368 0.6278 -0.1921 0.0692  -0.2419 339 LYS A CD  
2603 C CE  . LYS A 339 ? 0.4460 0.6168 0.7298 -0.2014 0.0817  -0.2475 339 LYS A CE  
2604 N NZ  . LYS A 339 ? 0.5398 0.6794 0.8095 -0.1977 0.0887  -0.2402 339 LYS A NZ  
2605 N N   . TRP A 340 ? 0.4431 0.7164 0.7642 -0.1721 0.0332  -0.2255 340 TRP A N   
2606 C CA  . TRP A 340 ? 0.4392 0.7189 0.7793 -0.1687 0.0364  -0.2225 340 TRP A CA  
2607 C C   . TRP A 340 ? 0.5093 0.8135 0.8666 -0.1614 0.0240  -0.2169 340 TRP A C   
2608 O O   . TRP A 340 ? 0.5211 0.8398 0.9031 -0.1627 0.0253  -0.2201 340 TRP A O   
2609 C CB  . TRP A 340 ? 0.4263 0.6803 0.7544 -0.1631 0.0469  -0.2149 340 TRP A CB  
2610 C CG  . TRP A 340 ? 0.4549 0.6827 0.7669 -0.1691 0.0582  -0.2178 340 TRP A CG  
2611 C CD1 . TRP A 340 ? 0.4961 0.7036 0.7865 -0.1660 0.0589  -0.2133 340 TRP A CD1 
2612 C CD2 . TRP A 340 ? 0.4638 0.6831 0.7820 -0.1796 0.0699  -0.2255 340 TRP A CD2 
2613 N NE1 . TRP A 340 ? 0.4992 0.6857 0.7831 -0.1732 0.0697  -0.2171 340 TRP A NE1 
2614 C CE2 . TRP A 340 ? 0.5255 0.7180 0.8249 -0.1819 0.0768  -0.2243 340 TRP A CE2 
2615 C CE3 . TRP A 340 ? 0.4831 0.7148 0.8222 -0.1874 0.0756  -0.2333 340 TRP A CE3 
2616 C CZ2 . TRP A 340 ? 0.5337 0.7103 0.8333 -0.1919 0.0886  -0.2296 340 TRP A CZ2 
2617 C CZ3 . TRP A 340 ? 0.5151 0.7316 0.8534 -0.1979 0.0882  -0.2395 340 TRP A CZ3 
2618 C CH2 . TRP A 340 ? 0.5344 0.7231 0.8525 -0.2002 0.0943  -0.2371 340 TRP A CH2 
2619 N N   . LEU A 341 ? 0.4638 0.7716 0.8094 -0.1536 0.0126  -0.2081 341 LEU A N   
2620 C CA  . LEU A 341 ? 0.4543 0.7818 0.8146 -0.1452 0.0001  -0.1999 341 LEU A CA  
2621 C C   . LEU A 341 ? 0.5077 0.8646 0.8825 -0.1494 -0.0148 -0.2027 341 LEU A C   
2622 O O   . LEU A 341 ? 0.4848 0.8600 0.8795 -0.1432 -0.0248 -0.1965 341 LEU A O   
2623 C CB  . LEU A 341 ? 0.4526 0.7689 0.7941 -0.1349 -0.0047 -0.1876 341 LEU A CB  
2624 C CG  . LEU A 341 ? 0.5087 0.8019 0.8425 -0.1278 0.0061  -0.1816 341 LEU A CG  
2625 C CD1 . LEU A 341 ? 0.5141 0.7821 0.8258 -0.1322 0.0172  -0.1850 341 LEU A CD1 
2626 C CD2 . LEU A 341 ? 0.5429 0.8333 0.8671 -0.1171 -0.0017 -0.1694 341 LEU A CD2 
2627 N N   . THR A 342 ? 0.4922 0.8539 0.8581 -0.1600 -0.0166 -0.2119 342 THR A N   
2628 C CA  . THR A 342 ? 0.5025 0.8927 0.8796 -0.1660 -0.0312 -0.2156 342 THR A CA  
2629 C C   . THR A 342 ? 0.5574 0.9681 0.9706 -0.1666 -0.0329 -0.2189 342 THR A C   
2630 O O   . THR A 342 ? 0.5478 0.9518 0.9730 -0.1713 -0.0194 -0.2273 342 THR A O   
2631 C CB  . THR A 342 ? 0.6444 1.0334 1.0052 -0.1788 -0.0296 -0.2274 342 THR A CB  
2632 O OG1 . THR A 342 ? 0.6969 1.0673 1.0272 -0.1768 -0.0276 -0.2239 342 THR A OG1 
2633 C CG2 . THR A 342 ? 0.6406 1.0598 1.0104 -0.1868 -0.0453 -0.2320 342 THR A CG2 
2634 N N   . GLY A 343 ? 0.5187 0.9530 0.9489 -0.1612 -0.0492 -0.2112 343 GLY A N   
2635 C CA  . GLY A 343 ? 0.5052 0.9625 0.9742 -0.1595 -0.0539 -0.2124 343 GLY A CA  
2636 C C   . GLY A 343 ? 0.5291 0.9811 1.0150 -0.1467 -0.0502 -0.2033 343 GLY A C   
2637 O O   . GLY A 343 ? 0.5210 0.9939 1.0399 -0.1419 -0.0583 -0.2005 343 GLY A O   
2638 N N   . LEU A 344 ? 0.4654 0.8894 0.9295 -0.1411 -0.0381 -0.1988 344 LEU A N   
2639 C CA  . LEU A 344 ? 0.4446 0.8589 0.9196 -0.1301 -0.0316 -0.1917 344 LEU A CA  
2640 C C   . LEU A 344 ? 0.4677 0.8744 0.9269 -0.1192 -0.0404 -0.1772 344 LEU A C   
2641 O O   . LEU A 344 ? 0.4438 0.8477 0.9170 -0.1094 -0.0388 -0.1705 344 LEU A O   
2642 C CB  . LEU A 344 ? 0.4402 0.8283 0.9034 -0.1331 -0.0104 -0.1978 344 LEU A CB  
2643 C CG  . LEU A 344 ? 0.4991 0.8876 0.9706 -0.1452 0.0016  -0.2117 344 LEU A CG  
2644 C CD1 . LEU A 344 ? 0.5006 0.8594 0.9516 -0.1482 0.0200  -0.2142 344 LEU A CD1 
2645 C CD2 . LEU A 344 ? 0.5227 0.9343 1.0352 -0.1465 0.0022  -0.2180 344 LEU A CD2 
2646 N N   . ALA A 345 ? 0.4276 0.8293 0.8570 -0.1214 -0.0481 -0.1733 345 ALA A N   
2647 C CA  . ALA A 345 ? 0.4187 0.8115 0.8291 -0.1128 -0.0553 -0.1602 345 ALA A CA  
2648 C C   . ALA A 345 ? 0.4714 0.8723 0.8594 -0.1174 -0.0690 -0.1567 345 ALA A C   
2649 O O   . ALA A 345 ? 0.4736 0.8823 0.8551 -0.1281 -0.0704 -0.1661 345 ALA A O   
2650 C CB  . ALA A 345 ? 0.4204 0.7835 0.8082 -0.1095 -0.0404 -0.1592 345 ALA A CB  
2651 N N   . GLU A 346 ? 0.4276 0.8256 0.8029 -0.1100 -0.0781 -0.1437 346 GLU A N   
2652 C CA  . GLU A 346 ? 0.4307 0.8345 0.7815 -0.1138 -0.0906 -0.1383 346 GLU A CA  
2653 C C   . GLU A 346 ? 0.4519 0.8330 0.7747 -0.1086 -0.0851 -0.1312 346 GLU A C   
2654 O O   . GLU A 346 ? 0.4243 0.7927 0.7527 -0.0989 -0.0797 -0.1244 346 GLU A O   
2655 C CB  . GLU A 346 ? 0.4569 0.8849 0.8242 -0.1105 -0.1110 -0.1269 346 GLU A CB  
2656 C CG  . GLU A 346 ? 0.6642 1.1181 1.0587 -0.1168 -0.1194 -0.1337 346 GLU A CG  
2657 C CD  . GLU A 346 ? 1.1100 1.5899 1.5117 -0.1182 -0.1425 -0.1241 346 GLU A CD  
2658 O OE1 . GLU A 346 ? 1.1363 1.6187 1.5449 -0.1087 -0.1533 -0.1087 346 GLU A OE1 
2659 O OE2 . GLU A 346 ? 1.0689 1.5670 1.4708 -0.1293 -0.1503 -0.1317 346 GLU A OE2 
2660 N N   . TRP A 347 ? 0.4179 0.7941 0.7114 -0.1158 -0.0856 -0.1341 347 TRP A N   
2661 C CA  . TRP A 347 ? 0.4169 0.7730 0.6841 -0.1122 -0.0800 -0.1289 347 TRP A CA  
2662 C C   . TRP A 347 ? 0.4731 0.8340 0.7128 -0.1200 -0.0873 -0.1287 347 TRP A C   
2663 O O   . TRP A 347 ? 0.4690 0.8444 0.7054 -0.1305 -0.0925 -0.1368 347 TRP A O   
2664 C CB  . TRP A 347 ? 0.3934 0.7253 0.6531 -0.1121 -0.0616 -0.1375 347 TRP A CB  
2665 C CG  . TRP A 347 ? 0.4100 0.7405 0.6644 -0.1232 -0.0541 -0.1523 347 TRP A CG  
2666 C CD1 . TRP A 347 ? 0.4545 0.7765 0.6858 -0.1304 -0.0495 -0.1594 347 TRP A CD1 
2667 C CD2 . TRP A 347 ? 0.4073 0.7442 0.6812 -0.1286 -0.0492 -0.1625 347 TRP A CD2 
2668 N NE1 . TRP A 347 ? 0.4492 0.7711 0.6848 -0.1396 -0.0423 -0.1732 347 TRP A NE1 
2669 C CE2 . TRP A 347 ? 0.4611 0.7920 0.7218 -0.1391 -0.0421 -0.1751 347 TRP A CE2 
2670 C CE3 . TRP A 347 ? 0.4150 0.7624 0.7177 -0.1261 -0.0493 -0.1630 347 TRP A CE3 
2671 C CZ2 . TRP A 347 ? 0.4548 0.7891 0.7290 -0.1472 -0.0357 -0.1871 347 TRP A CZ2 
2672 C CZ3 . TRP A 347 ? 0.4331 0.7847 0.7488 -0.1344 -0.0426 -0.1753 347 TRP A CZ3 
2673 C CH2 . TRP A 347 ? 0.4485 0.7933 0.7496 -0.1449 -0.0360 -0.1868 347 TRP A CH2 
2674 N N   . HIS A 348 ? 0.4478 0.7971 0.6678 -0.1157 -0.0872 -0.1200 348 HIS A N   
2675 C CA  . HIS A 348 ? 0.4647 0.8154 0.6559 -0.1233 -0.0912 -0.1201 348 HIS A CA  
2676 C C   . HIS A 348 ? 0.4938 0.8229 0.6672 -0.1254 -0.0751 -0.1295 348 HIS A C   
2677 O O   . HIS A 348 ? 0.4623 0.7734 0.6409 -0.1174 -0.0648 -0.1282 348 HIS A O   
2678 C CB  . HIS A 348 ? 0.4851 0.8383 0.6674 -0.1176 -0.1021 -0.1034 348 HIS A CB  
2679 C CG  . HIS A 348 ? 0.5405 0.9157 0.7388 -0.1163 -0.1202 -0.0928 348 HIS A CG  
2680 N ND1 . HIS A 348 ? 0.5803 0.9771 0.7803 -0.1265 -0.1311 -0.0978 348 HIS A ND1 
2681 C CD2 . HIS A 348 ? 0.5613 0.9397 0.7753 -0.1062 -0.1295 -0.0775 348 HIS A CD2 
2682 C CE1 . HIS A 348 ? 0.5760 0.9889 0.7939 -0.1217 -0.1472 -0.0847 348 HIS A CE1 
2683 N NE2 . HIS A 348 ? 0.5697 0.9718 0.7969 -0.1093 -0.1468 -0.0721 348 HIS A NE2 
2684 N N   . VAL A 349 ? 0.4624 0.7935 0.6159 -0.1366 -0.0729 -0.1396 349 VAL A N   
2685 C CA  . VAL A 349 ? 0.4511 0.7625 0.5901 -0.1388 -0.0580 -0.1490 349 VAL A CA  
2686 C C   . VAL A 349 ? 0.5041 0.8029 0.6291 -0.1315 -0.0563 -0.1385 349 VAL A C   
2687 O O   . VAL A 349 ? 0.5099 0.8182 0.6212 -0.1335 -0.0658 -0.1302 349 VAL A O   
2688 C CB  . VAL A 349 ? 0.5047 0.8219 0.6279 -0.1529 -0.0553 -0.1636 349 VAL A CB  
2689 C CG1 . VAL A 349 ? 0.5078 0.8039 0.6195 -0.1540 -0.0397 -0.1729 349 VAL A CG1 
2690 C CG2 . VAL A 349 ? 0.4955 0.8243 0.6338 -0.1604 -0.0564 -0.1745 349 VAL A CG2 
2691 N N   . PRO A 350 ? 0.4420 0.7201 0.5709 -0.1234 -0.0450 -0.1379 350 PRO A N   
2692 C CA  . PRO A 350 ? 0.4201 0.6868 0.5376 -0.1168 -0.0430 -0.1287 350 PRO A CA  
2693 C C   . PRO A 350 ? 0.4594 0.7239 0.5541 -0.1247 -0.0388 -0.1350 350 PRO A C   
2694 O O   . PRO A 350 ? 0.4557 0.7147 0.5468 -0.1314 -0.0296 -0.1488 350 PRO A O   
2695 C CB  . PRO A 350 ? 0.4256 0.6721 0.5533 -0.1085 -0.0319 -0.1294 350 PRO A CB  
2696 C CG  . PRO A 350 ? 0.4807 0.7291 0.6261 -0.1096 -0.0295 -0.1357 350 PRO A CG  
2697 C CD  . PRO A 350 ? 0.4477 0.7119 0.5903 -0.1208 -0.0337 -0.1452 350 PRO A CD  
2698 N N   . ALA A 351 ? 0.4207 0.6897 0.5004 -0.1247 -0.0451 -0.1253 351 ALA A N   
2699 C CA  . ALA A 351 ? 0.4344 0.7022 0.4911 -0.1329 -0.0406 -0.1307 351 ALA A CA  
2700 C C   . ALA A 351 ? 0.5066 0.7543 0.5616 -0.1272 -0.0275 -0.1329 351 ALA A C   
2701 O O   . ALA A 351 ? 0.5118 0.7549 0.5551 -0.1339 -0.0184 -0.1436 351 ALA A O   
2702 C CB  . ALA A 351 ? 0.4515 0.7316 0.4924 -0.1359 -0.0525 -0.1183 351 ALA A CB  
2703 N N   . ALA A 352 ? 0.4563 0.6927 0.5244 -0.1152 -0.0265 -0.1235 352 ALA A N   
2704 C CA  . ALA A 352 ? 0.4456 0.6640 0.5148 -0.1087 -0.0163 -0.1236 352 ALA A CA  
2705 C C   . ALA A 352 ? 0.4975 0.7050 0.5844 -0.0976 -0.0154 -0.1170 352 ALA A C   
2706 O O   . ALA A 352 ? 0.4965 0.7110 0.5948 -0.0943 -0.0224 -0.1113 352 ALA A O   
2707 C CB  . ALA A 352 ? 0.4590 0.6776 0.5134 -0.1085 -0.0178 -0.1154 352 ALA A CB  
2708 N N   . GLY A 353 ? 0.4393 0.6306 0.5289 -0.0924 -0.0066 -0.1183 353 GLY A N   
2709 C CA  . GLY A 353 ? 0.4275 0.6071 0.5300 -0.0830 -0.0050 -0.1122 353 GLY A CA  
2710 C C   . GLY A 353 ? 0.4856 0.6571 0.5998 -0.0827 0.0002  -0.1189 353 GLY A C   
2711 O O   . GLY A 353 ? 0.4671 0.6351 0.5805 -0.0882 0.0061  -0.1296 353 GLY A O   
2712 N N   . MET A 354 ? 0.4520 0.6198 0.5772 -0.0765 -0.0015 -0.1126 354 MET A N   
2713 C CA  . MET A 354 ? 0.4487 0.6075 0.5841 -0.0760 0.0036  -0.1166 354 MET A CA  
2714 C C   . MET A 354 ? 0.4448 0.6119 0.5924 -0.0751 -0.0003 -0.1142 354 MET A C   
2715 O O   . MET A 354 ? 0.4170 0.5759 0.5721 -0.0747 0.0046  -0.1164 354 MET A O   
2716 C CB  . MET A 354 ? 0.4884 0.6289 0.6241 -0.0703 0.0093  -0.1135 354 MET A CB  
2717 C CG  . MET A 354 ? 0.5586 0.6971 0.6932 -0.0632 0.0062  -0.1032 354 MET A CG  
2718 S SD  . MET A 354 ? 0.6387 0.7575 0.7728 -0.0575 0.0113  -0.0995 354 MET A SD  
2719 C CE  . MET A 354 ? 0.6001 0.7149 0.7275 -0.0598 0.0152  -0.1052 354 MET A CE  
2720 N N   . PHE A 355 ? 0.4109 0.5945 0.5613 -0.0754 -0.0088 -0.1101 355 PHE A N   
2721 C CA  . PHE A 355 ? 0.4062 0.5992 0.5723 -0.0741 -0.0124 -0.1083 355 PHE A CA  
2722 C C   . PHE A 355 ? 0.4433 0.6547 0.6153 -0.0807 -0.0186 -0.1132 355 PHE A C   
2723 O O   . PHE A 355 ? 0.4401 0.6621 0.6024 -0.0852 -0.0246 -0.1136 355 PHE A O   
2724 C CB  . PHE A 355 ? 0.4230 0.6180 0.5958 -0.0661 -0.0174 -0.0971 355 PHE A CB  
2725 C CG  . PHE A 355 ? 0.4339 0.6121 0.6020 -0.0600 -0.0120 -0.0924 355 PHE A CG  
2726 C CD1 . PHE A 355 ? 0.4640 0.6285 0.6352 -0.0589 -0.0039 -0.0955 355 PHE A CD1 
2727 C CD2 . PHE A 355 ? 0.4575 0.6337 0.6170 -0.0562 -0.0152 -0.0848 355 PHE A CD2 
2728 C CE1 . PHE A 355 ? 0.4658 0.6158 0.6319 -0.0541 0.0000  -0.0911 355 PHE A CE1 
2729 C CE2 . PHE A 355 ? 0.4818 0.6434 0.6378 -0.0512 -0.0105 -0.0811 355 PHE A CE2 
2730 C CZ  . PHE A 355 ? 0.4497 0.5988 0.6091 -0.0502 -0.0034 -0.0843 355 PHE A CZ  
2731 N N   . LEU A 356 ? 0.3934 0.6093 0.5812 -0.0818 -0.0171 -0.1170 356 LEU A N   
2732 C CA  . LEU A 356 ? 0.3978 0.6326 0.5967 -0.0874 -0.0232 -0.1215 356 LEU A CA  
2733 C C   . LEU A 356 ? 0.4423 0.6866 0.6614 -0.0813 -0.0284 -0.1147 356 LEU A C   
2734 O O   . LEU A 356 ? 0.4337 0.6689 0.6628 -0.0774 -0.0212 -0.1148 356 LEU A O   
2735 C CB  . LEU A 356 ? 0.4021 0.6336 0.6052 -0.0949 -0.0154 -0.1336 356 LEU A CB  
2736 C CG  . LEU A 356 ? 0.4649 0.7165 0.6793 -0.1023 -0.0212 -0.1402 356 LEU A CG  
2737 C CD1 . LEU A 356 ? 0.4717 0.7354 0.6725 -0.1089 -0.0290 -0.1426 356 LEU A CD1 
2738 C CD2 . LEU A 356 ? 0.4914 0.7371 0.7132 -0.1088 -0.0117 -0.1512 356 LEU A CD2 
2739 N N   . TRP A 357 ? 0.4090 0.6712 0.6339 -0.0805 -0.0408 -0.1084 357 TRP A N   
2740 C CA  . TRP A 357 ? 0.4136 0.6869 0.6606 -0.0740 -0.0478 -0.1008 357 TRP A CA  
2741 C C   . TRP A 357 ? 0.4718 0.7637 0.7392 -0.0789 -0.0520 -0.1073 357 TRP A C   
2742 O O   . TRP A 357 ? 0.4992 0.8073 0.7641 -0.0849 -0.0619 -0.1083 357 TRP A O   
2743 C CB  . TRP A 357 ? 0.4144 0.6947 0.6546 -0.0702 -0.0599 -0.0884 357 TRP A CB  
2744 C CG  . TRP A 357 ? 0.4338 0.7225 0.6960 -0.0620 -0.0680 -0.0779 357 TRP A CG  
2745 C CD1 . TRP A 357 ? 0.4775 0.7839 0.7481 -0.0613 -0.0832 -0.0691 357 TRP A CD1 
2746 C CD2 . TRP A 357 ? 0.4302 0.7081 0.7065 -0.0531 -0.0619 -0.0739 357 TRP A CD2 
2747 N NE1 . TRP A 357 ? 0.4702 0.7774 0.7623 -0.0518 -0.0867 -0.0598 357 TRP A NE1 
2748 C CE2 . TRP A 357 ? 0.4798 0.7698 0.7761 -0.0469 -0.0731 -0.0635 357 TRP A CE2 
2749 C CE3 . TRP A 357 ? 0.4436 0.7032 0.7182 -0.0503 -0.0481 -0.0784 357 TRP A CE3 
2750 C CZ2 . TRP A 357 ? 0.4630 0.7469 0.7788 -0.0379 -0.0698 -0.0587 357 TRP A CZ2 
2751 C CZ3 . TRP A 357 ? 0.4565 0.7108 0.7479 -0.0424 -0.0450 -0.0740 357 TRP A CZ3 
2752 C CH2 . TRP A 357 ? 0.4654 0.7315 0.7777 -0.0362 -0.0551 -0.0649 357 TRP A CH2 
2753 N N   . ILE A 358 ? 0.3991 0.6885 0.6856 -0.0775 -0.0436 -0.1126 358 ILE A N   
2754 C CA  . ILE A 358 ? 0.3857 0.6911 0.6947 -0.0823 -0.0444 -0.1204 358 ILE A CA  
2755 C C   . ILE A 358 ? 0.4166 0.7373 0.7561 -0.0756 -0.0516 -0.1146 358 ILE A C   
2756 O O   . ILE A 358 ? 0.4051 0.7168 0.7543 -0.0680 -0.0461 -0.1107 358 ILE A O   
2757 C CB  . ILE A 358 ? 0.4184 0.7099 0.7277 -0.0871 -0.0286 -0.1315 358 ILE A CB  
2758 C CG1 . ILE A 358 ? 0.4296 0.7077 0.7134 -0.0941 -0.0226 -0.1377 358 ILE A CG1 
2759 C CG2 . ILE A 358 ? 0.4096 0.7163 0.7446 -0.0919 -0.0269 -0.1399 358 ILE A CG2 
2760 C CD1 . ILE A 358 ? 0.5206 0.7754 0.7947 -0.0936 -0.0090 -0.1401 358 ILE A CD1 
2761 N N   . LYS A 359 ? 0.3872 0.7313 0.7436 -0.0786 -0.0637 -0.1149 359 LYS A N   
2762 C CA  . LYS A 359 ? 0.3815 0.7428 0.7724 -0.0725 -0.0715 -0.1102 359 LYS A CA  
2763 C C   . LYS A 359 ? 0.4375 0.8092 0.8523 -0.0780 -0.0649 -0.1226 359 LYS A C   
2764 O O   . LYS A 359 ? 0.4336 0.8182 0.8472 -0.0868 -0.0695 -0.1293 359 LYS A O   
2765 C CB  . LYS A 359 ? 0.4176 0.7997 0.8128 -0.0721 -0.0920 -0.1002 359 LYS A CB  
2766 C CG  . LYS A 359 ? 0.5709 0.9695 1.0050 -0.0640 -0.1011 -0.0935 359 LYS A CG  
2767 C CD  . LYS A 359 ? 0.7308 1.1502 1.1698 -0.0639 -0.1230 -0.0821 359 LYS A CD  
2768 C CE  . LYS A 359 ? 0.9101 1.3417 1.3887 -0.0536 -0.1318 -0.0730 359 LYS A CE  
2769 N NZ  . LYS A 359 ? 1.0540 1.5075 1.5406 -0.0537 -0.1552 -0.0606 359 LYS A NZ  
2770 N N   . VAL A 360 ? 0.3980 0.7649 0.8349 -0.0736 -0.0536 -0.1262 360 VAL A N   
2771 C CA  . VAL A 360 ? 0.4015 0.7788 0.8634 -0.0792 -0.0459 -0.1384 360 VAL A CA  
2772 C C   . VAL A 360 ? 0.4641 0.8701 0.9617 -0.0769 -0.0605 -0.1359 360 VAL A C   
2773 O O   . VAL A 360 ? 0.4521 0.8641 0.9707 -0.0672 -0.0675 -0.1268 360 VAL A O   
2774 C CB  . VAL A 360 ? 0.4400 0.8021 0.9103 -0.0779 -0.0270 -0.1449 360 VAL A CB  
2775 C CG1 . VAL A 360 ? 0.4285 0.7994 0.9181 -0.0865 -0.0174 -0.1585 360 VAL A CG1 
2776 C CG2 . VAL A 360 ? 0.4379 0.7719 0.8724 -0.0789 -0.0159 -0.1442 360 VAL A CG2 
2777 N N   . LYS A 361 ? 0.4448 0.8682 0.9488 -0.0861 -0.0660 -0.1435 361 LYS A N   
2778 C CA  . LYS A 361 ? 0.4568 0.9100 0.9926 -0.0864 -0.0819 -0.1421 361 LYS A CA  
2779 C C   . LYS A 361 ? 0.5414 1.0085 1.1237 -0.0783 -0.0822 -0.1414 361 LYS A C   
2780 O O   . LYS A 361 ? 0.5445 1.0267 1.1468 -0.0708 -0.0987 -0.1301 361 LYS A O   
2781 C CB  . LYS A 361 ? 0.4836 0.9506 1.0182 -0.0994 -0.0834 -0.1538 361 LYS A CB  
2782 C CG  . LYS A 361 ? 0.6248 1.0951 1.1276 -0.1059 -0.0964 -0.1501 361 LYS A CG  
2783 C CD  . LYS A 361 ? 0.6795 1.1776 1.1981 -0.1153 -0.1089 -0.1564 361 LYS A CD  
2784 C CE  . LYS A 361 ? 0.7552 1.2568 1.2406 -0.1245 -0.1196 -0.1559 361 LYS A CE  
2785 N NZ  . LYS A 361 ? 0.8187 1.3030 1.2775 -0.1349 -0.1041 -0.1694 361 LYS A NZ  
2786 N N   . GLY A 362 ? 0.5127 0.9746 1.1122 -0.0804 -0.0641 -0.1532 362 GLY A N   
2787 C CA  . GLY A 362 ? 0.5169 0.9925 1.1633 -0.0743 -0.0609 -0.1562 362 GLY A CA  
2788 C C   . GLY A 362 ? 0.5868 1.0495 1.2436 -0.0627 -0.0547 -0.1498 362 GLY A C   
2789 O O   . GLY A 362 ? 0.5778 1.0542 1.2666 -0.0533 -0.0659 -0.1418 362 GLY A O   
2790 N N   . ILE A 363 ? 0.5679 1.0042 1.1991 -0.0638 -0.0367 -0.1536 363 ILE A N   
2791 C CA  . ILE A 363 ? 0.5756 0.9959 1.2113 -0.0552 -0.0267 -0.1505 363 ILE A CA  
2792 C C   . ILE A 363 ? 0.6464 1.0641 1.2789 -0.0438 -0.0414 -0.1341 363 ILE A C   
2793 O O   . ILE A 363 ? 0.6543 1.0735 1.2634 -0.0442 -0.0563 -0.1243 363 ILE A O   
2794 C CB  . ILE A 363 ? 0.6149 1.0075 1.2190 -0.0607 -0.0056 -0.1579 363 ILE A CB  
2795 C CG1 . ILE A 363 ? 0.6228 1.0089 1.1990 -0.0734 0.0011  -0.1663 363 ILE A CG1 
2796 C CG2 . ILE A 363 ? 0.6255 1.0132 1.2538 -0.0589 0.0122  -0.1666 363 ILE A CG2 
2797 C CD1 . ILE A 363 ? 0.7145 1.1158 1.3148 -0.0838 0.0097  -0.1811 363 ILE A CD1 
2798 N N   . ASN A 364 ? 0.5968 1.0100 1.2534 -0.0345 -0.0361 -0.1317 364 ASN A N   
2799 C CA  . ASN A 364 ? 0.5931 1.0020 1.2523 -0.0233 -0.0474 -0.1168 364 ASN A CA  
2800 C C   . ASN A 364 ? 0.6379 1.0184 1.2645 -0.0214 -0.0356 -0.1147 364 ASN A C   
2801 O O   . ASN A 364 ? 0.6370 1.0088 1.2442 -0.0162 -0.0454 -0.1017 364 ASN A O   
2802 C CB  . ASN A 364 ? 0.6088 1.0324 1.3213 -0.0137 -0.0504 -0.1156 364 ASN A CB  
2803 C CG  . ASN A 364 ? 1.0823 1.5360 1.8324 -0.0140 -0.0648 -0.1158 364 ASN A CG  
2804 O OD1 . ASN A 364 ? 1.0731 1.5393 1.8112 -0.0170 -0.0829 -0.1078 364 ASN A OD1 
2805 N ND2 . ASN A 364 ? 1.0187 1.4855 1.8166 -0.0111 -0.0572 -0.1250 364 ASN A ND2 
2806 N N   . ASP A 365 ? 0.5791 0.9456 1.2000 -0.0262 -0.0146 -0.1273 365 ASP A N   
2807 C CA  . ASP A 365 ? 0.5691 0.9095 1.1600 -0.0260 -0.0022 -0.1272 365 ASP A CA  
2808 C C   . ASP A 365 ? 0.6007 0.9276 1.1587 -0.0373 0.0111  -0.1368 365 ASP A C   
2809 O O   . ASP A 365 ? 0.5922 0.9216 1.1622 -0.0440 0.0245  -0.1493 365 ASP A O   
2810 C CB  . ASP A 365 ? 0.5937 0.9284 1.2114 -0.0201 0.0101  -0.1318 365 ASP A CB  
2811 C CG  . ASP A 365 ? 0.7793 1.0881 1.3663 -0.0210 0.0229  -0.1327 365 ASP A CG  
2812 O OD1 . ASP A 365 ? 0.7972 1.0964 1.3783 -0.0280 0.0409  -0.1448 365 ASP A OD1 
2813 O OD2 . ASP A 365 ? 0.8594 1.1575 1.4267 -0.0157 0.0146  -0.1211 365 ASP A OD2 
2814 N N   . VAL A 366 ? 0.5464 0.8589 1.0641 -0.0397 0.0074  -0.1307 366 VAL A N   
2815 C CA  . VAL A 366 ? 0.5418 0.8401 1.0269 -0.0496 0.0173  -0.1372 366 VAL A CA  
2816 C C   . VAL A 366 ? 0.6109 0.8856 1.0757 -0.0511 0.0327  -0.1403 366 VAL A C   
2817 O O   . VAL A 366 ? 0.6023 0.8644 1.0441 -0.0596 0.0426  -0.1460 366 VAL A O   
2818 C CB  . VAL A 366 ? 0.5811 0.8787 1.0377 -0.0520 0.0050  -0.1305 366 VAL A CB  
2819 C CG1 . VAL A 366 ? 0.5736 0.8515 0.9983 -0.0485 0.0040  -0.1220 366 VAL A CG1 
2820 C CG2 . VAL A 366 ? 0.5797 0.8774 1.0238 -0.0629 0.0104  -0.1396 366 VAL A CG2 
2821 N N   . LYS A 367 ? 0.5840 0.8528 1.0578 -0.0434 0.0343  -0.1361 367 LYS A N   
2822 C CA  . LYS A 367 ? 0.5913 0.8394 1.0480 -0.0448 0.0480  -0.1391 367 LYS A CA  
2823 C C   . LYS A 367 ? 0.6755 0.9230 1.1434 -0.0529 0.0655  -0.1530 367 LYS A C   
2824 O O   . LYS A 367 ? 0.6746 0.9049 1.1176 -0.0599 0.0775  -0.1573 367 LYS A O   
2825 C CB  . LYS A 367 ? 0.6161 0.8607 1.0851 -0.0349 0.0453  -0.1326 367 LYS A CB  
2826 C CG  . LYS A 367 ? 0.7782 1.0006 1.2223 -0.0361 0.0553  -0.1330 367 LYS A CG  
2827 C CD  . LYS A 367 ? 0.9080 1.1251 1.3522 -0.0266 0.0471  -0.1224 367 LYS A CD  
2828 C CE  . LYS A 367 ? 1.0327 1.2334 1.4705 -0.0267 0.0591  -0.1262 367 LYS A CE  
2829 N NZ  . LYS A 367 ? 1.1261 1.3337 1.6009 -0.0237 0.0679  -0.1341 367 LYS A NZ  
2830 N N   . GLU A 368 ? 0.6591 0.9262 1.1641 -0.0527 0.0664  -0.1596 368 GLU A N   
2831 C CA  . GLU A 368 ? 0.6786 0.9493 1.1999 -0.0608 0.0829  -0.1736 368 GLU A CA  
2832 C C   . GLU A 368 ? 0.7703 1.0358 1.2677 -0.0728 0.0886  -0.1788 368 GLU A C   
2833 O O   . GLU A 368 ? 0.7887 1.0439 1.2764 -0.0821 0.1050  -0.1877 368 GLU A O   
2834 C CB  . GLU A 368 ? 0.6961 0.9914 1.2678 -0.0559 0.0800  -0.1783 368 GLU A CB  
2835 C CG  . GLU A 368 ? 0.8711 1.1827 1.4621 -0.0642 0.0845  -0.1886 368 GLU A CG  
2836 C CD  . GLU A 368 ? 1.1642 1.4921 1.7579 -0.0642 0.0675  -0.1833 368 GLU A CD  
2837 O OE1 . GLU A 368 ? 1.0323 1.3513 1.5931 -0.0642 0.0573  -0.1743 368 GLU A OE1 
2838 O OE2 . GLU A 368 ? 1.0745 1.4243 1.7034 -0.0652 0.0650  -0.1892 368 GLU A OE2 
2839 N N   . LEU A 369 ? 0.7276 0.9996 1.2149 -0.0733 0.0753  -0.1732 369 LEU A N   
2840 C CA  . LEU A 369 ? 0.7282 0.9969 1.1966 -0.0838 0.0781  -0.1774 369 LEU A CA  
2841 C C   . LEU A 369 ? 0.7857 1.0288 1.2121 -0.0898 0.0850  -0.1752 369 LEU A C   
2842 O O   . LEU A 369 ? 0.7946 1.0303 1.2106 -0.1003 0.0961  -0.1820 369 LEU A O   
2843 C CB  . LEU A 369 ? 0.7256 1.0093 1.1970 -0.0819 0.0611  -0.1723 369 LEU A CB  
2844 C CG  . LEU A 369 ? 0.7872 1.0865 1.2750 -0.0903 0.0624  -0.1813 369 LEU A CG  
2845 C CD1 . LEU A 369 ? 0.7807 1.1072 1.3041 -0.0845 0.0486  -0.1799 369 LEU A CD1 
2846 C CD2 . LEU A 369 ? 0.8215 1.1126 1.2798 -0.0973 0.0590  -0.1804 369 LEU A CD2 
2847 N N   . ILE A 370 ? 0.7343 0.9643 1.1376 -0.0836 0.0781  -0.1653 370 ILE A N   
2848 C CA  . ILE A 370 ? 0.7409 0.9473 1.1066 -0.0880 0.0826  -0.1618 370 ILE A CA  
2849 C C   . ILE A 370 ? 0.8123 1.0045 1.1693 -0.0956 0.0998  -0.1684 370 ILE A C   
2850 O O   . ILE A 370 ? 0.8226 1.0000 1.1558 -0.1045 0.1066  -0.1695 370 ILE A O   
2851 C CB  . ILE A 370 ? 0.7721 0.9699 1.1203 -0.0791 0.0718  -0.1505 370 ILE A CB  
2852 C CG1 . ILE A 370 ? 0.7669 0.9742 1.1121 -0.0760 0.0570  -0.1448 370 ILE A CG1 
2853 C CG2 . ILE A 370 ? 0.7834 0.9569 1.0981 -0.0823 0.0777  -0.1472 370 ILE A CG2 
2854 C CD1 . ILE A 370 ? 0.8130 1.0186 1.1499 -0.0668 0.0454  -0.1342 370 ILE A CD1 
2855 N N   . GLU A 371 ? 0.7572 0.9542 1.1345 -0.0926 0.1068  -0.1728 371 GLU A N   
2856 C CA  . GLU A 371 ? 0.9334 1.1196 1.3052 -0.1001 0.1237  -0.1805 371 GLU A CA  
2857 C C   . GLU A 371 ? 1.2301 1.4212 1.6101 -0.1118 0.1359  -0.1910 371 GLU A C   
2858 O O   . GLU A 371 ? 0.7517 0.9296 1.1059 -0.1211 0.1403  -0.1906 371 GLU A O   
2859 C CB  . GLU A 371 ? 0.9474 1.1409 1.3455 -0.0932 0.1275  -0.1840 371 GLU A CB  
2860 C CG  . GLU A 371 ? 1.1051 1.2857 1.4936 -0.1005 0.1447  -0.1918 371 GLU A CG  
2861 C CD  . GLU A 371 ? 1.4224 1.5843 1.7827 -0.0986 0.1439  -0.1854 371 GLU A CD  
2862 O OE1 . GLU A 371 ? 1.4915 1.6449 1.8287 -0.0947 0.1318  -0.1745 371 GLU A OE1 
2863 O OE2 . GLU A 371 ? 1.2959 1.4519 1.6574 -0.1018 0.1560  -0.1924 371 GLU A OE2 
2864 N N   . GLY A 378 ? 0.9056 1.0425 1.1523 -0.0975 0.0742  -0.1412 378 GLY A N   
2865 C CA  . GLY A 378 ? 0.9046 1.0291 1.1329 -0.0917 0.0687  -0.1328 378 GLY A CA  
2866 C C   . GLY A 378 ? 0.9675 1.0794 1.1772 -0.0939 0.0657  -0.1297 378 GLY A C   
2867 O O   . GLY A 378 ? 0.9899 1.1049 1.2025 -0.0990 0.0659  -0.1340 378 GLY A O   
2868 N N   . VAL A 379 ? 0.8986 0.9957 1.0905 -0.0905 0.0632  -0.1227 379 VAL A N   
2869 C CA  . VAL A 379 ? 0.8871 0.9703 1.0627 -0.0909 0.0599  -0.1185 379 VAL A CA  
2870 C C   . VAL A 379 ? 0.8587 0.9509 1.0370 -0.0839 0.0505  -0.1163 379 VAL A C   
2871 O O   . VAL A 379 ? 0.8465 0.9322 1.0159 -0.0785 0.0464  -0.1104 379 VAL A O   
2872 C CB  . VAL A 379 ? 0.9572 1.0310 1.1277 -0.0994 0.0645  -0.1218 379 VAL A CB  
2873 C CG1 . VAL A 379 ? 0.9568 1.0155 1.1140 -0.0980 0.0607  -0.1169 379 VAL A CG1 
2874 C CG2 . VAL A 379 ? 0.9707 1.0350 1.1363 -0.1078 0.0745  -0.1235 379 VAL A CG2 
2875 N N   . LEU A 380 ? 0.7570 0.8644 0.9471 -0.0850 0.0474  -0.1212 380 LEU A N   
2876 C CA  . LEU A 380 ? 0.7248 0.8428 0.9164 -0.0808 0.0389  -0.1202 380 LEU A CA  
2877 C C   . LEU A 380 ? 0.7037 0.8412 0.9104 -0.0766 0.0332  -0.1197 380 LEU A C   
2878 O O   . LEU A 380 ? 0.6879 0.8333 0.8935 -0.0723 0.0255  -0.1162 380 LEU A O   
2879 C CB  . LEU A 380 ? 0.7327 0.8519 0.9229 -0.0864 0.0387  -0.1261 380 LEU A CB  
2880 C CG  . LEU A 380 ? 0.7902 0.9176 0.9918 -0.0940 0.0426  -0.1342 380 LEU A CG  
2881 C CD1 . LEU A 380 ? 0.7832 0.9256 0.9901 -0.0966 0.0370  -0.1397 380 LEU A CD1 
2882 C CD2 . LEU A 380 ? 0.8264 0.9362 1.0211 -0.1009 0.0511  -0.1366 380 LEU A CD2 
2883 N N   . MET A 381 ? 0.6241 0.7689 0.8454 -0.0779 0.0372  -0.1226 381 MET A N   
2884 C CA  . MET A 381 ? 0.5995 0.7633 0.8403 -0.0738 0.0317  -0.1221 381 MET A CA  
2885 C C   . MET A 381 ? 0.6250 0.7872 0.8727 -0.0677 0.0333  -0.1179 381 MET A C   
2886 O O   . MET A 381 ? 0.6385 0.7868 0.8785 -0.0692 0.0413  -0.1183 381 MET A O   
2887 C CB  . MET A 381 ? 0.6261 0.8037 0.8851 -0.0796 0.0342  -0.1300 381 MET A CB  
2888 C CG  . MET A 381 ? 0.6677 0.8498 0.9226 -0.0859 0.0316  -0.1351 381 MET A CG  
2889 S SD  . MET A 381 ? 0.7133 0.9099 0.9891 -0.0942 0.0359  -0.1454 381 MET A SD  
2890 C CE  . MET A 381 ? 0.6817 0.8561 0.9450 -0.1019 0.0502  -0.1493 381 MET A CE  
2891 N N   . LEU A 382 ? 0.5513 0.7274 0.8132 -0.0613 0.0252  -0.1136 382 LEU A N   
2892 C CA  . LEU A 382 ? 0.5335 0.7107 0.8077 -0.0547 0.0256  -0.1098 382 LEU A CA  
2893 C C   . LEU A 382 ? 0.5676 0.7653 0.8670 -0.0499 0.0166  -0.1074 382 LEU A C   
2894 O O   . LEU A 382 ? 0.5592 0.7687 0.8588 -0.0509 0.0074  -0.1058 382 LEU A O   
2895 C CB  . LEU A 382 ? 0.5279 0.6908 0.7853 -0.0499 0.0247  -0.1028 382 LEU A CB  
2896 C CG  . LEU A 382 ? 0.5771 0.7460 0.8354 -0.0430 0.0143  -0.0941 382 LEU A CG  
2897 C CD1 . LEU A 382 ? 0.5730 0.7308 0.8275 -0.0379 0.0165  -0.0892 382 LEU A CD1 
2898 C CD2 . LEU A 382 ? 0.6153 0.7832 0.8557 -0.0449 0.0085  -0.0917 382 LEU A CD2 
2899 N N   . PRO A 383 ? 0.5104 0.7131 0.8322 -0.0451 0.0189  -0.1074 383 PRO A N   
2900 C CA  . PRO A 383 ? 0.4897 0.7123 0.8391 -0.0404 0.0095  -0.1045 383 PRO A CA  
2901 C C   . PRO A 383 ? 0.4683 0.6940 0.8163 -0.0330 -0.0028 -0.0927 383 PRO A C   
2902 O O   . PRO A 383 ? 0.4438 0.6560 0.7787 -0.0293 -0.0012 -0.0875 383 PRO A O   
2903 C CB  . PRO A 383 ? 0.5166 0.7419 0.8925 -0.0388 0.0188  -0.1105 383 PRO A CB  
2904 C CG  . PRO A 383 ? 0.5888 0.7946 0.9466 -0.0431 0.0328  -0.1158 383 PRO A CG  
2905 C CD  . PRO A 383 ? 0.5340 0.7252 0.8587 -0.0446 0.0303  -0.1107 383 PRO A CD  
2906 N N   . GLY A 384 ? 0.4067 0.6505 0.7686 -0.0315 -0.0152 -0.0884 384 GLY A N   
2907 C CA  . GLY A 384 ? 0.4023 0.6520 0.7633 -0.0260 -0.0289 -0.0760 384 GLY A CA  
2908 C C   . GLY A 384 ? 0.4403 0.6842 0.8136 -0.0172 -0.0300 -0.0679 384 GLY A C   
2909 O O   . GLY A 384 ? 0.4461 0.6876 0.8087 -0.0138 -0.0386 -0.0572 384 GLY A O   
2910 N N   . ASN A 385 ? 0.3817 0.6233 0.7780 -0.0142 -0.0206 -0.0735 385 ASN A N   
2911 C CA  . ASN A 385 ? 0.3703 0.6060 0.7838 -0.0062 -0.0189 -0.0687 385 ASN A CA  
2912 C C   . ASN A 385 ? 0.4178 0.6371 0.8072 -0.0036 -0.0195 -0.0606 385 ASN A C   
2913 O O   . ASN A 385 ? 0.4364 0.6564 0.8343 0.0027  -0.0278 -0.0499 385 ASN A O   
2914 C CB  . ASN A 385 ? 0.3540 0.5846 0.7851 -0.0070 -0.0033 -0.0804 385 ASN A CB  
2915 C CG  . ASN A 385 ? 0.7027 0.9492 1.1595 -0.0101 -0.0005 -0.0896 385 ASN A CG  
2916 O OD1 . ASN A 385 ? 0.6588 0.9052 1.1036 -0.0182 0.0060  -0.0983 385 ASN A OD1 
2917 N ND2 . ASN A 385 ? 0.6426 0.9032 1.1370 -0.0039 -0.0055 -0.0878 385 ASN A ND2 
2918 N N   . ALA A 386 ? 0.3467 0.5518 0.7069 -0.0089 -0.0116 -0.0651 386 ALA A N   
2919 C CA  . ALA A 386 ? 0.3413 0.5308 0.6777 -0.0077 -0.0106 -0.0597 386 ALA A CA  
2920 C C   . ALA A 386 ? 0.3588 0.5511 0.6828 -0.0056 -0.0231 -0.0476 386 ALA A C   
2921 O O   . ALA A 386 ? 0.3717 0.5528 0.6835 -0.0032 -0.0228 -0.0417 386 ALA A O   
2922 C CB  . ALA A 386 ? 0.3541 0.5316 0.6639 -0.0145 -0.0020 -0.0669 386 ALA A CB  
2923 N N   . PHE A 387 ? 0.2823 0.4894 0.6072 -0.0077 -0.0334 -0.0445 387 PHE A N   
2924 C CA  . PHE A 387 ? 0.2741 0.4849 0.5826 -0.0082 -0.0447 -0.0342 387 PHE A CA  
2925 C C   . PHE A 387 ? 0.3380 0.5589 0.6656 -0.0025 -0.0572 -0.0219 387 PHE A C   
2926 O O   . PHE A 387 ? 0.3482 0.5760 0.6641 -0.0041 -0.0686 -0.0126 387 PHE A O   
2927 C CB  . PHE A 387 ? 0.2896 0.5088 0.5814 -0.0161 -0.0478 -0.0392 387 PHE A CB  
2928 C CG  . PHE A 387 ? 0.2944 0.5028 0.5709 -0.0213 -0.0358 -0.0506 387 PHE A CG  
2929 C CD1 . PHE A 387 ? 0.3198 0.5312 0.6084 -0.0242 -0.0289 -0.0609 387 PHE A CD1 
2930 C CD2 . PHE A 387 ? 0.3154 0.5104 0.5667 -0.0235 -0.0316 -0.0507 387 PHE A CD2 
2931 C CE1 . PHE A 387 ? 0.3238 0.5238 0.5977 -0.0294 -0.0185 -0.0698 387 PHE A CE1 
2932 C CE2 . PHE A 387 ? 0.3439 0.5285 0.5829 -0.0279 -0.0219 -0.0599 387 PHE A CE2 
2933 C CZ  . PHE A 387 ? 0.3153 0.5020 0.5648 -0.0309 -0.0158 -0.0687 387 PHE A CZ  
2934 N N   . TYR A 388 ? 0.2929 0.5139 0.6496 0.0040  -0.0548 -0.0215 388 TYR A N   
2935 C CA  . TYR A 388 ? 0.2947 0.5240 0.6759 0.0108  -0.0662 -0.0095 388 TYR A CA  
2936 C C   . TYR A 388 ? 0.3762 0.5915 0.7693 0.0178  -0.0608 -0.0053 388 TYR A C   
2937 O O   . TYR A 388 ? 0.3899 0.5934 0.7837 0.0178  -0.0469 -0.0152 388 TYR A O   
2938 C CB  . TYR A 388 ? 0.2868 0.5336 0.7017 0.0126  -0.0698 -0.0139 388 TYR A CB  
2939 C CG  . TYR A 388 ? 0.2808 0.5443 0.6876 0.0060  -0.0791 -0.0151 388 TYR A CG  
2940 C CD1 . TYR A 388 ? 0.3087 0.5854 0.7153 0.0060  -0.0966 -0.0023 388 TYR A CD1 
2941 C CD2 . TYR A 388 ? 0.2767 0.5423 0.6745 -0.0011 -0.0705 -0.0290 388 TYR A CD2 
2942 C CE1 . TYR A 388 ? 0.3251 0.6175 0.7222 -0.0013 -0.1053 -0.0044 388 TYR A CE1 
2943 C CE2 . TYR A 388 ? 0.2860 0.5663 0.6760 -0.0079 -0.0784 -0.0312 388 TYR A CE2 
2944 C CZ  . TYR A 388 ? 0.3683 0.6628 0.7584 -0.0081 -0.0957 -0.0195 388 TYR A CZ  
2945 O OH  . TYR A 388 ? 0.3196 0.6296 0.7019 -0.0158 -0.1037 -0.0226 388 TYR A OH  
2946 N N   . VAL A 389 ? 0.3248 0.5412 0.7274 0.0232  -0.0720 0.0096  389 VAL A N   
2947 C CA  . VAL A 389 ? 0.3203 0.5239 0.7386 0.0302  -0.0683 0.0150  389 VAL A CA  
2948 C C   . VAL A 389 ? 0.4138 0.6204 0.8707 0.0352  -0.0600 0.0053  389 VAL A C   
2949 O O   . VAL A 389 ? 0.3944 0.5879 0.8564 0.0366  -0.0466 -0.0028 389 VAL A O   
2950 C CB  . VAL A 389 ? 0.3571 0.5621 0.7791 0.0345  -0.0833 0.0343  389 VAL A CB  
2951 C CG1 . VAL A 389 ? 0.3470 0.5386 0.7901 0.0420  -0.0790 0.0392  389 VAL A CG1 
2952 C CG2 . VAL A 389 ? 0.3579 0.5591 0.7403 0.0281  -0.0887 0.0420  389 VAL A CG2 
2953 N N   . ASP A 390 ? 0.4112 0.6359 0.8939 0.0367  -0.0672 0.0045  390 ASP A N   
2954 C CA  . ASP A 390 ? 0.4254 0.6561 0.9463 0.0404  -0.0591 -0.0061 390 ASP A CA  
2955 C C   . ASP A 390 ? 0.5017 0.7366 1.0111 0.0325  -0.0484 -0.0225 390 ASP A C   
2956 O O   . ASP A 390 ? 0.5114 0.7631 1.0290 0.0297  -0.0546 -0.0249 390 ASP A O   
2957 C CB  . ASP A 390 ? 0.4673 0.7161 1.0266 0.0469  -0.0739 0.0033  390 ASP A CB  
2958 C CG  . ASP A 390 ? 0.6488 0.9051 1.2553 0.0521  -0.0662 -0.0068 390 ASP A CG  
2959 O OD1 . ASP A 390 ? 0.6801 0.9487 1.3235 0.0593  -0.0781 0.0022  390 ASP A OD1 
2960 O OD2 . ASP A 390 ? 0.6964 0.9470 1.3034 0.0484  -0.0485 -0.0236 390 ASP A OD2 
2961 N N   . SER A 391 ? 0.4554 0.6747 0.9451 0.0283  -0.0327 -0.0332 391 SER A N   
2962 C CA  . SER A 391 ? 0.4436 0.6625 0.9184 0.0201  -0.0214 -0.0477 391 SER A CA  
2963 C C   . SER A 391 ? 0.4923 0.7192 0.9994 0.0199  -0.0112 -0.0605 391 SER A C   
2964 O O   . SER A 391 ? 0.4913 0.7200 0.9891 0.0126  -0.0026 -0.0718 391 SER A O   
2965 C CB  . SER A 391 ? 0.4808 0.6802 0.9226 0.0155  -0.0102 -0.0525 391 SER A CB  
2966 O OG  . SER A 391 ? 0.5912 0.7773 1.0364 0.0204  -0.0068 -0.0484 391 SER A OG  
2967 N N   . SER A 392 ? 0.4467 0.6781 0.9927 0.0277  -0.0115 -0.0590 392 SER A N   
2968 C CA  . SER A 392 ? 0.4425 0.6826 1.0256 0.0283  -0.0013 -0.0716 392 SER A CA  
2969 C C   . SER A 392 ? 0.4817 0.7451 1.0905 0.0291  -0.0121 -0.0704 392 SER A C   
2970 O O   . SER A 392 ? 0.4725 0.7456 1.1059 0.0267  -0.0030 -0.0830 392 SER A O   
2971 C CB  . SER A 392 ? 0.4966 0.7306 1.1126 0.0364  0.0043  -0.0717 392 SER A CB  
2972 O OG  . SER A 392 ? 0.6597 0.8954 1.2875 0.0450  -0.0118 -0.0545 392 SER A OG  
2973 N N   . ALA A 393 ? 0.4408 0.7137 1.0431 0.0314  -0.0313 -0.0558 393 ALA A N   
2974 C CA  . ALA A 393 ? 0.4391 0.7350 1.0613 0.0312  -0.0445 -0.0531 393 ALA A CA  
2975 C C   . ALA A 393 ? 0.4652 0.7663 1.0660 0.0204  -0.0382 -0.0650 393 ALA A C   
2976 O O   . ALA A 393 ? 0.4453 0.7324 1.0059 0.0141  -0.0321 -0.0675 393 ALA A O   
2977 C CB  . ALA A 393 ? 0.4567 0.7587 1.0678 0.0342  -0.0660 -0.0343 393 ALA A CB  
2978 N N   . PRO A 394 ? 0.4142 0.7346 1.0428 0.0182  -0.0390 -0.0728 394 PRO A N   
2979 C CA  . PRO A 394 ? 0.4038 0.7280 1.0124 0.0074  -0.0326 -0.0841 394 PRO A CA  
2980 C C   . PRO A 394 ? 0.4420 0.7703 1.0177 0.0023  -0.0467 -0.0760 394 PRO A C   
2981 O O   . PRO A 394 ? 0.4532 0.7917 1.0336 0.0066  -0.0646 -0.0626 394 PRO A O   
2982 C CB  . PRO A 394 ? 0.4204 0.7654 1.0726 0.0071  -0.0308 -0.0934 394 PRO A CB  
2983 C CG  . PRO A 394 ? 0.4829 0.8409 1.1735 0.0178  -0.0455 -0.0820 394 PRO A CG  
2984 C CD  . PRO A 394 ? 0.4305 0.7702 1.1112 0.0252  -0.0460 -0.0716 394 PRO A CD  
2985 N N   . SER A 395 ? 0.3661 0.6861 0.9083 -0.0071 -0.0384 -0.0840 395 SER A N   
2986 C CA  . SER A 395 ? 0.3473 0.6692 0.8569 -0.0130 -0.0485 -0.0792 395 SER A CA  
2987 C C   . SER A 395 ? 0.3569 0.6863 0.8604 -0.0232 -0.0434 -0.0914 395 SER A C   
2988 O O   . SER A 395 ? 0.3386 0.6566 0.8341 -0.0282 -0.0272 -0.1024 395 SER A O   
2989 C CB  . SER A 395 ? 0.3775 0.6773 0.8472 -0.0137 -0.0445 -0.0746 395 SER A CB  
2990 O OG  . SER A 395 ? 0.4253 0.7273 0.8661 -0.0187 -0.0544 -0.0696 395 SER A OG  
2991 N N   . PRO A 396 ? 0.3059 0.6534 0.8106 -0.0274 -0.0569 -0.0894 396 PRO A N   
2992 C CA  . PRO A 396 ? 0.2997 0.6535 0.7985 -0.0378 -0.0515 -0.1016 396 PRO A CA  
2993 C C   . PRO A 396 ? 0.3459 0.6845 0.8014 -0.0452 -0.0477 -0.1035 396 PRO A C   
2994 O O   . PRO A 396 ? 0.3499 0.6891 0.7972 -0.0541 -0.0414 -0.1138 396 PRO A O   
2995 C CB  . PRO A 396 ? 0.3233 0.7037 0.8437 -0.0389 -0.0687 -0.0984 396 PRO A CB  
2996 C CG  . PRO A 396 ? 0.3883 0.7703 0.9001 -0.0327 -0.0854 -0.0819 396 PRO A CG  
2997 C CD  . PRO A 396 ? 0.3304 0.6935 0.8412 -0.0238 -0.0778 -0.0760 396 PRO A CD  
2998 N N   . TYR A 397 ? 0.2824 0.6073 0.7124 -0.0415 -0.0511 -0.0939 397 TYR A N   
2999 C CA  . TYR A 397 ? 0.2797 0.5905 0.6714 -0.0470 -0.0485 -0.0944 397 TYR A CA  
3000 C C   . TYR A 397 ? 0.3473 0.6350 0.7219 -0.0480 -0.0321 -0.1000 397 TYR A C   
3001 O O   . TYR A 397 ? 0.3546 0.6330 0.7386 -0.0426 -0.0246 -0.0992 397 TYR A O   
3002 C CB  . TYR A 397 ? 0.2917 0.5999 0.6653 -0.0430 -0.0601 -0.0813 397 TYR A CB  
3003 C CG  . TYR A 397 ? 0.3014 0.6305 0.6827 -0.0434 -0.0784 -0.0732 397 TYR A CG  
3004 C CD1 . TYR A 397 ? 0.3258 0.6656 0.7330 -0.0353 -0.0893 -0.0626 397 TYR A CD1 
3005 C CD2 . TYR A 397 ? 0.3099 0.6475 0.6718 -0.0522 -0.0853 -0.0757 397 TYR A CD2 
3006 C CE1 . TYR A 397 ? 0.3550 0.7143 0.7688 -0.0361 -0.1079 -0.0535 397 TYR A CE1 
3007 C CE2 . TYR A 397 ? 0.3361 0.6933 0.7019 -0.0540 -0.1030 -0.0679 397 TYR A CE2 
3008 C CZ  . TYR A 397 ? 0.4730 0.8413 0.8646 -0.0459 -0.1150 -0.0562 397 TYR A CZ  
3009 O OH  . TYR A 397 ? 0.4981 0.8864 0.8933 -0.0483 -0.1341 -0.0473 397 TYR A OH  
3010 N N   . LEU A 398 ? 0.3054 0.5832 0.6536 -0.0550 -0.0274 -0.1050 398 LEU A N   
3011 C CA  . LEU A 398 ? 0.3155 0.5707 0.6436 -0.0563 -0.0146 -0.1081 398 LEU A CA  
3012 C C   . LEU A 398 ? 0.3659 0.6114 0.6637 -0.0593 -0.0169 -0.1060 398 LEU A C   
3013 O O   . LEU A 398 ? 0.3540 0.6100 0.6459 -0.0641 -0.0243 -0.1074 398 LEU A O   
3014 C CB  . LEU A 398 ? 0.3241 0.5735 0.6583 -0.0622 -0.0009 -0.1190 398 LEU A CB  
3015 C CG  . LEU A 398 ? 0.4055 0.6620 0.7397 -0.0717 0.0009  -0.1283 398 LEU A CG  
3016 C CD1 . LEU A 398 ? 0.4226 0.6614 0.7284 -0.0772 0.0066  -0.1310 398 LEU A CD1 
3017 C CD2 . LEU A 398 ? 0.4246 0.6844 0.7789 -0.0758 0.0113  -0.1373 398 LEU A CD2 
3018 N N   . ARG A 399 ? 0.3145 0.5410 0.5945 -0.0566 -0.0109 -0.1029 399 ARG A N   
3019 C CA  . ARG A 399 ? 0.3063 0.5227 0.5606 -0.0587 -0.0117 -0.1014 399 ARG A CA  
3020 C C   . ARG A 399 ? 0.3605 0.5610 0.6021 -0.0641 -0.0009 -0.1088 399 ARG A C   
3021 O O   . ARG A 399 ? 0.3585 0.5455 0.5987 -0.0627 0.0075  -0.1092 399 ARG A O   
3022 C CB  . ARG A 399 ? 0.2974 0.5053 0.5419 -0.0518 -0.0145 -0.0918 399 ARG A CB  
3023 C CG  . ARG A 399 ? 0.4199 0.6202 0.6407 -0.0540 -0.0158 -0.0904 399 ARG A CG  
3024 C CD  . ARG A 399 ? 0.3923 0.5797 0.6029 -0.0483 -0.0145 -0.0832 399 ARG A CD  
3025 N NE  . ARG A 399 ? 0.3594 0.5295 0.5646 -0.0478 -0.0047 -0.0861 399 ARG A NE  
3026 C CZ  . ARG A 399 ? 0.4801 0.6381 0.6782 -0.0434 -0.0023 -0.0812 399 ARG A CZ  
3027 N NH1 . ARG A 399 ? 0.2717 0.4322 0.4676 -0.0391 -0.0081 -0.0734 399 ARG A NH1 
3028 N NH2 . ARG A 399 ? 0.3009 0.4442 0.4936 -0.0440 0.0055  -0.0838 399 ARG A NH2 
3029 N N   . ALA A 400 ? 0.3166 0.5187 0.5488 -0.0707 -0.0013 -0.1145 400 ALA A N   
3030 C CA  . ALA A 400 ? 0.3101 0.4973 0.5314 -0.0762 0.0077  -0.1210 400 ALA A CA  
3031 C C   . ALA A 400 ? 0.3624 0.5389 0.5643 -0.0756 0.0071  -0.1190 400 ALA A C   
3032 O O   . ALA A 400 ? 0.3586 0.5443 0.5547 -0.0764 0.0004  -0.1182 400 ALA A O   
3033 C CB  . ALA A 400 ? 0.3215 0.5180 0.5498 -0.0845 0.0088  -0.1304 400 ALA A CB  
3034 N N   . SER A 401 ? 0.3199 0.4773 0.5121 -0.0746 0.0141  -0.1182 401 SER A N   
3035 C CA  . SER A 401 ? 0.3032 0.4498 0.4807 -0.0736 0.0144  -0.1169 401 SER A CA  
3036 C C   . SER A 401 ? 0.3346 0.4717 0.5075 -0.0797 0.0201  -0.1243 401 SER A C   
3037 O O   . SER A 401 ? 0.3349 0.4622 0.5104 -0.0827 0.0262  -0.1267 401 SER A O   
3038 C CB  . SER A 401 ? 0.3179 0.4507 0.4895 -0.0675 0.0165  -0.1097 401 SER A CB  
3039 O OG  . SER A 401 ? 0.4243 0.5485 0.5849 -0.0662 0.0165  -0.1087 401 SER A OG  
3040 N N   . PHE A 402 ? 0.2755 0.4151 0.4417 -0.0821 0.0185  -0.1282 402 PHE A N   
3041 C CA  . PHE A 402 ? 0.2722 0.4025 0.4357 -0.0878 0.0241  -0.1361 402 PHE A CA  
3042 C C   . PHE A 402 ? 0.3594 0.4741 0.5151 -0.0844 0.0271  -0.1342 402 PHE A C   
3043 O O   . PHE A 402 ? 0.3724 0.4812 0.5270 -0.0881 0.0309  -0.1411 402 PHE A O   
3044 C CB  . PHE A 402 ? 0.2821 0.4274 0.4463 -0.0949 0.0217  -0.1450 402 PHE A CB  
3045 C CG  . PHE A 402 ? 0.2813 0.4393 0.4375 -0.0946 0.0153  -0.1438 402 PHE A CG  
3046 C CD1 . PHE A 402 ? 0.3199 0.4719 0.4666 -0.0954 0.0180  -0.1469 402 PHE A CD1 
3047 C CD2 . PHE A 402 ? 0.2861 0.4626 0.4451 -0.0942 0.0067  -0.1398 402 PHE A CD2 
3048 C CE1 . PHE A 402 ? 0.3334 0.4972 0.4707 -0.0967 0.0130  -0.1461 402 PHE A CE1 
3049 C CE2 . PHE A 402 ? 0.3247 0.5124 0.4740 -0.0952 0.0002  -0.1376 402 PHE A CE2 
3050 C CZ  . PHE A 402 ? 0.3139 0.4951 0.4509 -0.0970 0.0039  -0.1410 402 PHE A CZ  
3051 N N   . SER A 403 ? 0.3172 0.4254 0.4694 -0.0775 0.0255  -0.1255 403 SER A N   
3052 C CA  . SER A 403 ? 0.3244 0.4198 0.4717 -0.0739 0.0275  -0.1234 403 SER A CA  
3053 C C   . SER A 403 ? 0.4092 0.4857 0.5583 -0.0742 0.0323  -0.1229 403 SER A C   
3054 O O   . SER A 403 ? 0.4160 0.4825 0.5650 -0.0726 0.0341  -0.1236 403 SER A O   
3055 C CB  . SER A 403 ? 0.3619 0.4583 0.5054 -0.0671 0.0236  -0.1146 403 SER A CB  
3056 O OG  . SER A 403 ? 0.5128 0.6047 0.6580 -0.0641 0.0232  -0.1084 403 SER A OG  
3057 N N   . SER A 404 ? 0.3802 0.4515 0.5314 -0.0766 0.0343  -0.1215 404 SER A N   
3058 C CA  . SER A 404 ? 0.3946 0.4469 0.5450 -0.0775 0.0380  -0.1189 404 SER A CA  
3059 C C   . SER A 404 ? 0.4578 0.5048 0.6117 -0.0847 0.0428  -0.1232 404 SER A C   
3060 O O   . SER A 404 ? 0.4860 0.5174 0.6407 -0.0868 0.0458  -0.1233 404 SER A O   
3061 C CB  . SER A 404 ? 0.4499 0.4944 0.5948 -0.0731 0.0361  -0.1094 404 SER A CB  
3062 O OG  . SER A 404 ? 0.6195 0.6749 0.7648 -0.0729 0.0352  -0.1080 404 SER A OG  
3063 N N   . ALA A 405 ? 0.3770 0.4363 0.5344 -0.0884 0.0434  -0.1265 405 ALA A N   
3064 C CA  . ALA A 405 ? 0.3748 0.4306 0.5365 -0.0960 0.0487  -0.1312 405 ALA A CA  
3065 C C   . ALA A 405 ? 0.4517 0.5034 0.6177 -0.1012 0.0519  -0.1395 405 ALA A C   
3066 O O   . ALA A 405 ? 0.4456 0.5063 0.6132 -0.1006 0.0498  -0.1451 405 ALA A O   
3067 C CB  . ALA A 405 ? 0.3758 0.4492 0.5442 -0.0986 0.0483  -0.1345 405 ALA A CB  
3068 N N   . SER A 406 ? 0.4278 0.4647 0.5952 -0.1067 0.0573  -0.1404 406 SER A N   
3069 C CA  . SER A 406 ? 0.4336 0.4642 0.6070 -0.1122 0.0615  -0.1486 406 SER A CA  
3070 C C   . SER A 406 ? 0.5113 0.5592 0.6917 -0.1193 0.0630  -0.1592 406 SER A C   
3071 O O   . SER A 406 ? 0.4965 0.5561 0.6785 -0.1207 0.0621  -0.1583 406 SER A O   
3072 C CB  . SER A 406 ? 0.4694 0.4769 0.6421 -0.1157 0.0663  -0.1442 406 SER A CB  
3073 O OG  . SER A 406 ? 0.5713 0.5781 0.7438 -0.1227 0.0707  -0.1445 406 SER A OG  
3074 N N   . PRO A 407 ? 0.4983 0.5488 0.6842 -0.1244 0.0654  -0.1699 407 PRO A N   
3075 C CA  . PRO A 407 ? 0.5013 0.5695 0.6939 -0.1322 0.0659  -0.1802 407 PRO A CA  
3076 C C   . PRO A 407 ? 0.5526 0.6199 0.7506 -0.1385 0.0703  -0.1807 407 PRO A C   
3077 O O   . PRO A 407 ? 0.5261 0.6124 0.7304 -0.1422 0.0684  -0.1855 407 PRO A O   
3078 C CB  . PRO A 407 ? 0.5350 0.5991 0.7313 -0.1374 0.0698  -0.1914 407 PRO A CB  
3079 C CG  . PRO A 407 ? 0.5845 0.6389 0.7762 -0.1301 0.0686  -0.1875 407 PRO A CG  
3080 C CD  . PRO A 407 ? 0.5245 0.5629 0.7123 -0.1238 0.0679  -0.1741 407 PRO A CD  
3081 N N   . GLU A 408 ? 0.5364 0.5819 0.7322 -0.1400 0.0758  -0.1751 408 GLU A N   
3082 C CA  . GLU A 408 ? 0.5488 0.5899 0.7472 -0.1468 0.0816  -0.1745 408 GLU A CA  
3083 C C   . GLU A 408 ? 0.5786 0.6236 0.7720 -0.1428 0.0800  -0.1658 408 GLU A C   
3084 O O   . GLU A 408 ? 0.5909 0.6425 0.7893 -0.1483 0.0841  -0.1680 408 GLU A O   
3085 C CB  . GLU A 408 ? 0.5900 0.6057 0.7877 -0.1525 0.0887  -0.1731 408 GLU A CB  
3086 C CG  . GLU A 408 ? 0.8008 0.7954 0.9922 -0.1461 0.0870  -0.1646 408 GLU A CG  
3087 C CD  . GLU A 408 ? 1.0970 1.0910 1.2938 -0.1430 0.0855  -0.1712 408 GLU A CD  
3088 O OE1 . GLU A 408 ? 1.0284 1.0304 1.2335 -0.1493 0.0886  -0.1837 408 GLU A OE1 
3089 O OE2 . GLU A 408 ? 0.9676 0.9529 1.1608 -0.1351 0.0818  -0.1645 408 GLU A OE2 
3090 N N   . GLN A 409 ? 0.5029 0.5454 0.6879 -0.1337 0.0747  -0.1571 409 GLN A N   
3091 C CA  . GLN A 409 ? 0.4902 0.5374 0.6709 -0.1295 0.0731  -0.1500 409 GLN A CA  
3092 C C   . GLN A 409 ? 0.5158 0.5893 0.7073 -0.1285 0.0694  -0.1555 409 GLN A C   
3093 O O   . GLN A 409 ? 0.4976 0.5790 0.6940 -0.1297 0.0717  -0.1552 409 GLN A O   
3094 C CB  . GLN A 409 ? 0.4969 0.5364 0.6675 -0.1203 0.0677  -0.1406 409 GLN A CB  
3095 C CG  . GLN A 409 ? 0.7272 0.7450 0.8864 -0.1207 0.0703  -0.1311 409 GLN A CG  
3096 C CD  . GLN A 409 ? 1.0963 1.1081 1.2474 -0.1120 0.0643  -0.1226 409 GLN A CD  
3097 O OE1 . GLN A 409 ? 1.0176 1.0398 1.1670 -0.1066 0.0607  -0.1200 409 GLN A OE1 
3098 N NE2 . GLN A 409 ? 1.0670 1.0613 1.2143 -0.1105 0.0630  -0.1180 409 GLN A NE2 
3099 N N   . MET A 410 ? 0.4632 0.5500 0.6586 -0.1269 0.0639  -0.1609 410 MET A N   
3100 C CA  . MET A 410 ? 0.4489 0.5609 0.6540 -0.1263 0.0579  -0.1654 410 MET A CA  
3101 C C   . MET A 410 ? 0.5205 0.6437 0.7390 -0.1350 0.0617  -0.1740 410 MET A C   
3102 O O   . MET A 410 ? 0.5132 0.6532 0.7426 -0.1343 0.0595  -0.1745 410 MET A O   
3103 C CB  . MET A 410 ? 0.4741 0.5939 0.6760 -0.1249 0.0520  -0.1692 410 MET A CB  
3104 C CG  . MET A 410 ? 0.5060 0.6224 0.6980 -0.1159 0.0469  -0.1611 410 MET A CG  
3105 S SD  . MET A 410 ? 0.5510 0.6678 0.7361 -0.1163 0.0445  -0.1667 410 MET A SD  
3106 C CE  . MET A 410 ? 0.4944 0.6074 0.6704 -0.1061 0.0399  -0.1562 410 MET A CE  
3107 N N   . ASP A 411 ? 0.4951 0.6087 0.7146 -0.1433 0.0679  -0.1808 411 ASP A N   
3108 C CA  . ASP A 411 ? 0.4974 0.6195 0.7297 -0.1530 0.0727  -0.1899 411 ASP A CA  
3109 C C   . ASP A 411 ? 0.5653 0.6850 0.8022 -0.1549 0.0791  -0.1868 411 ASP A C   
3110 O O   . ASP A 411 ? 0.5627 0.7016 0.8144 -0.1571 0.0785  -0.1913 411 ASP A O   
3111 C CB  . ASP A 411 ? 0.5358 0.6422 0.7664 -0.1610 0.0794  -0.1963 411 ASP A CB  
3112 C CG  . ASP A 411 ? 0.7413 0.8612 0.9857 -0.1715 0.0821  -0.2085 411 ASP A CG  
3113 O OD1 . ASP A 411 ? 0.7873 0.9072 1.0398 -0.1776 0.0887  -0.2103 411 ASP A OD1 
3114 O OD2 . ASP A 411 ? 0.7829 0.9133 1.0298 -0.1744 0.0781  -0.2168 411 ASP A OD2 
3115 N N   . VAL A 412 ? 0.5333 0.6304 0.7578 -0.1540 0.0848  -0.1790 412 VAL A N   
3116 C CA  . VAL A 412 ? 0.5316 0.6232 0.7557 -0.1570 0.0922  -0.1758 412 VAL A CA  
3117 C C   . VAL A 412 ? 0.5695 0.6795 0.8022 -0.1506 0.0884  -0.1741 412 VAL A C   
3118 O O   . VAL A 412 ? 0.5707 0.6917 0.8164 -0.1549 0.0935  -0.1788 412 VAL A O   
3119 C CB  . VAL A 412 ? 0.5863 0.6499 0.7916 -0.1570 0.0965  -0.1661 412 VAL A CB  
3120 C CG1 . VAL A 412 ? 0.5861 0.6454 0.7869 -0.1598 0.1034  -0.1622 412 VAL A CG1 
3121 C CG2 . VAL A 412 ? 0.5973 0.6420 0.7985 -0.1648 0.1018  -0.1676 412 VAL A CG2 
3122 N N   . ALA A 413 ? 0.5134 0.6268 0.7405 -0.1404 0.0798  -0.1678 413 ALA A N   
3123 C CA  . ALA A 413 ? 0.4961 0.6242 0.7309 -0.1331 0.0754  -0.1648 413 ALA A CA  
3124 C C   . ALA A 413 ? 0.5467 0.7019 0.8030 -0.1328 0.0698  -0.1711 413 ALA A C   
3125 O O   . ALA A 413 ? 0.5449 0.7119 0.8159 -0.1316 0.0717  -0.1723 413 ALA A O   
3126 C CB  . ALA A 413 ? 0.4963 0.6188 0.7188 -0.1233 0.0679  -0.1563 413 ALA A CB  
3127 N N   . PHE A 414 ? 0.4959 0.6614 0.7548 -0.1343 0.0630  -0.1755 414 PHE A N   
3128 C CA  . PHE A 414 ? 0.4906 0.6827 0.7686 -0.1350 0.0556  -0.1809 414 PHE A CA  
3129 C C   . PHE A 414 ? 0.5473 0.7489 0.8435 -0.1441 0.0625  -0.1901 414 PHE A C   
3130 O O   . PHE A 414 ? 0.5436 0.7682 0.8607 -0.1440 0.0574  -0.1937 414 PHE A O   
3131 C CB  . PHE A 414 ? 0.5189 0.7191 0.7911 -0.1354 0.0464  -0.1831 414 PHE A CB  
3132 C CG  . PHE A 414 ? 0.5352 0.7399 0.7989 -0.1262 0.0362  -0.1749 414 PHE A CG  
3133 C CD1 . PHE A 414 ? 0.5680 0.7745 0.8352 -0.1175 0.0337  -0.1666 414 PHE A CD1 
3134 C CD2 . PHE A 414 ? 0.5704 0.7782 0.8234 -0.1270 0.0297  -0.1763 414 PHE A CD2 
3135 C CE1 . PHE A 414 ? 0.5727 0.7825 0.8322 -0.1096 0.0246  -0.1587 414 PHE A CE1 
3136 C CE2 . PHE A 414 ? 0.5996 0.8115 0.8439 -0.1196 0.0211  -0.1687 414 PHE A CE2 
3137 C CZ  . PHE A 414 ? 0.5624 0.7750 0.8100 -0.1109 0.0183  -0.1595 414 PHE A CZ  
3138 N N   . GLN A 415 ? 0.5150 0.6988 0.8043 -0.1520 0.0739  -0.1933 415 GLN A N   
3139 C CA  . GLN A 415 ? 0.5285 0.7175 0.8329 -0.1619 0.0830  -0.2018 415 GLN A CA  
3140 C C   . GLN A 415 ? 0.5848 0.7779 0.9002 -0.1598 0.0891  -0.2003 415 GLN A C   
3141 O O   . GLN A 415 ? 0.5948 0.8059 0.9334 -0.1637 0.0918  -0.2075 415 GLN A O   
3142 C CB  . GLN A 415 ? 0.5640 0.7293 0.8546 -0.1708 0.0931  -0.2037 415 GLN A CB  
3143 C CG  . GLN A 415 ? 0.8182 0.9827 1.1197 -0.1822 0.1052  -0.2110 415 GLN A CG  
3144 C CD  . GLN A 415 ? 1.1385 1.2772 1.4244 -0.1902 0.1135  -0.2106 415 GLN A CD  
3145 O OE1 . GLN A 415 ? 1.0676 1.2073 1.3587 -0.1976 0.1148  -0.2182 415 GLN A OE1 
3146 N NE2 . GLN A 415 ? 1.1003 1.2150 1.3666 -0.1887 0.1184  -0.2013 415 GLN A NE2 
3147 N N   . VAL A 416 ? 0.5229 0.7002 0.8229 -0.1538 0.0914  -0.1917 416 VAL A N   
3148 C CA  . VAL A 416 ? 0.5090 0.6878 0.8163 -0.1516 0.0979  -0.1905 416 VAL A CA  
3149 C C   . VAL A 416 ? 0.5284 0.7323 0.8589 -0.1430 0.0885  -0.1907 416 VAL A C   
3150 O O   . VAL A 416 ? 0.5105 0.7279 0.8635 -0.1443 0.0935  -0.1960 416 VAL A O   
3151 C CB  . VAL A 416 ? 0.5533 0.7083 0.8355 -0.1482 0.1014  -0.1813 416 VAL A CB  
3152 C CG1 . VAL A 416 ? 0.5436 0.7013 0.8330 -0.1459 0.1078  -0.1811 416 VAL A CG1 
3153 C CG2 . VAL A 416 ? 0.5653 0.6958 0.8269 -0.1573 0.1101  -0.1800 416 VAL A CG2 
3154 N N   . LEU A 417 ? 0.4813 0.6915 0.8075 -0.1349 0.0750  -0.1850 417 LEU A N   
3155 C CA  . LEU A 417 ? 0.4736 0.7061 0.8193 -0.1265 0.0637  -0.1827 417 LEU A CA  
3156 C C   . LEU A 417 ? 0.5340 0.7911 0.9085 -0.1313 0.0614  -0.1913 417 LEU A C   
3157 O O   . LEU A 417 ? 0.5259 0.7987 0.9259 -0.1278 0.0611  -0.1929 417 LEU A O   
3158 C CB  . LEU A 417 ? 0.4689 0.7025 0.8007 -0.1200 0.0501  -0.1755 417 LEU A CB  
3159 C CG  . LEU A 417 ? 0.5073 0.7468 0.8416 -0.1084 0.0406  -0.1662 417 LEU A CG  
3160 C CD1 . LEU A 417 ? 0.5042 0.7554 0.8339 -0.1055 0.0261  -0.1623 417 LEU A CD1 
3161 C CD2 . LEU A 417 ? 0.5119 0.7671 0.8749 -0.1042 0.0409  -0.1671 417 LEU A CD2 
3162 N N   . ALA A 418 ? 0.5044 0.7643 0.8763 -0.1398 0.0606  -0.1977 418 ALA A N   
3163 C CA  . ALA A 418 ? 0.5056 0.7889 0.9030 -0.1462 0.0579  -0.2069 418 ALA A CA  
3164 C C   . ALA A 418 ? 0.5799 0.8698 1.0012 -0.1508 0.0698  -0.2142 418 ALA A C   
3165 O O   . ALA A 418 ? 0.5831 0.8974 1.0345 -0.1498 0.0646  -0.2183 418 ALA A O   
3166 C CB  . ALA A 418 ? 0.5223 0.8013 0.9085 -0.1560 0.0586  -0.2134 418 ALA A CB  
3167 N N   . GLN A 419 ? 0.5541 0.8226 0.9624 -0.1562 0.0854  -0.2157 419 GLN A N   
3168 C CA  . GLN A 419 ? 0.5646 0.8371 0.9922 -0.1623 0.0993  -0.2235 419 GLN A CA  
3169 C C   . GLN A 419 ? 0.5971 0.8799 1.0443 -0.1534 0.0994  -0.2214 419 GLN A C   
3170 O O   . GLN A 419 ? 0.5679 0.8695 1.0472 -0.1552 0.1036  -0.2291 419 GLN A O   
3171 C CB  . GLN A 419 ? 0.6013 0.8468 1.0051 -0.1716 0.1154  -0.2243 419 GLN A CB  
3172 C CG  . GLN A 419 ? 0.9906 1.2415 1.4128 -0.1828 0.1306  -0.2351 419 GLN A CG  
3173 C CD  . GLN A 419 ? 1.4509 1.6752 1.8490 -0.1907 0.1465  -0.2337 419 GLN A CD  
3174 O OE1 . GLN A 419 ? 1.4216 1.6290 1.8023 -0.2004 0.1530  -0.2343 419 GLN A OE1 
3175 N NE2 . GLN A 419 ? 1.4482 1.6678 1.8446 -0.1871 0.1531  -0.2315 419 GLN A NE2 
3176 N N   . LEU A 420 ? 0.5614 0.8320 0.9914 -0.1438 0.0951  -0.2115 420 LEU A N   
3177 C CA  . LEU A 420 ? 0.5570 0.8341 1.0033 -0.1347 0.0949  -0.2087 420 LEU A CA  
3178 C C   . LEU A 420 ? 0.6228 0.9282 1.1024 -0.1270 0.0808  -0.2082 420 LEU A C   
3179 O O   . LEU A 420 ? 0.6218 0.9411 1.1324 -0.1237 0.0843  -0.2123 420 LEU A O   
3180 C CB  . LEU A 420 ? 0.5520 0.8092 0.9707 -0.1270 0.0924  -0.1981 420 LEU A CB  
3181 C CG  . LEU A 420 ? 0.6171 0.8470 1.0057 -0.1336 0.1058  -0.1973 420 LEU A CG  
3182 C CD1 . LEU A 420 ? 0.6146 0.8277 0.9777 -0.1258 0.1002  -0.1866 420 LEU A CD1 
3183 C CD2 . LEU A 420 ? 0.6531 0.8814 1.0530 -0.1395 0.1224  -0.2051 420 LEU A CD2 
3184 N N   . ILE A 421 ? 0.5787 0.8927 1.0522 -0.1248 0.0651  -0.2036 421 ILE A N   
3185 C CA  . ILE A 421 ? 0.5765 0.9173 1.0769 -0.1189 0.0488  -0.2014 421 ILE A CA  
3186 C C   . ILE A 421 ? 0.6790 1.0421 1.2151 -0.1257 0.0525  -0.2128 421 ILE A C   
3187 O O   . ILE A 421 ? 0.6789 1.0619 1.2503 -0.1199 0.0481  -0.2135 421 ILE A O   
3188 C CB  . ILE A 421 ? 0.6085 0.9509 1.0877 -0.1184 0.0334  -0.1951 421 ILE A CB  
3189 C CG1 . ILE A 421 ? 0.6069 0.9336 1.0609 -0.1091 0.0277  -0.1830 421 ILE A CG1 
3190 C CG2 . ILE A 421 ? 0.6138 0.9860 1.1188 -0.1173 0.0169  -0.1952 421 ILE A CG2 
3191 C CD1 . ILE A 421 ? 0.6905 1.0109 1.1154 -0.1104 0.0182  -0.1783 421 ILE A CD1 
3192 N N   . LYS A 422 ? 0.6636 1.0219 1.1919 -0.1380 0.0618  -0.2219 422 LYS A N   
3193 C CA  . LYS A 422 ? 0.6743 1.0512 1.2330 -0.1468 0.0676  -0.2341 422 LYS A CA  
3194 C C   . LYS A 422 ? 0.7494 1.1303 1.3355 -0.1467 0.0821  -0.2407 422 LYS A C   
3195 O O   . LYS A 422 ? 0.7342 1.1389 1.3583 -0.1489 0.0822  -0.2489 422 LYS A O   
3196 C CB  . LYS A 422 ? 0.7189 1.0829 1.2574 -0.1604 0.0771  -0.2414 422 LYS A CB  
3197 C CG  . LYS A 422 ? 0.9042 1.2774 1.4347 -0.1640 0.0633  -0.2417 422 LYS A CG  
3198 C CD  . LYS A 422 ? 1.0012 1.3520 1.5026 -0.1747 0.0730  -0.2456 422 LYS A CD  
3199 C CE  . LYS A 422 ? 1.1134 1.4724 1.6066 -0.1789 0.0608  -0.2475 422 LYS A CE  
3200 N NZ  . LYS A 422 ? 1.2760 1.6093 1.7387 -0.1868 0.0693  -0.2493 422 LYS A NZ  
3201 N N   . GLU A 423 ? 0.7416 1.0999 1.3088 -0.1450 0.0949  -0.2381 423 GLU A N   
3202 C CA  . GLU A 423 ? 0.7570 1.1154 1.3444 -0.1459 0.1111  -0.2452 423 GLU A CA  
3203 C C   . GLU A 423 ? 0.8122 1.1903 1.4362 -0.1335 0.1026  -0.2428 423 GLU A C   
3204 O O   . GLU A 423 ? 0.8010 1.1964 1.4635 -0.1349 0.1101  -0.2523 423 GLU A O   
3205 C CB  . GLU A 423 ? 0.7890 1.1169 1.3407 -0.1479 0.1246  -0.2418 423 GLU A CB  
3206 C CG  . GLU A 423 ? 0.9966 1.3054 1.5225 -0.1624 0.1396  -0.2470 423 GLU A CG  
3207 C CD  . GLU A 423 ? 1.3273 1.6048 1.8094 -0.1635 0.1451  -0.2390 423 GLU A CD  
3208 O OE1 . GLU A 423 ? 1.1093 1.3774 1.5864 -0.1606 0.1530  -0.2378 423 GLU A OE1 
3209 O OE2 . GLU A 423 ? 1.3197 1.5822 1.7735 -0.1676 0.1416  -0.2344 423 GLU A OE2 
3210 N N   . SER A 424 ? 0.7815 1.1565 1.3947 -0.1215 0.0876  -0.2300 424 SER A N   
3211 C CA  . SER A 424 ? 0.7789 1.1692 1.4234 -0.1085 0.0773  -0.2246 424 SER A CA  
3212 C C   . SER A 424 ? 0.8442 1.2664 1.5293 -0.1062 0.0628  -0.2262 424 SER A C   
3213 O O   . SER A 424 ? 0.8382 1.2776 1.5648 -0.0989 0.0608  -0.2278 424 SER A O   
3214 C CB  . SER A 424 ? 0.8197 1.1977 1.4380 -0.0983 0.0639  -0.2097 424 SER A CB  
3215 O OG  . SER A 424 ? 0.9638 1.3159 1.5543 -0.0978 0.0761  -0.2078 424 SER A OG  
3216 N N   . LEU A 425 ? 0.8105 1.2409 1.4849 -0.1124 0.0522  -0.2260 425 LEU A N   
3217 C CA  . LEU A 425 ? 0.8126 1.2737 1.5210 -0.1119 0.0366  -0.2273 425 LEU A CA  
3218 C C   . LEU A 425 ? 0.8938 1.3732 1.6428 -0.1192 0.0483  -0.2422 425 LEU A C   
3219 O O   . LEU A 425 ? 0.8897 1.3975 1.6797 -0.1162 0.0365  -0.2436 425 LEU A O   
3220 C CB  . LEU A 425 ? 0.8143 1.2774 1.4957 -0.1179 0.0231  -0.2240 425 LEU A CB  
3221 C CG  . LEU A 425 ? 0.8661 1.3171 1.5125 -0.1111 0.0087  -0.2096 425 LEU A CG  
3222 C CD1 . LEU A 425 ? 0.8718 1.3185 1.4865 -0.1204 0.0033  -0.2109 425 LEU A CD1 
3223 C CD2 . LEU A 425 ? 0.8809 1.3511 1.5507 -0.0992 -0.0119 -0.1979 425 LEU A CD2 
3224 N N   . LEU A 426 ? 0.8771 1.3406 1.6155 -0.1290 0.0712  -0.2530 426 LEU A N   
3225 C CA  . LEU A 426 ? 0.8891 1.3672 1.6628 -0.1378 0.0860  -0.2683 426 LEU A CA  
3226 C C   . LEU A 426 ? 0.9731 1.4633 1.7907 -0.1300 0.0932  -0.2728 426 LEU A C   
3227 O O   . LEU A 426 ? 0.9617 1.4746 1.8234 -0.1334 0.0982  -0.2840 426 LEU A O   
3228 C CB  . LEU A 426 ? 0.8972 1.3521 1.6408 -0.1520 0.1083  -0.2771 426 LEU A CB  
3229 C CG  . LEU A 426 ? 0.9598 1.4128 1.6831 -0.1641 0.1064  -0.2806 426 LEU A CG  
3230 C CD1 . LEU A 426 ? 0.9723 1.3965 1.6603 -0.1761 0.1270  -0.2850 426 LEU A CD1 
3231 C CD2 . LEU A 426 ? 0.9930 1.4765 1.7589 -0.1708 0.1040  -0.2920 426 LEU A CD2 
3232 N N   . VAL A 427 ? 0.9633 1.4385 1.7706 -0.1199 0.0943  -0.2649 427 VAL A N   
3233 C CA  . VAL A 427 ? 0.9721 1.4554 1.8192 -0.1120 0.1021  -0.2693 427 VAL A CA  
3234 C C   . VAL A 427 ? 1.0470 1.5522 1.9308 -0.0967 0.0791  -0.2587 427 VAL A C   
3235 O O   . VAL A 427 ? 1.0467 1.5456 1.9058 -0.0893 0.0611  -0.2437 427 VAL A O   
3236 C CB  . VAL A 427 ? 1.0235 1.4777 1.8419 -0.1122 0.1205  -0.2700 427 VAL A CB  
3237 C CG1 . VAL A 427 ? 1.0139 1.4506 1.7999 -0.1015 0.1075  -0.2537 427 VAL A CG1 
3238 C CG2 . VAL A 427 ? 1.0229 1.4844 1.8824 -0.1105 0.1378  -0.2820 427 VAL A CG2 
3239 N N   . PRO A 428 ? 1.0145 1.5457 1.9576 -0.0921 0.0789  -0.2658 428 PRO A N   
3240 C CA  . PRO A 428 ? 1.0719 1.6232 2.0511 -0.0774 0.0557  -0.2540 428 PRO A CA  
3241 C C   . PRO A 428 ? 1.6290 2.1642 2.6040 -0.0644 0.0547  -0.2439 428 PRO A C   
3242 O O   . PRO A 428 ? 1.1784 1.7147 2.1476 -0.0541 0.0336  -0.2276 428 PRO A O   
3243 C CB  . PRO A 428 ? 1.0839 1.6655 2.1295 -0.0772 0.0593  -0.2664 428 PRO A CB  
3244 C CG  . PRO A 428 ? 1.1231 1.7023 2.1632 -0.0935 0.0827  -0.2846 428 PRO A CG  
3245 C CD  . PRO A 428 ? 1.0569 1.6005 2.0383 -0.1002 0.0994  -0.2845 428 PRO A CD  
3246 N N   . MET B 1   ? 0.3851 0.4787 0.7083 0.0472  0.0285  -0.1290 1   MET B N   
3247 C CA  . MET B 1   ? 0.3791 0.4629 0.7023 0.0515  0.0193  -0.1157 1   MET B CA  
3248 C C   . MET B 1   ? 0.4126 0.5045 0.7481 0.0582  0.0146  -0.1080 1   MET B C   
3249 O O   . MET B 1   ? 0.3960 0.4985 0.7258 0.0547  0.0145  -0.1048 1   MET B O   
3250 C CB  . MET B 1   ? 0.4054 0.4828 0.7068 0.0435  0.0155  -0.1074 1   MET B CB  
3251 C CG  . MET B 1   ? 0.4658 0.5278 0.7623 0.0426  0.0129  -0.1064 1   MET B CG  
3252 S SD  . MET B 1   ? 0.5203 0.5730 0.8031 0.0396  0.0047  -0.0918 1   MET B SD  
3253 C CE  . MET B 1   ? 0.4749 0.5294 0.7706 0.0484  -0.0011 -0.0815 1   MET B CE  
3254 N N   . ASN B 2   ? 0.3800 0.4667 0.7322 0.0676  0.0103  -0.1048 2   ASN B N   
3255 C CA  . ASN B 2   ? 0.3730 0.4673 0.7366 0.0739  0.0046  -0.0967 2   ASN B CA  
3256 C C   . ASN B 2   ? 0.4248 0.5127 0.7761 0.0721  -0.0032 -0.0828 2   ASN B C   
3257 O O   . ASN B 2   ? 0.4396 0.5146 0.7916 0.0752  -0.0080 -0.0763 2   ASN B O   
3258 C CB  . ASN B 2   ? 0.3547 0.4478 0.7424 0.0847  0.0028  -0.0984 2   ASN B CB  
3259 C CG  . ASN B 2   ? 0.8040 0.9129 1.2061 0.0898  0.0003  -0.0960 2   ASN B CG  
3260 O OD1 . ASN B 2   ? 0.7414 0.8531 1.1397 0.0903  -0.0067 -0.0850 2   ASN B OD1 
3261 N ND2 . ASN B 2   ? 0.7653 0.8862 1.1831 0.0926  0.0065  -0.1071 2   ASN B ND2 
3262 N N   . TYR B 3   ? 0.3468 0.4435 0.6870 0.0666  -0.0037 -0.0788 3   TYR B N   
3263 C CA  . TYR B 3   ? 0.3389 0.4310 0.6675 0.0643  -0.0099 -0.0671 3   TYR B CA  
3264 C C   . TYR B 3   ? 0.3837 0.4774 0.7230 0.0712  -0.0170 -0.0585 3   TYR B C   
3265 O O   . TYR B 3   ? 0.3826 0.4679 0.7146 0.0708  -0.0222 -0.0491 3   TYR B O   
3266 C CB  . TYR B 3   ? 0.3546 0.4545 0.6689 0.0562  -0.0080 -0.0660 3   TYR B CB  
3267 C CG  . TYR B 3   ? 0.3850 0.4803 0.6846 0.0484  -0.0033 -0.0706 3   TYR B CG  
3268 C CD1 . TYR B 3   ? 0.3992 0.5037 0.6953 0.0432  0.0031  -0.0787 3   TYR B CD1 
3269 C CD2 . TYR B 3   ? 0.4068 0.4889 0.6961 0.0459  -0.0054 -0.0669 3   TYR B CD2 
3270 C CE1 . TYR B 3   ? 0.3996 0.5000 0.6812 0.0356  0.0068  -0.0822 3   TYR B CE1 
3271 C CE2 . TYR B 3   ? 0.4212 0.4998 0.6974 0.0387  -0.0021 -0.0707 3   TYR B CE2 
3272 C CZ  . TYR B 3   ? 0.4709 0.5585 0.7427 0.0335  0.0037  -0.0780 3   TYR B CZ  
3273 O OH  . TYR B 3   ? 0.4374 0.5217 0.6949 0.0259  0.0062  -0.0809 3   TYR B OH  
3274 N N   . ALA B 4   ? 0.3305 0.4351 0.6874 0.0774  -0.0172 -0.0617 4   ALA B N   
3275 C CA  . ALA B 4   ? 0.3192 0.4276 0.6877 0.0841  -0.0247 -0.0535 4   ALA B CA  
3276 C C   . ALA B 4   ? 0.3547 0.4487 0.7285 0.0900  -0.0302 -0.0464 4   ALA B C   
3277 O O   . ALA B 4   ? 0.3627 0.4560 0.7356 0.0919  -0.0375 -0.0359 4   ALA B O   
3278 C CB  . ALA B 4   ? 0.3290 0.4531 0.7170 0.0895  -0.0236 -0.0593 4   ALA B CB  
3279 N N   . ARG B 5   ? 0.2899 0.3721 0.6679 0.0919  -0.0269 -0.0519 5   ARG B N   
3280 C CA  . ARG B 5   ? 0.2954 0.3624 0.6785 0.0969  -0.0319 -0.0450 5   ARG B CA  
3281 C C   . ARG B 5   ? 0.3536 0.4098 0.7188 0.0917  -0.0360 -0.0346 5   ARG B C   
3282 O O   . ARG B 5   ? 0.3479 0.3931 0.7156 0.0949  -0.0412 -0.0262 5   ARG B O   
3283 C CB  . ARG B 5   ? 0.2972 0.3538 0.6904 0.1001  -0.0270 -0.0544 5   ARG B CB  
3284 C CG  . ARG B 5   ? 0.3852 0.4337 0.7633 0.0922  -0.0209 -0.0613 5   ARG B CG  
3285 C CD  . ARG B 5   ? 0.4567 0.4939 0.8460 0.0958  -0.0171 -0.0700 5   ARG B CD  
3286 N NE  . ARG B 5   ? 0.4541 0.4763 0.8306 0.0901  -0.0161 -0.0701 5   ARG B NE  
3287 C CZ  . ARG B 5   ? 0.6433 0.6528 1.0150 0.0899  -0.0216 -0.0599 5   ARG B CZ  
3288 N NH1 . ARG B 5   ? 0.4309 0.4403 0.8071 0.0944  -0.0286 -0.0480 5   ARG B NH1 
3289 N NH2 . ARG B 5   ? 0.6409 0.6383 1.0025 0.0844  -0.0201 -0.0614 5   ARG B NH2 
3290 N N   . PHE B 6   ? 0.3061 0.3660 0.6542 0.0836  -0.0335 -0.0350 6   PHE B N   
3291 C CA  . PHE B 6   ? 0.3010 0.3530 0.6327 0.0780  -0.0359 -0.0269 6   PHE B CA  
3292 C C   . PHE B 6   ? 0.3373 0.3970 0.6626 0.0764  -0.0407 -0.0179 6   PHE B C   
3293 O O   . PHE B 6   ? 0.3273 0.3799 0.6434 0.0739  -0.0440 -0.0097 6   PHE B O   
3294 C CB  . PHE B 6   ? 0.3164 0.3667 0.6343 0.0702  -0.0305 -0.0327 6   PHE B CB  
3295 C CG  . PHE B 6   ? 0.3425 0.3846 0.6631 0.0699  -0.0259 -0.0414 6   PHE B CG  
3296 C CD1 . PHE B 6   ? 0.3843 0.4338 0.7091 0.0693  -0.0200 -0.0526 6   PHE B CD1 
3297 C CD2 . PHE B 6   ? 0.3727 0.4002 0.6911 0.0693  -0.0272 -0.0390 6   PHE B CD2 
3298 C CE1 . PHE B 6   ? 0.4009 0.4433 0.7268 0.0681  -0.0154 -0.0616 6   PHE B CE1 
3299 C CE2 . PHE B 6   ? 0.4199 0.4400 0.7402 0.0682  -0.0229 -0.0480 6   PHE B CE2 
3300 C CZ  . PHE B 6   ? 0.3974 0.4250 0.7211 0.0676  -0.0170 -0.0594 6   PHE B CZ  
3301 N N   . ILE B 7   ? 0.2820 0.3565 0.6118 0.0771  -0.0408 -0.0200 7   ILE B N   
3302 C CA  . ILE B 7   ? 0.2690 0.3516 0.5917 0.0745  -0.0449 -0.0129 7   ILE B CA  
3303 C C   . ILE B 7   ? 0.3179 0.4037 0.6491 0.0799  -0.0527 -0.0043 7   ILE B C   
3304 O O   . ILE B 7   ? 0.3420 0.4249 0.6878 0.0871  -0.0553 -0.0036 7   ILE B O   
3305 C CB  . ILE B 7   ? 0.2966 0.3924 0.6145 0.0694  -0.0408 -0.0188 7   ILE B CB  
3306 C CG1 . ILE B 7   ? 0.2891 0.3991 0.6226 0.0736  -0.0399 -0.0250 7   ILE B CG1 
3307 C CG2 . ILE B 7   ? 0.3075 0.3979 0.6144 0.0633  -0.0344 -0.0247 7   ILE B CG2 
3308 C CD1 . ILE B 7   ? 0.2783 0.4023 0.6075 0.0683  -0.0373 -0.0285 7   ILE B CD1 
3309 N N   . THR B 8   ? 0.2387 0.3293 0.5602 0.0763  -0.0566 0.0028  8   THR B N   
3310 C CA  . THR B 8   ? 0.2287 0.3239 0.5556 0.0801  -0.0646 0.0117  8   THR B CA  
3311 C C   . THR B 8   ? 0.2683 0.3818 0.6044 0.0815  -0.0660 0.0080  8   THR B C   
3312 O O   . THR B 8   ? 0.2577 0.3792 0.5921 0.0777  -0.0602 -0.0003 8   THR B O   
3313 C CB  . THR B 8   ? 0.2644 0.3560 0.5748 0.0744  -0.0678 0.0206  8   THR B CB  
3314 O OG1 . THR B 8   ? 0.2790 0.3781 0.5779 0.0674  -0.0641 0.0168  8   THR B OG1 
3315 C CG2 . THR B 8   ? 0.2394 0.3144 0.5416 0.0726  -0.0665 0.0245  8   THR B CG2 
3316 N N   . ALA B 9   ? 0.2169 0.3375 0.5626 0.0863  -0.0738 0.0148  9   ALA B N   
3317 C CA  . ALA B 9   ? 0.2066 0.3459 0.5629 0.0879  -0.0770 0.0129  9   ALA B CA  
3318 C C   . ALA B 9   ? 0.2775 0.4261 0.6185 0.0792  -0.0764 0.0129  9   ALA B C   
3319 O O   . ALA B 9   ? 0.2726 0.4355 0.6182 0.0772  -0.0742 0.0066  9   ALA B O   
3320 C CB  . ALA B 9   ? 0.2255 0.3679 0.5940 0.0949  -0.0870 0.0223  9   ALA B CB  
3321 N N   . ALA B 10  ? 0.2488 0.3890 0.5721 0.0737  -0.0775 0.0193  10  ALA B N   
3322 C CA  . ALA B 10  ? 0.2465 0.3930 0.5546 0.0652  -0.0764 0.0191  10  ALA B CA  
3323 C C   . ALA B 10  ? 0.3266 0.4732 0.6294 0.0601  -0.0674 0.0094  10  ALA B C   
3324 O O   . ALA B 10  ? 0.3138 0.4714 0.6138 0.0551  -0.0658 0.0053  10  ALA B O   
3325 C CB  . ALA B 10  ? 0.2577 0.3939 0.5496 0.0609  -0.0784 0.0271  10  ALA B CB  
3326 N N   . SER B 11  ? 0.2996 0.4338 0.6014 0.0611  -0.0620 0.0060  11  SER B N   
3327 C CA  . SER B 11  ? 0.2955 0.4278 0.5918 0.0564  -0.0541 -0.0020 11  SER B CA  
3328 C C   . SER B 11  ? 0.3144 0.4601 0.6214 0.0570  -0.0511 -0.0101 11  SER B C   
3329 O O   . SER B 11  ? 0.3051 0.4572 0.6061 0.0509  -0.0475 -0.0142 11  SER B O   
3330 C CB  . SER B 11  ? 0.3644 0.4821 0.6592 0.0580  -0.0504 -0.0035 11  SER B CB  
3331 O OG  . SER B 11  ? 0.5284 0.6429 0.8142 0.0523  -0.0439 -0.0089 11  SER B OG  
3332 N N   . ALA B 12  ? 0.2407 0.3911 0.5646 0.0642  -0.0527 -0.0122 12  ALA B N   
3333 C CA  . ALA B 12  ? 0.2238 0.3881 0.5612 0.0657  -0.0495 -0.0204 12  ALA B CA  
3334 C C   . ALA B 12  ? 0.2679 0.4489 0.6070 0.0623  -0.0522 -0.0204 12  ALA B C   
3335 O O   . ALA B 12  ? 0.2687 0.4591 0.6088 0.0579  -0.0470 -0.0275 12  ALA B O   
3336 C CB  . ALA B 12  ? 0.2347 0.4001 0.5914 0.0750  -0.0516 -0.0215 12  ALA B CB  
3337 N N   . ALA B 13  ? 0.2064 0.3909 0.5448 0.0635  -0.0603 -0.0123 13  ALA B N   
3338 C CA  . ALA B 13  ? 0.1879 0.3881 0.5272 0.0601  -0.0647 -0.0110 13  ALA B CA  
3339 C C   . ALA B 13  ? 0.2287 0.4321 0.5545 0.0502  -0.0596 -0.0153 13  ALA B C   
3340 O O   . ALA B 13  ? 0.2222 0.4408 0.5531 0.0471  -0.0600 -0.0190 13  ALA B O   
3341 C CB  . ALA B 13  ? 0.1991 0.3980 0.5340 0.0615  -0.0740 -0.0004 13  ALA B CB  
3342 N N   . ARG B 14  ? 0.1805 0.3697 0.4901 0.0455  -0.0552 -0.0148 14  ARG B N   
3343 C CA  . ARG B 14  ? 0.1674 0.3556 0.4637 0.0366  -0.0503 -0.0181 14  ARG B CA  
3344 C C   . ARG B 14  ? 0.2153 0.4132 0.5170 0.0329  -0.0444 -0.0265 14  ARG B C   
3345 O O   . ARG B 14  ? 0.2167 0.4144 0.5261 0.0357  -0.0402 -0.0312 14  ARG B O   
3346 C CB  . ARG B 14  ? 0.1583 0.3289 0.4409 0.0342  -0.0462 -0.0165 14  ARG B CB  
3347 C CG  . ARG B 14  ? 0.2243 0.3857 0.4995 0.0358  -0.0509 -0.0085 14  ARG B CG  
3348 C CD  . ARG B 14  ? 0.3346 0.4812 0.5968 0.0322  -0.0465 -0.0077 14  ARG B CD  
3349 N NE  . ARG B 14  ? 0.3683 0.5049 0.6264 0.0349  -0.0499 -0.0006 14  ARG B NE  
3350 C CZ  . ARG B 14  ? 0.5132 0.6501 0.7638 0.0328  -0.0538 0.0050  14  ARG B CZ  
3351 N NH1 . ARG B 14  ? 0.3891 0.5359 0.6353 0.0279  -0.0551 0.0041  14  ARG B NH1 
3352 N NH2 . ARG B 14  ? 0.3797 0.5072 0.6267 0.0349  -0.0562 0.0115  14  ARG B NH2 
3353 N N   . ASN B 15  ? 0.1778 0.3845 0.4753 0.0260  -0.0440 -0.0285 15  ASN B N   
3354 C CA  . ASN B 15  ? 0.1879 0.4042 0.4894 0.0209  -0.0385 -0.0360 15  ASN B CA  
3355 C C   . ASN B 15  ? 0.3110 0.5194 0.5976 0.0119  -0.0333 -0.0377 15  ASN B C   
3356 O O   . ASN B 15  ? 0.3302 0.5307 0.6055 0.0093  -0.0351 -0.0338 15  ASN B O   
3357 C CB  . ASN B 15  ? 0.1402 0.3763 0.4532 0.0203  -0.0429 -0.0376 15  ASN B CB  
3358 C CG  . ASN B 15  ? 0.2659 0.5118 0.5962 0.0293  -0.0488 -0.0356 15  ASN B CG  
3359 O OD1 . ASN B 15  ? 0.2743 0.5233 0.6173 0.0342  -0.0458 -0.0398 15  ASN B OD1 
3360 N ND2 . ASN B 15  ? 0.0675 0.3197 0.3993 0.0311  -0.0575 -0.0296 15  ASN B ND2 
3361 N N   . PRO B 16  ? 0.3013 0.5112 0.5875 0.0067  -0.0266 -0.0434 16  PRO B N   
3362 C CA  . PRO B 16  ? 0.3156 0.5172 0.5888 -0.0016 -0.0223 -0.0442 16  PRO B CA  
3363 C C   . PRO B 16  ? 0.4062 0.6175 0.6784 -0.0076 -0.0245 -0.0455 16  PRO B C   
3364 O O   . PRO B 16  ? 0.4193 0.6467 0.7020 -0.0067 -0.0279 -0.0473 16  PRO B O   
3365 C CB  . PRO B 16  ? 0.3376 0.5396 0.6119 -0.0053 -0.0153 -0.0492 16  PRO B CB  
3366 C CG  . PRO B 16  ? 0.3827 0.5924 0.6698 0.0014  -0.0152 -0.0518 16  PRO B CG  
3367 C CD  . PRO B 16  ? 0.3216 0.5410 0.6191 0.0077  -0.0224 -0.0493 16  PRO B CD  
3368 N N   . SER B 17  ? 0.3779 0.5800 0.6384 -0.0136 -0.0226 -0.0450 17  SER B N   
3369 C CA  . SER B 17  ? 0.3858 0.5955 0.6438 -0.0204 -0.0240 -0.0472 17  SER B CA  
3370 C C   . SER B 17  ? 0.4747 0.6991 0.7410 -0.0257 -0.0217 -0.0530 17  SER B C   
3371 O O   . SER B 17  ? 0.4707 0.6932 0.7386 -0.0281 -0.0160 -0.0559 17  SER B O   
3372 C CB  . SER B 17  ? 0.4180 0.6134 0.6632 -0.0262 -0.0204 -0.0471 17  SER B CB  
3373 O OG  . SER B 17  ? 0.5051 0.7070 0.7471 -0.0320 -0.0223 -0.0493 17  SER B OG  
3374 N N   . PRO B 18  ? 0.4531 0.6931 0.7246 -0.0284 -0.0262 -0.0548 18  PRO B N   
3375 C CA  . PRO B 18  ? 0.4606 0.7159 0.7412 -0.0342 -0.0240 -0.0607 18  PRO B CA  
3376 C C   . PRO B 18  ? 0.5495 0.7973 0.8217 -0.0444 -0.0174 -0.0647 18  PRO B C   
3377 O O   . PRO B 18  ? 0.5511 0.8072 0.8292 -0.0499 -0.0133 -0.0693 18  PRO B O   
3378 C CB  . PRO B 18  ? 0.4814 0.7539 0.7682 -0.0343 -0.0318 -0.0605 18  PRO B CB  
3379 C CG  . PRO B 18  ? 0.5343 0.7970 0.8089 -0.0336 -0.0359 -0.0559 18  PRO B CG  
3380 C CD  . PRO B 18  ? 0.4725 0.7175 0.7414 -0.0270 -0.0337 -0.0514 18  PRO B CD  
3381 N N   . ILE B 19  ? 0.5259 0.7579 0.7851 -0.0471 -0.0162 -0.0628 19  ILE B N   
3382 C CA  . ILE B 19  ? 0.5317 0.7530 0.7829 -0.0559 -0.0103 -0.0659 19  ILE B CA  
3383 C C   . ILE B 19  ? 0.5654 0.7712 0.8126 -0.0551 -0.0044 -0.0638 19  ILE B C   
3384 O O   . ILE B 19  ? 0.5434 0.7353 0.7845 -0.0502 -0.0046 -0.0595 19  ILE B O   
3385 C CB  . ILE B 19  ? 0.5781 0.7922 0.8195 -0.0597 -0.0117 -0.0662 19  ILE B CB  
3386 C CG1 . ILE B 19  ? 0.5849 0.7858 0.8191 -0.0528 -0.0135 -0.0608 19  ILE B CG1 
3387 C CG2 . ILE B 19  ? 0.5867 0.8189 0.8317 -0.0629 -0.0174 -0.0690 19  ILE B CG2 
3388 C CD1 . ILE B 19  ? 0.6627 0.8577 0.8874 -0.0558 -0.0146 -0.0613 19  ILE B CD1 
3389 N N   . ARG B 20  ? 0.5353 0.7450 0.7863 -0.0601 0.0005  -0.0668 20  ARG B N   
3390 C CA  . ARG B 20  ? 0.5442 0.7416 0.7908 -0.0607 0.0058  -0.0647 20  ARG B CA  
3391 C C   . ARG B 20  ? 0.6038 0.7822 0.8402 -0.0662 0.0095  -0.0630 20  ARG B C   
3392 O O   . ARG B 20  ? 0.5980 0.7755 0.8329 -0.0736 0.0111  -0.0661 20  ARG B O   
3393 C CB  . ARG B 20  ? 0.5553 0.7648 0.8091 -0.0645 0.0099  -0.0684 20  ARG B CB  
3394 C CG  . ARG B 20  ? 0.6701 0.8949 0.9352 -0.0570 0.0074  -0.0696 20  ARG B CG  
3395 C CD  . ARG B 20  ? 0.8183 1.0334 1.0806 -0.0486 0.0067  -0.0656 20  ARG B CD  
3396 N NE  . ARG B 20  ? 1.0613 1.2877 1.3342 -0.0396 0.0018  -0.0657 20  ARG B NE  
3397 C CZ  . ARG B 20  ? 1.3357 1.5542 1.6073 -0.0312 -0.0014 -0.0618 20  ARG B CZ  
3398 N NH1 . ARG B 20  ? 1.1823 1.3828 1.4424 -0.0306 -0.0004 -0.0576 20  ARG B NH1 
3399 N NH2 . ARG B 20  ? 1.2089 1.4374 1.4913 -0.0233 -0.0059 -0.0617 20  ARG B NH2 
3400 N N   . THR B 21  ? 0.5722 0.7353 0.8024 -0.0625 0.0105  -0.0581 21  THR B N   
3401 C CA  . THR B 21  ? 0.5832 0.7274 0.8054 -0.0660 0.0133  -0.0552 21  THR B CA  
3402 C C   . THR B 21  ? 0.6593 0.7945 0.8773 -0.0668 0.0163  -0.0513 21  THR B C   
3403 O O   . THR B 21  ? 0.6630 0.8072 0.8837 -0.0646 0.0166  -0.0517 21  THR B O   
3404 C CB  . THR B 21  ? 0.5954 0.7287 0.8139 -0.0606 0.0104  -0.0525 21  THR B CB  
3405 O OG1 . THR B 21  ? 0.5411 0.6725 0.7593 -0.0523 0.0076  -0.0484 21  THR B OG1 
3406 C CG2 . THR B 21  ? 0.5264 0.6673 0.7462 -0.0616 0.0079  -0.0563 21  THR B CG2 
3407 N N   . MET B 22  ? 0.6252 0.7433 0.8370 -0.0701 0.0184  -0.0475 22  MET B N   
3408 C CA  . MET B 22  ? 0.6360 0.7442 0.8420 -0.0718 0.0203  -0.0424 22  MET B CA  
3409 C C   . MET B 22  ? 0.7111 0.8008 0.9123 -0.0759 0.0218  -0.0381 22  MET B C   
3410 O O   . MET B 22  ? 0.7183 0.8045 0.9211 -0.0807 0.0234  -0.0408 22  MET B O   
3411 C CB  . MET B 22  ? 0.6712 0.7898 0.8775 -0.0782 0.0242  -0.0448 22  MET B CB  
3412 C CG  . MET B 22  ? 0.7251 0.8481 0.9339 -0.0874 0.0277  -0.0489 22  MET B CG  
3413 S SD  . MET B 22  ? 0.7913 0.9223 0.9984 -0.0965 0.0334  -0.0500 22  MET B SD  
3414 C CE  . MET B 22  ? 0.7551 0.8923 0.9673 -0.1065 0.0365  -0.0557 22  MET B CE  
3415 N N   . THR B 23  ? 0.6677 0.7460 0.8632 -0.0750 0.0212  -0.0315 23  THR B N   
3416 C CA  . THR B 23  ? 0.6742 0.7349 0.8663 -0.0789 0.0221  -0.0263 23  THR B CA  
3417 C C   . THR B 23  ? 0.7284 0.7884 0.9172 -0.0893 0.0263  -0.0260 23  THR B C   
3418 O O   . THR B 23  ? 0.7052 0.7733 0.8903 -0.0925 0.0280  -0.0256 23  THR B O   
3419 C CB  . THR B 23  ? 0.7451 0.7931 0.9339 -0.0735 0.0186  -0.0188 23  THR B CB  
3420 O OG1 . THR B 23  ? 0.7599 0.8070 0.9414 -0.0767 0.0187  -0.0140 23  THR B OG1 
3421 C CG2 . THR B 23  ? 0.6873 0.7390 0.8792 -0.0641 0.0150  -0.0197 23  THR B CG2 
3422 N N   . ASP B 24  ? 0.7076 0.7584 0.8983 -0.0949 0.0285  -0.0268 24  ASP B N   
3423 C CA  . ASP B 24  ? 0.7252 0.7734 0.9140 -0.1057 0.0329  -0.0270 24  ASP B CA  
3424 C C   . ASP B 24  ? 0.8129 0.8557 0.9934 -0.1118 0.0344  -0.0200 24  ASP B C   
3425 O O   . ASP B 24  ? 0.8334 0.8886 1.0120 -0.1177 0.0377  -0.0229 24  ASP B O   
3426 C CB  . ASP B 24  ? 0.7588 0.7941 0.9514 -0.1094 0.0345  -0.0287 24  ASP B CB  
3427 C CG  . ASP B 24  ? 0.9398 0.9792 1.1340 -0.1202 0.0392  -0.0337 24  ASP B CG  
3428 O OD1 . ASP B 24  ? 0.9718 1.0028 1.1699 -0.1234 0.0409  -0.0372 24  ASP B OD1 
3429 O OD2 . ASP B 24  ? 1.0160 1.0676 1.2080 -0.1257 0.0416  -0.0349 24  ASP B OD2 
3430 N N   . ILE B 25  ? 0.7689 0.7937 0.9448 -0.1114 0.0322  -0.0110 25  ILE B N   
3431 C CA  . ILE B 25  ? 0.7720 0.7898 0.9382 -0.1179 0.0327  -0.0027 25  ILE B CA  
3432 C C   . ILE B 25  ? 0.8198 0.8356 0.9830 -0.1306 0.0380  -0.0025 25  ILE B C   
3433 O O   . ILE B 25  ? 0.8309 0.8312 0.9881 -0.1360 0.0377  0.0062  25  ILE B O   
3434 C CB  . ILE B 25  ? 0.8041 0.8316 0.9633 -0.1145 0.0308  -0.0007 25  ILE B CB  
3435 C CG1 . ILE B 25  ? 0.8024 0.8225 0.9625 -0.1042 0.0248  0.0037  25  ILE B CG1 
3436 C CG2 . ILE B 25  ? 0.8244 0.8495 0.9717 -0.1236 0.0327  0.0058  25  ILE B CG2 
3437 C CD1 . ILE B 25  ? 0.9165 0.9507 1.0787 -0.0964 0.0232  -0.0014 25  ILE B CD1 
3438 N N   . LEU B 26  ? 0.7622 0.7931 0.9299 -0.1353 0.0424  -0.0117 26  LEU B N   
3439 C CA  . LEU B 26  ? 0.7687 0.8008 0.9352 -0.1477 0.0480  -0.0132 26  LEU B CA  
3440 C C   . LEU B 26  ? 0.8652 0.8814 1.0361 -0.1527 0.0493  -0.0130 26  LEU B C   
3441 O O   . LEU B 26  ? 0.8610 0.8749 1.0303 -0.1638 0.0538  -0.0131 26  LEU B O   
3442 C CB  . LEU B 26  ? 0.7524 0.8083 0.9246 -0.1504 0.0517  -0.0237 26  LEU B CB  
3443 C CG  . LEU B 26  ? 0.8031 0.8758 0.9711 -0.1517 0.0540  -0.0251 26  LEU B CG  
3444 C CD1 . LEU B 26  ? 0.7989 0.8925 0.9746 -0.1573 0.0588  -0.0348 26  LEU B CD1 
3445 C CD2 . LEU B 26  ? 0.8434 0.9069 0.9987 -0.1596 0.0561  -0.0165 26  LEU B CD2 
3446 N N   . SER B 27  ? 0.8655 0.8712 1.0424 -0.1450 0.0461  -0.0137 27  SER B N   
3447 C CA  . SER B 27  ? 0.8939 0.8846 1.0763 -0.1492 0.0480  -0.0153 27  SER B CA  
3448 C C   . SER B 27  ? 0.9959 0.9616 1.1780 -0.1470 0.0453  -0.0055 27  SER B C   
3449 O O   . SER B 27  ? 0.9820 0.9412 1.1576 -0.1444 0.0419  0.0043  27  SER B O   
3450 C CB  . SER B 27  ? 0.9279 0.9271 1.1192 -0.1446 0.0480  -0.0260 27  SER B CB  
3451 O OG  . SER B 27  ? 1.0510 1.0666 1.2450 -0.1522 0.0517  -0.0348 27  SER B OG  
3452 N N   . ARG B 28  ? 1.0047 0.9568 1.1943 -0.1489 0.0472  -0.0088 28  ARG B N   
3453 C CA  . ARG B 28  ? 1.0370 0.9648 1.2313 -0.1465 0.0458  -0.0027 28  ARG B CA  
3454 C C   . ARG B 28  ? 1.1195 1.0345 1.3090 -0.1421 0.0405  0.0112  28  ARG B C   
3455 O O   . ARG B 28  ? 1.1412 1.0432 1.3256 -0.1492 0.0405  0.0206  28  ARG B O   
3456 C CB  . ARG B 28  ? 1.0532 0.9791 1.2578 -0.1387 0.0457  -0.0114 28  ARG B CB  
3457 C CG  . ARG B 28  ? 1.2052 1.1467 1.4101 -0.1279 0.0422  -0.0147 28  ARG B CG  
3458 C CD  . ARG B 28  ? 1.3591 1.3069 1.5710 -0.1243 0.0439  -0.0262 28  ARG B CD  
3459 N NE  . ARG B 28  ? 1.4382 1.3999 1.6495 -0.1147 0.0403  -0.0280 28  ARG B NE  
3460 C CZ  . ARG B 28  ? 1.5566 1.5390 1.7645 -0.1143 0.0397  -0.0327 28  ARG B CZ  
3461 N NH1 . ARG B 28  ? 1.3959 1.3894 1.6013 -0.1228 0.0424  -0.0365 28  ARG B NH1 
3462 N NH2 . ARG B 28  ? 1.2956 1.2878 1.5034 -0.1054 0.0363  -0.0334 28  ARG B NH2 
3463 N N   . GLY B 29  ? 1.0590 0.9785 1.2499 -0.1310 0.0358  0.0125  29  GLY B N   
3464 C CA  . GLY B 29  ? 1.0586 0.9691 1.2463 -0.1253 0.0298  0.0244  29  GLY B CA  
3465 C C   . GLY B 29  ? 1.0814 1.0019 1.2720 -0.1138 0.0260  0.0217  29  GLY B C   
3466 O O   . GLY B 29  ? 1.0746 1.0067 1.2573 -0.1118 0.0233  0.0244  29  GLY B O   
3467 N N   . PRO B 30  ? 1.0141 0.9310 1.2158 -0.1063 0.0261  0.0159  30  PRO B N   
3468 C CA  . PRO B 30  ? 0.9790 0.9056 1.1832 -0.0959 0.0226  0.0138  30  PRO B CA  
3469 C C   . PRO B 30  ? 0.9636 0.9118 1.1641 -0.0956 0.0246  0.0044  30  PRO B C   
3470 O O   . PRO B 30  ? 0.9603 0.9147 1.1641 -0.0984 0.0286  -0.0051 30  PRO B O   
3471 C CB  . PRO B 30  ? 1.0030 0.9181 1.2200 -0.0896 0.0232  0.0105  30  PRO B CB  
3472 C CG  . PRO B 30  ? 1.0763 0.9827 1.2975 -0.0971 0.0287  0.0049  30  PRO B CG  
3473 C CD  . PRO B 30  ? 1.0402 0.9441 1.2526 -0.1074 0.0297  0.0105  30  PRO B CD  
3474 N N   . LYS B 31  ? 0.8657 0.8253 1.0592 -0.0926 0.0215  0.0073  31  LYS B N   
3475 C CA  . LYS B 31  ? 0.8284 0.8080 1.0196 -0.0914 0.0226  -0.0004 31  LYS B CA  
3476 C C   . LYS B 31  ? 0.8364 0.8217 1.0342 -0.0825 0.0213  -0.0062 31  LYS B C   
3477 O O   . LYS B 31  ? 0.8290 0.8070 1.0304 -0.0755 0.0181  -0.0024 31  LYS B O   
3478 C CB  . LYS B 31  ? 0.8476 0.8369 1.0294 -0.0927 0.0210  0.0037  31  LYS B CB  
3479 C CG  . LYS B 31  ? 0.9488 0.9488 1.1300 -0.0842 0.0176  0.0024  31  LYS B CG  
3480 C CD  . LYS B 31  ? 0.9700 0.9597 1.1504 -0.0784 0.0123  0.0109  31  LYS B CD  
3481 C CE  . LYS B 31  ? 0.9866 0.9858 1.1680 -0.0702 0.0093  0.0088  31  LYS B CE  
3482 N NZ  . LYS B 31  ? 1.0641 1.0756 1.2376 -0.0719 0.0094  0.0079  31  LYS B NZ  
3483 N N   . SER B 32  ? 0.7611 0.7598 0.9606 -0.0835 0.0238  -0.0154 32  SER B N   
3484 C CA  . SER B 32  ? 0.7294 0.7362 0.9333 -0.0771 0.0230  -0.0216 32  SER B CA  
3485 C C   . SER B 32  ? 0.7276 0.7538 0.9296 -0.0789 0.0237  -0.0279 32  SER B C   
3486 O O   . SER B 32  ? 0.7196 0.7514 0.9194 -0.0860 0.0261  -0.0294 32  SER B O   
3487 C CB  . SER B 32  ? 0.7813 0.7796 0.9913 -0.0784 0.0259  -0.0269 32  SER B CB  
3488 O OG  . SER B 32  ? 0.9479 0.9498 1.1577 -0.0870 0.0297  -0.0329 32  SER B OG  
3489 N N   . MET B 33  ? 0.6503 0.6868 0.8541 -0.0726 0.0215  -0.0314 33  MET B N   
3490 C CA  . MET B 33  ? 0.6269 0.6817 0.8307 -0.0733 0.0213  -0.0367 33  MET B CA  
3491 C C   . MET B 33  ? 0.6726 0.7342 0.8790 -0.0795 0.0238  -0.0444 33  MET B C   
3492 O O   . MET B 33  ? 0.6633 0.7168 0.8715 -0.0811 0.0254  -0.0474 33  MET B O   
3493 C CB  . MET B 33  ? 0.6381 0.7022 0.8423 -0.0648 0.0174  -0.0362 33  MET B CB  
3494 C CG  . MET B 33  ? 0.6737 0.7447 0.8805 -0.0620 0.0162  -0.0412 33  MET B CG  
3495 S SD  . MET B 33  ? 0.7039 0.7926 0.9120 -0.0558 0.0121  -0.0423 33  MET B SD  
3496 C CE  . MET B 33  ? 0.6601 0.7565 0.8694 -0.0573 0.0115  -0.0484 33  MET B CE  
3497 N N   . ILE B 34  ? 0.6302 0.7070 0.8374 -0.0835 0.0244  -0.0479 34  ILE B N   
3498 C CA  . ILE B 34  ? 0.6324 0.7193 0.8424 -0.0901 0.0261  -0.0552 34  ILE B CA  
3499 C C   . ILE B 34  ? 0.6979 0.8055 0.9111 -0.0866 0.0227  -0.0587 34  ILE B C   
3500 O O   . ILE B 34  ? 0.6797 0.7939 0.8935 -0.0812 0.0207  -0.0558 34  ILE B O   
3501 C CB  . ILE B 34  ? 0.6748 0.7601 0.8845 -0.1002 0.0303  -0.0559 34  ILE B CB  
3502 C CG1 . ILE B 34  ? 0.6669 0.7596 0.8750 -0.1006 0.0308  -0.0523 34  ILE B CG1 
3503 C CG2 . ILE B 34  ? 0.6914 0.7553 0.8993 -0.1044 0.0333  -0.0531 34  ILE B CG2 
3504 C CD1 . ILE B 34  ? 0.6874 0.7933 0.8983 -0.1090 0.0340  -0.0568 34  ILE B CD1 
3505 N N   . SER B 35  ? 0.6833 0.8009 0.8989 -0.0898 0.0220  -0.0650 35  SER B N   
3506 C CA  . SER B 35  ? 0.6869 0.8247 0.9067 -0.0870 0.0180  -0.0678 35  SER B CA  
3507 C C   . SER B 35  ? 0.7516 0.9039 0.9764 -0.0949 0.0197  -0.0726 35  SER B C   
3508 O O   . SER B 35  ? 0.7429 0.8922 0.9673 -0.1037 0.0228  -0.0769 35  SER B O   
3509 C CB  . SER B 35  ? 0.7399 0.8811 0.9583 -0.0850 0.0147  -0.0706 35  SER B CB  
3510 O OG  . SER B 35  ? 0.8981 1.0374 1.1154 -0.0936 0.0174  -0.0767 35  SER B OG  
3511 N N   . LEU B 36  ? 0.7138 0.8817 0.9443 -0.0919 0.0181  -0.0724 36  LEU B N   
3512 C CA  . LEU B 36  ? 0.7148 0.8993 0.9523 -0.0985 0.0198  -0.0771 36  LEU B CA  
3513 C C   . LEU B 36  ? 0.7569 0.9589 1.0002 -0.1011 0.0161  -0.0827 36  LEU B C   
3514 O O   . LEU B 36  ? 0.7612 0.9787 1.0119 -0.1070 0.0171  -0.0871 36  LEU B O   
3515 C CB  . LEU B 36  ? 0.7123 0.9062 0.9546 -0.0947 0.0207  -0.0754 36  LEU B CB  
3516 C CG  . LEU B 36  ? 0.7737 0.9544 1.0101 -0.0978 0.0261  -0.0716 36  LEU B CG  
3517 C CD1 . LEU B 36  ? 0.7677 0.9485 1.0036 -0.0894 0.0251  -0.0679 36  LEU B CD1 
3518 C CD2 . LEU B 36  ? 0.7980 0.9860 1.0371 -0.1083 0.0315  -0.0751 36  LEU B CD2 
3519 N N   . ALA B 37  ? 0.6925 0.8923 0.9321 -0.0978 0.0118  -0.0827 37  ALA B N   
3520 C CA  . ALA B 37  ? 0.6824 0.8978 0.9251 -0.1010 0.0074  -0.0876 37  ALA B CA  
3521 C C   . ALA B 37  ? 0.6968 0.9055 0.9345 -0.1114 0.0104  -0.0933 37  ALA B C   
3522 O O   . ALA B 37  ? 0.7086 0.9274 0.9511 -0.1199 0.0121  -0.0984 37  ALA B O   
3523 C CB  . ALA B 37  ? 0.6896 0.9106 0.9315 -0.0921 0.0005  -0.0844 37  ALA B CB  
3524 N N   . GLY B 38  ? 0.6133 0.8054 0.8425 -0.1114 0.0117  -0.0934 38  GLY B N   
3525 C CA  . GLY B 38  ? 0.5942 0.7732 0.8176 -0.1026 0.0106  -0.0881 38  GLY B CA  
3526 C C   . GLY B 38  ? 0.6183 0.7880 0.8344 -0.1051 0.0114  -0.0916 38  GLY B C   
3527 O O   . GLY B 38  ? 0.6210 0.7839 0.8355 -0.1137 0.0157  -0.0974 38  GLY B O   
3528 N N   . GLY B 39  ? 0.5319 0.7007 0.7439 -0.0979 0.0078  -0.0883 39  GLY B N   
3529 C CA  . GLY B 39  ? 0.5088 0.6716 0.7135 -0.1003 0.0086  -0.0921 39  GLY B CA  
3530 C C   . GLY B 39  ? 0.5030 0.6454 0.7042 -0.0962 0.0129  -0.0898 39  GLY B C   
3531 O O   . GLY B 39  ? 0.5098 0.6502 0.7057 -0.0933 0.0119  -0.0897 39  GLY B O   
3532 N N   . LEU B 40  ? 0.4016 0.5294 0.6058 -0.0964 0.0176  -0.0879 40  LEU B N   
3533 C CA  . LEU B 40  ? 0.3705 0.4790 0.5735 -0.0924 0.0213  -0.0854 40  LEU B CA  
3534 C C   . LEU B 40  ? 0.4177 0.5173 0.6183 -0.0989 0.0261  -0.0934 40  LEU B C   
3535 O O   . LEU B 40  ? 0.4127 0.5130 0.6143 -0.1077 0.0289  -0.0995 40  LEU B O   
3536 C CB  . LEU B 40  ? 0.3587 0.4544 0.5654 -0.0910 0.0239  -0.0801 40  LEU B CB  
3537 C CG  . LEU B 40  ? 0.3848 0.4865 0.5935 -0.0854 0.0206  -0.0731 40  LEU B CG  
3538 C CD1 . LEU B 40  ? 0.3708 0.4574 0.5806 -0.0849 0.0234  -0.0679 40  LEU B CD1 
3539 C CD2 . LEU B 40  ? 0.4013 0.5078 0.6086 -0.0762 0.0161  -0.0686 40  LEU B CD2 
3540 N N   . PRO B 41  ? 0.3636 0.4557 0.5614 -0.0953 0.0277  -0.0942 41  PRO B N   
3541 C CA  . PRO B 41  ? 0.3649 0.4486 0.5610 -0.1014 0.0333  -0.1030 41  PRO B CA  
3542 C C   . PRO B 41  ? 0.4044 0.4695 0.6067 -0.1039 0.0390  -0.1040 41  PRO B C   
3543 O O   . PRO B 41  ? 0.3870 0.4437 0.5936 -0.0988 0.0383  -0.0962 41  PRO B O   
3544 C CB  . PRO B 41  ? 0.3845 0.4647 0.5774 -0.0956 0.0338  -0.1022 41  PRO B CB  
3545 C CG  . PRO B 41  ? 0.4361 0.5141 0.6319 -0.0860 0.0303  -0.0920 41  PRO B CG  
3546 C CD  . PRO B 41  ? 0.3776 0.4680 0.5742 -0.0859 0.0251  -0.0876 41  PRO B CD  
3547 N N   . ASN B 42  ? 0.3630 0.4218 0.5657 -0.1121 0.0443  -0.1133 42  ASN B N   
3548 C CA  . ASN B 42  ? 0.3759 0.4156 0.5853 -0.1147 0.0496  -0.1141 42  ASN B CA  
3549 C C   . ASN B 42  ? 0.4436 0.4664 0.6583 -0.1066 0.0522  -0.1102 42  ASN B C   
3550 O O   . ASN B 42  ? 0.4479 0.4689 0.6618 -0.1049 0.0550  -0.1154 42  ASN B O   
3551 C CB  . ASN B 42  ? 0.3983 0.4349 0.6077 -0.1255 0.0547  -0.1254 42  ASN B CB  
3552 C CG  . ASN B 42  ? 0.7477 0.7673 0.9640 -0.1296 0.0587  -0.1245 42  ASN B CG  
3553 O OD1 . ASN B 42  ? 0.6785 0.6798 0.9012 -0.1250 0.0616  -0.1209 42  ASN B OD1 
3554 N ND2 . ASN B 42  ? 0.6801 0.7058 0.8958 -0.1384 0.0586  -0.1271 42  ASN B ND2 
3555 N N   . PRO B 43  ? 0.3813 0.3930 0.6014 -0.1018 0.0512  -0.1009 43  PRO B N   
3556 C CA  . PRO B 43  ? 0.3795 0.3762 0.6062 -0.0940 0.0527  -0.0966 43  PRO B CA  
3557 C C   . PRO B 43  ? 0.4336 0.4124 0.6683 -0.0968 0.0596  -0.1033 43  PRO B C   
3558 O O   . PRO B 43  ? 0.4111 0.3801 0.6524 -0.0906 0.0617  -0.1026 43  PRO B O   
3559 C CB  . PRO B 43  ? 0.3938 0.3862 0.6223 -0.0896 0.0485  -0.0846 43  PRO B CB  
3560 C CG  . PRO B 43  ? 0.4478 0.4442 0.6737 -0.0977 0.0483  -0.0851 43  PRO B CG  
3561 C CD  . PRO B 43  ? 0.3898 0.4023 0.6103 -0.1041 0.0487  -0.0943 43  PRO B CD  
3562 N N   . ASN B 44  ? 0.4222 0.3970 0.6572 -0.1062 0.0633  -0.1105 44  ASN B N   
3563 C CA  . ASN B 44  ? 0.4472 0.4044 0.6903 -0.1097 0.0704  -0.1183 44  ASN B CA  
3564 C C   . ASN B 44  ? 0.5158 0.4773 0.7571 -0.1111 0.0753  -0.1305 44  ASN B C   
3565 O O   . ASN B 44  ? 0.5312 0.4794 0.7795 -0.1139 0.0822  -0.1393 44  ASN B O   
3566 C CB  . ASN B 44  ? 0.4701 0.4206 0.7140 -0.1199 0.0730  -0.1219 44  ASN B CB  
3567 C CG  . ASN B 44  ? 0.8357 0.7801 1.0811 -0.1196 0.0694  -0.1100 44  ASN B CG  
3568 O OD1 . ASN B 44  ? 0.8022 0.7315 1.0545 -0.1136 0.0686  -0.1013 44  ASN B OD1 
3569 N ND2 . ASN B 44  ? 0.7210 0.6774 0.9600 -0.1266 0.0672  -0.1096 44  ASN B ND2 
3570 N N   . MET B 45  ? 0.4589 0.4382 0.6912 -0.1089 0.0719  -0.1308 45  MET B N   
3571 C CA  . MET B 45  ? 0.4572 0.4435 0.6848 -0.1105 0.0757  -0.1409 45  MET B CA  
3572 C C   . MET B 45  ? 0.4750 0.4593 0.7063 -0.1007 0.0760  -0.1367 45  MET B C   
3573 O O   . MET B 45  ? 0.4615 0.4472 0.6916 -0.1015 0.0810  -0.1452 45  MET B O   
3574 C CB  . MET B 45  ? 0.4863 0.4947 0.7004 -0.1158 0.0712  -0.1434 45  MET B CB  
3575 C CG  . MET B 45  ? 0.5474 0.5611 0.7579 -0.1265 0.0710  -0.1492 45  MET B CG  
3576 S SD  . MET B 45  ? 0.6263 0.6287 0.8390 -0.1370 0.0807  -0.1660 45  MET B SD  
3577 C CE  . MET B 45  ? 0.5978 0.5807 0.8220 -0.1394 0.0828  -0.1623 45  MET B CE  
3578 N N   . PHE B 46  ? 0.4193 0.4013 0.6547 -0.0921 0.0707  -0.1241 46  PHE B N   
3579 C CA  . PHE B 46  ? 0.3940 0.3749 0.6336 -0.0827 0.0699  -0.1186 46  PHE B CA  
3580 C C   . PHE B 46  ? 0.4356 0.3995 0.6893 -0.0793 0.0765  -0.1226 46  PHE B C   
3581 O O   . PHE B 46  ? 0.4367 0.3857 0.6995 -0.0802 0.0784  -0.1219 46  PHE B O   
3582 C CB  . PHE B 46  ? 0.3977 0.3815 0.6371 -0.0757 0.0620  -0.1046 46  PHE B CB  
3583 C CG  . PHE B 46  ? 0.3988 0.4001 0.6266 -0.0772 0.0556  -0.1006 46  PHE B CG  
3584 C CD1 . PHE B 46  ? 0.4257 0.4416 0.6434 -0.0819 0.0555  -0.1072 46  PHE B CD1 
3585 C CD2 . PHE B 46  ? 0.4128 0.4162 0.6399 -0.0739 0.0496  -0.0903 46  PHE B CD2 
3586 C CE1 . PHE B 46  ? 0.4237 0.4557 0.6330 -0.0826 0.0490  -0.1030 46  PHE B CE1 
3587 C CE2 . PHE B 46  ? 0.4324 0.4519 0.6510 -0.0746 0.0441  -0.0873 46  PHE B CE2 
3588 C CZ  . PHE B 46  ? 0.4075 0.4411 0.6182 -0.0786 0.0436  -0.0934 46  PHE B CZ  
3589 N N   . PRO B 47  ? 0.3861 0.3521 0.6424 -0.0758 0.0806  -0.1274 47  PRO B N   
3590 C CA  . PRO B 47  ? 0.3917 0.3425 0.6637 -0.0725 0.0879  -0.1329 47  PRO B CA  
3591 C C   . PRO B 47  ? 0.4497 0.3879 0.7369 -0.0630 0.0850  -0.1222 47  PRO B C   
3592 O O   . PRO B 47  ? 0.4532 0.3763 0.7554 -0.0610 0.0900  -0.1257 47  PRO B O   
3593 C CB  . PRO B 47  ? 0.4064 0.3663 0.6749 -0.0728 0.0933  -0.1416 47  PRO B CB  
3594 C CG  . PRO B 47  ? 0.4461 0.4226 0.7010 -0.0713 0.0862  -0.1340 47  PRO B CG  
3595 C CD  . PRO B 47  ? 0.3815 0.3635 0.6269 -0.0753 0.0794  -0.1285 47  PRO B CD  
3596 N N   . PHE B 48  ? 0.4020 0.3462 0.6859 -0.0573 0.0770  -0.1095 48  PHE B N   
3597 C CA  . PHE B 48  ? 0.4047 0.3385 0.7015 -0.0489 0.0731  -0.0987 48  PHE B CA  
3598 C C   . PHE B 48  ? 0.4420 0.3642 0.7407 -0.0511 0.0696  -0.0919 48  PHE B C   
3599 O O   . PHE B 48  ? 0.4329 0.3618 0.7194 -0.0564 0.0660  -0.0892 48  PHE B O   
3600 C CB  . PHE B 48  ? 0.4165 0.3612 0.7089 -0.0426 0.0665  -0.0891 48  PHE B CB  
3601 C CG  . PHE B 48  ? 0.4393 0.3966 0.7267 -0.0421 0.0696  -0.0952 48  PHE B CG  
3602 C CD1 . PHE B 48  ? 0.4920 0.4460 0.7913 -0.0387 0.0760  -0.1013 48  PHE B CD1 
3603 C CD2 . PHE B 48  ? 0.4662 0.4386 0.7374 -0.0454 0.0664  -0.0949 48  PHE B CD2 
3604 C CE1 . PHE B 48  ? 0.5038 0.4696 0.7971 -0.0394 0.0795  -0.1069 48  PHE B CE1 
3605 C CE2 . PHE B 48  ? 0.5032 0.4865 0.7685 -0.0457 0.0691  -0.0995 48  PHE B CE2 
3606 C CZ  . PHE B 48  ? 0.4853 0.4652 0.7610 -0.0431 0.0758  -0.1055 48  PHE B CZ  
3607 N N   . LYS B 49  ? 0.3840 0.2890 0.6986 -0.0475 0.0710  -0.0892 49  LYS B N   
3608 C CA  . LYS B 49  ? 0.3812 0.2728 0.6980 -0.0507 0.0686  -0.0831 49  LYS B CA  
3609 C C   . LYS B 49  ? 0.4320 0.3163 0.7535 -0.0450 0.0608  -0.0675 49  LYS B C   
3610 O O   . LYS B 49  ? 0.4281 0.3111 0.7412 -0.0493 0.0565  -0.0602 49  LYS B O   
3611 C CB  . LYS B 49  ? 0.4012 0.2770 0.7287 -0.0549 0.0764  -0.0928 49  LYS B CB  
3612 C CG  . LYS B 49  ? 0.3415 0.2248 0.6605 -0.0635 0.0836  -0.1085 49  LYS B CG  
3613 C CD  . LYS B 49  ? 0.3810 0.2736 0.6834 -0.0726 0.0809  -0.1085 49  LYS B CD  
3614 C CE  . LYS B 49  ? 0.4911 0.3925 0.7851 -0.0813 0.0870  -0.1235 49  LYS B CE  
3615 N NZ  . LYS B 49  ? 0.6441 0.5602 0.9221 -0.0885 0.0828  -0.1224 49  LYS B NZ  
3616 N N   . THR B 50  ? 0.3724 0.2523 0.7076 -0.0361 0.0591  -0.0626 50  THR B N   
3617 C CA  . THR B 50  ? 0.3665 0.2404 0.7070 -0.0303 0.0509  -0.0477 50  THR B CA  
3618 C C   . THR B 50  ? 0.4317 0.3133 0.7800 -0.0216 0.0486  -0.0452 50  THR B C   
3619 O O   . THR B 50  ? 0.4312 0.3172 0.7862 -0.0195 0.0548  -0.0551 50  THR B O   
3620 C CB  . THR B 50  ? 0.4218 0.2745 0.7778 -0.0288 0.0507  -0.0426 50  THR B CB  
3621 O OG1 . THR B 50  ? 0.4647 0.3102 0.8401 -0.0233 0.0564  -0.0500 50  THR B OG1 
3622 C CG2 . THR B 50  ? 0.3748 0.2172 0.7249 -0.0378 0.0530  -0.0442 50  THR B CG2 
3623 N N   . ALA B 51  ? 0.3954 0.2789 0.7430 -0.0171 0.0401  -0.0323 51  ALA B N   
3624 C CA  . ALA B 51  ? 0.3930 0.2841 0.7483 -0.0093 0.0374  -0.0294 51  ALA B CA  
3625 C C   . ALA B 51  ? 0.4386 0.3228 0.8025 -0.0038 0.0288  -0.0154 51  ALA B C   
3626 O O   . ALA B 51  ? 0.4412 0.3208 0.7967 -0.0068 0.0229  -0.0058 51  ALA B O   
3627 C CB  . ALA B 51  ? 0.3889 0.2979 0.7283 -0.0105 0.0358  -0.0306 51  ALA B CB  
3628 N N   . VAL B 52  ? 0.3811 0.2659 0.7621 0.0039  0.0281  -0.0144 52  VAL B N   
3629 C CA  . VAL B 52  ? 0.3797 0.2603 0.7711 0.0099  0.0193  -0.0014 52  VAL B CA  
3630 C C   . VAL B 52  ? 0.3961 0.2897 0.7939 0.0159  0.0177  -0.0017 52  VAL B C   
3631 O O   . VAL B 52  ? 0.3915 0.2878 0.8030 0.0194  0.0243  -0.0108 52  VAL B O   
3632 C CB  . VAL B 52  ? 0.4471 0.3092 0.8578 0.0132  0.0180  0.0038  52  VAL B CB  
3633 C CG1 . VAL B 52  ? 0.4594 0.3142 0.8863 0.0145  0.0284  -0.0094 52  VAL B CG1 
3634 C CG2 . VAL B 52  ? 0.4399 0.3007 0.8655 0.0210  0.0089  0.0160  52  VAL B CG2 
3635 N N   . ILE B 53  ? 0.3282 0.2303 0.7147 0.0160  0.0097  0.0072  53  ILE B N   
3636 C CA  . ILE B 53  ? 0.3230 0.2377 0.7126 0.0204  0.0068  0.0086  53  ILE B CA  
3637 C C   . ILE B 53  ? 0.4057 0.3172 0.8059 0.0254  -0.0034 0.0218  53  ILE B C   
3638 O O   . ILE B 53  ? 0.3925 0.2993 0.7826 0.0226  -0.0108 0.0320  53  ILE B O   
3639 C CB  . ILE B 53  ? 0.3443 0.2722 0.7118 0.0160  0.0060  0.0070  53  ILE B CB  
3640 C CG1 . ILE B 53  ? 0.3498 0.2814 0.7074 0.0111  0.0151  -0.0053 53  ILE B CG1 
3641 C CG2 . ILE B 53  ? 0.3126 0.2525 0.6824 0.0200  0.0024  0.0093  53  ILE B CG2 
3642 C CD1 . ILE B 53  ? 0.3624 0.3016 0.6982 0.0054  0.0138  -0.0053 53  ILE B CD1 
3643 N N   . THR B 54  ? 0.3861 0.3008 0.8067 0.0322  -0.0038 0.0214  54  THR B N   
3644 C CA  . THR B 54  ? 0.4023 0.3160 0.8356 0.0374  -0.0138 0.0334  54  THR B CA  
3645 C C   . THR B 54  ? 0.4750 0.4020 0.8964 0.0366  -0.0205 0.0385  54  THR B C   
3646 O O   . THR B 54  ? 0.4614 0.3995 0.8751 0.0353  -0.0159 0.0310  54  THR B O   
3647 C CB  . THR B 54  ? 0.4700 0.3814 0.9335 0.0454  -0.0114 0.0307  54  THR B CB  
3648 O OG1 . THR B 54  ? 0.3898 0.3139 0.8590 0.0472  -0.0045 0.0205  54  THR B OG1 
3649 C CG2 . THR B 54  ? 0.4698 0.3657 0.9463 0.0463  -0.0055 0.0264  54  THR B CG2 
3650 N N   . VAL B 55  ? 0.4594 0.3847 0.8782 0.0368  -0.0316 0.0515  55  VAL B N   
3651 C CA  . VAL B 55  ? 0.4576 0.3942 0.8655 0.0357  -0.0389 0.0570  55  VAL B CA  
3652 C C   . VAL B 55  ? 0.5540 0.4921 0.9787 0.0409  -0.0489 0.0673  55  VAL B C   
3653 O O   . VAL B 55  ? 0.5562 0.4843 0.9882 0.0422  -0.0555 0.0771  55  VAL B O   
3654 C CB  . VAL B 55  ? 0.4977 0.4344 0.8784 0.0283  -0.0423 0.0612  55  VAL B CB  
3655 C CG1 . VAL B 55  ? 0.4826 0.4297 0.8538 0.0271  -0.0503 0.0670  55  VAL B CG1 
3656 C CG2 . VAL B 55  ? 0.4929 0.4323 0.8587 0.0238  -0.0329 0.0503  55  VAL B CG2 
3657 N N   . GLU B 56  ? 0.5269 0.4779 0.9581 0.0435  -0.0502 0.0652  56  GLU B N   
3658 C CA  . GLU B 56  ? 0.5373 0.4942 0.9828 0.0476  -0.0601 0.0738  56  GLU B CA  
3659 C C   . GLU B 56  ? 0.6251 0.5846 1.0482 0.0419  -0.0697 0.0831  56  GLU B C   
3660 O O   . GLU B 56  ? 0.6297 0.5956 1.0330 0.0370  -0.0670 0.0784  56  GLU B O   
3661 C CB  . GLU B 56  ? 0.5424 0.5128 0.9997 0.0507  -0.0559 0.0661  56  GLU B CB  
3662 C CG  . GLU B 56  ? 0.7288 0.7072 1.2052 0.0553  -0.0649 0.0731  56  GLU B CG  
3663 C CD  . GLU B 56  ? 1.1577 1.1418 1.6628 0.0619  -0.0590 0.0662  56  GLU B CD  
3664 O OE1 . GLU B 56  ? 1.2260 1.2224 1.7334 0.0616  -0.0555 0.0601  56  GLU B OE1 
3665 O OE2 . GLU B 56  ? 1.0996 1.0759 1.6255 0.0672  -0.0575 0.0667  56  GLU B OE2 
3666 N N   . ASN B 57  ? 0.5931 0.5470 1.0186 0.0421  -0.0806 0.0960  57  ASN B N   
3667 C CA  . ASN B 57  ? 0.5912 0.5467 0.9951 0.0359  -0.0900 0.1054  57  ASN B CA  
3668 C C   . ASN B 57  ? 0.6278 0.5761 1.0060 0.0285  -0.0867 0.1050  57  ASN B C   
3669 O O   . ASN B 57  ? 0.6291 0.5822 0.9859 0.0224  -0.0901 0.1072  57  ASN B O   
3670 C CB  . ASN B 57  ? 0.5726 0.5426 0.9711 0.0345  -0.0947 0.1049  57  ASN B CB  
3671 C CG  . ASN B 57  ? 0.9044 0.8793 1.3187 0.0379  -0.1066 0.1151  57  ASN B CG  
3672 O OD1 . ASN B 57  ? 0.8770 0.8614 1.3099 0.0426  -0.1067 0.1118  57  ASN B OD1 
3673 N ND2 . ASN B 57  ? 0.7722 0.7415 1.1799 0.0353  -0.1172 0.1279  57  ASN B ND2 
3674 N N   . GLY B 58  ? 0.5657 0.5026 0.9474 0.0288  -0.0802 0.1023  58  GLY B N   
3675 C CA  . GLY B 58  ? 0.5575 0.4870 0.9186 0.0219  -0.0762 0.1015  58  GLY B CA  
3676 C C   . GLY B 58  ? 0.6037 0.5183 0.9754 0.0233  -0.0722 0.1021  58  GLY B C   
3677 O O   . GLY B 58  ? 0.6154 0.5257 1.0111 0.0301  -0.0712 0.1012  58  GLY B O   
3678 N N   . LYS B 59  ? 0.5390 0.4455 0.8939 0.0166  -0.0698 0.1033  59  LYS B N   
3679 C CA  . LYS B 59  ? 0.5376 0.4290 0.9009 0.0166  -0.0652 0.1030  59  LYS B CA  
3680 C C   . LYS B 59  ? 0.5691 0.4625 0.9386 0.0183  -0.0526 0.0872  59  LYS B C   
3681 O O   . LYS B 59  ? 0.5588 0.4644 0.9192 0.0173  -0.0482 0.0785  59  LYS B O   
3682 C CB  . LYS B 59  ? 0.5662 0.4496 0.9085 0.0077  -0.0664 0.1092  59  LYS B CB  
3683 C CG  . LYS B 59  ? 0.7238 0.5889 1.0760 0.0075  -0.0663 0.1151  59  LYS B CG  
3684 C CD  . LYS B 59  ? 0.8362 0.6939 1.1668 -0.0024 -0.0670 0.1213  59  LYS B CD  
3685 C CE  . LYS B 59  ? 0.9538 0.7945 1.2916 -0.0043 -0.0614 0.1203  59  LYS B CE  
3686 N NZ  . LYS B 59  ? 0.9764 0.8198 1.3116 -0.0064 -0.0490 0.1043  59  LYS B NZ  
3687 N N   . THR B 60  ? 0.5077 0.3891 0.8928 0.0209  -0.0472 0.0835  60  THR B N   
3688 C CA  . THR B 60  ? 0.4812 0.3639 0.8710 0.0214  -0.0352 0.0683  60  THR B CA  
3689 C C   . THR B 60  ? 0.4902 0.3738 0.8575 0.0130  -0.0294 0.0624  60  THR B C   
3690 O O   . THR B 60  ? 0.5103 0.3842 0.8683 0.0076  -0.0313 0.0686  60  THR B O   
3691 C CB  . THR B 60  ? 0.5874 0.4578 1.0022 0.0269  -0.0307 0.0649  60  THR B CB  
3692 O OG1 . THR B 60  ? 0.5526 0.4253 0.9689 0.0260  -0.0188 0.0495  60  THR B OG1 
3693 C CG2 . THR B 60  ? 0.6479 0.4998 1.0655 0.0247  -0.0339 0.0739  60  THR B CG2 
3694 N N   . ILE B 61  ? 0.3942 0.2900 0.7527 0.0116  -0.0229 0.0513  61  ILE B N   
3695 C CA  . ILE B 61  ? 0.3747 0.2744 0.7137 0.0043  -0.0176 0.0447  61  ILE B CA  
3696 C C   . ILE B 61  ? 0.4342 0.3245 0.7790 0.0021  -0.0088 0.0358  61  ILE B C   
3697 O O   . ILE B 61  ? 0.4352 0.3236 0.7963 0.0066  -0.0036 0.0284  61  ILE B O   
3698 C CB  . ILE B 61  ? 0.3862 0.3023 0.7158 0.0046  -0.0153 0.0375  61  ILE B CB  
3699 C CG1 . ILE B 61  ? 0.3828 0.3071 0.7008 0.0038  -0.0234 0.0456  61  ILE B CG1 
3700 C CG2 . ILE B 61  ? 0.3765 0.2974 0.6934 -0.0009 -0.0078 0.0273  61  ILE B CG2 
3701 C CD1 . ILE B 61  ? 0.3834 0.3210 0.7000 0.0067  -0.0232 0.0413  61  ILE B CD1 
3702 N N   . GLN B 62  ? 0.3921 0.2770 0.7244 -0.0053 -0.0069 0.0358  62  GLN B N   
3703 C CA  . GLN B 62  ? 0.4040 0.2799 0.7408 -0.0086 0.0012  0.0271  62  GLN B CA  
3704 C C   . GLN B 62  ? 0.4446 0.3271 0.7638 -0.0166 0.0060  0.0201  62  GLN B C   
3705 O O   . GLN B 62  ? 0.4559 0.3408 0.7603 -0.0219 0.0024  0.0261  62  GLN B O   
3706 C CB  . GLN B 62  ? 0.4457 0.3026 0.7920 -0.0094 -0.0009 0.0349  62  GLN B CB  
3707 C CG  . GLN B 62  ? 0.8444 0.6921 1.2150 -0.0009 -0.0023 0.0373  62  GLN B CG  
3708 C CD  . GLN B 62  ? 1.1377 0.9705 1.5151 0.0000  -0.0102 0.0520  62  GLN B CD  
3709 O OE1 . GLN B 62  ? 1.0605 0.8965 1.4316 0.0006  -0.0196 0.0643  62  GLN B OE1 
3710 N NE2 . GLN B 62  ? 1.0586 0.8742 1.4494 0.0000  -0.0068 0.0511  62  GLN B NE2 
3711 N N   . PHE B 63  ? 0.3786 0.2648 0.6997 -0.0178 0.0140  0.0072  63  PHE B N   
3712 C CA  . PHE B 63  ? 0.3623 0.2549 0.6689 -0.0255 0.0184  -0.0001 63  PHE B CA  
3713 C C   . PHE B 63  ? 0.4261 0.3051 0.7391 -0.0301 0.0244  -0.0057 63  PHE B C   
3714 O O   . PHE B 63  ? 0.4315 0.3064 0.7563 -0.0279 0.0303  -0.0147 63  PHE B O   
3715 C CB  . PHE B 63  ? 0.3650 0.2736 0.6658 -0.0249 0.0223  -0.0102 63  PHE B CB  
3716 C CG  . PHE B 63  ? 0.3701 0.2927 0.6628 -0.0216 0.0174  -0.0064 63  PHE B CG  
3717 C CD1 . PHE B 63  ? 0.4021 0.3239 0.6934 -0.0189 0.0098  0.0049  63  PHE B CD1 
3718 C CD2 . PHE B 63  ? 0.3877 0.3238 0.6746 -0.0213 0.0202  -0.0141 63  PHE B CD2 
3719 C CE1 . PHE B 63  ? 0.3963 0.3302 0.6809 -0.0161 0.0058  0.0074  63  PHE B CE1 
3720 C CE2 . PHE B 63  ? 0.4112 0.3586 0.6919 -0.0181 0.0158  -0.0106 63  PHE B CE2 
3721 C CZ  . PHE B 63  ? 0.3777 0.3237 0.6577 -0.0155 0.0089  -0.0004 63  PHE B CZ  
3722 N N   . GLY B 64  ? 0.3806 0.2521 0.6864 -0.0366 0.0229  -0.0002 64  GLY B N   
3723 C CA  . GLY B 64  ? 0.3912 0.2492 0.7013 -0.0425 0.0283  -0.0048 64  GLY B CA  
3724 C C   . GLY B 64  ? 0.4433 0.3108 0.7449 -0.0492 0.0351  -0.0180 64  GLY B C   
3725 O O   . GLY B 64  ? 0.4098 0.2941 0.7028 -0.0486 0.0352  -0.0228 64  GLY B O   
3726 N N   . GLU B 65  ? 0.4459 0.3026 0.7502 -0.0559 0.0403  -0.0235 65  GLU B N   
3727 C CA  . GLU B 65  ? 0.4580 0.3224 0.7554 -0.0634 0.0467  -0.0365 65  GLU B CA  
3728 C C   . GLU B 65  ? 0.5033 0.3873 0.7839 -0.0676 0.0444  -0.0368 65  GLU B C   
3729 O O   . GLU B 65  ? 0.4940 0.3923 0.7697 -0.0678 0.0466  -0.0458 65  GLU B O   
3730 C CB  . GLU B 65  ? 0.5007 0.3491 0.8019 -0.0714 0.0512  -0.0394 65  GLU B CB  
3731 C CG  . GLU B 65  ? 0.7301 0.5695 1.0432 -0.0718 0.0591  -0.0525 65  GLU B CG  
3732 C CD  . GLU B 65  ? 1.2287 1.0520 1.5611 -0.0634 0.0600  -0.0506 65  GLU B CD  
3733 O OE1 . GLU B 65  ? 1.2835 1.0995 1.6214 -0.0576 0.0536  -0.0373 65  GLU B OE1 
3734 O OE2 . GLU B 65  ? 1.1880 1.0061 1.5306 -0.0631 0.0673  -0.0629 65  GLU B OE2 
3735 N N   . GLU B 66  ? 0.4565 0.3412 0.7288 -0.0705 0.0397  -0.0267 66  GLU B N   
3736 C CA  . GLU B 66  ? 0.4365 0.3388 0.6947 -0.0744 0.0377  -0.0265 66  GLU B CA  
3737 C C   . GLU B 66  ? 0.4761 0.3925 0.7298 -0.0672 0.0330  -0.0233 66  GLU B C   
3738 O O   . GLU B 66  ? 0.4758 0.4086 0.7222 -0.0682 0.0333  -0.0288 66  GLU B O   
3739 C CB  . GLU B 66  ? 0.4572 0.3550 0.7082 -0.0819 0.0361  -0.0189 66  GLU B CB  
3740 C CG  . GLU B 66  ? 0.6025 0.4887 0.8565 -0.0908 0.0415  -0.0237 66  GLU B CG  
3741 C CD  . GLU B 66  ? 0.9014 0.7985 1.1529 -0.0971 0.0468  -0.0373 66  GLU B CD  
3742 O OE1 . GLU B 66  ? 0.8989 0.8149 1.1415 -0.0989 0.0457  -0.0401 66  GLU B OE1 
3743 O OE2 . GLU B 66  ? 0.7562 0.6428 1.0149 -0.1006 0.0519  -0.0451 66  GLU B OE2 
3744 N N   . MET B 67  ? 0.4057 0.3157 0.6648 -0.0599 0.0284  -0.0145 67  MET B N   
3745 C CA  . MET B 67  ? 0.3744 0.2957 0.6308 -0.0529 0.0239  -0.0111 67  MET B CA  
3746 C C   . MET B 67  ? 0.4014 0.3325 0.6606 -0.0492 0.0272  -0.0211 67  MET B C   
3747 O O   . MET B 67  ? 0.3856 0.3311 0.6378 -0.0472 0.0253  -0.0224 67  MET B O   
3748 C CB  . MET B 67  ? 0.4108 0.3220 0.6746 -0.0466 0.0187  -0.0006 67  MET B CB  
3749 C CG  . MET B 67  ? 0.4558 0.3780 0.7167 -0.0402 0.0136  0.0034  67  MET B CG  
3750 S SD  . MET B 67  ? 0.5101 0.4445 0.7541 -0.0440 0.0093  0.0088  67  MET B SD  
3751 C CE  . MET B 67  ? 0.4840 0.4058 0.7279 -0.0442 0.0029  0.0232  67  MET B CE  
3752 N N   . MET B 68  ? 0.3545 0.2773 0.6236 -0.0488 0.0324  -0.0284 68  MET B N   
3753 C CA  . MET B 68  ? 0.3322 0.2629 0.6034 -0.0468 0.0366  -0.0387 68  MET B CA  
3754 C C   . MET B 68  ? 0.3311 0.2760 0.5908 -0.0531 0.0386  -0.0464 68  MET B C   
3755 O O   . MET B 68  ? 0.3004 0.2583 0.5553 -0.0509 0.0380  -0.0497 68  MET B O   
3756 C CB  . MET B 68  ? 0.3738 0.2916 0.6583 -0.0461 0.0426  -0.0455 68  MET B CB  
3757 C CG  . MET B 68  ? 0.4237 0.3490 0.7111 -0.0435 0.0472  -0.0553 68  MET B CG  
3758 S SD  . MET B 68  ? 0.4792 0.4124 0.7700 -0.0340 0.0428  -0.0492 68  MET B SD  
3759 C CE  . MET B 68  ? 0.4513 0.3751 0.7600 -0.0295 0.0493  -0.0561 68  MET B CE  
3760 N N   . LYS B 69  ? 0.2722 0.2149 0.5277 -0.0610 0.0403  -0.0485 69  LYS B N   
3761 C CA  . LYS B 69  ? 0.2588 0.2158 0.5049 -0.0673 0.0415  -0.0554 69  LYS B CA  
3762 C C   . LYS B 69  ? 0.3014 0.2736 0.5389 -0.0648 0.0361  -0.0501 69  LYS B C   
3763 O O   . LYS B 69  ? 0.3189 0.3057 0.5510 -0.0652 0.0357  -0.0550 69  LYS B O   
3764 C CB  . LYS B 69  ? 0.2868 0.2382 0.5317 -0.0766 0.0443  -0.0580 69  LYS B CB  
3765 C CG  . LYS B 69  ? 0.3135 0.2548 0.5648 -0.0808 0.0508  -0.0679 69  LYS B CG  
3766 C CD  . LYS B 69  ? 0.3286 0.2661 0.5779 -0.0910 0.0536  -0.0714 69  LYS B CD  
3767 C CE  . LYS B 69  ? 0.4843 0.3996 0.7430 -0.0926 0.0565  -0.0690 69  LYS B CE  
3768 N NZ  . LYS B 69  ? 0.7251 0.6364 0.9816 -0.1034 0.0594  -0.0723 69  LYS B NZ  
3769 N N   . ARG B 70  ? 0.2210 0.1896 0.4576 -0.0621 0.0319  -0.0400 70  ARG B N   
3770 C CA  . ARG B 70  ? 0.2001 0.1815 0.4296 -0.0593 0.0272  -0.0353 70  ARG B CA  
3771 C C   . ARG B 70  ? 0.2352 0.2231 0.4659 -0.0517 0.0252  -0.0356 70  ARG B C   
3772 O O   . ARG B 70  ? 0.2088 0.2104 0.4342 -0.0507 0.0237  -0.0378 70  ARG B O   
3773 C CB  . ARG B 70  ? 0.1878 0.1627 0.4154 -0.0590 0.0237  -0.0251 70  ARG B CB  
3774 C CG  . ARG B 70  ? 0.2510 0.2392 0.4711 -0.0574 0.0199  -0.0218 70  ARG B CG  
3775 C CD  . ARG B 70  ? 0.3191 0.3016 0.5360 -0.0567 0.0163  -0.0121 70  ARG B CD  
3776 N NE  . ARG B 70  ? 0.3512 0.3464 0.5622 -0.0539 0.0132  -0.0106 70  ARG B NE  
3777 C CZ  . ARG B 70  ? 0.5068 0.5010 0.7131 -0.0531 0.0097  -0.0034 70  ARG B CZ  
3778 N NH1 . ARG B 70  ? 0.2438 0.2253 0.4499 -0.0550 0.0082  0.0040  70  ARG B NH1 
3779 N NH2 . ARG B 70  ? 0.4751 0.4806 0.6769 -0.0506 0.0077  -0.0037 70  ARG B NH2 
3780 N N   . ALA B 71  ? 0.2076 0.1855 0.4461 -0.0464 0.0254  -0.0333 71  ALA B N   
3781 C CA  . ALA B 71  ? 0.2186 0.2009 0.4596 -0.0397 0.0242  -0.0332 71  ALA B CA  
3782 C C   . ALA B 71  ? 0.3091 0.3011 0.5475 -0.0407 0.0273  -0.0420 71  ALA B C   
3783 O O   . ALA B 71  ? 0.3157 0.3165 0.5513 -0.0368 0.0252  -0.0412 71  ALA B O   
3784 C CB  . ALA B 71  ? 0.2390 0.2085 0.4913 -0.0350 0.0247  -0.0303 71  ALA B CB  
3785 N N   . LEU B 72  ? 0.2766 0.2667 0.5155 -0.0463 0.0322  -0.0501 72  LEU B N   
3786 C CA  . LEU B 72  ? 0.2584 0.2573 0.4935 -0.0488 0.0354  -0.0589 72  LEU B CA  
3787 C C   . LEU B 72  ? 0.2629 0.2765 0.4882 -0.0534 0.0332  -0.0614 72  LEU B C   
3788 O O   . LEU B 72  ? 0.2432 0.2656 0.4637 -0.0560 0.0346  -0.0678 72  LEU B O   
3789 C CB  . LEU B 72  ? 0.2698 0.2591 0.5106 -0.0529 0.0420  -0.0674 72  LEU B CB  
3790 C CG  . LEU B 72  ? 0.3314 0.3076 0.5844 -0.0481 0.0453  -0.0674 72  LEU B CG  
3791 C CD1 . LEU B 72  ? 0.3421 0.3098 0.6004 -0.0530 0.0527  -0.0778 72  LEU B CD1 
3792 C CD2 . LEU B 72  ? 0.3431 0.3252 0.5975 -0.0419 0.0447  -0.0663 72  LEU B CD2 
3793 N N   . GLN B 73  ? 0.1887 0.2056 0.4113 -0.0544 0.0296  -0.0562 73  GLN B N   
3794 C CA  . GLN B 73  ? 0.1733 0.2043 0.3894 -0.0583 0.0273  -0.0580 73  GLN B CA  
3795 C C   . GLN B 73  ? 0.2056 0.2469 0.4185 -0.0529 0.0219  -0.0520 73  GLN B C   
3796 O O   . GLN B 73  ? 0.1857 0.2217 0.4007 -0.0472 0.0199  -0.0457 73  GLN B O   
3797 C CB  . GLN B 73  ? 0.1913 0.2188 0.4079 -0.0650 0.0288  -0.0583 73  GLN B CB  
3798 C CG  . GLN B 73  ? 0.2038 0.2464 0.4162 -0.0701 0.0272  -0.0610 73  GLN B CG  
3799 C CD  . GLN B 73  ? 0.3928 0.4460 0.6023 -0.0743 0.0280  -0.0693 73  GLN B CD  
3800 O OE1 . GLN B 73  ? 0.3485 0.4119 0.5549 -0.0708 0.0251  -0.0695 73  GLN B OE1 
3801 N NE2 . GLN B 73  ? 0.3257 0.3771 0.5357 -0.0824 0.0316  -0.0760 73  GLN B NE2 
3802 N N   . TYR B 74  ? 0.1479 0.2042 0.3567 -0.0548 0.0195  -0.0542 74  TYR B N   
3803 C CA  . TYR B 74  ? 0.1357 0.2019 0.3428 -0.0499 0.0147  -0.0495 74  TYR B CA  
3804 C C   . TYR B 74  ? 0.2077 0.2693 0.4161 -0.0485 0.0137  -0.0438 74  TYR B C   
3805 O O   . TYR B 74  ? 0.1957 0.2497 0.4052 -0.0530 0.0162  -0.0436 74  TYR B O   
3806 C CB  . TYR B 74  ? 0.1388 0.2214 0.3437 -0.0529 0.0124  -0.0531 74  TYR B CB  
3807 C CG  . TYR B 74  ? 0.1549 0.2449 0.3564 -0.0542 0.0117  -0.0574 74  TYR B CG  
3808 C CD1 . TYR B 74  ? 0.1777 0.2692 0.3769 -0.0488 0.0093  -0.0545 74  TYR B CD1 
3809 C CD2 . TYR B 74  ? 0.1709 0.2677 0.3706 -0.0616 0.0130  -0.0641 74  TYR B CD2 
3810 C CE1 . TYR B 74  ? 0.1944 0.2929 0.3887 -0.0509 0.0086  -0.0578 74  TYR B CE1 
3811 C CE2 . TYR B 74  ? 0.1823 0.2871 0.3771 -0.0637 0.0118  -0.0679 74  TYR B CE2 
3812 C CZ  . TYR B 74  ? 0.2517 0.3573 0.4433 -0.0583 0.0096  -0.0645 74  TYR B CZ  
3813 O OH  . TYR B 74  ? 0.2077 0.3213 0.3929 -0.0610 0.0083  -0.0674 74  TYR B OH  
3814 N N   . SER B 75  ? 0.1691 0.2350 0.3770 -0.0428 0.0101  -0.0391 75  SER B N   
3815 C CA  . SER B 75  ? 0.1608 0.2241 0.3684 -0.0415 0.0090  -0.0341 75  SER B CA  
3816 C C   . SER B 75  ? 0.2498 0.3244 0.4569 -0.0371 0.0055  -0.0328 75  SER B C   
3817 O O   . SER B 75  ? 0.2546 0.3365 0.4621 -0.0340 0.0034  -0.0342 75  SER B O   
3818 C CB  . SER B 75  ? 0.1614 0.2107 0.3701 -0.0385 0.0088  -0.0289 75  SER B CB  
3819 O OG  . SER B 75  ? 0.1754 0.2229 0.3858 -0.0330 0.0076  -0.0280 75  SER B OG  
3820 N N   . PRO B 76  ? 0.2160 0.2924 0.4223 -0.0371 0.0050  -0.0304 76  PRO B N   
3821 C CA  . PRO B 76  ? 0.2080 0.2948 0.4154 -0.0328 0.0024  -0.0304 76  PRO B CA  
3822 C C   . PRO B 76  ? 0.2653 0.3508 0.4733 -0.0257 -0.0008 -0.0278 76  PRO B C   
3823 O O   . PRO B 76  ? 0.2519 0.3272 0.4589 -0.0235 -0.0012 -0.0245 76  PRO B O   
3824 C CB  . PRO B 76  ? 0.2284 0.3139 0.4336 -0.0347 0.0036  -0.0284 76  PRO B CB  
3825 C CG  . PRO B 76  ? 0.2794 0.3580 0.4823 -0.0416 0.0067  -0.0281 76  PRO B CG  
3826 C CD  . PRO B 76  ? 0.2297 0.2985 0.4336 -0.0413 0.0070  -0.0276 76  PRO B CD  
3827 N N   . SER B 77  ? 0.2359 0.3320 0.4466 -0.0222 -0.0033 -0.0291 77  SER B N   
3828 C CA  . SER B 77  ? 0.2361 0.3320 0.4478 -0.0158 -0.0065 -0.0266 77  SER B CA  
3829 C C   . SER B 77  ? 0.2908 0.3782 0.5013 -0.0124 -0.0073 -0.0229 77  SER B C   
3830 O O   . SER B 77  ? 0.2918 0.3735 0.5020 -0.0091 -0.0088 -0.0202 77  SER B O   
3831 C CB  . SER B 77  ? 0.2712 0.3797 0.4872 -0.0129 -0.0093 -0.0282 77  SER B CB  
3832 O OG  . SER B 77  ? 0.3330 0.4498 0.5497 -0.0154 -0.0101 -0.0307 77  SER B OG  
3833 N N   . ALA B 78  ? 0.2472 0.3346 0.4568 -0.0138 -0.0062 -0.0230 78  ALA B N   
3834 C CA  . ALA B 78  ? 0.2351 0.3159 0.4427 -0.0116 -0.0071 -0.0200 78  ALA B CA  
3835 C C   . ALA B 78  ? 0.3079 0.3770 0.5124 -0.0134 -0.0070 -0.0161 78  ALA B C   
3836 O O   . ALA B 78  ? 0.3077 0.3713 0.5111 -0.0113 -0.0088 -0.0131 78  ALA B O   
3837 C CB  . ALA B 78  ? 0.2422 0.3283 0.4488 -0.0136 -0.0056 -0.0222 78  ALA B CB  
3838 N N   . GLY B 79  ? 0.2811 0.3467 0.4852 -0.0173 -0.0050 -0.0163 79  GLY B N   
3839 C CA  . GLY B 79  ? 0.2685 0.3228 0.4719 -0.0189 -0.0047 -0.0126 79  GLY B CA  
3840 C C   . GLY B 79  ? 0.3138 0.3651 0.5146 -0.0250 -0.0024 -0.0122 79  GLY B C   
3841 O O   . GLY B 79  ? 0.3192 0.3777 0.5179 -0.0285 -0.0007 -0.0149 79  GLY B O   
3842 N N   . ILE B 80  ? 0.2625 0.3030 0.4642 -0.0265 -0.0022 -0.0088 80  ILE B N   
3843 C CA  . ILE B 80  ? 0.2668 0.3017 0.4661 -0.0325 -0.0003 -0.0071 80  ILE B CA  
3844 C C   . ILE B 80  ? 0.3089 0.3436 0.5016 -0.0350 -0.0018 -0.0031 80  ILE B C   
3845 O O   . ILE B 80  ? 0.2857 0.3191 0.4772 -0.0315 -0.0050 0.0000  80  ILE B O   
3846 C CB  . ILE B 80  ? 0.3201 0.3427 0.5240 -0.0329 0.0003  -0.0047 80  ILE B CB  
3847 C CG1 . ILE B 80  ? 0.3210 0.3361 0.5280 -0.0280 -0.0034 0.0010  80  ILE B CG1 
3848 C CG2 . ILE B 80  ? 0.3325 0.3569 0.5409 -0.0326 0.0032  -0.0107 80  ILE B CG2 
3849 C CD1 . ILE B 80  ? 0.2813 0.2835 0.4930 -0.0287 -0.0039 0.0057  80  ILE B CD1 
3850 N N   . PRO B 81  ? 0.2849 0.3224 0.4730 -0.0414 0.0008  -0.0039 81  PRO B N   
3851 C CA  . PRO B 81  ? 0.2840 0.3229 0.4643 -0.0446 0.0001  -0.0010 81  PRO B CA  
3852 C C   . PRO B 81  ? 0.3576 0.3863 0.5340 -0.0444 -0.0039 0.0069  81  PRO B C   
3853 O O   . PRO B 81  ? 0.3672 0.3989 0.5387 -0.0436 -0.0060 0.0080  81  PRO B O   
3854 C CB  . PRO B 81  ? 0.3096 0.3517 0.4863 -0.0526 0.0043  -0.0028 81  PRO B CB  
3855 C CG  . PRO B 81  ? 0.3716 0.4100 0.5541 -0.0539 0.0063  -0.0049 81  PRO B CG  
3856 C CD  . PRO B 81  ? 0.3081 0.3483 0.4973 -0.0468 0.0047  -0.0079 81  PRO B CD  
3857 N N   . GLU B 82  ? 0.3119 0.3290 0.4913 -0.0450 -0.0053 0.0120  82  GLU B N   
3858 C CA  . GLU B 82  ? 0.3178 0.3252 0.4954 -0.0445 -0.0100 0.0204  82  GLU B CA  
3859 C C   . GLU B 82  ? 0.3745 0.3829 0.5557 -0.0377 -0.0142 0.0215  82  GLU B C   
3860 O O   . GLU B 82  ? 0.3826 0.3891 0.5587 -0.0383 -0.0184 0.0268  82  GLU B O   
3861 C CB  . GLU B 82  ? 0.3476 0.3419 0.5298 -0.0463 -0.0105 0.0257  82  GLU B CB  
3862 C CG  . GLU B 82  ? 0.5067 0.4982 0.6994 -0.0431 -0.0075 0.0208  82  GLU B CG  
3863 C CD  . GLU B 82  ? 0.6440 0.6379 0.8362 -0.0484 -0.0021 0.0151  82  GLU B CD  
3864 O OE1 . GLU B 82  ? 0.3613 0.3672 0.5518 -0.0487 0.0005  0.0083  82  GLU B OE1 
3865 O OE2 . GLU B 82  ? 0.5933 0.5770 0.7876 -0.0523 -0.0006 0.0175  82  GLU B OE2 
3866 N N   . LEU B 83  ? 0.3201 0.3322 0.5092 -0.0320 -0.0131 0.0164  83  LEU B N   
3867 C CA  . LEU B 83  ? 0.2888 0.3025 0.4819 -0.0259 -0.0163 0.0166  83  LEU B CA  
3868 C C   . LEU B 83  ? 0.3124 0.3348 0.4992 -0.0257 -0.0169 0.0138  83  LEU B C   
3869 O O   . LEU B 83  ? 0.3152 0.3370 0.5005 -0.0240 -0.0207 0.0166  83  LEU B O   
3870 C CB  . LEU B 83  ? 0.2713 0.2860 0.4734 -0.0210 -0.0143 0.0122  83  LEU B CB  
3871 C CG  . LEU B 83  ? 0.3100 0.3262 0.5173 -0.0152 -0.0168 0.0123  83  LEU B CG  
3872 C CD1 . LEU B 83  ? 0.3167 0.3260 0.5277 -0.0137 -0.0212 0.0189  83  LEU B CD1 
3873 C CD2 . LEU B 83  ? 0.3234 0.3404 0.5377 -0.0121 -0.0138 0.0081  83  LEU B CD2 
3874 N N   . LEU B 84  ? 0.2467 0.2774 0.4308 -0.0274 -0.0131 0.0079  84  LEU B N   
3875 C CA  . LEU B 84  ? 0.2322 0.2713 0.4121 -0.0271 -0.0127 0.0040  84  LEU B CA  
3876 C C   . LEU B 84  ? 0.2952 0.3336 0.4656 -0.0319 -0.0141 0.0070  84  LEU B C   
3877 O O   . LEU B 84  ? 0.2834 0.3240 0.4512 -0.0304 -0.0160 0.0061  84  LEU B O   
3878 C CB  . LEU B 84  ? 0.2210 0.2698 0.4023 -0.0279 -0.0084 -0.0028 84  LEU B CB  
3879 C CG  . LEU B 84  ? 0.2616 0.3148 0.4507 -0.0225 -0.0080 -0.0066 84  LEU B CG  
3880 C CD1 . LEU B 84  ? 0.2453 0.3080 0.4363 -0.0242 -0.0047 -0.0120 84  LEU B CD1 
3881 C CD2 . LEU B 84  ? 0.2948 0.3500 0.4861 -0.0169 -0.0104 -0.0076 84  LEU B CD2 
3882 N N   . SER B 85  ? 0.2749 0.3096 0.4394 -0.0383 -0.0132 0.0106  85  SER B N   
3883 C CA  . SER B 85  ? 0.2961 0.3301 0.4493 -0.0443 -0.0145 0.0142  85  SER B CA  
3884 C C   . SER B 85  ? 0.3752 0.4023 0.5267 -0.0428 -0.0210 0.0212  85  SER B C   
3885 O O   . SER B 85  ? 0.4046 0.4343 0.5481 -0.0452 -0.0229 0.0213  85  SER B O   
3886 C CB  . SER B 85  ? 0.3538 0.3848 0.5006 -0.0520 -0.0120 0.0173  85  SER B CB  
3887 O OG  . SER B 85  ? 0.5436 0.5648 0.6963 -0.0513 -0.0135 0.0226  85  SER B OG  
3888 N N   . TRP B 86  ? 0.3006 0.3198 0.4605 -0.0390 -0.0242 0.0261  86  TRP B N   
3889 C CA  . TRP B 86  ? 0.2937 0.3073 0.4552 -0.0369 -0.0307 0.0329  86  TRP B CA  
3890 C C   . TRP B 86  ? 0.3066 0.3253 0.4705 -0.0324 -0.0326 0.0292  86  TRP B C   
3891 O O   . TRP B 86  ? 0.2834 0.3020 0.4424 -0.0338 -0.0373 0.0325  86  TRP B O   
3892 C CB  . TRP B 86  ? 0.2776 0.2828 0.4506 -0.0330 -0.0324 0.0373  86  TRP B CB  
3893 C CG  . TRP B 86  ? 0.2928 0.2914 0.4678 -0.0325 -0.0395 0.0464  86  TRP B CG  
3894 C CD1 . TRP B 86  ? 0.3431 0.3341 0.5142 -0.0368 -0.0431 0.0551  86  TRP B CD1 
3895 C CD2 . TRP B 86  ? 0.2842 0.2836 0.4663 -0.0276 -0.0444 0.0481  86  TRP B CD2 
3896 N NE1 . TRP B 86  ? 0.3451 0.3328 0.5208 -0.0344 -0.0505 0.0624  86  TRP B NE1 
3897 C CE2 . TRP B 86  ? 0.3494 0.3425 0.5326 -0.0288 -0.0512 0.0579  86  TRP B CE2 
3898 C CE3 . TRP B 86  ? 0.2844 0.2893 0.4725 -0.0225 -0.0438 0.0427  86  TRP B CE3 
3899 C CZ2 . TRP B 86  ? 0.3353 0.3287 0.5264 -0.0249 -0.0574 0.0618  86  TRP B CZ2 
3900 C CZ3 . TRP B 86  ? 0.3009 0.3055 0.4958 -0.0193 -0.0494 0.0464  86  TRP B CZ3 
3901 C CH2 . TRP B 86  ? 0.3210 0.3204 0.5180 -0.0204 -0.0561 0.0555  86  TRP B CH2 
3902 N N   . LEU B 87  ? 0.2527 0.2756 0.4239 -0.0274 -0.0292 0.0226  87  LEU B N   
3903 C CA  . LEU B 87  ? 0.2332 0.2600 0.4078 -0.0230 -0.0303 0.0189  87  LEU B CA  
3904 C C   . LEU B 87  ? 0.2790 0.3117 0.4446 -0.0260 -0.0294 0.0145  87  LEU B C   
3905 O O   . LEU B 87  ? 0.2575 0.2905 0.4217 -0.0253 -0.0326 0.0145  87  LEU B O   
3906 C CB  . LEU B 87  ? 0.2143 0.2434 0.3982 -0.0175 -0.0272 0.0142  87  LEU B CB  
3907 C CG  . LEU B 87  ? 0.2622 0.2859 0.4556 -0.0143 -0.0277 0.0172  87  LEU B CG  
3908 C CD1 . LEU B 87  ? 0.3011 0.3280 0.5003 -0.0108 -0.0238 0.0121  87  LEU B CD1 
3909 C CD2 . LEU B 87  ? 0.2556 0.2760 0.4545 -0.0114 -0.0325 0.0214  87  LEU B CD2 
3910 N N   . LYS B 88  ? 0.2477 0.2853 0.4074 -0.0298 -0.0247 0.0103  88  LYS B N   
3911 C CA  . LYS B 88  ? 0.2430 0.2868 0.3945 -0.0334 -0.0223 0.0050  88  LYS B CA  
3912 C C   . LYS B 88  ? 0.3152 0.3565 0.4558 -0.0388 -0.0265 0.0094  88  LYS B C   
3913 O O   . LYS B 88  ? 0.3152 0.3594 0.4519 -0.0395 -0.0272 0.0056  88  LYS B O   
3914 C CB  . LYS B 88  ? 0.2750 0.3240 0.4227 -0.0378 -0.0166 0.0014  88  LYS B CB  
3915 C CG  . LYS B 88  ? 0.5523 0.6087 0.7084 -0.0334 -0.0121 -0.0062 88  LYS B CG  
3916 C CD  . LYS B 88  ? 0.7399 0.8036 0.8924 -0.0387 -0.0064 -0.0106 88  LYS B CD  
3917 C CE  . LYS B 88  ? 0.8529 0.9242 1.0005 -0.0412 -0.0029 -0.0176 88  LYS B CE  
3918 N NZ  . LYS B 88  ? 0.9408 1.0184 1.0988 -0.0344 -0.0010 -0.0249 88  LYS B NZ  
3919 N N   . GLN B 89  ? 0.2975 0.3332 0.4336 -0.0429 -0.0296 0.0175  89  GLN B N   
3920 C CA  . GLN B 89  ? 0.3235 0.3565 0.4488 -0.0487 -0.0348 0.0239  89  GLN B CA  
3921 C C   . GLN B 89  ? 0.3904 0.4212 0.5203 -0.0450 -0.0414 0.0269  89  GLN B C   
3922 O O   . GLN B 89  ? 0.4092 0.4416 0.5298 -0.0493 -0.0450 0.0278  89  GLN B O   
3923 C CB  . GLN B 89  ? 0.3550 0.3813 0.4768 -0.0529 -0.0370 0.0331  89  GLN B CB  
3924 C CG  . GLN B 89  ? 0.5865 0.6155 0.7001 -0.0594 -0.0309 0.0309  89  GLN B CG  
3925 C CD  . GLN B 89  ? 0.9585 0.9843 1.0576 -0.0685 -0.0335 0.0386  89  GLN B CD  
3926 O OE1 . GLN B 89  ? 0.9324 0.9582 1.0223 -0.0720 -0.0387 0.0425  89  GLN B OE1 
3927 N NE2 . GLN B 89  ? 0.8880 0.9115 0.9841 -0.0732 -0.0297 0.0408  89  GLN B NE2 
3928 N N   . LEU B 90  ? 0.3344 0.3621 0.4781 -0.0378 -0.0427 0.0280  90  LEU B N   
3929 C CA  . LEU B 90  ? 0.3299 0.3564 0.4805 -0.0340 -0.0482 0.0302  90  LEU B CA  
3930 C C   . LEU B 90  ? 0.3702 0.4019 0.5190 -0.0332 -0.0467 0.0222  90  LEU B C   
3931 O O   . LEU B 90  ? 0.3827 0.4151 0.5274 -0.0355 -0.0513 0.0233  90  LEU B O   
3932 C CB  . LEU B 90  ? 0.3162 0.3391 0.4822 -0.0269 -0.0483 0.0319  90  LEU B CB  
3933 C CG  . LEU B 90  ? 0.3598 0.3817 0.5348 -0.0233 -0.0538 0.0351  90  LEU B CG  
3934 C CD1 . LEU B 90  ? 0.3633 0.3818 0.5380 -0.0257 -0.0611 0.0446  90  LEU B CD1 
3935 C CD2 . LEU B 90  ? 0.3937 0.4143 0.5827 -0.0168 -0.0512 0.0334  90  LEU B CD2 
3936 N N   . GLN B 91  ? 0.3027 0.3378 0.4543 -0.0304 -0.0403 0.0143  91  GLN B N   
3937 C CA  . GLN B 91  ? 0.2976 0.3365 0.4491 -0.0290 -0.0379 0.0062  91  GLN B CA  
3938 C C   . GLN B 91  ? 0.3520 0.3942 0.4903 -0.0359 -0.0378 0.0030  91  GLN B C   
3939 O O   . GLN B 91  ? 0.3386 0.3815 0.4755 -0.0363 -0.0392 -0.0009 91  GLN B O   
3940 C CB  . GLN B 91  ? 0.3078 0.3501 0.4654 -0.0248 -0.0316 -0.0004 91  GLN B CB  
3941 C CG  . GLN B 91  ? 0.4313 0.4714 0.6007 -0.0185 -0.0314 0.0016  91  GLN B CG  
3942 C CD  . GLN B 91  ? 0.6332 0.6705 0.8101 -0.0143 -0.0346 0.0027  91  GLN B CD  
3943 O OE1 . GLN B 91  ? 0.7114 0.7498 0.8920 -0.0113 -0.0332 -0.0020 91  GLN B OE1 
3944 N NE2 . GLN B 91  ? 0.4400 0.4736 0.6204 -0.0140 -0.0388 0.0091  91  GLN B NE2 
3945 N N   . ILE B 92  ? 0.3226 0.3662 0.4505 -0.0420 -0.0360 0.0047  92  ILE B N   
3946 C CA  . ILE B 92  ? 0.3411 0.3882 0.4541 -0.0501 -0.0355 0.0020  92  ILE B CA  
3947 C C   . ILE B 92  ? 0.4183 0.4629 0.5243 -0.0542 -0.0437 0.0086  92  ILE B C   
3948 O O   . ILE B 92  ? 0.4133 0.4606 0.5125 -0.0577 -0.0443 0.0036  92  ILE B O   
3949 C CB  . ILE B 92  ? 0.3819 0.4318 0.4854 -0.0563 -0.0307 0.0022  92  ILE B CB  
3950 C CG1 . ILE B 92  ? 0.3753 0.4307 0.4858 -0.0529 -0.0225 -0.0069 92  ILE B CG1 
3951 C CG2 . ILE B 92  ? 0.3998 0.4528 0.4855 -0.0663 -0.0308 0.0012  92  ILE B CG2 
3952 C CD1 . ILE B 92  ? 0.4524 0.5103 0.5598 -0.0568 -0.0177 -0.0062 92  ILE B CD1 
3953 N N   . LYS B 93  ? 0.3930 0.4327 0.5018 -0.0537 -0.0499 0.0192  93  LYS B N   
3954 C CA  . LYS B 93  ? 0.4146 0.4530 0.5185 -0.0572 -0.0588 0.0263  93  LYS B CA  
3955 C C   . LYS B 93  ? 0.4728 0.5118 0.5856 -0.0530 -0.0624 0.0238  93  LYS B C   
3956 O O   . LYS B 93  ? 0.4857 0.5265 0.5918 -0.0575 -0.0680 0.0250  93  LYS B O   
3957 C CB  . LYS B 93  ? 0.4460 0.4791 0.5519 -0.0575 -0.0649 0.0388  93  LYS B CB  
3958 C CG  . LYS B 93  ? 0.7619 0.7947 0.8514 -0.0665 -0.0650 0.0436  93  LYS B CG  
3959 C CD  . LYS B 93  ? 0.9552 0.9814 1.0466 -0.0671 -0.0713 0.0566  93  LYS B CD  
3960 C CE  . LYS B 93  ? 1.1580 1.1825 1.2347 -0.0753 -0.0691 0.0609  93  LYS B CE  
3961 N NZ  . LYS B 93  ? 1.3564 1.3803 1.4375 -0.0734 -0.0599 0.0554  93  LYS B NZ  
3962 N N   . LEU B 94  ? 0.4073 0.4449 0.5346 -0.0451 -0.0592 0.0203  94  LEU B N   
3963 C CA  . LEU B 94  ? 0.3927 0.4302 0.5300 -0.0409 -0.0619 0.0183  94  LEU B CA  
3964 C C   . LEU B 94  ? 0.4531 0.4930 0.5879 -0.0413 -0.0575 0.0076  94  LEU B C   
3965 O O   . LEU B 94  ? 0.4730 0.5135 0.6082 -0.0427 -0.0610 0.0056  94  LEU B O   
3966 C CB  . LEU B 94  ? 0.3706 0.4050 0.5244 -0.0327 -0.0608 0.0207  94  LEU B CB  
3967 C CG  . LEU B 94  ? 0.4177 0.4496 0.5808 -0.0305 -0.0672 0.0301  94  LEU B CG  
3968 C CD1 . LEU B 94  ? 0.4261 0.4563 0.5816 -0.0350 -0.0714 0.0384  94  LEU B CD1 
3969 C CD2 . LEU B 94  ? 0.4397 0.4690 0.6165 -0.0235 -0.0635 0.0305  94  LEU B CD2 
3970 N N   . HIS B 95  ? 0.3858 0.4271 0.5194 -0.0400 -0.0499 0.0006  95  HIS B N   
3971 C CA  . HIS B 95  ? 0.3735 0.4163 0.5080 -0.0389 -0.0453 -0.0097 95  HIS B CA  
3972 C C   . HIS B 95  ? 0.4143 0.4613 0.5371 -0.0445 -0.0399 -0.0177 95  HIS B C   
3973 O O   . HIS B 95  ? 0.4173 0.4651 0.5404 -0.0445 -0.0369 -0.0266 95  HIS B O   
3974 C CB  . HIS B 95  ? 0.3666 0.4076 0.5151 -0.0305 -0.0413 -0.0123 95  HIS B CB  
3975 C CG  . HIS B 95  ? 0.4038 0.4415 0.5632 -0.0256 -0.0451 -0.0051 95  HIS B CG  
3976 N ND1 . HIS B 95  ? 0.4224 0.4593 0.5872 -0.0221 -0.0435 -0.0008 95  HIS B ND1 
3977 C CD2 . HIS B 95  ? 0.4239 0.4596 0.5896 -0.0243 -0.0498 -0.0021 95  HIS B CD2 
3978 C CE1 . HIS B 95  ? 0.4085 0.4429 0.5827 -0.0186 -0.0468 0.0041  95  HIS B CE1 
3979 N NE2 . HIS B 95  ? 0.4143 0.4481 0.5898 -0.0197 -0.0507 0.0037  95  HIS B NE2 
3980 N N   . ASN B 96  ? 0.3388 0.3883 0.4518 -0.0494 -0.0382 -0.0151 96  ASN B N   
3981 C CA  . ASN B 96  ? 0.3347 0.3894 0.4365 -0.0554 -0.0320 -0.0227 96  ASN B CA  
3982 C C   . ASN B 96  ? 0.3956 0.4525 0.5055 -0.0508 -0.0251 -0.0345 96  ASN B C   
3983 O O   . ASN B 96  ? 0.4052 0.4631 0.5108 -0.0538 -0.0236 -0.0425 96  ASN B O   
3984 C CB  . ASN B 96  ? 0.3012 0.3578 0.3859 -0.0654 -0.0355 -0.0221 96  ASN B CB  
3985 C CG  . ASN B 96  ? 0.5079 0.5704 0.5785 -0.0734 -0.0289 -0.0290 96  ASN B CG  
3986 O OD1 . ASN B 96  ? 0.5546 0.6201 0.6258 -0.0733 -0.0227 -0.0307 96  ASN B OD1 
3987 N ND2 . ASN B 96  ? 0.2353 0.3002 0.2925 -0.0812 -0.0298 -0.0335 96  ASN B ND2 
3988 N N   . PRO B 97  ? 0.3405 0.3973 0.4636 -0.0431 -0.0217 -0.0355 97  PRO B N   
3989 C CA  . PRO B 97  ? 0.3307 0.3889 0.4636 -0.0378 -0.0164 -0.0454 97  PRO B CA  
3990 C C   . PRO B 97  ? 0.3688 0.4337 0.4958 -0.0422 -0.0090 -0.0555 97  PRO B C   
3991 O O   . PRO B 97  ? 0.3605 0.4302 0.4798 -0.0472 -0.0061 -0.0544 97  PRO B O   
3992 C CB  . PRO B 97  ? 0.3398 0.3976 0.4860 -0.0298 -0.0156 -0.0421 97  PRO B CB  
3993 C CG  . PRO B 97  ? 0.3961 0.4504 0.5407 -0.0303 -0.0210 -0.0311 97  PRO B CG  
3994 C CD  . PRO B 97  ? 0.3497 0.4052 0.4795 -0.0391 -0.0227 -0.0280 97  PRO B CD  
3995 N N   . PRO B 98  ? 0.3198 0.3850 0.4510 -0.0406 -0.0052 -0.0658 98  PRO B N   
3996 C CA  . PRO B 98  ? 0.3303 0.4025 0.4576 -0.0445 0.0029  -0.0770 98  PRO B CA  
3997 C C   . PRO B 98  ? 0.3980 0.4773 0.5340 -0.0409 0.0088  -0.0793 98  PRO B C   
3998 O O   . PRO B 98  ? 0.4033 0.4902 0.5330 -0.0464 0.0152  -0.0854 98  PRO B O   
3999 C CB  . PRO B 98  ? 0.3523 0.4214 0.4870 -0.0413 0.0051  -0.0870 98  PRO B CB  
4000 C CG  . PRO B 98  ? 0.4005 0.4609 0.5361 -0.0396 -0.0028 -0.0804 98  PRO B CG  
4001 C CD  . PRO B 98  ? 0.3307 0.3895 0.4709 -0.0355 -0.0078 -0.0682 98  PRO B CD  
4002 N N   . THR B 99  ? 0.3494 0.4267 0.4991 -0.0323 0.0065  -0.0743 99  THR B N   
4003 C CA  . THR B 99  ? 0.3390 0.4229 0.4997 -0.0276 0.0106  -0.0758 99  THR B CA  
4004 C C   . THR B 99  ? 0.4379 0.5273 0.5923 -0.0325 0.0119  -0.0707 99  THR B C   
4005 O O   . THR B 99  ? 0.4446 0.5409 0.6082 -0.0294 0.0156  -0.0733 99  THR B O   
4006 C CB  . THR B 99  ? 0.3601 0.4400 0.5365 -0.0175 0.0071  -0.0725 99  THR B CB  
4007 O OG1 . THR B 99  ? 0.3674 0.4410 0.5412 -0.0169 0.0006  -0.0616 99  THR B OG1 
4008 C CG2 . THR B 99  ? 0.3165 0.3914 0.5011 -0.0127 0.0072  -0.0786 99  THR B CG2 
4009 N N   . ILE B 100 ? 0.4241 0.5104 0.5638 -0.0399 0.0086  -0.0636 100 ILE B N   
4010 C CA  . ILE B 100 ? 0.4442 0.5333 0.5772 -0.0451 0.0093  -0.0576 100 ILE B CA  
4011 C C   . ILE B 100 ? 0.4921 0.5920 0.6260 -0.0486 0.0176  -0.0648 100 ILE B C   
4012 O O   . ILE B 100 ? 0.4731 0.5766 0.6145 -0.0463 0.0188  -0.0627 100 ILE B O   
4013 C CB  . ILE B 100 ? 0.5097 0.5933 0.6259 -0.0533 0.0044  -0.0490 100 ILE B CB  
4014 C CG1 . ILE B 100 ? 0.5117 0.5860 0.6303 -0.0492 -0.0041 -0.0410 100 ILE B CG1 
4015 C CG2 . ILE B 100 ? 0.5360 0.6209 0.6458 -0.0589 0.0053  -0.0423 100 ILE B CG2 
4016 C CD1 . ILE B 100 ? 0.6682 0.7385 0.7716 -0.0568 -0.0095 -0.0351 100 ILE B CD1 
4017 N N   . HIS B 101 ? 0.4561 0.5618 0.5827 -0.0544 0.0235  -0.0737 101 HIS B N   
4018 C CA  . HIS B 101 ? 0.4495 0.5666 0.5767 -0.0588 0.0322  -0.0813 101 HIS B CA  
4019 C C   . HIS B 101 ? 0.4712 0.5965 0.6149 -0.0522 0.0385  -0.0934 101 HIS B C   
4020 O O   . HIS B 101 ? 0.4802 0.6165 0.6257 -0.0560 0.0466  -0.1013 101 HIS B O   
4021 C CB  . HIS B 101 ? 0.4810 0.6007 0.5879 -0.0714 0.0358  -0.0825 101 HIS B CB  
4022 C CG  . HIS B 101 ? 0.5335 0.6464 0.6264 -0.0777 0.0298  -0.0694 101 HIS B CG  
4023 N ND1 . HIS B 101 ? 0.5656 0.6690 0.6485 -0.0793 0.0219  -0.0619 101 HIS B ND1 
4024 C CD2 . HIS B 101 ? 0.5592 0.6730 0.6487 -0.0820 0.0303  -0.0626 101 HIS B CD2 
4025 C CE1 . HIS B 101 ? 0.5636 0.6625 0.6378 -0.0841 0.0178  -0.0506 101 HIS B CE1 
4026 N NE2 . HIS B 101 ? 0.5655 0.6697 0.6430 -0.0860 0.0228  -0.0507 101 HIS B NE2 
4027 N N   . TYR B 102 ? 0.4006 0.5210 0.5578 -0.0423 0.0349  -0.0945 102 TYR B N   
4028 C CA  . TYR B 102 ? 0.3974 0.5235 0.5730 -0.0343 0.0392  -0.1044 102 TYR B CA  
4029 C C   . TYR B 102 ? 0.4532 0.5894 0.6424 -0.0306 0.0416  -0.1044 102 TYR B C   
4030 O O   . TYR B 102 ? 0.4492 0.5838 0.6356 -0.0316 0.0376  -0.0951 102 TYR B O   
4031 C CB  . TYR B 102 ? 0.4084 0.5247 0.5942 -0.0248 0.0328  -0.1015 102 TYR B CB  
4032 C CG  . TYR B 102 ? 0.4422 0.5504 0.6218 -0.0261 0.0318  -0.1055 102 TYR B CG  
4033 C CD1 . TYR B 102 ? 0.4627 0.5636 0.6542 -0.0178 0.0287  -0.1067 102 TYR B CD1 
4034 C CD2 . TYR B 102 ? 0.4583 0.5658 0.6194 -0.0364 0.0334  -0.1074 102 TYR B CD2 
4035 C CE1 . TYR B 102 ? 0.4752 0.5685 0.6615 -0.0196 0.0279  -0.1108 102 TYR B CE1 
4036 C CE2 . TYR B 102 ? 0.4709 0.5717 0.6260 -0.0383 0.0321  -0.1116 102 TYR B CE2 
4037 C CZ  . TYR B 102 ? 0.5363 0.6298 0.7043 -0.0300 0.0295  -0.1135 102 TYR B CZ  
4038 O OH  . TYR B 102 ? 0.5344 0.6210 0.6970 -0.0325 0.0283  -0.1181 102 TYR B OH  
4039 N N   . PRO B 103 ? 0.4301 0.5768 0.6351 -0.0262 0.0477  -0.1145 103 PRO B N   
4040 C CA  . PRO B 103 ? 0.4279 0.5849 0.6469 -0.0224 0.0486  -0.1138 103 PRO B CA  
4041 C C   . PRO B 103 ? 0.4799 0.6306 0.7083 -0.0137 0.0400  -0.1045 103 PRO B C   
4042 O O   . PRO B 103 ? 0.4601 0.6014 0.6921 -0.0075 0.0355  -0.1029 103 PRO B O   
4043 C CB  . PRO B 103 ? 0.4510 0.6193 0.6877 -0.0177 0.0558  -0.1267 103 PRO B CB  
4044 C CG  . PRO B 103 ? 0.5205 0.6854 0.7490 -0.0217 0.0606  -0.1353 103 PRO B CG  
4045 C CD  . PRO B 103 ? 0.4630 0.6127 0.6756 -0.0239 0.0538  -0.1273 103 PRO B CD  
4046 N N   . PRO B 104 ? 0.4596 0.6151 0.6911 -0.0138 0.0378  -0.0986 104 PRO B N   
4047 C CA  . PRO B 104 ? 0.4553 0.6050 0.6935 -0.0067 0.0299  -0.0901 104 PRO B CA  
4048 C C   . PRO B 104 ? 0.5151 0.6633 0.7694 0.0041  0.0268  -0.0919 104 PRO B C   
4049 O O   . PRO B 104 ? 0.5165 0.6538 0.7692 0.0082  0.0205  -0.0852 104 PRO B O   
4050 C CB  . PRO B 104 ? 0.4689 0.6283 0.7109 -0.0090 0.0304  -0.0877 104 PRO B CB  
4051 C CG  . PRO B 104 ? 0.5273 0.6905 0.7565 -0.0197 0.0363  -0.0898 104 PRO B CG  
4052 C CD  . PRO B 104 ? 0.4841 0.6497 0.7117 -0.0215 0.0424  -0.0993 104 PRO B CD  
4053 N N   . SER B 105 ? 0.4732 0.6316 0.7429 0.0084  0.0313  -0.1010 105 SER B N   
4054 C CA  . SER B 105 ? 0.4648 0.6218 0.7518 0.0189  0.0286  -0.1031 105 SER B CA  
4055 C C   . SER B 105 ? 0.5104 0.6546 0.7935 0.0206  0.0284  -0.1056 105 SER B C   
4056 O O   . SER B 105 ? 0.5132 0.6506 0.8064 0.0286  0.0239  -0.1033 105 SER B O   
4057 C CB  . SER B 105 ? 0.4960 0.6684 0.8025 0.0230  0.0337  -0.1124 105 SER B CB  
4058 O OG  . SER B 105 ? 0.5598 0.7406 0.8617 0.0156  0.0429  -0.1220 105 SER B OG  
4059 N N   . GLN B 106 ? 0.4560 0.5968 0.7239 0.0125  0.0328  -0.1097 106 GLN B N   
4060 C CA  . GLN B 106 ? 0.4554 0.5849 0.7176 0.0123  0.0328  -0.1128 106 GLN B CA  
4061 C C   . GLN B 106 ? 0.4802 0.5959 0.7298 0.0110  0.0254  -0.1023 106 GLN B C   
4062 O O   . GLN B 106 ? 0.4703 0.5766 0.7138 0.0096  0.0247  -0.1041 106 GLN B O   
4063 C CB  . GLN B 106 ? 0.4836 0.6170 0.7356 0.0040  0.0409  -0.1230 106 GLN B CB  
4064 C CG  . GLN B 106 ? 0.6866 0.8267 0.9547 0.0083  0.0481  -0.1365 106 GLN B CG  
4065 C CD  . GLN B 106 ? 1.0018 1.1464 1.2585 -0.0009 0.0569  -0.1475 106 GLN B CD  
4066 O OE1 . GLN B 106 ? 0.9317 1.0677 1.1723 -0.0070 0.0565  -0.1480 106 GLN B OE1 
4067 N NE2 . GLN B 106 ? 0.9678 1.1268 1.2331 -0.0023 0.0652  -0.1569 106 GLN B NE2 
4068 N N   . GLY B 107 ? 0.4118 0.5270 0.6588 0.0113  0.0203  -0.0923 107 GLY B N   
4069 C CA  . GLY B 107 ? 0.3869 0.4908 0.6247 0.0107  0.0136  -0.0822 107 GLY B CA  
4070 C C   . GLY B 107 ? 0.3901 0.4914 0.6103 0.0018  0.0129  -0.0773 107 GLY B C   
4071 O O   . GLY B 107 ? 0.3729 0.4646 0.5846 0.0000  0.0089  -0.0724 107 GLY B O   
4072 N N   . GLN B 108 ? 0.3250 0.4349 0.5405 -0.0037 0.0165  -0.0780 108 GLN B N   
4073 C CA  . GLN B 108 ? 0.3226 0.4301 0.5220 -0.0123 0.0159  -0.0725 108 GLN B CA  
4074 C C   . GLN B 108 ? 0.3445 0.4427 0.5407 -0.0107 0.0088  -0.0618 108 GLN B C   
4075 O O   . GLN B 108 ? 0.3106 0.4086 0.5162 -0.0047 0.0059  -0.0583 108 GLN B O   
4076 C CB  . GLN B 108 ? 0.3405 0.4584 0.5392 -0.0171 0.0204  -0.0739 108 GLN B CB  
4077 C CG  . GLN B 108 ? 0.4350 0.5502 0.6170 -0.0267 0.0205  -0.0685 108 GLN B CG  
4078 C CD  . GLN B 108 ? 0.5903 0.7154 0.7719 -0.0321 0.0256  -0.0704 108 GLN B CD  
4079 O OE1 . GLN B 108 ? 0.4863 0.6177 0.6790 -0.0285 0.0258  -0.0705 108 GLN B OE1 
4080 N NE2 . GLN B 108 ? 0.5229 0.6495 0.6908 -0.0416 0.0294  -0.0713 108 GLN B NE2 
4081 N N   . MET B 109 ? 0.3017 0.3925 0.4847 -0.0162 0.0061  -0.0568 109 MET B N   
4082 C CA  . MET B 109 ? 0.2877 0.3700 0.4685 -0.0150 0.0000  -0.0473 109 MET B CA  
4083 C C   . MET B 109 ? 0.3288 0.4132 0.5115 -0.0152 -0.0004 -0.0422 109 MET B C   
4084 O O   . MET B 109 ? 0.3131 0.4017 0.4899 -0.0211 0.0025  -0.0423 109 MET B O   
4085 C CB  . MET B 109 ? 0.3202 0.3961 0.4881 -0.0210 -0.0031 -0.0431 109 MET B CB  
4086 C CG  . MET B 109 ? 0.3626 0.4300 0.5313 -0.0186 -0.0094 -0.0343 109 MET B CG  
4087 S SD  . MET B 109 ? 0.4308 0.4926 0.5861 -0.0259 -0.0139 -0.0266 109 MET B SD  
4088 C CE  . MET B 109 ? 0.3904 0.4512 0.5465 -0.0269 -0.0141 -0.0196 109 MET B CE  
4089 N N   . ASP B 110 ? 0.2892 0.3708 0.4799 -0.0094 -0.0037 -0.0383 110 ASP B N   
4090 C CA  . ASP B 110 ? 0.2878 0.3707 0.4808 -0.0094 -0.0044 -0.0341 110 ASP B CA  
4091 C C   . ASP B 110 ? 0.3376 0.4121 0.5315 -0.0066 -0.0090 -0.0274 110 ASP B C   
4092 O O   . ASP B 110 ? 0.3255 0.3952 0.5215 -0.0031 -0.0116 -0.0266 110 ASP B O   
4093 C CB  . ASP B 110 ? 0.3112 0.4035 0.5145 -0.0056 -0.0022 -0.0384 110 ASP B CB  
4094 C CG  . ASP B 110 ? 0.5390 0.6356 0.7426 -0.0086 -0.0011 -0.0366 110 ASP B CG  
4095 O OD1 . ASP B 110 ? 0.5623 0.6542 0.7578 -0.0141 -0.0010 -0.0325 110 ASP B OD1 
4096 O OD2 . ASP B 110 ? 0.6381 0.7429 0.8504 -0.0057 -0.0005 -0.0391 110 ASP B OD2 
4097 N N   . LEU B 111 ? 0.3047 0.3775 0.4973 -0.0086 -0.0096 -0.0230 111 LEU B N   
4098 C CA  . LEU B 111 ? 0.3039 0.3694 0.4977 -0.0068 -0.0129 -0.0172 111 LEU B CA  
4099 C C   . LEU B 111 ? 0.3484 0.4160 0.5467 -0.0056 -0.0122 -0.0165 111 LEU B C   
4100 O O   . LEU B 111 ? 0.3721 0.4455 0.5704 -0.0085 -0.0095 -0.0188 111 LEU B O   
4101 C CB  . LEU B 111 ? 0.3162 0.3753 0.5027 -0.0118 -0.0142 -0.0123 111 LEU B CB  
4102 C CG  . LEU B 111 ? 0.3919 0.4441 0.5771 -0.0108 -0.0183 -0.0083 111 LEU B CG  
4103 C CD1 . LEU B 111 ? 0.4214 0.4728 0.5976 -0.0159 -0.0191 -0.0079 111 LEU B CD1 
4104 C CD2 . LEU B 111 ? 0.3906 0.4366 0.5783 -0.0105 -0.0204 -0.0025 111 LEU B CD2 
4105 N N   . CYS B 112 ? 0.2620 0.3252 0.4637 -0.0024 -0.0144 -0.0134 112 CYS B N   
4106 C CA  . CYS B 112 ? 0.2611 0.3254 0.4655 -0.0023 -0.0137 -0.0127 112 CYS B CA  
4107 C C   . CYS B 112 ? 0.2934 0.3504 0.4991 -0.0010 -0.0153 -0.0087 112 CYS B C   
4108 O O   . CYS B 112 ? 0.3072 0.3607 0.5144 0.0017  -0.0174 -0.0069 112 CYS B O   
4109 C CB  . CYS B 112 ? 0.2716 0.3441 0.4807 0.0005  -0.0134 -0.0159 112 CYS B CB  
4110 S SG  . CYS B 112 ? 0.3280 0.3993 0.5415 0.0068  -0.0164 -0.0147 112 CYS B SG  
4111 N N   . VAL B 113 ? 0.2221 0.2770 0.4280 -0.0034 -0.0138 -0.0079 113 VAL B N   
4112 C CA  . VAL B 113 ? 0.2229 0.2718 0.4316 -0.0024 -0.0141 -0.0054 113 VAL B CA  
4113 C C   . VAL B 113 ? 0.2817 0.3345 0.4927 0.0001  -0.0137 -0.0071 113 VAL B C   
4114 O O   . VAL B 113 ? 0.2887 0.3481 0.4993 -0.0008 -0.0127 -0.0100 113 VAL B O   
4115 C CB  . VAL B 113 ? 0.2803 0.3243 0.4891 -0.0060 -0.0122 -0.0045 113 VAL B CB  
4116 C CG1 . VAL B 113 ? 0.2829 0.3202 0.4966 -0.0044 -0.0124 -0.0021 113 VAL B CG1 
4117 C CG2 . VAL B 113 ? 0.2804 0.3217 0.4849 -0.0097 -0.0126 -0.0025 113 VAL B CG2 
4118 N N   . THR B 114 ? 0.2285 0.2781 0.4420 0.0028  -0.0148 -0.0050 114 THR B N   
4119 C CA  . THR B 114 ? 0.2096 0.2622 0.4240 0.0045  -0.0145 -0.0055 114 THR B CA  
4120 C C   . THR B 114 ? 0.2031 0.2516 0.4197 0.0037  -0.0123 -0.0051 114 THR B C   
4121 O O   . THR B 114 ? 0.1546 0.1975 0.3741 0.0032  -0.0118 -0.0038 114 THR B O   
4122 C CB  . THR B 114 ? 0.3348 0.3879 0.5500 0.0080  -0.0172 -0.0039 114 THR B CB  
4123 O OG1 . THR B 114 ? 0.3458 0.3931 0.5627 0.0088  -0.0184 -0.0016 114 THR B OG1 
4124 C CG2 . THR B 114 ? 0.2907 0.3489 0.5054 0.0093  -0.0185 -0.0057 114 THR B CG2 
4125 N N   . SER B 115 ? 0.1934 0.2450 0.4089 0.0034  -0.0110 -0.0063 115 SER B N   
4126 C CA  . SER B 115 ? 0.2107 0.2594 0.4283 0.0023  -0.0079 -0.0071 115 SER B CA  
4127 C C   . SER B 115 ? 0.2875 0.3334 0.5082 0.0046  -0.0087 -0.0041 115 SER B C   
4128 O O   . SER B 115 ? 0.2852 0.3331 0.5042 0.0045  -0.0079 -0.0036 115 SER B O   
4129 C CB  . SER B 115 ? 0.2656 0.3196 0.4791 -0.0004 -0.0057 -0.0102 115 SER B CB  
4130 O OG  . SER B 115 ? 0.4348 0.4908 0.6467 -0.0033 -0.0045 -0.0136 115 SER B OG  
4131 N N   . GLY B 116 ? 0.2578 0.2993 0.4824 0.0061  -0.0105 -0.0017 116 GLY B N   
4132 C CA  . GLY B 116 ? 0.2496 0.2888 0.4781 0.0080  -0.0122 0.0012  116 GLY B CA  
4133 C C   . GLY B 116 ? 0.3122 0.3522 0.5377 0.0096  -0.0158 0.0027  116 GLY B C   
4134 O O   . GLY B 116 ? 0.3098 0.3533 0.5311 0.0098  -0.0165 0.0014  116 GLY B O   
4135 N N   . SER B 117 ? 0.2795 0.3167 0.5079 0.0108  -0.0181 0.0049  117 SER B N   
4136 C CA  . SER B 117 ? 0.2769 0.3140 0.5031 0.0121  -0.0210 0.0054  117 SER B CA  
4137 C C   . SER B 117 ? 0.3471 0.3855 0.5717 0.0135  -0.0211 0.0061  117 SER B C   
4138 O O   . SER B 117 ? 0.3690 0.4079 0.5922 0.0151  -0.0231 0.0057  117 SER B O   
4139 C CB  . SER B 117 ? 0.3298 0.3635 0.5591 0.0122  -0.0235 0.0070  117 SER B CB  
4140 O OG  . SER B 117 ? 0.4637 0.4959 0.6973 0.0124  -0.0231 0.0088  117 SER B OG  
4141 N N   . GLN B 118 ? 0.2845 0.3236 0.5094 0.0126  -0.0189 0.0071  118 GLN B N   
4142 C CA  . GLN B 118 ? 0.2738 0.3140 0.4959 0.0129  -0.0192 0.0090  118 GLN B CA  
4143 C C   . GLN B 118 ? 0.3001 0.3450 0.5181 0.0137  -0.0204 0.0081  118 GLN B C   
4144 O O   . GLN B 118 ? 0.2850 0.3303 0.5019 0.0154  -0.0227 0.0103  118 GLN B O   
4145 C CB  . GLN B 118 ? 0.2865 0.3274 0.5085 0.0104  -0.0156 0.0096  118 GLN B CB  
4146 C CG  . GLN B 118 ? 0.2652 0.3064 0.4833 0.0097  -0.0159 0.0129  118 GLN B CG  
4147 C CD  . GLN B 118 ? 0.6394 0.6758 0.8598 0.0112  -0.0186 0.0162  118 GLN B CD  
4148 O OE1 . GLN B 118 ? 0.5832 0.6164 0.8086 0.0107  -0.0180 0.0164  118 GLN B OE1 
4149 N NE2 . GLN B 118 ? 0.6459 0.6815 0.8637 0.0131  -0.0218 0.0187  118 GLN B NE2 
4150 N N   . GLN B 119 ? 0.2641 0.3125 0.4807 0.0124  -0.0189 0.0051  119 GLN B N   
4151 C CA  . GLN B 119 ? 0.2660 0.3204 0.4798 0.0125  -0.0200 0.0036  119 GLN B CA  
4152 C C   . GLN B 119 ? 0.3487 0.4040 0.5647 0.0155  -0.0228 0.0031  119 GLN B C   
4153 O O   . GLN B 119 ? 0.3433 0.4025 0.5596 0.0175  -0.0252 0.0040  119 GLN B O   
4154 C CB  . GLN B 119 ? 0.2743 0.3317 0.4866 0.0095  -0.0173 0.0001  119 GLN B CB  
4155 C CG  . GLN B 119 ? 0.2763 0.3412 0.4851 0.0083  -0.0180 -0.0013 119 GLN B CG  
4156 C CD  . GLN B 119 ? 0.3648 0.4331 0.5731 0.0054  -0.0161 -0.0055 119 GLN B CD  
4157 O OE1 . GLN B 119 ? 0.2333 0.2983 0.4437 0.0049  -0.0147 -0.0069 119 GLN B OE1 
4158 N NE2 . GLN B 119 ? 0.2835 0.3585 0.4884 0.0031  -0.0162 -0.0071 119 GLN B NE2 
4159 N N   . GLY B 120 ? 0.3268 0.3788 0.5447 0.0157  -0.0226 0.0018  120 GLY B N   
4160 C CA  . GLY B 120 ? 0.3206 0.3732 0.5403 0.0178  -0.0241 0.0000  120 GLY B CA  
4161 C C   . GLY B 120 ? 0.3539 0.4036 0.5763 0.0210  -0.0265 0.0020  120 GLY B C   
4162 O O   . GLY B 120 ? 0.3477 0.4007 0.5727 0.0238  -0.0280 0.0011  120 GLY B O   
4163 N N   . LEU B 121 ? 0.3034 0.3472 0.5263 0.0207  -0.0267 0.0048  121 LEU B N   
4164 C CA  . LEU B 121 ? 0.3080 0.3471 0.5333 0.0229  -0.0287 0.0074  121 LEU B CA  
4165 C C   . LEU B 121 ? 0.3611 0.4030 0.5862 0.0249  -0.0305 0.0103  121 LEU B C   
4166 O O   . LEU B 121 ? 0.3805 0.4212 0.6093 0.0283  -0.0329 0.0108  121 LEU B O   
4167 C CB  . LEU B 121 ? 0.3090 0.3426 0.5345 0.0209  -0.0280 0.0101  121 LEU B CB  
4168 C CG  . LEU B 121 ? 0.3593 0.3898 0.5865 0.0194  -0.0278 0.0084  121 LEU B CG  
4169 C CD1 . LEU B 121 ? 0.3510 0.3795 0.5797 0.0170  -0.0266 0.0108  121 LEU B CD1 
4170 C CD2 . LEU B 121 ? 0.4098 0.4359 0.6393 0.0208  -0.0296 0.0068  121 LEU B CD2 
4171 N N   . CYS B 122 ? 0.3018 0.3476 0.5228 0.0226  -0.0296 0.0120  122 CYS B N   
4172 C CA  . CYS B 122 ? 0.3150 0.3647 0.5337 0.0232  -0.0318 0.0153  122 CYS B CA  
4173 C C   . CYS B 122 ? 0.3206 0.3766 0.5428 0.0264  -0.0344 0.0137  122 CYS B C   
4174 O O   . CYS B 122 ? 0.3059 0.3616 0.5311 0.0297  -0.0380 0.0171  122 CYS B O   
4175 C CB  . CYS B 122 ? 0.3369 0.3905 0.5495 0.0189  -0.0294 0.0155  122 CYS B CB  
4176 S SG  . CYS B 122 ? 0.4014 0.4622 0.6089 0.0181  -0.0325 0.0191  122 CYS B SG  
4177 N N   . LYS B 123 ? 0.2609 0.3226 0.4835 0.0254  -0.0327 0.0088  123 LYS B N   
4178 C CA  . LYS B 123 ? 0.2536 0.3232 0.4806 0.0277  -0.0343 0.0062  123 LYS B CA  
4179 C C   . LYS B 123 ? 0.3039 0.3709 0.5383 0.0323  -0.0356 0.0047  123 LYS B C   
4180 O O   . LYS B 123 ? 0.2941 0.3663 0.5347 0.0360  -0.0383 0.0048  123 LYS B O   
4181 C CB  . LYS B 123 ? 0.2683 0.3434 0.4936 0.0244  -0.0312 0.0011  123 LYS B CB  
4182 C CG  . LYS B 123 ? 0.3567 0.4338 0.5757 0.0196  -0.0292 0.0010  123 LYS B CG  
4183 C CD  . LYS B 123 ? 0.4211 0.5053 0.6376 0.0187  -0.0318 0.0032  123 LYS B CD  
4184 C CE  . LYS B 123 ? 0.3605 0.4412 0.5701 0.0154  -0.0305 0.0059  123 LYS B CE  
4185 N NZ  . LYS B 123 ? 0.4569 0.5445 0.6625 0.0141  -0.0338 0.0088  123 LYS B NZ  
4186 N N   . VAL B 124 ? 0.2493 0.3085 0.4838 0.0320  -0.0337 0.0032  124 VAL B N   
4187 C CA  . VAL B 124 ? 0.2398 0.2950 0.4803 0.0354  -0.0339 0.0005  124 VAL B CA  
4188 C C   . VAL B 124 ? 0.3093 0.3593 0.5544 0.0394  -0.0374 0.0052  124 VAL B C   
4189 O O   . VAL B 124 ? 0.3301 0.3811 0.5832 0.0439  -0.0389 0.0037  124 VAL B O   
4190 C CB  . VAL B 124 ? 0.2744 0.3233 0.5121 0.0327  -0.0314 -0.0022 124 VAL B CB  
4191 C CG1 . VAL B 124 ? 0.2792 0.3217 0.5219 0.0354  -0.0319 -0.0044 124 VAL B CG1 
4192 C CG2 . VAL B 124 ? 0.2597 0.3139 0.4944 0.0297  -0.0287 -0.0068 124 VAL B CG2 
4193 N N   . PHE B 125 ? 0.2451 0.2894 0.4856 0.0375  -0.0384 0.0109  125 PHE B N   
4194 C CA  . PHE B 125 ? 0.2429 0.2812 0.4863 0.0402  -0.0417 0.0167  125 PHE B CA  
4195 C C   . PHE B 125 ? 0.2922 0.3370 0.5389 0.0436  -0.0458 0.0202  125 PHE B C   
4196 O O   . PHE B 125 ? 0.2914 0.3330 0.5459 0.0484  -0.0489 0.0223  125 PHE B O   
4197 C CB  . PHE B 125 ? 0.2629 0.2956 0.4994 0.0362  -0.0412 0.0221  125 PHE B CB  
4198 C CG  . PHE B 125 ? 0.2744 0.3004 0.5096 0.0333  -0.0383 0.0201  125 PHE B CG  
4199 C CD1 . PHE B 125 ? 0.3072 0.3322 0.5370 0.0289  -0.0362 0.0225  125 PHE B CD1 
4200 C CD2 . PHE B 125 ? 0.2997 0.3210 0.5397 0.0347  -0.0376 0.0156  125 PHE B CD2 
4201 C CE1 . PHE B 125 ? 0.3154 0.3355 0.5458 0.0264  -0.0342 0.0210  125 PHE B CE1 
4202 C CE2 . PHE B 125 ? 0.3234 0.3395 0.5623 0.0316  -0.0358 0.0140  125 PHE B CE2 
4203 C CZ  . PHE B 125 ? 0.2961 0.3119 0.5308 0.0276  -0.0344 0.0170  125 PHE B CZ  
4204 N N   . GLU B 126 ? 0.2590 0.3132 0.5007 0.0410  -0.0460 0.0205  126 GLU B N   
4205 C CA  . GLU B 126 ? 0.2750 0.3379 0.5187 0.0430  -0.0504 0.0238  126 GLU B CA  
4206 C C   . GLU B 126 ? 0.3297 0.3995 0.5850 0.0482  -0.0517 0.0192  126 GLU B C   
4207 O O   . GLU B 126 ? 0.3264 0.4008 0.5885 0.0523  -0.0567 0.0229  126 GLU B O   
4208 C CB  . GLU B 126 ? 0.2910 0.3620 0.5255 0.0376  -0.0495 0.0239  126 GLU B CB  
4209 C CG  . GLU B 126 ? 0.4297 0.4955 0.6542 0.0331  -0.0489 0.0291  126 GLU B CG  
4210 C CD  . GLU B 126 ? 0.7424 0.8147 0.9572 0.0272  -0.0471 0.0286  126 GLU B CD  
4211 O OE1 . GLU B 126 ? 0.7781 0.8466 0.9852 0.0234  -0.0459 0.0323  126 GLU B OE1 
4212 O OE2 . GLU B 126 ? 0.6592 0.7403 0.8741 0.0259  -0.0464 0.0240  126 GLU B OE2 
4213 N N   . MET B 127 ? 0.2670 0.3379 0.5247 0.0477  -0.0471 0.0114  127 MET B N   
4214 C CA  . MET B 127 ? 0.2521 0.3298 0.5202 0.0514  -0.0463 0.0053  127 MET B CA  
4215 C C   . MET B 127 ? 0.3346 0.4056 0.6136 0.0576  -0.0479 0.0053  127 MET B C   
4216 O O   . MET B 127 ? 0.3508 0.4284 0.6415 0.0629  -0.0503 0.0042  127 MET B O   
4217 C CB  . MET B 127 ? 0.2671 0.3461 0.5313 0.0474  -0.0404 -0.0022 127 MET B CB  
4218 C CG  . MET B 127 ? 0.3101 0.3934 0.5836 0.0502  -0.0378 -0.0096 127 MET B CG  
4219 S SD  . MET B 127 ? 0.3619 0.4443 0.6275 0.0443  -0.0315 -0.0165 127 MET B SD  
4220 C CE  . MET B 127 ? 0.3184 0.3864 0.5812 0.0444  -0.0308 -0.0161 127 MET B CE  
4221 N N   . ILE B 128 ? 0.2759 0.3341 0.5521 0.0571  -0.0468 0.0066  128 ILE B N   
4222 C CA  . ILE B 128 ? 0.2812 0.3300 0.5666 0.0619  -0.0474 0.0057  128 ILE B CA  
4223 C C   . ILE B 128 ? 0.3459 0.3881 0.6363 0.0661  -0.0531 0.0145  128 ILE B C   
4224 O O   . ILE B 128 ? 0.3502 0.3921 0.6537 0.0725  -0.0556 0.0142  128 ILE B O   
4225 C CB  . ILE B 128 ? 0.3149 0.3536 0.5949 0.0582  -0.0432 0.0019  128 ILE B CB  
4226 C CG1 . ILE B 128 ? 0.3096 0.3543 0.5855 0.0545  -0.0383 -0.0063 128 ILE B CG1 
4227 C CG2 . ILE B 128 ? 0.3357 0.3632 0.6245 0.0623  -0.0435 0.0004  128 ILE B CG2 
4228 C CD1 . ILE B 128 ? 0.4613 0.4990 0.7282 0.0492  -0.0356 -0.0075 128 ILE B CD1 
4229 N N   . ILE B 129 ? 0.2953 0.3315 0.5758 0.0623  -0.0549 0.0222  129 ILE B N   
4230 C CA  . ILE B 129 ? 0.2971 0.3247 0.5791 0.0644  -0.0598 0.0316  129 ILE B CA  
4231 C C   . ILE B 129 ? 0.3434 0.3772 0.6301 0.0683  -0.0665 0.0389  129 ILE B C   
4232 O O   . ILE B 129 ? 0.3545 0.3981 0.6338 0.0653  -0.0683 0.0418  129 ILE B O   
4233 C CB  . ILE B 129 ? 0.3361 0.3550 0.6061 0.0583  -0.0585 0.0368  129 ILE B CB  
4234 C CG1 . ILE B 129 ? 0.3291 0.3400 0.5980 0.0556  -0.0534 0.0305  129 ILE B CG1 
4235 C CG2 . ILE B 129 ? 0.3602 0.3701 0.6304 0.0595  -0.0635 0.0475  129 ILE B CG2 
4236 C CD1 . ILE B 129 ? 0.3899 0.4023 0.6474 0.0489  -0.0500 0.0301  129 ILE B CD1 
4237 N N   . ASN B 130 ? 0.2944 0.3215 0.5935 0.0749  -0.0704 0.0423  130 ASN B N   
4238 C CA  . ASN B 130 ? 0.3042 0.3342 0.6099 0.0796  -0.0784 0.0514  130 ASN B CA  
4239 C C   . ASN B 130 ? 0.3915 0.4064 0.6927 0.0784  -0.0814 0.0616  130 ASN B C   
4240 O O   . ASN B 130 ? 0.3883 0.3905 0.6906 0.0777  -0.0776 0.0588  130 ASN B O   
4241 C CB  . ASN B 130 ? 0.2766 0.3089 0.6025 0.0887  -0.0803 0.0474  130 ASN B CB  
4242 C CG  . ASN B 130 ? 0.5567 0.6056 0.8888 0.0900  -0.0782 0.0387  130 ASN B CG  
4243 O OD1 . ASN B 130 ? 0.3392 0.4011 0.6668 0.0880  -0.0813 0.0415  130 ASN B OD1 
4244 N ND2 . ASN B 130 ? 0.5783 0.6270 0.9206 0.0930  -0.0726 0.0278  130 ASN B ND2 
4245 N N   . PRO B 131 ? 0.3561 0.3721 0.6518 0.0775  -0.0882 0.0735  131 PRO B N   
4246 C CA  . PRO B 131 ? 0.3602 0.3612 0.6505 0.0753  -0.0907 0.0838  131 PRO B CA  
4247 C C   . PRO B 131 ? 0.4097 0.3961 0.7156 0.0821  -0.0918 0.0841  131 PRO B C   
4248 O O   . PRO B 131 ? 0.3981 0.3868 0.7200 0.0903  -0.0963 0.0844  131 PRO B O   
4249 C CB  . PRO B 131 ? 0.3898 0.3971 0.6730 0.0740  -0.0987 0.0961  131 PRO B CB  
4250 C CG  . PRO B 131 ? 0.4323 0.4581 0.7115 0.0722  -0.0984 0.0908  131 PRO B CG  
4251 C CD  . PRO B 131 ? 0.3653 0.3962 0.6582 0.0773  -0.0940 0.0783  131 PRO B CD  
4252 N N   . GLY B 132 ? 0.3703 0.3427 0.6726 0.0785  -0.0872 0.0826  132 GLY B N   
4253 C CA  . GLY B 132 ? 0.3823 0.3385 0.6976 0.0832  -0.0870 0.0818  132 GLY B CA  
4254 C C   . GLY B 132 ? 0.4184 0.3722 0.7417 0.0847  -0.0799 0.0674  132 GLY B C   
4255 O O   . GLY B 132 ? 0.4044 0.3453 0.7395 0.0887  -0.0791 0.0648  132 GLY B O   
4256 N N   . ASP B 133 ? 0.3782 0.3439 0.6947 0.0811  -0.0746 0.0579  133 ASP B N   
4257 C CA  . ASP B 133 ? 0.3678 0.3332 0.6886 0.0811  -0.0678 0.0444  133 ASP B CA  
4258 C C   . ASP B 133 ? 0.4440 0.3978 0.7571 0.0746  -0.0636 0.0427  133 ASP B C   
4259 O O   . ASP B 133 ? 0.4444 0.3967 0.7451 0.0684  -0.0638 0.0493  133 ASP B O   
4260 C CB  . ASP B 133 ? 0.3709 0.3531 0.6864 0.0790  -0.0644 0.0366  133 ASP B CB  
4261 C CG  . ASP B 133 ? 0.5461 0.5413 0.8725 0.0853  -0.0666 0.0338  133 ASP B CG  
4262 O OD1 . ASP B 133 ? 0.5807 0.5724 0.9223 0.0928  -0.0705 0.0359  133 ASP B OD1 
4263 O OD2 . ASP B 133 ? 0.5803 0.5892 0.9016 0.0828  -0.0644 0.0290  133 ASP B OD2 
4264 N N   . ASN B 134 ? 0.4062 0.3525 0.7267 0.0757  -0.0595 0.0332  134 ASN B N   
4265 C CA  . ASN B 134 ? 0.4039 0.3401 0.7183 0.0694  -0.0558 0.0304  134 ASN B CA  
4266 C C   . ASN B 134 ? 0.4431 0.3893 0.7481 0.0639  -0.0510 0.0221  134 ASN B C   
4267 O O   . ASN B 134 ? 0.4222 0.3774 0.7303 0.0662  -0.0486 0.0135  134 ASN B O   
4268 C CB  . ASN B 134 ? 0.4213 0.3436 0.7480 0.0725  -0.0542 0.0244  134 ASN B CB  
4269 C CG  . ASN B 134 ? 0.6829 0.5913 1.0186 0.0767  -0.0589 0.0338  134 ASN B CG  
4270 O OD1 . ASN B 134 ? 0.6145 0.5177 0.9429 0.0735  -0.0623 0.0455  134 ASN B OD1 
4271 N ND2 . ASN B 134 ? 0.5545 0.4558 0.9062 0.0837  -0.0589 0.0287  134 ASN B ND2 
4272 N N   . VAL B 135 ? 0.3999 0.3449 0.6936 0.0567  -0.0496 0.0250  135 VAL B N   
4273 C CA  . VAL B 135 ? 0.3813 0.3346 0.6665 0.0513  -0.0458 0.0186  135 VAL B CA  
4274 C C   . VAL B 135 ? 0.4359 0.3807 0.7180 0.0453  -0.0437 0.0167  135 VAL B C   
4275 O O   . VAL B 135 ? 0.4628 0.3984 0.7444 0.0430  -0.0450 0.0236  135 VAL B O   
4276 C CB  . VAL B 135 ? 0.4140 0.3802 0.6896 0.0489  -0.0460 0.0221  135 VAL B CB  
4277 C CG1 . VAL B 135 ? 0.4087 0.3850 0.6878 0.0540  -0.0477 0.0217  135 VAL B CG1 
4278 C CG2 . VAL B 135 ? 0.4154 0.3791 0.6839 0.0450  -0.0476 0.0321  135 VAL B CG2 
4279 N N   . LEU B 136 ? 0.3546 0.3026 0.6346 0.0424  -0.0406 0.0076  136 LEU B N   
4280 C CA  . LEU B 136 ? 0.3422 0.2843 0.6199 0.0364  -0.0390 0.0047  136 LEU B CA  
4281 C C   . LEU B 136 ? 0.3816 0.3319 0.6506 0.0309  -0.0383 0.0066  136 LEU B C   
4282 O O   . LEU B 136 ? 0.3628 0.3237 0.6273 0.0309  -0.0375 0.0040  136 LEU B O   
4283 C CB  . LEU B 136 ? 0.3458 0.2855 0.6270 0.0361  -0.0367 -0.0066 136 LEU B CB  
4284 C CG  . LEU B 136 ? 0.4088 0.3384 0.7008 0.0412  -0.0364 -0.0105 136 LEU B CG  
4285 C CD1 . LEU B 136 ? 0.4149 0.3473 0.7089 0.0415  -0.0331 -0.0229 136 LEU B CD1 
4286 C CD2 . LEU B 136 ? 0.4309 0.3454 0.7269 0.0388  -0.0372 -0.0074 136 LEU B CD2 
4287 N N   . LEU B 137 ? 0.3562 0.3014 0.6236 0.0260  -0.0384 0.0109  137 LEU B N   
4288 C CA  . LEU B 137 ? 0.3410 0.2934 0.6026 0.0209  -0.0376 0.0134  137 LEU B CA  
4289 C C   . LEU B 137 ? 0.4195 0.3652 0.6829 0.0152  -0.0372 0.0138  137 LEU B C   
4290 O O   . LEU B 137 ? 0.4231 0.3576 0.6911 0.0150  -0.0376 0.0146  137 LEU B O   
4291 C CB  . LEU B 137 ? 0.3350 0.2912 0.5931 0.0220  -0.0381 0.0219  137 LEU B CB  
4292 C CG  . LEU B 137 ? 0.3884 0.3527 0.6412 0.0180  -0.0366 0.0247  137 LEU B CG  
4293 C CD1 . LEU B 137 ? 0.3894 0.3629 0.6378 0.0207  -0.0365 0.0263  137 LEU B CD1 
4294 C CD2 . LEU B 137 ? 0.4240 0.3834 0.6763 0.0140  -0.0359 0.0315  137 LEU B CD2 
4295 N N   . ASP B 138 ? 0.3944 0.3470 0.6553 0.0105  -0.0365 0.0134  138 ASP B N   
4296 C CA  . ASP B 138 ? 0.4075 0.3566 0.6710 0.0045  -0.0362 0.0138  138 ASP B CA  
4297 C C   . ASP B 138 ? 0.4580 0.4114 0.7204 0.0013  -0.0347 0.0208  138 ASP B C   
4298 O O   . ASP B 138 ? 0.4546 0.4180 0.7144 0.0016  -0.0339 0.0215  138 ASP B O   
4299 C CB  . ASP B 138 ? 0.4398 0.3936 0.7036 0.0010  -0.0370 0.0067  138 ASP B CB  
4300 C CG  . ASP B 138 ? 0.7057 0.6714 0.9655 0.0018  -0.0373 0.0053  138 ASP B CG  
4301 O OD1 . ASP B 138 ? 0.7456 0.7143 1.0021 0.0063  -0.0371 0.0038  138 ASP B OD1 
4302 O OD2 . ASP B 138 ? 0.8051 0.7770 1.0658 -0.0020 -0.0380 0.0055  138 ASP B OD2 
4303 N N   . GLU B 139 ? 0.4280 0.3735 0.6924 -0.0018 -0.0340 0.0258  139 GLU B N   
4304 C CA  . GLU B 139 ? 0.4291 0.3783 0.6926 -0.0060 -0.0317 0.0319  139 GLU B CA  
4305 C C   . GLU B 139 ? 0.4996 0.4519 0.7684 -0.0120 -0.0310 0.0290  139 GLU B C   
4306 O O   . GLU B 139 ? 0.5014 0.4468 0.7742 -0.0144 -0.0323 0.0254  139 GLU B O   
4307 C CB  . GLU B 139 ? 0.4609 0.4000 0.7232 -0.0072 -0.0313 0.0394  139 GLU B CB  
4308 C CG  . GLU B 139 ? 0.6237 0.5622 0.8805 -0.0023 -0.0324 0.0448  139 GLU B CG  
4309 C CD  . GLU B 139 ? 0.9639 0.8922 1.2189 -0.0041 -0.0329 0.0536  139 GLU B CD  
4310 O OE1 . GLU B 139 ? 0.8415 0.7738 1.0901 -0.0063 -0.0315 0.0601  139 GLU B OE1 
4311 O OE2 . GLU B 139 ? 0.9717 0.8873 1.2313 -0.0037 -0.0345 0.0540  139 GLU B OE2 
4312 N N   . PRO B 140 ? 0.4437 0.4065 0.7137 -0.0147 -0.0289 0.0299  140 PRO B N   
4313 C CA  . PRO B 140 ? 0.4227 0.3940 0.6886 -0.0128 -0.0266 0.0329  140 PRO B CA  
4314 C C   . PRO B 140 ? 0.4192 0.3972 0.6824 -0.0078 -0.0280 0.0290  140 PRO B C   
4315 O O   . PRO B 140 ? 0.3760 0.3564 0.6415 -0.0072 -0.0303 0.0240  140 PRO B O   
4316 C CB  . PRO B 140 ? 0.4489 0.4276 0.7202 -0.0182 -0.0234 0.0337  140 PRO B CB  
4317 C CG  . PRO B 140 ? 0.5028 0.4819 0.7817 -0.0212 -0.0257 0.0293  140 PRO B CG  
4318 C CD  . PRO B 140 ? 0.4560 0.4235 0.7332 -0.0202 -0.0287 0.0274  140 PRO B CD  
4319 N N   . ALA B 141 ? 0.3915 0.3723 0.6489 -0.0047 -0.0269 0.0317  141 ALA B N   
4320 C CA  . ALA B 141 ? 0.3879 0.3745 0.6420 -0.0003 -0.0278 0.0288  141 ALA B CA  
4321 C C   . ALA B 141 ? 0.4653 0.4604 0.7169 -0.0005 -0.0247 0.0301  141 ALA B C   
4322 O O   . ALA B 141 ? 0.4527 0.4489 0.7037 -0.0038 -0.0216 0.0336  141 ALA B O   
4323 C CB  . ALA B 141 ? 0.3975 0.3788 0.6475 0.0042  -0.0299 0.0295  141 ALA B CB  
4324 N N   . TYR B 142 ? 0.4462 0.4471 0.6963 0.0024  -0.0252 0.0269  142 TYR B N   
4325 C CA  . TYR B 142 ? 0.4513 0.4595 0.6994 0.0025  -0.0222 0.0270  142 TYR B CA  
4326 C C   . TYR B 142 ? 0.5005 0.5078 0.7415 0.0024  -0.0207 0.0309  142 TYR B C   
4327 O O   . TYR B 142 ? 0.5187 0.5226 0.7557 0.0053  -0.0234 0.0322  142 TYR B O   
4328 C CB  . TYR B 142 ? 0.4650 0.4774 0.7123 0.0056  -0.0235 0.0231  142 TYR B CB  
4329 C CG  . TYR B 142 ? 0.4984 0.5167 0.7428 0.0061  -0.0207 0.0226  142 TYR B CG  
4330 C CD1 . TYR B 142 ? 0.5250 0.5448 0.7642 0.0088  -0.0216 0.0212  142 TYR B CD1 
4331 C CD2 . TYR B 142 ? 0.5087 0.5314 0.7566 0.0036  -0.0166 0.0226  142 TYR B CD2 
4332 C CE1 . TYR B 142 ? 0.5295 0.5543 0.7661 0.0086  -0.0190 0.0200  142 TYR B CE1 
4333 C CE2 . TYR B 142 ? 0.5126 0.5399 0.7580 0.0037  -0.0134 0.0209  142 TYR B CE2 
4334 C CZ  . TYR B 142 ? 0.5920 0.6202 0.8315 0.0061  -0.0148 0.0197  142 TYR B CZ  
4335 O OH  . TYR B 142 ? 0.5984 0.6308 0.8354 0.0056  -0.0117 0.0176  142 TYR B OH  
4336 N N   . SER B 143 ? 0.4286 0.4394 0.6686 -0.0013 -0.0165 0.0329  143 SER B N   
4337 C CA  . SER B 143 ? 0.4211 0.4321 0.6527 -0.0030 -0.0149 0.0371  143 SER B CA  
4338 C C   . SER B 143 ? 0.4224 0.4369 0.6475 0.0001  -0.0163 0.0363  143 SER B C   
4339 O O   . SER B 143 ? 0.4146 0.4273 0.6330 0.0003  -0.0182 0.0406  143 SER B O   
4340 C CB  . SER B 143 ? 0.4733 0.4892 0.7048 -0.0082 -0.0091 0.0374  143 SER B CB  
4341 O OG  . SER B 143 ? 0.6259 0.6491 0.8614 -0.0077 -0.0059 0.0322  143 SER B OG  
4342 N N   . GLY B 144 ? 0.3402 0.3594 0.5676 0.0022  -0.0159 0.0313  144 GLY B N   
4343 C CA  . GLY B 144 ? 0.3320 0.3552 0.5545 0.0047  -0.0170 0.0296  144 GLY B CA  
4344 C C   . GLY B 144 ? 0.3816 0.4013 0.6026 0.0086  -0.0220 0.0311  144 GLY B C   
4345 O O   . GLY B 144 ? 0.3781 0.4005 0.5939 0.0097  -0.0235 0.0326  144 GLY B O   
4346 N N   . THR B 145 ? 0.3299 0.3441 0.5562 0.0106  -0.0244 0.0304  145 THR B N   
4347 C CA  . THR B 145 ? 0.3288 0.3394 0.5556 0.0147  -0.0284 0.0308  145 THR B CA  
4348 C C   . THR B 145 ? 0.3910 0.3962 0.6158 0.0147  -0.0304 0.0370  145 THR B C   
4349 O O   . THR B 145 ? 0.3869 0.3923 0.6105 0.0180  -0.0335 0.0390  145 THR B O   
4350 C CB  . THR B 145 ? 0.3764 0.3845 0.6084 0.0168  -0.0299 0.0261  145 THR B CB  
4351 O OG1 . THR B 145 ? 0.4018 0.4021 0.6370 0.0186  -0.0322 0.0273  145 THR B OG1 
4352 C CG2 . THR B 145 ? 0.3215 0.3306 0.5566 0.0142  -0.0282 0.0234  145 THR B CG2 
4353 N N   . LEU B 146 ? 0.3434 0.3441 0.5682 0.0109  -0.0287 0.0405  146 LEU B N   
4354 C CA  . LEU B 146 ? 0.3347 0.3289 0.5569 0.0098  -0.0305 0.0477  146 LEU B CA  
4355 C C   . LEU B 146 ? 0.3650 0.3644 0.5786 0.0086  -0.0309 0.0522  146 LEU B C   
4356 O O   . LEU B 146 ? 0.3451 0.3416 0.5568 0.0109  -0.0351 0.0575  146 LEU B O   
4357 C CB  . LEU B 146 ? 0.3314 0.3208 0.5552 0.0047  -0.0278 0.0501  146 LEU B CB  
4358 C CG  . LEU B 146 ? 0.3637 0.3486 0.5956 0.0046  -0.0277 0.0458  146 LEU B CG  
4359 C CD1 . LEU B 146 ? 0.3664 0.3507 0.6002 -0.0014 -0.0241 0.0473  146 LEU B CD1 
4360 C CD2 . LEU B 146 ? 0.3597 0.3344 0.5957 0.0079  -0.0315 0.0466  146 LEU B CD2 
4361 N N   . GLN B 147 ? 0.3379 0.3455 0.5471 0.0053  -0.0269 0.0496  147 GLN B N   
4362 C CA  . GLN B 147 ? 0.3557 0.3696 0.5556 0.0030  -0.0266 0.0523  147 GLN B CA  
4363 C C   . GLN B 147 ? 0.4021 0.4207 0.6012 0.0075  -0.0308 0.0510  147 GLN B C   
4364 O O   . GLN B 147 ? 0.3831 0.4051 0.5751 0.0066  -0.0333 0.0554  147 GLN B O   
4365 C CB  . GLN B 147 ? 0.3761 0.3967 0.5729 -0.0020 -0.0203 0.0483  147 GLN B CB  
4366 C CG  . GLN B 147 ? 0.6533 0.6714 0.8488 -0.0078 -0.0159 0.0512  147 GLN B CG  
4367 C CD  . GLN B 147 ? 0.9745 0.9893 1.1609 -0.0114 -0.0177 0.0598  147 GLN B CD  
4368 O OE1 . GLN B 147 ? 0.8889 0.8953 1.0772 -0.0120 -0.0194 0.0652  147 GLN B OE1 
4369 N NE2 . GLN B 147 ? 0.9395 0.9601 1.1153 -0.0140 -0.0179 0.0619  147 GLN B NE2 
4370 N N   . SER B 148 ? 0.3655 0.3846 0.5718 0.0120  -0.0316 0.0453  148 SER B N   
4371 C CA  . SER B 148 ? 0.3540 0.3779 0.5618 0.0163  -0.0350 0.0431  148 SER B CA  
4372 C C   . SER B 148 ? 0.4082 0.4270 0.6201 0.0209  -0.0404 0.0476  148 SER B C   
4373 O O   . SER B 148 ? 0.4186 0.4421 0.6291 0.0231  -0.0442 0.0502  148 SER B O   
4374 C CB  . SER B 148 ? 0.3787 0.4043 0.5922 0.0184  -0.0332 0.0356  148 SER B CB  
4375 O OG  . SER B 148 ? 0.4797 0.5119 0.6902 0.0156  -0.0296 0.0314  148 SER B OG  
4376 N N   . LEU B 149 ? 0.3445 0.3538 0.5624 0.0225  -0.0409 0.0483  149 LEU B N   
4377 C CA  . LEU B 149 ? 0.3451 0.3477 0.5692 0.0274  -0.0454 0.0517  149 LEU B CA  
4378 C C   . LEU B 149 ? 0.4538 0.4522 0.6741 0.0267  -0.0493 0.0616  149 LEU B C   
4379 O O   . LEU B 149 ? 0.4541 0.4514 0.6788 0.0316  -0.0543 0.0651  149 LEU B O   
4380 C CB  . LEU B 149 ? 0.3349 0.3284 0.5669 0.0289  -0.0444 0.0480  149 LEU B CB  
4381 C CG  . LEU B 149 ? 0.3573 0.3541 0.5929 0.0298  -0.0417 0.0387  149 LEU B CG  
4382 C CD1 . LEU B 149 ? 0.3486 0.3365 0.5901 0.0299  -0.0410 0.0356  149 LEU B CD1 
4383 C CD2 . LEU B 149 ? 0.3485 0.3521 0.5874 0.0344  -0.0432 0.0345  149 LEU B CD2 
4384 N N   . HIS B 150 ? 0.4590 0.4550 0.6716 0.0206  -0.0469 0.0663  150 HIS B N   
4385 C CA  . HIS B 150 ? 0.4870 0.4783 0.6934 0.0181  -0.0500 0.0767  150 HIS B CA  
4386 C C   . HIS B 150 ? 0.4951 0.4931 0.6972 0.0201  -0.0557 0.0823  150 HIS B C   
4387 O O   . HIS B 150 ? 0.4994 0.4911 0.7045 0.0233  -0.0614 0.0899  150 HIS B O   
4388 C CB  . HIS B 150 ? 0.5260 0.5169 0.7237 0.0099  -0.0449 0.0792  150 HIS B CB  
4389 C CG  . HIS B 150 ? 0.6054 0.5933 0.7936 0.0057  -0.0475 0.0900  150 HIS B CG  
4390 N ND1 . HIS B 150 ? 0.6407 0.6376 0.8164 0.0003  -0.0463 0.0923  150 HIS B ND1 
4391 C CD2 . HIS B 150 ? 0.6509 0.6276 0.8400 0.0059  -0.0513 0.0991  150 HIS B CD2 
4392 C CE1 . HIS B 150 ? 0.6556 0.6471 0.8238 -0.0030 -0.0495 0.1031  150 HIS B CE1 
4393 N NE2 . HIS B 150 ? 0.6660 0.6449 0.8423 0.0004  -0.0529 0.1080  150 HIS B NE2 
4394 N N   . PRO B 151 ? 0.4176 0.4279 0.6138 0.0186  -0.0549 0.0787  151 PRO B N   
4395 C CA  . PRO B 151 ? 0.4195 0.4370 0.6121 0.0201  -0.0612 0.0840  151 PRO B CA  
4396 C C   . PRO B 151 ? 0.4419 0.4606 0.6470 0.0287  -0.0667 0.0829  151 PRO B C   
4397 O O   . PRO B 151 ? 0.4141 0.4377 0.6191 0.0311  -0.0733 0.0888  151 PRO B O   
4398 C CB  . PRO B 151 ? 0.4318 0.4616 0.6158 0.0155  -0.0575 0.0782  151 PRO B CB  
4399 C CG  . PRO B 151 ? 0.4713 0.4988 0.6534 0.0110  -0.0495 0.0724  151 PRO B CG  
4400 C CD  . PRO B 151 ? 0.4102 0.4283 0.6032 0.0152  -0.0487 0.0701  151 PRO B CD  
4401 N N   . LEU B 152 ? 0.3958 0.4111 0.6118 0.0331  -0.0640 0.0750  152 LEU B N   
4402 C CA  . LEU B 152 ? 0.3812 0.3981 0.6102 0.0410  -0.0673 0.0715  152 LEU B CA  
4403 C C   . LEU B 152 ? 0.4213 0.4274 0.6599 0.0465  -0.0723 0.0779  152 LEU B C   
4404 O O   . LEU B 152 ? 0.4291 0.4371 0.6800 0.0535  -0.0754 0.0755  152 LEU B O   
4405 C CB  . LEU B 152 ? 0.3629 0.3813 0.5981 0.0424  -0.0619 0.0601  152 LEU B CB  
4406 C CG  . LEU B 152 ? 0.3994 0.4287 0.6284 0.0387  -0.0578 0.0533  152 LEU B CG  
4407 C CD1 . LEU B 152 ? 0.4304 0.4571 0.6624 0.0381  -0.0523 0.0448  152 LEU B CD1 
4408 C CD2 . LEU B 152 ? 0.3843 0.4256 0.6167 0.0416  -0.0609 0.0512  152 LEU B CD2 
4409 N N   . GLY B 153 ? 0.3489 0.3441 0.5826 0.0433  -0.0730 0.0859  153 GLY B N   
4410 C CA  . GLY B 153 ? 0.3583 0.3411 0.6003 0.0477  -0.0779 0.0934  153 GLY B CA  
4411 C C   . GLY B 153 ? 0.4157 0.3904 0.6728 0.0539  -0.0764 0.0862  153 GLY B C   
4412 O O   . GLY B 153 ? 0.4457 0.4169 0.7152 0.0611  -0.0811 0.0884  153 GLY B O   
4413 N N   . CYS B 154 ? 0.3544 0.3268 0.6112 0.0512  -0.0698 0.0773  154 CYS B N   
4414 C CA  . CYS B 154 ? 0.3615 0.3266 0.6302 0.0553  -0.0673 0.0691  154 CYS B CA  
4415 C C   . CYS B 154 ? 0.4629 0.4129 0.7311 0.0517  -0.0654 0.0715  154 CYS B C   
4416 O O   . CYS B 154 ? 0.4790 0.4273 0.7366 0.0449  -0.0639 0.0768  154 CYS B O   
4417 C CB  . CYS B 154 ? 0.3532 0.3275 0.6213 0.0544  -0.0621 0.0572  154 CYS B CB  
4418 S SG  . CYS B 154 ? 0.3950 0.3724 0.6498 0.0453  -0.0563 0.0547  154 CYS B SG  
4419 N N   . ASN B 155 ? 0.4296 0.3690 0.7094 0.0557  -0.0648 0.0669  155 ASN B N   
4420 C CA  . ASN B 155 ? 0.4274 0.3520 0.7081 0.0520  -0.0628 0.0680  155 ASN B CA  
4421 C C   . ASN B 155 ? 0.4623 0.3890 0.7409 0.0477  -0.0569 0.0573  155 ASN B C   
4422 O O   . ASN B 155 ? 0.4492 0.3785 0.7344 0.0510  -0.0549 0.0473  155 ASN B O   
4423 C CB  . ASN B 155 ? 0.4318 0.3422 0.7264 0.0581  -0.0656 0.0691  155 ASN B CB  
4424 C CG  . ASN B 155 ? 0.8213 0.7288 1.1196 0.0629  -0.0727 0.0810  155 ASN B CG  
4425 O OD1 . ASN B 155 ? 0.8093 0.7131 1.0988 0.0587  -0.0755 0.0926  155 ASN B OD1 
4426 N ND2 . ASN B 155 ? 0.7119 0.6215 1.0236 0.0717  -0.0757 0.0784  155 ASN B ND2 
4427 N N   . ILE B 156 ? 0.4205 0.3473 0.6899 0.0401  -0.0541 0.0594  156 ILE B N   
4428 C CA  . ILE B 156 ? 0.4089 0.3378 0.6766 0.0355  -0.0494 0.0508  156 ILE B CA  
4429 C C   . ILE B 156 ? 0.4581 0.3726 0.7318 0.0334  -0.0484 0.0492  156 ILE B C   
4430 O O   . ILE B 156 ? 0.4392 0.3448 0.7110 0.0295  -0.0490 0.0568  156 ILE B O   
4431 C CB  . ILE B 156 ? 0.4391 0.3774 0.6965 0.0290  -0.0466 0.0523  156 ILE B CB  
4432 C CG1 . ILE B 156 ? 0.4246 0.3770 0.6766 0.0308  -0.0469 0.0516  156 ILE B CG1 
4433 C CG2 . ILE B 156 ? 0.4483 0.3873 0.7062 0.0245  -0.0429 0.0448  156 ILE B CG2 
4434 C CD1 . ILE B 156 ? 0.4227 0.3827 0.6650 0.0252  -0.0447 0.0552  156 ILE B CD1 
4435 N N   . ILE B 157 ? 0.4355 0.3476 0.7159 0.0354  -0.0468 0.0390  157 ILE B N   
4436 C CA  . ILE B 157 ? 0.4405 0.3398 0.7269 0.0331  -0.0455 0.0347  157 ILE B CA  
4437 C C   . ILE B 157 ? 0.4953 0.4000 0.7766 0.0261  -0.0423 0.0287  157 ILE B C   
4438 O O   . ILE B 157 ? 0.4798 0.3942 0.7591 0.0265  -0.0409 0.0209  157 ILE B O   
4439 C CB  . ILE B 157 ? 0.4826 0.3763 0.7796 0.0394  -0.0455 0.0264  157 ILE B CB  
4440 C CG1 . ILE B 157 ? 0.4984 0.3905 0.8023 0.0476  -0.0492 0.0323  157 ILE B CG1 
4441 C CG2 . ILE B 157 ? 0.4933 0.3718 0.7967 0.0366  -0.0440 0.0220  157 ILE B CG2 
4442 C CD1 . ILE B 157 ? 0.5840 0.4767 0.8992 0.0551  -0.0486 0.0230  157 ILE B CD1 
4443 N N   . ASN B 158 ? 0.4749 0.3740 0.7543 0.0196  -0.0415 0.0328  158 ASN B N   
4444 C CA  . ASN B 158 ? 0.4762 0.3811 0.7526 0.0129  -0.0392 0.0280  158 ASN B CA  
4445 C C   . ASN B 158 ? 0.5349 0.4347 0.8162 0.0110  -0.0383 0.0179  158 ASN B C   
4446 O O   . ASN B 158 ? 0.5534 0.4398 0.8407 0.0110  -0.0385 0.0167  158 ASN B O   
4447 C CB  . ASN B 158 ? 0.4905 0.3939 0.7640 0.0062  -0.0381 0.0356  158 ASN B CB  
4448 C CG  . ASN B 158 ? 0.7849 0.6925 1.0589 -0.0007 -0.0363 0.0309  158 ASN B CG  
4449 O OD1 . ASN B 158 ? 0.7657 0.6852 1.0374 -0.0014 -0.0357 0.0264  158 ASN B OD1 
4450 N ND2 . ASN B 158 ? 0.7069 0.6046 0.9848 -0.0059 -0.0357 0.0318  158 ASN B ND2 
4451 N N   . VAL B 159 ? 0.4797 0.3899 0.7579 0.0092  -0.0375 0.0106  159 VAL B N   
4452 C CA  . VAL B 159 ? 0.4906 0.3988 0.7707 0.0061  -0.0368 0.0005  159 VAL B CA  
4453 C C   . VAL B 159 ? 0.5473 0.4589 0.8261 -0.0018 -0.0368 0.0008  159 VAL B C   
4454 O O   . VAL B 159 ? 0.5457 0.4680 0.8208 -0.0035 -0.0369 0.0047  159 VAL B O   
4455 C CB  . VAL B 159 ? 0.5462 0.4642 0.8230 0.0091  -0.0364 -0.0073 159 VAL B CB  
4456 C CG1 . VAL B 159 ? 0.5501 0.4662 0.8273 0.0051  -0.0358 -0.0180 159 VAL B CG1 
4457 C CG2 . VAL B 159 ? 0.5491 0.4664 0.8287 0.0171  -0.0363 -0.0073 159 VAL B CG2 
4458 N N   . ALA B 160 ? 0.5051 0.4079 0.7879 -0.0068 -0.0367 -0.0036 160 ALA B N   
4459 C CA  . ALA B 160 ? 0.4971 0.4036 0.7805 -0.0148 -0.0370 -0.0039 160 ALA B CA  
4460 C C   . ALA B 160 ? 0.5423 0.4630 0.8215 -0.0169 -0.0384 -0.0088 160 ALA B C   
4461 O O   . ALA B 160 ? 0.5311 0.4548 0.8070 -0.0147 -0.0388 -0.0155 160 ALA B O   
4462 C CB  . ALA B 160 ? 0.5199 0.4139 0.8085 -0.0199 -0.0368 -0.0087 160 ALA B CB  
4463 N N   . SER B 161 ? 0.4991 0.4288 0.7790 -0.0213 -0.0390 -0.0049 161 SER B N   
4464 C CA  . SER B 161 ? 0.4814 0.4244 0.7590 -0.0235 -0.0411 -0.0075 161 SER B CA  
4465 C C   . SER B 161 ? 0.5140 0.4617 0.7968 -0.0310 -0.0426 -0.0073 161 SER B C   
4466 O O   . SER B 161 ? 0.5173 0.4598 0.8053 -0.0345 -0.0411 -0.0036 161 SER B O   
4467 C CB  . SER B 161 ? 0.5141 0.4670 0.7884 -0.0188 -0.0406 -0.0024 161 SER B CB  
4468 O OG  . SER B 161 ? 0.6534 0.6074 0.9306 -0.0194 -0.0387 0.0051  161 SER B OG  
4469 N N   . ASP B 162 ? 0.4388 0.3969 0.7205 -0.0338 -0.0459 -0.0110 162 ASP B N   
4470 C CA  . ASP B 162 ? 0.4221 0.3877 0.7098 -0.0406 -0.0485 -0.0111 162 ASP B CA  
4471 C C   . ASP B 162 ? 0.4409 0.4212 0.7281 -0.0396 -0.0517 -0.0094 162 ASP B C   
4472 O O   . ASP B 162 ? 0.4362 0.4197 0.7193 -0.0338 -0.0506 -0.0067 162 ASP B O   
4473 C CB  . ASP B 162 ? 0.4535 0.4135 0.7416 -0.0470 -0.0505 -0.0187 162 ASP B CB  
4474 C CG  . ASP B 162 ? 0.5502 0.5118 0.8301 -0.0471 -0.0530 -0.0264 162 ASP B CG  
4475 O OD1 . ASP B 162 ? 0.5325 0.4969 0.8061 -0.0415 -0.0525 -0.0260 162 ASP B OD1 
4476 O OD2 . ASP B 162 ? 0.6317 0.5918 0.9112 -0.0536 -0.0553 -0.0331 162 ASP B OD2 
4477 N N   . GLU B 163 ? 0.3912 0.3803 0.6833 -0.0452 -0.0558 -0.0107 163 GLU B N   
4478 C CA  . GLU B 163 ? 0.3934 0.3961 0.6870 -0.0447 -0.0600 -0.0085 163 GLU B CA  
4479 C C   . GLU B 163 ? 0.4566 0.4609 0.7394 -0.0414 -0.0622 -0.0108 163 GLU B C   
4480 O O   . GLU B 163 ? 0.4677 0.4807 0.7505 -0.0388 -0.0643 -0.0072 163 GLU B O   
4481 C CB  . GLU B 163 ? 0.4188 0.4302 0.7197 -0.0519 -0.0654 -0.0100 163 GLU B CB  
4482 C CG  . GLU B 163 ? 0.5998 0.6065 0.9081 -0.0584 -0.0642 -0.0120 163 GLU B CG  
4483 C CD  . GLU B 163 ? 0.9115 0.9076 1.2138 -0.0630 -0.0646 -0.0195 163 GLU B CD  
4484 O OE1 . GLU B 163 ? 0.6674 0.6513 0.9708 -0.0636 -0.0601 -0.0203 163 GLU B OE1 
4485 O OE2 . GLU B 163 ? 0.9589 0.9586 1.2552 -0.0664 -0.0694 -0.0247 163 GLU B OE2 
4486 N N   . SER B 164 ? 0.3908 0.3867 0.6650 -0.0420 -0.0613 -0.0171 164 SER B N   
4487 C CA  . SER B 164 ? 0.3718 0.3689 0.6352 -0.0400 -0.0623 -0.0204 164 SER B CA  
4488 C C   . SER B 164 ? 0.3892 0.3794 0.6483 -0.0330 -0.0572 -0.0202 164 SER B C   
4489 O O   . SER B 164 ? 0.3787 0.3669 0.6295 -0.0317 -0.0563 -0.0251 164 SER B O   
4490 C CB  . SER B 164 ? 0.4261 0.4209 0.6831 -0.0462 -0.0648 -0.0288 164 SER B CB  
4491 O OG  . SER B 164 ? 0.5289 0.5303 0.7909 -0.0531 -0.0699 -0.0287 164 SER B OG  
4492 N N   . GLY B 165 ? 0.3249 0.3127 0.5896 -0.0289 -0.0539 -0.0146 165 GLY B N   
4493 C CA  . GLY B 165 ? 0.3176 0.3000 0.5798 -0.0225 -0.0497 -0.0130 165 GLY B CA  
4494 C C   . GLY B 165 ? 0.3962 0.3664 0.6581 -0.0215 -0.0470 -0.0172 165 GLY B C   
4495 O O   . GLY B 165 ? 0.4099 0.3736 0.6761 -0.0257 -0.0471 -0.0192 165 GLY B O   
4496 N N   . ILE B 166 ? 0.3521 0.3191 0.6102 -0.0159 -0.0446 -0.0185 166 ILE B N   
4497 C CA  . ILE B 166 ? 0.3539 0.3098 0.6133 -0.0132 -0.0421 -0.0223 166 ILE B CA  
4498 C C   . ILE B 166 ? 0.4319 0.3823 0.6912 -0.0184 -0.0427 -0.0309 166 ILE B C   
4499 O O   . ILE B 166 ? 0.4193 0.3762 0.6730 -0.0223 -0.0446 -0.0360 166 ILE B O   
4500 C CB  . ILE B 166 ? 0.3877 0.3454 0.6434 -0.0067 -0.0402 -0.0237 166 ILE B CB  
4501 C CG1 . ILE B 166 ? 0.3793 0.3381 0.6369 -0.0015 -0.0391 -0.0155 166 ILE B CG1 
4502 C CG2 . ILE B 166 ? 0.4136 0.3625 0.6708 -0.0045 -0.0379 -0.0315 166 ILE B CG2 
4503 C CD1 . ILE B 166 ? 0.4109 0.3751 0.6648 0.0039  -0.0379 -0.0158 166 ILE B CD1 
4504 N N   . VAL B 167 ? 0.4111 0.3494 0.6761 -0.0190 -0.0412 -0.0323 167 VAL B N   
4505 C CA  . VAL B 167 ? 0.4234 0.3543 0.6893 -0.0240 -0.0410 -0.0414 167 VAL B CA  
4506 C C   . VAL B 167 ? 0.5226 0.4468 0.7881 -0.0190 -0.0378 -0.0486 167 VAL B C   
4507 O O   . VAL B 167 ? 0.5522 0.4681 0.8234 -0.0131 -0.0358 -0.0453 167 VAL B O   
4508 C CB  . VAL B 167 ? 0.4605 0.3811 0.7338 -0.0282 -0.0409 -0.0392 167 VAL B CB  
4509 C CG1 . VAL B 167 ? 0.4653 0.3776 0.7397 -0.0339 -0.0405 -0.0496 167 VAL B CG1 
4510 C CG2 . VAL B 167 ? 0.4459 0.3748 0.7212 -0.0327 -0.0434 -0.0322 167 VAL B CG2 
4511 N N   . PRO B 168 ? 0.4704 0.3988 0.7296 -0.0214 -0.0372 -0.0581 168 PRO B N   
4512 C CA  . PRO B 168 ? 0.4730 0.3967 0.7332 -0.0166 -0.0332 -0.0660 168 PRO B CA  
4513 C C   . PRO B 168 ? 0.5368 0.4446 0.8064 -0.0147 -0.0304 -0.0707 168 PRO B C   
4514 O O   . PRO B 168 ? 0.5361 0.4391 0.8112 -0.0075 -0.0276 -0.0724 168 PRO B O   
4515 C CB  . PRO B 168 ? 0.5012 0.4329 0.7515 -0.0220 -0.0330 -0.0756 168 PRO B CB  
4516 C CG  . PRO B 168 ? 0.5509 0.4941 0.7945 -0.0270 -0.0378 -0.0693 168 PRO B CG  
4517 C CD  . PRO B 168 ? 0.4894 0.4282 0.7402 -0.0286 -0.0402 -0.0618 168 PRO B CD  
4518 N N   . ASP B 169 ? 0.5073 0.4068 0.7799 -0.0210 -0.0314 -0.0725 169 ASP B N   
4519 C CA  . ASP B 169 ? 0.5219 0.4043 0.8042 -0.0199 -0.0289 -0.0765 169 ASP B CA  
4520 C C   . ASP B 169 ? 0.5449 0.4186 0.8358 -0.0129 -0.0290 -0.0655 169 ASP B C   
4521 O O   . ASP B 169 ? 0.5429 0.4040 0.8425 -0.0078 -0.0267 -0.0679 169 ASP B O   
4522 C CB  . ASP B 169 ? 0.5627 0.4389 0.8455 -0.0295 -0.0298 -0.0818 169 ASP B CB  
4523 C CG  . ASP B 169 ? 0.8044 0.6828 1.0812 -0.0355 -0.0281 -0.0964 169 ASP B CG  
4524 O OD1 . ASP B 169 ? 0.8412 0.7096 1.1226 -0.0331 -0.0238 -0.1063 169 ASP B OD1 
4525 O OD2 . ASP B 169 ? 0.9138 0.8042 1.1813 -0.0425 -0.0312 -0.0980 169 ASP B OD2 
4526 N N   . SER B 170 ? 0.4815 0.3621 0.7701 -0.0125 -0.0317 -0.0536 170 SER B N   
4527 C CA  . SER B 170 ? 0.4759 0.3505 0.7698 -0.0068 -0.0322 -0.0421 170 SER B CA  
4528 C C   . SER B 170 ? 0.4952 0.3719 0.7910 0.0027  -0.0312 -0.0417 170 SER B C   
4529 O O   . SER B 170 ? 0.4899 0.3558 0.7937 0.0084  -0.0308 -0.0384 170 SER B O   
4530 C CB  . SER B 170 ? 0.5180 0.4024 0.8074 -0.0093 -0.0345 -0.0315 170 SER B CB  
4531 O OG  . SER B 170 ? 0.6392 0.5188 0.9317 -0.0048 -0.0349 -0.0206 170 SER B OG  
4532 N N   . LEU B 171 ? 0.4393 0.3300 0.7283 0.0040  -0.0309 -0.0451 171 LEU B N   
4533 C CA  . LEU B 171 ? 0.4221 0.3184 0.7122 0.0118  -0.0296 -0.0463 171 LEU B CA  
4534 C C   . LEU B 171 ? 0.5094 0.3962 0.8079 0.0155  -0.0264 -0.0564 171 LEU B C   
4535 O O   . LEU B 171 ? 0.5147 0.3987 0.8211 0.0235  -0.0259 -0.0544 171 LEU B O   
4536 C CB  . LEU B 171 ? 0.4013 0.3137 0.6815 0.0098  -0.0296 -0.0490 171 LEU B CB  
4537 C CG  . LEU B 171 ? 0.4538 0.3746 0.7338 0.0162  -0.0279 -0.0512 171 LEU B CG  
4538 C CD1 . LEU B 171 ? 0.4409 0.3640 0.7238 0.0225  -0.0297 -0.0403 171 LEU B CD1 
4539 C CD2 . LEU B 171 ? 0.4860 0.4204 0.7553 0.0122  -0.0276 -0.0548 171 LEU B CD2 
4540 N N   . ARG B 172 ? 0.4867 0.3686 0.7844 0.0096  -0.0243 -0.0674 172 ARG B N   
4541 C CA  . ARG B 172 ? 0.5064 0.3785 0.8125 0.0121  -0.0203 -0.0791 172 ARG B CA  
4542 C C   . ARG B 172 ? 0.5976 0.4522 0.9171 0.0171  -0.0208 -0.0740 172 ARG B C   
4543 O O   . ARG B 172 ? 0.5916 0.4412 0.9217 0.0251  -0.0190 -0.0763 172 ARG B O   
4544 C CB  . ARG B 172 ? 0.5171 0.3878 0.8175 0.0028  -0.0184 -0.0914 172 ARG B CB  
4545 C CG  . ARG B 172 ? 0.6537 0.5212 0.9582 0.0040  -0.0129 -0.1069 172 ARG B CG  
4546 C CD  . ARG B 172 ? 0.8464 0.7177 1.1403 -0.0064 -0.0113 -0.1190 172 ARG B CD  
4547 N NE  . ARG B 172 ? 0.9474 0.8365 1.2269 -0.0103 -0.0128 -0.1184 172 ARG B NE  
4548 C CZ  . ARG B 172 ? 1.0398 0.9364 1.3083 -0.0189 -0.0167 -0.1157 172 ARG B CZ  
4549 N NH1 . ARG B 172 ? 0.9033 0.7923 1.1733 -0.0250 -0.0194 -0.1143 172 ARG B NH1 
4550 N NH2 . ARG B 172 ? 0.6959 0.6075 0.9523 -0.0217 -0.0183 -0.1145 172 ARG B NH2 
4551 N N   . ASP B 173 ? 0.5964 0.4426 0.9158 0.0123  -0.0234 -0.0663 173 ASP B N   
4552 C CA  . ASP B 173 ? 0.6208 0.4495 0.9507 0.0151  -0.0244 -0.0594 173 ASP B CA  
4553 C C   . ASP B 173 ? 0.6660 0.4955 1.0008 0.0244  -0.0269 -0.0476 173 ASP B C   
4554 O O   . ASP B 173 ? 0.6889 0.5060 1.0358 0.0310  -0.0270 -0.0462 173 ASP B O   
4555 C CB  . ASP B 173 ? 0.6618 0.4853 0.9879 0.0063  -0.0265 -0.0529 173 ASP B CB  
4556 C CG  . ASP B 173 ? 0.9729 0.7769 1.3087 0.0072  -0.0273 -0.0458 173 ASP B CG  
4557 O OD1 . ASP B 173 ? 1.0310 0.8209 1.3729 0.0035  -0.0252 -0.0539 173 ASP B OD1 
4558 O OD2 . ASP B 173 ? 1.0727 0.8752 1.4093 0.0110  -0.0301 -0.0322 173 ASP B OD2 
4559 N N   . ILE B 174 ? 0.5924 0.4367 0.9185 0.0249  -0.0292 -0.0394 174 ILE B N   
4560 C CA  . ILE B 174 ? 0.5849 0.4327 0.9133 0.0326  -0.0320 -0.0284 174 ILE B CA  
4561 C C   . ILE B 174 ? 0.6302 0.4809 0.9675 0.0415  -0.0305 -0.0349 174 ILE B C   
4562 O O   . ILE B 174 ? 0.6391 0.4804 0.9878 0.0487  -0.0321 -0.0304 174 ILE B O   
4563 C CB  . ILE B 174 ? 0.6043 0.4678 0.9208 0.0300  -0.0340 -0.0202 174 ILE B CB  
4564 C CG1 . ILE B 174 ? 0.6118 0.4710 0.9233 0.0228  -0.0355 -0.0115 174 ILE B CG1 
4565 C CG2 . ILE B 174 ? 0.6007 0.4714 0.9184 0.0377  -0.0363 -0.0122 174 ILE B CG2 
4566 C CD1 . ILE B 174 ? 0.7145 0.5891 1.0150 0.0175  -0.0359 -0.0089 174 ILE B CD1 
4567 N N   . LEU B 175 ? 0.5557 0.4188 0.8884 0.0407  -0.0273 -0.0457 175 LEU B N   
4568 C CA  . LEU B 175 ? 0.5413 0.4103 0.8816 0.0478  -0.0247 -0.0537 175 LEU B CA  
4569 C C   . LEU B 175 ? 0.6231 0.4779 0.9793 0.0530  -0.0221 -0.0616 175 LEU B C   
4570 O O   . LEU B 175 ? 0.6271 0.4848 0.9942 0.0614  -0.0212 -0.0641 175 LEU B O   
4571 C CB  . LEU B 175 ? 0.5252 0.4088 0.8554 0.0434  -0.0211 -0.0644 175 LEU B CB  
4572 C CG  . LEU B 175 ? 0.5548 0.4550 0.8731 0.0417  -0.0231 -0.0578 175 LEU B CG  
4573 C CD1 . LEU B 175 ? 0.5430 0.4537 0.8499 0.0350  -0.0204 -0.0670 175 LEU B CD1 
4574 C CD2 . LEU B 175 ? 0.5723 0.4810 0.8965 0.0500  -0.0241 -0.0535 175 LEU B CD2 
4575 N N   . SER B 176 ? 0.5950 0.4344 0.9537 0.0482  -0.0209 -0.0655 176 SER B N   
4576 C CA  . SER B 176 ? 0.6092 0.4325 0.9835 0.0523  -0.0180 -0.0738 176 SER B CA  
4577 C C   . SER B 176 ? 0.6489 0.4618 1.0391 0.0624  -0.0216 -0.0637 176 SER B C   
4578 O O   . SER B 176 ? 0.6641 0.4658 1.0704 0.0684  -0.0191 -0.0709 176 SER B O   
4579 C CB  . SER B 176 ? 0.6770 0.4864 1.0492 0.0435  -0.0164 -0.0794 176 SER B CB  
4580 O OG  . SER B 176 ? 0.8392 0.6330 1.2157 0.0430  -0.0201 -0.0675 176 SER B OG  
4581 N N   . ARG B 177 ? 0.5729 0.3898 0.9587 0.0645  -0.0274 -0.0473 177 ARG B N   
4582 C CA  . ARG B 177 ? 0.5731 0.3813 0.9718 0.0735  -0.0321 -0.0358 177 ARG B CA  
4583 C C   . ARG B 177 ? 0.6240 0.4414 1.0359 0.0841  -0.0317 -0.0399 177 ARG B C   
4584 O O   . ARG B 177 ? 0.6377 0.4466 1.0650 0.0928  -0.0352 -0.0334 177 ARG B O   
4585 C CB  . ARG B 177 ? 0.5547 0.3633 0.9438 0.0711  -0.0382 -0.0175 177 ARG B CB  
4586 C CG  . ARG B 177 ? 0.6818 0.5101 1.0615 0.0727  -0.0409 -0.0108 177 ARG B CG  
4587 C CD  . ARG B 177 ? 0.9267 0.7542 1.2971 0.0698  -0.0462 0.0062  177 ARG B CD  
4588 N NE  . ARG B 177 ? 1.0753 0.9039 1.4312 0.0592  -0.0446 0.0074  177 ARG B NE  
4589 C CZ  . ARG B 177 ? 1.2505 1.0832 1.5952 0.0547  -0.0473 0.0194  177 ARG B CZ  
4590 N NH1 . ARG B 177 ? 1.0865 0.9225 1.4308 0.0592  -0.0520 0.0313  177 ARG B NH1 
4591 N NH2 . ARG B 177 ? 1.0574 0.8918 1.3916 0.0455  -0.0454 0.0191  177 ARG B NH2 
4592 N N   . TRP B 178 ? 0.5575 0.3920 0.9639 0.0831  -0.0274 -0.0508 178 TRP B N   
4593 C CA  . TRP B 178 ? 0.5479 0.3941 0.9657 0.0913  -0.0253 -0.0580 178 TRP B CA  
4594 C C   . TRP B 178 ? 0.5987 0.4460 1.0189 0.0886  -0.0169 -0.0778 178 TRP B C   
4595 O O   . TRP B 178 ? 0.5942 0.4360 1.0042 0.0797  -0.0138 -0.0846 178 TRP B O   
4596 C CB  . TRP B 178 ? 0.5142 0.3818 0.9204 0.0906  -0.0271 -0.0530 178 TRP B CB  
4597 C CG  . TRP B 178 ? 0.5234 0.3931 0.9232 0.0913  -0.0345 -0.0352 178 TRP B CG  
4598 C CD1 . TRP B 178 ? 0.5644 0.4358 0.9744 0.0996  -0.0402 -0.0247 178 TRP B CD1 
4599 C CD2 . TRP B 178 ? 0.5128 0.3856 0.8940 0.0830  -0.0368 -0.0265 178 TRP B CD2 
4600 N NE1 . TRP B 178 ? 0.5544 0.4288 0.9518 0.0962  -0.0457 -0.0101 178 TRP B NE1 
4601 C CE2 . TRP B 178 ? 0.5612 0.4365 0.9414 0.0862  -0.0432 -0.0113 178 TRP B CE2 
4602 C CE3 . TRP B 178 ? 0.5223 0.3962 0.8883 0.0730  -0.0341 -0.0302 178 TRP B CE3 
4603 C CZ2 . TRP B 178 ? 0.5451 0.4235 0.9096 0.0797  -0.0461 -0.0007 178 TRP B CZ2 
4604 C CZ3 . TRP B 178 ? 0.5337 0.4108 0.8862 0.0674  -0.0373 -0.0192 178 TRP B CZ3 
4605 C CH2 . TRP B 178 ? 0.5413 0.4204 0.8930 0.0707  -0.0427 -0.0052 178 TRP B CH2 
4606 N N   . LYS B 179 ? 0.5502 0.4062 0.9837 0.0958  -0.0131 -0.0873 179 LYS B N   
4607 C CA  . LYS B 179 ? 0.5518 0.4120 0.9878 0.0937  -0.0043 -0.1068 179 LYS B CA  
4608 C C   . LYS B 179 ? 0.6005 0.4838 1.0256 0.0914  -0.0020 -0.1103 179 LYS B C   
4609 O O   . LYS B 179 ? 0.5894 0.4835 1.0168 0.0966  -0.0064 -0.1004 179 LYS B O   
4610 C CB  . LYS B 179 ? 0.5953 0.4478 1.0576 0.1041  -0.0008 -0.1158 179 LYS B CB  
4611 C CG  . LYS B 179 ? 0.7600 0.5880 1.2364 0.1076  -0.0030 -0.1123 179 LYS B CG  
4612 C CD  . LYS B 179 ? 0.9197 0.7341 1.3918 0.0994  0.0032  -0.1262 179 LYS B CD  
4613 C CE  . LYS B 179 ? 1.1343 0.9234 1.6188 0.1018  0.0005  -0.1210 179 LYS B CE  
4614 N NZ  . LYS B 179 ? 1.2720 1.0486 1.7465 0.0908  0.0045  -0.1303 179 LYS B NZ  
4615 N N   . PRO B 180 ? 0.5652 0.4566 0.9783 0.0834  0.0046  -0.1239 180 PRO B N   
4616 C CA  . PRO B 180 ? 0.5511 0.4636 0.9538 0.0810  0.0068  -0.1263 180 PRO B CA  
4617 C C   . PRO B 180 ? 0.6122 0.5365 1.0316 0.0909  0.0076  -0.1269 180 PRO B C   
4618 O O   . PRO B 180 ? 0.5941 0.5339 1.0068 0.0908  0.0054  -0.1207 180 PRO B O   
4619 C CB  . PRO B 180 ? 0.5766 0.4922 0.9690 0.0721  0.0147  -0.1430 180 PRO B CB  
4620 C CG  . PRO B 180 ? 0.6425 0.5408 1.0307 0.0665  0.0139  -0.1445 180 PRO B CG  
4621 C CD  . PRO B 180 ? 0.5942 0.4761 1.0016 0.0755  0.0102  -0.1373 180 PRO B CD  
4622 N N   . GLU B 181 ? 0.5922 0.5091 1.0346 0.0996  0.0104  -0.1341 181 GLU B N   
4623 C CA  . GLU B 181 ? 0.5979 0.5251 1.0609 0.1102  0.0110  -0.1354 181 GLU B CA  
4624 C C   . GLU B 181 ? 0.6377 0.5681 1.1053 0.1169  0.0010  -0.1166 181 GLU B C   
4625 O O   . GLU B 181 ? 0.6205 0.5662 1.0976 0.1227  0.0002  -0.1153 181 GLU B O   
4626 C CB  . GLU B 181 ? 0.6386 0.5551 1.1272 0.1183  0.0161  -0.1474 181 GLU B CB  
4627 C CG  . GLU B 181 ? 0.8421 0.7345 1.3398 0.1215  0.0119  -0.1414 181 GLU B CG  
4628 C CD  . GLU B 181 ? 1.2601 1.1424 1.7886 0.1335  0.0134  -0.1468 181 GLU B CD  
4629 O OE1 . GLU B 181 ? 1.2712 1.1486 1.8139 0.1427  0.0052  -0.1326 181 GLU B OE1 
4630 O OE2 . GLU B 181 ? 1.2120 1.0908 1.7506 0.1336  0.0226  -0.1650 181 GLU B OE2 
4631 N N   . ASP B 182 ? 0.5916 0.5085 1.0519 0.1154  -0.0063 -0.1025 182 ASP B N   
4632 C CA  . ASP B 182 ? 0.5820 0.5003 1.0437 0.1201  -0.0159 -0.0842 182 ASP B CA  
4633 C C   . ASP B 182 ? 0.6379 0.5757 1.0851 0.1166  -0.0183 -0.0777 182 ASP B C   
4634 O O   . ASP B 182 ? 0.6490 0.5935 1.1027 0.1225  -0.0247 -0.0668 182 ASP B O   
4635 C CB  . ASP B 182 ? 0.6051 0.5049 1.0593 0.1171  -0.0217 -0.0717 182 ASP B CB  
4636 C CG  . ASP B 182 ? 0.7401 0.6185 1.2104 0.1214  -0.0210 -0.0746 182 ASP B CG  
4637 O OD1 . ASP B 182 ? 0.7814 0.6584 1.2701 0.1274  -0.0157 -0.0874 182 ASP B OD1 
4638 O OD2 . ASP B 182 ? 0.7684 0.6313 1.2335 0.1186  -0.0255 -0.0644 182 ASP B OD2 
4639 N N   . ALA B 183 ? 0.5711 0.5177 0.9990 0.1070  -0.0137 -0.0841 183 ALA B N   
4640 C CA  . ALA B 183 ? 0.5442 0.5081 0.9580 0.1030  -0.0152 -0.0791 183 ALA B CA  
4641 C C   . ALA B 183 ? 0.5926 0.5732 1.0203 0.1097  -0.0143 -0.0821 183 ALA B C   
4642 O O   . ALA B 183 ? 0.5621 0.5540 0.9858 0.1103  -0.0190 -0.0730 183 ALA B O   
4643 C CB  . ALA B 183 ? 0.5440 0.5128 0.9382 0.0923  -0.0097 -0.0871 183 ALA B CB  
4644 N N   . LYS B 184 ? 0.5879 0.5698 1.0331 0.1147  -0.0082 -0.0953 184 LYS B N   
4645 C CA  . LYS B 184 ? 0.5987 0.5966 1.0617 0.1217  -0.0061 -0.1008 184 LYS B CA  
4646 C C   . LYS B 184 ? 0.6776 0.6740 1.1612 0.1330  -0.0145 -0.0896 184 LYS B C   
4647 O O   . LYS B 184 ? 0.6750 0.6873 1.1710 0.1384  -0.0157 -0.0895 184 LYS B O   
4648 C CB  . LYS B 184 ? 0.6401 0.6388 1.1154 0.1229  0.0042  -0.1198 184 LYS B CB  
4649 C CG  . LYS B 184 ? 0.7734 0.7749 1.2281 0.1112  0.0122  -0.1311 184 LYS B CG  
4650 C CD  . LYS B 184 ? 0.8902 0.8896 1.3560 0.1117  0.0224  -0.1501 184 LYS B CD  
4651 C CE  . LYS B 184 ? 1.0580 1.0571 1.5016 0.0994  0.0293  -0.1603 184 LYS B CE  
4652 N NZ  . LYS B 184 ? 1.2569 1.2369 1.6895 0.0946  0.0266  -0.1574 184 LYS B NZ  
4653 N N   . ASN B 185 ? 0.6442 0.6218 1.1313 0.1362  -0.0204 -0.0801 185 ASN B N   
4654 C CA  . ASN B 185 ? 0.6475 0.6210 1.1519 0.1461  -0.0294 -0.0674 185 ASN B CA  
4655 C C   . ASN B 185 ? 0.6938 0.6689 1.1812 0.1424  -0.0386 -0.0495 185 ASN B C   
4656 O O   . ASN B 185 ? 0.6848 0.6464 1.1565 0.1364  -0.0406 -0.0425 185 ASN B O   
4657 C CB  . ASN B 185 ? 0.6707 0.6221 1.1904 0.1518  -0.0301 -0.0678 185 ASN B CB  
4658 C CG  . ASN B 185 ? 0.9405 0.8857 1.4802 0.1627  -0.0396 -0.0548 185 ASN B CG  
4659 O OD1 . ASN B 185 ? 0.8507 0.8093 1.3948 0.1669  -0.0466 -0.0451 185 ASN B OD1 
4660 N ND2 . ASN B 185 ? 0.8567 0.7811 1.4092 0.1672  -0.0404 -0.0541 185 ASN B ND2 
4661 N N   . PRO B 186 ? 0.6460 0.6379 1.1364 0.1454  -0.0439 -0.0425 186 PRO B N   
4662 C CA  . PRO B 186 ? 0.6363 0.6310 1.1092 0.1409  -0.0517 -0.0270 186 PRO B