data_4GDY
# 
_entry.id   4GDY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GDY         
RCSB  RCSB074062   
WWPDB D_1000074062 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4GE9 . unspecified 
PDB 4GE4 . unspecified 
PDB 4GE7 . unspecified 
PDB 4GEB . unspecified 
PDB 3UE8 . unspecified 
# 
_pdbx_database_status.entry_id                        4GDY 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Pandit, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of Hydroxamate Bioisosteres as KATII Inhibitors with Improved Oral Bioavailability and Pharmacokinetics' 
_citation.journal_abbrev            MEDCHEMCOMM 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2040-2511 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      10.1039/C2MD20166F 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Verhoest, P.R.'   1  
primary 'Henderson, J.L.'  2  
primary 'Sawant-Basak, A.' 3  
primary 'Tuttle, J.B.'     4  
primary 'Dounay, A.B.'     5  
primary 'McAllister, L.A.' 6  
primary 'Pandit, J.'       7  
primary 'Rong, S.'         8  
primary 'Hou, X.'          9  
primary 'Bechle, B.'       10 
primary 'Parikh, V.'       11 
primary 'Evrard, E.'       12 
primary 'Ghosh, S.'        13 
primary 'Salafia, M.A.'    14 
primary 'Rago, B.'         15 
primary 'Obach, R.'        16 
primary 'Fonseca, K.R.'    17 
primary 'Chang, C.'        18 
# 
_cell.length_a           116.457 
_cell.length_b           116.457 
_cell.length_c           115.211 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4GDY 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         4GDY 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial' 48950.074 2   '2.6.1.39, 2.6.1.7' 'K240S, F241G' 
? ? 
2 non-polymer syn 
;(5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate
;
523.435   2   ?                   ?              ? ? 
3 water       nat water 18.015    217 ?                   ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KAT/AadAT, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, AadAT, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNS
GRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNS
GRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESLLVPRGSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 SER n 
1 241 GLY n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
1 426 LEU n 
1 427 VAL n 
1 428 PRO n 
1 429 ARG n 
1 430 GLY n 
1 431 SER n 
1 432 LEU n 
1 433 GLU n 
1 434 HIS n 
1 435 HIS n 
1 436 HIS n 
1 437 HIS n 
1 438 HIS n 
1 439 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GDY A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 4GDY B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GDY SER A 240 ? UNP Q8N5Z0 LYS 240 'ENGINEERED MUTATION' 240 1  
1 4GDY GLY A 241 ? UNP Q8N5Z0 PHE 241 'ENGINEERED MUTATION' 241 2  
1 4GDY LEU A 426 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      426 3  
1 4GDY VAL A 427 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      427 4  
1 4GDY PRO A 428 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      428 5  
1 4GDY ARG A 429 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      429 6  
1 4GDY GLY A 430 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      430 7  
1 4GDY SER A 431 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      431 8  
1 4GDY LEU A 432 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      432 9  
1 4GDY GLU A 433 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      433 10 
1 4GDY HIS A 434 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      434 11 
1 4GDY HIS A 435 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      435 12 
1 4GDY HIS A 436 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      436 13 
1 4GDY HIS A 437 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      437 14 
1 4GDY HIS A 438 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      438 15 
1 4GDY HIS A 439 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      439 16 
2 4GDY SER B 240 ? UNP Q8N5Z0 LYS 240 'ENGINEERED MUTATION' 240 17 
2 4GDY GLY B 241 ? UNP Q8N5Z0 PHE 241 'ENGINEERED MUTATION' 241 18 
2 4GDY LEU B 426 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      426 19 
2 4GDY VAL B 427 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      427 20 
2 4GDY PRO B 428 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      428 21 
2 4GDY ARG B 429 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      429 22 
2 4GDY GLY B 430 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      430 23 
2 4GDY SER B 431 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      431 24 
2 4GDY LEU B 432 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      432 25 
2 4GDY GLU B 433 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      433 26 
2 4GDY HIS B 434 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      434 27 
2 4GDY HIS B 435 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      435 28 
2 4GDY HIS B 436 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      436 29 
2 4GDY HIS B 437 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      437 30 
2 4GDY HIS B 438 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      438 31 
2 4GDY HIS B 439 ? UNP Q8N5Z0 ?   ?   'EXPRESSION TAG'      439 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0X1 non-polymer         . 
;(5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate
;
? 'C24 H22 N5 O7 P' 523.435 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4GDY 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-03-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     4GDY 
_reflns.d_resolution_high            2.8900 
_reflns.d_resolution_low             115.211 
_reflns.number_all                   20593 
_reflns.number_obs                   20593 
_reflns.pdbx_netI_over_sigmaI        17.400 
_reflns.pdbx_Rsym_value              0.127 
_reflns.pdbx_redundancy              10.500 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.890 3.050   ? 32885 ? 0.495 1.400  0.495 ? 11.100 ? 2957 100.000 1  1 
3.050 3.240   ? 31199 ? 0.366 1.900  0.366 ? 11.100 ? 2804 100.000 2  1 
3.240 3.460   ? 28627 ? 0.254 2.800  0.254 ? 10.900 ? 2637 100.000 3  1 
3.460 3.740   ? 23387 ? 0.182 4.000  0.182 ? 9.500  ? 2474 100.000 4  1 
3.740 4.090   ? 21976 ? 0.145 5.100  0.145 ? 9.600  ? 2282 100.000 5  1 
4.090 4.580   ? 22058 ? 0.095 7.600  0.095 ? 10.700 ? 2062 100.000 6  1 
4.580 5.280   ? 19650 ? 0.079 9.100  0.079 ? 10.600 ? 1852 100.000 7  1 
5.280 6.470   ? 16636 ? 0.077 9.300  0.077 ? 10.600 ? 1566 100.000 8  1 
6.470 9.150   ? 12712 ? 0.055 11.800 0.055 ? 10.300 ? 1231 100.000 9  1 
9.150 115.211 ? 6825  ? 0.039 15.600 0.039 ? 9.400  ? 728  99.700  10 1 
# 
_refine.entry_id                                 4GDY 
_refine.ls_d_res_high                            2.8900 
_refine.ls_d_res_low                             100.8500 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.3300 
_refine.ls_number_reflns_obs                     20510 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1744 
_refine.ls_R_factor_R_work                       0.1709 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2399 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1100 
_refine.ls_number_reflns_R_free                  1049 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               48.8469 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.7586 
_refine.aniso_B[2][2]                            1.7586 
_refine.aniso_B[3][3]                            -3.5172 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9415 
_refine.correlation_coeff_Fo_to_Fc_free          0.8883 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3UE8 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                168.360 
_refine.B_iso_min                                3.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4GDY 
_refine_analyze.Luzzati_coordinate_error_obs    0.335 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6589 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         74 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               6880 
_refine_hist.d_res_high                       2.8900 
_refine_hist.d_res_low                        100.8500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        2310 ?      ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           162  ?      ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              990  ?      ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      6832 ?      ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 889  ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?    ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      7498 ?      ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  6832 0.010  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               9287 1.220  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?    2.740  ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?    21.700 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.8900 
_refine_ls_shell.d_res_low                        3.0500 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.percent_reflns_obs               99.3300 
_refine_ls_shell.number_reflns_R_work             2730 
_refine_ls_shell.R_factor_all                     0.1936 
_refine_ls_shell.R_factor_R_work                  0.1888 
_refine_ls_shell.R_factor_R_free                  0.2810 
_refine_ls_shell.percent_reflns_R_free            5.1800 
_refine_ls_shell.number_reflns_R_free             149 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2879 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4GDY 
_struct.title                     'Kynurenine Aminotransferase II inhibitors' 
_struct.pdbx_descriptor           'Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (E.C.2.6.1.39, 2.6.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GDY 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'Aminotransferase, Pyridoxal phosphate co-factor, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 2   ? PHE A 6   ? ASN A 2   PHE A 6   5 ? 5  
HELX_P HELX_P2  2  THR A 8   ? ARG A 14  ? THR A 8   ARG A 14  1 ? 7  
HELX_P HELX_P3  3  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P4  4  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P5  5  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P6  6  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P7  7  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P8  8  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P9  9  PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P10 10 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P11 11 ARG A 177 ? TRP A 178 ? ARG A 177 TRP A 178 5 ? 2  
HELX_P HELX_P12 12 LYS A 179 ? ASN A 189 ? LYS A 179 ASN A 189 5 ? 11 
HELX_P HELX_P13 13 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P14 14 TYR A 233 ? GLN A 237 ? TYR A 233 GLN A 237 5 ? 5  
HELX_P HELX_P15 15 THR A 245 ? ASP A 250 ? THR A 245 ASP A 250 5 ? 6  
HELX_P HELX_P16 16 LYS A 278 ? GLN A 289 ? LYS A 278 GLN A 289 1 ? 12 
HELX_P HELX_P17 17 SER A 296 ? THR A 342 ? SER A 296 THR A 342 1 ? 47 
HELX_P HELX_P18 18 VAL A 366 ? GLU A 371 ? VAL A 366 GLU A 371 1 ? 6  
HELX_P HELX_P19 19 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P20 20 SER A 406 ? VAL A 427 ? SER A 406 VAL A 427 1 ? 22 
HELX_P HELX_P21 21 ASN B 2   ? PHE B 6   ? ASN B 2   PHE B 6   5 ? 5  
HELX_P HELX_P22 22 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P23 23 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P24 24 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P25 25 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P26 26 PRO B 103 ? GLY B 107 ? PRO B 103 GLY B 107 5 ? 5  
HELX_P HELX_P27 27 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P28 28 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P29 29 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P30 30 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P31 31 ARG B 177 ? TRP B 178 ? ARG B 177 TRP B 178 5 ? 2  
HELX_P HELX_P32 32 LYS B 179 ? ASN B 189 ? LYS B 179 ASN B 189 5 ? 11 
HELX_P HELX_P33 33 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P34 34 TYR B 233 ? GLN B 237 ? TYR B 233 GLN B 237 5 ? 5  
HELX_P HELX_P35 35 THR B 245 ? ASP B 250 ? THR B 245 ASP B 250 5 ? 6  
HELX_P HELX_P36 36 LYS B 278 ? GLN B 289 ? LYS B 278 GLN B 289 1 ? 12 
HELX_P HELX_P37 37 SER B 296 ? THR B 342 ? SER B 296 THR B 342 1 ? 47 
HELX_P HELX_P38 38 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P39 39 GLU B 372 ? MET B 377 ? GLU B 372 MET B 377 1 ? 6  
HELX_P HELX_P40 40 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P41 41 SER B 406 ? VAL B 427 ? SER B 406 VAL B 427 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 20  A . ? ARG 20  A THR 21  A ? THR 21  A 1 -6.56 
2 GLU 56  A . ? GLU 56  A ASN 57  A ? ASN 57  A 1 0.06  
3 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 -0.15 
4 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 11.22 
5 ALA 37  B . ? ALA 37  B GLY 38  B ? GLY 38  B 1 -1.66 
6 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 -0.37 
7 ASN 202 B . ? ASN 202 B PRO 203 B ? PRO 203 B 1 11.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 5 ? 
I ? 2 ? 
J ? 2 ? 
K ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
A 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
B 1 THR A 60  ? PHE A 63  ? THR A 60  PHE A 63  
B 2 PHE A 48  ? THR A 54  ? PHE A 48  THR A 54  
B 3 THR B 50  ? VAL B 55  ? THR B 50  VAL B 55  
B 4 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
C 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
C 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
C 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
C 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
C 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
D 1 ASN A 134 ? LEU A 137 ? ASN A 134 LEU A 137 
D 2 ASN A 155 ? ASN A 158 ? ASN A 155 ASN A 158 
E 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
E 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
F 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
F 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
F 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
F 4 MET A 381 ? PRO A 383 ? MET A 381 PRO A 383 
G 1 THR B 21  ? THR B 23  ? THR B 21  THR B 23  
G 2 MET B 33  ? SER B 35  ? MET B 33  SER B 35  
H 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
H 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
H 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
H 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
H 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
I 1 ASN B 134 ? LEU B 137 ? ASN B 134 LEU B 137 
I 2 ASN B 155 ? ASN B 158 ? ASN B 155 ASN B 158 
J 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
J 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
K 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
K 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
K 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
K 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 34  ? N ILE A 34  O LEU B 380 ? O LEU B 380 
B 1 2 O PHE A 63  ? O PHE A 63  N ALA A 51  ? N ALA A 51  
B 2 3 N LYS A 49  ? N LYS A 49  O THR B 54  ? O THR B 54  
B 3 4 N ALA B 51  ? N ALA B 51  O PHE B 63  ? O PHE B 63  
C 1 2 N ASP A 110 ? N ASP A 110 O GLY A 276 ? O GLY A 276 
C 2 3 O THR A 275 ? O THR A 275 N ARG A 257 ? N ARG A 257 
C 3 4 O ALA A 258 ? O ALA A 258 N GLU A 229 ? N GLU A 229 
C 4 5 O ILE A 228 ? O ILE A 228 N LEU A 194 ? N LEU A 194 
D 1 2 N VAL A 135 ? N VAL A 135 O ASN A 155 ? O ASN A 155 
E 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
F 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
F 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
F 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
G 1 2 N MET B 22  ? N MET B 22  O ILE B 34  ? O ILE B 34  
H 1 2 N ASP B 110 ? N ASP B 110 O GLY B 276 ? O GLY B 276 
H 2 3 O THR B 275 ? O THR B 275 N ARG B 257 ? N ARG B 257 
H 3 4 O ILE B 256 ? O ILE B 256 N ILE B 227 ? N ILE B 227 
H 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
I 1 2 N VAL B 135 ? N VAL B 135 O ASN B 155 ? O ASN B 155 
J 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
K 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
K 2 3 N LEU B 356 ? N LEU B 356 O ALA B 400 ? O ALA B 400 
K 3 4 O ARG B 399 ? O ARG B 399 N LEU B 382 ? N LEU B 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE 0X1 A 501' 
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE 0X1 B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 GLY A 116 ? GLY A 116 . ? 1_555 ? 
2  AC1 19 SER A 117 ? SER A 117 . ? 1_555 ? 
3  AC1 19 GLN A 118 ? GLN A 118 . ? 1_555 ? 
4  AC1 19 TYR A 142 ? TYR A 142 . ? 1_555 ? 
5  AC1 19 ASN A 202 ? ASN A 202 . ? 1_555 ? 
6  AC1 19 ASP A 230 ? ASP A 230 . ? 1_555 ? 
7  AC1 19 TYR A 233 ? TYR A 233 . ? 1_555 ? 
8  AC1 19 SER A 260 ? SER A 260 . ? 1_555 ? 
9  AC1 19 SER A 262 ? SER A 262 . ? 1_555 ? 
10 AC1 19 ARG A 270 ? ARG A 270 . ? 1_555 ? 
11 AC1 19 PHE A 355 ? PHE A 355 . ? 1_555 ? 
12 AC1 19 ARG A 399 ? ARG A 399 . ? 1_555 ? 
13 AC1 19 ILE B 19  ? ILE B 19  . ? 1_555 ? 
14 AC1 19 MET B 33  ? MET B 33  . ? 1_555 ? 
15 AC1 19 GLY B 39  ? GLY B 39  . ? 1_555 ? 
16 AC1 19 LEU B 40  ? LEU B 40  . ? 1_555 ? 
17 AC1 19 TYR B 74  ? TYR B 74  . ? 1_555 ? 
18 AC1 19 SER B 75  ? SER B 75  . ? 1_555 ? 
19 AC1 19 SER B 77  ? SER B 77  . ? 1_555 ? 
20 AC2 21 ILE A 19  ? ILE A 19  . ? 1_555 ? 
21 AC2 21 ARG A 20  ? ARG A 20  . ? 1_555 ? 
22 AC2 21 GLY A 39  ? GLY A 39  . ? 1_555 ? 
23 AC2 21 LEU A 40  ? LEU A 40  . ? 1_555 ? 
24 AC2 21 TYR A 74  ? TYR A 74  . ? 1_555 ? 
25 AC2 21 SER A 75  ? SER A 75  . ? 1_555 ? 
26 AC2 21 SER A 77  ? SER A 77  . ? 1_555 ? 
27 AC2 21 LEU A 293 ? LEU A 293 . ? 1_555 ? 
28 AC2 21 GLY B 116 ? GLY B 116 . ? 1_555 ? 
29 AC2 21 SER B 117 ? SER B 117 . ? 1_555 ? 
30 AC2 21 GLN B 118 ? GLN B 118 . ? 1_555 ? 
31 AC2 21 TYR B 142 ? TYR B 142 . ? 1_555 ? 
32 AC2 21 ASN B 202 ? ASN B 202 . ? 1_555 ? 
33 AC2 21 ASP B 230 ? ASP B 230 . ? 1_555 ? 
34 AC2 21 PRO B 232 ? PRO B 232 . ? 1_555 ? 
35 AC2 21 TYR B 233 ? TYR B 233 . ? 1_555 ? 
36 AC2 21 SER B 260 ? SER B 260 . ? 1_555 ? 
37 AC2 21 SER B 262 ? SER B 262 . ? 1_555 ? 
38 AC2 21 ARG B 270 ? ARG B 270 . ? 1_555 ? 
39 AC2 21 PHE B 355 ? PHE B 355 . ? 1_555 ? 
40 AC2 21 ARG B 399 ? ARG B 399 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4GDY 
_atom_sites.fract_transf_matrix[1][1]   0.008587 
_atom_sites.fract_transf_matrix[1][2]   0.004958 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009915 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008680 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? -7.204  41.862 -12.518 1.00 77.31  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? -7.913  41.992 -11.248 1.00 75.24  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? -7.386  43.150 -10.402 1.00 77.01  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? -6.184  43.205 -10.101 1.00 76.31  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? -7.820  40.692 -10.442 1.00 75.68  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? -8.764  39.611 -10.914 1.00 80.15  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? -10.458 39.752 -10.295 1.00 84.35  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? -10.239 39.242 -8.633  1.00 78.02  ? 1   MET A CE  1 
ATOM   9    N N   . ASN A 1 2   ? -8.290  44.071 -10.009 1.00 71.64  ? 2   ASN A N   1 
ATOM   10   C CA  . ASN A 1 2   ? -7.943  45.192 -9.135  1.00 69.74  ? 2   ASN A CA  1 
ATOM   11   C C   . ASN A 1 2   ? -8.204  44.719 -7.710  1.00 69.12  ? 2   ASN A C   1 
ATOM   12   O O   . ASN A 1 2   ? -9.322  44.835 -7.192  1.00 69.32  ? 2   ASN A O   1 
ATOM   13   C CB  . ASN A 1 2   ? -8.738  46.465 -9.482  1.00 70.43  ? 2   ASN A CB  1 
ATOM   14   C CG  . ASN A 1 2   ? -8.498  47.630 -8.542  1.00 87.84  ? 2   ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 2   ? -7.380  47.888 -8.080  1.00 80.89  ? 2   ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 2   ? -9.555  48.358 -8.232  1.00 79.42  ? 2   ASN A ND2 1 
ATOM   17   N N   . TYR A 1 3   ? -7.184  44.109 -7.107  1.00 61.37  ? 3   TYR A N   1 
ATOM   18   C CA  . TYR A 1 3   ? -7.279  43.565 -5.757  1.00 57.94  ? 3   TYR A CA  1 
ATOM   19   C C   . TYR A 1 3   ? -7.510  44.630 -4.691  1.00 61.30  ? 3   TYR A C   1 
ATOM   20   O O   . TYR A 1 3   ? -8.057  44.315 -3.631  1.00 59.41  ? 3   TYR A O   1 
ATOM   21   C CB  . TYR A 1 3   ? -6.067  42.671 -5.435  1.00 56.85  ? 3   TYR A CB  1 
ATOM   22   C CG  . TYR A 1 3   ? -6.002  41.419 -6.286  1.00 57.36  ? 3   TYR A CG  1 
ATOM   23   C CD1 . TYR A 1 3   ? -4.923  41.180 -7.129  1.00 58.98  ? 3   TYR A CD1 1 
ATOM   24   C CD2 . TYR A 1 3   ? -7.036  40.486 -6.269  1.00 57.81  ? 3   TYR A CD2 1 
ATOM   25   C CE1 . TYR A 1 3   ? -4.859  40.031 -7.915  1.00 59.26  ? 3   TYR A CE1 1 
ATOM   26   C CE2 . TYR A 1 3   ? -6.987  39.338 -7.055  1.00 59.01  ? 3   TYR A CE2 1 
ATOM   27   C CZ  . TYR A 1 3   ? -5.894  39.110 -7.872  1.00 65.65  ? 3   TYR A CZ  1 
ATOM   28   O OH  . TYR A 1 3   ? -5.860  37.977 -8.650  1.00 65.44  ? 3   TYR A OH  1 
ATOM   29   N N   . ALA A 1 4   ? -7.154  45.900 -5.006  1.00 59.61  ? 4   ALA A N   1 
ATOM   30   C CA  . ALA A 1 4   ? -7.289  47.082 -4.143  1.00 59.24  ? 4   ALA A CA  1 
ATOM   31   C C   . ALA A 1 4   ? -8.713  47.306 -3.597  1.00 62.29  ? 4   ALA A C   1 
ATOM   32   O O   . ALA A 1 4   ? -8.870  47.853 -2.500  1.00 61.03  ? 4   ALA A O   1 
ATOM   33   C CB  . ALA A 1 4   ? -6.794  48.324 -4.870  1.00 61.75  ? 4   ALA A CB  1 
ATOM   34   N N   . ARG A 1 5   ? -9.740  46.866 -4.349  1.00 58.77  ? 5   ARG A N   1 
ATOM   35   C CA  . ARG A 1 5   ? -11.124 47.004 -3.923  1.00 58.65  ? 5   ARG A CA  1 
ATOM   36   C C   . ARG A 1 5   ? -11.568 45.905 -2.934  1.00 60.48  ? 5   ARG A C   1 
ATOM   37   O O   . ARG A 1 5   ? -12.660 46.006 -2.370  1.00 60.17  ? 5   ARG A O   1 
ATOM   38   C CB  . ARG A 1 5   ? -12.072 47.163 -5.127  1.00 60.95  ? 5   ARG A CB  1 
ATOM   39   C CG  . ARG A 1 5   ? -12.302 45.910 -5.973  1.00 70.26  ? 5   ARG A CG  1 
ATOM   40   C CD  . ARG A 1 5   ? -13.367 46.139 -7.042  1.00 78.69  ? 5   ARG A CD  1 
ATOM   41   N NE  . ARG A 1 5   ? -14.690 46.434 -6.478  1.00 80.54  ? 5   ARG A NE  1 
ATOM   42   C CZ  . ARG A 1 5   ? -15.713 45.583 -6.469  1.00 87.23  ? 5   ARG A CZ  1 
ATOM   43   N NH1 . ARG A 1 5   ? -16.876 45.940 -5.939  1.00 73.60  ? 5   ARG A NH1 1 
ATOM   44   N NH2 . ARG A 1 5   ? -15.584 44.374 -7.002  1.00 65.82  ? 5   ARG A NH2 1 
ATOM   45   N N   . PHE A 1 6   ? -10.703 44.888 -2.700  1.00 54.91  ? 6   PHE A N   1 
ATOM   46   C CA  . PHE A 1 6   ? -10.966 43.759 -1.799  1.00 52.63  ? 6   PHE A CA  1 
ATOM   47   C C   . PHE A 1 6   ? -10.084 43.758 -0.545  1.00 52.54  ? 6   PHE A C   1 
ATOM   48   O O   . PHE A 1 6   ? -10.232 42.887 0.317   1.00 50.31  ? 6   PHE A O   1 
ATOM   49   C CB  . PHE A 1 6   ? -10.832 42.424 -2.547  1.00 54.63  ? 6   PHE A CB  1 
ATOM   50   C CG  . PHE A 1 6   ? -11.728 42.288 -3.751  1.00 58.57  ? 6   PHE A CG  1 
ATOM   51   C CD1 . PHE A 1 6   ? -11.207 42.371 -5.038  1.00 63.49  ? 6   PHE A CD1 1 
ATOM   52   C CD2 . PHE A 1 6   ? -13.095 42.094 -3.603  1.00 61.20  ? 6   PHE A CD2 1 
ATOM   53   C CE1 . PHE A 1 6   ? -12.032 42.232 -6.153  1.00 65.99  ? 6   PHE A CE1 1 
ATOM   54   C CE2 . PHE A 1 6   ? -13.922 41.960 -4.722  1.00 65.85  ? 6   PHE A CE2 1 
ATOM   55   C CZ  . PHE A 1 6   ? -13.386 42.033 -5.988  1.00 65.36  ? 6   PHE A CZ  1 
ATOM   56   N N   . ILE A 1 7   ? -9.168  44.722 -0.449  1.00 48.12  ? 7   ILE A N   1 
ATOM   57   C CA  . ILE A 1 7   ? -8.274  44.875 0.701   1.00 46.17  ? 7   ILE A CA  1 
ATOM   58   C C   . ILE A 1 7   ? -8.752  46.122 1.476   1.00 48.15  ? 7   ILE A C   1 
ATOM   59   O O   . ILE A 1 7   ? -9.019  47.150 0.844   1.00 49.11  ? 7   ILE A O   1 
ATOM   60   C CB  . ILE A 1 7   ? -6.760  44.934 0.263   1.00 49.95  ? 7   ILE A CB  1 
ATOM   61   C CG1 . ILE A 1 7   ? -6.505  46.032 -0.820  1.00 54.43  ? 7   ILE A CG1 1 
ATOM   62   C CG2 . ILE A 1 7   ? -6.272  43.579 -0.255  1.00 48.44  ? 7   ILE A CG2 1 
ATOM   63   C CD1 . ILE A 1 7   ? -4.935  46.452 -1.186  1.00 68.70  ? 7   ILE A CD1 1 
ATOM   64   N N   . THR A 1 8   ? -8.940  46.030 2.815   1.00 41.90  ? 8   THR A N   1 
ATOM   65   C CA  . THR A 1 8   ? -9.347  47.224 3.591   1.00 41.70  ? 8   THR A CA  1 
ATOM   66   C C   . THR A 1 8   ? -8.165  48.226 3.787   1.00 44.12  ? 8   THR A C   1 
ATOM   67   O O   . THR A 1 8   ? -6.998  47.919 3.453   1.00 41.83  ? 8   THR A O   1 
ATOM   68   C CB  . THR A 1 8   ? -9.951  46.863 4.964   1.00 45.79  ? 8   THR A CB  1 
ATOM   69   O OG1 . THR A 1 8   ? -9.052  46.015 5.675   1.00 48.58  ? 8   THR A OG1 1 
ATOM   70   C CG2 . THR A 1 8   ? -11.346 46.265 4.872   1.00 40.92  ? 8   THR A CG2 1 
ATOM   71   N N   . ALA A 1 9   ? -8.476  49.422 4.350   1.00 40.90  ? 9   ALA A N   1 
ATOM   72   C CA  . ALA A 1 9   ? -7.435  50.409 4.649   1.00 40.88  ? 9   ALA A CA  1 
ATOM   73   C C   . ALA A 1 9   ? -6.473  49.837 5.732   1.00 43.92  ? 9   ALA A C   1 
ATOM   74   O O   . ALA A 1 9   ? -5.254  49.992 5.621   1.00 43.45  ? 9   ALA A O   1 
ATOM   75   C CB  . ALA A 1 9   ? -8.059  51.708 5.115   1.00 42.41  ? 9   ALA A CB  1 
ATOM   76   N N   . ALA A 1 10  ? -7.029  49.114 6.722   1.00 38.90  ? 10  ALA A N   1 
ATOM   77   C CA  . ALA A 1 10  ? -6.275  48.463 7.785   1.00 37.43  ? 10  ALA A CA  1 
ATOM   78   C C   . ALA A 1 10  ? -5.371  47.339 7.241   1.00 40.81  ? 10  ALA A C   1 
ATOM   79   O O   . ALA A 1 10  ? -4.215  47.232 7.642   1.00 38.06  ? 10  ALA A O   1 
ATOM   80   C CB  . ALA A 1 10  ? -7.239  47.894 8.809   1.00 37.39  ? 10  ALA A CB  1 
ATOM   81   N N   . SER A 1 11  ? -5.902  46.505 6.328   1.00 39.61  ? 11  SER A N   1 
ATOM   82   C CA  . SER A 1 11  ? -5.156  45.396 5.738   1.00 39.38  ? 11  SER A CA  1 
ATOM   83   C C   . SER A 1 11  ? -3.998  45.920 4.898   1.00 44.98  ? 11  SER A C   1 
ATOM   84   O O   . SER A 1 11  ? -2.890  45.409 5.054   1.00 44.40  ? 11  SER A O   1 
ATOM   85   C CB  . SER A 1 11  ? -6.076  44.493 4.921   1.00 44.06  ? 11  SER A CB  1 
ATOM   86   O OG  . SER A 1 11  ? -5.402  43.344 4.432   1.00 53.91  ? 11  SER A OG  1 
ATOM   87   N N   . ALA A 1 12  ? -4.234  46.970 4.056   1.00 42.75  ? 12  ALA A N   1 
ATOM   88   C CA  . ALA A 1 12  ? -3.193  47.586 3.219   1.00 43.23  ? 12  ALA A CA  1 
ATOM   89   C C   . ALA A 1 12  ? -2.020  48.120 4.039   1.00 44.94  ? 12  ALA A C   1 
ATOM   90   O O   . ALA A 1 12  ? -0.865  47.912 3.668   1.00 43.83  ? 12  ALA A O   1 
ATOM   91   C CB  . ALA A 1 12  ? -3.778  48.705 2.384   1.00 46.12  ? 12  ALA A CB  1 
ATOM   92   N N   . ALA A 1 13  ? -2.327  48.770 5.176   1.00 41.89  ? 13  ALA A N   1 
ATOM   93   C CA  . ALA A 1 13  ? -1.390  49.369 6.131   1.00 41.44  ? 13  ALA A CA  1 
ATOM   94   C C   . ALA A 1 13  ? -0.314  48.431 6.652   1.00 45.24  ? 13  ALA A C   1 
ATOM   95   O O   . ALA A 1 13  ? 0.803   48.887 6.887   1.00 45.75  ? 13  ALA A O   1 
ATOM   96   C CB  . ALA A 1 13  ? -2.159  49.952 7.297   1.00 42.07  ? 13  ALA A CB  1 
ATOM   97   N N   . ARG A 1 14  ? -0.644  47.135 6.837   1.00 41.54  ? 14  ARG A N   1 
ATOM   98   C CA  . ARG A 1 14  ? 0.250   46.088 7.342   1.00 40.69  ? 14  ARG A CA  1 
ATOM   99   C C   . ARG A 1 14  ? 1.575   45.996 6.584   1.00 47.10  ? 14  ARG A C   1 
ATOM   100  O O   . ARG A 1 14  ? 1.594   46.013 5.353   1.00 47.36  ? 14  ARG A O   1 
ATOM   101  C CB  . ARG A 1 14  ? -0.457  44.722 7.350   1.00 38.37  ? 14  ARG A CB  1 
ATOM   102  C CG  . ARG A 1 14  ? -1.654  44.649 8.291   1.00 35.18  ? 14  ARG A CG  1 
ATOM   103  C CD  . ARG A 1 14  ? -2.176  43.232 8.467   1.00 31.53  ? 14  ARG A CD  1 
ATOM   104  N NE  . ARG A 1 14  ? -3.577  43.217 8.878   1.00 32.73  ? 14  ARG A NE  1 
ATOM   105  C CZ  . ARG A 1 14  ? -4.000  43.423 10.119  1.00 40.48  ? 14  ARG A CZ  1 
ATOM   106  N NH1 . ARG A 1 14  ? -3.129  43.646 11.095  1.00 28.51  ? 14  ARG A NH1 1 
ATOM   107  N NH2 . ARG A 1 14  ? -5.296  43.420 10.393  1.00 22.72  ? 14  ARG A NH2 1 
ATOM   108  N N   . ASN A 1 15  ? 2.682   45.932 7.336   1.00 45.09  ? 15  ASN A N   1 
ATOM   109  C CA  . ASN A 1 15  ? 4.044   45.822 6.795   1.00 45.60  ? 15  ASN A CA  1 
ATOM   110  C C   . ASN A 1 15  ? 4.746   44.537 7.318   1.00 49.49  ? 15  ASN A C   1 
ATOM   111  O O   . ASN A 1 15  ? 4.376   44.023 8.387   1.00 45.37  ? 15  ASN A O   1 
ATOM   112  C CB  . ASN A 1 15  ? 4.874   47.056 7.164   1.00 45.11  ? 15  ASN A CB  1 
ATOM   113  C CG  . ASN A 1 15  ? 4.277   48.375 6.744   1.00 65.51  ? 15  ASN A CG  1 
ATOM   114  O OD1 . ASN A 1 15  ? 4.159   48.689 5.552   1.00 65.64  ? 15  ASN A OD1 1 
ATOM   115  N ND2 . ASN A 1 15  ? 3.960   49.214 7.723   1.00 54.39  ? 15  ASN A ND2 1 
ATOM   116  N N   . PRO A 1 16  ? 5.776   44.015 6.601   1.00 50.38  ? 16  PRO A N   1 
ATOM   117  C CA  . PRO A 1 16  ? 6.465   42.807 7.089   1.00 50.90  ? 16  PRO A CA  1 
ATOM   118  C C   . PRO A 1 16  ? 7.309   43.084 8.326   1.00 57.38  ? 16  PRO A C   1 
ATOM   119  O O   . PRO A 1 16  ? 7.720   44.225 8.547   1.00 56.74  ? 16  PRO A O   1 
ATOM   120  C CB  . PRO A 1 16  ? 7.336   42.376 5.898   1.00 53.02  ? 16  PRO A CB  1 
ATOM   121  C CG  . PRO A 1 16  ? 6.904   43.222 4.755   1.00 57.85  ? 16  PRO A CG  1 
ATOM   122  C CD  . PRO A 1 16  ? 6.375   44.476 5.336   1.00 53.15  ? 16  PRO A CD  1 
ATOM   123  N N   . SER A 1 17  ? 7.548   42.035 9.134   1.00 56.19  ? 17  SER A N   1 
ATOM   124  C CA  . SER A 1 17  ? 8.336   42.119 10.361  1.00 57.24  ? 17  SER A CA  1 
ATOM   125  C C   . SER A 1 17  ? 9.782   42.448 10.040  1.00 66.83  ? 17  SER A C   1 
ATOM   126  O O   . SER A 1 17  ? 10.331  41.896 9.082   1.00 66.39  ? 17  SER A O   1 
ATOM   127  C CB  . SER A 1 17  ? 8.262   40.823 11.164  1.00 59.25  ? 17  SER A CB  1 
ATOM   128  O OG  . SER A 1 17  ? 8.810   41.022 12.458  1.00 66.49  ? 17  SER A OG  1 
ATOM   129  N N   . PRO A 1 18  ? 10.415  43.345 10.832  1.00 67.73  ? 18  PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? 11.815  43.716 10.557  1.00 69.91  ? 18  PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? 12.851  42.629 10.863  1.00 79.31  ? 18  PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? 13.981  42.731 10.399  1.00 79.67  ? 18  PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? 12.031  44.942 11.443  1.00 71.49  ? 18  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? 10.664  45.344 11.932  1.00 74.62  ? 18  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? 9.890   44.093 11.990  1.00 68.90  ? 18  PRO A CD  1 
ATOM   136  N N   . ILE A 1 19  ? 12.466  41.595 11.627  1.00 79.79  ? 19  ILE A N   1 
ATOM   137  C CA  . ILE A 1 19  ? 13.328  40.474 12.028  1.00 81.96  ? 19  ILE A CA  1 
ATOM   138  C C   . ILE A 1 19  ? 13.004  39.196 11.190  1.00 90.22  ? 19  ILE A C   1 
ATOM   139  O O   . ILE A 1 19  ? 13.409  38.086 11.570  1.00 90.06  ? 19  ILE A O   1 
ATOM   140  C CB  . ILE A 1 19  ? 13.228  40.217 13.581  1.00 84.76  ? 19  ILE A CB  1 
ATOM   141  C CG1 . ILE A 1 19  ? 12.855  41.485 14.392  1.00 84.82  ? 19  ILE A CG1 1 
ATOM   142  C CG2 . ILE A 1 19  ? 14.486  39.537 14.149  1.00 86.05  ? 19  ILE A CG2 1 
ATOM   143  C CD1 . ILE A 1 19  ? 11.527  41.398 15.018  1.00 87.85  ? 19  ILE A CD1 1 
ATOM   144  N N   . ARG A 1 20  ? 12.291  39.355 10.042  1.00 89.51  ? 20  ARG A N   1 
ATOM   145  C CA  . ARG A 1 20  ? 11.899  38.220 9.193   1.00 90.29  ? 20  ARG A CA  1 
ATOM   146  C C   . ARG A 1 20  ? 11.716  38.493 7.664   1.00 97.50  ? 20  ARG A C   1 
ATOM   147  O O   . ARG A 1 20  ? 10.624  38.207 7.163   1.00 97.11  ? 20  ARG A O   1 
ATOM   148  C CB  . ARG A 1 20  ? 10.686  37.471 9.794   1.00 89.30  ? 20  ARG A CB  1 
ATOM   149  C CG  . ARG A 1 20  ? 11.023  36.076 10.304  1.00 97.32  ? 20  ARG A CG  1 
ATOM   150  C CD  . ARG A 1 20  ? 9.776   35.240 10.522  1.00 98.91  ? 20  ARG A CD  1 
ATOM   151  N NE  . ARG A 1 20  ? 9.368   34.502 9.322   1.00 96.96  ? 20  ARG A NE  1 
ATOM   152  C CZ  . ARG A 1 20  ? 8.194   34.644 8.715   1.00 97.45  ? 20  ARG A CZ  1 
ATOM   153  N NH1 . ARG A 1 20  ? 7.293   35.492 9.189   1.00 81.96  ? 20  ARG A NH1 1 
ATOM   154  N NH2 . ARG A 1 20  ? 7.909   33.934 7.633   1.00 76.35  ? 20  ARG A NH2 1 
ATOM   155  N N   . THR A 1 21  ? 12.743  38.943 6.870   1.00 96.45  ? 21  THR A N   1 
ATOM   156  C CA  . THR A 1 21  ? 14.131  39.402 7.093   1.00 97.56  ? 21  THR A CA  1 
ATOM   157  C C   . THR A 1 21  ? 15.046  38.602 8.037   1.00 102.56 ? 21  THR A C   1 
ATOM   158  O O   . THR A 1 21  ? 14.573  37.755 8.795   1.00 101.20 ? 21  THR A O   1 
ATOM   159  C CB  . THR A 1 21  ? 14.223  40.928 7.253   1.00 106.28 ? 21  THR A CB  1 
ATOM   160  O OG1 . THR A 1 21  ? 12.917  41.506 7.275   1.00 106.17 ? 21  THR A OG1 1 
ATOM   161  C CG2 . THR A 1 21  ? 15.039  41.569 6.145   1.00 105.75 ? 21  THR A CG2 1 
ATOM   162  N N   . MET A 1 22  ? 16.374  38.866 7.971   1.00 101.02 ? 22  MET A N   1 
ATOM   163  C CA  . MET A 1 22  ? 17.429  38.205 8.768   1.00 101.38 ? 22  MET A CA  1 
ATOM   164  C C   . MET A 1 22  ? 17.531  36.703 8.424   1.00 105.87 ? 22  MET A C   1 
ATOM   165  O O   . MET A 1 22  ? 18.539  36.264 7.860   1.00 106.61 ? 22  MET A O   1 
ATOM   166  C CB  . MET A 1 22  ? 17.267  38.433 10.301  1.00 102.90 ? 22  MET A CB  1 
ATOM   167  C CG  . MET A 1 22  ? 16.872  39.856 10.703  1.00 106.34 ? 22  MET A CG  1 
ATOM   168  S SD  . MET A 1 22  ? 18.061  41.127 10.215  1.00 111.75 ? 22  MET A SD  1 
ATOM   169  C CE  . MET A 1 22  ? 17.007  42.225 9.365   1.00 108.43 ? 22  MET A CE  1 
ATOM   170  N N   . THR A 1 23  ? 16.459  35.941 8.735   1.00 101.29 ? 23  THR A N   1 
ATOM   171  C CA  . THR A 1 23  ? 16.293  34.507 8.491   1.00 118.18 ? 23  THR A CA  1 
ATOM   172  C C   . THR A 1 23  ? 15.998  34.241 7.009   1.00 136.99 ? 23  THR A C   1 
ATOM   173  O O   . THR A 1 23  ? 16.697  34.739 6.125   1.00 97.86  ? 23  THR A O   1 
ATOM   174  C CB  . THR A 1 23  ? 15.162  33.951 9.384   1.00 122.79 ? 23  THR A CB  1 
ATOM   175  O OG1 . THR A 1 23  ? 13.995  34.762 9.230   1.00 121.25 ? 23  THR A OG1 1 
ATOM   176  C CG2 . THR A 1 23  ? 15.549  33.882 10.861  1.00 119.75 ? 23  THR A CG2 1 
ATOM   177  N N   . LYS A 1 31  ? 27.182  30.402 5.372   1.00 96.41  ? 31  LYS A N   1 
ATOM   178  C CA  . LYS A 1 31  ? 26.778  29.429 6.389   1.00 95.19  ? 31  LYS A CA  1 
ATOM   179  C C   . LYS A 1 31  ? 27.561  29.517 7.719   1.00 97.80  ? 31  LYS A C   1 
ATOM   180  O O   . LYS A 1 31  ? 27.162  28.887 8.705   1.00 96.96  ? 31  LYS A O   1 
ATOM   181  C CB  . LYS A 1 31  ? 26.708  27.991 5.828   1.00 98.43  ? 31  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 31  ? 27.968  27.493 5.114   1.00 114.84 ? 31  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 31  ? 27.716  26.124 4.471   1.00 124.34 ? 31  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 31  ? 28.949  25.493 3.870   1.00 131.21 ? 31  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 31  ? 28.648  24.160 3.282   1.00 135.41 ? 31  LYS A NZ  1 
ATOM   186  N N   . SER A 1 32  ? 28.650  30.320 7.751   1.00 93.32  ? 32  SER A N   1 
ATOM   187  C CA  . SER A 1 32  ? 29.455  30.547 8.958   1.00 92.28  ? 32  SER A CA  1 
ATOM   188  C C   . SER A 1 32  ? 29.172  31.953 9.558   1.00 91.92  ? 32  SER A C   1 
ATOM   189  O O   . SER A 1 32  ? 30.085  32.649 10.023  1.00 93.06  ? 32  SER A O   1 
ATOM   190  C CB  . SER A 1 32  ? 30.940  30.311 8.684   1.00 97.79  ? 32  SER A CB  1 
ATOM   191  O OG  . SER A 1 32  ? 31.451  31.219 7.722   1.00 108.06 ? 32  SER A OG  1 
ATOM   192  N N   . MET A 1 33  ? 27.876  32.343 9.549   1.00 82.66  ? 33  MET A N   1 
ATOM   193  C CA  . MET A 1 33  ? 27.333  33.593 10.078  1.00 79.01  ? 33  MET A CA  1 
ATOM   194  C C   . MET A 1 33  ? 27.280  33.564 11.592  1.00 76.84  ? 33  MET A C   1 
ATOM   195  O O   . MET A 1 33  ? 26.915  32.547 12.174  1.00 76.19  ? 33  MET A O   1 
ATOM   196  C CB  . MET A 1 33  ? 25.888  33.772 9.587   1.00 80.09  ? 33  MET A CB  1 
ATOM   197  C CG  . MET A 1 33  ? 25.779  34.376 8.236   1.00 84.82  ? 33  MET A CG  1 
ATOM   198  S SD  . MET A 1 33  ? 25.910  36.172 8.294   1.00 89.97  ? 33  MET A SD  1 
ATOM   199  C CE  . MET A 1 33  ? 26.107  36.490 6.593   1.00 88.07  ? 33  MET A CE  1 
ATOM   200  N N   . ILE A 1 34  ? 27.575  34.687 12.234  1.00 69.89  ? 34  ILE A N   1 
ATOM   201  C CA  . ILE A 1 34  ? 27.420  34.792 13.681  1.00 67.56  ? 34  ILE A CA  1 
ATOM   202  C C   . ILE A 1 34  ? 26.132  35.598 13.881  1.00 68.24  ? 34  ILE A C   1 
ATOM   203  O O   . ILE A 1 34  ? 26.097  36.779 13.540  1.00 67.94  ? 34  ILE A O   1 
ATOM   204  C CB  . ILE A 1 34  ? 28.654  35.404 14.392  1.00 71.27  ? 34  ILE A CB  1 
ATOM   205  C CG1 . ILE A 1 34  ? 29.887  34.497 14.218  1.00 72.77  ? 34  ILE A CG1 1 
ATOM   206  C CG2 . ILE A 1 34  ? 28.357  35.644 15.878  1.00 71.27  ? 34  ILE A CG2 1 
ATOM   207  C CD1 . ILE A 1 34  ? 31.187  35.116 14.543  1.00 75.36  ? 34  ILE A CD1 1 
ATOM   208  N N   . SER A 1 35  ? 25.062  34.942 14.359  1.00 62.20  ? 35  SER A N   1 
ATOM   209  C CA  . SER A 1 35  ? 23.767  35.592 14.570  1.00 60.01  ? 35  SER A CA  1 
ATOM   210  C C   . SER A 1 35  ? 23.503  36.060 16.016  1.00 60.38  ? 35  SER A C   1 
ATOM   211  O O   . SER A 1 35  ? 23.301  35.242 16.926  1.00 59.68  ? 35  SER A O   1 
ATOM   212  C CB  . SER A 1 35  ? 22.624  34.718 14.053  1.00 63.38  ? 35  SER A CB  1 
ATOM   213  O OG  . SER A 1 35  ? 21.358  35.360 14.124  1.00 72.59  ? 35  SER A OG  1 
ATOM   214  N N   . LEU A 1 36  ? 23.498  37.391 16.204  1.00 54.11  ? 36  LEU A N   1 
ATOM   215  C CA  . LEU A 1 36  ? 23.165  38.078 17.459  1.00 52.03  ? 36  LEU A CA  1 
ATOM   216  C C   . LEU A 1 36  ? 21.944  38.933 17.170  1.00 52.33  ? 36  LEU A C   1 
ATOM   217  O O   . LEU A 1 36  ? 21.632  39.846 17.937  1.00 50.25  ? 36  LEU A O   1 
ATOM   218  C CB  . LEU A 1 36  ? 24.315  38.976 17.926  1.00 52.74  ? 36  LEU A CB  1 
ATOM   219  C CG  . LEU A 1 36  ? 25.515  38.251 18.430  1.00 57.69  ? 36  LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 36  ? 26.668  38.553 17.584  1.00 59.04  ? 36  LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 36  ? 25.809  38.626 19.829  1.00 59.22  ? 36  LEU A CD2 1 
ATOM   222  N N   . ALA A 1 37  ? 21.263  38.629 16.045  1.00 48.80  ? 37  ALA A N   1 
ATOM   223  C CA  . ALA A 1 37  ? 20.092  39.344 15.570  1.00 48.66  ? 37  ALA A CA  1 
ATOM   224  C C   . ALA A 1 37  ? 18.846  38.878 16.273  1.00 54.62  ? 37  ALA A C   1 
ATOM   225  O O   . ALA A 1 37  ? 18.376  39.536 17.207  1.00 53.97  ? 37  ALA A O   1 
ATOM   226  C CB  . ALA A 1 37  ? 19.949  39.183 14.062  1.00 49.38  ? 37  ALA A CB  1 
ATOM   227  N N   . GLY A 1 38  ? 18.353  37.726 15.830  1.00 53.54  ? 38  GLY A N   1 
ATOM   228  C CA  . GLY A 1 38  ? 17.137  37.083 16.305  1.00 52.71  ? 38  GLY A CA  1 
ATOM   229  C C   . GLY A 1 38  ? 17.146  36.684 17.759  1.00 56.78  ? 38  GLY A C   1 
ATOM   230  O O   . GLY A 1 38  ? 18.084  36.043 18.248  1.00 57.20  ? 38  GLY A O   1 
ATOM   231  N N   . GLY A 1 39  ? 16.089  37.101 18.431  1.00 52.48  ? 39  GLY A N   1 
ATOM   232  C CA  . GLY A 1 39  ? 15.798  36.795 19.825  1.00 51.95  ? 39  GLY A CA  1 
ATOM   233  C C   . GLY A 1 39  ? 15.110  35.455 20.021  1.00 54.21  ? 39  GLY A C   1 
ATOM   234  O O   . GLY A 1 39  ? 14.134  35.360 20.768  1.00 53.67  ? 39  GLY A O   1 
ATOM   235  N N   . LEU A 1 40  ? 15.626  34.401 19.356  1.00 49.19  ? 40  LEU A N   1 
ATOM   236  C CA  . LEU A 1 40  ? 15.127  33.037 19.496  1.00 47.14  ? 40  LEU A CA  1 
ATOM   237  C C   . LEU A 1 40  ? 15.638  32.481 20.828  1.00 50.31  ? 40  LEU A C   1 
ATOM   238  O O   . LEU A 1 40  ? 16.827  32.623 21.135  1.00 51.57  ? 40  LEU A O   1 
ATOM   239  C CB  . LEU A 1 40  ? 15.575  32.112 18.346  1.00 46.78  ? 40  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 40  ? 15.170  32.462 16.908  1.00 50.85  ? 40  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 40  ? 15.462  31.308 15.990  1.00 52.47  ? 40  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 40  ? 13.693  32.832 16.779  1.00 49.57  ? 40  LEU A CD2 1 
ATOM   243  N N   . PRO A 1 41  ? 14.758  31.870 21.645  1.00 44.29  ? 41  PRO A N   1 
ATOM   244  C CA  . PRO A 1 41  ? 15.221  31.314 22.924  1.00 44.72  ? 41  PRO A CA  1 
ATOM   245  C C   . PRO A 1 41  ? 16.147  30.114 22.708  1.00 49.71  ? 41  PRO A C   1 
ATOM   246  O O   . PRO A 1 41  ? 16.069  29.472 21.658  1.00 49.74  ? 41  PRO A O   1 
ATOM   247  C CB  . PRO A 1 41  ? 13.920  30.897 23.602  1.00 45.51  ? 41  PRO A CB  1 
ATOM   248  C CG  . PRO A 1 41  ? 12.990  30.640 22.485  1.00 48.23  ? 41  PRO A CG  1 
ATOM   249  C CD  . PRO A 1 41  ? 13.317  31.628 21.442  1.00 43.66  ? 41  PRO A CD  1 
ATOM   250  N N   . ASN A 1 42  ? 17.027  29.821 23.678  1.00 46.12  ? 42  ASN A N   1 
ATOM   251  C CA  . ASN A 1 42  ? 17.914  28.682 23.543  1.00 46.75  ? 42  ASN A CA  1 
ATOM   252  C C   . ASN A 1 42  ? 17.126  27.345 23.648  1.00 52.80  ? 42  ASN A C   1 
ATOM   253  O O   . ASN A 1 42  ? 16.450  27.084 24.654  1.00 50.64  ? 42  ASN A O   1 
ATOM   254  C CB  . ASN A 1 42  ? 19.066  28.735 24.534  1.00 45.93  ? 42  ASN A CB  1 
ATOM   255  C CG  . ASN A 1 42  ? 20.201  27.836 24.125  1.00 65.44  ? 42  ASN A CG  1 
ATOM   256  O OD1 . ASN A 1 42  ? 20.041  26.620 23.994  1.00 58.26  ? 42  ASN A OD1 1 
ATOM   257  N ND2 . ASN A 1 42  ? 21.353  28.424 23.826  1.00 59.57  ? 42  ASN A ND2 1 
ATOM   258  N N   . PRO A 1 43  ? 17.190  26.500 22.594  1.00 52.62  ? 43  PRO A N   1 
ATOM   259  C CA  . PRO A 1 43  ? 16.446  25.230 22.633  1.00 53.33  ? 43  PRO A CA  1 
ATOM   260  C C   . PRO A 1 43  ? 17.047  24.163 23.565  1.00 58.25  ? 43  PRO A C   1 
ATOM   261  O O   . PRO A 1 43  ? 16.337  23.212 23.940  1.00 60.59  ? 43  PRO A O   1 
ATOM   262  C CB  . PRO A 1 43  ? 16.413  24.797 21.164  1.00 54.89  ? 43  PRO A CB  1 
ATOM   263  C CG  . PRO A 1 43  ? 17.655  25.365 20.593  1.00 59.65  ? 43  PRO A CG  1 
ATOM   264  C CD  . PRO A 1 43  ? 17.946  26.641 21.332  1.00 54.78  ? 43  PRO A CD  1 
ATOM   265  N N   . ASN A 1 44  ? 18.325  24.333 23.974  1.00 50.69  ? 44  ASN A N   1 
ATOM   266  C CA  . ASN A 1 44  ? 18.952  23.403 24.908  1.00 50.60  ? 44  ASN A CA  1 
ATOM   267  C C   . ASN A 1 44  ? 18.389  23.555 26.337  1.00 53.70  ? 44  ASN A C   1 
ATOM   268  O O   . ASN A 1 44  ? 18.800  22.829 27.238  1.00 55.18  ? 44  ASN A O   1 
ATOM   269  C CB  . ASN A 1 44  ? 20.485  23.517 24.864  1.00 52.41  ? 44  ASN A CB  1 
ATOM   270  C CG  . ASN A 1 44  ? 21.100  23.211 23.511  1.00 76.80  ? 44  ASN A CG  1 
ATOM   271  O OD1 . ASN A 1 44  ? 20.973  22.109 22.965  1.00 73.38  ? 44  ASN A OD1 1 
ATOM   272  N ND2 . ASN A 1 44  ? 21.820  24.167 22.953  1.00 68.33  ? 44  ASN A ND2 1 
ATOM   273  N N   . MET A 1 45  ? 17.416  24.470 26.524  1.00 48.62  ? 45  MET A N   1 
ATOM   274  C CA  . MET A 1 45  ? 16.755  24.769 27.797  1.00 48.22  ? 45  MET A CA  1 
ATOM   275  C C   . MET A 1 45  ? 15.363  24.153 27.889  1.00 50.20  ? 45  MET A C   1 
ATOM   276  O O   . MET A 1 45  ? 14.800  24.075 28.981  1.00 49.54  ? 45  MET A O   1 
ATOM   277  C CB  . MET A 1 45  ? 16.644  26.296 27.992  1.00 50.26  ? 45  MET A CB  1 
ATOM   278  C CG  . MET A 1 45  ? 17.982  27.014 28.088  1.00 54.93  ? 45  MET A CG  1 
ATOM   279  S SD  . MET A 1 45  ? 18.977  26.482 29.498  1.00 61.16  ? 45  MET A SD  1 
ATOM   280  C CE  . MET A 1 45  ? 20.304  25.678 28.689  1.00 59.08  ? 45  MET A CE  1 
ATOM   281  N N   . PHE A 1 46  ? 14.796  23.755 26.737  1.00 46.10  ? 46  PHE A N   1 
ATOM   282  C CA  . PHE A 1 46  ? 13.457  23.181 26.621  1.00 44.83  ? 46  PHE A CA  1 
ATOM   283  C C   . PHE A 1 46  ? 13.389  21.810 27.273  1.00 45.77  ? 46  PHE A C   1 
ATOM   284  O O   . PHE A 1 46  ? 14.314  21.018 27.097  1.00 44.95  ? 46  PHE A O   1 
ATOM   285  C CB  . PHE A 1 46  ? 12.978  23.182 25.154  1.00 46.67  ? 46  PHE A CB  1 
ATOM   286  C CG  . PHE A 1 46  ? 12.792  24.555 24.520  1.00 48.76  ? 46  PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 46  ? 12.570  25.689 25.310  1.00 51.66  ? 46  PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 46  ? 12.817  24.709 23.138  1.00 51.29  ? 46  PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 46  ? 12.399  26.944 24.730  1.00 52.27  ? 46  PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 46  ? 12.641  25.970 22.558  1.00 53.65  ? 46  PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 46  ? 12.442  27.078 23.359  1.00 51.55  ? 46  PHE A CZ  1 
ATOM   292  N N   . PRO A 1 47  ? 12.345  21.538 28.096  1.00 41.04  ? 47  PRO A N   1 
ATOM   293  C CA  . PRO A 1 47  ? 12.302  20.254 28.832  1.00 40.83  ? 47  PRO A CA  1 
ATOM   294  C C   . PRO A 1 47  ? 12.008  18.984 28.030  1.00 42.12  ? 47  PRO A C   1 
ATOM   295  O O   . PRO A 1 47  ? 12.382  17.902 28.485  1.00 41.74  ? 47  PRO A O   1 
ATOM   296  C CB  . PRO A 1 47  ? 11.268  20.513 29.933  1.00 41.91  ? 47  PRO A CB  1 
ATOM   297  C CG  . PRO A 1 47  ? 10.369  21.527 29.357  1.00 44.85  ? 47  PRO A CG  1 
ATOM   298  C CD  . PRO A 1 47  ? 11.197  22.402 28.454  1.00 40.64  ? 47  PRO A CD  1 
ATOM   299  N N   . PHE A 1 48  ? 11.329  19.094 26.870  1.00 36.82  ? 48  PHE A N   1 
ATOM   300  C CA  . PHE A 1 48  ? 11.024  17.917 26.047  1.00 36.67  ? 48  PHE A CA  1 
ATOM   301  C C   . PHE A 1 48  ? 12.243  17.577 25.184  1.00 41.06  ? 48  PHE A C   1 
ATOM   302  O O   . PHE A 1 48  ? 12.835  18.469 24.565  1.00 40.98  ? 48  PHE A O   1 
ATOM   303  C CB  . PHE A 1 48  ? 9.750   18.126 25.225  1.00 37.36  ? 48  PHE A CB  1 
ATOM   304  C CG  . PHE A 1 48  ? 8.602   18.678 26.031  1.00 38.02  ? 48  PHE A CG  1 
ATOM   305  C CD1 . PHE A 1 48  ? 7.945   17.887 26.968  1.00 41.65  ? 48  PHE A CD1 1 
ATOM   306  C CD2 . PHE A 1 48  ? 8.191   19.995 25.870  1.00 39.37  ? 48  PHE A CD2 1 
ATOM   307  C CE1 . PHE A 1 48  ? 6.892   18.405 27.724  1.00 42.47  ? 48  PHE A CE1 1 
ATOM   308  C CE2 . PHE A 1 48  ? 7.136   20.514 26.624  1.00 41.84  ? 48  PHE A CE2 1 
ATOM   309  C CZ  . PHE A 1 48  ? 6.483   19.712 27.536  1.00 40.81  ? 48  PHE A CZ  1 
ATOM   310  N N   . LYS A 1 49  ? 12.659  16.303 25.193  1.00 37.66  ? 49  LYS A N   1 
ATOM   311  C CA  . LYS A 1 49  ? 13.897  15.893 24.537  1.00 38.63  ? 49  LYS A CA  1 
ATOM   312  C C   . LYS A 1 49  ? 13.810  15.066 23.253  1.00 43.06  ? 49  LYS A C   1 
ATOM   313  O O   . LYS A 1 49  ? 14.563  15.349 22.315  1.00 42.44  ? 49  LYS A O   1 
ATOM   314  C CB  . LYS A 1 49  ? 14.887  15.295 25.567  1.00 42.75  ? 49  LYS A CB  1 
ATOM   315  C CG  . LYS A 1 49  ? 15.281  16.259 26.704  1.00 57.91  ? 49  LYS A CG  1 
ATOM   316  C CD  . LYS A 1 49  ? 16.140  17.450 26.230  1.00 66.03  ? 49  LYS A CD  1 
ATOM   317  C CE  . LYS A 1 49  ? 16.478  18.443 27.315  1.00 71.05  ? 49  LYS A CE  1 
ATOM   318  N NZ  . LYS A 1 49  ? 16.925  19.751 26.755  1.00 76.10  ? 49  LYS A NZ  1 
ATOM   319  N N   . THR A 1 50  ? 12.954  14.018 23.234  1.00 40.16  ? 50  THR A N   1 
ATOM   320  C CA  . THR A 1 50  ? 12.732  13.121 22.086  1.00 40.35  ? 50  THR A CA  1 
ATOM   321  C C   . THR A 1 50  ? 11.279  12.666 22.092  1.00 44.62  ? 50  THR A C   1 
ATOM   322  O O   . THR A 1 50  ? 10.647  12.664 23.148  1.00 44.87  ? 50  THR A O   1 
ATOM   323  C CB  . THR A 1 50  ? 13.620  11.852 22.124  1.00 47.50  ? 50  THR A CB  1 
ATOM   324  O OG1 . THR A 1 50  ? 13.256  11.039 23.232  1.00 48.01  ? 50  THR A OG1 1 
ATOM   325  C CG2 . THR A 1 50  ? 15.115  12.133 22.123  1.00 45.60  ? 50  THR A CG2 1 
ATOM   326  N N   . ALA A 1 51  ? 10.752  12.261 20.933  1.00 40.67  ? 51  ALA A N   1 
ATOM   327  C CA  . ALA A 1 51  ? 9.369   11.805 20.856  1.00 40.01  ? 51  ALA A CA  1 
ATOM   328  C C   . ALA A 1 51  ? 9.208   10.658 19.877  1.00 46.00  ? 51  ALA A C   1 
ATOM   329  O O   . ALA A 1 51  ? 9.892   10.611 18.847  1.00 46.83  ? 51  ALA A O   1 
ATOM   330  C CB  . ALA A 1 51  ? 8.442   12.949 20.482  1.00 38.87  ? 51  ALA A CB  1 
ATOM   331  N N   . VAL A 1 52  ? 8.311   9.719  20.222  1.00 41.03  ? 52  VAL A N   1 
ATOM   332  C CA  . VAL A 1 52  ? 7.975   8.577  19.393  1.00 41.06  ? 52  VAL A CA  1 
ATOM   333  C C   . VAL A 1 52  ? 6.470   8.377  19.444  1.00 42.92  ? 52  VAL A C   1 
ATOM   334  O O   . VAL A 1 52  ? 5.905   8.115  20.506  1.00 42.88  ? 52  VAL A O   1 
ATOM   335  C CB  . VAL A 1 52  ? 8.843   7.293  19.603  1.00 47.06  ? 52  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 52  ? 9.201   7.073  21.070  1.00 47.99  ? 52  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 52  ? 8.193   6.046  18.995  1.00 46.95  ? 52  VAL A CG2 1 
ATOM   338  N N   . ILE A 1 53  ? 5.830   8.592  18.288  1.00 37.24  ? 53  ILE A N   1 
ATOM   339  C CA  . ILE A 1 53  ? 4.396   8.493  18.072  1.00 35.37  ? 53  ILE A CA  1 
ATOM   340  C C   . ILE A 1 53  ? 4.120   7.285  17.166  1.00 41.15  ? 53  ILE A C   1 
ATOM   341  O O   . ILE A 1 53  ? 4.695   7.182  16.065  1.00 40.17  ? 53  ILE A O   1 
ATOM   342  C CB  . ILE A 1 53  ? 3.851   9.836  17.481  1.00 36.30  ? 53  ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 53  ? 4.106   11.012 18.452  1.00 36.13  ? 53  ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 53  ? 2.361   9.750  17.103  1.00 34.74  ? 53  ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 53  ? 4.316   12.397 17.799  1.00 43.48  ? 53  ILE A CD1 1 
ATOM   346  N N   . THR A 1 54  ? 3.235   6.372  17.642  1.00 38.92  ? 54  THR A N   1 
ATOM   347  C CA  . THR A 1 54  ? 2.821   5.196  16.866  1.00 39.97  ? 54  THR A CA  1 
ATOM   348  C C   . THR A 1 54  ? 1.656   5.578  15.938  1.00 43.87  ? 54  THR A C   1 
ATOM   349  O O   . THR A 1 54  ? 0.842   6.438  16.289  1.00 39.25  ? 54  THR A O   1 
ATOM   350  C CB  . THR A 1 54  ? 2.529   3.958  17.735  1.00 42.91  ? 54  THR A CB  1 
ATOM   351  O OG1 . THR A 1 54  ? 1.342   4.176  18.481  1.00 47.41  ? 54  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 54  ? 3.671   3.577  18.655  1.00 34.72  ? 54  THR A CG2 1 
ATOM   353  N N   . VAL A 1 55  ? 1.600   4.940  14.751  1.00 45.80  ? 55  VAL A N   1 
ATOM   354  C CA  . VAL A 1 55  ? 0.608   5.208  13.693  1.00 47.56  ? 55  VAL A CA  1 
ATOM   355  C C   . VAL A 1 55  ? -0.246  3.927  13.384  1.00 57.99  ? 55  VAL A C   1 
ATOM   356  O O   . VAL A 1 55  ? -0.160  2.950  14.130  1.00 58.61  ? 55  VAL A O   1 
ATOM   357  C CB  . VAL A 1 55  ? 1.324   5.829  12.435  1.00 51.23  ? 55  VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 55  ? 0.328   6.304  11.377  1.00 50.11  ? 55  VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 55  ? 2.256   6.981  12.829  1.00 50.37  ? 55  VAL A CG2 1 
ATOM   360  N N   . GLU A 1 56  ? -1.085  3.959  12.324  1.00 58.61  ? 56  GLU A N   1 
ATOM   361  C CA  . GLU A 1 56  ? -1.935  2.855  11.858  1.00 61.20  ? 56  GLU A CA  1 
ATOM   362  C C   . GLU A 1 56  ? -1.275  2.033  10.695  1.00 72.29  ? 56  GLU A C   1 
ATOM   363  O O   . GLU A 1 56  ? -1.474  2.376  9.526   1.00 73.50  ? 56  GLU A O   1 
ATOM   364  C CB  . GLU A 1 56  ? -3.347  3.366  11.466  1.00 61.42  ? 56  GLU A CB  1 
ATOM   365  C CG  . GLU A 1 56  ? -3.398  4.423  10.365  1.00 67.46  ? 56  GLU A CG  1 
ATOM   366  C CD  . GLU A 1 56  ? -4.781  4.769  9.846   1.00 92.37  ? 56  GLU A CD  1 
ATOM   367  O OE1 . GLU A 1 56  ? -4.991  4.682  8.613   1.00 83.09  ? 56  GLU A OE1 1 
ATOM   368  O OE2 . GLU A 1 56  ? -5.647  5.160  10.664  1.00 92.47  ? 56  GLU A OE2 1 
ATOM   369  N N   . ASN A 1 57  ? -0.507  0.956  10.969  1.00 72.32  ? 57  ASN A N   1 
ATOM   370  C CA  . ASN A 1 57  ? -0.149  0.366  12.259  1.00 73.76  ? 57  ASN A CA  1 
ATOM   371  C C   . ASN A 1 57  ? 1.272   -0.194 12.160  1.00 80.43  ? 57  ASN A C   1 
ATOM   372  O O   . ASN A 1 57  ? 1.690   -0.631 11.079  1.00 81.07  ? 57  ASN A O   1 
ATOM   373  C CB  . ASN A 1 57  ? -1.132  -0.752 12.631  1.00 77.64  ? 57  ASN A CB  1 
ATOM   374  C CG  . ASN A 1 57  ? -0.644  -1.663 13.731  1.00 105.26 ? 57  ASN A CG  1 
ATOM   375  O OD1 . ASN A 1 57  ? -0.352  -1.230 14.856  1.00 102.39 ? 57  ASN A OD1 1 
ATOM   376  N ND2 . ASN A 1 57  ? -0.486  -2.932 13.403  1.00 97.15  ? 57  ASN A ND2 1 
ATOM   377  N N   . GLY A 1 58  ? 1.998   -0.170 13.283  1.00 77.09  ? 58  GLY A N   1 
ATOM   378  C CA  . GLY A 1 58  ? 3.378   -0.641 13.338  1.00 77.98  ? 58  GLY A CA  1 
ATOM   379  C C   . GLY A 1 58  ? 4.314   0.408  12.782  1.00 80.98  ? 58  GLY A C   1 
ATOM   380  O O   . GLY A 1 58  ? 5.534   0.325  12.963  1.00 82.48  ? 58  GLY A O   1 
ATOM   381  N N   . LYS A 1 59  ? 3.727   1.403  12.087  1.00 74.71  ? 59  LYS A N   1 
ATOM   382  C CA  . LYS A 1 59  ? 4.397   2.564  11.511  1.00 73.22  ? 59  LYS A CA  1 
ATOM   383  C C   . LYS A 1 59  ? 4.739   3.490  12.683  1.00 73.15  ? 59  LYS A C   1 
ATOM   384  O O   . LYS A 1 59  ? 3.979   3.568  13.663  1.00 71.01  ? 59  LYS A O   1 
ATOM   385  C CB  . LYS A 1 59  ? 3.489   3.277  10.496  1.00 74.78  ? 59  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 59  ? 3.054   2.410  9.314   1.00 84.38  ? 59  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 59  ? 1.755   2.942  8.727   1.00 87.32  ? 59  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 59  ? 1.281   2.160  7.535   1.00 91.51  ? 59  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 59  ? 0.084   2.794  6.922   1.00 97.84  ? 59  LYS A NZ  1 
ATOM   390  N N   . THR A 1 60  ? 5.910   4.145  12.605  1.00 67.92  ? 60  THR A N   1 
ATOM   391  C CA  . THR A 1 60  ? 6.398   4.981  13.686  1.00 65.92  ? 60  THR A CA  1 
ATOM   392  C C   . THR A 1 60  ? 7.048   6.280  13.230  1.00 65.76  ? 60  THR A C   1 
ATOM   393  O O   . THR A 1 60  ? 7.974   6.264  12.418  1.00 67.52  ? 60  THR A O   1 
ATOM   394  C CB  . THR A 1 60  ? 7.249   4.105  14.641  1.00 75.82  ? 60  THR A CB  1 
ATOM   395  O OG1 . THR A 1 60  ? 6.364   3.401  15.509  1.00 75.61  ? 60  THR A OG1 1 
ATOM   396  C CG2 . THR A 1 60  ? 8.250   4.892  15.471  1.00 74.92  ? 60  THR A CG2 1 
ATOM   397  N N   . ILE A 1 61  ? 6.548   7.399  13.776  1.00 57.04  ? 61  ILE A N   1 
ATOM   398  C CA  . ILE A 1 61  ? 7.090   8.754  13.623  1.00 54.23  ? 61  ILE A CA  1 
ATOM   399  C C   . ILE A 1 61  ? 8.073   8.975  14.792  1.00 53.79  ? 61  ILE A C   1 
ATOM   400  O O   . ILE A 1 61  ? 7.758   8.625  15.933  1.00 52.97  ? 61  ILE A O   1 
ATOM   401  C CB  . ILE A 1 61  ? 5.935   9.802  13.605  1.00 55.78  ? 61  ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 61  ? 5.308   9.885  12.213  1.00 55.59  ? 61  ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 61  ? 6.381   11.194 14.084  1.00 56.55  ? 61  ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 61  ? 3.951   10.471 12.206  1.00 62.31  ? 61  ILE A CD1 1 
ATOM   405  N N   . GLN A 1 62  ? 9.252   9.546  14.514  1.00 48.40  ? 62  GLN A N   1 
ATOM   406  C CA  . GLN A 1 62  ? 10.257  9.789  15.555  1.00 47.51  ? 62  GLN A CA  1 
ATOM   407  C C   . GLN A 1 62  ? 10.870  11.158 15.487  1.00 48.67  ? 62  GLN A C   1 
ATOM   408  O O   . GLN A 1 62  ? 11.353  11.573 14.428  1.00 50.15  ? 62  GLN A O   1 
ATOM   409  C CB  . GLN A 1 62  ? 11.384  8.741  15.512  1.00 50.44  ? 62  GLN A CB  1 
ATOM   410  C CG  . GLN A 1 62  ? 11.019  7.425  16.171  1.00 75.58  ? 62  GLN A CG  1 
ATOM   411  C CD  . GLN A 1 62  ? 11.718  6.256  15.533  1.00 99.12  ? 62  GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 62  ? 11.362  5.816  14.428  1.00 94.96  ? 62  GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 62  ? 12.709  5.711  16.233  1.00 91.73  ? 62  GLN A NE2 1 
ATOM   414  N N   . PHE A 1 63  ? 10.879  11.858 16.623  1.00 40.64  ? 63  PHE A N   1 
ATOM   415  C CA  . PHE A 1 63  ? 11.557  13.138 16.699  1.00 38.40  ? 63  PHE A CA  1 
ATOM   416  C C   . PHE A 1 63  ? 12.804  12.909 17.553  1.00 40.81  ? 63  PHE A C   1 
ATOM   417  O O   . PHE A 1 63  ? 12.698  12.677 18.761  1.00 40.44  ? 63  PHE A O   1 
ATOM   418  C CB  . PHE A 1 63  ? 10.667  14.266 17.274  1.00 38.22  ? 63  PHE A CB  1 
ATOM   419  C CG  . PHE A 1 63  ? 9.466   14.742 16.477  1.00 37.89  ? 63  PHE A CG  1 
ATOM   420  C CD1 . PHE A 1 63  ? 9.073   14.089 15.312  1.00 39.92  ? 63  PHE A CD1 1 
ATOM   421  C CD2 . PHE A 1 63  ? 8.686   15.801 16.931  1.00 38.88  ? 63  PHE A CD2 1 
ATOM   422  C CE1 . PHE A 1 63  ? 7.936   14.499 14.607  1.00 39.61  ? 63  PHE A CE1 1 
ATOM   423  C CE2 . PHE A 1 63  ? 7.556   16.221 16.215  1.00 40.33  ? 63  PHE A CE2 1 
ATOM   424  C CZ  . PHE A 1 63  ? 7.201   15.575 15.048  1.00 38.42  ? 63  PHE A CZ  1 
ATOM   425  N N   . GLY A 1 64  ? 13.961  12.909 16.897  1.00 36.44  ? 64  GLY A N   1 
ATOM   426  C CA  . GLY A 1 64  ? 15.252  12.771 17.552  1.00 37.50  ? 64  GLY A CA  1 
ATOM   427  C C   . GLY A 1 64  ? 15.664  14.044 18.267  1.00 41.50  ? 64  GLY A C   1 
ATOM   428  O O   . GLY A 1 64  ? 14.923  15.030 18.266  1.00 39.96  ? 64  GLY A O   1 
ATOM   429  N N   . GLU A 1 65  ? 16.857  14.034 18.876  1.00 39.85  ? 65  GLU A N   1 
ATOM   430  C CA  . GLU A 1 65  ? 17.404  15.152 19.637  1.00 39.87  ? 65  GLU A CA  1 
ATOM   431  C C   . GLU A 1 65  ? 17.260  16.507 18.932  1.00 43.42  ? 65  GLU A C   1 
ATOM   432  O O   . GLU A 1 65  ? 16.718  17.462 19.508  1.00 40.70  ? 65  GLU A O   1 
ATOM   433  C CB  . GLU A 1 65  ? 18.872  14.873 20.020  1.00 43.11  ? 65  GLU A CB  1 
ATOM   434  C CG  . GLU A 1 65  ? 19.094  14.606 21.504  1.00 55.77  ? 65  GLU A CG  1 
ATOM   435  C CD  . GLU A 1 65  ? 18.723  13.237 22.048  1.00 90.24  ? 65  GLU A CD  1 
ATOM   436  O OE1 . GLU A 1 65  ? 18.423  12.323 21.243  1.00 106.49 ? 65  GLU A OE1 1 
ATOM   437  O OE2 . GLU A 1 65  ? 18.770  13.071 23.288  1.00 81.97  ? 65  GLU A OE2 1 
ATOM   438  N N   . GLU A 1 66  ? 17.698  16.559 17.672  1.00 42.30  ? 66  GLU A N   1 
ATOM   439  C CA  . GLU A 1 66  ? 17.679  17.770 16.854  1.00 41.98  ? 66  GLU A CA  1 
ATOM   440  C C   . GLU A 1 66  ? 16.323  18.132 16.270  1.00 46.31  ? 66  GLU A C   1 
ATOM   441  O O   . GLU A 1 66  ? 15.976  19.320 16.272  1.00 43.09  ? 66  GLU A O   1 
ATOM   442  C CB  . GLU A 1 66  ? 18.789  17.735 15.806  1.00 44.26  ? 66  GLU A CB  1 
ATOM   443  C CG  . GLU A 1 66  ? 20.172  17.617 16.433  1.00 54.61  ? 66  GLU A CG  1 
ATOM   444  C CD  . GLU A 1 66  ? 20.680  18.797 17.235  1.00 79.24  ? 66  GLU A CD  1 
ATOM   445  O OE1 . GLU A 1 66  ? 20.464  19.957 16.813  1.00 78.31  ? 66  GLU A OE1 1 
ATOM   446  O OE2 . GLU A 1 66  ? 21.320  18.554 18.283  1.00 73.69  ? 66  GLU A OE2 1 
ATOM   447  N N   . MET A 1 67  ? 15.543  17.112 15.806  1.00 46.13  ? 67  MET A N   1 
ATOM   448  C CA  . MET A 1 67  ? 14.182  17.277 15.271  1.00 46.40  ? 67  MET A CA  1 
ATOM   449  C C   . MET A 1 67  ? 13.265  17.901 16.351  1.00 47.01  ? 67  MET A C   1 
ATOM   450  O O   . MET A 1 67  ? 12.473  18.795 16.041  1.00 43.65  ? 67  MET A O   1 
ATOM   451  C CB  . MET A 1 67  ? 13.641  15.927 14.773  1.00 50.66  ? 67  MET A CB  1 
ATOM   452  C CG  . MET A 1 67  ? 12.263  15.991 14.122  1.00 55.71  ? 67  MET A CG  1 
ATOM   453  S SD  . MET A 1 67  ? 12.197  16.818 12.514  1.00 62.15  ? 67  MET A SD  1 
ATOM   454  C CE  . MET A 1 67  ? 12.488  15.436 11.440  1.00 60.09  ? 67  MET A CE  1 
ATOM   455  N N   . MET A 1 68  ? 13.429  17.462 17.620  1.00 44.26  ? 68  MET A N   1 
ATOM   456  C CA  . MET A 1 68  ? 12.694  17.973 18.777  1.00 43.25  ? 68  MET A CA  1 
ATOM   457  C C   . MET A 1 68  ? 13.018  19.444 19.023  1.00 44.49  ? 68  MET A C   1 
ATOM   458  O O   . MET A 1 68  ? 12.106  20.228 19.264  1.00 44.24  ? 68  MET A O   1 
ATOM   459  C CB  . MET A 1 68  ? 12.972  17.120 20.028  1.00 46.99  ? 68  MET A CB  1 
ATOM   460  C CG  . MET A 1 68  ? 12.035  17.404 21.196  1.00 51.05  ? 68  MET A CG  1 
ATOM   461  S SD  . MET A 1 68  ? 10.295  17.077 20.826  1.00 55.49  ? 68  MET A SD  1 
ATOM   462  C CE  . MET A 1 68  ? 9.899   15.955 22.096  1.00 53.11  ? 68  MET A CE  1 
ATOM   463  N N   . LYS A 1 69  ? 14.300  19.826 18.930  1.00 39.77  ? 69  LYS A N   1 
ATOM   464  C CA  . LYS A 1 69  ? 14.725  21.216 19.108  1.00 38.07  ? 69  LYS A CA  1 
ATOM   465  C C   . LYS A 1 69  ? 14.079  22.104 18.039  1.00 39.58  ? 69  LYS A C   1 
ATOM   466  O O   . LYS A 1 69  ? 13.626  23.207 18.347  1.00 38.36  ? 69  LYS A O   1 
ATOM   467  C CB  . LYS A 1 69  ? 16.257  21.338 19.082  1.00 41.10  ? 69  LYS A CB  1 
ATOM   468  C CG  . LYS A 1 69  ? 16.897  20.999 20.414  1.00 48.19  ? 69  LYS A CG  1 
ATOM   469  C CD  . LYS A 1 69  ? 18.383  21.291 20.412  1.00 52.95  ? 69  LYS A CD  1 
ATOM   470  C CE  . LYS A 1 69  ? 19.199  20.036 20.516  1.00 55.17  ? 69  LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 69  ? 20.649  20.345 20.534  1.00 66.49  ? 69  LYS A NZ  1 
ATOM   472  N N   . ARG A 1 70  ? 13.972  21.587 16.800  1.00 34.27  ? 70  ARG A N   1 
ATOM   473  C CA  . ARG A 1 70  ? 13.322  22.305 15.717  1.00 32.06  ? 70  ARG A CA  1 
ATOM   474  C C   . ARG A 1 70  ? 11.808  22.458 16.014  1.00 34.07  ? 70  ARG A C   1 
ATOM   475  O O   . ARG A 1 70  ? 11.269  23.561 15.920  1.00 32.39  ? 70  ARG A O   1 
ATOM   476  C CB  . ARG A 1 70  ? 13.562  21.585 14.381  1.00 30.27  ? 70  ARG A CB  1 
ATOM   477  C CG  . ARG A 1 70  ? 13.091  22.412 13.209  1.00 33.96  ? 70  ARG A CG  1 
ATOM   478  C CD  . ARG A 1 70  ? 13.008  21.636 11.928  1.00 36.05  ? 70  ARG A CD  1 
ATOM   479  N NE  . ARG A 1 70  ? 12.247  22.417 10.955  1.00 42.27  ? 70  ARG A NE  1 
ATOM   480  C CZ  . ARG A 1 70  ? 11.970  22.011 9.725   1.00 56.81  ? 70  ARG A CZ  1 
ATOM   481  N NH1 . ARG A 1 70  ? 12.371  20.815 9.306   1.00 52.94  ? 70  ARG A NH1 1 
ATOM   482  N NH2 . ARG A 1 70  ? 11.273  22.789 8.907   1.00 34.86  ? 70  ARG A NH2 1 
ATOM   483  N N   . ALA A 1 71  ? 11.151  21.347 16.402  1.00 30.55  ? 71  ALA A N   1 
ATOM   484  C CA  . ALA A 1 71  ? 9.724   21.271 16.719  1.00 28.42  ? 71  ALA A CA  1 
ATOM   485  C C   . ALA A 1 71  ? 9.279   22.208 17.840  1.00 31.29  ? 71  ALA A C   1 
ATOM   486  O O   . ALA A 1 71  ? 8.166   22.723 17.785  1.00 30.76  ? 71  ALA A O   1 
ATOM   487  C CB  . ALA A 1 71  ? 9.354   19.842 17.063  1.00 29.06  ? 71  ALA A CB  1 
ATOM   488  N N   . LEU A 1 72  ? 10.136  22.421 18.850  1.00 26.90  ? 72  LEU A N   1 
ATOM   489  C CA  . LEU A 1 72  ? 9.833   23.248 20.011  1.00 25.60  ? 72  LEU A CA  1 
ATOM   490  C C   . LEU A 1 72  ? 10.195  24.725 19.835  1.00 30.27  ? 72  LEU A C   1 
ATOM   491  O O   . LEU A 1 72  ? 10.001  25.517 20.758  1.00 30.76  ? 72  LEU A O   1 
ATOM   492  C CB  . LEU A 1 72  ? 10.543  22.667 21.246  1.00 26.24  ? 72  LEU A CB  1 
ATOM   493  C CG  . LEU A 1 72  ? 10.140  21.268 21.734  1.00 31.00  ? 72  LEU A CG  1 
ATOM   494  C CD1 . LEU A 1 72  ? 10.903  20.904 23.006  1.00 32.06  ? 72  LEU A CD1 1 
ATOM   495  C CD2 . LEU A 1 72  ? 8.630   21.152 21.962  1.00 32.13  ? 72  LEU A CD2 1 
ATOM   496  N N   . GLN A 1 73  ? 10.726  25.092 18.656  1.00 26.92  ? 73  GLN A N   1 
ATOM   497  C CA  . GLN A 1 73  ? 11.190  26.447 18.312  1.00 25.99  ? 73  GLN A CA  1 
ATOM   498  C C   . GLN A 1 73  ? 10.268  27.177 17.306  1.00 27.28  ? 73  GLN A C   1 
ATOM   499  O O   . GLN A 1 73  ? 9.496   26.517 16.608  1.00 26.88  ? 73  GLN A O   1 
ATOM   500  C CB  . GLN A 1 73  ? 12.656  26.363 17.784  1.00 27.62  ? 73  GLN A CB  1 
ATOM   501  C CG  . GLN A 1 73  ? 13.373  27.683 17.440  1.00 28.88  ? 73  GLN A CG  1 
ATOM   502  C CD  . GLN A 1 73  ? 13.476  28.648 18.594  1.00 43.29  ? 73  GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 73  ? 12.517  29.356 18.935  1.00 45.80  ? 73  GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 73  ? 14.646  28.717 19.211  1.00 22.10  ? 73  GLN A NE2 1 
ATOM   505  N N   . TYR A 1 74  ? 10.368  28.539 17.227  1.00 22.23  ? 74  TYR A N   1 
ATOM   506  C CA  . TYR A 1 74  ? 9.638   29.378 16.268  1.00 21.75  ? 74  TYR A CA  1 
ATOM   507  C C   . TYR A 1 74  ? 9.906   28.907 14.811  1.00 27.78  ? 74  TYR A C   1 
ATOM   508  O O   . TYR A 1 74  ? 10.970  28.344 14.507  1.00 26.79  ? 74  TYR A O   1 
ATOM   509  C CB  . TYR A 1 74  ? 10.042  30.868 16.386  1.00 22.70  ? 74  TYR A CB  1 
ATOM   510  C CG  . TYR A 1 74  ? 9.604   31.605 17.640  1.00 25.43  ? 74  TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 74  ? 8.252   31.834 17.906  1.00 27.63  ? 74  TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 74  ? 10.542  32.185 18.498  1.00 25.97  ? 74  TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 74  ? 7.845   32.546 19.040  1.00 27.67  ? 74  TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 74  ? 10.149  32.918 19.617  1.00 26.20  ? 74  TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 74  ? 8.797   33.100 19.886  1.00 31.42  ? 74  TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 74  ? 8.398   33.832 20.990  1.00 23.86  ? 74  TYR A OH  1 
ATOM   517  N N   . SER A 1 75  ? 8.941   29.155 13.917  1.00 26.22  ? 75  SER A N   1 
ATOM   518  C CA  . SER A 1 75  ? 9.049   28.794 12.499  1.00 27.46  ? 75  SER A CA  1 
ATOM   519  C C   . SER A 1 75  ? 8.309   29.825 11.599  1.00 32.00  ? 75  SER A C   1 
ATOM   520  O O   . SER A 1 75  ? 7.548   30.638 12.138  1.00 29.43  ? 75  SER A O   1 
ATOM   521  C CB  . SER A 1 75  ? 8.563   27.361 12.264  1.00 30.88  ? 75  SER A CB  1 
ATOM   522  O OG  . SER A 1 75  ? 7.295   27.110 12.837  1.00 33.91  ? 75  SER A OG  1 
ATOM   523  N N   . PRO A 1 76  ? 8.539   29.851 10.248  1.00 29.84  ? 76  PRO A N   1 
ATOM   524  C CA  . PRO A 1 76  ? 7.876   30.873 9.402   1.00 28.56  ? 76  PRO A CA  1 
ATOM   525  C C   . PRO A 1 76  ? 6.347   30.959 9.497   1.00 30.89  ? 76  PRO A C   1 
ATOM   526  O O   . PRO A 1 76  ? 5.666   29.948 9.664   1.00 29.28  ? 76  PRO A O   1 
ATOM   527  C CB  . PRO A 1 76  ? 8.330   30.509 7.983   1.00 30.60  ? 76  PRO A CB  1 
ATOM   528  C CG  . PRO A 1 76  ? 9.541   29.713 8.148   1.00 35.29  ? 76  PRO A CG  1 
ATOM   529  C CD  . PRO A 1 76  ? 9.408   28.971 9.431   1.00 30.96  ? 76  PRO A CD  1 
ATOM   530  N N   . SER A 1 77  ? 5.820   32.184 9.352   1.00 28.14  ? 77  SER A N   1 
ATOM   531  C CA  . SER A 1 77  ? 4.394   32.517 9.410   1.00 27.74  ? 77  SER A CA  1 
ATOM   532  C C   . SER A 1 77  ? 3.515   31.703 8.471   1.00 34.96  ? 77  SER A C   1 
ATOM   533  O O   . SER A 1 77  ? 2.429   31.289 8.885   1.00 35.21  ? 77  SER A O   1 
ATOM   534  C CB  . SER A 1 77  ? 4.169   34.003 9.145   1.00 28.57  ? 77  SER A CB  1 
ATOM   535  O OG  . SER A 1 77  ? 4.671   34.798 10.199  1.00 31.25  ? 77  SER A OG  1 
ATOM   536  N N   . ALA A 1 78  ? 3.972   31.484 7.223   1.00 33.62  ? 78  ALA A N   1 
ATOM   537  C CA  . ALA A 1 78  ? 3.238   30.757 6.183   1.00 34.61  ? 78  ALA A CA  1 
ATOM   538  C C   . ALA A 1 78  ? 3.214   29.228 6.362   1.00 38.64  ? 78  ALA A C   1 
ATOM   539  O O   . ALA A 1 78  ? 2.383   28.558 5.748   1.00 38.44  ? 78  ALA A O   1 
ATOM   540  C CB  . ALA A 1 78  ? 3.790   31.115 4.815   1.00 36.44  ? 78  ALA A CB  1 
ATOM   541  N N   . GLY A 1 79  ? 4.124   28.703 7.183   1.00 34.56  ? 79  GLY A N   1 
ATOM   542  C CA  . GLY A 1 79  ? 4.261   27.274 7.445   1.00 33.61  ? 79  GLY A CA  1 
ATOM   543  C C   . GLY A 1 79  ? 5.680   26.800 7.224   1.00 36.76  ? 79  GLY A C   1 
ATOM   544  O O   . GLY A 1 79  ? 6.513   27.540 6.676   1.00 37.55  ? 79  GLY A O   1 
ATOM   545  N N   . ILE A 1 80  ? 5.981   25.566 7.678   1.00 30.22  ? 80  ILE A N   1 
ATOM   546  C CA  . ILE A 1 80  ? 7.301   24.962 7.475   1.00 29.27  ? 80  ILE A CA  1 
ATOM   547  C C   . ILE A 1 80  ? 7.484   24.646 5.964   1.00 32.25  ? 80  ILE A C   1 
ATOM   548  O O   . ILE A 1 80  ? 6.512   24.253 5.305   1.00 30.58  ? 80  ILE A O   1 
ATOM   549  C CB  . ILE A 1 80  ? 7.566   23.762 8.418   1.00 32.28  ? 80  ILE A CB  1 
ATOM   550  C CG1 . ILE A 1 80  ? 6.522   22.620 8.227   1.00 33.31  ? 80  ILE A CG1 1 
ATOM   551  C CG2 . ILE A 1 80  ? 7.620   24.249 9.876   1.00 31.55  ? 80  ILE A CG2 1 
ATOM   552  C CD1 . ILE A 1 80  ? 6.925   21.210 8.644   1.00 36.08  ? 80  ILE A CD1 1 
ATOM   553  N N   . PRO A 1 81  ? 8.675   24.911 5.372   1.00 29.65  ? 81  PRO A N   1 
ATOM   554  C CA  . PRO A 1 81  ? 8.836   24.721 3.914   1.00 30.03  ? 81  PRO A CA  1 
ATOM   555  C C   . PRO A 1 81  ? 8.402   23.383 3.326   1.00 34.84  ? 81  PRO A C   1 
ATOM   556  O O   . PRO A 1 81  ? 7.747   23.380 2.274   1.00 36.13  ? 81  PRO A O   1 
ATOM   557  C CB  . PRO A 1 81  ? 10.318  25.049 3.657   1.00 31.62  ? 81  PRO A CB  1 
ATOM   558  C CG  . PRO A 1 81  ? 10.954  25.064 4.961   1.00 35.42  ? 81  PRO A CG  1 
ATOM   559  C CD  . PRO A 1 81  ? 9.915   25.444 5.968   1.00 30.51  ? 81  PRO A CD  1 
ATOM   560  N N   . GLU A 1 82  ? 8.749   22.265 3.999   1.00 29.69  ? 82  GLU A N   1 
ATOM   561  C CA  . GLU A 1 82  ? 8.404   20.917 3.555   1.00 29.89  ? 82  GLU A CA  1 
ATOM   562  C C   . GLU A 1 82  ? 6.902   20.667 3.495   1.00 37.03  ? 82  GLU A C   1 
ATOM   563  O O   . GLU A 1 82  ? 6.452   20.020 2.554   1.00 38.46  ? 82  GLU A O   1 
ATOM   564  C CB  . GLU A 1 82  ? 9.154   19.816 4.326   1.00 31.12  ? 82  GLU A CB  1 
ATOM   565  C CG  . GLU A 1 82  ? 9.191   19.969 5.831   1.00 41.08  ? 82  GLU A CG  1 
ATOM   566  C CD  . GLU A 1 82  ? 10.384  20.736 6.374   1.00 62.07  ? 82  GLU A CD  1 
ATOM   567  O OE1 . GLU A 1 82  ? 10.357  21.988 6.360   1.00 56.21  ? 82  GLU A OE1 1 
ATOM   568  O OE2 . GLU A 1 82  ? 11.330  20.078 6.860   1.00 52.06  ? 82  GLU A OE2 1 
ATOM   569  N N   . LEU A 1 83  ? 6.117   21.227 4.460   1.00 33.48  ? 83  LEU A N   1 
ATOM   570  C CA  . LEU A 1 83  ? 4.654   21.105 4.454   1.00 32.73  ? 83  LEU A CA  1 
ATOM   571  C C   . LEU A 1 83  ? 4.064   21.894 3.294   1.00 39.28  ? 83  LEU A C   1 
ATOM   572  O O   . LEU A 1 83  ? 3.283   21.333 2.526   1.00 40.90  ? 83  LEU A O   1 
ATOM   573  C CB  . LEU A 1 83  ? 4.032   21.549 5.787   1.00 31.14  ? 83  LEU A CB  1 
ATOM   574  C CG  . LEU A 1 83  ? 2.572   21.112 6.109   1.00 34.05  ? 83  LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 83  ? 2.307   19.614 5.826   1.00 33.46  ? 83  LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 83  ? 2.233   21.422 7.556   1.00 33.90  ? 83  LEU A CD2 1 
ATOM   577  N N   . LEU A 1 84  ? 4.494   23.163 3.124   1.00 35.82  ? 84  LEU A N   1 
ATOM   578  C CA  . LEU A 1 84  ? 4.044   24.051 2.050   1.00 36.15  ? 84  LEU A CA  1 
ATOM   579  C C   . LEU A 1 84  ? 4.278   23.489 0.652   1.00 41.70  ? 84  LEU A C   1 
ATOM   580  O O   . LEU A 1 84  ? 3.361   23.556 -0.169  1.00 43.40  ? 84  LEU A O   1 
ATOM   581  C CB  . LEU A 1 84  ? 4.655   25.448 2.175   1.00 36.40  ? 84  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 84  ? 4.048   26.372 3.212   1.00 40.85  ? 84  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 84  ? 4.899   27.593 3.393   1.00 41.30  ? 84  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 84  ? 2.618   26.797 2.830   1.00 44.70  ? 84  LEU A CD2 1 
ATOM   585  N N   . SER A 1 85  ? 5.466   22.912 0.384   1.00 38.20  ? 85  SER A N   1 
ATOM   586  C CA  . SER A 1 85  ? 5.751   22.331 -0.936  1.00 40.51  ? 85  SER A CA  1 
ATOM   587  C C   . SER A 1 85  ? 4.887   21.097 -1.235  1.00 46.48  ? 85  SER A C   1 
ATOM   588  O O   . SER A 1 85  ? 4.420   20.944 -2.367  1.00 47.39  ? 85  SER A O   1 
ATOM   589  C CB  . SER A 1 85  ? 7.230   22.005 -1.100  1.00 45.09  ? 85  SER A CB  1 
ATOM   590  O OG  . SER A 1 85  ? 7.710   21.224 -0.019  1.00 57.37  ? 85  SER A OG  1 
ATOM   591  N N   . TRP A 1 86  ? 4.644   20.249 -0.213  1.00 42.18  ? 86  TRP A N   1 
ATOM   592  C CA  . TRP A 1 86  ? 3.844   19.034 -0.346  1.00 42.74  ? 86  TRP A CA  1 
ATOM   593  C C   . TRP A 1 86  ? 2.391   19.362 -0.681  1.00 48.41  ? 86  TRP A C   1 
ATOM   594  O O   . TRP A 1 86  ? 1.783   18.712 -1.545  1.00 49.16  ? 86  TRP A O   1 
ATOM   595  C CB  . TRP A 1 86  ? 3.910   18.216 0.950   1.00 40.46  ? 86  TRP A CB  1 
ATOM   596  C CG  . TRP A 1 86  ? 3.587   16.767 0.765   1.00 41.75  ? 86  TRP A CG  1 
ATOM   597  C CD1 . TRP A 1 86  ? 4.478   15.750 0.592   1.00 45.39  ? 86  TRP A CD1 1 
ATOM   598  C CD2 . TRP A 1 86  ? 2.282   16.167 0.748   1.00 41.24  ? 86  TRP A CD2 1 
ATOM   599  N NE1 . TRP A 1 86  ? 3.816   14.551 0.483   1.00 44.64  ? 86  TRP A NE1 1 
ATOM   600  C CE2 . TRP A 1 86  ? 2.466   14.774 0.576   1.00 45.35  ? 86  TRP A CE2 1 
ATOM   601  C CE3 . TRP A 1 86  ? 0.976   16.663 0.937   1.00 41.56  ? 86  TRP A CE3 1 
ATOM   602  C CZ2 . TRP A 1 86  ? 1.392   13.874 0.534   1.00 44.56  ? 86  TRP A CZ2 1 
ATOM   603  C CZ3 . TRP A 1 86  ? -0.091  15.772 0.879   1.00 42.70  ? 86  TRP A CZ3 1 
ATOM   604  C CH2 . TRP A 1 86  ? 0.121   14.398 0.657   1.00 44.13  ? 86  TRP A CH2 1 
ATOM   605  N N   . LEU A 1 87  ? 1.842   20.372 0.019   1.00 43.80  ? 87  LEU A N   1 
ATOM   606  C CA  . LEU A 1 87  ? 0.474   20.825 -0.166  1.00 43.22  ? 87  LEU A CA  1 
ATOM   607  C C   . LEU A 1 87  ? 0.253   21.487 -1.532  1.00 49.18  ? 87  LEU A C   1 
ATOM   608  O O   . LEU A 1 87  ? -0.763  21.216 -2.165  1.00 48.30  ? 87  LEU A O   1 
ATOM   609  C CB  . LEU A 1 87  ? 0.039   21.721 0.996   1.00 41.64  ? 87  LEU A CB  1 
ATOM   610  C CG  . LEU A 1 87  ? -0.071  21.012 2.354   1.00 44.76  ? 87  LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 87  ? -0.230  22.018 3.481   1.00 45.90  ? 87  LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 87  ? -1.207  19.976 2.381   1.00 43.96  ? 87  LEU A CD2 1 
ATOM   613  N N   . LYS A 1 88  ? 1.241   22.279 -2.016  1.00 47.69  ? 88  LYS A N   1 
ATOM   614  C CA  . LYS A 1 88  ? 1.232   22.932 -3.335  1.00 49.41  ? 88  LYS A CA  1 
ATOM   615  C C   . LYS A 1 88  ? 1.056   21.889 -4.449  1.00 55.22  ? 88  LYS A C   1 
ATOM   616  O O   . LYS A 1 88  ? 0.248   22.077 -5.359  1.00 55.52  ? 88  LYS A O   1 
ATOM   617  C CB  . LYS A 1 88  ? 2.559   23.665 -3.559  1.00 52.70  ? 88  LYS A CB  1 
ATOM   618  C CG  . LYS A 1 88  ? 2.546   25.121 -3.123  1.00 72.22  ? 88  LYS A CG  1 
ATOM   619  C CD  . LYS A 1 88  ? 3.798   25.854 -3.600  1.00 83.51  ? 88  LYS A CD  1 
ATOM   620  C CE  . LYS A 1 88  ? 3.640   26.512 -4.965  1.00 97.26  ? 88  LYS A CE  1 
ATOM   621  N NZ  . LYS A 1 88  ? 2.922   27.819 -4.895  1.00 108.20 ? 88  LYS A NZ  1 
ATOM   622  N N   . GLN A 1 89  ? 1.817   20.783 -4.350  1.00 51.85  ? 89  GLN A N   1 
ATOM   623  C CA  . GLN A 1 89  ? 1.816   19.671 -5.288  1.00 52.47  ? 89  GLN A CA  1 
ATOM   624  C C   . GLN A 1 89  ? 0.480   18.937 -5.283  1.00 56.43  ? 89  GLN A C   1 
ATOM   625  O O   . GLN A 1 89  ? 0.013   18.497 -6.348  1.00 58.83  ? 89  GLN A O   1 
ATOM   626  C CB  . GLN A 1 89  ? 2.943   18.703 -4.941  1.00 53.77  ? 89  GLN A CB  1 
ATOM   627  C CG  . GLN A 1 89  ? 4.329   19.217 -5.287  1.00 66.89  ? 89  GLN A CG  1 
ATOM   628  C CD  . GLN A 1 89  ? 5.142   18.087 -5.874  1.00 89.63  ? 89  GLN A CD  1 
ATOM   629  O OE1 . GLN A 1 89  ? 4.707   17.403 -6.815  1.00 88.85  ? 89  GLN A OE1 1 
ATOM   630  N NE2 . GLN A 1 89  ? 6.322   17.832 -5.316  1.00 78.92  ? 89  GLN A NE2 1 
ATOM   631  N N   . LEU A 1 90  ? -0.135  18.806 -4.089  1.00 48.57  ? 90  LEU A N   1 
ATOM   632  C CA  . LEU A 1 90  ? -1.440  18.166 -3.949  1.00 46.68  ? 90  LEU A CA  1 
ATOM   633  C C   . LEU A 1 90  ? -2.506  19.002 -4.672  1.00 47.47  ? 90  LEU A C   1 
ATOM   634  O O   . LEU A 1 90  ? -3.281  18.446 -5.445  1.00 45.79  ? 90  LEU A O   1 
ATOM   635  C CB  . LEU A 1 90  ? -1.791  17.968 -2.467  1.00 45.21  ? 90  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 90  ? -3.029  17.132 -2.184  1.00 50.10  ? 90  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 90  ? -2.770  15.634 -2.445  1.00 51.15  ? 90  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 90  ? -3.498  17.349 -0.777  1.00 50.70  ? 90  LEU A CD2 1 
ATOM   639  N N   . GLN A 1 91  ? -2.487  20.346 -4.468  1.00 43.04  ? 91  GLN A N   1 
ATOM   640  C CA  . GLN A 1 91  ? -3.394  21.314 -5.096  1.00 42.07  ? 91  GLN A CA  1 
ATOM   641  C C   . GLN A 1 91  ? -3.273  21.255 -6.611  1.00 47.94  ? 91  GLN A C   1 
ATOM   642  O O   . GLN A 1 91  ? -4.295  21.323 -7.303  1.00 49.24  ? 91  GLN A O   1 
ATOM   643  C CB  . GLN A 1 91  ? -3.139  22.750 -4.588  1.00 41.90  ? 91  GLN A CB  1 
ATOM   644  C CG  . GLN A 1 91  ? -3.390  22.976 -3.104  1.00 42.86  ? 91  GLN A CG  1 
ATOM   645  C CD  . GLN A 1 91  ? -4.805  22.702 -2.680  1.00 62.22  ? 91  GLN A CD  1 
ATOM   646  O OE1 . GLN A 1 91  ? -5.682  23.557 -2.775  1.00 61.31  ? 91  GLN A OE1 1 
ATOM   647  N NE2 . GLN A 1 91  ? -5.049  21.514 -2.154  1.00 54.95  ? 91  GLN A NE2 1 
ATOM   648  N N   . ILE A 1 92  ? -2.033  21.087 -7.123  1.00 44.28  ? 92  ILE A N   1 
ATOM   649  C CA  . ILE A 1 92  ? -1.784  20.947 -8.556  1.00 46.12  ? 92  ILE A CA  1 
ATOM   650  C C   . ILE A 1 92  ? -2.396  19.627 -9.117  1.00 52.79  ? 92  ILE A C   1 
ATOM   651  O O   . ILE A 1 92  ? -3.096  19.685 -10.128 1.00 53.50  ? 92  ILE A O   1 
ATOM   652  C CB  . ILE A 1 92  ? -0.290  21.166 -8.908  1.00 49.60  ? 92  ILE A CB  1 
ATOM   653  C CG1 . ILE A 1 92  ? 0.082   22.642 -8.697  1.00 49.72  ? 92  ILE A CG1 1 
ATOM   654  C CG2 . ILE A 1 92  ? 0.023   20.746 -10.347 1.00 52.74  ? 92  ILE A CG2 1 
ATOM   655  C CD1 . ILE A 1 92  ? 1.551   22.947 -8.551  1.00 55.96  ? 92  ILE A CD1 1 
ATOM   656  N N   . LYS A 1 93  ? -2.173  18.460 -8.459  1.00 49.68  ? 93  LYS A N   1 
ATOM   657  C CA  . LYS A 1 93  ? -2.733  17.195 -8.963  1.00 50.61  ? 93  LYS A CA  1 
ATOM   658  C C   . LYS A 1 93  ? -4.238  17.092 -8.856  1.00 55.07  ? 93  LYS A C   1 
ATOM   659  O O   . LYS A 1 93  ? -4.876  16.436 -9.675  1.00 57.37  ? 93  LYS A O   1 
ATOM   660  C CB  . LYS A 1 93  ? -2.070  15.966 -8.339  1.00 53.52  ? 93  LYS A CB  1 
ATOM   661  C CG  . LYS A 1 93  ? -0.804  15.566 -9.065  1.00 90.04  ? 93  LYS A CG  1 
ATOM   662  C CD  . LYS A 1 93  ? -0.148  14.325 -8.451  1.00 107.85 ? 93  LYS A CD  1 
ATOM   663  C CE  . LYS A 1 93  ? 1.282   14.180 -8.925  1.00 125.86 ? 93  LYS A CE  1 
ATOM   664  N NZ  . LYS A 1 93  ? 2.189   15.191 -8.311  1.00 132.80 ? 93  LYS A NZ  1 
ATOM   665  N N   . LEU A 1 94  ? -4.806  17.737 -7.858  1.00 49.54  ? 94  LEU A N   1 
ATOM   666  C CA  . LEU A 1 94  ? -6.234  17.677 -7.605  1.00 48.07  ? 94  LEU A CA  1 
ATOM   667  C C   . LEU A 1 94  ? -7.014  18.752 -8.363  1.00 54.58  ? 94  LEU A C   1 
ATOM   668  O O   . LEU A 1 94  ? -8.091  18.459 -8.879  1.00 55.67  ? 94  LEU A O   1 
ATOM   669  C CB  . LEU A 1 94  ? -6.485  17.764 -6.077  1.00 45.16  ? 94  LEU A CB  1 
ATOM   670  C CG  . LEU A 1 94  ? -6.563  16.447 -5.259  1.00 47.79  ? 94  LEU A CG  1 
ATOM   671  C CD1 . LEU A 1 94  ? -5.450  15.479 -5.571  1.00 47.94  ? 94  LEU A CD1 1 
ATOM   672  C CD2 . LEU A 1 94  ? -6.515  16.726 -3.787  1.00 48.27  ? 94  LEU A CD2 1 
ATOM   673  N N   . HIS A 1 95  ? -6.486  19.985 -8.436  1.00 51.53  ? 95  HIS A N   1 
ATOM   674  C CA  . HIS A 1 95  ? -7.226  21.090 -9.037  1.00 52.69  ? 95  HIS A CA  1 
ATOM   675  C C   . HIS A 1 95  ? -6.611  21.759 -10.252 1.00 59.54  ? 95  HIS A C   1 
ATOM   676  O O   . HIS A 1 95  ? -7.336  22.475 -10.946 1.00 60.11  ? 95  HIS A O   1 
ATOM   677  C CB  . HIS A 1 95  ? -7.605  22.134 -7.966  1.00 52.46  ? 95  HIS A CB  1 
ATOM   678  C CG  . HIS A 1 95  ? -8.056  21.534 -6.669  1.00 54.80  ? 95  HIS A CG  1 
ATOM   679  N ND1 . HIS A 1 95  ? -7.250  21.561 -5.543  1.00 55.46  ? 95  HIS A ND1 1 
ATOM   680  C CD2 . HIS A 1 95  ? -9.193  20.861 -6.373  1.00 56.60  ? 95  HIS A CD2 1 
ATOM   681  C CE1 . HIS A 1 95  ? -7.937  20.939 -4.596  1.00 53.94  ? 95  HIS A CE1 1 
ATOM   682  N NE2 . HIS A 1 95  ? -9.113  20.504 -5.048  1.00 54.81  ? 95  HIS A NE2 1 
ATOM   683  N N   . ASN A 1 96  ? -5.298  21.530 -10.528 1.00 57.78  ? 96  ASN A N   1 
ATOM   684  C CA  . ASN A 1 96  ? -4.562  22.148 -11.641 1.00 59.49  ? 96  ASN A CA  1 
ATOM   685  C C   . ASN A 1 96  ? -5.111  23.572 -11.919 1.00 64.52  ? 96  ASN A C   1 
ATOM   686  O O   . ASN A 1 96  ? -5.796  23.797 -12.928 1.00 66.05  ? 96  ASN A O   1 
ATOM   687  C CB  . ASN A 1 96  ? -4.564  21.246 -12.890 1.00 62.43  ? 96  ASN A CB  1 
ATOM   688  C CG  . ASN A 1 96  ? -3.663  21.721 -14.032 1.00 91.70  ? 96  ASN A CG  1 
ATOM   689  O OD1 . ASN A 1 96  ? -2.626  22.381 -13.837 1.00 85.57  ? 96  ASN A OD1 1 
ATOM   690  N ND2 . ASN A 1 96  ? -4.034  21.384 -15.262 1.00 83.24  ? 96  ASN A ND2 1 
ATOM   691  N N   . PRO A 1 97  ? -4.937  24.513 -10.957 1.00 59.65  ? 97  PRO A N   1 
ATOM   692  C CA  . PRO A 1 97  ? -5.510  25.853 -11.145 1.00 59.41  ? 97  PRO A CA  1 
ATOM   693  C C   . PRO A 1 97  ? -4.878  26.608 -12.302 1.00 63.78  ? 97  PRO A C   1 
ATOM   694  O O   . PRO A 1 97  ? -3.675  26.485 -12.519 1.00 62.66  ? 97  PRO A O   1 
ATOM   695  C CB  . PRO A 1 97  ? -5.248  26.551 -9.802  1.00 59.70  ? 97  PRO A CB  1 
ATOM   696  C CG  . PRO A 1 97  ? -4.890  25.448 -8.833  1.00 62.87  ? 97  PRO A CG  1 
ATOM   697  C CD  . PRO A 1 97  ? -4.216  24.418 -9.667  1.00 59.75  ? 97  PRO A CD  1 
ATOM   698  N N   . PRO A 1 98  ? -5.666  27.403 -13.058 1.00 62.42  ? 98  PRO A N   1 
ATOM   699  C CA  . PRO A 1 98  ? -5.086  28.159 -14.178 1.00 64.12  ? 98  PRO A CA  1 
ATOM   700  C C   . PRO A 1 98  ? -4.011  29.170 -13.760 1.00 68.29  ? 98  PRO A C   1 
ATOM   701  O O   . PRO A 1 98  ? -3.095  29.445 -14.534 1.00 69.48  ? 98  PRO A O   1 
ATOM   702  C CB  . PRO A 1 98  ? -6.306  28.867 -14.794 1.00 66.97  ? 98  PRO A CB  1 
ATOM   703  C CG  . PRO A 1 98  ? -7.488  28.106 -14.327 1.00 70.31  ? 98  PRO A CG  1 
ATOM   704  C CD  . PRO A 1 98  ? -7.118  27.651 -12.951 1.00 63.83  ? 98  PRO A CD  1 
ATOM   705  N N   . THR A 1 99  ? -4.107  29.681 -12.523 1.00 64.14  ? 99  THR A N   1 
ATOM   706  C CA  . THR A 1 99  ? -3.259  30.725 -11.940 1.00 64.03  ? 99  THR A CA  1 
ATOM   707  C C   . THR A 1 99  ? -1.808  30.384 -11.562 1.00 68.99  ? 99  THR A C   1 
ATOM   708  O O   . THR A 1 99  ? -1.068  31.303 -11.206 1.00 68.10  ? 99  THR A O   1 
ATOM   709  C CB  . THR A 1 99  ? -4.000  31.422 -10.788 1.00 69.73  ? 99  THR A CB  1 
ATOM   710  O OG1 . THR A 1 99  ? -4.158  30.507 -9.699  1.00 67.73  ? 99  THR A OG1 1 
ATOM   711  C CG2 . THR A 1 99  ? -5.338  32.011 -11.215 1.00 67.52  ? 99  THR A CG2 1 
ATOM   712  N N   . ILE A 1 100 ? -1.394  29.102 -11.642 1.00 67.24  ? 100 ILE A N   1 
ATOM   713  C CA  . ILE A 1 100 ? -0.052  28.636 -11.252 1.00 67.29  ? 100 ILE A CA  1 
ATOM   714  C C   . ILE A 1 100 ? 1.121   29.500 -11.746 1.00 75.18  ? 100 ILE A C   1 
ATOM   715  O O   . ILE A 1 100 ? 1.903   29.984 -10.923 1.00 74.31  ? 100 ILE A O   1 
ATOM   716  C CB  . ILE A 1 100 ? 0.188   27.116 -11.504 1.00 70.41  ? 100 ILE A CB  1 
ATOM   717  C CG1 . ILE A 1 100 ? -0.884  26.233 -10.846 1.00 69.21  ? 100 ILE A CG1 1 
ATOM   718  C CG2 . ILE A 1 100 ? 1.585   26.700 -10.999 1.00 70.68  ? 100 ILE A CG2 1 
ATOM   719  C CD1 . ILE A 1 100 ? -1.046  24.855 -11.511 1.00 75.83  ? 100 ILE A CD1 1 
ATOM   720  N N   . HIS A 1 101 ? 1.253   29.673 -13.074 1.00 75.95  ? 101 HIS A N   1 
ATOM   721  C CA  . HIS A 1 101 ? 2.367   30.420 -13.662 1.00 77.61  ? 101 HIS A CA  1 
ATOM   722  C C   . HIS A 1 101 ? 2.122   31.874 -14.035 1.00 80.13  ? 101 HIS A C   1 
ATOM   723  O O   . HIS A 1 101 ? 2.984   32.497 -14.657 1.00 82.15  ? 101 HIS A O   1 
ATOM   724  C CB  . HIS A 1 101 ? 3.100   29.602 -14.738 1.00 80.75  ? 101 HIS A CB  1 
ATOM   725  C CG  . HIS A 1 101 ? 3.744   28.378 -14.156 1.00 83.66  ? 101 HIS A CG  1 
ATOM   726  N ND1 . HIS A 1 101 ? 3.073   27.165 -14.109 1.00 85.25  ? 101 HIS A ND1 1 
ATOM   727  C CD2 . HIS A 1 101 ? 4.942   28.240 -13.530 1.00 84.94  ? 101 HIS A CD2 1 
ATOM   728  C CE1 . HIS A 1 101 ? 3.888   26.327 -13.481 1.00 84.07  ? 101 HIS A CE1 1 
ATOM   729  N NE2 . HIS A 1 101 ? 5.025   26.929 -13.112 1.00 84.13  ? 101 HIS A NE2 1 
ATOM   730  N N   . TYR A 1 102 ? 0.995   32.434 -13.583 1.00 72.92  ? 102 TYR A N   1 
ATOM   731  C CA  . TYR A 1 102 ? 0.618   33.832 -13.797 1.00 72.46  ? 102 TYR A CA  1 
ATOM   732  C C   . TYR A 1 102 ? 1.618   34.758 -13.071 1.00 73.60  ? 102 TYR A C   1 
ATOM   733  O O   . TYR A 1 102 ? 2.176   34.332 -12.054 1.00 71.85  ? 102 TYR A O   1 
ATOM   734  C CB  . TYR A 1 102 ? -0.784  34.076 -13.190 1.00 72.77  ? 102 TYR A CB  1 
ATOM   735  C CG  . TYR A 1 102 ? -1.987  33.647 -14.011 1.00 75.79  ? 102 TYR A CG  1 
ATOM   736  C CD1 . TYR A 1 102 ? -3.248  34.178 -13.762 1.00 77.47  ? 102 TYR A CD1 1 
ATOM   737  C CD2 . TYR A 1 102 ? -1.873  32.679 -15.006 1.00 77.84  ? 102 TYR A CD2 1 
ATOM   738  C CE1 . TYR A 1 102 ? -4.361  33.788 -14.503 1.00 79.07  ? 102 TYR A CE1 1 
ATOM   739  C CE2 . TYR A 1 102 ? -2.976  32.289 -15.762 1.00 79.71  ? 102 TYR A CE2 1 
ATOM   740  C CZ  . TYR A 1 102 ? -4.221  32.838 -15.498 1.00 85.67  ? 102 TYR A CZ  1 
ATOM   741  O OH  . TYR A 1 102 ? -5.319  32.461 -16.229 1.00 86.69  ? 102 TYR A OH  1 
ATOM   742  N N   . PRO A 1 103 ? 1.850   36.020 -13.514 1.00 69.21  ? 103 PRO A N   1 
ATOM   743  C CA  . PRO A 1 103 ? 2.730   36.917 -12.732 1.00 67.36  ? 103 PRO A CA  1 
ATOM   744  C C   . PRO A 1 103 ? 2.162   37.168 -11.324 1.00 68.61  ? 103 PRO A C   1 
ATOM   745  O O   . PRO A 1 103 ? 0.940   37.218 -11.180 1.00 67.49  ? 103 PRO A O   1 
ATOM   746  C CB  . PRO A 1 103 ? 2.750   38.215 -13.545 1.00 70.84  ? 103 PRO A CB  1 
ATOM   747  C CG  . PRO A 1 103 ? 2.200   37.871 -14.863 1.00 77.45  ? 103 PRO A CG  1 
ATOM   748  C CD  . PRO A 1 103 ? 1.287   36.711 -14.689 1.00 72.47  ? 103 PRO A CD  1 
ATOM   749  N N   . PRO A 1 104 ? 3.003   37.309 -10.270 1.00 65.16  ? 104 PRO A N   1 
ATOM   750  C CA  . PRO A 1 104 ? 2.467   37.503 -8.901  1.00 63.50  ? 104 PRO A CA  1 
ATOM   751  C C   . PRO A 1 104 ? 1.343   38.525 -8.740  1.00 68.43  ? 104 PRO A C   1 
ATOM   752  O O   . PRO A 1 104 ? 0.350   38.217 -8.068  1.00 66.56  ? 104 PRO A O   1 
ATOM   753  C CB  . PRO A 1 104 ? 3.709   37.842 -8.078  1.00 64.04  ? 104 PRO A CB  1 
ATOM   754  C CG  . PRO A 1 104 ? 4.796   37.131 -8.782  1.00 69.47  ? 104 PRO A CG  1 
ATOM   755  C CD  . PRO A 1 104 ? 4.477   37.245 -10.248 1.00 67.18  ? 104 PRO A CD  1 
ATOM   756  N N   . SER A 1 105 ? 1.477   39.702 -9.404  1.00 67.18  ? 105 SER A N   1 
ATOM   757  C CA  . SER A 1 105 ? 0.499   40.797 -9.408  1.00 67.41  ? 105 SER A CA  1 
ATOM   758  C C   . SER A 1 105 ? -0.783  40.449 -10.174 1.00 72.73  ? 105 SER A C   1 
ATOM   759  O O   . SER A 1 105 ? -1.826  41.050 -9.911  1.00 72.52  ? 105 SER A O   1 
ATOM   760  C CB  . SER A 1 105 ? 1.122   42.083 -9.939  1.00 72.14  ? 105 SER A CB  1 
ATOM   761  O OG  . SER A 1 105 ? 1.975   41.853 -11.050 1.00 82.00  ? 105 SER A OG  1 
ATOM   762  N N   . GLN A 1 106 ? -0.719  39.472 -11.100 1.00 70.51  ? 106 GLN A N   1 
ATOM   763  C CA  . GLN A 1 106 ? -1.885  39.020 -11.865 1.00 71.54  ? 106 GLN A CA  1 
ATOM   764  C C   . GLN A 1 106 ? -2.731  37.943 -11.138 1.00 73.45  ? 106 GLN A C   1 
ATOM   765  O O   . GLN A 1 106 ? -3.706  37.432 -11.698 1.00 74.15  ? 106 GLN A O   1 
ATOM   766  C CB  . GLN A 1 106 ? -1.479  38.566 -13.270 1.00 74.96  ? 106 GLN A CB  1 
ATOM   767  C CG  . GLN A 1 106 ? -1.634  39.660 -14.312 1.00 104.71 ? 106 GLN A CG  1 
ATOM   768  C CD  . GLN A 1 106 ? -1.244  39.198 -15.694 1.00 133.72 ? 106 GLN A CD  1 
ATOM   769  O OE1 . GLN A 1 106 ? -1.819  38.256 -16.256 1.00 133.48 ? 106 GLN A OE1 1 
ATOM   770  N NE2 . GLN A 1 106 ? -0.281  39.885 -16.292 1.00 124.94 ? 106 GLN A NE2 1 
ATOM   771  N N   . GLY A 1 107 ? -2.357  37.626 -9.902  1.00 67.10  ? 107 GLY A N   1 
ATOM   772  C CA  . GLY A 1 107 ? -3.063  36.652 -9.076  1.00 64.65  ? 107 GLY A CA  1 
ATOM   773  C C   . GLY A 1 107 ? -2.493  35.250 -9.047  1.00 64.77  ? 107 GLY A C   1 
ATOM   774  O O   . GLY A 1 107 ? -3.258  34.282 -9.008  1.00 64.06  ? 107 GLY A O   1 
ATOM   775  N N   . GLN A 1 108 ? -1.150  35.135 -9.029  1.00 58.47  ? 108 GLN A N   1 
ATOM   776  C CA  . GLN A 1 108 ? -0.438  33.855 -8.962  1.00 56.60  ? 108 GLN A CA  1 
ATOM   777  C C   . GLN A 1 108 ? -0.883  33.010 -7.739  1.00 55.35  ? 108 GLN A C   1 
ATOM   778  O O   . GLN A 1 108 ? -1.073  33.563 -6.650  1.00 53.00  ? 108 GLN A O   1 
ATOM   779  C CB  . GLN A 1 108 ? 1.075   34.102 -8.915  1.00 57.98  ? 108 GLN A CB  1 
ATOM   780  C CG  . GLN A 1 108 ? 1.920   32.834 -9.021  1.00 77.58  ? 108 GLN A CG  1 
ATOM   781  C CD  . GLN A 1 108 ? 3.396   33.124 -9.040  1.00 105.08 ? 108 GLN A CD  1 
ATOM   782  O OE1 . GLN A 1 108 ? 3.918   33.910 -8.237  1.00 98.06  ? 108 GLN A OE1 1 
ATOM   783  N NE2 . GLN A 1 108 ? 4.109   32.450 -9.934  1.00 105.68 ? 108 GLN A NE2 1 
ATOM   784  N N   . MET A 1 109 ? -1.055  31.680 -7.937  1.00 50.00  ? 109 MET A N   1 
ATOM   785  C CA  . MET A 1 109 ? -1.474  30.757 -6.885  1.00 47.51  ? 109 MET A CA  1 
ATOM   786  C C   . MET A 1 109 ? -0.450  30.720 -5.760  1.00 48.93  ? 109 MET A C   1 
ATOM   787  O O   . MET A 1 109 ? 0.738   30.503 -5.996  1.00 48.27  ? 109 MET A O   1 
ATOM   788  C CB  . MET A 1 109 ? -1.749  29.343 -7.427  1.00 50.51  ? 109 MET A CB  1 
ATOM   789  C CG  . MET A 1 109 ? -2.375  28.402 -6.382  1.00 53.02  ? 109 MET A CG  1 
ATOM   790  S SD  . MET A 1 109 ? -2.173  26.614 -6.690  1.00 57.40  ? 109 MET A SD  1 
ATOM   791  C CE  . MET A 1 109 ? -0.896  26.212 -5.534  1.00 52.80  ? 109 MET A CE  1 
ATOM   792  N N   . ASP A 1 110 ? -0.923  30.976 -4.539  1.00 44.90  ? 110 ASP A N   1 
ATOM   793  C CA  . ASP A 1 110 ? -0.114  30.949 -3.328  1.00 44.04  ? 110 ASP A CA  1 
ATOM   794  C C   . ASP A 1 110 ? -0.869  30.221 -2.218  1.00 46.25  ? 110 ASP A C   1 
ATOM   795  O O   . ASP A 1 110 ? -2.095  30.122 -2.268  1.00 44.99  ? 110 ASP A O   1 
ATOM   796  C CB  . ASP A 1 110 ? 0.337   32.365 -2.903  1.00 46.51  ? 110 ASP A CB  1 
ATOM   797  C CG  . ASP A 1 110 ? 1.586   32.401 -2.025  1.00 62.18  ? 110 ASP A CG  1 
ATOM   798  O OD1 . ASP A 1 110 ? 2.245   31.332 -1.865  1.00 63.54  ? 110 ASP A OD1 1 
ATOM   799  O OD2 . ASP A 1 110 ? 1.914   33.492 -1.503  1.00 68.95  ? 110 ASP A OD2 1 
ATOM   800  N N   . LEU A 1 111 ? -0.121  29.702 -1.231  1.00 42.50  ? 111 LEU A N   1 
ATOM   801  C CA  . LEU A 1 111 ? -0.625  28.902 -0.120  1.00 41.12  ? 111 LEU A CA  1 
ATOM   802  C C   . LEU A 1 111 ? -0.071  29.321 1.214   1.00 42.95  ? 111 LEU A C   1 
ATOM   803  O O   . LEU A 1 111 ? 1.069   29.780 1.303   1.00 42.84  ? 111 LEU A O   1 
ATOM   804  C CB  . LEU A 1 111 ? -0.173  27.443 -0.343  1.00 41.66  ? 111 LEU A CB  1 
ATOM   805  C CG  . LEU A 1 111 ? -1.249  26.398 -0.513  1.00 46.93  ? 111 LEU A CG  1 
ATOM   806  C CD1 . LEU A 1 111 ? -1.118  25.738 -1.848  1.00 48.67  ? 111 LEU A CD1 1 
ATOM   807  C CD2 . LEU A 1 111 ? -1.147  25.347 0.560   1.00 49.49  ? 111 LEU A CD2 1 
ATOM   808  N N   . CYS A 1 112 ? -0.833  29.044 2.270   1.00 38.67  ? 112 CYS A N   1 
ATOM   809  C CA  . CYS A 1 112 ? -0.362  29.215 3.634   1.00 38.35  ? 112 CYS A CA  1 
ATOM   810  C C   . CYS A 1 112 ? -1.056  28.287 4.619   1.00 37.90  ? 112 CYS A C   1 
ATOM   811  O O   . CYS A 1 112 ? -2.240  28.003 4.480   1.00 37.42  ? 112 CYS A O   1 
ATOM   812  C CB  . CYS A 1 112 ? -0.371  30.670 4.095   1.00 39.88  ? 112 CYS A CB  1 
ATOM   813  S SG  . CYS A 1 112 ? -2.017  31.400 4.240   1.00 44.34  ? 112 CYS A SG  1 
ATOM   814  N N   . VAL A 1 113 ? -0.290  27.767 5.576   1.00 31.25  ? 113 VAL A N   1 
ATOM   815  C CA  . VAL A 1 113 ? -0.787  26.899 6.633   1.00 29.13  ? 113 VAL A CA  1 
ATOM   816  C C   . VAL A 1 113 ? -1.371  27.835 7.705   1.00 36.46  ? 113 VAL A C   1 
ATOM   817  O O   . VAL A 1 113 ? -0.737  28.837 8.067   1.00 38.02  ? 113 VAL A O   1 
ATOM   818  C CB  . VAL A 1 113 ? 0.314   25.976 7.220   1.00 30.87  ? 113 VAL A CB  1 
ATOM   819  C CG1 . VAL A 1 113 ? -0.290  24.898 8.112   1.00 29.42  ? 113 VAL A CG1 1 
ATOM   820  C CG2 . VAL A 1 113 ? 1.164   25.345 6.120   1.00 31.08  ? 113 VAL A CG2 1 
ATOM   821  N N   . THR A 1 114 ? -2.594  27.531 8.180   1.00 32.58  ? 114 THR A N   1 
ATOM   822  C CA  . THR A 1 114 ? -3.300  28.318 9.198   1.00 30.99  ? 114 THR A CA  1 
ATOM   823  C C   . THR A 1 114 ? -3.589  27.446 10.420  1.00 33.95  ? 114 THR A C   1 
ATOM   824  O O   . THR A 1 114 ? -3.491  26.221 10.343  1.00 32.96  ? 114 THR A O   1 
ATOM   825  C CB  . THR A 1 114 ? -4.576  28.969 8.595   1.00 36.72  ? 114 THR A CB  1 
ATOM   826  O OG1 . THR A 1 114 ? -5.384  27.953 8.002   1.00 38.21  ? 114 THR A OG1 1 
ATOM   827  C CG2 . THR A 1 114 ? -4.262  30.063 7.555   1.00 30.88  ? 114 THR A CG2 1 
ATOM   828  N N   . SER A 1 115 ? -3.941  28.066 11.554  1.00 31.92  ? 115 SER A N   1 
ATOM   829  C CA  . SER A 1 115 ? -4.255  27.324 12.780  1.00 31.78  ? 115 SER A CA  1 
ATOM   830  C C   . SER A 1 115 ? -5.715  26.871 12.732  1.00 36.95  ? 115 SER A C   1 
ATOM   831  O O   . SER A 1 115 ? -6.566  27.371 13.471  1.00 36.64  ? 115 SER A O   1 
ATOM   832  C CB  . SER A 1 115 ? -3.916  28.154 14.012  1.00 34.44  ? 115 SER A CB  1 
ATOM   833  O OG  . SER A 1 115 ? -2.511  28.320 14.134  1.00 40.78  ? 115 SER A OG  1 
ATOM   834  N N   . GLY A 1 116 ? -5.958  25.909 11.838  1.00 34.44  ? 116 GLY A N   1 
ATOM   835  C CA  . GLY A 1 116 ? -7.265  25.392 11.451  1.00 34.68  ? 116 GLY A CA  1 
ATOM   836  C C   . GLY A 1 116 ? -7.706  26.145 10.206  1.00 40.29  ? 116 GLY A C   1 
ATOM   837  O O   . GLY A 1 116 ? -7.080  27.153 9.868   1.00 41.30  ? 116 GLY A O   1 
ATOM   838  N N   . SER A 1 117 ? -8.765  25.690 9.494   1.00 36.74  ? 117 SER A N   1 
ATOM   839  C CA  . SER A 1 117 ? -9.265  26.425 8.316   1.00 37.03  ? 117 SER A CA  1 
ATOM   840  C C   . SER A 1 117 ? -10.061 27.680 8.745   1.00 38.90  ? 117 SER A C   1 
ATOM   841  O O   . SER A 1 117 ? -10.223 28.608 7.954   1.00 38.56  ? 117 SER A O   1 
ATOM   842  C CB  . SER A 1 117 ? -10.087 25.519 7.392   1.00 41.70  ? 117 SER A CB  1 
ATOM   843  O OG  . SER A 1 117 ? -11.375 25.209 7.904   1.00 52.69  ? 117 SER A OG  1 
ATOM   844  N N   . GLN A 1 118 ? -10.537 27.695 10.005  1.00 33.71  ? 118 GLN A N   1 
ATOM   845  C CA  . GLN A 1 118 ? -11.298 28.781 10.614  1.00 33.83  ? 118 GLN A CA  1 
ATOM   846  C C   . GLN A 1 118 ? -10.474 30.079 10.698  1.00 38.39  ? 118 GLN A C   1 
ATOM   847  O O   . GLN A 1 118 ? -11.030 31.176 10.569  1.00 39.10  ? 118 GLN A O   1 
ATOM   848  C CB  . GLN A 1 118 ? -11.791 28.355 12.016  1.00 34.72  ? 118 GLN A CB  1 
ATOM   849  C CG  . GLN A 1 118 ? -12.852 29.256 12.659  1.00 50.47  ? 118 GLN A CG  1 
ATOM   850  C CD  . GLN A 1 118 ? -14.075 29.444 11.801  1.00 66.01  ? 118 GLN A CD  1 
ATOM   851  O OE1 . GLN A 1 118 ? -14.794 28.498 11.451  1.00 69.57  ? 118 GLN A OE1 1 
ATOM   852  N NE2 . GLN A 1 118 ? -14.318 30.687 11.440  1.00 44.75  ? 118 GLN A NE2 1 
ATOM   853  N N   . GLN A 1 119 ? -9.159  29.952 10.940  1.00 32.74  ? 119 GLN A N   1 
ATOM   854  C CA  . GLN A 1 119 ? -8.259  31.095 11.051  1.00 31.00  ? 119 GLN A CA  1 
ATOM   855  C C   . GLN A 1 119 ? -8.111  31.797 9.715   1.00 34.60  ? 119 GLN A C   1 
ATOM   856  O O   . GLN A 1 119 ? -8.185  33.022 9.668   1.00 33.79  ? 119 GLN A O   1 
ATOM   857  C CB  . GLN A 1 119 ? -6.909  30.696 11.654  1.00 31.30  ? 119 GLN A CB  1 
ATOM   858  C CG  . GLN A 1 119 ? -6.172  31.878 12.264  1.00 34.82  ? 119 GLN A CG  1 
ATOM   859  C CD  . GLN A 1 119 ? -4.675  31.704 12.405  1.00 46.58  ? 119 GLN A CD  1 
ATOM   860  O OE1 . GLN A 1 119 ? -4.025  30.876 11.744  1.00 41.15  ? 119 GLN A OE1 1 
ATOM   861  N NE2 . GLN A 1 119 ? -4.083  32.542 13.250  1.00 31.65  ? 119 GLN A NE2 1 
ATOM   862  N N   . GLY A 1 120 ? -7.963  31.015 8.647   1.00 32.12  ? 120 GLY A N   1 
ATOM   863  C CA  . GLY A 1 120 ? -7.861  31.531 7.285   1.00 33.09  ? 120 GLY A CA  1 
ATOM   864  C C   . GLY A 1 120 ? -9.109  32.290 6.887   1.00 38.76  ? 120 GLY A C   1 
ATOM   865  O O   . GLY A 1 120 ? -9.020  33.446 6.471   1.00 38.06  ? 120 GLY A O   1 
ATOM   866  N N   . LEU A 1 121 ? -10.287 31.662 7.101   1.00 37.62  ? 121 LEU A N   1 
ATOM   867  C CA  . LEU A 1 121 ? -11.603 32.239 6.843   1.00 39.41  ? 121 LEU A CA  1 
ATOM   868  C C   . LEU A 1 121 ? -11.770 33.578 7.580   1.00 44.47  ? 121 LEU A C   1 
ATOM   869  O O   . LEU A 1 121 ? -12.176 34.566 6.965   1.00 44.95  ? 121 LEU A O   1 
ATOM   870  C CB  . LEU A 1 121 ? -12.709 31.258 7.274   1.00 39.53  ? 121 LEU A CB  1 
ATOM   871  C CG  . LEU A 1 121 ? -12.916 30.004 6.414   1.00 45.32  ? 121 LEU A CG  1 
ATOM   872  C CD1 . LEU A 1 121 ? -13.693 28.957 7.175   1.00 45.51  ? 121 LEU A CD1 1 
ATOM   873  C CD2 . LEU A 1 121 ? -13.650 30.317 5.133   1.00 48.37  ? 121 LEU A CD2 1 
ATOM   874  N N   . CYS A 1 122 ? -11.410 33.606 8.878   1.00 39.99  ? 122 CYS A N   1 
ATOM   875  C CA  . CYS A 1 122 ? -11.484 34.774 9.748   1.00 40.02  ? 122 CYS A CA  1 
ATOM   876  C C   . CYS A 1 122 ? -10.659 35.948 9.215   1.00 39.78  ? 122 CYS A C   1 
ATOM   877  O O   . CYS A 1 122 ? -11.197 37.047 9.093   1.00 39.15  ? 122 CYS A O   1 
ATOM   878  C CB  . CYS A 1 122 ? -11.074 34.397 11.170  1.00 40.97  ? 122 CYS A CB  1 
ATOM   879  S SG  . CYS A 1 122 ? -10.849 35.804 12.299  1.00 45.57  ? 122 CYS A SG  1 
ATOM   880  N N   . LYS A 1 123 ? -9.361  35.718 8.910   1.00 32.92  ? 123 LYS A N   1 
ATOM   881  C CA  . LYS A 1 123 ? -8.439  36.737 8.404   1.00 31.57  ? 123 LYS A CA  1 
ATOM   882  C C   . LYS A 1 123 ? -8.895  37.268 7.048   1.00 36.11  ? 123 LYS A C   1 
ATOM   883  O O   . LYS A 1 123 ? -8.718  38.459 6.770   1.00 37.82  ? 123 LYS A O   1 
ATOM   884  C CB  . LYS A 1 123 ? -6.998  36.208 8.322   1.00 33.41  ? 123 LYS A CB  1 
ATOM   885  C CG  . LYS A 1 123 ? -6.404  35.630 9.624   1.00 52.43  ? 123 LYS A CG  1 
ATOM   886  C CD  . LYS A 1 123 ? -6.273  36.628 10.763  1.00 62.62  ? 123 LYS A CD  1 
ATOM   887  C CE  . LYS A 1 123 ? -6.914  36.120 12.029  1.00 77.05  ? 123 LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 123 ? -6.920  37.165 13.084  1.00 86.54  ? 123 LYS A NZ  1 
ATOM   889  N N   . VAL A 1 124 ? -9.508  36.393 6.219   1.00 30.82  ? 124 VAL A N   1 
ATOM   890  C CA  . VAL A 1 124 ? -10.039 36.724 4.895   1.00 30.51  ? 124 VAL A CA  1 
ATOM   891  C C   . VAL A 1 124 ? -11.265 37.636 5.040   1.00 35.04  ? 124 VAL A C   1 
ATOM   892  O O   . VAL A 1 124 ? -11.348 38.646 4.350   1.00 36.07  ? 124 VAL A O   1 
ATOM   893  C CB  . VAL A 1 124 ? -10.331 35.442 4.071   1.00 33.05  ? 124 VAL A CB  1 
ATOM   894  C CG1 . VAL A 1 124 ? -11.281 35.713 2.902   1.00 33.58  ? 124 VAL A CG1 1 
ATOM   895  C CG2 . VAL A 1 124 ? -9.033  34.826 3.578   1.00 32.40  ? 124 VAL A CG2 1 
ATOM   896  N N   . PHE A 1 125 ? -12.197 37.286 5.941   1.00 30.92  ? 125 PHE A N   1 
ATOM   897  C CA  . PHE A 1 125 ? -13.387 38.084 6.199   1.00 31.85  ? 125 PHE A CA  1 
ATOM   898  C C   . PHE A 1 125 ? -12.997 39.478 6.696   1.00 35.07  ? 125 PHE A C   1 
ATOM   899  O O   . PHE A 1 125 ? -13.572 40.460 6.232   1.00 36.53  ? 125 PHE A O   1 
ATOM   900  C CB  . PHE A 1 125 ? -14.308 37.387 7.226   1.00 33.90  ? 125 PHE A CB  1 
ATOM   901  C CG  . PHE A 1 125 ? -14.965 36.087 6.812   1.00 36.52  ? 125 PHE A CG  1 
ATOM   902  C CD1 . PHE A 1 125 ? -15.357 35.145 7.767   1.00 39.69  ? 125 PHE A CD1 1 
ATOM   903  C CD2 . PHE A 1 125 ? -15.256 35.828 5.477   1.00 40.04  ? 125 PHE A CD2 1 
ATOM   904  C CE1 . PHE A 1 125 ? -16.010 33.953 7.386   1.00 40.61  ? 125 PHE A CE1 1 
ATOM   905  C CE2 . PHE A 1 125 ? -15.900 34.639 5.101   1.00 43.00  ? 125 PHE A CE2 1 
ATOM   906  C CZ  . PHE A 1 125 ? -16.265 33.706 6.058   1.00 40.07  ? 125 PHE A CZ  1 
ATOM   907  N N   . GLU A 1 126 ? -12.004 39.560 7.614   1.00 29.51  ? 126 GLU A N   1 
ATOM   908  C CA  . GLU A 1 126 ? -11.495 40.795 8.222   1.00 29.18  ? 126 GLU A CA  1 
ATOM   909  C C   . GLU A 1 126 ? -10.758 41.712 7.213   1.00 36.35  ? 126 GLU A C   1 
ATOM   910  O O   . GLU A 1 126 ? -10.797 42.943 7.348   1.00 37.53  ? 126 GLU A O   1 
ATOM   911  C CB  . GLU A 1 126 ? -10.639 40.488 9.471   1.00 29.11  ? 126 GLU A CB  1 
ATOM   912  C CG  . GLU A 1 126 ? -11.468 39.954 10.637  1.00 44.50  ? 126 GLU A CG  1 
ATOM   913  C CD  . GLU A 1 126 ? -10.822 39.586 11.967  1.00 67.44  ? 126 GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 126 ? -11.569 39.181 12.891  1.00 50.74  ? 126 GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 126 ? -9.582  39.707 12.097  1.00 59.12  ? 126 GLU A OE2 1 
ATOM   916  N N   . MET A 1 127 ? -10.132 41.114 6.182   1.00 33.47  ? 127 MET A N   1 
ATOM   917  C CA  . MET A 1 127 ? -9.383  41.797 5.115   1.00 34.24  ? 127 MET A CA  1 
ATOM   918  C C   . MET A 1 127 ? -10.346 42.529 4.185   1.00 41.64  ? 127 MET A C   1 
ATOM   919  O O   . MET A 1 127 ? -10.057 43.643 3.738   1.00 43.73  ? 127 MET A O   1 
ATOM   920  C CB  . MET A 1 127 ? -8.571  40.736 4.323   1.00 36.06  ? 127 MET A CB  1 
ATOM   921  C CG  . MET A 1 127 ? -7.881  41.223 3.035   1.00 40.26  ? 127 MET A CG  1 
ATOM   922  S SD  . MET A 1 127 ? -7.104  39.865 2.097   1.00 43.58  ? 127 MET A SD  1 
ATOM   923  C CE  . MET A 1 127 ? -8.540  39.101 1.368   1.00 41.05  ? 127 MET A CE  1 
ATOM   924  N N   . ILE A 1 128 ? -11.479 41.889 3.889   1.00 38.19  ? 128 ILE A N   1 
ATOM   925  C CA  . ILE A 1 128 ? -12.485 42.375 2.952   1.00 39.44  ? 128 ILE A CA  1 
ATOM   926  C C   . ILE A 1 128 ? -13.534 43.335 3.525   1.00 46.54  ? 128 ILE A C   1 
ATOM   927  O O   . ILE A 1 128 ? -13.701 44.432 2.985   1.00 47.82  ? 128 ILE A O   1 
ATOM   928  C CB  . ILE A 1 128 ? -13.148 41.163 2.265   1.00 42.33  ? 128 ILE A CB  1 
ATOM   929  C CG1 . ILE A 1 128 ? -12.114 40.281 1.537   1.00 42.19  ? 128 ILE A CG1 1 
ATOM   930  C CG2 . ILE A 1 128 ? -14.270 41.600 1.336   1.00 44.69  ? 128 ILE A CG2 1 
ATOM   931  C CD1 . ILE A 1 128 ? -12.563 38.844 1.302   1.00 46.74  ? 128 ILE A CD1 1 
ATOM   932  N N   . ILE A 1 129 ? -14.291 42.891 4.555   1.00 43.73  ? 129 ILE A N   1 
ATOM   933  C CA  . ILE A 1 129 ? -15.439 43.611 5.128   1.00 44.31  ? 129 ILE A CA  1 
ATOM   934  C C   . ILE A 1 129 ? -15.208 44.936 5.839   1.00 48.85  ? 129 ILE A C   1 
ATOM   935  O O   . ILE A 1 129 ? -14.505 44.995 6.845   1.00 48.42  ? 129 ILE A O   1 
ATOM   936  C CB  . ILE A 1 129 ? -16.385 42.672 5.927   1.00 46.25  ? 129 ILE A CB  1 
ATOM   937  C CG1 . ILE A 1 129 ? -16.879 41.511 5.050   1.00 47.26  ? 129 ILE A CG1 1 
ATOM   938  C CG2 . ILE A 1 129 ? -17.565 43.438 6.536   1.00 46.15  ? 129 ILE A CG2 1 
ATOM   939  C CD1 . ILE A 1 129 ? -16.832 40.173 5.723   1.00 52.24  ? 129 ILE A CD1 1 
ATOM   940  N N   . ASN A 1 130 ? -15.892 45.973 5.343   1.00 46.76  ? 130 ASN A N   1 
ATOM   941  C CA  . ASN A 1 130 ? -16.008 47.310 5.924   1.00 47.73  ? 130 ASN A CA  1 
ATOM   942  C C   . ASN A 1 130 ? -17.457 47.401 6.406   1.00 54.15  ? 130 ASN A C   1 
ATOM   943  O O   . ASN A 1 130 ? -18.336 46.827 5.748   1.00 53.72  ? 130 ASN A O   1 
ATOM   944  C CB  . ASN A 1 130 ? -15.779 48.396 4.884   1.00 47.79  ? 130 ASN A CB  1 
ATOM   945  C CG  . ASN A 1 130 ? -14.351 48.566 4.487   1.00 61.57  ? 130 ASN A CG  1 
ATOM   946  O OD1 . ASN A 1 130 ? -13.476 48.831 5.322   1.00 64.57  ? 130 ASN A OD1 1 
ATOM   947  N ND2 . ASN A 1 130 ? -14.099 48.457 3.191   1.00 42.90  ? 130 ASN A ND2 1 
ATOM   948  N N   . PRO A 1 131 ? -17.755 48.082 7.537   1.00 52.21  ? 131 PRO A N   1 
ATOM   949  C CA  . PRO A 1 131 ? -19.156 48.135 8.000   1.00 52.69  ? 131 PRO A CA  1 
ATOM   950  C C   . PRO A 1 131 ? -20.101 48.702 6.936   1.00 57.05  ? 131 PRO A C   1 
ATOM   951  O O   . PRO A 1 131 ? -19.851 49.780 6.399   1.00 57.77  ? 131 PRO A O   1 
ATOM   952  C CB  . PRO A 1 131 ? -19.089 49.010 9.259   1.00 54.45  ? 131 PRO A CB  1 
ATOM   953  C CG  . PRO A 1 131 ? -17.662 48.976 9.681   1.00 57.57  ? 131 PRO A CG  1 
ATOM   954  C CD  . PRO A 1 131 ? -16.857 48.829 8.440   1.00 53.26  ? 131 PRO A CD  1 
ATOM   955  N N   . GLY A 1 132 ? -21.117 47.917 6.590   1.00 53.63  ? 132 GLY A N   1 
ATOM   956  C CA  . GLY A 1 132 ? -22.128 48.261 5.596   1.00 55.59  ? 132 GLY A CA  1 
ATOM   957  C C   . GLY A 1 132 ? -21.973 47.629 4.223   1.00 60.75  ? 132 GLY A C   1 
ATOM   958  O O   . GLY A 1 132 ? -22.724 47.971 3.308   1.00 62.69  ? 132 GLY A O   1 
ATOM   959  N N   . ASP A 1 133 ? -21.001 46.709 4.062   1.00 56.16  ? 133 ASP A N   1 
ATOM   960  C CA  . ASP A 1 133 ? -20.728 46.012 2.804   1.00 56.30  ? 133 ASP A CA  1 
ATOM   961  C C   . ASP A 1 133 ? -21.726 44.886 2.578   1.00 60.00  ? 133 ASP A C   1 
ATOM   962  O O   . ASP A 1 133 ? -22.189 44.264 3.535   1.00 59.74  ? 133 ASP A O   1 
ATOM   963  C CB  . ASP A 1 133 ? -19.285 45.467 2.770   1.00 57.01  ? 133 ASP A CB  1 
ATOM   964  C CG  . ASP A 1 133 ? -18.166 46.481 2.529   1.00 71.24  ? 133 ASP A CG  1 
ATOM   965  O OD1 . ASP A 1 133 ? -18.472 47.640 2.145   1.00 74.38  ? 133 ASP A OD1 1 
ATOM   966  O OD2 . ASP A 1 133 ? -16.984 46.102 2.674   1.00 76.08  ? 133 ASP A OD2 1 
ATOM   967  N N   . ASN A 1 134 ? -22.067 44.625 1.311   1.00 56.22  ? 134 ASN A N   1 
ATOM   968  C CA  . ASN A 1 134 ? -22.996 43.556 0.972   1.00 55.09  ? 134 ASN A CA  1 
ATOM   969  C C   . ASN A 1 134 ? -22.231 42.261 0.717   1.00 56.87  ? 134 ASN A C   1 
ATOM   970  O O   . ASN A 1 134 ? -21.209 42.278 0.029   1.00 56.47  ? 134 ASN A O   1 
ATOM   971  C CB  . ASN A 1 134 ? -23.815 43.942 -0.246  1.00 54.46  ? 134 ASN A CB  1 
ATOM   972  C CG  . ASN A 1 134 ? -24.831 45.022 0.018   1.00 80.54  ? 134 ASN A CG  1 
ATOM   973  O OD1 . ASN A 1 134 ? -25.513 45.043 1.052   1.00 76.87  ? 134 ASN A OD1 1 
ATOM   974  N ND2 . ASN A 1 134 ? -24.983 45.927 -0.938  1.00 76.15  ? 134 ASN A ND2 1 
ATOM   975  N N   . VAL A 1 135 ? -22.700 41.146 1.312   1.00 51.64  ? 135 VAL A N   1 
ATOM   976  C CA  . VAL A 1 135 ? -22.095 39.816 1.141   1.00 49.99  ? 135 VAL A CA  1 
ATOM   977  C C   . VAL A 1 135 ? -23.155 38.780 0.787   1.00 53.33  ? 135 VAL A C   1 
ATOM   978  O O   . VAL A 1 135 ? -24.271 38.830 1.318   1.00 52.05  ? 135 VAL A O   1 
ATOM   979  C CB  . VAL A 1 135 ? -21.124 39.344 2.273   1.00 51.73  ? 135 VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 135 ? -19.941 40.304 2.433   1.00 51.36  ? 135 VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 135 ? -21.844 39.137 3.605   1.00 50.49  ? 135 VAL A CG2 1 
ATOM   982  N N   . LEU A 1 136 ? -22.808 37.863 -0.139  1.00 50.63  ? 136 LEU A N   1 
ATOM   983  C CA  . LEU A 1 136 ? -23.704 36.812 -0.615  1.00 50.99  ? 136 LEU A CA  1 
ATOM   984  C C   . LEU A 1 136 ? -23.409 35.494 0.061   1.00 56.14  ? 136 LEU A C   1 
ATOM   985  O O   . LEU A 1 136 ? -22.259 35.062 0.133   1.00 53.66  ? 136 LEU A O   1 
ATOM   986  C CB  . LEU A 1 136 ? -23.637 36.665 -2.135  1.00 52.13  ? 136 LEU A CB  1 
ATOM   987  C CG  . LEU A 1 136 ? -24.089 37.863 -2.947  1.00 58.67  ? 136 LEU A CG  1 
ATOM   988  C CD1 . LEU A 1 136 ? -23.502 37.810 -4.341  1.00 60.26  ? 136 LEU A CD1 1 
ATOM   989  C CD2 . LEU A 1 136 ? -25.606 37.963 -2.992  1.00 62.33  ? 136 LEU A CD2 1 
ATOM   990  N N   . LEU A 1 137 ? -24.470 34.852 0.553   1.00 56.33  ? 137 LEU A N   1 
ATOM   991  C CA  . LEU A 1 137 ? -24.417 33.609 1.320   1.00 55.47  ? 137 LEU A CA  1 
ATOM   992  C C   . LEU A 1 137 ? -25.753 32.849 1.155   1.00 60.64  ? 137 LEU A C   1 
ATOM   993  O O   . LEU A 1 137 ? -26.771 33.450 0.792   1.00 60.19  ? 137 LEU A O   1 
ATOM   994  C CB  . LEU A 1 137 ? -24.202 34.042 2.784   1.00 54.37  ? 137 LEU A CB  1 
ATOM   995  C CG  . LEU A 1 137 ? -23.987 32.992 3.843   1.00 57.82  ? 137 LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 137 ? -22.774 33.331 4.660   1.00 57.04  ? 137 LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 137 ? -25.209 32.894 4.757   1.00 60.71  ? 137 LEU A CD2 1 
ATOM   998  N N   . ASP A 1 138 ? -25.736 31.534 1.418   1.00 57.95  ? 138 ASP A N   1 
ATOM   999  C CA  . ASP A 1 138 ? -26.927 30.686 1.352   1.00 58.80  ? 138 ASP A CA  1 
ATOM   1000 C C   . ASP A 1 138 ? -27.329 30.133 2.737   1.00 59.59  ? 138 ASP A C   1 
ATOM   1001 O O   . ASP A 1 138 ? -26.530 29.470 3.396   1.00 56.54  ? 138 ASP A O   1 
ATOM   1002 C CB  . ASP A 1 138 ? -26.753 29.552 0.315   1.00 61.91  ? 138 ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 138 ? -25.482 28.726 0.456   1.00 79.30  ? 138 ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 138 ? -24.371 29.313 0.352   1.00 79.80  ? 138 ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 138 ? -25.596 27.486 0.626   1.00 89.33  ? 138 ASP A OD2 1 
ATOM   1006 N N   . GLU A 1 139 ? -28.555 30.452 3.184   1.00 56.50  ? 139 GLU A N   1 
ATOM   1007 C CA  . GLU A 1 139 ? -29.126 29.951 4.439   1.00 54.51  ? 139 GLU A CA  1 
ATOM   1008 C C   . GLU A 1 139 ? -29.880 28.649 4.108   1.00 56.37  ? 139 GLU A C   1 
ATOM   1009 O O   . GLU A 1 139 ? -30.584 28.609 3.091   1.00 57.29  ? 139 GLU A O   1 
ATOM   1010 C CB  . GLU A 1 139 ? -30.111 30.954 5.062   1.00 56.86  ? 139 GLU A CB  1 
ATOM   1011 C CG  . GLU A 1 139 ? -29.478 32.122 5.794   1.00 67.60  ? 139 GLU A CG  1 
ATOM   1012 C CD  . GLU A 1 139 ? -30.501 33.063 6.401   1.00 96.15  ? 139 GLU A CD  1 
ATOM   1013 O OE1 . GLU A 1 139 ? -30.509 33.203 7.644   1.00 92.23  ? 139 GLU A OE1 1 
ATOM   1014 O OE2 . GLU A 1 139 ? -31.311 33.642 5.641   1.00 96.76  ? 139 GLU A OE2 1 
ATOM   1015 N N   . PRO A 1 140 ? -29.760 27.577 4.930   1.00 49.77  ? 140 PRO A N   1 
ATOM   1016 C CA  . PRO A 1 140 ? -28.961 27.477 6.165   1.00 47.21  ? 140 PRO A CA  1 
ATOM   1017 C C   . PRO A 1 140 ? -27.458 27.342 5.915   1.00 49.82  ? 140 PRO A C   1 
ATOM   1018 O O   . PRO A 1 140 ? -27.032 26.729 4.929   1.00 50.35  ? 140 PRO A O   1 
ATOM   1019 C CB  . PRO A 1 140 ? -29.610 26.305 6.905   1.00 48.06  ? 140 PRO A CB  1 
ATOM   1020 C CG  . PRO A 1 140 ? -30.175 25.431 5.834   1.00 53.15  ? 140 PRO A CG  1 
ATOM   1021 C CD  . PRO A 1 140 ? -30.458 26.309 4.636   1.00 50.50  ? 140 PRO A CD  1 
ATOM   1022 N N   . ALA A 1 141 ? -26.663 27.963 6.794   1.00 44.30  ? 141 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 141 ? -25.206 28.003 6.705   1.00 42.74  ? 141 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 141 ? -24.515 27.555 7.996   1.00 45.44  ? 141 ALA A C   1 
ATOM   1025 O O   . ALA A 1 141 ? -25.162 27.461 9.052   1.00 44.33  ? 141 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 141 ? -24.755 29.413 6.346   1.00 43.75  ? 141 ALA A CB  1 
ATOM   1027 N N   . TYR A 1 142 ? -23.174 27.296 7.895   1.00 40.59  ? 142 TYR A N   1 
ATOM   1028 C CA  . TYR A 1 142 ? -22.320 26.926 9.018   1.00 38.07  ? 142 TYR A CA  1 
ATOM   1029 C C   . TYR A 1 142 ? -22.349 28.087 10.030  1.00 40.96  ? 142 TYR A C   1 
ATOM   1030 O O   . TYR A 1 142 ? -22.023 29.231 9.682   1.00 40.57  ? 142 TYR A O   1 
ATOM   1031 C CB  . TYR A 1 142 ? -20.871 26.586 8.547   1.00 37.46  ? 142 TYR A CB  1 
ATOM   1032 C CG  . TYR A 1 142 ? -19.818 26.498 9.647   1.00 36.22  ? 142 TYR A CG  1 
ATOM   1033 C CD1 . TYR A 1 142 ? -18.628 27.215 9.560   1.00 37.38  ? 142 TYR A CD1 1 
ATOM   1034 C CD2 . TYR A 1 142 ? -20.002 25.680 10.760  1.00 35.80  ? 142 TYR A CD2 1 
ATOM   1035 C CE1 . TYR A 1 142 ? -17.651 27.133 10.550  1.00 36.62  ? 142 TYR A CE1 1 
ATOM   1036 C CE2 . TYR A 1 142 ? -19.039 25.605 11.770  1.00 35.57  ? 142 TYR A CE2 1 
ATOM   1037 C CZ  . TYR A 1 142 ? -17.863 26.335 11.660  1.00 43.28  ? 142 TYR A CZ  1 
ATOM   1038 O OH  . TYR A 1 142 ? -16.894 26.314 12.648  1.00 45.39  ? 142 TYR A OH  1 
ATOM   1039 N N   . SER A 1 143 ? -22.819 27.777 11.262  1.00 37.74  ? 143 SER A N   1 
ATOM   1040 C CA  . SER A 1 143 ? -22.961 28.726 12.380  1.00 38.31  ? 143 SER A CA  1 
ATOM   1041 C C   . SER A 1 143 ? -21.660 29.514 12.683  1.00 40.71  ? 143 SER A C   1 
ATOM   1042 O O   . SER A 1 143 ? -21.707 30.683 13.047  1.00 39.60  ? 143 SER A O   1 
ATOM   1043 C CB  . SER A 1 143 ? -23.493 28.008 13.624  1.00 42.32  ? 143 SER A CB  1 
ATOM   1044 O OG  . SER A 1 143 ? -22.573 27.024 14.069  1.00 50.24  ? 143 SER A OG  1 
ATOM   1045 N N   . GLY A 1 144 ? -20.525 28.874 12.444  1.00 37.13  ? 144 GLY A N   1 
ATOM   1046 C CA  . GLY A 1 144 ? -19.207 29.463 12.638  1.00 36.75  ? 144 GLY A CA  1 
ATOM   1047 C C   . GLY A 1 144 ? -18.937 30.646 11.742  1.00 41.31  ? 144 GLY A C   1 
ATOM   1048 O O   . GLY A 1 144 ? -18.258 31.585 12.160  1.00 41.55  ? 144 GLY A O   1 
ATOM   1049 N N   . THR A 1 145 ? -19.466 30.618 10.506  1.00 37.15  ? 145 THR A N   1 
ATOM   1050 C CA  . THR A 1 145 ? -19.277 31.750 9.602   1.00 36.16  ? 145 THR A CA  1 
ATOM   1051 C C   . THR A 1 145 ? -20.230 32.863 9.926   1.00 37.66  ? 145 THR A C   1 
ATOM   1052 O O   . THR A 1 145 ? -19.838 34.035 9.857   1.00 37.56  ? 145 THR A O   1 
ATOM   1053 C CB  . THR A 1 145 ? -19.036 31.380 8.134   1.00 38.23  ? 145 THR A CB  1 
ATOM   1054 O OG1 . THR A 1 145 ? -19.918 32.115 7.292   1.00 39.71  ? 145 THR A OG1 1 
ATOM   1055 C CG2 . THR A 1 145 ? -19.185 29.929 7.879   1.00 34.16  ? 145 THR A CG2 1 
ATOM   1056 N N   . LEU A 1 146 ? -21.454 32.502 10.355  1.00 33.10  ? 146 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 146 ? -22.483 33.480 10.751  1.00 33.13  ? 146 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 146 ? -22.000 34.251 11.991  1.00 35.14  ? 146 LEU A C   1 
ATOM   1059 O O   . LEU A 1 146 ? -22.084 35.484 12.035  1.00 33.86  ? 146 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 146 ? -23.843 32.780 11.034  1.00 33.26  ? 146 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 146 ? -24.456 31.928 9.908   1.00 39.32  ? 146 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 146 ? -25.588 31.035 10.435  1.00 40.27  ? 146 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 146 ? -24.941 32.798 8.742   1.00 43.52  ? 146 LEU A CD2 1 
ATOM   1064 N N   . GLN A 1 147 ? -21.393 33.511 12.948  1.00 30.78  ? 147 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 147 ? -20.839 34.061 14.181  1.00 30.09  ? 147 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 147 ? -19.645 34.968 13.937  1.00 33.75  ? 147 GLN A C   1 
ATOM   1067 O O   . GLN A 1 147 ? -19.404 35.891 14.722  1.00 33.40  ? 147 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 147 ? -20.525 32.949 15.193  1.00 30.70  ? 147 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 147 ? -21.762 32.334 15.856  1.00 60.21  ? 147 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 147 ? -22.594 33.323 16.632  1.00 90.09  ? 147 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 147 ? -22.422 33.491 17.843  1.00 89.33  ? 147 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 147 ? -23.574 33.928 15.976  1.00 81.53  ? 147 GLN A NE2 1 
ATOM   1073 N N   . SER A 1 148 ? -18.920 34.716 12.823  1.00 29.73  ? 148 SER A N   1 
ATOM   1074 C CA  . SER A 1 148 ? -17.769 35.492 12.369  1.00 29.24  ? 148 SER A CA  1 
ATOM   1075 C C   . SER A 1 148 ? -18.226 36.780 11.691  1.00 33.26  ? 148 SER A C   1 
ATOM   1076 O O   . SER A 1 148 ? -17.648 37.842 11.950  1.00 32.48  ? 148 SER A O   1 
ATOM   1077 C CB  . SER A 1 148 ? -16.939 34.686 11.371  1.00 33.27  ? 148 SER A CB  1 
ATOM   1078 O OG  . SER A 1 148 ? -15.925 33.929 12.002  1.00 41.87  ? 148 SER A OG  1 
ATOM   1079 N N   . LEU A 1 149 ? -19.238 36.685 10.804  1.00 31.35  ? 149 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 149 ? -19.719 37.834 10.037  1.00 33.72  ? 149 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 149 ? -20.531 38.869 10.823  1.00 40.37  ? 149 LEU A C   1 
ATOM   1082 O O   . LEU A 1 149 ? -20.409 40.070 10.553  1.00 39.85  ? 149 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 149 ? -20.441 37.408 8.746   1.00 34.63  ? 149 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 149 ? -19.649 36.532 7.748   1.00 38.94  ? 149 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 149 ? -20.504 36.158 6.570   1.00 40.99  ? 149 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 149 ? -18.398 37.213 7.245   1.00 39.85  ? 149 LEU A CD2 1 
ATOM   1087 N N   . HIS A 1 150 ? -21.349 38.402 11.797  1.00 38.68  ? 150 HIS A N   1 
ATOM   1088 C CA  . HIS A 1 150 ? -22.201 39.239 12.652  1.00 39.81  ? 150 HIS A CA  1 
ATOM   1089 C C   . HIS A 1 150 ? -21.504 40.497 13.261  1.00 42.37  ? 150 HIS A C   1 
ATOM   1090 O O   . HIS A 1 150 ? -22.038 41.598 13.090  1.00 42.38  ? 150 HIS A O   1 
ATOM   1091 C CB  . HIS A 1 150 ? -22.939 38.385 13.712  1.00 40.59  ? 150 HIS A CB  1 
ATOM   1092 C CG  . HIS A 1 150 ? -23.677 39.192 14.740  1.00 45.45  ? 150 HIS A CG  1 
ATOM   1093 N ND1 . HIS A 1 150 ? -23.236 39.278 16.054  1.00 46.91  ? 150 HIS A ND1 1 
ATOM   1094 C CD2 . HIS A 1 150 ? -24.783 39.959 14.606  1.00 48.93  ? 150 HIS A CD2 1 
ATOM   1095 C CE1 . HIS A 1 150 ? -24.100 40.071 16.673  1.00 47.33  ? 150 HIS A CE1 1 
ATOM   1096 N NE2 . HIS A 1 150 ? -25.042 40.508 15.844  1.00 48.90  ? 150 HIS A NE2 1 
ATOM   1097 N N   . PRO A 1 151 ? -20.314 40.385 13.918  1.00 37.59  ? 151 PRO A N   1 
ATOM   1098 C CA  . PRO A 1 151 ? -19.675 41.589 14.481  1.00 37.66  ? 151 PRO A CA  1 
ATOM   1099 C C   . PRO A 1 151 ? -19.101 42.562 13.453  1.00 42.81  ? 151 PRO A C   1 
ATOM   1100 O O   . PRO A 1 151 ? -18.799 43.699 13.804  1.00 42.88  ? 151 PRO A O   1 
ATOM   1101 C CB  . PRO A 1 151 ? -18.557 41.015 15.359  1.00 37.78  ? 151 PRO A CB  1 
ATOM   1102 C CG  . PRO A 1 151 ? -18.844 39.561 15.478  1.00 41.28  ? 151 PRO A CG  1 
ATOM   1103 C CD  . PRO A 1 151 ? -19.516 39.185 14.233  1.00 37.14  ? 151 PRO A CD  1 
ATOM   1104 N N   . LEU A 1 152 ? -18.942 42.114 12.197  1.00 40.75  ? 152 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 152 ? -18.351 42.898 11.105  1.00 41.72  ? 152 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 152 ? -19.271 43.945 10.487  1.00 47.52  ? 152 LEU A C   1 
ATOM   1107 O O   . LEU A 1 152 ? -18.813 44.764 9.668   1.00 49.16  ? 152 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 152 ? -17.717 41.996 10.024  1.00 41.26  ? 152 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 152 ? -16.512 41.161 10.446  1.00 43.75  ? 152 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 152 ? -16.343 39.992 9.534   1.00 45.44  ? 152 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 152 ? -15.245 41.992 10.436  1.00 43.53  ? 152 LEU A CD2 1 
ATOM   1112 N N   . GLY A 1 153 ? -20.536 43.928 10.905  1.00 43.89  ? 153 GLY A N   1 
ATOM   1113 C CA  . GLY A 1 153 ? -21.551 44.875 10.455  1.00 45.23  ? 153 GLY A CA  1 
ATOM   1114 C C   . GLY A 1 153 ? -21.755 44.929 8.956   1.00 49.22  ? 153 GLY A C   1 
ATOM   1115 O O   . GLY A 1 153 ? -21.817 46.010 8.377   1.00 49.10  ? 153 GLY A O   1 
ATOM   1116 N N   . CYS A 1 154 ? -21.838 43.761 8.326   1.00 46.18  ? 154 CYS A N   1 
ATOM   1117 C CA  . CYS A 1 154 ? -22.065 43.620 6.898   1.00 47.51  ? 154 CYS A CA  1 
ATOM   1118 C C   . CYS A 1 154 ? -23.490 43.138 6.671   1.00 53.31  ? 154 CYS A C   1 
ATOM   1119 O O   . CYS A 1 154 ? -24.078 42.543 7.579   1.00 54.11  ? 154 CYS A O   1 
ATOM   1120 C CB  . CYS A 1 154 ? -21.047 42.662 6.284   1.00 46.90  ? 154 CYS A CB  1 
ATOM   1121 S SG  . CYS A 1 154 ? -21.116 40.966 6.933   1.00 49.06  ? 154 CYS A SG  1 
ATOM   1122 N N   . ASN A 1 155 ? -24.041 43.367 5.463   1.00 50.26  ? 155 ASN A N   1 
ATOM   1123 C CA  . ASN A 1 155 ? -25.394 42.921 5.115   1.00 50.83  ? 155 ASN A CA  1 
ATOM   1124 C C   . ASN A 1 155 ? -25.341 41.571 4.411   1.00 52.54  ? 155 ASN A C   1 
ATOM   1125 O O   . ASN A 1 155 ? -24.784 41.478 3.309   1.00 53.48  ? 155 ASN A O   1 
ATOM   1126 C CB  . ASN A 1 155 ? -26.118 43.961 4.253   1.00 54.49  ? 155 ASN A CB  1 
ATOM   1127 C CG  . ASN A 1 155 ? -26.229 45.325 4.892   1.00 72.67  ? 155 ASN A CG  1 
ATOM   1128 O OD1 . ASN A 1 155 ? -26.798 45.492 5.978   1.00 63.85  ? 155 ASN A OD1 1 
ATOM   1129 N ND2 . ASN A 1 155 ? -25.683 46.336 4.226   1.00 65.28  ? 155 ASN A ND2 1 
ATOM   1130 N N   . ILE A 1 156 ? -25.874 40.521 5.067   1.00 45.33  ? 156 ILE A N   1 
ATOM   1131 C CA  . ILE A 1 156 ? -25.922 39.173 4.494   1.00 43.55  ? 156 ILE A CA  1 
ATOM   1132 C C   . ILE A 1 156 ? -27.214 39.030 3.673   1.00 49.82  ? 156 ILE A C   1 
ATOM   1133 O O   . ILE A 1 156 ? -28.309 39.077 4.235   1.00 49.76  ? 156 ILE A O   1 
ATOM   1134 C CB  . ILE A 1 156 ? -25.772 38.033 5.552   1.00 43.67  ? 156 ILE A CB  1 
ATOM   1135 C CG1 . ILE A 1 156 ? -24.393 38.081 6.232   1.00 41.42  ? 156 ILE A CG1 1 
ATOM   1136 C CG2 . ILE A 1 156 ? -26.015 36.651 4.902   1.00 43.42  ? 156 ILE A CG2 1 
ATOM   1137 C CD1 . ILE A 1 156 ? -24.301 37.334 7.533   1.00 37.83  ? 156 ILE A CD1 1 
ATOM   1138 N N   . ILE A 1 157 ? -27.063 38.849 2.350   1.00 47.67  ? 157 ILE A N   1 
ATOM   1139 C CA  . ILE A 1 157 ? -28.149 38.661 1.388   1.00 48.91  ? 157 ILE A CA  1 
ATOM   1140 C C   . ILE A 1 157 ? -28.256 37.148 1.139   1.00 54.11  ? 157 ILE A C   1 
ATOM   1141 O O   . ILE A 1 157 ? -27.315 36.539 0.620   1.00 53.01  ? 157 ILE A O   1 
ATOM   1142 C CB  . ILE A 1 157 ? -27.887 39.464 0.073   1.00 52.96  ? 157 ILE A CB  1 
ATOM   1143 C CG1 . ILE A 1 157 ? -27.493 40.943 0.362   1.00 53.06  ? 157 ILE A CG1 1 
ATOM   1144 C CG2 . ILE A 1 157 ? -29.085 39.372 -0.877  1.00 55.62  ? 157 ILE A CG2 1 
ATOM   1145 C CD1 . ILE A 1 157 ? -26.799 41.718 -0.813  1.00 51.33  ? 157 ILE A CD1 1 
ATOM   1146 N N   . ASN A 1 158 ? -29.377 36.537 1.553   1.00 52.83  ? 158 ASN A N   1 
ATOM   1147 C CA  . ASN A 1 158 ? -29.585 35.099 1.376   1.00 53.14  ? 158 ASN A CA  1 
ATOM   1148 C C   . ASN A 1 158 ? -29.941 34.709 -0.078  1.00 60.91  ? 158 ASN A C   1 
ATOM   1149 O O   . ASN A 1 158 ? -30.822 35.315 -0.687  1.00 62.19  ? 158 ASN A O   1 
ATOM   1150 C CB  . ASN A 1 158 ? -30.570 34.526 2.406   1.00 52.09  ? 158 ASN A CB  1 
ATOM   1151 C CG  . ASN A 1 158 ? -31.052 33.126 2.089   1.00 83.85  ? 158 ASN A CG  1 
ATOM   1152 O OD1 . ASN A 1 158 ? -30.271 32.168 1.992   1.00 71.58  ? 158 ASN A OD1 1 
ATOM   1153 N ND2 . ASN A 1 158 ? -32.354 32.991 1.862   1.00 84.43  ? 158 ASN A ND2 1 
ATOM   1154 N N   . VAL A 1 159 ? -29.235 33.700 -0.613  1.00 58.82  ? 159 VAL A N   1 
ATOM   1155 C CA  . VAL A 1 159 ? -29.435 33.166 -1.960  1.00 61.11  ? 159 VAL A CA  1 
ATOM   1156 C C   . VAL A 1 159 ? -30.171 31.834 -1.818  1.00 66.49  ? 159 VAL A C   1 
ATOM   1157 O O   . VAL A 1 159 ? -29.770 30.992 -0.999  1.00 66.21  ? 159 VAL A O   1 
ATOM   1158 C CB  . VAL A 1 159 ? -28.089 32.999 -2.725  1.00 65.30  ? 159 VAL A CB  1 
ATOM   1159 C CG1 . VAL A 1 159 ? -28.317 32.489 -4.147  1.00 67.00  ? 159 VAL A CG1 1 
ATOM   1160 C CG2 . VAL A 1 159 ? -27.296 34.303 -2.751  1.00 65.46  ? 159 VAL A CG2 1 
ATOM   1161 N N   . ALA A 1 160 ? -31.243 31.640 -2.603  1.00 63.40  ? 160 ALA A N   1 
ATOM   1162 C CA  . ALA A 1 160 ? -32.019 30.405 -2.554  1.00 62.85  ? 160 ALA A CA  1 
ATOM   1163 C C   . ALA A 1 160 ? -31.190 29.176 -2.946  1.00 64.70  ? 160 ALA A C   1 
ATOM   1164 O O   . ALA A 1 160 ? -30.306 29.262 -3.803  1.00 63.34  ? 160 ALA A O   1 
ATOM   1165 C CB  . ALA A 1 160 ? -33.251 30.518 -3.433  1.00 66.07  ? 160 ALA A CB  1 
ATOM   1166 N N   . SER A 1 161 ? -31.467 28.044 -2.277  1.00 60.84  ? 161 SER A N   1 
ATOM   1167 C CA  . SER A 1 161 ? -30.790 26.769 -2.504  1.00 60.02  ? 161 SER A CA  1 
ATOM   1168 C C   . SER A 1 161 ? -31.751 25.568 -2.481  1.00 64.85  ? 161 SER A C   1 
ATOM   1169 O O   . SER A 1 161 ? -32.875 25.674 -1.980  1.00 65.45  ? 161 SER A O   1 
ATOM   1170 C CB  . SER A 1 161 ? -29.651 26.579 -1.507  1.00 61.30  ? 161 SER A CB  1 
ATOM   1171 O OG  . SER A 1 161 ? -30.143 26.526 -0.181  1.00 71.33  ? 161 SER A OG  1 
ATOM   1172 N N   . ASP A 1 162 ? -31.301 24.434 -3.051  1.00 60.66  ? 162 ASP A N   1 
ATOM   1173 C CA  . ASP A 1 162 ? -32.038 23.172 -3.108  1.00 60.21  ? 162 ASP A CA  1 
ATOM   1174 C C   . ASP A 1 162 ? -31.064 21.980 -2.928  1.00 61.59  ? 162 ASP A C   1 
ATOM   1175 O O   . ASP A 1 162 ? -29.950 22.196 -2.447  1.00 59.43  ? 162 ASP A O   1 
ATOM   1176 C CB  . ASP A 1 162 ? -32.859 23.090 -4.408  1.00 64.18  ? 162 ASP A CB  1 
ATOM   1177 C CG  . ASP A 1 162 ? -32.065 23.047 -5.703  1.00 75.39  ? 162 ASP A CG  1 
ATOM   1178 O OD1 . ASP A 1 162 ? -30.854 23.359 -5.672  1.00 73.53  ? 162 ASP A OD1 1 
ATOM   1179 O OD2 . ASP A 1 162 ? -32.661 22.716 -6.751  1.00 85.35  ? 162 ASP A OD2 1 
ATOM   1180 N N   . GLU A 1 163 ? -31.474 20.743 -3.307  1.00 58.11  ? 163 GLU A N   1 
ATOM   1181 C CA  . GLU A 1 163 ? -30.678 19.500 -3.214  1.00 56.25  ? 163 GLU A CA  1 
ATOM   1182 C C   . GLU A 1 163 ? -29.320 19.593 -3.934  1.00 58.45  ? 163 GLU A C   1 
ATOM   1183 O O   . GLU A 1 163 ? -28.385 18.866 -3.579  1.00 57.17  ? 163 GLU A O   1 
ATOM   1184 C CB  . GLU A 1 163 ? -31.441 18.268 -3.760  1.00 58.84  ? 163 GLU A CB  1 
ATOM   1185 C CG  . GLU A 1 163 ? -32.957 18.375 -3.824  1.00 74.42  ? 163 GLU A CG  1 
ATOM   1186 C CD  . GLU A 1 163 ? -33.550 19.041 -5.052  1.00 103.78 ? 163 GLU A CD  1 
ATOM   1187 O OE1 . GLU A 1 163 ? -34.352 19.986 -4.876  1.00 107.07 ? 163 GLU A OE1 1 
ATOM   1188 O OE2 . GLU A 1 163 ? -33.240 18.604 -6.184  1.00 99.42  ? 163 GLU A OE2 1 
ATOM   1189 N N   . SER A 1 164 ? -29.222 20.460 -4.956  1.00 54.77  ? 164 SER A N   1 
ATOM   1190 C CA  . SER A 1 164 ? -28.006 20.649 -5.740  1.00 54.38  ? 164 SER A CA  1 
ATOM   1191 C C   . SER A 1 164 ? -27.271 21.956 -5.352  1.00 56.07  ? 164 SER A C   1 
ATOM   1192 O O   . SER A 1 164 ? -26.508 22.512 -6.149  1.00 54.50  ? 164 SER A O   1 
ATOM   1193 C CB  . SER A 1 164 ? -28.346 20.611 -7.226  1.00 61.57  ? 164 SER A CB  1 
ATOM   1194 O OG  . SER A 1 164 ? -29.174 19.499 -7.533  1.00 72.84  ? 164 SER A OG  1 
ATOM   1195 N N   . GLY A 1 165 ? -27.497 22.399 -4.109  1.00 52.07  ? 165 GLY A N   1 
ATOM   1196 C CA  . GLY A 1 165 ? -26.927 23.612 -3.532  1.00 50.96  ? 165 GLY A CA  1 
ATOM   1197 C C   . GLY A 1 165 ? -27.519 24.909 -4.065  1.00 55.66  ? 165 GLY A C   1 
ATOM   1198 O O   . GLY A 1 165 ? -28.702 24.963 -4.420  1.00 57.39  ? 165 GLY A O   1 
ATOM   1199 N N   . ILE A 1 166 ? -26.682 25.970 -4.122  1.00 49.83  ? 166 ILE A N   1 
ATOM   1200 C CA  . ILE A 1 166 ? -27.023 27.300 -4.618  1.00 50.25  ? 166 ILE A CA  1 
ATOM   1201 C C   . ILE A 1 166 ? -27.733 27.192 -5.965  1.00 57.27  ? 166 ILE A C   1 
ATOM   1202 O O   . ILE A 1 166 ? -27.302 26.414 -6.825  1.00 58.22  ? 166 ILE A O   1 
ATOM   1203 C CB  . ILE A 1 166 ? -25.744 28.200 -4.677  1.00 52.27  ? 166 ILE A CB  1 
ATOM   1204 C CG1 . ILE A 1 166 ? -25.419 28.774 -3.286  1.00 50.17  ? 166 ILE A CG1 1 
ATOM   1205 C CG2 . ILE A 1 166 ? -25.849 29.333 -5.737  1.00 55.09  ? 166 ILE A CG2 1 
ATOM   1206 C CD1 . ILE A 1 166 ? -24.040 29.348 -3.132  1.00 51.37  ? 166 ILE A CD1 1 
ATOM   1207 N N   . VAL A 1 167 ? -28.832 27.947 -6.123  1.00 54.81  ? 167 VAL A N   1 
ATOM   1208 C CA  . VAL A 1 167 ? -29.607 27.991 -7.359  1.00 57.05  ? 167 VAL A CA  1 
ATOM   1209 C C   . VAL A 1 167 ? -29.098 29.202 -8.149  1.00 62.46  ? 167 VAL A C   1 
ATOM   1210 O O   . VAL A 1 167 ? -29.243 30.330 -7.671  1.00 61.88  ? 167 VAL A O   1 
ATOM   1211 C CB  . VAL A 1 167 ? -31.140 28.048 -7.095  1.00 62.16  ? 167 VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 167 ? -31.930 28.080 -8.399  1.00 64.55  ? 167 VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 167 ? -31.594 26.880 -6.228  1.00 60.79  ? 167 VAL A CG2 1 
ATOM   1214 N N   . PRO A 1 168 ? -28.486 28.993 -9.344  1.00 61.47  ? 168 PRO A N   1 
ATOM   1215 C CA  . PRO A 1 168 ? -27.947 30.135 -10.116 1.00 62.56  ? 168 PRO A CA  1 
ATOM   1216 C C   . PRO A 1 168 ? -28.938 31.228 -10.512 1.00 68.82  ? 168 PRO A C   1 
ATOM   1217 O O   . PRO A 1 168 ? -28.539 32.391 -10.574 1.00 68.73  ? 168 PRO A O   1 
ATOM   1218 C CB  . PRO A 1 168 ? -27.291 29.473 -11.335 1.00 65.41  ? 168 PRO A CB  1 
ATOM   1219 C CG  . PRO A 1 168 ? -27.031 28.061 -10.909 1.00 68.92  ? 168 PRO A CG  1 
ATOM   1220 C CD  . PRO A 1 168 ? -28.193 27.712 -10.020 1.00 63.78  ? 168 PRO A CD  1 
ATOM   1221 N N   . ASP A 1 169 ? -30.216 30.875 -10.765 1.00 67.28  ? 169 ASP A N   1 
ATOM   1222 C CA  . ASP A 1 169 ? -31.241 31.857 -11.130 1.00 69.70  ? 169 ASP A CA  1 
ATOM   1223 C C   . ASP A 1 169 ? -31.605 32.804 -9.989  1.00 71.89  ? 169 ASP A C   1 
ATOM   1224 O O   . ASP A 1 169 ? -31.927 33.963 -10.247 1.00 72.28  ? 169 ASP A O   1 
ATOM   1225 C CB  . ASP A 1 169 ? -32.473 31.189 -11.743 1.00 74.44  ? 169 ASP A CB  1 
ATOM   1226 C CG  . ASP A 1 169 ? -32.273 30.819 -13.202 1.00 96.20  ? 169 ASP A CG  1 
ATOM   1227 O OD1 . ASP A 1 169 ? -32.356 31.726 -14.063 1.00 101.07 ? 169 ASP A OD1 1 
ATOM   1228 O OD2 . ASP A 1 169 ? -32.016 29.629 -13.482 1.00 103.86 ? 169 ASP A OD2 1 
ATOM   1229 N N   . SER A 1 170 ? -31.516 32.325 -8.727  1.00 66.71  ? 170 SER A N   1 
ATOM   1230 C CA  . SER A 1 170 ? -31.761 33.141 -7.529  1.00 65.38  ? 170 SER A CA  1 
ATOM   1231 C C   . SER A 1 170 ? -30.681 34.224 -7.447  1.00 67.20  ? 170 SER A C   1 
ATOM   1232 O O   . SER A 1 170 ? -30.999 35.397 -7.254  1.00 66.98  ? 170 SER A O   1 
ATOM   1233 C CB  . SER A 1 170 ? -31.724 32.277 -6.274  1.00 67.03  ? 170 SER A CB  1 
ATOM   1234 O OG  . SER A 1 170 ? -31.934 33.056 -5.107  1.00 78.06  ? 170 SER A OG  1 
ATOM   1235 N N   . LEU A 1 171 ? -29.406 33.812 -7.643  1.00 61.75  ? 171 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 171 ? -28.219 34.664 -7.655  1.00 60.59  ? 171 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 171 ? -28.327 35.692 -8.782  1.00 66.95  ? 171 LEU A C   1 
ATOM   1238 O O   . LEU A 1 171 ? -27.984 36.851 -8.568  1.00 66.38  ? 171 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 171 ? -26.959 33.785 -7.807  1.00 58.82  ? 171 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 171 ? -25.585 34.467 -7.894  1.00 62.10  ? 171 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 171 ? -25.211 35.141 -6.583  1.00 60.61  ? 171 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 171 ? -24.512 33.466 -8.276  1.00 61.77  ? 171 LEU A CD2 1 
ATOM   1243 N N   . ARG A 1 172 ? -28.860 35.278 -9.953  1.00 65.86  ? 172 ARG A N   1 
ATOM   1244 C CA  . ARG A 1 172 ? -29.075 36.150 -11.111 1.00 68.27  ? 172 ARG A CA  1 
ATOM   1245 C C   . ARG A 1 172 ? -30.093 37.248 -10.753 1.00 74.05  ? 172 ARG A C   1 
ATOM   1246 O O   . ARG A 1 172 ? -29.820 38.430 -10.965 1.00 74.27  ? 172 ARG A O   1 
ATOM   1247 C CB  . ARG A 1 172 ? -29.545 35.319 -12.319 1.00 68.79  ? 172 ARG A CB  1 
ATOM   1248 C CG  . ARG A 1 172 ? -29.261 35.958 -13.673 1.00 78.42  ? 172 ARG A CG  1 
ATOM   1249 C CD  . ARG A 1 172 ? -29.394 34.970 -14.823 1.00 92.40  ? 172 ARG A CD  1 
ATOM   1250 N NE  . ARG A 1 172 ? -28.299 33.994 -14.865 1.00 103.92 ? 172 ARG A NE  1 
ATOM   1251 C CZ  . ARG A 1 172 ? -28.460 32.672 -14.836 1.00 118.26 ? 172 ARG A CZ  1 
ATOM   1252 N NH1 . ARG A 1 172 ? -29.679 32.146 -14.772 1.00 106.91 ? 172 ARG A NH1 1 
ATOM   1253 N NH2 . ARG A 1 172 ? -27.407 31.867 -14.878 1.00 101.03 ? 172 ARG A NH2 1 
ATOM   1254 N N   . ASP A 1 173 ? -31.230 36.848 -10.160 1.00 72.08  ? 173 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 173 ? -32.322 37.725 -9.735  1.00 73.96  ? 173 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 173 ? -31.836 38.738 -8.695  1.00 74.03  ? 173 ASP A C   1 
ATOM   1257 O O   . ASP A 1 173 ? -32.166 39.921 -8.802  1.00 74.85  ? 173 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 173 ? -33.506 36.884 -9.201  1.00 76.96  ? 173 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 173 ? -34.740 37.686 -8.811  1.00 97.84  ? 173 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 173 ? -35.660 37.812 -9.654  1.00 102.23 ? 173 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 173 ? -34.804 38.152 -7.649  1.00 105.18 ? 173 ASP A OD2 1 
ATOM   1262 N N   . ILE A 1 174 ? -31.035 38.281 -7.715  1.00 66.36  ? 174 ILE A N   1 
ATOM   1263 C CA  . ILE A 1 174 ? -30.482 39.142 -6.665  1.00 64.09  ? 174 ILE A CA  1 
ATOM   1264 C C   . ILE A 1 174 ? -29.550 40.201 -7.283  1.00 67.57  ? 174 ILE A C   1 
ATOM   1265 O O   . ILE A 1 174 ? -29.804 41.393 -7.116  1.00 69.15  ? 174 ILE A O   1 
ATOM   1266 C CB  . ILE A 1 174 ? -29.802 38.299 -5.542  1.00 63.94  ? 174 ILE A CB  1 
ATOM   1267 C CG1 . ILE A 1 174 ? -30.856 37.569 -4.682  1.00 63.52  ? 174 ILE A CG1 1 
ATOM   1268 C CG2 . ILE A 1 174 ? -28.876 39.160 -4.663  1.00 63.14  ? 174 ILE A CG2 1 
ATOM   1269 C CD1 . ILE A 1 174 ? -30.383 36.247 -4.025  1.00 68.18  ? 174 ILE A CD1 1 
ATOM   1270 N N   . LEU A 1 175 ? -28.523 39.756 -8.040  1.00 62.08  ? 175 LEU A N   1 
ATOM   1271 C CA  . LEU A 1 175 ? -27.517 40.596 -8.695  1.00 62.36  ? 175 LEU A CA  1 
ATOM   1272 C C   . LEU A 1 175 ? -28.071 41.670 -9.623  1.00 69.73  ? 175 LEU A C   1 
ATOM   1273 O O   . LEU A 1 175 ? -27.407 42.688 -9.822  1.00 68.93  ? 175 LEU A O   1 
ATOM   1274 C CB  . LEU A 1 175 ? -26.480 39.736 -9.445  1.00 61.63  ? 175 LEU A CB  1 
ATOM   1275 C CG  . LEU A 1 175 ? -25.432 38.993 -8.602  1.00 62.34  ? 175 LEU A CG  1 
ATOM   1276 C CD1 . LEU A 1 175 ? -24.731 37.934 -9.430  1.00 61.91  ? 175 LEU A CD1 1 
ATOM   1277 C CD2 . LEU A 1 175 ? -24.425 39.951 -7.987  1.00 61.75  ? 175 LEU A CD2 1 
ATOM   1278 N N   . SER A 1 176 ? -29.288 41.461 -10.166 1.00 70.38  ? 176 SER A N   1 
ATOM   1279 C CA  . SER A 1 176 ? -29.951 42.391 -11.086 1.00 74.38  ? 176 SER A CA  1 
ATOM   1280 C C   . SER A 1 176 ? -30.232 43.783 -10.488 1.00 81.61  ? 176 SER A C   1 
ATOM   1281 O O   . SER A 1 176 ? -30.475 44.727 -11.252 1.00 82.88  ? 176 SER A O   1 
ATOM   1282 C CB  . SER A 1 176 ? -31.214 41.767 -11.681 1.00 79.18  ? 176 SER A CB  1 
ATOM   1283 O OG  . SER A 1 176 ? -32.386 42.032 -10.928 1.00 87.61  ? 176 SER A OG  1 
ATOM   1284 N N   . ARG A 1 177 ? -30.167 43.918 -9.130  1.00 78.27  ? 177 ARG A N   1 
ATOM   1285 C CA  . ARG A 1 177 ? -30.404 45.202 -8.461  1.00 79.68  ? 177 ARG A CA  1 
ATOM   1286 C C   . ARG A 1 177 ? -29.327 46.271 -8.762  1.00 86.24  ? 177 ARG A C   1 
ATOM   1287 O O   . ARG A 1 177 ? -29.572 47.466 -8.576  1.00 86.76  ? 177 ARG A O   1 
ATOM   1288 C CB  . ARG A 1 177 ? -30.769 45.042 -6.972  1.00 77.38  ? 177 ARG A CB  1 
ATOM   1289 C CG  . ARG A 1 177 ? -29.604 44.920 -6.021  1.00 86.82  ? 177 ARG A CG  1 
ATOM   1290 C CD  . ARG A 1 177 ? -30.051 44.813 -4.573  1.00 96.17  ? 177 ARG A CD  1 
ATOM   1291 N NE  . ARG A 1 177 ? -30.570 43.484 -4.219  1.00 99.06  ? 177 ARG A NE  1 
ATOM   1292 C CZ  . ARG A 1 177 ? -30.760 43.055 -2.972  1.00 106.47 ? 177 ARG A CZ  1 
ATOM   1293 N NH1 . ARG A 1 177 ? -30.459 43.834 -1.941  1.00 88.45  ? 177 ARG A NH1 1 
ATOM   1294 N NH2 . ARG A 1 177 ? -31.242 41.840 -2.747  1.00 92.86  ? 177 ARG A NH2 1 
ATOM   1295 N N   . TRP A 1 178 ? -28.167 45.819 -9.292  1.00 83.65  ? 178 TRP A N   1 
ATOM   1296 C CA  . TRP A 1 178 ? -27.029 46.620 -9.750  1.00 84.56  ? 178 TRP A CA  1 
ATOM   1297 C C   . TRP A 1 178 ? -26.789 46.308 -11.241 1.00 90.17  ? 178 TRP A C   1 
ATOM   1298 O O   . TRP A 1 178 ? -27.396 45.380 -11.790 1.00 90.20  ? 178 TRP A O   1 
ATOM   1299 C CB  . TRP A 1 178 ? -25.750 46.251 -8.974  1.00 81.17  ? 178 TRP A CB  1 
ATOM   1300 C CG  . TRP A 1 178 ? -25.835 46.362 -7.481  1.00 80.64  ? 178 TRP A CG  1 
ATOM   1301 C CD1 . TRP A 1 178 ? -25.601 47.474 -6.726  1.00 83.48  ? 178 TRP A CD1 1 
ATOM   1302 C CD2 . TRP A 1 178 ? -26.059 45.288 -6.558  1.00 78.46  ? 178 TRP A CD2 1 
ATOM   1303 N NE1 . TRP A 1 178 ? -25.725 47.173 -5.390  1.00 80.87  ? 178 TRP A NE1 1 
ATOM   1304 C CE2 . TRP A 1 178 ? -26.005 45.836 -5.257  1.00 81.08  ? 178 TRP A CE2 1 
ATOM   1305 C CE3 . TRP A 1 178 ? -26.327 43.912 -6.706  1.00 79.03  ? 178 TRP A CE3 1 
ATOM   1306 C CZ2 . TRP A 1 178 ? -26.221 45.063 -4.110  1.00 78.47  ? 178 TRP A CZ2 1 
ATOM   1307 C CZ3 . TRP A 1 178 ? -26.551 43.149 -5.570  1.00 78.72  ? 178 TRP A CZ3 1 
ATOM   1308 C CH2 . TRP A 1 178 ? -26.494 43.722 -4.290  1.00 78.22  ? 178 TRP A CH2 1 
ATOM   1309 N N   . LYS A 1 179 ? -25.884 47.074 -11.878 1.00 88.16  ? 179 LYS A N   1 
ATOM   1310 C CA  . LYS A 1 179 ? -25.460 46.908 -13.275 1.00 89.77  ? 179 LYS A CA  1 
ATOM   1311 C C   . LYS A 1 179 ? -23.994 46.433 -13.257 1.00 91.55  ? 179 LYS A C   1 
ATOM   1312 O O   . LYS A 1 179 ? -23.255 46.881 -12.376 1.00 88.75  ? 179 LYS A O   1 
ATOM   1313 C CB  . LYS A 1 179 ? -25.553 48.250 -14.054 1.00 94.89  ? 179 LYS A CB  1 
ATOM   1314 C CG  . LYS A 1 179 ? -26.944 48.889 -14.120 1.00 106.35 ? 179 LYS A CG  1 
ATOM   1315 C CD  . LYS A 1 179 ? -27.812 48.282 -15.217 1.00 118.40 ? 179 LYS A CD  1 
ATOM   1316 C CE  . LYS A 1 179 ? -29.242 48.757 -15.161 1.00 127.07 ? 179 LYS A CE  1 
ATOM   1317 N NZ  . LYS A 1 179 ? -30.107 47.992 -16.097 1.00 132.25 ? 179 LYS A NZ  1 
ATOM   1318 N N   . PRO A 1 180 ? -23.519 45.582 -14.209 1.00 88.56  ? 180 PRO A N   1 
ATOM   1319 C CA  . PRO A 1 180 ? -22.096 45.170 -14.186 1.00 87.04  ? 180 PRO A CA  1 
ATOM   1320 C C   . PRO A 1 180 ? -21.084 46.320 -14.042 1.00 93.39  ? 180 PRO A C   1 
ATOM   1321 O O   . PRO A 1 180 ? -20.071 46.157 -13.362 1.00 90.97  ? 180 PRO A O   1 
ATOM   1322 C CB  . PRO A 1 180 ? -21.926 44.414 -15.506 1.00 89.88  ? 180 PRO A CB  1 
ATOM   1323 C CG  . PRO A 1 180 ? -23.279 43.890 -15.803 1.00 95.03  ? 180 PRO A CG  1 
ATOM   1324 C CD  . PRO A 1 180 ? -24.238 44.944 -15.332 1.00 91.63  ? 180 PRO A CD  1 
ATOM   1325 N N   . GLU A 1 181 ? -21.388 47.494 -14.637 1.00 94.24  ? 181 GLU A N   1 
ATOM   1326 C CA  . GLU A 1 181 ? -20.562 48.708 -14.576 1.00 95.04  ? 181 GLU A CA  1 
ATOM   1327 C C   . GLU A 1 181 ? -20.405 49.274 -13.149 1.00 97.61  ? 181 GLU A C   1 
ATOM   1328 O O   . GLU A 1 181 ? -19.393 49.919 -12.864 1.00 97.18  ? 181 GLU A O   1 
ATOM   1329 C CB  . GLU A 1 181 ? -21.074 49.795 -15.551 1.00 99.92  ? 181 GLU A CB  1 
ATOM   1330 C CG  . GLU A 1 181 ? -22.548 50.149 -15.406 1.00 113.98 ? 181 GLU A CG  1 
ATOM   1331 C CD  . GLU A 1 181 ? -22.936 51.528 -15.904 1.00 144.43 ? 181 GLU A CD  1 
ATOM   1332 O OE1 . GLU A 1 181 ? -23.186 52.413 -15.054 1.00 147.42 ? 181 GLU A OE1 1 
ATOM   1333 O OE2 . GLU A 1 181 ? -23.009 51.723 -17.139 1.00 140.62 ? 181 GLU A OE2 1 
ATOM   1334 N N   . ASP A 1 182 ? -21.394 49.020 -12.263 1.00 93.12  ? 182 ASP A N   1 
ATOM   1335 C CA  . ASP A 1 182 ? -21.400 49.494 -10.876 1.00 91.22  ? 182 ASP A CA  1 
ATOM   1336 C C   . ASP A 1 182 ? -20.233 48.992 -10.027 1.00 91.30  ? 182 ASP A C   1 
ATOM   1337 O O   . ASP A 1 182 ? -19.836 49.700 -9.108  1.00 89.69  ? 182 ASP A O   1 
ATOM   1338 C CB  . ASP A 1 182 ? -22.739 49.185 -10.179 1.00 93.17  ? 182 ASP A CB  1 
ATOM   1339 C CG  . ASP A 1 182 ? -23.965 49.846 -10.775 1.00 110.03 ? 182 ASP A CG  1 
ATOM   1340 O OD1 . ASP A 1 182 ? -23.816 50.596 -11.766 1.00 114.80 ? 182 ASP A OD1 1 
ATOM   1341 O OD2 . ASP A 1 182 ? -25.076 49.620 -10.246 1.00 115.73 ? 182 ASP A OD2 1 
ATOM   1342 N N   . ALA A 1 183 ? -19.684 47.788 -10.323 1.00 86.53  ? 183 ALA A N   1 
ATOM   1343 C CA  . ALA A 1 183 ? -18.552 47.200 -9.583  1.00 83.73  ? 183 ALA A CA  1 
ATOM   1344 C C   . ALA A 1 183 ? -17.338 48.122 -9.595  1.00 87.64  ? 183 ALA A C   1 
ATOM   1345 O O   . ALA A 1 183 ? -16.622 48.204 -8.601  1.00 85.20  ? 183 ALA A O   1 
ATOM   1346 C CB  . ALA A 1 183 ? -18.181 45.847 -10.168 1.00 83.70  ? 183 ALA A CB  1 
ATOM   1347 N N   . LYS A 1 184 ? -17.153 48.852 -10.709 1.00 86.85  ? 184 LYS A N   1 
ATOM   1348 C CA  . LYS A 1 184 ? -16.088 49.828 -10.942 1.00 87.58  ? 184 LYS A CA  1 
ATOM   1349 C C   . LYS A 1 184 ? -16.320 51.136 -10.149 1.00 92.87  ? 184 LYS A C   1 
ATOM   1350 O O   . LYS A 1 184 ? -15.365 51.884 -9.921  1.00 92.36  ? 184 LYS A O   1 
ATOM   1351 C CB  . LYS A 1 184 ? -15.951 50.114 -12.450 1.00 92.79  ? 184 LYS A CB  1 
ATOM   1352 C CG  . LYS A 1 184 ? -15.677 48.869 -13.297 1.00 107.75 ? 184 LYS A CG  1 
ATOM   1353 C CD  . LYS A 1 184 ? -15.787 49.161 -14.789 1.00 123.64 ? 184 LYS A CD  1 
ATOM   1354 C CE  . LYS A 1 184 ? -15.757 47.908 -15.636 1.00 134.15 ? 184 LYS A CE  1 
ATOM   1355 N NZ  . LYS A 1 184 ? -17.070 47.206 -15.650 1.00 139.89 ? 184 LYS A NZ  1 
ATOM   1356 N N   . ASN A 1 185 ? -17.581 51.412 -9.742  1.00 91.04  ? 185 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 185 ? -17.952 52.598 -8.961  1.00 92.03  ? 185 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 185 ? -18.023 52.239 -7.460  1.00 94.56  ? 185 ASN A C   1 
ATOM   1359 O O   . ASN A 1 185 ? -18.944 51.528 -7.045  1.00 93.79  ? 185 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 185 ? -19.277 53.206 -9.462  1.00 97.04  ? 185 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 185 ? -19.699 54.506 -8.791  1.00 122.35 ? 185 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 185 ? -19.013 55.067 -7.921  1.00 116.80 ? 185 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 185 ? -20.846 55.027 -9.203  1.00 114.21 ? 185 ASN A ND2 1 
ATOM   1364 N N   . PRO A 1 186 ? -17.060 52.727 -6.637  1.00 90.27  ? 186 PRO A N   1 
ATOM   1365 C CA  . PRO A 1 186 ? -17.049 52.358 -5.205  1.00 87.58  ? 186 PRO A CA  1 
ATOM   1366 C C   . PRO A 1 186 ? -18.325 52.639 -4.406  1.00 91.03  ? 186 PRO A C   1 
ATOM   1367 O O   . PRO A 1 186 ? -18.758 51.779 -3.632  1.00 88.35  ? 186 PRO A O   1 
ATOM   1368 C CB  . PRO A 1 186 ? -15.827 53.098 -4.647  1.00 88.70  ? 186 PRO A CB  1 
ATOM   1369 C CG  . PRO A 1 186 ? -15.471 54.127 -5.681  1.00 95.59  ? 186 PRO A CG  1 
ATOM   1370 C CD  . PRO A 1 186 ? -15.888 53.556 -6.988  1.00 92.63  ? 186 PRO A CD  1 
ATOM   1371 N N   . GLN A 1 187 ? -18.948 53.814 -4.622  1.00 89.74  ? 187 GLN A N   1 
ATOM   1372 C CA  . GLN A 1 187 ? -20.170 54.209 -3.913  1.00 89.73  ? 187 GLN A CA  1 
ATOM   1373 C C   . GLN A 1 187 ? -21.470 53.470 -4.290  1.00 92.72  ? 187 GLN A C   1 
ATOM   1374 O O   . GLN A 1 187 ? -22.491 53.701 -3.638  1.00 93.20  ? 187 GLN A O   1 
ATOM   1375 C CB  . GLN A 1 187 ? -20.349 55.736 -3.862  1.00 93.24  ? 187 GLN A CB  1 
ATOM   1376 C CG  . GLN A 1 187 ? -20.434 56.412 -5.219  1.00 116.36 ? 187 GLN A CG  1 
ATOM   1377 C CD  . GLN A 1 187 ? -19.309 57.398 -5.392  1.00 138.38 ? 187 GLN A CD  1 
ATOM   1378 O OE1 . GLN A 1 187 ? -18.169 57.033 -5.696  1.00 132.77 ? 187 GLN A OE1 1 
ATOM   1379 N NE2 . GLN A 1 187 ? -19.599 58.674 -5.188  1.00 133.19 ? 187 GLN A NE2 1 
ATOM   1380 N N   . LYS A 1 188 ? -21.440 52.574 -5.303  1.00 87.44  ? 188 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 188 ? -22.634 51.807 -5.694  1.00 87.04  ? 188 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 188 ? -22.926 50.636 -4.743  1.00 86.45  ? 188 LYS A C   1 
ATOM   1383 O O   . LYS A 1 188 ? -24.074 50.170 -4.676  1.00 86.43  ? 188 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 188 ? -22.566 51.346 -7.157  1.00 90.85  ? 188 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 188 ? -22.860 52.449 -8.175  1.00 107.58 ? 188 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 188 ? -24.355 52.633 -8.455  1.00 118.30 ? 188 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 188 ? -24.589 53.597 -9.591  1.00 131.83 ? 188 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 188 ? -26.019 53.641 -9.998  1.00 141.84 ? 188 LYS A NZ  1 
ATOM   1389 N N   . ASN A 1 189 ? -21.879 50.180 -3.998  1.00 78.53  ? 189 ASN A N   1 
ATOM   1390 C CA  . ASN A 1 189 ? -21.897 49.121 -2.973  1.00 74.46  ? 189 ASN A CA  1 
ATOM   1391 C C   . ASN A 1 189 ? -22.320 47.709 -3.436  1.00 73.30  ? 189 ASN A C   1 
ATOM   1392 O O   . ASN A 1 189 ? -23.158 47.066 -2.803  1.00 69.55  ? 189 ASN A O   1 
ATOM   1393 C CB  . ASN A 1 189 ? -22.638 49.598 -1.705  1.00 76.86  ? 189 ASN A CB  1 
ATOM   1394 C CG  . ASN A 1 189 ? -22.113 49.038 -0.414  1.00 104.03 ? 189 ASN A CG  1 
ATOM   1395 O OD1 . ASN A 1 189 ? -22.851 48.418 0.360   1.00 98.20  ? 189 ASN A OD1 1 
ATOM   1396 N ND2 . ASN A 1 189 ? -20.841 49.288 -0.123  1.00 96.62  ? 189 ASN A ND2 1 
ATOM   1397 N N   . THR A 1 190 ? -21.697 47.224 -4.530  1.00 70.45  ? 190 THR A N   1 
ATOM   1398 C CA  . THR A 1 190 ? -21.933 45.889 -5.109  1.00 69.80  ? 190 THR A CA  1 
ATOM   1399 C C   . THR A 1 190 ? -21.346 44.797 -4.199  1.00 70.26  ? 190 THR A C   1 
ATOM   1400 O O   . THR A 1 190 ? -20.417 45.107 -3.447  1.00 68.54  ? 190 THR A O   1 
ATOM   1401 C CB  . THR A 1 190 ? -21.329 45.786 -6.525  1.00 81.14  ? 190 THR A CB  1 
ATOM   1402 O OG1 . THR A 1 190 ? -19.954 46.162 -6.499  1.00 82.91  ? 190 THR A OG1 1 
ATOM   1403 C CG2 . THR A 1 190 ? -22.089 46.601 -7.550  1.00 82.46  ? 190 THR A CG2 1 
ATOM   1404 N N   . PRO A 1 191 ? -21.827 43.521 -4.249  1.00 65.35  ? 191 PRO A N   1 
ATOM   1405 C CA  . PRO A 1 191 ? -21.272 42.490 -3.348  1.00 62.11  ? 191 PRO A CA  1 
ATOM   1406 C C   . PRO A 1 191 ? -19.771 42.242 -3.476  1.00 64.06  ? 191 PRO A C   1 
ATOM   1407 O O   . PRO A 1 191 ? -19.218 42.190 -4.581  1.00 65.29  ? 191 PRO A O   1 
ATOM   1408 C CB  . PRO A 1 191 ? -22.098 41.242 -3.665  1.00 63.63  ? 191 PRO A CB  1 
ATOM   1409 C CG  . PRO A 1 191 ? -23.364 41.772 -4.222  1.00 70.74  ? 191 PRO A CG  1 
ATOM   1410 C CD  . PRO A 1 191 ? -22.940 42.965 -5.041  1.00 68.22  ? 191 PRO A CD  1 
ATOM   1411 N N   . LYS A 1 192 ? -19.106 42.146 -2.320  1.00 56.87  ? 192 LYS A N   1 
ATOM   1412 C CA  . LYS A 1 192 ? -17.665 41.927 -2.250  1.00 54.30  ? 192 LYS A CA  1 
ATOM   1413 C C   . LYS A 1 192 ? -17.311 40.471 -2.572  1.00 56.13  ? 192 LYS A C   1 
ATOM   1414 O O   . LYS A 1 192 ? -16.340 40.223 -3.290  1.00 56.23  ? 192 LYS A O   1 
ATOM   1415 C CB  . LYS A 1 192 ? -17.124 42.352 -0.876  1.00 53.88  ? 192 LYS A CB  1 
ATOM   1416 C CG  . LYS A 1 192 ? -17.221 43.855 -0.587  1.00 52.16  ? 192 LYS A CG  1 
ATOM   1417 C CD  . LYS A 1 192 ? -16.081 44.668 -1.224  1.00 54.07  ? 192 LYS A CD  1 
ATOM   1418 C CE  . LYS A 1 192 ? -15.826 45.970 -0.506  1.00 63.83  ? 192 LYS A CE  1 
ATOM   1419 N NZ  . LYS A 1 192 ? -15.052 45.766 0.752   1.00 74.91  ? 192 LYS A NZ  1 
ATOM   1420 N N   . PHE A 1 193 ? -18.107 39.513 -2.061  1.00 50.00  ? 193 PHE A N   1 
ATOM   1421 C CA  . PHE A 1 193 ? -17.880 38.091 -2.294  1.00 48.06  ? 193 PHE A CA  1 
ATOM   1422 C C   . PHE A 1 193 ? -19.134 37.265 -2.132  1.00 50.86  ? 193 PHE A C   1 
ATOM   1423 O O   . PHE A 1 193 ? -20.141 37.744 -1.601  1.00 50.26  ? 193 PHE A O   1 
ATOM   1424 C CB  . PHE A 1 193 ? -16.792 37.539 -1.346  1.00 47.73  ? 193 PHE A CB  1 
ATOM   1425 C CG  . PHE A 1 193 ? -17.137 37.500 0.130   1.00 48.07  ? 193 PHE A CG  1 
ATOM   1426 C CD1 . PHE A 1 193 ? -16.626 38.454 1.005   1.00 50.97  ? 193 PHE A CD1 1 
ATOM   1427 C CD2 . PHE A 1 193 ? -17.926 36.477 0.654   1.00 49.10  ? 193 PHE A CD2 1 
ATOM   1428 C CE1 . PHE A 1 193 ? -16.910 38.396 2.374   1.00 50.17  ? 193 PHE A CE1 1 
ATOM   1429 C CE2 . PHE A 1 193 ? -18.219 36.426 2.019   1.00 50.66  ? 193 PHE A CE2 1 
ATOM   1430 C CZ  . PHE A 1 193 ? -17.700 37.379 2.872   1.00 48.34  ? 193 PHE A CZ  1 
ATOM   1431 N N   . LEU A 1 194 ? -19.023 35.984 -2.535  1.00 46.61  ? 194 LEU A N   1 
ATOM   1432 C CA  . LEU A 1 194 ? -20.019 34.941 -2.362  1.00 45.94  ? 194 LEU A CA  1 
ATOM   1433 C C   . LEU A 1 194 ? -19.298 33.843 -1.584  1.00 47.50  ? 194 LEU A C   1 
ATOM   1434 O O   . LEU A 1 194 ? -18.216 33.396 -1.996  1.00 46.71  ? 194 LEU A O   1 
ATOM   1435 C CB  . LEU A 1 194 ? -20.560 34.407 -3.697  1.00 47.71  ? 194 LEU A CB  1 
ATOM   1436 C CG  . LEU A 1 194 ? -21.495 33.193 -3.571  1.00 52.75  ? 194 LEU A CG  1 
ATOM   1437 C CD1 . LEU A 1 194 ? -22.858 33.475 -4.155  1.00 54.08  ? 194 LEU A CD1 1 
ATOM   1438 C CD2 . LEU A 1 194 ? -20.879 31.963 -4.208  1.00 56.93  ? 194 LEU A CD2 1 
ATOM   1439 N N   . TYR A 1 195 ? -19.869 33.461 -0.431  1.00 42.19  ? 195 TYR A N   1 
ATOM   1440 C CA  . TYR A 1 195 ? -19.329 32.415 0.430   1.00 39.89  ? 195 TYR A CA  1 
ATOM   1441 C C   . TYR A 1 195 ? -20.157 31.143 0.228   1.00 46.29  ? 195 TYR A C   1 
ATOM   1442 O O   . TYR A 1 195 ? -21.390 31.198 0.285   1.00 46.37  ? 195 TYR A O   1 
ATOM   1443 C CB  . TYR A 1 195 ? -19.345 32.852 1.915   1.00 38.50  ? 195 TYR A CB  1 
ATOM   1444 C CG  . TYR A 1 195 ? -19.088 31.708 2.877   1.00 36.76  ? 195 TYR A CG  1 
ATOM   1445 C CD1 . TYR A 1 195 ? -17.792 31.326 3.207   1.00 37.03  ? 195 TYR A CD1 1 
ATOM   1446 C CD2 . TYR A 1 195 ? -20.144 30.974 3.417   1.00 36.51  ? 195 TYR A CD2 1 
ATOM   1447 C CE1 . TYR A 1 195 ? -17.554 30.253 4.060   1.00 36.02  ? 195 TYR A CE1 1 
ATOM   1448 C CE2 . TYR A 1 195 ? -19.916 29.886 4.257   1.00 35.27  ? 195 TYR A CE2 1 
ATOM   1449 C CZ  . TYR A 1 195 ? -18.621 29.525 4.573   1.00 40.11  ? 195 TYR A CZ  1 
ATOM   1450 O OH  . TYR A 1 195 ? -18.412 28.465 5.426   1.00 38.51  ? 195 TYR A OH  1 
ATOM   1451 N N   . THR A 1 196 ? -19.480 29.996 0.039   1.00 43.79  ? 196 THR A N   1 
ATOM   1452 C CA  . THR A 1 196 ? -20.159 28.710 -0.149  1.00 44.00  ? 196 THR A CA  1 
ATOM   1453 C C   . THR A 1 196 ? -19.330 27.506 0.269   1.00 46.16  ? 196 THR A C   1 
ATOM   1454 O O   . THR A 1 196 ? -18.109 27.493 0.084   1.00 44.63  ? 196 THR A O   1 
ATOM   1455 C CB  . THR A 1 196 ? -20.740 28.564 -1.583  1.00 54.00  ? 196 THR A CB  1 
ATOM   1456 O OG1 . THR A 1 196 ? -21.586 27.410 -1.641  1.00 55.48  ? 196 THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 196 ? -19.668 28.526 -2.680  1.00 49.11  ? 196 THR A CG2 1 
ATOM   1458 N N   . VAL A 1 197 ? -20.020 26.494 0.830   1.00 42.77  ? 197 VAL A N   1 
ATOM   1459 C CA  . VAL A 1 197 ? -19.450 25.195 1.202   1.00 42.01  ? 197 VAL A CA  1 
ATOM   1460 C C   . VAL A 1 197 ? -19.938 24.313 0.053   1.00 46.57  ? 197 VAL A C   1 
ATOM   1461 O O   . VAL A 1 197 ? -21.129 23.981 0.028   1.00 46.42  ? 197 VAL A O   1 
ATOM   1462 C CB  . VAL A 1 197 ? -19.909 24.683 2.601   1.00 44.68  ? 197 VAL A CB  1 
ATOM   1463 C CG1 . VAL A 1 197 ? -19.373 23.277 2.872   1.00 43.25  ? 197 VAL A CG1 1 
ATOM   1464 C CG2 . VAL A 1 197 ? -19.484 25.650 3.709   1.00 43.49  ? 197 VAL A CG2 1 
ATOM   1465 N N   . PRO A 1 198 ? -19.095 24.050 -0.977  1.00 43.27  ? 198 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 198 ? -19.602 23.362 -2.180  1.00 44.73  ? 198 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 198 ? -19.989 21.904 -2.044  1.00 48.59  ? 198 PRO A C   1 
ATOM   1468 O O   . PRO A 1 198 ? -20.852 21.445 -2.789  1.00 50.17  ? 198 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 198 ? -18.498 23.577 -3.226  1.00 47.17  ? 198 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 198 ? -17.608 24.636 -2.645  1.00 50.67  ? 198 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 198 ? -17.689 24.452 -1.160  1.00 44.33  ? 198 PRO A CD  1 
ATOM   1472 N N   . ASN A 1 199 ? -19.354 21.180 -1.117  1.00 42.86  ? 199 ASN A N   1 
ATOM   1473 C CA  . ASN A 1 199 ? -19.597 19.761 -0.890  1.00 41.73  ? 199 ASN A CA  1 
ATOM   1474 C C   . ASN A 1 199 ? -20.119 19.529 0.507   1.00 44.43  ? 199 ASN A C   1 
ATOM   1475 O O   . ASN A 1 199 ? -19.450 19.858 1.498   1.00 42.01  ? 199 ASN A O   1 
ATOM   1476 C CB  . ASN A 1 199 ? -18.318 18.939 -1.122  1.00 39.67  ? 199 ASN A CB  1 
ATOM   1477 C CG  . ASN A 1 199 ? -17.782 19.014 -2.522  1.00 54.13  ? 199 ASN A CG  1 
ATOM   1478 O OD1 . ASN A 1 199 ? -18.333 18.423 -3.463  1.00 56.30  ? 199 ASN A OD1 1 
ATOM   1479 N ND2 . ASN A 1 199 ? -16.680 19.726 -2.683  1.00 35.89  ? 199 ASN A ND2 1 
ATOM   1480 N N   . GLY A 1 200 ? -21.308 18.940 0.557   1.00 43.18  ? 200 GLY A N   1 
ATOM   1481 C CA  . GLY A 1 200 ? -21.995 18.565 1.783   1.00 42.96  ? 200 GLY A CA  1 
ATOM   1482 C C   . GLY A 1 200 ? -22.100 19.695 2.779   1.00 47.02  ? 200 GLY A C   1 
ATOM   1483 O O   . GLY A 1 200 ? -21.582 19.590 3.894   1.00 46.16  ? 200 GLY A O   1 
ATOM   1484 N N   . ASN A 1 201 ? -22.758 20.785 2.367   1.00 43.79  ? 201 ASN A N   1 
ATOM   1485 C CA  . ASN A 1 201 ? -22.974 21.981 3.170   1.00 42.91  ? 201 ASN A CA  1 
ATOM   1486 C C   . ASN A 1 201 ? -23.435 21.674 4.606   1.00 45.78  ? 201 ASN A C   1 
ATOM   1487 O O   . ASN A 1 201 ? -24.311 20.824 4.817   1.00 46.44  ? 201 ASN A O   1 
ATOM   1488 C CB  . ASN A 1 201 ? -23.993 22.884 2.475   1.00 43.77  ? 201 ASN A CB  1 
ATOM   1489 C CG  . ASN A 1 201 ? -24.409 24.073 3.299   1.00 56.79  ? 201 ASN A CG  1 
ATOM   1490 O OD1 . ASN A 1 201 ? -23.618 24.991 3.551   1.00 57.04  ? 201 ASN A OD1 1 
ATOM   1491 N ND2 . ASN A 1 201 ? -25.647 24.053 3.773   1.00 39.67  ? 201 ASN A ND2 1 
ATOM   1492 N N   . ASN A 1 202 ? -22.833 22.368 5.587   1.00 39.74  ? 202 ASN A N   1 
ATOM   1493 C CA  . ASN A 1 202 ? -23.234 22.254 6.981   1.00 38.84  ? 202 ASN A CA  1 
ATOM   1494 C C   . ASN A 1 202 ? -24.371 23.284 7.135   1.00 44.78  ? 202 ASN A C   1 
ATOM   1495 O O   . ASN A 1 202 ? -24.129 24.468 6.847   1.00 45.81  ? 202 ASN A O   1 
ATOM   1496 C CB  . ASN A 1 202 ? -22.058 22.602 7.890   1.00 38.52  ? 202 ASN A CB  1 
ATOM   1497 C CG  . ASN A 1 202 ? -22.267 22.346 9.368   1.00 43.52  ? 202 ASN A CG  1 
ATOM   1498 O OD1 . ASN A 1 202 ? -23.394 22.195 9.861   1.00 29.47  ? 202 ASN A OD1 1 
ATOM   1499 N ND2 . ASN A 1 202 ? -21.167 22.317 10.113  1.00 30.29  ? 202 ASN A ND2 1 
ATOM   1500 N N   . PRO A 1 203 ? -25.639 22.892 7.432   1.00 40.10  ? 203 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 203 ? -26.155 21.577 7.872   1.00 39.14  ? 203 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 203 ? -26.868 20.640 6.867   1.00 40.40  ? 203 PRO A C   1 
ATOM   1503 O O   . PRO A 1 203 ? -27.264 19.537 7.258   1.00 38.40  ? 203 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 203 ? -27.184 21.996 8.927   1.00 41.39  ? 203 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 203 ? -27.815 23.231 8.318   1.00 47.01  ? 203 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 203 ? -26.685 23.929 7.567   1.00 42.38  ? 203 PRO A CD  1 
ATOM   1507 N N   . THR A 1 204 ? -27.110 21.089 5.626   1.00 36.87  ? 204 THR A N   1 
ATOM   1508 C CA  . THR A 1 204 ? -27.903 20.368 4.607   1.00 36.80  ? 204 THR A CA  1 
ATOM   1509 C C   . THR A 1 204 ? -27.357 19.033 4.075   1.00 39.32  ? 204 THR A C   1 
ATOM   1510 O O   . THR A 1 204 ? -28.131 18.109 3.787   1.00 38.57  ? 204 THR A O   1 
ATOM   1511 C CB  . THR A 1 204 ? -28.268 21.300 3.449   1.00 44.25  ? 204 THR A CB  1 
ATOM   1512 O OG1 . THR A 1 204 ? -27.092 21.596 2.687   1.00 46.87  ? 204 THR A OG1 1 
ATOM   1513 C CG2 . THR A 1 204 ? -28.905 22.576 3.917   1.00 42.82  ? 204 THR A CG2 1 
ATOM   1514 N N   . GLY A 1 205 ? -26.047 18.968 3.882   1.00 34.88  ? 205 GLY A N   1 
ATOM   1515 C CA  . GLY A 1 205 ? -25.400 17.808 3.289   1.00 34.48  ? 205 GLY A CA  1 
ATOM   1516 C C   . GLY A 1 205 ? -25.524 17.828 1.777   1.00 38.90  ? 205 GLY A C   1 
ATOM   1517 O O   . GLY A 1 205 ? -25.125 16.866 1.112   1.00 40.44  ? 205 GLY A O   1 
ATOM   1518 N N   . ASN A 1 206 ? -26.056 18.946 1.220   1.00 34.03  ? 206 ASN A N   1 
ATOM   1519 C CA  . ASN A 1 206 ? -26.251 19.125 -0.217  1.00 35.14  ? 206 ASN A CA  1 
ATOM   1520 C C   . ASN A 1 206 ? -24.981 19.640 -0.901  1.00 39.65  ? 206 ASN A C   1 
ATOM   1521 O O   . ASN A 1 206 ? -24.219 20.424 -0.301  1.00 37.13  ? 206 ASN A O   1 
ATOM   1522 C CB  . ASN A 1 206 ? -27.477 20.007 -0.515  1.00 34.58  ? 206 ASN A CB  1 
ATOM   1523 C CG  . ASN A 1 206 ? -28.803 19.428 -0.054  1.00 56.32  ? 206 ASN A CG  1 
ATOM   1524 O OD1 . ASN A 1 206 ? -29.700 20.150 0.394   1.00 55.47  ? 206 ASN A OD1 1 
ATOM   1525 N ND2 . ASN A 1 206 ? -28.970 18.116 -0.151  1.00 45.21  ? 206 ASN A ND2 1 
ATOM   1526 N N   . SER A 1 207 ? -24.754 19.182 -2.157  1.00 38.24  ? 207 SER A N   1 
ATOM   1527 C CA  . SER A 1 207 ? -23.572 19.526 -2.942  1.00 39.16  ? 207 SER A CA  1 
ATOM   1528 C C   . SER A 1 207 ? -23.870 20.143 -4.292  1.00 48.01  ? 207 SER A C   1 
ATOM   1529 O O   . SER A 1 207 ? -24.807 19.716 -4.973  1.00 51.14  ? 207 SER A O   1 
ATOM   1530 C CB  . SER A 1 207 ? -22.682 18.303 -3.131  1.00 41.88  ? 207 SER A CB  1 
ATOM   1531 O OG  . SER A 1 207 ? -22.180 17.840 -1.891  1.00 50.17  ? 207 SER A OG  1 
ATOM   1532 N N   . LEU A 1 208 ? -23.034 21.119 -4.699  1.00 44.50  ? 208 LEU A N   1 
ATOM   1533 C CA  . LEU A 1 208 ? -23.129 21.819 -5.982  1.00 46.20  ? 208 LEU A CA  1 
ATOM   1534 C C   . LEU A 1 208 ? -22.676 20.918 -7.129  1.00 53.48  ? 208 LEU A C   1 
ATOM   1535 O O   . LEU A 1 208 ? -21.809 20.058 -6.939  1.00 52.40  ? 208 LEU A O   1 
ATOM   1536 C CB  . LEU A 1 208 ? -22.265 23.102 -5.978  1.00 45.66  ? 208 LEU A CB  1 
ATOM   1537 C CG  . LEU A 1 208 ? -22.940 24.415 -5.577  1.00 50.09  ? 208 LEU A CG  1 
ATOM   1538 C CD1 . LEU A 1 208 ? -21.917 25.470 -5.278  1.00 49.51  ? 208 LEU A CD1 1 
ATOM   1539 C CD2 . LEU A 1 208 ? -23.874 24.908 -6.649  1.00 55.07  ? 208 LEU A CD2 1 
ATOM   1540 N N   . THR A 1 209 ? -23.240 21.148 -8.329  1.00 53.01  ? 209 THR A N   1 
ATOM   1541 C CA  . THR A 1 209 ? -22.912 20.401 -9.545  1.00 54.11  ? 209 THR A CA  1 
ATOM   1542 C C   . THR A 1 209 ? -21.912 21.190 -10.393 1.00 59.48  ? 209 THR A C   1 
ATOM   1543 O O   . THR A 1 209 ? -21.746 22.400 -10.178 1.00 58.98  ? 209 THR A O   1 
ATOM   1544 C CB  . THR A 1 209 ? -24.192 20.062 -10.316 1.00 62.22  ? 209 THR A CB  1 
ATOM   1545 O OG1 . THR A 1 209 ? -24.863 21.275 -10.656 1.00 64.70  ? 209 THR A OG1 1 
ATOM   1546 C CG2 . THR A 1 209 ? -25.130 19.161 -9.527  1.00 59.33  ? 209 THR A CG2 1 
ATOM   1547 N N   . SER A 1 210 ? -21.257 20.512 -11.367 1.00 57.29  ? 210 SER A N   1 
ATOM   1548 C CA  . SER A 1 210 ? -20.268 21.121 -12.277 1.00 58.08  ? 210 SER A CA  1 
ATOM   1549 C C   . SER A 1 210 ? -20.856 22.304 -13.045 1.00 62.55  ? 210 SER A C   1 
ATOM   1550 O O   . SER A 1 210 ? -20.252 23.374 -13.083 1.00 61.51  ? 210 SER A O   1 
ATOM   1551 C CB  . SER A 1 210 ? -19.725 20.087 -13.265 1.00 63.92  ? 210 SER A CB  1 
ATOM   1552 O OG  . SER A 1 210 ? -19.248 18.913 -12.625 1.00 75.71  ? 210 SER A OG  1 
ATOM   1553 N N   . GLU A 1 211 ? -22.053 22.094 -13.628 1.00 60.63  ? 211 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 211 ? -22.820 23.037 -14.445 1.00 62.30  ? 211 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 211 ? -23.182 24.292 -13.653 1.00 63.53  ? 211 GLU A C   1 
ATOM   1556 O O   . GLU A 1 211 ? -22.980 25.407 -14.151 1.00 63.93  ? 211 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 211 ? -24.076 22.362 -15.037 1.00 65.59  ? 211 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 211 ? -23.883 20.912 -15.483 1.00 82.58  ? 211 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 211 ? -23.916 19.867 -14.376 1.00 114.00 ? 211 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 211 ? -22.839 19.315 -14.053 1.00 108.80 ? 211 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 211 ? -25.008 19.623 -13.809 1.00 113.06 ? 211 GLU A OE2 1 
ATOM   1562 N N   . ARG A 1 212 ? -23.657 24.106 -12.405 1.00 57.00  ? 212 ARG A N   1 
ATOM   1563 C CA  . ARG A 1 212 ? -24.016 25.191 -11.486 1.00 55.74  ? 212 ARG A CA  1 
ATOM   1564 C C   . ARG A 1 212 ? -22.795 26.054 -11.120 1.00 56.38  ? 212 ARG A C   1 
ATOM   1565 O O   . ARG A 1 212 ? -22.881 27.285 -11.196 1.00 55.95  ? 212 ARG A O   1 
ATOM   1566 C CB  . ARG A 1 212 ? -24.710 24.649 -10.226 1.00 54.98  ? 212 ARG A CB  1 
ATOM   1567 C CG  . ARG A 1 212 ? -26.168 24.299 -10.457 1.00 60.38  ? 212 ARG A CG  1 
ATOM   1568 C CD  . ARG A 1 212 ? -26.916 24.145 -9.166  1.00 63.88  ? 212 ARG A CD  1 
ATOM   1569 N NE  . ARG A 1 212 ? -28.337 23.892 -9.405  1.00 71.14  ? 212 ARG A NE  1 
ATOM   1570 C CZ  . ARG A 1 212 ? -29.268 23.867 -8.455  1.00 80.16  ? 212 ARG A CZ  1 
ATOM   1571 N NH1 . ARG A 1 212 ? -28.942 24.101 -7.189  1.00 65.04  ? 212 ARG A NH1 1 
ATOM   1572 N NH2 . ARG A 1 212 ? -30.533 23.613 -8.765  1.00 60.75  ? 212 ARG A NH2 1 
ATOM   1573 N N   . LYS A 1 213 ? -21.652 25.410 -10.790 1.00 49.51  ? 213 LYS A N   1 
ATOM   1574 C CA  . LYS A 1 213 ? -20.392 26.093 -10.469 1.00 46.96  ? 213 LYS A CA  1 
ATOM   1575 C C   . LYS A 1 213 ? -19.940 26.978 -11.637 1.00 52.57  ? 213 LYS A C   1 
ATOM   1576 O O   . LYS A 1 213 ? -19.657 28.155 -11.419 1.00 52.03  ? 213 LYS A O   1 
ATOM   1577 C CB  . LYS A 1 213 ? -19.298 25.090 -10.075 1.00 46.62  ? 213 LYS A CB  1 
ATOM   1578 C CG  . LYS A 1 213 ? -19.472 24.495 -8.686  1.00 45.96  ? 213 LYS A CG  1 
ATOM   1579 C CD  . LYS A 1 213 ? -18.431 23.424 -8.401  1.00 45.52  ? 213 LYS A CD  1 
ATOM   1580 C CE  . LYS A 1 213 ? -18.545 22.863 -7.008  1.00 46.08  ? 213 LYS A CE  1 
ATOM   1581 N NZ  . LYS A 1 213 ? -17.625 21.717 -6.793  1.00 50.64  ? 213 LYS A NZ  1 
ATOM   1582 N N   . LYS A 1 214 ? -19.944 26.430 -12.878 1.00 52.08  ? 214 LYS A N   1 
ATOM   1583 C CA  . LYS A 1 214 ? -19.611 27.140 -14.124 1.00 54.48  ? 214 LYS A CA  1 
ATOM   1584 C C   . LYS A 1 214 ? -20.447 28.431 -14.208 1.00 60.68  ? 214 LYS A C   1 
ATOM   1585 O O   . LYS A 1 214 ? -19.876 29.516 -14.327 1.00 59.38  ? 214 LYS A O   1 
ATOM   1586 C CB  . LYS A 1 214 ? -19.888 26.248 -15.349 1.00 58.89  ? 214 LYS A CB  1 
ATOM   1587 C CG  . LYS A 1 214 ? -18.852 25.156 -15.584 1.00 76.52  ? 214 LYS A CG  1 
ATOM   1588 C CD  . LYS A 1 214 ? -19.357 24.137 -16.604 1.00 91.17  ? 214 LYS A CD  1 
ATOM   1589 C CE  . LYS A 1 214 ? -18.355 23.045 -16.889 1.00 105.44 ? 214 LYS A CE  1 
ATOM   1590 N NZ  . LYS A 1 214 ? -18.829 22.135 -17.965 1.00 118.38 ? 214 LYS A NZ  1 
ATOM   1591 N N   . GLU A 1 215 ? -21.798 28.299 -14.060 1.00 59.72  ? 215 GLU A N   1 
ATOM   1592 C CA  . GLU A 1 215 ? -22.793 29.380 -14.049 1.00 61.25  ? 215 GLU A CA  1 
ATOM   1593 C C   . GLU A 1 215 ? -22.509 30.408 -12.951 1.00 65.38  ? 215 GLU A C   1 
ATOM   1594 O O   . GLU A 1 215 ? -22.632 31.604 -13.211 1.00 65.52  ? 215 GLU A O   1 
ATOM   1595 C CB  . GLU A 1 215 ? -24.206 28.814 -13.844 1.00 63.13  ? 215 GLU A CB  1 
ATOM   1596 C CG  . GLU A 1 215 ? -24.939 28.422 -15.109 1.00 78.73  ? 215 GLU A CG  1 
ATOM   1597 C CD  . GLU A 1 215 ? -26.387 28.068 -14.833 1.00 105.27 ? 215 GLU A CD  1 
ATOM   1598 O OE1 . GLU A 1 215 ? -26.681 26.864 -14.656 1.00 94.67  ? 215 GLU A OE1 1 
ATOM   1599 O OE2 . GLU A 1 215 ? -27.217 29.002 -14.736 1.00 108.19 ? 215 GLU A OE2 1 
ATOM   1600 N N   . ILE A 1 216 ? -22.157 29.943 -11.720 1.00 61.59  ? 216 ILE A N   1 
ATOM   1601 C CA  . ILE A 1 216 ? -21.831 30.817 -10.589 1.00 60.39  ? 216 ILE A CA  1 
ATOM   1602 C C   . ILE A 1 216 ? -20.576 31.627 -10.935 1.00 64.18  ? 216 ILE A C   1 
ATOM   1603 O O   . ILE A 1 216 ? -20.627 32.857 -10.842 1.00 64.70  ? 216 ILE A O   1 
ATOM   1604 C CB  . ILE A 1 216 ? -21.750 30.060 -9.230  1.00 61.76  ? 216 ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 216 ? -23.124 29.483 -8.840  1.00 62.59  ? 216 ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 216 ? -21.217 30.965 -8.097  1.00 61.72  ? 216 ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 216 ? -23.038 28.192 -8.077  1.00 69.30  ? 216 ILE A CD1 1 
ATOM   1608 N N   . TYR A 1 217 ? -19.495 30.955 -11.416 1.00 60.21  ? 217 TYR A N   1 
ATOM   1609 C CA  . TYR A 1 217 ? -18.251 31.624 -11.839 1.00 60.39  ? 217 TYR A CA  1 
ATOM   1610 C C   . TYR A 1 217 ? -18.509 32.719 -12.884 1.00 65.71  ? 217 TYR A C   1 
ATOM   1611 O O   . TYR A 1 217 ? -17.930 33.797 -12.772 1.00 64.37  ? 217 TYR A O   1 
ATOM   1612 C CB  . TYR A 1 217 ? -17.191 30.621 -12.357 1.00 61.88  ? 217 TYR A CB  1 
ATOM   1613 C CG  . TYR A 1 217 ? -15.791 31.193 -12.376 1.00 64.25  ? 217 TYR A CG  1 
ATOM   1614 C CD1 . TYR A 1 217 ? -14.974 31.127 -11.249 1.00 64.39  ? 217 TYR A CD1 1 
ATOM   1615 C CD2 . TYR A 1 217 ? -15.295 31.839 -13.504 1.00 66.92  ? 217 TYR A CD2 1 
ATOM   1616 C CE1 . TYR A 1 217 ? -13.698 31.688 -11.246 1.00 65.10  ? 217 TYR A CE1 1 
ATOM   1617 C CE2 . TYR A 1 217 ? -14.024 32.407 -13.512 1.00 67.61  ? 217 TYR A CE2 1 
ATOM   1618 C CZ  . TYR A 1 217 ? -13.228 32.327 -12.380 1.00 74.25  ? 217 TYR A CZ  1 
ATOM   1619 O OH  . TYR A 1 217 ? -11.970 32.878 -12.375 1.00 77.29  ? 217 TYR A OH  1 
ATOM   1620 N N   . GLU A 1 218 ? -19.391 32.453 -13.882 1.00 64.82  ? 218 GLU A N   1 
ATOM   1621 C CA  . GLU A 1 218 ? -19.719 33.414 -14.941 1.00 66.74  ? 218 GLU A CA  1 
ATOM   1622 C C   . GLU A 1 218 ? -20.316 34.715 -14.370 1.00 69.49  ? 218 GLU A C   1 
ATOM   1623 O O   . GLU A 1 218 ? -19.978 35.799 -14.852 1.00 70.43  ? 218 GLU A O   1 
ATOM   1624 C CB  . GLU A 1 218 ? -20.547 32.760 -16.073 1.00 70.55  ? 218 GLU A CB  1 
ATOM   1625 C CG  . GLU A 1 218 ? -22.029 33.126 -16.126 1.00 87.74  ? 218 GLU A CG  1 
ATOM   1626 C CD  . GLU A 1 218 ? -23.060 32.043 -16.413 1.00 112.39 ? 218 GLU A CD  1 
ATOM   1627 O OE1 . GLU A 1 218 ? -24.191 32.170 -15.889 1.00 103.78 ? 218 GLU A OE1 1 
ATOM   1628 O OE2 . GLU A 1 218 ? -22.758 31.090 -17.170 1.00 108.32 ? 218 GLU A OE2 1 
ATOM   1629 N N   . LEU A 1 219 ? -21.119 34.601 -13.287 1.00 64.35  ? 219 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 219 ? -21.736 35.740 -12.595 1.00 64.15  ? 219 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 219 ? -20.732 36.551 -11.768 1.00 66.50  ? 219 LEU A C   1 
ATOM   1632 O O   . LEU A 1 219 ? -20.816 37.785 -11.749 1.00 66.18  ? 219 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 219 ? -22.949 35.307 -11.764 1.00 63.28  ? 219 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 219 ? -24.204 35.010 -12.601 1.00 69.90  ? 219 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 219 ? -25.048 33.928 -11.959 1.00 69.14  ? 219 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 219 ? -25.028 36.275 -12.859 1.00 72.05  ? 219 LEU A CD2 1 
ATOM   1637 N N   . ALA A 1 220 ? -19.746 35.860 -11.147 1.00 61.20  ? 220 ALA A N   1 
ATOM   1638 C CA  . ALA A 1 220 ? -18.650 36.445 -10.364 1.00 58.96  ? 220 ALA A CA  1 
ATOM   1639 C C   . ALA A 1 220 ? -17.709 37.306 -11.225 1.00 63.03  ? 220 ALA A C   1 
ATOM   1640 O O   . ALA A 1 220 ? -17.124 38.250 -10.698 1.00 61.99  ? 220 ALA A O   1 
ATOM   1641 C CB  . ALA A 1 220 ? -17.866 35.353 -9.653  1.00 57.44  ? 220 ALA A CB  1 
ATOM   1642 N N   . ARG A 1 221 ? -17.559 36.983 -12.538 1.00 60.51  ? 221 ARG A N   1 
ATOM   1643 C CA  . ARG A 1 221 ? -16.751 37.770 -13.481 1.00 61.46  ? 221 ARG A CA  1 
ATOM   1644 C C   . ARG A 1 221 ? -17.540 39.034 -13.779 1.00 67.09  ? 221 ARG A C   1 
ATOM   1645 O O   . ARG A 1 221 ? -17.027 40.137 -13.578 1.00 66.75  ? 221 ARG A O   1 
ATOM   1646 C CB  . ARG A 1 221 ? -16.543 37.035 -14.823 1.00 62.22  ? 221 ARG A CB  1 
ATOM   1647 C CG  . ARG A 1 221 ? -15.759 35.732 -14.792 1.00 66.91  ? 221 ARG A CG  1 
ATOM   1648 C CD  . ARG A 1 221 ? -15.778 35.050 -16.161 1.00 65.38  ? 221 ARG A CD  1 
ATOM   1649 N NE  . ARG A 1 221 ? -15.061 35.798 -17.193 1.00 65.42  ? 221 ARG A NE  1 
ATOM   1650 C CZ  . ARG A 1 221 ? -13.842 35.496 -17.633 1.00 84.90  ? 221 ARG A CZ  1 
ATOM   1651 N NH1 . ARG A 1 221 ? -13.190 34.448 -17.143 1.00 72.62  ? 221 ARG A NH1 1 
ATOM   1652 N NH2 . ARG A 1 221 ? -13.269 36.234 -18.575 1.00 79.80  ? 221 ARG A NH2 1 
ATOM   1653 N N   . LYS A 1 222 ? -18.806 38.845 -14.262 1.00 64.84  ? 222 LYS A N   1 
ATOM   1654 C CA  . LYS A 1 222 ? -19.783 39.867 -14.661 1.00 66.68  ? 222 LYS A CA  1 
ATOM   1655 C C   . LYS A 1 222 ? -19.943 40.988 -13.628 1.00 70.10  ? 222 LYS A C   1 
ATOM   1656 O O   . LYS A 1 222 ? -19.879 42.162 -13.995 1.00 70.57  ? 222 LYS A O   1 
ATOM   1657 C CB  . LYS A 1 222 ? -21.144 39.211 -14.977 1.00 69.85  ? 222 LYS A CB  1 
ATOM   1658 C CG  . LYS A 1 222 ? -22.191 40.158 -15.564 1.00 82.41  ? 222 LYS A CG  1 
ATOM   1659 C CD  . LYS A 1 222 ? -23.391 39.404 -16.104 1.00 95.51  ? 222 LYS A CD  1 
ATOM   1660 C CE  . LYS A 1 222 ? -24.396 40.330 -16.743 1.00 117.15 ? 222 LYS A CE  1 
ATOM   1661 N NZ  . LYS A 1 222 ? -25.470 39.582 -17.457 1.00 129.97 ? 222 LYS A NZ  1 
ATOM   1662 N N   . TYR A 1 223 ? -20.122 40.617 -12.341 1.00 64.53  ? 223 TYR A N   1 
ATOM   1663 C CA  . TYR A 1 223 ? -20.320 41.557 -11.244 1.00 62.86  ? 223 TYR A CA  1 
ATOM   1664 C C   . TYR A 1 223 ? -19.069 41.752 -10.370 1.00 64.45  ? 223 TYR A C   1 
ATOM   1665 O O   . TYR A 1 223 ? -19.142 42.424 -9.333  1.00 63.08  ? 223 TYR A O   1 
ATOM   1666 C CB  . TYR A 1 223 ? -21.560 41.158 -10.426 1.00 62.90  ? 223 TYR A CB  1 
ATOM   1667 C CG  . TYR A 1 223 ? -22.856 41.285 -11.197 1.00 66.63  ? 223 TYR A CG  1 
ATOM   1668 C CD1 . TYR A 1 223 ? -23.585 42.473 -11.186 1.00 69.95  ? 223 TYR A CD1 1 
ATOM   1669 C CD2 . TYR A 1 223 ? -23.344 40.226 -11.958 1.00 68.41  ? 223 TYR A CD2 1 
ATOM   1670 C CE1 . TYR A 1 223 ? -24.773 42.600 -11.905 1.00 73.01  ? 223 TYR A CE1 1 
ATOM   1671 C CE2 . TYR A 1 223 ? -24.529 40.343 -12.686 1.00 71.69  ? 223 TYR A CE2 1 
ATOM   1672 C CZ  . TYR A 1 223 ? -25.241 41.531 -12.655 1.00 79.77  ? 223 TYR A CZ  1 
ATOM   1673 O OH  . TYR A 1 223 ? -26.412 41.647 -13.367 1.00 82.46  ? 223 TYR A OH  1 
ATOM   1674 N N   . ASP A 1 224 ? -17.915 41.207 -10.820 1.00 60.67  ? 224 ASP A N   1 
ATOM   1675 C CA  . ASP A 1 224 ? -16.611 41.291 -10.151 1.00 59.13  ? 224 ASP A CA  1 
ATOM   1676 C C   . ASP A 1 224 ? -16.648 41.066 -8.626  1.00 59.83  ? 224 ASP A C   1 
ATOM   1677 O O   . ASP A 1 224 ? -16.510 42.010 -7.843  1.00 59.69  ? 224 ASP A O   1 
ATOM   1678 C CB  . ASP A 1 224 ? -15.818 42.559 -10.567 1.00 62.64  ? 224 ASP A CB  1 
ATOM   1679 C CG  . ASP A 1 224 ? -14.387 42.654 -10.016 1.00 72.73  ? 224 ASP A CG  1 
ATOM   1680 O OD1 . ASP A 1 224 ? -13.636 41.657 -10.129 1.00 72.66  ? 224 ASP A OD1 1 
ATOM   1681 O OD2 . ASP A 1 224 ? -14.016 43.738 -9.490  1.00 75.95  ? 224 ASP A OD2 1 
ATOM   1682 N N   . PHE A 1 225 ? -16.887 39.822 -8.213  1.00 53.42  ? 225 PHE A N   1 
ATOM   1683 C CA  . PHE A 1 225 ? -16.870 39.476 -6.799  1.00 50.74  ? 225 PHE A CA  1 
ATOM   1684 C C   . PHE A 1 225 ? -16.097 38.198 -6.571  1.00 53.42  ? 225 PHE A C   1 
ATOM   1685 O O   . PHE A 1 225 ? -16.056 37.328 -7.445  1.00 53.32  ? 225 PHE A O   1 
ATOM   1686 C CB  . PHE A 1 225 ? -18.269 39.450 -6.156  1.00 52.26  ? 225 PHE A CB  1 
ATOM   1687 C CG  . PHE A 1 225 ? -19.300 38.538 -6.774  1.00 53.93  ? 225 PHE A CG  1 
ATOM   1688 C CD1 . PHE A 1 225 ? -19.358 37.189 -6.429  1.00 55.18  ? 225 PHE A CD1 1 
ATOM   1689 C CD2 . PHE A 1 225 ? -20.265 39.044 -7.635  1.00 56.45  ? 225 PHE A CD2 1 
ATOM   1690 C CE1 . PHE A 1 225 ? -20.320 36.352 -6.986  1.00 56.43  ? 225 PHE A CE1 1 
ATOM   1691 C CE2 . PHE A 1 225 ? -21.230 38.209 -8.185  1.00 59.91  ? 225 PHE A CE2 1 
ATOM   1692 C CZ  . PHE A 1 225 ? -21.259 36.872 -7.852  1.00 57.07  ? 225 PHE A CZ  1 
ATOM   1693 N N   . LEU A 1 226 ? -15.483 38.089 -5.392  1.00 48.79  ? 226 LEU A N   1 
ATOM   1694 C CA  . LEU A 1 226 ? -14.677 36.929 -5.015  1.00 46.98  ? 226 LEU A CA  1 
ATOM   1695 C C   . LEU A 1 226 ? -15.517 35.707 -4.616  1.00 47.28  ? 226 LEU A C   1 
ATOM   1696 O O   . LEU A 1 226 ? -16.668 35.853 -4.216  1.00 46.39  ? 226 LEU A O   1 
ATOM   1697 C CB  . LEU A 1 226 ? -13.660 37.304 -3.911  1.00 45.42  ? 226 LEU A CB  1 
ATOM   1698 C CG  . LEU A 1 226 ? -12.686 38.463 -4.232  1.00 50.75  ? 226 LEU A CG  1 
ATOM   1699 C CD1 . LEU A 1 226 ? -11.774 38.742 -3.061  1.00 50.06  ? 226 LEU A CD1 1 
ATOM   1700 C CD2 . LEU A 1 226 ? -11.828 38.171 -5.449  1.00 51.17  ? 226 LEU A CD2 1 
ATOM   1701 N N   . ILE A 1 227 ? -14.955 34.509 -4.762  1.00 41.48  ? 227 ILE A N   1 
ATOM   1702 C CA  . ILE A 1 227 ? -15.650 33.294 -4.352  1.00 40.70  ? 227 ILE A CA  1 
ATOM   1703 C C   . ILE A 1 227 ? -14.866 32.682 -3.210  1.00 42.85  ? 227 ILE A C   1 
ATOM   1704 O O   . ILE A 1 227 ? -13.671 32.382 -3.362  1.00 41.90  ? 227 ILE A O   1 
ATOM   1705 C CB  . ILE A 1 227 ? -15.928 32.281 -5.501  1.00 44.92  ? 227 ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 227 ? -16.896 32.874 -6.553  1.00 47.51  ? 227 ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 227 ? -16.493 30.955 -4.933  1.00 44.19  ? 227 ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 227 ? -17.056 32.036 -7.879  1.00 54.15  ? 227 ILE A CD1 1 
ATOM   1709 N N   . ILE A 1 228 ? -15.528 32.536 -2.052  1.00 38.34  ? 228 ILE A N   1 
ATOM   1710 C CA  . ILE A 1 228 ? -14.879 31.936 -0.889  1.00 36.77  ? 228 ILE A CA  1 
ATOM   1711 C C   . ILE A 1 228 ? -15.323 30.483 -0.782  1.00 42.44  ? 228 ILE A C   1 
ATOM   1712 O O   . ILE A 1 228 ? -16.442 30.190 -0.322  1.00 42.36  ? 228 ILE A O   1 
ATOM   1713 C CB  . ILE A 1 228 ? -14.998 32.765 0.422   1.00 37.68  ? 228 ILE A CB  1 
ATOM   1714 C CG1 . ILE A 1 228 ? -14.408 34.187 0.207   1.00 37.54  ? 228 ILE A CG1 1 
ATOM   1715 C CG2 . ILE A 1 228 ? -14.314 32.023 1.587   1.00 35.44  ? 228 ILE A CG2 1 
ATOM   1716 C CD1 . ILE A 1 228 ? -14.677 35.181 1.284   1.00 41.18  ? 228 ILE A CD1 1 
ATOM   1717 N N   . GLU A 1 229 ? -14.447 29.590 -1.297  1.00 38.24  ? 229 GLU A N   1 
ATOM   1718 C CA  . GLU A 1 229 ? -14.660 28.154 -1.335  1.00 37.51  ? 229 GLU A CA  1 
ATOM   1719 C C   . GLU A 1 229 ? -14.230 27.488 -0.032  1.00 40.09  ? 229 GLU A C   1 
ATOM   1720 O O   . GLU A 1 229 ? -13.067 27.089 0.095   1.00 38.18  ? 229 GLU A O   1 
ATOM   1721 C CB  . GLU A 1 229 ? -13.923 27.547 -2.536  1.00 39.47  ? 229 GLU A CB  1 
ATOM   1722 C CG  . GLU A 1 229 ? -14.221 26.072 -2.743  1.00 45.49  ? 229 GLU A CG  1 
ATOM   1723 C CD  . GLU A 1 229 ? -13.885 25.534 -4.116  1.00 58.33  ? 229 GLU A CD  1 
ATOM   1724 O OE1 . GLU A 1 229 ? -14.790 24.953 -4.757  1.00 55.27  ? 229 GLU A OE1 1 
ATOM   1725 O OE2 . GLU A 1 229 ? -12.711 25.656 -4.535  1.00 44.66  ? 229 GLU A OE2 1 
ATOM   1726 N N   . ASP A 1 230 ? -15.171 27.369 0.937   1.00 37.42  ? 230 ASP A N   1 
ATOM   1727 C CA  . ASP A 1 230 ? -14.901 26.703 2.215   1.00 37.05  ? 230 ASP A CA  1 
ATOM   1728 C C   . ASP A 1 230 ? -15.251 25.223 2.019   1.00 44.37  ? 230 ASP A C   1 
ATOM   1729 O O   . ASP A 1 230 ? -16.418 24.845 2.140   1.00 45.45  ? 230 ASP A O   1 
ATOM   1730 C CB  . ASP A 1 230 ? -15.717 27.338 3.355   1.00 38.22  ? 230 ASP A CB  1 
ATOM   1731 C CG  . ASP A 1 230 ? -15.404 26.814 4.751   1.00 49.80  ? 230 ASP A CG  1 
ATOM   1732 O OD1 . ASP A 1 230 ? -14.323 26.204 4.933   1.00 52.48  ? 230 ASP A OD1 1 
ATOM   1733 O OD2 . ASP A 1 230 ? -16.226 27.041 5.672   1.00 51.39  ? 230 ASP A OD2 1 
ATOM   1734 N N   . ASP A 1 231 ? -14.244 24.397 1.667   1.00 40.69  ? 231 ASP A N   1 
ATOM   1735 C CA  . ASP A 1 231 ? -14.420 22.987 1.319   1.00 40.50  ? 231 ASP A CA  1 
ATOM   1736 C C   . ASP A 1 231 ? -13.798 21.986 2.334   1.00 44.80  ? 231 ASP A C   1 
ATOM   1737 O O   . ASP A 1 231 ? -12.818 21.318 1.993   1.00 45.63  ? 231 ASP A O   1 
ATOM   1738 C CB  . ASP A 1 231 ? -13.860 22.771 -0.106  1.00 43.15  ? 231 ASP A CB  1 
ATOM   1739 C CG  . ASP A 1 231 ? -14.739 22.024 -1.104  1.00 53.30  ? 231 ASP A CG  1 
ATOM   1740 O OD1 . ASP A 1 231 ? -15.793 21.486 -0.692  1.00 54.04  ? 231 ASP A OD1 1 
ATOM   1741 O OD2 . ASP A 1 231 ? -14.353 21.947 -2.293  1.00 56.89  ? 231 ASP A OD2 1 
ATOM   1742 N N   . PRO A 1 232 ? -14.336 21.826 3.569   1.00 40.59  ? 232 PRO A N   1 
ATOM   1743 C CA  . PRO A 1 232 ? -13.728 20.856 4.501   1.00 39.02  ? 232 PRO A CA  1 
ATOM   1744 C C   . PRO A 1 232 ? -14.114 19.411 4.219   1.00 42.31  ? 232 PRO A C   1 
ATOM   1745 O O   . PRO A 1 232 ? -13.376 18.506 4.602   1.00 40.70  ? 232 PRO A O   1 
ATOM   1746 C CB  . PRO A 1 232 ? -14.233 21.301 5.877   1.00 40.27  ? 232 PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 232 ? -15.211 22.422 5.643   1.00 45.44  ? 232 PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 232 ? -15.499 22.501 4.184   1.00 42.24  ? 232 PRO A CD  1 
ATOM   1749 N N   . TYR A 1 233 ? -15.264 19.192 3.549   1.00 41.04  ? 233 TYR A N   1 
ATOM   1750 C CA  . TYR A 1 233 ? -15.785 17.858 3.203   1.00 40.78  ? 233 TYR A CA  1 
ATOM   1751 C C   . TYR A 1 233 ? -15.440 17.416 1.782   1.00 44.35  ? 233 TYR A C   1 
ATOM   1752 O O   . TYR A 1 233 ? -16.059 16.482 1.271   1.00 43.95  ? 233 TYR A O   1 
ATOM   1753 C CB  . TYR A 1 233 ? -17.307 17.759 3.477   1.00 41.69  ? 233 TYR A CB  1 
ATOM   1754 C CG  . TYR A 1 233 ? -17.717 18.348 4.811   1.00 41.70  ? 233 TYR A CG  1 
ATOM   1755 C CD1 . TYR A 1 233 ? -18.441 19.533 4.879   1.00 43.08  ? 233 TYR A CD1 1 
ATOM   1756 C CD2 . TYR A 1 233 ? -17.321 17.759 6.007   1.00 42.11  ? 233 TYR A CD2 1 
ATOM   1757 C CE1 . TYR A 1 233 ? -18.792 20.100 6.105   1.00 43.26  ? 233 TYR A CE1 1 
ATOM   1758 C CE2 . TYR A 1 233 ? -17.659 18.321 7.239   1.00 42.83  ? 233 TYR A CE2 1 
ATOM   1759 C CZ  . TYR A 1 233 ? -18.401 19.489 7.285   1.00 50.83  ? 233 TYR A CZ  1 
ATOM   1760 O OH  . TYR A 1 233 ? -18.728 20.044 8.504   1.00 49.81  ? 233 TYR A OH  1 
ATOM   1761 N N   . TYR A 1 234 ? -14.425 18.063 1.157   1.00 41.71  ? 234 TYR A N   1 
ATOM   1762 C CA  . TYR A 1 234 ? -13.970 17.749 -0.202  1.00 43.05  ? 234 TYR A CA  1 
ATOM   1763 C C   . TYR A 1 234 ? -13.529 16.274 -0.324  1.00 49.36  ? 234 TYR A C   1 
ATOM   1764 O O   . TYR A 1 234 ? -13.800 15.623 -1.335  1.00 49.96  ? 234 TYR A O   1 
ATOM   1765 C CB  . TYR A 1 234 ? -12.851 18.724 -0.667  1.00 43.92  ? 234 TYR A CB  1 
ATOM   1766 C CG  . TYR A 1 234 ? -12.265 18.334 -2.008  1.00 46.88  ? 234 TYR A CG  1 
ATOM   1767 C CD1 . TYR A 1 234 ? -13.024 18.421 -3.175  1.00 50.45  ? 234 TYR A CD1 1 
ATOM   1768 C CD2 . TYR A 1 234 ? -10.998 17.767 -2.097  1.00 47.34  ? 234 TYR A CD2 1 
ATOM   1769 C CE1 . TYR A 1 234 ? -12.526 17.983 -4.400  1.00 51.51  ? 234 TYR A CE1 1 
ATOM   1770 C CE2 . TYR A 1 234 ? -10.491 17.321 -3.317  1.00 49.58  ? 234 TYR A CE2 1 
ATOM   1771 C CZ  . TYR A 1 234 ? -11.260 17.434 -4.467  1.00 57.57  ? 234 TYR A CZ  1 
ATOM   1772 O OH  . TYR A 1 234 ? -10.770 17.014 -5.679  1.00 60.22  ? 234 TYR A OH  1 
ATOM   1773 N N   . PHE A 1 235 ? -12.878 15.761 0.730   1.00 47.10  ? 235 PHE A N   1 
ATOM   1774 C CA  . PHE A 1 235 ? -12.385 14.397 0.824   1.00 48.40  ? 235 PHE A CA  1 
ATOM   1775 C C   . PHE A 1 235 ? -13.400 13.463 1.480   1.00 56.09  ? 235 PHE A C   1 
ATOM   1776 O O   . PHE A 1 235 ? -13.014 12.392 1.956   1.00 56.88  ? 235 PHE A O   1 
ATOM   1777 C CB  . PHE A 1 235 ? -11.047 14.357 1.584   1.00 49.59  ? 235 PHE A CB  1 
ATOM   1778 C CG  . PHE A 1 235 ? -9.936  15.112 0.904   1.00 52.13  ? 235 PHE A CG  1 
ATOM   1779 C CD1 . PHE A 1 235 ? -9.353  14.625 -0.265  1.00 56.12  ? 235 PHE A CD1 1 
ATOM   1780 C CD2 . PHE A 1 235 ? -9.470  16.311 1.427   1.00 54.15  ? 235 PHE A CD2 1 
ATOM   1781 C CE1 . PHE A 1 235 ? -8.322  15.321 -0.890  1.00 57.04  ? 235 PHE A CE1 1 
ATOM   1782 C CE2 . PHE A 1 235 ? -8.432  17.005 0.801   1.00 57.12  ? 235 PHE A CE2 1 
ATOM   1783 C CZ  . PHE A 1 235 ? -7.868  16.504 -0.353  1.00 55.97  ? 235 PHE A CZ  1 
ATOM   1784 N N   . LEU A 1 236 ? -14.691 13.857 1.513   1.00 53.72  ? 236 LEU A N   1 
ATOM   1785 C CA  . LEU A 1 236 ? -15.762 13.037 2.086   1.00 53.10  ? 236 LEU A CA  1 
ATOM   1786 C C   . LEU A 1 236 ? -16.951 12.910 1.131   1.00 59.60  ? 236 LEU A C   1 
ATOM   1787 O O   . LEU A 1 236 ? -18.082 12.714 1.566   1.00 59.48  ? 236 LEU A O   1 
ATOM   1788 C CB  . LEU A 1 236 ? -16.176 13.551 3.475   1.00 51.60  ? 236 LEU A CB  1 
ATOM   1789 C CG  . LEU A 1 236 ? -15.327 13.081 4.659   1.00 54.95  ? 236 LEU A CG  1 
ATOM   1790 C CD1 . LEU A 1 236 ? -14.192 14.058 4.954   1.00 54.78  ? 236 LEU A CD1 1 
ATOM   1791 C CD2 . LEU A 1 236 ? -16.160 12.985 5.896   1.00 55.98  ? 236 LEU A CD2 1 
ATOM   1792 N N   . GLN A 1 237 ? -16.683 13.006 -0.183  1.00 58.62  ? 237 GLN A N   1 
ATOM   1793 C CA  . GLN A 1 237 ? -17.691 12.876 -1.243  1.00 59.98  ? 237 GLN A CA  1 
ATOM   1794 C C   . GLN A 1 237 ? -18.014 11.403 -1.410  1.00 64.04  ? 237 GLN A C   1 
ATOM   1795 O O   . GLN A 1 237 ? -17.106 10.577 -1.509  1.00 63.39  ? 237 GLN A O   1 
ATOM   1796 C CB  . GLN A 1 237 ? -17.202 13.499 -2.563  1.00 62.40  ? 237 GLN A CB  1 
ATOM   1797 C CG  . GLN A 1 237 ? -17.040 15.021 -2.510  1.00 66.95  ? 237 GLN A CG  1 
ATOM   1798 C CD  . GLN A 1 237 ? -16.586 15.621 -3.819  1.00 81.77  ? 237 GLN A CD  1 
ATOM   1799 O OE1 . GLN A 1 237 ? -15.590 16.342 -3.867  1.00 83.66  ? 237 GLN A OE1 1 
ATOM   1800 N NE2 . GLN A 1 237 ? -17.313 15.377 -4.906  1.00 64.50  ? 237 GLN A NE2 1 
ATOM   1801 N N   . PHE A 1 238 ? -19.298 11.072 -1.379  1.00 61.53  ? 238 PHE A N   1 
ATOM   1802 C CA  . PHE A 1 238 ? -19.737 9.687  -1.410  1.00 61.89  ? 238 PHE A CA  1 
ATOM   1803 C C   . PHE A 1 238 ? -19.722 9.036  -2.740  1.00 70.73  ? 238 PHE A C   1 
ATOM   1804 O O   . PHE A 1 238 ? -19.371 7.849  -2.854  1.00 72.23  ? 238 PHE A O   1 
ATOM   1805 C CB  . PHE A 1 238 ? -21.101 9.533  -0.732  1.00 62.50  ? 238 PHE A CB  1 
ATOM   1806 C CG  . PHE A 1 238 ? -21.024 9.867  0.734   1.00 61.76  ? 238 PHE A CG  1 
ATOM   1807 C CD1 . PHE A 1 238 ? -21.901 10.781 1.301   1.00 63.56  ? 238 PHE A CD1 1 
ATOM   1808 C CD2 . PHE A 1 238 ? -20.018 9.333  1.531   1.00 62.29  ? 238 PHE A CD2 1 
ATOM   1809 C CE1 . PHE A 1 238 ? -21.806 11.111 2.647   1.00 63.15  ? 238 PHE A CE1 1 
ATOM   1810 C CE2 . PHE A 1 238 ? -19.907 9.684  2.868   1.00 63.74  ? 238 PHE A CE2 1 
ATOM   1811 C CZ  . PHE A 1 238 ? -20.809 10.565 3.422   1.00 61.53  ? 238 PHE A CZ  1 
ATOM   1812 N N   . ASN A 1 239 ? -20.082 9.807  -3.756  1.00 68.38  ? 239 ASN A N   1 
ATOM   1813 C CA  . ASN A 1 239 ? -20.240 9.245  -5.078  1.00 69.64  ? 239 ASN A CA  1 
ATOM   1814 C C   . ASN A 1 239 ? -19.083 9.391  -6.018  1.00 71.05  ? 239 ASN A C   1 
ATOM   1815 O O   . ASN A 1 239 ? -18.301 10.337 -5.890  1.00 68.93  ? 239 ASN A O   1 
ATOM   1816 C CB  . ASN A 1 239 ? -21.610 9.582  -5.641  1.00 75.78  ? 239 ASN A CB  1 
ATOM   1817 C CG  . ASN A 1 239 ? -22.694 9.291  -4.609  1.00 107.04 ? 239 ASN A CG  1 
ATOM   1818 O OD1 . ASN A 1 239 ? -23.029 10.149 -3.776  1.00 103.68 ? 239 ASN A OD1 1 
ATOM   1819 N ND2 . ASN A 1 239 ? -23.138 8.038  -4.529  1.00 99.97  ? 239 ASN A ND2 1 
ATOM   1820 N N   . SER A 1 240 ? -18.942 8.369  -6.904  1.00 68.09  ? 240 SER A N   1 
ATOM   1821 C CA  . SER A 1 240 ? -17.923 8.130  -7.936  1.00 68.39  ? 240 SER A CA  1 
ATOM   1822 C C   . SER A 1 240 ? -17.467 9.371  -8.676  1.00 70.85  ? 240 SER A C   1 
ATOM   1823 O O   . SER A 1 240 ? -18.248 9.966  -9.420  1.00 72.04  ? 240 SER A O   1 
ATOM   1824 C CB  . SER A 1 240 ? -18.398 7.064  -8.921  1.00 73.77  ? 240 SER A CB  1 
ATOM   1825 O OG  . SER A 1 240 ? -18.177 7.398  -10.282 1.00 85.22  ? 240 SER A OG  1 
ATOM   1826 N N   . GLY A 1 241 ? -16.193 9.710  -8.492  1.00 64.10  ? 241 GLY A N   1 
ATOM   1827 C CA  . GLY A 1 241 ? -15.536 10.862 -9.102  1.00 62.59  ? 241 GLY A CA  1 
ATOM   1828 C C   . GLY A 1 241 ? -15.910 12.197 -8.489  1.00 60.90  ? 241 GLY A C   1 
ATOM   1829 O O   . GLY A 1 241 ? -17.081 12.603 -8.553  1.00 60.88  ? 241 GLY A O   1 
ATOM   1830 N N   . ARG A 1 242 ? -14.900 12.898 -7.917  1.00 52.48  ? 242 ARG A N   1 
ATOM   1831 C CA  . ARG A 1 242 ? -15.057 14.223 -7.298  1.00 49.48  ? 242 ARG A CA  1 
ATOM   1832 C C   . ARG A 1 242 ? -15.364 15.311 -8.343  1.00 51.55  ? 242 ARG A C   1 
ATOM   1833 O O   . ARG A 1 242 ? -14.841 15.272 -9.455  1.00 51.43  ? 242 ARG A O   1 
ATOM   1834 C CB  . ARG A 1 242 ? -13.842 14.601 -6.432  1.00 46.93  ? 242 ARG A CB  1 
ATOM   1835 C CG  . ARG A 1 242 ? -13.552 13.607 -5.295  1.00 53.01  ? 242 ARG A CG  1 
ATOM   1836 C CD  . ARG A 1 242 ? -12.261 13.880 -4.518  1.00 59.25  ? 242 ARG A CD  1 
ATOM   1837 N NE  . ARG A 1 242 ? -11.154 14.274 -5.391  1.00 66.98  ? 242 ARG A NE  1 
ATOM   1838 C CZ  . ARG A 1 242 ? -10.140 13.490 -5.734  1.00 76.71  ? 242 ARG A CZ  1 
ATOM   1839 N NH1 . ARG A 1 242 ? -10.048 12.258 -5.250  1.00 61.66  ? 242 ARG A NH1 1 
ATOM   1840 N NH2 . ARG A 1 242 ? -9.192  13.942 -6.541  1.00 62.71  ? 242 ARG A NH2 1 
ATOM   1841 N N   . VAL A 1 243 ? -16.254 16.246 -7.984  1.00 47.21  ? 243 VAL A N   1 
ATOM   1842 C CA  . VAL A 1 243 ? -16.738 17.344 -8.834  1.00 48.19  ? 243 VAL A CA  1 
ATOM   1843 C C   . VAL A 1 243 ? -15.621 18.398 -8.947  1.00 53.39  ? 243 VAL A C   1 
ATOM   1844 O O   . VAL A 1 243 ? -14.988 18.694 -7.920  1.00 52.38  ? 243 VAL A O   1 
ATOM   1845 C CB  . VAL A 1 243 ? -18.053 17.966 -8.243  1.00 51.23  ? 243 VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 243 ? -18.720 18.950 -9.207  1.00 52.34  ? 243 VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 243 ? -19.045 16.894 -7.791  1.00 50.67  ? 243 VAL A CG2 1 
ATOM   1848 N N   . PRO A 1 244 ? -15.376 19.012 -10.141 1.00 51.17  ? 244 PRO A N   1 
ATOM   1849 C CA  . PRO A 1 244 ? -14.346 20.068 -10.220 1.00 50.11  ? 244 PRO A CA  1 
ATOM   1850 C C   . PRO A 1 244 ? -14.672 21.224 -9.279  1.00 51.26  ? 244 PRO A C   1 
ATOM   1851 O O   . PRO A 1 244 ? -15.843 21.565 -9.106  1.00 51.53  ? 244 PRO A O   1 
ATOM   1852 C CB  . PRO A 1 244 ? -14.397 20.521 -11.683 1.00 53.95  ? 244 PRO A CB  1 
ATOM   1853 C CG  . PRO A 1 244 ? -15.084 19.442 -12.402 1.00 60.01  ? 244 PRO A CG  1 
ATOM   1854 C CD  . PRO A 1 244 ? -16.035 18.814 -11.448 1.00 54.68  ? 244 PRO A CD  1 
ATOM   1855 N N   . THR A 1 245 ? -13.642 21.789 -8.644  1.00 45.05  ? 245 THR A N   1 
ATOM   1856 C CA  . THR A 1 245 ? -13.774 22.879 -7.671  1.00 42.62  ? 245 THR A CA  1 
ATOM   1857 C C   . THR A 1 245 ? -13.742 24.244 -8.359  1.00 46.35  ? 245 THR A C   1 
ATOM   1858 O O   . THR A 1 245 ? -13.260 24.350 -9.483  1.00 46.92  ? 245 THR A O   1 
ATOM   1859 C CB  . THR A 1 245 ? -12.658 22.774 -6.584  1.00 44.97  ? 245 THR A CB  1 
ATOM   1860 O OG1 . THR A 1 245 ? -11.378 22.892 -7.208  1.00 41.53  ? 245 THR A OG1 1 
ATOM   1861 C CG2 . THR A 1 245 ? -12.732 21.481 -5.753  1.00 38.74  ? 245 THR A CG2 1 
ATOM   1862 N N   . PHE A 1 246 ? -14.218 25.295 -7.662  1.00 43.39  ? 246 PHE A N   1 
ATOM   1863 C CA  . PHE A 1 246 ? -14.177 26.678 -8.150  1.00 44.34  ? 246 PHE A CA  1 
ATOM   1864 C C   . PHE A 1 246 ? -12.747 27.099 -8.504  1.00 51.57  ? 246 PHE A C   1 
ATOM   1865 O O   . PHE A 1 246 ? -12.545 27.755 -9.526  1.00 52.39  ? 246 PHE A O   1 
ATOM   1866 C CB  . PHE A 1 246 ? -14.800 27.652 -7.131  1.00 44.34  ? 246 PHE A CB  1 
ATOM   1867 C CG  . PHE A 1 246 ? -16.300 27.791 -7.273  1.00 45.66  ? 246 PHE A CG  1 
ATOM   1868 C CD1 . PHE A 1 246 ? -17.152 27.368 -6.260  1.00 46.32  ? 246 PHE A CD1 1 
ATOM   1869 C CD2 . PHE A 1 246 ? -16.864 28.302 -8.443  1.00 48.83  ? 246 PHE A CD2 1 
ATOM   1870 C CE1 . PHE A 1 246 ? -18.538 27.481 -6.400  1.00 47.60  ? 246 PHE A CE1 1 
ATOM   1871 C CE2 . PHE A 1 246 ? -18.249 28.417 -8.580  1.00 51.95  ? 246 PHE A CE2 1 
ATOM   1872 C CZ  . PHE A 1 246 ? -19.078 28.003 -7.560  1.00 48.62  ? 246 PHE A CZ  1 
ATOM   1873 N N   . LEU A 1 247 ? -11.757 26.682 -7.674  1.00 49.42  ? 247 LEU A N   1 
ATOM   1874 C CA  . LEU A 1 247 ? -10.322 26.931 -7.854  1.00 49.83  ? 247 LEU A CA  1 
ATOM   1875 C C   . LEU A 1 247 ? -9.820  26.336 -9.180  1.00 56.58  ? 247 LEU A C   1 
ATOM   1876 O O   . LEU A 1 247 ? -8.998  26.968 -9.847  1.00 56.85  ? 247 LEU A O   1 
ATOM   1877 C CB  . LEU A 1 247 ? -9.533  26.350 -6.657  1.00 48.08  ? 247 LEU A CB  1 
ATOM   1878 C CG  . LEU A 1 247 ? -7.998  26.333 -6.755  1.00 53.34  ? 247 LEU A CG  1 
ATOM   1879 C CD1 . LEU A 1 247 ? -7.415  27.741 -6.663  1.00 53.70  ? 247 LEU A CD1 1 
ATOM   1880 C CD2 . LEU A 1 247 ? -7.382  25.419 -5.696  1.00 54.80  ? 247 LEU A CD2 1 
ATOM   1881 N N   . SER A 1 248 ? -10.333 25.139 -9.569  1.00 54.63  ? 248 SER A N   1 
ATOM   1882 C CA  . SER A 1 248 ? -9.945  24.457 -10.813 1.00 56.48  ? 248 SER A CA  1 
ATOM   1883 C C   . SER A 1 248 ? -10.319 25.246 -12.063 1.00 63.33  ? 248 SER A C   1 
ATOM   1884 O O   . SER A 1 248 ? -9.617  25.164 -13.064 1.00 64.97  ? 248 SER A O   1 
ATOM   1885 C CB  . SER A 1 248 ? -10.511 23.041 -10.872 1.00 59.95  ? 248 SER A CB  1 
ATOM   1886 O OG  . SER A 1 248 ? -11.829 22.989 -11.395 1.00 72.06  ? 248 SER A OG  1 
ATOM   1887 N N   . MET A 1 249 ? -11.412 26.014 -11.994 1.00 60.89  ? 249 MET A N   1 
ATOM   1888 C CA  . MET A 1 249 ? -11.919 26.842 -13.095 1.00 63.03  ? 249 MET A CA  1 
ATOM   1889 C C   . MET A 1 249 ? -11.602 28.352 -12.918 1.00 65.66  ? 249 MET A C   1 
ATOM   1890 O O   . MET A 1 249 ? -12.147 29.182 -13.657 1.00 66.15  ? 249 MET A O   1 
ATOM   1891 C CB  . MET A 1 249 ? -13.432 26.581 -13.321 1.00 66.18  ? 249 MET A CB  1 
ATOM   1892 C CG  . MET A 1 249 ? -14.308 26.855 -12.106 1.00 68.50  ? 249 MET A CG  1 
ATOM   1893 S SD  . MET A 1 249 ? -16.058 26.446 -12.326 1.00 73.77  ? 249 MET A SD  1 
ATOM   1894 C CE  . MET A 1 249 ? -16.005 24.676 -12.079 1.00 69.61  ? 249 MET A CE  1 
ATOM   1895 N N   . ASP A 1 250 ? -10.705 28.693 -11.957 1.00 60.20  ? 250 ASP A N   1 
ATOM   1896 C CA  . ASP A 1 250 ? -10.347 30.080 -11.650 1.00 60.02  ? 250 ASP A CA  1 
ATOM   1897 C C   . ASP A 1 250 ? -9.361  30.742 -12.629 1.00 65.50  ? 250 ASP A C   1 
ATOM   1898 O O   . ASP A 1 250 ? -8.181  30.932 -12.322 1.00 65.23  ? 250 ASP A O   1 
ATOM   1899 C CB  . ASP A 1 250 ? -9.941  30.257 -10.178 1.00 59.61  ? 250 ASP A CB  1 
ATOM   1900 C CG  . ASP A 1 250 ? -9.756  31.704 -9.739  1.00 70.56  ? 250 ASP A CG  1 
ATOM   1901 O OD1 . ASP A 1 250 ? -10.405 32.605 -10.341 1.00 71.56  ? 250 ASP A OD1 1 
ATOM   1902 O OD2 . ASP A 1 250 ? -8.989  31.936 -8.772  1.00 75.56  ? 250 ASP A OD2 1 
ATOM   1903 N N   . VAL A 1 251 ? -9.880  31.128 -13.792 1.00 62.91  ? 251 VAL A N   1 
ATOM   1904 C CA  . VAL A 1 251 ? -9.131  31.761 -14.872 1.00 64.24  ? 251 VAL A CA  1 
ATOM   1905 C C   . VAL A 1 251 ? -8.667  33.196 -14.494 1.00 68.12  ? 251 VAL A C   1 
ATOM   1906 O O   . VAL A 1 251 ? -7.569  33.604 -14.888 1.00 68.51  ? 251 VAL A O   1 
ATOM   1907 C CB  . VAL A 1 251 ? -9.986  31.716 -16.167 1.00 69.87  ? 251 VAL A CB  1 
ATOM   1908 C CG1 . VAL A 1 251 ? -9.340  32.487 -17.314 1.00 71.89  ? 251 VAL A CG1 1 
ATOM   1909 C CG2 . VAL A 1 251 ? -10.264 30.277 -16.579 1.00 69.70  ? 251 VAL A CG2 1 
ATOM   1910 N N   . ASP A 1 252 ? -9.494  33.926 -13.710 1.00 63.02  ? 252 ASP A N   1 
ATOM   1911 C CA  . ASP A 1 252 ? -9.284  35.317 -13.285 1.00 62.16  ? 252 ASP A CA  1 
ATOM   1912 C C   . ASP A 1 252 ? -8.464  35.519 -12.012 1.00 63.95  ? 252 ASP A C   1 
ATOM   1913 O O   . ASP A 1 252 ? -7.937  36.611 -11.806 1.00 64.45  ? 252 ASP A O   1 
ATOM   1914 C CB  . ASP A 1 252 ? -10.639 36.032 -13.093 1.00 63.87  ? 252 ASP A CB  1 
ATOM   1915 C CG  . ASP A 1 252 ? -11.628 35.932 -14.237 1.00 70.96  ? 252 ASP A CG  1 
ATOM   1916 O OD1 . ASP A 1 252 ? -11.310 35.263 -15.246 1.00 70.87  ? 252 ASP A OD1 1 
ATOM   1917 O OD2 . ASP A 1 252 ? -12.723 36.517 -14.120 1.00 76.90  ? 252 ASP A OD2 1 
ATOM   1918 N N   . GLY A 1 253 ? -8.414  34.520 -11.142 1.00 57.74  ? 253 GLY A N   1 
ATOM   1919 C CA  . GLY A 1 253 ? -7.735  34.665 -9.859  1.00 55.33  ? 253 GLY A CA  1 
ATOM   1920 C C   . GLY A 1 253 ? -8.637  35.397 -8.880  1.00 58.08  ? 253 GLY A C   1 
ATOM   1921 O O   . GLY A 1 253 ? -8.210  36.347 -8.221  1.00 57.22  ? 253 GLY A O   1 
ATOM   1922 N N   . ARG A 1 254 ? -9.922  34.988 -8.835  1.00 53.82  ? 254 ARG A N   1 
ATOM   1923 C CA  . ARG A 1 254 ? -10.957 35.558 -7.970  1.00 51.54  ? 254 ARG A CA  1 
ATOM   1924 C C   . ARG A 1 254 ? -11.442 34.583 -6.901  1.00 50.86  ? 254 ARG A C   1 
ATOM   1925 O O   . ARG A 1 254 ? -12.398 34.892 -6.187  1.00 51.21  ? 254 ARG A O   1 
ATOM   1926 C CB  . ARG A 1 254 ? -12.136 36.126 -8.790  1.00 52.26  ? 254 ARG A CB  1 
ATOM   1927 C CG  . ARG A 1 254 ? -12.838 35.138 -9.710  1.00 58.34  ? 254 ARG A CG  1 
ATOM   1928 C CD  . ARG A 1 254 ? -14.081 35.730 -10.353 1.00 66.31  ? 254 ARG A CD  1 
ATOM   1929 N NE  . ARG A 1 254 ? -13.789 36.784 -11.336 1.00 70.88  ? 254 ARG A NE  1 
ATOM   1930 C CZ  . ARG A 1 254 ? -13.909 38.092 -11.101 1.00 76.59  ? 254 ARG A CZ  1 
ATOM   1931 N NH1 . ARG A 1 254 ? -14.280 38.528 -9.902  1.00 60.44  ? 254 ARG A NH1 1 
ATOM   1932 N NH2 . ARG A 1 254 ? -13.643 38.973 -12.059 1.00 55.43  ? 254 ARG A NH2 1 
ATOM   1933 N N   . VAL A 1 255 ? -10.760 33.435 -6.757  1.00 43.65  ? 255 VAL A N   1 
ATOM   1934 C CA  . VAL A 1 255 ? -11.152 32.392 -5.806  1.00 41.49  ? 255 VAL A CA  1 
ATOM   1935 C C   . VAL A 1 255 ? -10.178 32.222 -4.620  1.00 44.74  ? 255 VAL A C   1 
ATOM   1936 O O   . VAL A 1 255 ? -8.966  32.089 -4.823  1.00 44.74  ? 255 VAL A O   1 
ATOM   1937 C CB  . VAL A 1 255 ? -11.453 31.051 -6.548  1.00 44.83  ? 255 VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 255 ? -11.763 29.916 -5.579  1.00 43.34  ? 255 VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 255 ? -12.590 31.220 -7.547  1.00 46.08  ? 255 VAL A CG2 1 
ATOM   1940 N N   . ILE A 1 256 ? -10.731 32.217 -3.390  1.00 39.54  ? 256 ILE A N   1 
ATOM   1941 C CA  . ILE A 1 256 ? -10.011 31.942 -2.149  1.00 37.35  ? 256 ILE A CA  1 
ATOM   1942 C C   . ILE A 1 256 ? -10.585 30.616 -1.615  1.00 40.82  ? 256 ILE A C   1 
ATOM   1943 O O   . ILE A 1 256 ? -11.765 30.547 -1.241  1.00 40.33  ? 256 ILE A O   1 
ATOM   1944 C CB  . ILE A 1 256 ? -10.097 33.079 -1.097  1.00 39.39  ? 256 ILE A CB  1 
ATOM   1945 C CG1 . ILE A 1 256 ? -9.446  34.369 -1.602  1.00 40.14  ? 256 ILE A CG1 1 
ATOM   1946 C CG2 . ILE A 1 256 ? -9.438  32.641 0.215   1.00 38.62  ? 256 ILE A CG2 1 
ATOM   1947 C CD1 . ILE A 1 256 ? -10.017 35.652 -0.983  1.00 44.54  ? 256 ILE A CD1 1 
ATOM   1948 N N   . ARG A 1 257 ? -9.743  29.570 -1.602  1.00 36.72  ? 257 ARG A N   1 
ATOM   1949 C CA  . ARG A 1 257 ? -10.101 28.226 -1.154  1.00 35.40  ? 257 ARG A CA  1 
ATOM   1950 C C   . ARG A 1 257 ? -9.522  27.880 0.210   1.00 36.79  ? 257 ARG A C   1 
ATOM   1951 O O   . ARG A 1 257 ? -8.318  28.013 0.416   1.00 37.24  ? 257 ARG A O   1 
ATOM   1952 C CB  . ARG A 1 257 ? -9.654  27.172 -2.195  1.00 34.46  ? 257 ARG A CB  1 
ATOM   1953 C CG  . ARG A 1 257 ? -10.072 25.754 -1.817  1.00 31.21  ? 257 ARG A CG  1 
ATOM   1954 C CD  . ARG A 1 257 ? -9.481  24.677 -2.691  1.00 24.17  ? 257 ARG A CD  1 
ATOM   1955 N NE  . ARG A 1 257 ? -9.779  23.352 -2.149  1.00 26.76  ? 257 ARG A NE  1 
ATOM   1956 C CZ  . ARG A 1 257 ? -10.939 22.715 -2.304  1.00 47.95  ? 257 ARG A CZ  1 
ATOM   1957 N NH1 . ARG A 1 257 ? -11.127 21.519 -1.754  1.00 34.95  ? 257 ARG A NH1 1 
ATOM   1958 N NH2 . ARG A 1 257 ? -11.925 23.273 -3.000  1.00 36.25  ? 257 ARG A NH2 1 
ATOM   1959 N N   . ALA A 1 258 ? -10.364 27.342 1.101   1.00 31.73  ? 258 ALA A N   1 
ATOM   1960 C CA  . ALA A 1 258 ? -9.949  26.874 2.423   1.00 30.23  ? 258 ALA A CA  1 
ATOM   1961 C C   . ALA A 1 258 ? -10.127 25.348 2.562   1.00 34.55  ? 258 ALA A C   1 
ATOM   1962 O O   . ALA A 1 258 ? -11.220 24.807 2.375   1.00 33.80  ? 258 ALA A O   1 
ATOM   1963 C CB  . ALA A 1 258 ? -10.708 27.601 3.518   1.00 30.28  ? 258 ALA A CB  1 
ATOM   1964 N N   . ASP A 1 259 ? -9.025  24.675 2.884   1.00 32.42  ? 259 ASP A N   1 
ATOM   1965 C CA  . ASP A 1 259 ? -8.949  23.241 3.085   1.00 33.29  ? 259 ASP A CA  1 
ATOM   1966 C C   . ASP A 1 259 ? -8.664  22.939 4.549   1.00 37.94  ? 259 ASP A C   1 
ATOM   1967 O O   . ASP A 1 259 ? -7.965  23.712 5.221   1.00 36.57  ? 259 ASP A O   1 
ATOM   1968 C CB  . ASP A 1 259 ? -7.842  22.651 2.221   1.00 36.44  ? 259 ASP A CB  1 
ATOM   1969 C CG  . ASP A 1 259 ? -8.144  22.623 0.740   1.00 55.71  ? 259 ASP A CG  1 
ATOM   1970 O OD1 . ASP A 1 259 ? -8.971  21.763 0.314   1.00 57.30  ? 259 ASP A OD1 1 
ATOM   1971 O OD2 . ASP A 1 259 ? -7.508  23.407 -0.010  1.00 65.03  ? 259 ASP A OD2 1 
ATOM   1972 N N   . SER A 1 260 ? -9.183  21.799 5.035   1.00 35.76  ? 260 SER A N   1 
ATOM   1973 C CA  . SER A 1 260 ? -9.009  21.401 6.428   1.00 35.50  ? 260 SER A CA  1 
ATOM   1974 C C   . SER A 1 260 ? -8.629  19.923 6.614   1.00 39.32  ? 260 SER A C   1 
ATOM   1975 O O   . SER A 1 260 ? -9.175  19.050 5.934   1.00 39.27  ? 260 SER A O   1 
ATOM   1976 C CB  . SER A 1 260 ? -10.283 21.714 7.205   1.00 39.96  ? 260 SER A CB  1 
ATOM   1977 O OG  . SER A 1 260 ? -10.132 21.451 8.589   1.00 51.34  ? 260 SER A OG  1 
ATOM   1978 N N   . PHE A 1 261 ? -7.730  19.654 7.583   1.00 34.88  ? 261 PHE A N   1 
ATOM   1979 C CA  . PHE A 1 261 ? -7.331  18.300 7.966   1.00 34.69  ? 261 PHE A CA  1 
ATOM   1980 C C   . PHE A 1 261 ? -8.203  17.751 9.131   1.00 35.98  ? 261 PHE A C   1 
ATOM   1981 O O   . PHE A 1 261 ? -8.069  16.583 9.494   1.00 35.18  ? 261 PHE A O   1 
ATOM   1982 C CB  . PHE A 1 261 ? -5.842  18.262 8.351   1.00 36.84  ? 261 PHE A CB  1 
ATOM   1983 C CG  . PHE A 1 261 ? -4.885  18.298 7.184   1.00 40.16  ? 261 PHE A CG  1 
ATOM   1984 C CD1 . PHE A 1 261 ? -5.037  17.429 6.108   1.00 44.69  ? 261 PHE A CD1 1 
ATOM   1985 C CD2 . PHE A 1 261 ? -3.810  19.177 7.172   1.00 42.57  ? 261 PHE A CD2 1 
ATOM   1986 C CE1 . PHE A 1 261 ? -4.154  17.471 5.025   1.00 46.17  ? 261 PHE A CE1 1 
ATOM   1987 C CE2 . PHE A 1 261 ? -2.923  19.208 6.091   1.00 45.64  ? 261 PHE A CE2 1 
ATOM   1988 C CZ  . PHE A 1 261 ? -3.099  18.351 5.033   1.00 44.53  ? 261 PHE A CZ  1 
ATOM   1989 N N   . SER A 1 262 ? -9.088  18.597 9.697   1.00 30.89  ? 262 SER A N   1 
ATOM   1990 C CA  . SER A 1 262 ? -9.967  18.303 10.827  1.00 30.67  ? 262 SER A CA  1 
ATOM   1991 C C   . SER A 1 262 ? -10.860 17.072 10.687  1.00 36.43  ? 262 SER A C   1 
ATOM   1992 O O   . SER A 1 262 ? -11.049 16.348 11.668  1.00 36.64  ? 262 SER A O   1 
ATOM   1993 C CB  . SER A 1 262 ? -10.808 19.521 11.190  1.00 33.48  ? 262 SER A CB  1 
ATOM   1994 O OG  . SER A 1 262 ? -9.977  20.566 11.661  1.00 42.01  ? 262 SER A OG  1 
ATOM   1995 N N   . LYS A 1 263 ? -11.407 16.834 9.495   1.00 33.33  ? 263 LYS A N   1 
ATOM   1996 C CA  . LYS A 1 263 ? -12.283 15.683 9.286   1.00 34.00  ? 263 LYS A CA  1 
ATOM   1997 C C   . LYS A 1 263 ? -11.524 14.417 8.849   1.00 39.47  ? 263 LYS A C   1 
ATOM   1998 O O   . LYS A 1 263 ? -12.080 13.322 8.920   1.00 38.28  ? 263 LYS A O   1 
ATOM   1999 C CB  . LYS A 1 263 ? -13.435 16.032 8.309   1.00 36.90  ? 263 LYS A CB  1 
ATOM   2000 C CG  . LYS A 1 263 ? -14.595 16.817 8.953   1.00 47.83  ? 263 LYS A CG  1 
ATOM   2001 C CD  . LYS A 1 263 ? -14.380 18.342 9.054   1.00 53.80  ? 263 LYS A CD  1 
ATOM   2002 C CE  . LYS A 1 263 ? -15.409 19.060 9.915   1.00 64.54  ? 263 LYS A CE  1 
ATOM   2003 N NZ  . LYS A 1 263 ? -15.218 18.834 11.375  1.00 69.97  ? 263 LYS A NZ  1 
ATOM   2004 N N   . ILE A 1 264 ? -10.250 14.563 8.439   1.00 38.06  ? 264 ILE A N   1 
ATOM   2005 C CA  . ILE A 1 264 ? -9.443  13.464 7.898   1.00 39.10  ? 264 ILE A CA  1 
ATOM   2006 C C   . ILE A 1 264 ? -8.168  13.054 8.665   1.00 42.87  ? 264 ILE A C   1 
ATOM   2007 O O   . ILE A 1 264 ? -7.807  11.873 8.618   1.00 43.35  ? 264 ILE A O   1 
ATOM   2008 C CB  . ILE A 1 264 ? -9.216  13.633 6.360   1.00 42.92  ? 264 ILE A CB  1 
ATOM   2009 C CG1 . ILE A 1 264 ? -8.636  15.038 6.024   1.00 43.66  ? 264 ILE A CG1 1 
ATOM   2010 C CG2 . ILE A 1 264 ? -10.530 13.374 5.585   1.00 42.69  ? 264 ILE A CG2 1 
ATOM   2011 C CD1 . ILE A 1 264 ? -7.977  15.192 4.632   1.00 54.40  ? 264 ILE A CD1 1 
ATOM   2012 N N   . ILE A 1 265 ? -7.479  14.008 9.332   1.00 37.44  ? 265 ILE A N   1 
ATOM   2013 C CA  . ILE A 1 265 ? -6.240  13.731 10.083  1.00 36.48  ? 265 ILE A CA  1 
ATOM   2014 C C   . ILE A 1 265 ? -6.332  14.011 11.591  1.00 38.72  ? 265 ILE A C   1 
ATOM   2015 O O   . ILE A 1 265 ? -5.995  13.129 12.384  1.00 38.81  ? 265 ILE A O   1 
ATOM   2016 C CB  . ILE A 1 265 ? -4.969  14.286 9.385   1.00 39.52  ? 265 ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 265 ? -4.493  13.284 8.322   1.00 42.21  ? 265 ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 265 ? -3.832  14.579 10.373  1.00 37.77  ? 265 ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 265 ? -4.026  13.895 7.013   1.00 55.95  ? 265 ILE A CD1 1 
ATOM   2020 N N   . SER A 1 266 ? -6.768  15.230 11.979  1.00 32.76  ? 266 SER A N   1 
ATOM   2021 C CA  . SER A 1 266 ? -6.959  15.659 13.368  1.00 31.65  ? 266 SER A CA  1 
ATOM   2022 C C   . SER A 1 266 ? -7.541  17.056 13.439  1.00 34.99  ? 266 SER A C   1 
ATOM   2023 O O   . SER A 1 266 ? -7.053  17.969 12.767  1.00 35.35  ? 266 SER A O   1 
ATOM   2024 C CB  . SER A 1 266 ? -5.659  15.594 14.170  1.00 35.44  ? 266 SER A CB  1 
ATOM   2025 O OG  . SER A 1 266 ? -5.768  16.216 15.442  1.00 42.43  ? 266 SER A OG  1 
ATOM   2026 N N   . SER A 1 267 ? -8.556  17.227 14.295  1.00 29.81  ? 267 SER A N   1 
ATOM   2027 C CA  . SER A 1 267 ? -9.193  18.516 14.544  1.00 28.60  ? 267 SER A CA  1 
ATOM   2028 C C   . SER A 1 267 ? -8.472  19.303 15.678  1.00 33.01  ? 267 SER A C   1 
ATOM   2029 O O   . SER A 1 267 ? -8.377  20.528 15.621  1.00 32.59  ? 267 SER A O   1 
ATOM   2030 C CB  . SER A 1 267 ? -10.656 18.304 14.883  1.00 30.32  ? 267 SER A CB  1 
ATOM   2031 O OG  . SER A 1 267 ? -10.791 17.374 15.941  1.00 36.72  ? 267 SER A OG  1 
ATOM   2032 N N   . GLY A 1 268 ? -7.954  18.583 16.671  1.00 29.67  ? 268 GLY A N   1 
ATOM   2033 C CA  . GLY A 1 268 ? -7.257  19.162 17.814  1.00 29.25  ? 268 GLY A CA  1 
ATOM   2034 C C   . GLY A 1 268 ? -5.846  19.652 17.559  1.00 33.64  ? 268 GLY A C   1 
ATOM   2035 O O   . GLY A 1 268 ? -5.275  20.338 18.415  1.00 33.16  ? 268 GLY A O   1 
ATOM   2036 N N   . LEU A 1 269 ? -5.250  19.276 16.407  1.00 29.98  ? 269 LEU A N   1 
ATOM   2037 C CA  . LEU A 1 269 ? -3.905  19.721 16.043  1.00 29.01  ? 269 LEU A CA  1 
ATOM   2038 C C   . LEU A 1 269 ? -3.915  21.152 15.485  1.00 32.14  ? 269 LEU A C   1 
ATOM   2039 O O   . LEU A 1 269 ? -2.869  21.806 15.506  1.00 31.80  ? 269 LEU A O   1 
ATOM   2040 C CB  . LEU A 1 269 ? -3.233  18.756 15.053  1.00 29.22  ? 269 LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 269 ? -2.678  17.425 15.587  1.00 33.01  ? 269 LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 269 ? -1.929  16.692 14.508  1.00 33.48  ? 269 LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 269 ? -1.736  17.616 16.775  1.00 33.65  ? 269 LEU A CD2 1 
ATOM   2044 N N   . ARG A 1 270 ? -5.103  21.643 15.022  1.00 28.04  ? 270 ARG A N   1 
ATOM   2045 C CA  . ARG A 1 270 ? -5.340  22.995 14.477  1.00 28.01  ? 270 ARG A CA  1 
ATOM   2046 C C   . ARG A 1 270 ? -4.430  23.306 13.275  1.00 33.23  ? 270 ARG A C   1 
ATOM   2047 O O   . ARG A 1 270 ? -3.546  24.164 13.354  1.00 32.92  ? 270 ARG A O   1 
ATOM   2048 C CB  . ARG A 1 270 ? -5.251  24.107 15.563  1.00 25.66  ? 270 ARG A CB  1 
ATOM   2049 C CG  . ARG A 1 270 ? -6.066  23.900 16.850  1.00 26.50  ? 270 ARG A CG  1 
ATOM   2050 C CD  . ARG A 1 270 ? -7.543  23.645 16.645  1.00 29.00  ? 270 ARG A CD  1 
ATOM   2051 N NE  . ARG A 1 270 ? -8.224  24.678 15.868  1.00 33.62  ? 270 ARG A NE  1 
ATOM   2052 C CZ  . ARG A 1 270 ? -8.943  24.445 14.774  1.00 43.37  ? 270 ARG A CZ  1 
ATOM   2053 N NH1 . ARG A 1 270 ? -9.064  23.213 14.297  1.00 16.38  ? 270 ARG A NH1 1 
ATOM   2054 N NH2 . ARG A 1 270 ? -9.546  25.443 14.147  1.00 35.45  ? 270 ARG A NH2 1 
ATOM   2055 N N   . ILE A 1 271 ? -4.613  22.547 12.189  1.00 29.85  ? 271 ILE A N   1 
ATOM   2056 C CA  . ILE A 1 271 ? -3.831  22.686 10.971  1.00 30.78  ? 271 ILE A CA  1 
ATOM   2057 C C   . ILE A 1 271 ? -4.748  22.626 9.757   1.00 38.56  ? 271 ILE A C   1 
ATOM   2058 O O   . ILE A 1 271 ? -5.406  21.608 9.513   1.00 38.90  ? 271 ILE A O   1 
ATOM   2059 C CB  . ILE A 1 271 ? -2.656  21.639 10.878  1.00 33.95  ? 271 ILE A CB  1 
ATOM   2060 C CG1 . ILE A 1 271 ? -1.571  21.812 11.987  1.00 32.87  ? 271 ILE A CG1 1 
ATOM   2061 C CG2 . ILE A 1 271 ? -2.030  21.573 9.459   1.00 35.67  ? 271 ILE A CG2 1 
ATOM   2062 C CD1 . ILE A 1 271 ? -0.709  23.131 11.958  1.00 29.50  ? 271 ILE A CD1 1 
ATOM   2063 N N   . GLY A 1 272 ? -4.765  23.731 9.018   1.00 36.91  ? 272 GLY A N   1 
ATOM   2064 C CA  . GLY A 1 272 ? -5.503  23.901 7.776   1.00 37.32  ? 272 GLY A CA  1 
ATOM   2065 C C   . GLY A 1 272 ? -4.657  24.677 6.786   1.00 41.01  ? 272 GLY A C   1 
ATOM   2066 O O   . GLY A 1 272 ? -3.525  25.050 7.097   1.00 39.88  ? 272 GLY A O   1 
ATOM   2067 N N   . PHE A 1 273 ? -5.194  24.936 5.592   1.00 37.81  ? 273 PHE A N   1 
ATOM   2068 C CA  . PHE A 1 273 ? -4.482  25.709 4.581   1.00 37.74  ? 273 PHE A CA  1 
ATOM   2069 C C   . PHE A 1 273 ? -5.390  26.518 3.665   1.00 41.32  ? 273 PHE A C   1 
ATOM   2070 O O   . PHE A 1 273 ? -6.504  26.099 3.345   1.00 42.07  ? 273 PHE A O   1 
ATOM   2071 C CB  . PHE A 1 273 ? -3.447  24.870 3.806   1.00 39.76  ? 273 PHE A CB  1 
ATOM   2072 C CG  . PHE A 1 273 ? -3.921  23.576 3.200   1.00 40.98  ? 273 PHE A CG  1 
ATOM   2073 C CD1 . PHE A 1 273 ? -4.139  22.456 3.995   1.00 44.02  ? 273 PHE A CD1 1 
ATOM   2074 C CD2 . PHE A 1 273 ? -4.078  23.453 1.827   1.00 44.01  ? 273 PHE A CD2 1 
ATOM   2075 C CE1 . PHE A 1 273 ? -4.572  21.252 3.432   1.00 46.08  ? 273 PHE A CE1 1 
ATOM   2076 C CE2 . PHE A 1 273 ? -4.476  22.238 1.257   1.00 47.94  ? 273 PHE A CE2 1 
ATOM   2077 C CZ  . PHE A 1 273 ? -4.717  21.144 2.062   1.00 46.00  ? 273 PHE A CZ  1 
ATOM   2078 N N   . LEU A 1 274 ? -4.898  27.686 3.259   1.00 35.58  ? 274 LEU A N   1 
ATOM   2079 C CA  . LEU A 1 274 ? -5.588  28.633 2.397   1.00 35.01  ? 274 LEU A CA  1 
ATOM   2080 C C   . LEU A 1 274 ? -4.872  28.701 1.066   1.00 39.89  ? 274 LEU A C   1 
ATOM   2081 O O   . LEU A 1 274 ? -3.644  28.757 1.038   1.00 40.00  ? 274 LEU A O   1 
ATOM   2082 C CB  . LEU A 1 274 ? -5.538  30.012 3.066   1.00 34.34  ? 274 LEU A CB  1 
ATOM   2083 C CG  . LEU A 1 274 ? -6.790  30.849 3.042   1.00 38.59  ? 274 LEU A CG  1 
ATOM   2084 C CD1 . LEU A 1 274 ? -7.887  30.206 3.842   1.00 38.55  ? 274 LEU A CD1 1 
ATOM   2085 C CD2 . LEU A 1 274 ? -6.514  32.195 3.611   1.00 38.87  ? 274 LEU A CD2 1 
ATOM   2086 N N   . THR A 1 275 ? -5.633  28.676 -0.036  1.00 36.90  ? 275 THR A N   1 
ATOM   2087 C CA  . THR A 1 275 ? -5.109  28.741 -1.406  1.00 36.89  ? 275 THR A CA  1 
ATOM   2088 C C   . THR A 1 275 ? -5.843  29.869 -2.099  1.00 40.50  ? 275 THR A C   1 
ATOM   2089 O O   . THR A 1 275 ? -7.062  29.956 -1.999  1.00 39.74  ? 275 THR A O   1 
ATOM   2090 C CB  . THR A 1 275 ? -5.324  27.424 -2.148  1.00 42.05  ? 275 THR A CB  1 
ATOM   2091 O OG1 . THR A 1 275 ? -5.221  26.321 -1.249  1.00 43.78  ? 275 THR A OG1 1 
ATOM   2092 C CG2 . THR A 1 275 ? -4.376  27.255 -3.307  1.00 39.86  ? 275 THR A CG2 1 
ATOM   2093 N N   . GLY A 1 276 ? -5.092  30.734 -2.759  1.00 38.60  ? 276 GLY A N   1 
ATOM   2094 C CA  . GLY A 1 276 ? -5.633  31.893 -3.458  1.00 40.05  ? 276 GLY A CA  1 
ATOM   2095 C C   . GLY A 1 276 ? -4.575  32.777 -4.099  1.00 45.58  ? 276 GLY A C   1 
ATOM   2096 O O   . GLY A 1 276 ? -3.394  32.406 -4.127  1.00 44.58  ? 276 GLY A O   1 
ATOM   2097 N N   . PRO A 1 277 ? -4.974  33.948 -4.650  1.00 43.88  ? 277 PRO A N   1 
ATOM   2098 C CA  . PRO A 1 277 ? -3.994  34.837 -5.300  1.00 45.43  ? 277 PRO A CA  1 
ATOM   2099 C C   . PRO A 1 277 ? -2.999  35.422 -4.313  1.00 49.40  ? 277 PRO A C   1 
ATOM   2100 O O   . PRO A 1 277 ? -3.395  35.836 -3.209  1.00 48.94  ? 277 PRO A O   1 
ATOM   2101 C CB  . PRO A 1 277 ? -4.855  35.958 -5.891  1.00 48.61  ? 277 PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 277 ? -6.245  35.456 -5.837  1.00 52.91  ? 277 PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 277 ? -6.325  34.532 -4.686  1.00 46.15  ? 277 PRO A CD  1 
ATOM   2104 N N   . LYS A 1 278 ? -1.713  35.470 -4.726  1.00 44.63  ? 278 LYS A N   1 
ATOM   2105 C CA  . LYS A 1 278 ? -0.584  35.995 -3.954  1.00 43.09  ? 278 LYS A CA  1 
ATOM   2106 C C   . LYS A 1 278 ? -0.883  37.351 -3.241  1.00 43.72  ? 278 LYS A C   1 
ATOM   2107 O O   . LYS A 1 278 ? -0.690  37.406 -2.016  1.00 40.87  ? 278 LYS A O   1 
ATOM   2108 C CB  . LYS A 1 278 ? 0.692   36.053 -4.825  1.00 47.36  ? 278 LYS A CB  1 
ATOM   2109 C CG  . LYS A 1 278 ? 1.982   36.327 -4.056  1.00 65.88  ? 278 LYS A CG  1 
ATOM   2110 C CD  . LYS A 1 278 ? 3.219   35.806 -4.787  1.00 83.09  ? 278 LYS A CD  1 
ATOM   2111 C CE  . LYS A 1 278 ? 3.579   34.375 -4.436  1.00 97.15  ? 278 LYS A CE  1 
ATOM   2112 N NZ  . LYS A 1 278 ? 4.735   33.888 -5.235  1.00 110.39 ? 278 LYS A NZ  1 
ATOM   2113 N N   . PRO A 1 279 ? -1.418  38.408 -3.926  1.00 40.05  ? 279 PRO A N   1 
ATOM   2114 C CA  . PRO A 1 279 ? -1.697  39.672 -3.214  1.00 39.42  ? 279 PRO A CA  1 
ATOM   2115 C C   . PRO A 1 279 ? -2.539  39.492 -1.957  1.00 45.77  ? 279 PRO A C   1 
ATOM   2116 O O   . PRO A 1 279 ? -2.168  39.987 -0.887  1.00 45.84  ? 279 PRO A O   1 
ATOM   2117 C CB  . PRO A 1 279 ? -2.427  40.515 -4.261  1.00 41.88  ? 279 PRO A CB  1 
ATOM   2118 C CG  . PRO A 1 279 ? -1.906  40.027 -5.530  1.00 47.47  ? 279 PRO A CG  1 
ATOM   2119 C CD  . PRO A 1 279 ? -1.729  38.546 -5.366  1.00 42.40  ? 279 PRO A CD  1 
ATOM   2120 N N   . LEU A 1 280 ? -3.640  38.730 -2.079  1.00 42.90  ? 280 LEU A N   1 
ATOM   2121 C CA  . LEU A 1 280 ? -4.565  38.458 -0.983  1.00 41.05  ? 280 LEU A CA  1 
ATOM   2122 C C   . LEU A 1 280 ? -3.989  37.510 0.067   1.00 45.08  ? 280 LEU A C   1 
ATOM   2123 O O   . LEU A 1 280 ? -4.174  37.783 1.257   1.00 45.78  ? 280 LEU A O   1 
ATOM   2124 C CB  . LEU A 1 280 ? -5.931  37.975 -1.492  1.00 40.61  ? 280 LEU A CB  1 
ATOM   2125 C CG  . LEU A 1 280 ? -6.609  38.814 -2.563  1.00 44.87  ? 280 LEU A CG  1 
ATOM   2126 C CD1 . LEU A 1 280 ? -7.788  38.076 -3.124  1.00 45.50  ? 280 LEU A CD1 1 
ATOM   2127 C CD2 . LEU A 1 280 ? -7.019  40.181 -2.039  1.00 44.55  ? 280 LEU A CD2 1 
ATOM   2128 N N   . ILE A 1 281 ? -3.269  36.431 -0.351  1.00 40.10  ? 281 ILE A N   1 
ATOM   2129 C CA  . ILE A 1 281 ? -2.613  35.483 0.576   1.00 38.45  ? 281 ILE A CA  1 
ATOM   2130 C C   . ILE A 1 281 ? -1.578  36.233 1.453   1.00 40.63  ? 281 ILE A C   1 
ATOM   2131 O O   . ILE A 1 281 ? -1.514  36.009 2.664   1.00 37.39  ? 281 ILE A O   1 
ATOM   2132 C CB  . ILE A 1 281 ? -2.034  34.230 -0.171  1.00 41.51  ? 281 ILE A CB  1 
ATOM   2133 C CG1 . ILE A 1 281 ? -3.160  33.359 -0.798  1.00 42.25  ? 281 ILE A CG1 1 
ATOM   2134 C CG2 . ILE A 1 281 ? -1.095  33.376 0.704   1.00 40.32  ? 281 ILE A CG2 1 
ATOM   2135 C CD1 . ILE A 1 281 ? -4.151  32.611 0.194   1.00 48.65  ? 281 ILE A CD1 1 
ATOM   2136 N N   . GLU A 1 282 ? -0.835  37.168 0.832   1.00 39.52  ? 282 GLU A N   1 
ATOM   2137 C CA  . GLU A 1 282 ? 0.159   38.024 1.483   1.00 39.74  ? 282 GLU A CA  1 
ATOM   2138 C C   . GLU A 1 282 ? -0.494  38.784 2.669   1.00 42.05  ? 282 GLU A C   1 
ATOM   2139 O O   . GLU A 1 282 ? -0.040  38.643 3.818   1.00 40.49  ? 282 GLU A O   1 
ATOM   2140 C CB  . GLU A 1 282 ? 0.761   38.971 0.431   1.00 42.75  ? 282 GLU A CB  1 
ATOM   2141 C CG  . GLU A 1 282 ? 1.670   40.076 0.942   1.00 55.68  ? 282 GLU A CG  1 
ATOM   2142 C CD  . GLU A 1 282 ? 2.231   40.955 -0.162  1.00 79.02  ? 282 GLU A CD  1 
ATOM   2143 O OE1 . GLU A 1 282 ? 1.458   41.378 -1.056  1.00 60.91  ? 282 GLU A OE1 1 
ATOM   2144 O OE2 . GLU A 1 282 ? 3.453   41.225 -0.127  1.00 80.88  ? 282 GLU A OE2 1 
ATOM   2145 N N   . ARG A 1 283 ? -1.610  39.507 2.395   1.00 37.36  ? 283 ARG A N   1 
ATOM   2146 C CA  . ARG A 1 283 ? -2.363  40.250 3.413   1.00 36.15  ? 283 ARG A CA  1 
ATOM   2147 C C   . ARG A 1 283 ? -2.741  39.352 4.607   1.00 38.93  ? 283 ARG A C   1 
ATOM   2148 O O   . ARG A 1 283 ? -2.623  39.793 5.764   1.00 37.57  ? 283 ARG A O   1 
ATOM   2149 C CB  . ARG A 1 283 ? -3.630  40.891 2.820   1.00 35.58  ? 283 ARG A CB  1 
ATOM   2150 C CG  . ARG A 1 283 ? -3.415  41.851 1.653   1.00 41.68  ? 283 ARG A CG  1 
ATOM   2151 C CD  . ARG A 1 283 ? -2.719  43.124 2.072   1.00 46.27  ? 283 ARG A CD  1 
ATOM   2152 N NE  . ARG A 1 283 ? -1.290  43.064 1.759   1.00 45.47  ? 283 ARG A NE  1 
ATOM   2153 C CZ  . ARG A 1 283 ? -0.369  43.851 2.303   1.00 49.08  ? 283 ARG A CZ  1 
ATOM   2154 N NH1 . ARG A 1 283 ? 0.903   43.727 1.957   1.00 46.32  ? 283 ARG A NH1 1 
ATOM   2155 N NH2 . ARG A 1 283 ? -0.712  44.763 3.202   1.00 20.54  ? 283 ARG A NH2 1 
ATOM   2156 N N   . VAL A 1 284 ? -3.152  38.080 4.312   1.00 33.58  ? 284 VAL A N   1 
ATOM   2157 C CA  . VAL A 1 284 ? -3.517  37.080 5.318   1.00 31.42  ? 284 VAL A CA  1 
ATOM   2158 C C   . VAL A 1 284 ? -2.286  36.681 6.163   1.00 34.97  ? 284 VAL A C   1 
ATOM   2159 O O   . VAL A 1 284 ? -2.382  36.715 7.391   1.00 35.06  ? 284 VAL A O   1 
ATOM   2160 C CB  . VAL A 1 284 ? -4.300  35.881 4.705   1.00 34.31  ? 284 VAL A CB  1 
ATOM   2161 C CG1 . VAL A 1 284 ? -4.416  34.695 5.670   1.00 32.37  ? 284 VAL A CG1 1 
ATOM   2162 C CG2 . VAL A 1 284 ? -5.677  36.322 4.243   1.00 34.60  ? 284 VAL A CG2 1 
ATOM   2163 N N   . ILE A 1 285 ? -1.130  36.371 5.511   1.00 30.05  ? 285 ILE A N   1 
ATOM   2164 C CA  . ILE A 1 285 ? 0.138   36.019 6.184   1.00 28.08  ? 285 ILE A CA  1 
ATOM   2165 C C   . ILE A 1 285 ? 0.585   37.176 7.085   1.00 29.69  ? 285 ILE A C   1 
ATOM   2166 O O   . ILE A 1 285 ? 0.988   36.924 8.223   1.00 27.81  ? 285 ILE A O   1 
ATOM   2167 C CB  . ILE A 1 285 ? 1.272   35.531 5.216   1.00 30.93  ? 285 ILE A CB  1 
ATOM   2168 C CG1 . ILE A 1 285 ? 0.860   34.265 4.443   1.00 31.22  ? 285 ILE A CG1 1 
ATOM   2169 C CG2 . ILE A 1 285 ? 2.577   35.277 5.975   1.00 30.39  ? 285 ILE A CG2 1 
ATOM   2170 C CD1 . ILE A 1 285 ? 1.642   34.011 3.184   1.00 36.26  ? 285 ILE A CD1 1 
ATOM   2171 N N   . LEU A 1 286 ? 0.474   38.445 6.596   1.00 26.58  ? 286 LEU A N   1 
ATOM   2172 C CA  . LEU A 1 286 ? 0.842   39.615 7.423   1.00 26.79  ? 286 LEU A CA  1 
ATOM   2173 C C   . LEU A 1 286 ? -0.012  39.799 8.704   1.00 31.03  ? 286 LEU A C   1 
ATOM   2174 O O   . LEU A 1 286 ? 0.536   40.226 9.720   1.00 29.61  ? 286 LEU A O   1 
ATOM   2175 C CB  . LEU A 1 286 ? 0.903   40.928 6.639   1.00 27.40  ? 286 LEU A CB  1 
ATOM   2176 C CG  . LEU A 1 286 ? 1.940   41.046 5.540   1.00 31.46  ? 286 LEU A CG  1 
ATOM   2177 C CD1 . LEU A 1 286 ? 1.785   42.350 4.846   1.00 32.11  ? 286 LEU A CD1 1 
ATOM   2178 C CD2 . LEU A 1 286 ? 3.345   40.926 6.083   1.00 32.33  ? 286 LEU A CD2 1 
ATOM   2179 N N   . HIS A 1 287 ? -1.331  39.456 8.660   1.00 28.22  ? 287 HIS A N   1 
ATOM   2180 C CA  . HIS A 1 287 ? -2.213  39.531 9.826   1.00 27.42  ? 287 HIS A CA  1 
ATOM   2181 C C   . HIS A 1 287 ? -1.815  38.416 10.813  1.00 32.62  ? 287 HIS A C   1 
ATOM   2182 O O   . HIS A 1 287 ? -1.673  38.675 12.015  1.00 32.11  ? 287 HIS A O   1 
ATOM   2183 C CB  . HIS A 1 287 ? -3.686  39.352 9.422   1.00 27.91  ? 287 HIS A CB  1 
ATOM   2184 C CG  . HIS A 1 287 ? -4.672  39.862 10.435  1.00 31.09  ? 287 HIS A CG  1 
ATOM   2185 N ND1 . HIS A 1 287 ? -6.027  39.953 10.140  1.00 32.97  ? 287 HIS A ND1 1 
ATOM   2186 C CD2 . HIS A 1 287 ? -4.471  40.308 11.702  1.00 32.40  ? 287 HIS A CD2 1 
ATOM   2187 C CE1 . HIS A 1 287 ? -6.591  40.460 11.223  1.00 32.27  ? 287 HIS A CE1 1 
ATOM   2188 N NE2 . HIS A 1 287 ? -5.696  40.683 12.191  1.00 32.20  ? 287 HIS A NE2 1 
ATOM   2189 N N   . ILE A 1 288 ? -1.636  37.178 10.298  1.00 29.39  ? 288 ILE A N   1 
ATOM   2190 C CA  . ILE A 1 288 ? -1.250  36.007 11.086  1.00 29.03  ? 288 ILE A CA  1 
ATOM   2191 C C   . ILE A 1 288 ? 0.020   36.307 11.858  1.00 33.81  ? 288 ILE A C   1 
ATOM   2192 O O   . ILE A 1 288 ? 0.081   36.017 13.057  1.00 33.96  ? 288 ILE A O   1 
ATOM   2193 C CB  . ILE A 1 288 ? -1.161  34.721 10.211  1.00 32.08  ? 288 ILE A CB  1 
ATOM   2194 C CG1 . ILE A 1 288 ? -2.579  34.228 9.869   1.00 32.64  ? 288 ILE A CG1 1 
ATOM   2195 C CG2 . ILE A 1 288 ? -0.335  33.605 10.910  1.00 31.75  ? 288 ILE A CG2 1 
ATOM   2196 C CD1 . ILE A 1 288 ? -2.638  33.158 8.805   1.00 44.98  ? 288 ILE A CD1 1 
ATOM   2197 N N   . GLN A 1 289 ? 0.983   36.989 11.177  1.00 30.27  ? 289 GLN A N   1 
ATOM   2198 C CA  . GLN A 1 289 ? 2.276   37.436 11.691  1.00 29.88  ? 289 GLN A CA  1 
ATOM   2199 C C   . GLN A 1 289 ? 2.139   38.313 12.967  1.00 33.24  ? 289 GLN A C   1 
ATOM   2200 O O   . GLN A 1 289 ? 3.074   38.373 13.767  1.00 33.06  ? 289 GLN A O   1 
ATOM   2201 C CB  . GLN A 1 289 ? 3.036   38.169 10.584  1.00 31.74  ? 289 GLN A CB  1 
ATOM   2202 C CG  . GLN A 1 289 ? 4.551   38.186 10.763  1.00 46.40  ? 289 GLN A CG  1 
ATOM   2203 C CD  . GLN A 1 289 ? 5.222   38.763 9.543   1.00 56.62  ? 289 GLN A CD  1 
ATOM   2204 O OE1 . GLN A 1 289 ? 5.407   39.983 9.425   1.00 52.09  ? 289 GLN A OE1 1 
ATOM   2205 N NE2 . GLN A 1 289 ? 5.527   37.900 8.574   1.00 39.45  ? 289 GLN A NE2 1 
ATOM   2206 N N   . VAL A 1 290 ? 0.974   38.967 13.155  1.00 28.69  ? 290 VAL A N   1 
ATOM   2207 C CA  . VAL A 1 290 ? 0.693   39.765 14.350  1.00 28.59  ? 290 VAL A CA  1 
ATOM   2208 C C   . VAL A 1 290 ? -0.311  39.090 15.327  1.00 32.24  ? 290 VAL A C   1 
ATOM   2209 O O   . VAL A 1 290 ? -0.607  39.641 16.386  1.00 30.87  ? 290 VAL A O   1 
ATOM   2210 C CB  . VAL A 1 290 ? 0.407   41.282 14.096  1.00 33.02  ? 290 VAL A CB  1 
ATOM   2211 C CG1 . VAL A 1 290 ? 1.541   41.951 13.320  1.00 33.12  ? 290 VAL A CG1 1 
ATOM   2212 C CG2 . VAL A 1 290 ? -0.951  41.518 13.421  1.00 32.94  ? 290 VAL A CG2 1 
ATOM   2213 N N   . SER A 1 291 ? -0.830  37.911 14.975  1.00 30.64  ? 291 SER A N   1 
ATOM   2214 C CA  . SER A 1 291 ? -1.738  37.197 15.870  1.00 31.41  ? 291 SER A CA  1 
ATOM   2215 C C   . SER A 1 291 ? -1.000  36.030 16.531  1.00 35.64  ? 291 SER A C   1 
ATOM   2216 O O   . SER A 1 291 ? -0.483  36.173 17.626  1.00 35.97  ? 291 SER A O   1 
ATOM   2217 C CB  . SER A 1 291 ? -3.004  36.706 15.152  1.00 36.75  ? 291 SER A CB  1 
ATOM   2218 O OG  . SER A 1 291 ? -3.395  37.502 14.046  1.00 52.20  ? 291 SER A OG  1 
ATOM   2219 N N   . THR A 1 292 ? -0.916  34.897 15.840  1.00 31.98  ? 292 THR A N   1 
ATOM   2220 C CA  . THR A 1 292 ? -0.338  33.656 16.347  1.00 31.09  ? 292 THR A CA  1 
ATOM   2221 C C   . THR A 1 292 ? 1.128   33.455 15.991  1.00 36.04  ? 292 THR A C   1 
ATOM   2222 O O   . THR A 1 292 ? 1.687   32.436 16.420  1.00 36.01  ? 292 THR A O   1 
ATOM   2223 C CB  . THR A 1 292 ? -1.169  32.481 15.817  1.00 30.96  ? 292 THR A CB  1 
ATOM   2224 O OG1 . THR A 1 292 ? -1.307  32.642 14.404  1.00 27.13  ? 292 THR A OG1 1 
ATOM   2225 C CG2 . THR A 1 292 ? -2.548  32.406 16.449  1.00 30.21  ? 292 THR A CG2 1 
ATOM   2226 N N   . LEU A 1 293 ? 1.758   34.411 15.221  1.00 30.99  ? 293 LEU A N   1 
ATOM   2227 C CA  . LEU A 1 293 ? 3.118   34.358 14.648  1.00 29.81  ? 293 LEU A CA  1 
ATOM   2228 C C   . LEU A 1 293 ? 3.241   33.241 13.585  1.00 34.42  ? 293 LEU A C   1 
ATOM   2229 O O   . LEU A 1 293 ? 3.733   33.512 12.494  1.00 36.22  ? 293 LEU A O   1 
ATOM   2230 C CB  . LEU A 1 293 ? 4.260   34.214 15.684  1.00 29.53  ? 293 LEU A CB  1 
ATOM   2231 C CG  . LEU A 1 293 ? 4.462   35.259 16.796  1.00 33.30  ? 293 LEU A CG  1 
ATOM   2232 C CD1 . LEU A 1 293 ? 5.827   35.111 17.404  1.00 32.98  ? 293 LEU A CD1 1 
ATOM   2233 C CD2 . LEU A 1 293 ? 4.371   36.671 16.282  1.00 36.62  ? 293 LEU A CD2 1 
ATOM   2234 N N   . HIS A 1 294 ? 2.796   31.997 13.893  1.00 29.61  ? 294 HIS A N   1 
ATOM   2235 C CA  . HIS A 1 294 ? 2.865   30.830 12.994  1.00 29.90  ? 294 HIS A CA  1 
ATOM   2236 C C   . HIS A 1 294 ? 2.046   29.653 13.549  1.00 31.61  ? 294 HIS A C   1 
ATOM   2237 O O   . HIS A 1 294 ? 1.770   29.638 14.758  1.00 29.31  ? 294 HIS A O   1 
ATOM   2238 C CB  . HIS A 1 294 ? 4.348   30.388 12.791  1.00 31.72  ? 294 HIS A CB  1 
ATOM   2239 C CG  . HIS A 1 294 ? 5.072   29.952 14.046  1.00 35.02  ? 294 HIS A CG  1 
ATOM   2240 N ND1 . HIS A 1 294 ? 5.024   28.639 14.498  1.00 36.29  ? 294 HIS A ND1 1 
ATOM   2241 C CD2 . HIS A 1 294 ? 5.847   30.668 14.896  1.00 36.73  ? 294 HIS A CD2 1 
ATOM   2242 C CE1 . HIS A 1 294 ? 5.769   28.604 15.593  1.00 35.69  ? 294 HIS A CE1 1 
ATOM   2243 N NE2 . HIS A 1 294 ? 6.277   29.801 15.878  1.00 36.23  ? 294 HIS A NE2 1 
ATOM   2244 N N   . PRO A 1 295 ? 1.686   28.634 12.725  1.00 29.67  ? 295 PRO A N   1 
ATOM   2245 C CA  . PRO A 1 295 ? 1.017   27.441 13.294  1.00 29.59  ? 295 PRO A CA  1 
ATOM   2246 C C   . PRO A 1 295 ? 2.072   26.566 14.003  1.00 32.62  ? 295 PRO A C   1 
ATOM   2247 O O   . PRO A 1 295 ? 3.220   26.534 13.554  1.00 32.48  ? 295 PRO A O   1 
ATOM   2248 C CB  . PRO A 1 295 ? 0.411   26.727 12.063  1.00 31.50  ? 295 PRO A CB  1 
ATOM   2249 C CG  . PRO A 1 295 ? 0.756   27.595 10.852  1.00 36.80  ? 295 PRO A CG  1 
ATOM   2250 C CD  . PRO A 1 295 ? 1.911   28.470 11.274  1.00 32.53  ? 295 PRO A CD  1 
ATOM   2251 N N   . SER A 1 296 ? 1.701   25.904 15.126  1.00 27.96  ? 296 SER A N   1 
ATOM   2252 C CA  . SER A 1 296 ? 2.573   25.047 15.943  1.00 27.56  ? 296 SER A CA  1 
ATOM   2253 C C   . SER A 1 296 ? 3.606   24.276 15.107  1.00 32.19  ? 296 SER A C   1 
ATOM   2254 O O   . SER A 1 296 ? 3.220   23.576 14.172  1.00 33.65  ? 296 SER A O   1 
ATOM   2255 C CB  . SER A 1 296 ? 1.727   24.089 16.781  1.00 29.68  ? 296 SER A CB  1 
ATOM   2256 O OG  . SER A 1 296 ? 2.519   23.155 17.497  1.00 32.77  ? 296 SER A OG  1 
ATOM   2257 N N   . THR A 1 297 ? 4.911   24.458 15.396  1.00 28.40  ? 297 THR A N   1 
ATOM   2258 C CA  . THR A 1 297 ? 5.998   23.795 14.651  1.00 28.59  ? 297 THR A CA  1 
ATOM   2259 C C   . THR A 1 297 ? 5.901   22.288 14.844  1.00 33.47  ? 297 THR A C   1 
ATOM   2260 O O   . THR A 1 297 ? 5.968   21.544 13.858  1.00 33.78  ? 297 THR A O   1 
ATOM   2261 C CB  . THR A 1 297 ? 7.396   24.353 15.024  1.00 32.41  ? 297 THR A CB  1 
ATOM   2262 O OG1 . THR A 1 297 ? 7.360   25.782 15.132  1.00 33.94  ? 297 THR A OG1 1 
ATOM   2263 C CG2 . THR A 1 297 ? 8.477   23.950 14.031  1.00 27.07  ? 297 THR A CG2 1 
ATOM   2264 N N   . PHE A 1 298 ? 5.682   21.845 16.107  1.00 29.80  ? 298 PHE A N   1 
ATOM   2265 C CA  . PHE A 1 298 ? 5.549   20.427 16.466  1.00 29.38  ? 298 PHE A CA  1 
ATOM   2266 C C   . PHE A 1 298 ? 4.444   19.759 15.635  1.00 32.85  ? 298 PHE A C   1 
ATOM   2267 O O   . PHE A 1 298 ? 4.701   18.739 15.001  1.00 33.11  ? 298 PHE A O   1 
ATOM   2268 C CB  . PHE A 1 298 ? 5.266   20.279 17.980  1.00 30.69  ? 298 PHE A CB  1 
ATOM   2269 C CG  . PHE A 1 298 ? 5.423   18.890 18.554  1.00 32.84  ? 298 PHE A CG  1 
ATOM   2270 C CD1 . PHE A 1 298 ? 4.468   17.904 18.314  1.00 36.92  ? 298 PHE A CD1 1 
ATOM   2271 C CD2 . PHE A 1 298 ? 6.497   18.578 19.380  1.00 35.81  ? 298 PHE A CD2 1 
ATOM   2272 C CE1 . PHE A 1 298 ? 4.616   16.612 18.847  1.00 38.30  ? 298 PHE A CE1 1 
ATOM   2273 C CE2 . PHE A 1 298 ? 6.640   17.291 19.921  1.00 39.21  ? 298 PHE A CE2 1 
ATOM   2274 C CZ  . PHE A 1 298 ? 5.699   16.319 19.653  1.00 37.38  ? 298 PHE A CZ  1 
ATOM   2275 N N   . ASN A 1 299 ? 3.234   20.352 15.625  1.00 28.88  ? 299 ASN A N   1 
ATOM   2276 C CA  . ASN A 1 299 ? 2.052   19.820 14.943  1.00 28.89  ? 299 ASN A CA  1 
ATOM   2277 C C   . ASN A 1 299 ? 2.191   19.665 13.423  1.00 33.66  ? 299 ASN A C   1 
ATOM   2278 O O   . ASN A 1 299 ? 1.666   18.689 12.855  1.00 33.20  ? 299 ASN A O   1 
ATOM   2279 C CB  . ASN A 1 299 ? 0.791   20.589 15.338  1.00 27.53  ? 299 ASN A CB  1 
ATOM   2280 C CG  . ASN A 1 299 ? 0.468   20.532 16.818  1.00 39.65  ? 299 ASN A CG  1 
ATOM   2281 O OD1 . ASN A 1 299 ? 1.140   19.865 17.617  1.00 34.98  ? 299 ASN A OD1 1 
ATOM   2282 N ND2 . ASN A 1 299 ? -0.583  21.233 17.214  1.00 23.69  ? 299 ASN A ND2 1 
ATOM   2283 N N   . GLN A 1 300 ? 2.924   20.607 12.782  1.00 28.34  ? 300 GLN A N   1 
ATOM   2284 C CA  . GLN A 1 300 ? 3.200   20.598 11.350  1.00 28.24  ? 300 GLN A CA  1 
ATOM   2285 C C   . GLN A 1 300 ? 4.164   19.447 10.994  1.00 33.55  ? 300 GLN A C   1 
ATOM   2286 O O   . GLN A 1 300 ? 3.919   18.704 10.033  1.00 33.04  ? 300 GLN A O   1 
ATOM   2287 C CB  . GLN A 1 300 ? 3.834   21.927 10.933  1.00 29.25  ? 300 GLN A CB  1 
ATOM   2288 C CG  . GLN A 1 300 ? 2.874   23.095 10.913  1.00 29.05  ? 300 GLN A CG  1 
ATOM   2289 C CD  . GLN A 1 300 ? 3.529   24.280 10.286  1.00 31.82  ? 300 GLN A CD  1 
ATOM   2290 O OE1 . GLN A 1 300 ? 3.617   24.376 9.060   1.00 25.46  ? 300 GLN A OE1 1 
ATOM   2291 N NE2 . GLN A 1 300 ? 4.063   25.169 11.113  1.00 15.85  ? 300 GLN A NE2 1 
ATOM   2292 N N   . LEU A 1 301 ? 5.263   19.312 11.789  1.00 30.23  ? 301 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 301 ? 6.330   18.304 11.665  1.00 30.12  ? 301 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 301 ? 5.764   16.927 11.837  1.00 32.96  ? 301 LEU A C   1 
ATOM   2295 O O   . LEU A 1 301 ? 6.267   16.014 11.231  1.00 32.32  ? 301 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 301 ? 7.395   18.541 12.752  1.00 30.45  ? 301 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 301 ? 8.821   19.051 12.408  1.00 35.45  ? 301 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 301 ? 9.048   19.336 10.929  1.00 35.99  ? 301 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 301 ? 9.193   20.222 13.260  1.00 35.62  ? 301 LEU A CD2 1 
ATOM   2300 N N   . MET A 1 302 ? 4.725   16.774 12.672  1.00 31.41  ? 302 MET A N   1 
ATOM   2301 C CA  . MET A 1 302 ? 4.017   15.515 12.921  1.00 32.41  ? 302 MET A CA  1 
ATOM   2302 C C   . MET A 1 302 ? 3.321   15.058 11.637  1.00 35.08  ? 302 MET A C   1 
ATOM   2303 O O   . MET A 1 302 ? 3.427   13.890 11.276  1.00 37.94  ? 302 MET A O   1 
ATOM   2304 C CB  . MET A 1 302 ? 2.948   15.722 13.992  1.00 34.94  ? 302 MET A CB  1 
ATOM   2305 C CG  . MET A 1 302 ? 3.422   15.540 15.410  1.00 40.33  ? 302 MET A CG  1 
ATOM   2306 S SD  . MET A 1 302 ? 1.981   15.562 16.523  1.00 45.53  ? 302 MET A SD  1 
ATOM   2307 C CE  . MET A 1 302 ? 1.260   13.932 16.171  1.00 42.32  ? 302 MET A CE  1 
ATOM   2308 N N   . ILE A 1 303 ? 2.621   15.989 10.947  1.00 26.66  ? 303 ILE A N   1 
ATOM   2309 C CA  . ILE A 1 303 ? 1.880   15.774 9.708   1.00 24.13  ? 303 ILE A CA  1 
ATOM   2310 C C   . ILE A 1 303 ? 2.843   15.607 8.552   1.00 27.73  ? 303 ILE A C   1 
ATOM   2311 O O   . ILE A 1 303 ? 2.706   14.648 7.799   1.00 27.99  ? 303 ILE A O   1 
ATOM   2312 C CB  . ILE A 1 303 ? 0.800   16.881 9.513   1.00 25.67  ? 303 ILE A CB  1 
ATOM   2313 C CG1 . ILE A 1 303 ? -0.343  16.712 10.565  1.00 25.42  ? 303 ILE A CG1 1 
ATOM   2314 C CG2 . ILE A 1 303 ? 0.248   16.939 8.088   1.00 24.85  ? 303 ILE A CG2 1 
ATOM   2315 C CD1 . ILE A 1 303 ? -1.144  18.000 10.973  1.00 28.00  ? 303 ILE A CD1 1 
ATOM   2316 N N   . SER A 1 304 ? 3.860   16.468 8.448   1.00 25.12  ? 304 SER A N   1 
ATOM   2317 C CA  . SER A 1 304 ? 4.845   16.344 7.366   1.00 26.62  ? 304 SER A CA  1 
ATOM   2318 C C   . SER A 1 304 ? 5.653   15.026 7.414   1.00 34.55  ? 304 SER A C   1 
ATOM   2319 O O   . SER A 1 304 ? 5.935   14.456 6.351   1.00 37.54  ? 304 SER A O   1 
ATOM   2320 C CB  . SER A 1 304 ? 5.735   17.584 7.261   1.00 29.76  ? 304 SER A CB  1 
ATOM   2321 O OG  . SER A 1 304 ? 6.911   17.533 8.057   1.00 40.87  ? 304 SER A OG  1 
ATOM   2322 N N   . GLN A 1 305 ? 5.973   14.516 8.630   1.00 30.94  ? 305 GLN A N   1 
ATOM   2323 C CA  . GLN A 1 305 ? 6.702   13.248 8.792   1.00 32.38  ? 305 GLN A CA  1 
ATOM   2324 C C   . GLN A 1 305 ? 5.791   12.073 8.375   1.00 37.65  ? 305 GLN A C   1 
ATOM   2325 O O   . GLN A 1 305 ? 6.248   11.117 7.714   1.00 38.35  ? 305 GLN A O   1 
ATOM   2326 C CB  . GLN A 1 305 ? 7.238   13.052 10.236  1.00 33.36  ? 305 GLN A CB  1 
ATOM   2327 C CG  . GLN A 1 305 ? 8.486   13.870 10.617  1.00 45.18  ? 305 GLN A CG  1 
ATOM   2328 C CD  . GLN A 1 305 ? 9.717   13.659 9.761   1.00 75.96  ? 305 GLN A CD  1 
ATOM   2329 O OE1 . GLN A 1 305 ? 10.151  14.563 9.030   1.00 74.25  ? 305 GLN A OE1 1 
ATOM   2330 N NE2 . GLN A 1 305 ? 10.342  12.487 9.876   1.00 70.21  ? 305 GLN A NE2 1 
ATOM   2331 N N   . LEU A 1 306 ? 4.490   12.169 8.756   1.00 32.16  ? 306 LEU A N   1 
ATOM   2332 C CA  . LEU A 1 306 ? 3.485   11.180 8.401   1.00 31.61  ? 306 LEU A CA  1 
ATOM   2333 C C   . LEU A 1 306 ? 3.377   11.166 6.873   1.00 38.85  ? 306 LEU A C   1 
ATOM   2334 O O   . LEU A 1 306 ? 3.485   10.100 6.267   1.00 39.49  ? 306 LEU A O   1 
ATOM   2335 C CB  . LEU A 1 306 ? 2.139   11.544 9.063   1.00 29.66  ? 306 LEU A CB  1 
ATOM   2336 C CG  . LEU A 1 306 ? 0.875   10.764 8.641   1.00 33.16  ? 306 LEU A CG  1 
ATOM   2337 C CD1 . LEU A 1 306 ? 0.840   9.380  9.243   1.00 33.06  ? 306 LEU A CD1 1 
ATOM   2338 C CD2 . LEU A 1 306 ? -0.387  11.521 9.038   1.00 33.48  ? 306 LEU A CD2 1 
ATOM   2339 N N   . LEU A 1 307 ? 3.249   12.368 6.254   1.00 36.31  ? 307 LEU A N   1 
ATOM   2340 C CA  . LEU A 1 307 ? 3.117   12.538 4.799   1.00 36.77  ? 307 LEU A CA  1 
ATOM   2341 C C   . LEU A 1 307 ? 4.322   12.036 4.039   1.00 41.72  ? 307 LEU A C   1 
ATOM   2342 O O   . LEU A 1 307 ? 4.163   11.439 2.975   1.00 42.51  ? 307 LEU A O   1 
ATOM   2343 C CB  . LEU A 1 307 ? 2.783   13.989 4.404   1.00 35.75  ? 307 LEU A CB  1 
ATOM   2344 C CG  . LEU A 1 307 ? 1.441   14.556 4.892   1.00 38.02  ? 307 LEU A CG  1 
ATOM   2345 C CD1 . LEU A 1 307 ? 1.325   16.012 4.542   1.00 37.96  ? 307 LEU A CD1 1 
ATOM   2346 C CD2 . LEU A 1 307 ? 0.243   13.743 4.385   1.00 37.98  ? 307 LEU A CD2 1 
ATOM   2347 N N   . HIS A 1 308 ? 5.518   12.219 4.603   1.00 37.75  ? 308 HIS A N   1 
ATOM   2348 C CA  . HIS A 1 308 ? 6.727   11.716 3.960   1.00 38.94  ? 308 HIS A CA  1 
ATOM   2349 C C   . HIS A 1 308 ? 6.751   10.183 3.893   1.00 40.00  ? 308 HIS A C   1 
ATOM   2350 O O   . HIS A 1 308 ? 7.263   9.623  2.923   1.00 39.13  ? 308 HIS A O   1 
ATOM   2351 C CB  . HIS A 1 308 ? 7.997   12.261 4.635   1.00 40.19  ? 308 HIS A CB  1 
ATOM   2352 C CG  . HIS A 1 308 ? 9.244   11.776 3.964   1.00 45.61  ? 308 HIS A CG  1 
ATOM   2353 N ND1 . HIS A 1 308 ? 9.929   10.667 4.430   1.00 48.51  ? 308 HIS A ND1 1 
ATOM   2354 C CD2 . HIS A 1 308 ? 9.836   12.208 2.827   1.00 48.64  ? 308 HIS A CD2 1 
ATOM   2355 C CE1 . HIS A 1 308 ? 10.942  10.493 3.597   1.00 49.46  ? 308 HIS A CE1 1 
ATOM   2356 N NE2 . HIS A 1 308 ? 10.926  11.390 2.615   1.00 49.98  ? 308 HIS A NE2 1 
ATOM   2357 N N   . GLU A 1 309 ? 6.208   9.528  4.938   1.00 36.40  ? 309 GLU A N   1 
ATOM   2358 C CA  . GLU A 1 309 ? 6.128   8.074  5.103   1.00 37.03  ? 309 GLU A CA  1 
ATOM   2359 C C   . GLU A 1 309 ? 5.096   7.466  4.136   1.00 40.50  ? 309 GLU A C   1 
ATOM   2360 O O   . GLU A 1 309 ? 5.414   6.541  3.393   1.00 39.71  ? 309 GLU A O   1 
ATOM   2361 C CB  . GLU A 1 309 ? 5.767   7.754  6.561   1.00 37.69  ? 309 GLU A CB  1 
ATOM   2362 C CG  . GLU A 1 309 ? 6.310   6.427  7.059   1.00 55.67  ? 309 GLU A CG  1 
ATOM   2363 C CD  . GLU A 1 309 ? 7.786   6.400  7.404   1.00 90.86  ? 309 GLU A CD  1 
ATOM   2364 O OE1 . GLU A 1 309 ? 8.261   7.332  8.096   1.00 87.60  ? 309 GLU A OE1 1 
ATOM   2365 O OE2 . GLU A 1 309 ? 8.465   5.428  6.999   1.00 93.32  ? 309 GLU A OE2 1 
ATOM   2366 N N   . TRP A 1 310 ? 3.882   8.031  4.130   1.00 37.90  ? 310 TRP A N   1 
ATOM   2367 C CA  . TRP A 1 310 ? 2.747   7.648  3.308   1.00 39.18  ? 310 TRP A CA  1 
ATOM   2368 C C   . TRP A 1 310 ? 2.931   7.927  1.800   1.00 43.13  ? 310 TRP A C   1 
ATOM   2369 O O   . TRP A 1 310 ? 2.727   7.013  0.999   1.00 43.46  ? 310 TRP A O   1 
ATOM   2370 C CB  . TRP A 1 310 ? 1.514   8.430  3.784   1.00 37.86  ? 310 TRP A CB  1 
ATOM   2371 C CG  . TRP A 1 310 ? 0.688   7.817  4.879   1.00 39.28  ? 310 TRP A CG  1 
ATOM   2372 C CD1 . TRP A 1 310 ? 0.852   6.593  5.465   1.00 43.21  ? 310 TRP A CD1 1 
ATOM   2373 C CD2 . TRP A 1 310 ? -0.460  8.407  5.497   1.00 37.96  ? 310 TRP A CD2 1 
ATOM   2374 N NE1 . TRP A 1 310 ? -0.120  6.391  6.422   1.00 42.02  ? 310 TRP A NE1 1 
ATOM   2375 C CE2 . TRP A 1 310 ? -0.928  7.497  6.474   1.00 42.05  ? 310 TRP A CE2 1 
ATOM   2376 C CE3 . TRP A 1 310 ? -1.140  9.620  5.322   1.00 38.36  ? 310 TRP A CE3 1 
ATOM   2377 C CZ2 . TRP A 1 310 ? -2.034  7.772  7.284   1.00 40.14  ? 310 TRP A CZ2 1 
ATOM   2378 C CZ3 . TRP A 1 310 ? -2.232  9.891  6.132   1.00 39.12  ? 310 TRP A CZ3 1 
ATOM   2379 C CH2 . TRP A 1 310 ? -2.677  8.966  7.089   1.00 39.46  ? 310 TRP A CH2 1 
ATOM   2380 N N   . GLY A 1 311 ? 3.225   9.198  1.441   1.00 38.44  ? 311 GLY A N   1 
ATOM   2381 C CA  . GLY A 1 311 ? 3.297   9.694  0.070   1.00 38.28  ? 311 GLY A CA  1 
ATOM   2382 C C   . GLY A 1 311 ? 1.882   9.980  -0.399  1.00 42.80  ? 311 GLY A C   1 
ATOM   2383 O O   . GLY A 1 311 ? 0.937   9.847  0.390   1.00 40.68  ? 311 GLY A O   1 
ATOM   2384 N N   . GLU A 1 312 ? 1.705   10.360 -1.685  1.00 41.21  ? 312 GLU A N   1 
ATOM   2385 C CA  . GLU A 1 312 ? 0.367   10.618 -2.235  1.00 40.16  ? 312 GLU A CA  1 
ATOM   2386 C C   . GLU A 1 312 ? -0.553  9.411  -2.164  1.00 40.42  ? 312 GLU A C   1 
ATOM   2387 O O   . GLU A 1 312 ? -1.697  9.579  -1.745  1.00 37.38  ? 312 GLU A O   1 
ATOM   2388 C CB  . GLU A 1 312 ? 0.419   11.215 -3.653  1.00 43.02  ? 312 GLU A CB  1 
ATOM   2389 C CG  . GLU A 1 312 ? 0.639   12.717 -3.624  1.00 56.07  ? 312 GLU A CG  1 
ATOM   2390 C CD  . GLU A 1 312 ? 0.899   13.422 -4.945  1.00 90.13  ? 312 GLU A CD  1 
ATOM   2391 O OE1 . GLU A 1 312 ? 1.413   12.783 -5.894  1.00 88.54  ? 312 GLU A OE1 1 
ATOM   2392 O OE2 . GLU A 1 312 ? 0.653   14.648 -5.005  1.00 89.06  ? 312 GLU A OE2 1 
ATOM   2393 N N   . GLU A 1 313 ? -0.046  8.197  -2.534  1.00 37.62  ? 313 GLU A N   1 
ATOM   2394 C CA  . GLU A 1 313 ? -0.804  6.931  -2.537  1.00 37.68  ? 313 GLU A CA  1 
ATOM   2395 C C   . GLU A 1 313 ? -1.331  6.591  -1.162  1.00 42.08  ? 313 GLU A C   1 
ATOM   2396 O O   . GLU A 1 313 ? -2.523  6.359  -1.008  1.00 40.67  ? 313 GLU A O   1 
ATOM   2397 C CB  . GLU A 1 313 ? 0.041   5.774  -3.066  1.00 40.28  ? 313 GLU A CB  1 
ATOM   2398 C CG  . GLU A 1 313 ? 0.063   5.697  -4.575  1.00 51.45  ? 313 GLU A CG  1 
ATOM   2399 C CD  . GLU A 1 313 ? 1.302   5.053  -5.160  1.00 80.82  ? 313 GLU A CD  1 
ATOM   2400 O OE1 . GLU A 1 313 ? 1.896   4.171  -4.495  1.00 71.41  ? 313 GLU A OE1 1 
ATOM   2401 O OE2 . GLU A 1 313 ? 1.670   5.424  -6.299  1.00 84.30  ? 313 GLU A OE2 1 
ATOM   2402 N N   . GLY A 1 314 ? -0.437  6.613  -0.175  1.00 40.14  ? 314 GLY A N   1 
ATOM   2403 C CA  . GLY A 1 314 ? -0.734  6.338  1.228   1.00 38.48  ? 314 GLY A CA  1 
ATOM   2404 C C   . GLY A 1 314 ? -1.761  7.272  1.808   1.00 38.23  ? 314 GLY A C   1 
ATOM   2405 O O   . GLY A 1 314 ? -2.589  6.837  2.607   1.00 36.48  ? 314 GLY A O   1 
ATOM   2406 N N   . PHE A 1 315 ? -1.710  8.556  1.383   1.00 35.02  ? 315 PHE A N   1 
ATOM   2407 C CA  . PHE A 1 315 ? -2.642  9.621  1.769   1.00 34.31  ? 315 PHE A CA  1 
ATOM   2408 C C   . PHE A 1 315 ? -3.998  9.416  1.081   1.00 37.38  ? 315 PHE A C   1 
ATOM   2409 O O   . PHE A 1 315 ? -5.025  9.652  1.706   1.00 35.74  ? 315 PHE A O   1 
ATOM   2410 C CB  . PHE A 1 315 ? -2.082  11.020 1.433   1.00 36.42  ? 315 PHE A CB  1 
ATOM   2411 C CG  . PHE A 1 315 ? -3.080  12.141 1.627   1.00 37.70  ? 315 PHE A CG  1 
ATOM   2412 C CD1 . PHE A 1 315 ? -3.347  12.647 2.900   1.00 40.94  ? 315 PHE A CD1 1 
ATOM   2413 C CD2 . PHE A 1 315 ? -3.764  12.679 0.545   1.00 40.14  ? 315 PHE A CD2 1 
ATOM   2414 C CE1 . PHE A 1 315 ? -4.279  13.679 3.081   1.00 40.99  ? 315 PHE A CE1 1 
ATOM   2415 C CE2 . PHE A 1 315 ? -4.700  13.707 0.729   1.00 42.64  ? 315 PHE A CE2 1 
ATOM   2416 C CZ  . PHE A 1 315 ? -4.960  14.191 1.996   1.00 39.80  ? 315 PHE A CZ  1 
ATOM   2417 N N   . MET A 1 316 ? -3.998  9.020  -0.210  1.00 34.46  ? 316 MET A N   1 
ATOM   2418 C CA  . MET A 1 316 ? -5.224  8.770  -0.964  1.00 33.98  ? 316 MET A CA  1 
ATOM   2419 C C   . MET A 1 316 ? -5.899  7.519  -0.442  1.00 36.20  ? 316 MET A C   1 
ATOM   2420 O O   . MET A 1 316 ? -7.115  7.542  -0.240  1.00 36.10  ? 316 MET A O   1 
ATOM   2421 C CB  . MET A 1 316 ? -4.981  8.716  -2.484  1.00 38.04  ? 316 MET A CB  1 
ATOM   2422 C CG  . MET A 1 316 ? -4.567  10.067 -3.108  1.00 41.99  ? 316 MET A CG  1 
ATOM   2423 S SD  . MET A 1 316 ? -5.449  11.558 -2.523  1.00 44.87  ? 316 MET A SD  1 
ATOM   2424 C CE  . MET A 1 316 ? -7.012  11.381 -3.390  1.00 42.53  ? 316 MET A CE  1 
ATOM   2425 N N   . ALA A 1 317 ? -5.105  6.457  -0.133  1.00 32.35  ? 317 ALA A N   1 
ATOM   2426 C CA  . ALA A 1 317 ? -5.581  5.193  0.470   1.00 31.67  ? 317 ALA A CA  1 
ATOM   2427 C C   . ALA A 1 317 ? -6.242  5.476  1.845   1.00 34.28  ? 317 ALA A C   1 
ATOM   2428 O O   . ALA A 1 317 ? -7.284  4.883  2.152   1.00 32.38  ? 317 ALA A O   1 
ATOM   2429 C CB  . ALA A 1 317 ? -4.437  4.198  0.622   1.00 32.67  ? 317 ALA A CB  1 
ATOM   2430 N N   . HIS A 1 318 ? -5.659  6.427  2.634   1.00 30.60  ? 318 HIS A N   1 
ATOM   2431 C CA  . HIS A 1 318 ? -6.235  6.840  3.906   1.00 29.99  ? 318 HIS A CA  1 
ATOM   2432 C C   . HIS A 1 318 ? -7.553  7.572  3.682   1.00 35.63  ? 318 HIS A C   1 
ATOM   2433 O O   . HIS A 1 318 ? -8.499  7.266  4.408   1.00 36.01  ? 318 HIS A O   1 
ATOM   2434 C CB  . HIS A 1 318 ? -5.292  7.700  4.742   1.00 30.07  ? 318 HIS A CB  1 
ATOM   2435 C CG  . HIS A 1 318 ? -5.954  8.221  5.982   1.00 32.85  ? 318 HIS A CG  1 
ATOM   2436 N ND1 . HIS A 1 318 ? -6.135  7.415  7.099   1.00 34.75  ? 318 HIS A ND1 1 
ATOM   2437 C CD2 . HIS A 1 318 ? -6.500  9.438  6.229   1.00 33.90  ? 318 HIS A CD2 1 
ATOM   2438 C CE1 . HIS A 1 318 ? -6.749  8.175  7.993   1.00 33.07  ? 318 HIS A CE1 1 
ATOM   2439 N NE2 . HIS A 1 318 ? -6.989  9.400  7.519   1.00 32.92  ? 318 HIS A NE2 1 
ATOM   2440 N N   . VAL A 1 319 ? -7.640  8.518  2.688   1.00 31.98  ? 319 VAL A N   1 
ATOM   2441 C CA  . VAL A 1 319 ? -8.911  9.220  2.438   1.00 31.53  ? 319 VAL A CA  1 
ATOM   2442 C C   . VAL A 1 319 ? -10.027 8.240  2.107   1.00 37.14  ? 319 VAL A C   1 
ATOM   2443 O O   . VAL A 1 319 ? -11.115 8.344  2.665   1.00 36.43  ? 319 VAL A O   1 
ATOM   2444 C CB  . VAL A 1 319 ? -8.904  10.501 1.555   1.00 35.10  ? 319 VAL A CB  1 
ATOM   2445 C CG1 . VAL A 1 319 ? -7.643  11.324 1.750   1.00 34.54  ? 319 VAL A CG1 1 
ATOM   2446 C CG2 . VAL A 1 319 ? -9.141  10.206 0.085   1.00 36.33  ? 319 VAL A CG2 1 
ATOM   2447 N N   . ASP A 1 320 ? -9.702  7.216  1.315   1.00 35.50  ? 320 ASP A N   1 
ATOM   2448 C CA  . ASP A 1 320 ? -10.642 6.168  0.949   1.00 36.73  ? 320 ASP A CA  1 
ATOM   2449 C C   . ASP A 1 320 ? -11.169 5.340  2.123   1.00 39.98  ? 320 ASP A C   1 
ATOM   2450 O O   . ASP A 1 320 ? -12.327 4.923  2.088   1.00 40.22  ? 320 ASP A O   1 
ATOM   2451 C CB  . ASP A 1 320 ? -10.080 5.307  -0.186  1.00 40.46  ? 320 ASP A CB  1 
ATOM   2452 C CG  . ASP A 1 320 ? -10.291 5.983  -1.528  1.00 58.06  ? 320 ASP A CG  1 
ATOM   2453 O OD1 . ASP A 1 320 ? -11.471 6.118  -1.949  1.00 60.24  ? 320 ASP A OD1 1 
ATOM   2454 O OD2 . ASP A 1 320 ? -9.291  6.441  -2.130  1.00 65.86  ? 320 ASP A OD2 1 
ATOM   2455 N N   . ARG A 1 321 ? -10.344 5.147  3.178   1.00 35.04  ? 321 ARG A N   1 
ATOM   2456 C CA  . ARG A 1 321 ? -10.737 4.411  4.382   1.00 33.77  ? 321 ARG A CA  1 
ATOM   2457 C C   . ARG A 1 321 ? -11.693 5.274  5.208   1.00 36.55  ? 321 ARG A C   1 
ATOM   2458 O O   . ARG A 1 321 ? -12.636 4.760  5.806   1.00 36.63  ? 321 ARG A O   1 
ATOM   2459 C CB  . ARG A 1 321 ? -9.507  4.005  5.208   1.00 32.84  ? 321 ARG A CB  1 
ATOM   2460 C CG  . ARG A 1 321 ? -8.716  2.848  4.611   1.00 43.00  ? 321 ARG A CG  1 
ATOM   2461 C CD  . ARG A 1 321 ? -7.632  2.331  5.547   1.00 56.81  ? 321 ARG A CD  1 
ATOM   2462 N NE  . ARG A 1 321 ? -6.462  3.213  5.635   1.00 66.33  ? 321 ARG A NE  1 
ATOM   2463 C CZ  . ARG A 1 321 ? -5.426  3.171  4.800   1.00 83.24  ? 321 ARG A CZ  1 
ATOM   2464 N NH1 . ARG A 1 321 ? -5.416  2.313  3.784   1.00 75.37  ? 321 ARG A NH1 1 
ATOM   2465 N NH2 . ARG A 1 321 ? -4.401  3.998  4.962   1.00 67.59  ? 321 ARG A NH2 1 
ATOM   2466 N N   . VAL A 1 322 ? -11.473 6.595  5.196   1.00 31.66  ? 322 VAL A N   1 
ATOM   2467 C CA  . VAL A 1 322 ? -12.336 7.545  5.890   1.00 29.93  ? 322 VAL A CA  1 
ATOM   2468 C C   . VAL A 1 322 ? -13.708 7.589  5.161   1.00 35.83  ? 322 VAL A C   1 
ATOM   2469 O O   . VAL A 1 322 ? -14.739 7.434  5.822   1.00 35.45  ? 322 VAL A O   1 
ATOM   2470 C CB  . VAL A 1 322 ? -11.648 8.931  6.075   1.00 30.80  ? 322 VAL A CB  1 
ATOM   2471 C CG1 . VAL A 1 322 ? -12.575 9.937  6.751   1.00 28.82  ? 322 VAL A CG1 1 
ATOM   2472 C CG2 . VAL A 1 322 ? -10.359 8.789  6.869   1.00 29.81  ? 322 VAL A CG2 1 
ATOM   2473 N N   . ILE A 1 323 ? -13.706 7.733  3.811   1.00 34.23  ? 323 ILE A N   1 
ATOM   2474 C CA  . ILE A 1 323 ? -14.923 7.732  2.983   1.00 36.30  ? 323 ILE A CA  1 
ATOM   2475 C C   . ILE A 1 323 ? -15.706 6.446  3.253   1.00 40.93  ? 323 ILE A C   1 
ATOM   2476 O O   . ILE A 1 323 ? -16.913 6.520  3.453   1.00 40.72  ? 323 ILE A O   1 
ATOM   2477 C CB  . ILE A 1 323 ? -14.642 7.874  1.449   1.00 41.49  ? 323 ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 323 ? -13.890 9.176  1.104   1.00 42.80  ? 323 ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 323 ? -15.945 7.785  0.646   1.00 42.62  ? 323 ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 323 ? -13.308 9.247  -0.392  1.00 54.29  ? 323 ILE A CD1 1 
ATOM   2481 N N   . ASP A 1 324 ? -15.016 5.279  3.277   1.00 38.01  ? 324 ASP A N   1 
ATOM   2482 C CA  . ASP A 1 324 ? -15.647 3.978  3.534   1.00 38.77  ? 324 ASP A CA  1 
ATOM   2483 C C   . ASP A 1 324 ? -16.335 3.952  4.889   1.00 41.25  ? 324 ASP A C   1 
ATOM   2484 O O   . ASP A 1 324 ? -17.447 3.412  4.989   1.00 41.86  ? 324 ASP A O   1 
ATOM   2485 C CB  . ASP A 1 324 ? -14.668 2.791  3.356   1.00 41.79  ? 324 ASP A CB  1 
ATOM   2486 C CG  . ASP A 1 324 ? -15.257 1.416  3.673   1.00 54.51  ? 324 ASP A CG  1 
ATOM   2487 O OD1 . ASP A 1 324 ? -16.242 1.008  2.990   1.00 56.16  ? 324 ASP A OD1 1 
ATOM   2488 O OD2 . ASP A 1 324 ? -14.746 0.753  4.606   1.00 59.52  ? 324 ASP A OD2 1 
ATOM   2489 N N   . PHE A 1 325 ? -15.715 4.572  5.914   1.00 34.77  ? 325 PHE A N   1 
ATOM   2490 C CA  . PHE A 1 325 ? -16.364 4.634  7.209   1.00 33.68  ? 325 PHE A CA  1 
ATOM   2491 C C   . PHE A 1 325 ? -17.625 5.533  7.180   1.00 40.33  ? 325 PHE A C   1 
ATOM   2492 O O   . PHE A 1 325 ? -18.679 5.090  7.655   1.00 42.81  ? 325 PHE A O   1 
ATOM   2493 C CB  . PHE A 1 325 ? -15.395 5.033  8.321   1.00 33.90  ? 325 PHE A CB  1 
ATOM   2494 C CG  . PHE A 1 325 ? -16.089 5.486  9.585   1.00 34.05  ? 325 PHE A CG  1 
ATOM   2495 C CD1 . PHE A 1 325 ? -16.575 4.563  10.501  1.00 35.81  ? 325 PHE A CD1 1 
ATOM   2496 C CD2 . PHE A 1 325 ? -16.288 6.840  9.842   1.00 35.78  ? 325 PHE A CD2 1 
ATOM   2497 C CE1 . PHE A 1 325 ? -17.246 4.982  11.649  1.00 35.66  ? 325 PHE A CE1 1 
ATOM   2498 C CE2 . PHE A 1 325 ? -16.948 7.258  10.998  1.00 37.50  ? 325 PHE A CE2 1 
ATOM   2499 C CZ  . PHE A 1 325 ? -17.417 6.324  11.896  1.00 35.07  ? 325 PHE A CZ  1 
ATOM   2500 N N   . TYR A 1 326 ? -17.526 6.773  6.636   1.00 34.64  ? 326 TYR A N   1 
ATOM   2501 C CA  . TYR A 1 326 ? -18.669 7.695  6.575   1.00 33.59  ? 326 TYR A CA  1 
ATOM   2502 C C   . TYR A 1 326 ? -19.805 7.257  5.644   1.00 35.50  ? 326 TYR A C   1 
ATOM   2503 O O   . TYR A 1 326 ? -20.964 7.642  5.860   1.00 35.03  ? 326 TYR A O   1 
ATOM   2504 C CB  . TYR A 1 326 ? -18.227 9.129  6.280   1.00 34.82  ? 326 TYR A CB  1 
ATOM   2505 C CG  . TYR A 1 326 ? -17.594 9.797  7.479   1.00 37.46  ? 326 TYR A CG  1 
ATOM   2506 C CD1 . TYR A 1 326 ? -18.374 10.428 8.445   1.00 38.98  ? 326 TYR A CD1 1 
ATOM   2507 C CD2 . TYR A 1 326 ? -16.211 9.789  7.658   1.00 38.29  ? 326 TYR A CD2 1 
ATOM   2508 C CE1 . TYR A 1 326 ? -17.794 11.029 9.560   1.00 39.65  ? 326 TYR A CE1 1 
ATOM   2509 C CE2 . TYR A 1 326 ? -15.622 10.382 8.774   1.00 37.93  ? 326 TYR A CE2 1 
ATOM   2510 C CZ  . TYR A 1 326 ? -16.416 10.998 9.722   1.00 45.79  ? 326 TYR A CZ  1 
ATOM   2511 O OH  . TYR A 1 326 ? -15.826 11.584 10.813  1.00 49.44  ? 326 TYR A OH  1 
ATOM   2512 N N   . SER A 1 327 ? -19.484 6.455  4.625   1.00 30.77  ? 327 SER A N   1 
ATOM   2513 C CA  . SER A 1 327 ? -20.483 5.954  3.697   1.00 32.42  ? 327 SER A CA  1 
ATOM   2514 C C   . SER A 1 327 ? -21.403 4.926  4.428   1.00 38.71  ? 327 SER A C   1 
ATOM   2515 O O   . SER A 1 327 ? -22.630 4.996  4.283   1.00 38.09  ? 327 SER A O   1 
ATOM   2516 C CB  . SER A 1 327 ? -19.813 5.381  2.447   1.00 37.56  ? 327 SER A CB  1 
ATOM   2517 O OG  . SER A 1 327 ? -20.627 4.496  1.692   1.00 52.08  ? 327 SER A OG  1 
ATOM   2518 N N   . ASN A 1 328 ? -20.811 4.032  5.265   1.00 36.63  ? 328 ASN A N   1 
ATOM   2519 C CA  . ASN A 1 328 ? -21.558 3.036  6.043   1.00 37.50  ? 328 ASN A CA  1 
ATOM   2520 C C   . ASN A 1 328 ? -22.421 3.745  7.090   1.00 40.30  ? 328 ASN A C   1 
ATOM   2521 O O   . ASN A 1 328 ? -23.582 3.376  7.280   1.00 41.52  ? 328 ASN A O   1 
ATOM   2522 C CB  . ASN A 1 328 ? -20.630 1.990  6.704   1.00 43.32  ? 328 ASN A CB  1 
ATOM   2523 C CG  . ASN A 1 328 ? -19.882 1.031  5.782   1.00 90.80  ? 328 ASN A CG  1 
ATOM   2524 O OD1 . ASN A 1 328 ? -19.657 -0.137 6.133   1.00 89.58  ? 328 ASN A OD1 1 
ATOM   2525 N ND2 . ASN A 1 328 ? -19.409 1.499  4.623   1.00 88.44  ? 328 ASN A ND2 1 
ATOM   2526 N N   . GLN A 1 329 ? -21.879 4.785  7.726   1.00 34.73  ? 329 GLN A N   1 
ATOM   2527 C CA  . GLN A 1 329 ? -22.635 5.570  8.698   1.00 34.73  ? 329 GLN A CA  1 
ATOM   2528 C C   . GLN A 1 329 ? -23.867 6.201  8.022   1.00 40.44  ? 329 GLN A C   1 
ATOM   2529 O O   . GLN A 1 329 ? -24.981 6.028  8.525   1.00 40.72  ? 329 GLN A O   1 
ATOM   2530 C CB  . GLN A 1 329 ? -21.743 6.634  9.362   1.00 35.01  ? 329 GLN A CB  1 
ATOM   2531 C CG  . GLN A 1 329 ? -20.668 6.074  10.321  1.00 44.93  ? 329 GLN A CG  1 
ATOM   2532 C CD  . GLN A 1 329 ? -21.209 5.589  11.660  1.00 52.55  ? 329 GLN A CD  1 
ATOM   2533 O OE1 . GLN A 1 329 ? -21.081 4.416  12.030  1.00 45.45  ? 329 GLN A OE1 1 
ATOM   2534 N NE2 . GLN A 1 329 ? -21.795 6.483  12.435  1.00 42.15  ? 329 GLN A NE2 1 
ATOM   2535 N N   . LYS A 1 330 ? -23.675 6.838  6.829   1.00 36.83  ? 330 LYS A N   1 
ATOM   2536 C CA  . LYS A 1 330 ? -24.743 7.446  6.026   1.00 36.52  ? 330 LYS A CA  1 
ATOM   2537 C C   . LYS A 1 330 ? -25.858 6.434  5.714   1.00 42.14  ? 330 LYS A C   1 
ATOM   2538 O O   . LYS A 1 330 ? -27.031 6.743  5.894   1.00 42.84  ? 330 LYS A O   1 
ATOM   2539 C CB  . LYS A 1 330 ? -24.176 8.042  4.725   1.00 38.32  ? 330 LYS A CB  1 
ATOM   2540 C CG  . LYS A 1 330 ? -25.222 8.800  3.896   1.00 41.04  ? 330 LYS A CG  1 
ATOM   2541 C CD  . LYS A 1 330 ? -24.824 8.970  2.434   1.00 48.71  ? 330 LYS A CD  1 
ATOM   2542 C CE  . LYS A 1 330 ? -25.251 7.846  1.513   1.00 53.04  ? 330 LYS A CE  1 
ATOM   2543 N NZ  . LYS A 1 330 ? -24.209 6.793  1.403   1.00 52.32  ? 330 LYS A NZ  1 
ATOM   2544 N N   . ASP A 1 331 ? -25.487 5.231  5.262   1.00 39.44  ? 331 ASP A N   1 
ATOM   2545 C CA  . ASP A 1 331 ? -26.435 4.169  4.933   1.00 40.64  ? 331 ASP A CA  1 
ATOM   2546 C C   . ASP A 1 331 ? -27.251 3.777  6.172   1.00 44.39  ? 331 ASP A C   1 
ATOM   2547 O O   . ASP A 1 331 ? -28.468 3.599  6.069   1.00 44.04  ? 331 ASP A O   1 
ATOM   2548 C CB  . ASP A 1 331 ? -25.691 2.945  4.354   1.00 43.50  ? 331 ASP A CB  1 
ATOM   2549 C CG  . ASP A 1 331 ? -24.950 3.177  3.044   1.00 55.37  ? 331 ASP A CG  1 
ATOM   2550 O OD1 . ASP A 1 331 ? -25.443 3.978  2.205   1.00 57.88  ? 331 ASP A OD1 1 
ATOM   2551 O OD2 . ASP A 1 331 ? -23.913 2.520  2.829   1.00 59.71  ? 331 ASP A OD2 1 
ATOM   2552 N N   . ALA A 1 332 ? -26.574 3.707  7.351   1.00 40.79  ? 332 ALA A N   1 
ATOM   2553 C CA  . ALA A 1 332 ? -27.165 3.357  8.650   1.00 40.61  ? 332 ALA A CA  1 
ATOM   2554 C C   . ALA A 1 332 ? -28.130 4.417  9.197   1.00 44.32  ? 332 ALA A C   1 
ATOM   2555 O O   . ALA A 1 332 ? -29.105 4.052  9.855   1.00 44.91  ? 332 ALA A O   1 
ATOM   2556 C CB  . ALA A 1 332 ? -26.081 3.036  9.666   1.00 40.60  ? 332 ALA A CB  1 
ATOM   2557 N N   . ILE A 1 333 ? -27.869 5.714  8.934   1.00 39.57  ? 333 ILE A N   1 
ATOM   2558 C CA  . ILE A 1 333 ? -28.775 6.797  9.320   1.00 39.44  ? 333 ILE A CA  1 
ATOM   2559 C C   . ILE A 1 333 ? -30.009 6.808  8.388   1.00 44.05  ? 333 ILE A C   1 
ATOM   2560 O O   . ILE A 1 333 ? -31.123 7.069  8.858   1.00 45.11  ? 333 ILE A O   1 
ATOM   2561 C CB  . ILE A 1 333 ? -28.064 8.192  9.432   1.00 41.95  ? 333 ILE A CB  1 
ATOM   2562 C CG1 . ILE A 1 333 ? -28.873 9.190  10.283  1.00 41.98  ? 333 ILE A CG1 1 
ATOM   2563 C CG2 . ILE A 1 333 ? -27.715 8.816  8.080   1.00 42.85  ? 333 ILE A CG2 1 
ATOM   2564 C CD1 . ILE A 1 333 ? -28.376 9.364  11.640  1.00 48.28  ? 333 ILE A CD1 1 
ATOM   2565 N N   . LEU A 1 334 ? -29.800 6.510  7.081   1.00 38.10  ? 334 LEU A N   1 
ATOM   2566 C CA  . LEU A 1 334 ? -30.844 6.484  6.068   1.00 37.86  ? 334 LEU A CA  1 
ATOM   2567 C C   . LEU A 1 334 ? -31.823 5.341  6.293   1.00 43.95  ? 334 LEU A C   1 
ATOM   2568 O O   . LEU A 1 334 ? -33.024 5.510  6.050   1.00 43.85  ? 334 LEU A O   1 
ATOM   2569 C CB  . LEU A 1 334 ? -30.213 6.395  4.678   1.00 37.73  ? 334 LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 334 ? -30.180 7.652  3.800   1.00 41.35  ? 334 LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 334 ? -30.678 8.913  4.526   1.00 40.46  ? 334 LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 334 ? -28.815 7.844  3.178   1.00 41.31  ? 334 LEU A CD2 1 
ATOM   2573 N N   . ALA A 1 335 ? -31.318 4.194  6.783   1.00 42.24  ? 335 ALA A N   1 
ATOM   2574 C CA  . ALA A 1 335 ? -32.132 3.011  7.085   1.00 44.03  ? 335 ALA A CA  1 
ATOM   2575 C C   . ALA A 1 335 ? -33.012 3.304  8.297   1.00 50.80  ? 335 ALA A C   1 
ATOM   2576 O O   . ALA A 1 335 ? -34.234 3.117  8.224   1.00 53.64  ? 335 ALA A O   1 
ATOM   2577 C CB  . ALA A 1 335 ? -31.244 1.800  7.349   1.00 44.48  ? 335 ALA A CB  1 
ATOM   2578 N N   . ALA A 1 336 ? -32.401 3.828  9.383   1.00 45.61  ? 336 ALA A N   1 
ATOM   2579 C CA  . ALA A 1 336 ? -33.103 4.205  10.607  1.00 45.85  ? 336 ALA A CA  1 
ATOM   2580 C C   . ALA A 1 336 ? -34.160 5.285  10.319  1.00 50.59  ? 336 ALA A C   1 
ATOM   2581 O O   . ALA A 1 336 ? -35.275 5.197  10.841  1.00 50.40  ? 336 ALA A O   1 
ATOM   2582 C CB  . ALA A 1 336 ? -32.112 4.687  11.656  1.00 45.55  ? 336 ALA A CB  1 
ATOM   2583 N N   . ALA A 1 337 ? -33.829 6.254  9.430   1.00 46.87  ? 337 ALA A N   1 
ATOM   2584 C CA  . ALA A 1 337 ? -34.751 7.300  8.995   1.00 46.88  ? 337 ALA A CA  1 
ATOM   2585 C C   . ALA A 1 337 ? -35.930 6.682  8.231   1.00 53.77  ? 337 ALA A C   1 
ATOM   2586 O O   . ALA A 1 337 ? -37.074 7.090  8.462   1.00 53.92  ? 337 ALA A O   1 
ATOM   2587 C CB  . ALA A 1 337 ? -34.029 8.313  8.121   1.00 46.93  ? 337 ALA A CB  1 
ATOM   2588 N N   . ASP A 1 338 ? -35.654 5.680  7.344   1.00 51.46  ? 338 ASP A N   1 
ATOM   2589 C CA  . ASP A 1 338 ? -36.685 5.002  6.544   1.00 53.34  ? 338 ASP A CA  1 
ATOM   2590 C C   . ASP A 1 338 ? -37.683 4.257  7.430   1.00 55.97  ? 338 ASP A C   1 
ATOM   2591 O O   . ASP A 1 338 ? -38.893 4.434  7.289   1.00 56.54  ? 338 ASP A O   1 
ATOM   2592 C CB  . ASP A 1 338 ? -36.056 4.039  5.515   1.00 56.95  ? 338 ASP A CB  1 
ATOM   2593 C CG  . ASP A 1 338 ? -35.541 4.668  4.222   1.00 81.03  ? 338 ASP A CG  1 
ATOM   2594 O OD1 . ASP A 1 338 ? -35.934 5.825  3.915   1.00 83.77  ? 338 ASP A OD1 1 
ATOM   2595 O OD2 . ASP A 1 338 ? -34.786 3.984  3.487   1.00 90.42  ? 338 ASP A OD2 1 
ATOM   2596 N N   . LYS A 1 339 ? -37.156 3.456  8.363   1.00 50.05  ? 339 LYS A N   1 
ATOM   2597 C CA  . LYS A 1 339 ? -37.881 2.627  9.314   1.00 49.51  ? 339 LYS A CA  1 
ATOM   2598 C C   . LYS A 1 339 ? -38.919 3.378  10.168  1.00 55.56  ? 339 LYS A C   1 
ATOM   2599 O O   . LYS A 1 339 ? -40.048 2.899  10.290  1.00 57.78  ? 339 LYS A O   1 
ATOM   2600 C CB  . LYS A 1 339 ? -36.855 1.921  10.220  1.00 49.10  ? 339 LYS A CB  1 
ATOM   2601 C CG  . LYS A 1 339 ? -37.387 0.792  11.087  1.00 41.76  ? 339 LYS A CG  1 
ATOM   2602 C CD  . LYS A 1 339 ? -36.207 0.097  11.734  1.00 39.82  ? 339 LYS A CD  1 
ATOM   2603 C CE  . LYS A 1 339 ? -36.547 -1.145 12.502  1.00 47.18  ? 339 LYS A CE  1 
ATOM   2604 N NZ  . LYS A 1 339 ? -35.376 -1.632 13.286  1.00 53.39  ? 339 LYS A NZ  1 
ATOM   2605 N N   . TRP A 1 340 ? -38.541 4.531  10.753  1.00 50.63  ? 340 TRP A N   1 
ATOM   2606 C CA  . TRP A 1 340 ? -39.368 5.265  11.698  1.00 50.99  ? 340 TRP A CA  1 
ATOM   2607 C C   . TRP A 1 340 ? -39.969 6.579  11.238  1.00 57.62  ? 340 TRP A C   1 
ATOM   2608 O O   . TRP A 1 340 ? -41.093 6.880  11.643  1.00 59.59  ? 340 TRP A O   1 
ATOM   2609 C CB  . TRP A 1 340 ? -38.582 5.508  12.998  1.00 48.98  ? 340 TRP A CB  1 
ATOM   2610 C CG  . TRP A 1 340 ? -37.933 4.281  13.560  1.00 50.13  ? 340 TRP A CG  1 
ATOM   2611 C CD1 . TRP A 1 340 ? -36.614 3.927  13.470  1.00 52.27  ? 340 TRP A CD1 1 
ATOM   2612 C CD2 . TRP A 1 340 ? -38.588 3.217  14.257  1.00 50.77  ? 340 TRP A CD2 1 
ATOM   2613 N NE1 . TRP A 1 340 ? -36.406 2.714  14.088  1.00 51.80  ? 340 TRP A NE1 1 
ATOM   2614 C CE2 . TRP A 1 340 ? -37.603 2.253  14.576  1.00 54.44  ? 340 TRP A CE2 1 
ATOM   2615 C CE3 . TRP A 1 340 ? -39.918 2.985  14.651  1.00 53.17  ? 340 TRP A CE3 1 
ATOM   2616 C CZ2 . TRP A 1 340 ? -37.909 1.072  15.265  1.00 54.67  ? 340 TRP A CZ2 1 
ATOM   2617 C CZ3 . TRP A 1 340 ? -40.223 1.812  15.329  1.00 55.27  ? 340 TRP A CZ3 1 
ATOM   2618 C CH2 . TRP A 1 340 ? -39.230 0.869  15.625  1.00 55.53  ? 340 TRP A CH2 1 
ATOM   2619 N N   . LEU A 1 341 ? -39.218 7.396  10.472  1.00 53.82  ? 341 LEU A N   1 
ATOM   2620 C CA  . LEU A 1 341 ? -39.631 8.748  10.063  1.00 53.97  ? 341 LEU A CA  1 
ATOM   2621 C C   . LEU A 1 341 ? -40.547 8.840  8.837   1.00 59.34  ? 341 LEU A C   1 
ATOM   2622 O O   . LEU A 1 341 ? -41.183 9.880  8.643   1.00 58.54  ? 341 LEU A O   1 
ATOM   2623 C CB  . LEU A 1 341 ? -38.412 9.683  9.907   1.00 53.05  ? 341 LEU A CB  1 
ATOM   2624 C CG  . LEU A 1 341 ? -37.647 10.117 11.169  1.00 56.67  ? 341 LEU A CG  1 
ATOM   2625 C CD1 . LEU A 1 341 ? -36.720 9.033  11.643  1.00 55.85  ? 341 LEU A CD1 1 
ATOM   2626 C CD2 . LEU A 1 341 ? -36.754 11.329 10.880  1.00 59.04  ? 341 LEU A CD2 1 
ATOM   2627 N N   . THR A 1 342 ? -40.622 7.771  8.013   1.00 58.01  ? 342 THR A N   1 
ATOM   2628 C CA  . THR A 1 342 ? -41.487 7.745  6.825   1.00 59.87  ? 342 THR A CA  1 
ATOM   2629 C C   . THR A 1 342 ? -42.920 8.049  7.252   1.00 65.70  ? 342 THR A C   1 
ATOM   2630 O O   . THR A 1 342 ? -43.431 7.415  8.182   1.00 65.08  ? 342 THR A O   1 
ATOM   2631 C CB  . THR A 1 342 ? -41.316 6.434  6.033   1.00 70.62  ? 342 THR A CB  1 
ATOM   2632 O OG1 . THR A 1 342 ? -39.935 6.296  5.652   1.00 73.47  ? 342 THR A OG1 1 
ATOM   2633 C CG2 . THR A 1 342 ? -42.208 6.367  4.790   1.00 71.34  ? 342 THR A CG2 1 
ATOM   2634 N N   . GLY A 1 343 ? -43.496 9.071  6.614   1.00 63.71  ? 343 GLY A N   1 
ATOM   2635 C CA  . GLY A 1 343 ? -44.835 9.588  6.871   1.00 64.27  ? 343 GLY A CA  1 
ATOM   2636 C C   . GLY A 1 343 ? -44.836 10.798 7.792   1.00 66.46  ? 343 GLY A C   1 
ATOM   2637 O O   . GLY A 1 343 ? -45.785 11.589 7.768   1.00 67.24  ? 343 GLY A O   1 
ATOM   2638 N N   . LEU A 1 344 ? -43.756 10.958 8.602   1.00 60.12  ? 344 LEU A N   1 
ATOM   2639 C CA  . LEU A 1 344 ? -43.594 12.026 9.607   1.00 58.51  ? 344 LEU A CA  1 
ATOM   2640 C C   . LEU A 1 344 ? -42.586 13.121 9.238   1.00 59.72  ? 344 LEU A C   1 
ATOM   2641 O O   . LEU A 1 344 ? -42.581 14.196 9.861   1.00 58.13  ? 344 LEU A O   1 
ATOM   2642 C CB  . LEU A 1 344 ? -43.185 11.412 10.963  1.00 57.16  ? 344 LEU A CB  1 
ATOM   2643 C CG  . LEU A 1 344 ? -43.930 10.165 11.434  1.00 62.04  ? 344 LEU A CG  1 
ATOM   2644 C CD1 . LEU A 1 344 ? -43.240 9.547  12.625  1.00 60.84  ? 344 LEU A CD1 1 
ATOM   2645 C CD2 . LEU A 1 344 ? -45.402 10.462 11.729  1.00 65.59  ? 344 LEU A CD2 1 
ATOM   2646 N N   . ALA A 1 345 ? -41.693 12.821 8.271   1.00 55.63  ? 345 ALA A N   1 
ATOM   2647 C CA  . ALA A 1 345 ? -40.623 13.728 7.856   1.00 54.20  ? 345 ALA A CA  1 
ATOM   2648 C C   . ALA A 1 345 ? -40.161 13.508 6.421   1.00 57.98  ? 345 ALA A C   1 
ATOM   2649 O O   . ALA A 1 345 ? -40.450 12.471 5.820   1.00 58.19  ? 345 ALA A O   1 
ATOM   2650 C CB  . ALA A 1 345 ? -39.437 13.602 8.809   1.00 52.96  ? 345 ALA A CB  1 
ATOM   2651 N N   . GLU A 1 346 ? -39.412 14.494 5.894   1.00 54.12  ? 346 GLU A N   1 
ATOM   2652 C CA  . GLU A 1 346 ? -38.833 14.502 4.554   1.00 53.87  ? 346 GLU A CA  1 
ATOM   2653 C C   . GLU A 1 346 ? -37.350 14.860 4.650   1.00 54.21  ? 346 GLU A C   1 
ATOM   2654 O O   . GLU A 1 346 ? -36.951 15.683 5.480   1.00 51.84  ? 346 GLU A O   1 
ATOM   2655 C CB  . GLU A 1 346 ? -39.563 15.506 3.648   1.00 57.01  ? 346 GLU A CB  1 
ATOM   2656 C CG  . GLU A 1 346 ? -41.004 15.130 3.351   1.00 74.77  ? 346 GLU A CG  1 
ATOM   2657 C CD  . GLU A 1 346 ? -41.598 15.674 2.064   1.00 110.84 ? 346 GLU A CD  1 
ATOM   2658 O OE1 . GLU A 1 346 ? -41.475 16.896 1.816   1.00 113.17 ? 346 GLU A OE1 1 
ATOM   2659 O OE2 . GLU A 1 346 ? -42.230 14.884 1.324   1.00 108.09 ? 346 GLU A OE2 1 
ATOM   2660 N N   . TRP A 1 347 ? -36.532 14.225 3.815   1.00 50.62  ? 347 TRP A N   1 
ATOM   2661 C CA  . TRP A 1 347 ? -35.090 14.452 3.792   1.00 49.32  ? 347 TRP A CA  1 
ATOM   2662 C C   . TRP A 1 347 ? -34.478 14.168 2.429   1.00 53.16  ? 347 TRP A C   1 
ATOM   2663 O O   . TRP A 1 347 ? -35.039 13.421 1.635   1.00 53.13  ? 347 TRP A O   1 
ATOM   2664 C CB  . TRP A 1 347 ? -34.375 13.635 4.892   1.00 46.63  ? 347 TRP A CB  1 
ATOM   2665 C CG  . TRP A 1 347 ? -34.573 12.148 4.792   1.00 47.76  ? 347 TRP A CG  1 
ATOM   2666 C CD1 . TRP A 1 347 ? -33.744 11.253 4.185   1.00 50.45  ? 347 TRP A CD1 1 
ATOM   2667 C CD2 . TRP A 1 347 ? -35.663 11.382 5.334   1.00 48.23  ? 347 TRP A CD2 1 
ATOM   2668 N NE1 . TRP A 1 347 ? -34.243 9.975  4.317   1.00 50.14  ? 347 TRP A NE1 1 
ATOM   2669 C CE2 . TRP A 1 347 ? -35.422 10.025 5.011   1.00 51.98  ? 347 TRP A CE2 1 
ATOM   2670 C CE3 . TRP A 1 347 ? -36.833 11.711 6.050   1.00 49.88  ? 347 TRP A CE3 1 
ATOM   2671 C CZ2 . TRP A 1 347 ? -36.304 8.998  5.376   1.00 51.92  ? 347 TRP A CZ2 1 
ATOM   2672 C CZ3 . TRP A 1 347 ? -37.706 10.690 6.414   1.00 51.76  ? 347 TRP A CZ3 1 
ATOM   2673 C CH2 . TRP A 1 347 ? -37.436 9.351  6.085   1.00 52.41  ? 347 TRP A CH2 1 
ATOM   2674 N N   . HIS A 1 348 ? -33.330 14.786 2.160   1.00 50.34  ? 348 HIS A N   1 
ATOM   2675 C CA  . HIS A 1 348 ? -32.551 14.574 0.949   1.00 50.95  ? 348 HIS A CA  1 
ATOM   2676 C C   . HIS A 1 348 ? -31.354 13.699 1.302   1.00 52.22  ? 348 HIS A C   1 
ATOM   2677 O O   . HIS A 1 348 ? -30.805 13.821 2.402   1.00 49.39  ? 348 HIS A O   1 
ATOM   2678 C CB  . HIS A 1 348 ? -32.078 15.909 0.359   1.00 52.40  ? 348 HIS A CB  1 
ATOM   2679 C CG  . HIS A 1 348 ? -33.192 16.753 -0.188  1.00 57.77  ? 348 HIS A CG  1 
ATOM   2680 N ND1 . HIS A 1 348 ? -34.152 16.224 -1.043  1.00 61.53  ? 348 HIS A ND1 1 
ATOM   2681 C CD2 . HIS A 1 348 ? -33.442 18.072 -0.018  1.00 59.91  ? 348 HIS A CD2 1 
ATOM   2682 C CE1 . HIS A 1 348 ? -34.974 17.225 -1.323  1.00 62.08  ? 348 HIS A CE1 1 
ATOM   2683 N NE2 . HIS A 1 348 ? -34.577 18.360 -0.748  1.00 61.55  ? 348 HIS A NE2 1 
ATOM   2684 N N   . VAL A 1 349 ? -30.960 12.802 0.385   1.00 49.26  ? 349 VAL A N   1 
ATOM   2685 C CA  . VAL A 1 349 ? -29.796 11.946 0.616   1.00 47.47  ? 349 VAL A CA  1 
ATOM   2686 C C   . VAL A 1 349 ? -28.528 12.835 0.610   1.00 50.96  ? 349 VAL A C   1 
ATOM   2687 O O   . VAL A 1 349 ? -28.328 13.591 -0.351  1.00 51.30  ? 349 VAL A O   1 
ATOM   2688 C CB  . VAL A 1 349 ? -29.703 10.789 -0.395  1.00 51.44  ? 349 VAL A CB  1 
ATOM   2689 C CG1 . VAL A 1 349 ? -28.437 9.964  -0.165  1.00 50.83  ? 349 VAL A CG1 1 
ATOM   2690 C CG2 . VAL A 1 349 ? -30.941 9.906  -0.327  1.00 51.42  ? 349 VAL A CG2 1 
ATOM   2691 N N   . PRO A 1 350 ? -27.702 12.809 1.697   1.00 45.61  ? 350 PRO A N   1 
ATOM   2692 C CA  . PRO A 1 350 ? -26.485 13.643 1.721   1.00 43.28  ? 350 PRO A CA  1 
ATOM   2693 C C   . PRO A 1 350 ? -25.463 13.183 0.688   1.00 45.73  ? 350 PRO A C   1 
ATOM   2694 O O   . PRO A 1 350 ? -25.198 11.982 0.587   1.00 45.19  ? 350 PRO A O   1 
ATOM   2695 C CB  . PRO A 1 350 ? -25.948 13.454 3.145   1.00 43.45  ? 350 PRO A CB  1 
ATOM   2696 C CG  . PRO A 1 350 ? -27.026 12.797 3.915   1.00 48.32  ? 350 PRO A CG  1 
ATOM   2697 C CD  . PRO A 1 350 ? -27.807 11.999 2.927   1.00 46.06  ? 350 PRO A CD  1 
ATOM   2698 N N   . ALA A 1 351 ? -24.929 14.130 -0.111  1.00 42.39  ? 351 ALA A N   1 
ATOM   2699 C CA  . ALA A 1 351 ? -23.923 13.848 -1.147  1.00 42.84  ? 351 ALA A CA  1 
ATOM   2700 C C   . ALA A 1 351 ? -22.506 13.719 -0.545  1.00 47.97  ? 351 ALA A C   1 
ATOM   2701 O O   . ALA A 1 351 ? -21.670 12.986 -1.085  1.00 47.95  ? 351 ALA A O   1 
ATOM   2702 C CB  . ALA A 1 351 ? -23.943 14.937 -2.198  1.00 44.10  ? 351 ALA A CB  1 
ATOM   2703 N N   . ALA A 1 352 ? -22.253 14.422 0.584   1.00 44.04  ? 352 ALA A N   1 
ATOM   2704 C CA  . ALA A 1 352 ? -20.973 14.431 1.278   1.00 42.75  ? 352 ALA A CA  1 
ATOM   2705 C C   . ALA A 1 352 ? -21.132 14.823 2.749   1.00 47.03  ? 352 ALA A C   1 
ATOM   2706 O O   . ALA A 1 352 ? -22.215 15.254 3.174   1.00 47.43  ? 352 ALA A O   1 
ATOM   2707 C CB  . ALA A 1 352 ? -20.033 15.405 0.588   1.00 43.43  ? 352 ALA A CB  1 
ATOM   2708 N N   . GLY A 1 353 ? -20.045 14.673 3.506   1.00 42.08  ? 353 GLY A N   1 
ATOM   2709 C CA  . GLY A 1 353 ? -19.978 15.076 4.903   1.00 41.18  ? 353 GLY A CA  1 
ATOM   2710 C C   . GLY A 1 353 ? -20.470 14.081 5.928   1.00 45.86  ? 353 GLY A C   1 
ATOM   2711 O O   . GLY A 1 353 ? -20.331 12.865 5.736   1.00 44.29  ? 353 GLY A O   1 
ATOM   2712 N N   . MET A 1 354 ? -21.046 14.622 7.036   1.00 43.40  ? 354 MET A N   1 
ATOM   2713 C CA  . MET A 1 354 ? -21.528 13.876 8.200   1.00 43.17  ? 354 MET A CA  1 
ATOM   2714 C C   . MET A 1 354 ? -22.923 14.259 8.738   1.00 43.40  ? 354 MET A C   1 
ATOM   2715 O O   . MET A 1 354 ? -23.317 13.783 9.800   1.00 41.19  ? 354 MET A O   1 
ATOM   2716 C CB  . MET A 1 354 ? -20.463 13.872 9.315   1.00 45.83  ? 354 MET A CB  1 
ATOM   2717 C CG  . MET A 1 354 ? -19.911 15.255 9.647   1.00 51.29  ? 354 MET A CG  1 
ATOM   2718 S SD  . MET A 1 354 ? -18.604 15.324 10.920  1.00 57.08  ? 354 MET A SD  1 
ATOM   2719 C CE  . MET A 1 354 ? -17.245 14.553 10.044  1.00 53.76  ? 354 MET A CE  1 
ATOM   2720 N N   . PHE A 1 355 ? -23.703 15.046 7.990   1.00 41.23  ? 355 PHE A N   1 
ATOM   2721 C CA  . PHE A 1 355 ? -25.034 15.446 8.471   1.00 41.53  ? 355 PHE A CA  1 
ATOM   2722 C C   . PHE A 1 355 ? -26.241 15.024 7.625   1.00 45.09  ? 355 PHE A C   1 
ATOM   2723 O O   . PHE A 1 355 ? -26.162 14.984 6.399   1.00 44.86  ? 355 PHE A O   1 
ATOM   2724 C CB  . PHE A 1 355 ? -25.081 16.960 8.762   1.00 43.08  ? 355 PHE A CB  1 
ATOM   2725 C CG  . PHE A 1 355 ? -23.958 17.484 9.633   1.00 43.37  ? 355 PHE A CG  1 
ATOM   2726 C CD1 . PHE A 1 355 ? -23.826 17.065 10.956  1.00 45.47  ? 355 PHE A CD1 1 
ATOM   2727 C CD2 . PHE A 1 355 ? -23.025 18.389 9.129   1.00 44.95  ? 355 PHE A CD2 1 
ATOM   2728 C CE1 . PHE A 1 355 ? -22.780 17.539 11.757  1.00 45.10  ? 355 PHE A CE1 1 
ATOM   2729 C CE2 . PHE A 1 355 ? -21.974 18.861 9.930   1.00 46.40  ? 355 PHE A CE2 1 
ATOM   2730 C CZ  . PHE A 1 355 ? -21.865 18.441 11.240  1.00 43.62  ? 355 PHE A CZ  1 
ATOM   2731 N N   . LEU A 1 356 ? -27.364 14.741 8.299   1.00 41.69  ? 356 LEU A N   1 
ATOM   2732 C CA  . LEU A 1 356 ? -28.668 14.443 7.704   1.00 42.82  ? 356 LEU A CA  1 
ATOM   2733 C C   . LEU A 1 356 ? -29.617 15.542 8.181   1.00 47.12  ? 356 LEU A C   1 
ATOM   2734 O O   . LEU A 1 356 ? -29.789 15.721 9.383   1.00 46.46  ? 356 LEU A O   1 
ATOM   2735 C CB  . LEU A 1 356 ? -29.190 13.052 8.097   1.00 43.19  ? 356 LEU A CB  1 
ATOM   2736 C CG  . LEU A 1 356 ? -30.507 12.597 7.441   1.00 48.97  ? 356 LEU A CG  1 
ATOM   2737 C CD1 . LEU A 1 356 ? -30.339 12.352 5.946   1.00 49.47  ? 356 LEU A CD1 1 
ATOM   2738 C CD2 . LEU A 1 356 ? -31.067 11.358 8.126   1.00 51.10  ? 356 LEU A CD2 1 
ATOM   2739 N N   . TRP A 1 357 ? -30.175 16.307 7.234   1.00 45.11  ? 357 TRP A N   1 
ATOM   2740 C CA  . TRP A 1 357 ? -31.062 17.449 7.449   1.00 46.35  ? 357 TRP A CA  1 
ATOM   2741 C C   . TRP A 1 357 ? -32.516 16.981 7.298   1.00 51.97  ? 357 TRP A C   1 
ATOM   2742 O O   . TRP A 1 357 ? -32.969 16.673 6.192   1.00 54.50  ? 357 TRP A O   1 
ATOM   2743 C CB  . TRP A 1 357 ? -30.678 18.544 6.439   1.00 46.42  ? 357 TRP A CB  1 
ATOM   2744 C CG  . TRP A 1 357 ? -31.325 19.891 6.565   1.00 48.75  ? 357 TRP A CG  1 
ATOM   2745 C CD1 . TRP A 1 357 ? -31.956 20.572 5.568   1.00 52.89  ? 357 TRP A CD1 1 
ATOM   2746 C CD2 . TRP A 1 357 ? -31.214 20.810 7.670   1.00 48.55  ? 357 TRP A CD2 1 
ATOM   2747 N NE1 . TRP A 1 357 ? -32.296 21.835 5.994   1.00 52.90  ? 357 TRP A NE1 1 
ATOM   2748 C CE2 . TRP A 1 357 ? -31.870 22.003 7.288   1.00 53.32  ? 357 TRP A CE2 1 
ATOM   2749 C CE3 . TRP A 1 357 ? -30.665 20.728 8.964   1.00 49.08  ? 357 TRP A CE3 1 
ATOM   2750 C CZ2 . TRP A 1 357 ? -31.974 23.110 8.141   1.00 52.34  ? 357 TRP A CZ2 1 
ATOM   2751 C CZ3 . TRP A 1 357 ? -30.791 21.816 9.819   1.00 50.41  ? 357 TRP A CZ3 1 
ATOM   2752 C CH2 . TRP A 1 357 ? -31.436 22.987 9.405   1.00 51.97  ? 357 TRP A CH2 1 
ATOM   2753 N N   . ILE A 1 358 ? -33.223 16.873 8.431   1.00 46.67  ? 358 ILE A N   1 
ATOM   2754 C CA  . ILE A 1 358 ? -34.606 16.372 8.528   1.00 46.62  ? 358 ILE A CA  1 
ATOM   2755 C C   . ILE A 1 358 ? -35.629 17.503 8.659   1.00 50.27  ? 358 ILE A C   1 
ATOM   2756 O O   . ILE A 1 358 ? -35.483 18.353 9.529   1.00 49.38  ? 358 ILE A O   1 
ATOM   2757 C CB  . ILE A 1 358 ? -34.708 15.349 9.717   1.00 48.85  ? 358 ILE A CB  1 
ATOM   2758 C CG1 . ILE A 1 358 ? -33.834 14.106 9.477   1.00 48.71  ? 358 ILE A CG1 1 
ATOM   2759 C CG2 . ILE A 1 358 ? -36.143 14.939 10.030  1.00 49.23  ? 358 ILE A CG2 1 
ATOM   2760 C CD1 . ILE A 1 358 ? -33.099 13.682 10.662  1.00 55.03  ? 358 ILE A CD1 1 
ATOM   2761 N N   . LYS A 1 359 ? -36.683 17.483 7.827   1.00 49.01  ? 359 LYS A N   1 
ATOM   2762 C CA  . LYS A 1 359 ? -37.783 18.444 7.891   1.00 49.92  ? 359 LYS A CA  1 
ATOM   2763 C C   . LYS A 1 359 ? -38.970 17.717 8.473   1.00 55.24  ? 359 LYS A C   1 
ATOM   2764 O O   . LYS A 1 359 ? -39.502 16.811 7.817   1.00 55.24  ? 359 LYS A O   1 
ATOM   2765 C CB  . LYS A 1 359 ? -38.172 18.975 6.501   1.00 53.43  ? 359 LYS A CB  1 
ATOM   2766 C CG  . LYS A 1 359 ? -39.241 20.055 6.585   1.00 66.99  ? 359 LYS A CG  1 
ATOM   2767 C CD  . LYS A 1 359 ? -39.652 20.565 5.240   1.00 80.29  ? 359 LYS A CD  1 
ATOM   2768 C CE  . LYS A 1 359 ? -40.469 21.824 5.399   1.00 95.82  ? 359 LYS A CE  1 
ATOM   2769 N NZ  . LYS A 1 359 ? -40.999 22.317 4.101   1.00 107.96 ? 359 LYS A NZ  1 
ATOM   2770 N N   . VAL A 1 360 ? -39.412 18.117 9.682   1.00 52.58  ? 360 VAL A N   1 
ATOM   2771 C CA  . VAL A 1 360 ? -40.594 17.492 10.293  1.00 53.79  ? 360 VAL A CA  1 
ATOM   2772 C C   . VAL A 1 360 ? -41.847 18.034 9.599   1.00 60.43  ? 360 VAL A C   1 
ATOM   2773 O O   . VAL A 1 360 ? -42.047 19.254 9.554   1.00 60.19  ? 360 VAL A O   1 
ATOM   2774 C CB  . VAL A 1 360 ? -40.648 17.596 11.836  1.00 56.65  ? 360 VAL A CB  1 
ATOM   2775 C CG1 . VAL A 1 360 ? -41.777 16.736 12.398  1.00 56.48  ? 360 VAL A CG1 1 
ATOM   2776 C CG2 . VAL A 1 360 ? -39.310 17.193 12.455  1.00 54.80  ? 360 VAL A CG2 1 
ATOM   2777 N N   . LYS A 1 361 ? -42.641 17.113 9.008   1.00 59.53  ? 361 LYS A N   1 
ATOM   2778 C CA  . LYS A 1 361 ? -43.850 17.375 8.220   1.00 62.10  ? 361 LYS A CA  1 
ATOM   2779 C C   . LYS A 1 361 ? -44.891 18.337 8.786   1.00 70.37  ? 361 LYS A C   1 
ATOM   2780 O O   . LYS A 1 361 ? -45.238 19.310 8.106   1.00 71.53  ? 361 LYS A O   1 
ATOM   2781 C CB  . LYS A 1 361 ? -44.503 16.076 7.724   1.00 64.54  ? 361 LYS A CB  1 
ATOM   2782 C CG  . LYS A 1 361 ? -43.926 15.581 6.402   1.00 74.94  ? 361 LYS A CG  1 
ATOM   2783 C CD  . LYS A 1 361 ? -45.016 14.940 5.541   1.00 80.41  ? 361 LYS A CD  1 
ATOM   2784 C CE  . LYS A 1 361 ? -44.485 14.297 4.280   1.00 85.61  ? 361 LYS A CE  1 
ATOM   2785 N NZ  . LYS A 1 361 ? -43.953 12.923 4.522   1.00 89.46  ? 361 LYS A NZ  1 
ATOM   2786 N N   . GLY A 1 362 ? -45.380 18.062 9.997   1.00 68.42  ? 362 GLY A N   1 
ATOM   2787 C CA  . GLY A 1 362 ? -46.442 18.849 10.621  1.00 70.34  ? 362 GLY A CA  1 
ATOM   2788 C C   . GLY A 1 362 ? -46.048 20.112 11.360  1.00 75.79  ? 362 GLY A C   1 
ATOM   2789 O O   . GLY A 1 362 ? -46.544 21.196 11.040  1.00 76.29  ? 362 GLY A O   1 
ATOM   2790 N N   . ILE A 1 363 ? -45.189 19.964 12.382  1.00 72.93  ? 363 ILE A N   1 
ATOM   2791 C CA  . ILE A 1 363 ? -44.710 21.033 13.280  1.00 73.24  ? 363 ILE A CA  1 
ATOM   2792 C C   . ILE A 1 363 ? -44.035 22.236 12.583  1.00 78.68  ? 363 ILE A C   1 
ATOM   2793 O O   . ILE A 1 363 ? -43.460 22.083 11.503  1.00 78.72  ? 363 ILE A O   1 
ATOM   2794 C CB  . ILE A 1 363 ? -43.882 20.512 14.507  1.00 74.78  ? 363 ILE A CB  1 
ATOM   2795 C CG1 . ILE A 1 363 ? -43.723 18.951 14.570  1.00 74.50  ? 363 ILE A CG1 1 
ATOM   2796 C CG2 . ILE A 1 363 ? -44.365 21.117 15.831  1.00 76.13  ? 363 ILE A CG2 1 
ATOM   2797 C CD1 . ILE A 1 363 ? -45.026 18.009 14.932  1.00 82.77  ? 363 ILE A CD1 1 
ATOM   2798 N N   . ASN A 1 364 ? -44.124 23.433 13.220  1.00 75.28  ? 364 ASN A N   1 
ATOM   2799 C CA  . ASN A 1 364 ? -43.558 24.702 12.746  1.00 74.94  ? 364 ASN A CA  1 
ATOM   2800 C C   . ASN A 1 364 ? -42.241 25.036 13.460  1.00 76.87  ? 364 ASN A C   1 
ATOM   2801 O O   . ASN A 1 364 ? -41.329 25.589 12.834  1.00 76.07  ? 364 ASN A O   1 
ATOM   2802 C CB  . ASN A 1 364 ? -44.561 25.849 12.921  1.00 77.97  ? 364 ASN A CB  1 
ATOM   2803 C CG  . ASN A 1 364 ? -45.869 25.666 12.180  1.00 117.14 ? 364 ASN A CG  1 
ATOM   2804 O OD1 . ASN A 1 364 ? -45.916 25.230 11.018  1.00 116.42 ? 364 ASN A OD1 1 
ATOM   2805 N ND2 . ASN A 1 364 ? -46.967 26.034 12.828  1.00 113.72 ? 364 ASN A ND2 1 
ATOM   2806 N N   . ASP A 1 365 ? -42.157 24.717 14.773  1.00 71.71  ? 365 ASP A N   1 
ATOM   2807 C CA  . ASP A 1 365 ? -40.976 24.939 15.609  1.00 69.45  ? 365 ASP A CA  1 
ATOM   2808 C C   . ASP A 1 365 ? -40.563 23.635 16.293  1.00 70.72  ? 365 ASP A C   1 
ATOM   2809 O O   . ASP A 1 365 ? -41.299 23.109 17.129  1.00 70.43  ? 365 ASP A O   1 
ATOM   2810 C CB  . ASP A 1 365 ? -41.198 26.072 16.628  1.00 71.94  ? 365 ASP A CB  1 
ATOM   2811 C CG  . ASP A 1 365 ? -40.015 26.297 17.558  1.00 85.11  ? 365 ASP A CG  1 
ATOM   2812 O OD1 . ASP A 1 365 ? -40.117 25.920 18.749  1.00 86.11  ? 365 ASP A OD1 1 
ATOM   2813 O OD2 . ASP A 1 365 ? -38.965 26.806 17.080  1.00 90.63  ? 365 ASP A OD2 1 
ATOM   2814 N N   . VAL A 1 366 ? -39.384 23.117 15.920  1.00 64.99  ? 366 VAL A N   1 
ATOM   2815 C CA  . VAL A 1 366 ? -38.844 21.853 16.412  1.00 63.40  ? 366 VAL A CA  1 
ATOM   2816 C C   . VAL A 1 366 ? -38.015 21.999 17.697  1.00 67.70  ? 366 VAL A C   1 
ATOM   2817 O O   . VAL A 1 366 ? -37.699 20.987 18.342  1.00 66.08  ? 366 VAL A O   1 
ATOM   2818 C CB  . VAL A 1 366 ? -38.114 21.115 15.262  1.00 65.73  ? 366 VAL A CB  1 
ATOM   2819 C CG1 . VAL A 1 366 ? -36.617 21.422 15.234  1.00 63.78  ? 366 VAL A CG1 1 
ATOM   2820 C CG2 . VAL A 1 366 ? -38.383 19.621 15.303  1.00 65.30  ? 366 VAL A CG2 1 
ATOM   2821 N N   . LYS A 1 367 ? -37.662 23.254 18.063  1.00 65.65  ? 367 LYS A N   1 
ATOM   2822 C CA  . LYS A 1 367 ? -36.907 23.569 19.277  1.00 65.23  ? 367 LYS A CA  1 
ATOM   2823 C C   . LYS A 1 367 ? -37.762 23.195 20.504  1.00 72.17  ? 367 LYS A C   1 
ATOM   2824 O O   . LYS A 1 367 ? -37.229 22.748 21.521  1.00 70.99  ? 367 LYS A O   1 
ATOM   2825 C CB  . LYS A 1 367 ? -36.505 25.051 19.280  1.00 67.43  ? 367 LYS A CB  1 
ATOM   2826 C CG  . LYS A 1 367 ? -35.410 25.397 20.276  1.00 78.98  ? 367 LYS A CG  1 
ATOM   2827 C CD  . LYS A 1 367 ? -34.588 26.584 19.801  1.00 89.10  ? 367 LYS A CD  1 
ATOM   2828 C CE  . LYS A 1 367 ? -33.992 27.377 20.938  1.00 98.34  ? 367 LYS A CE  1 
ATOM   2829 N NZ  . LYS A 1 367 ? -34.965 28.352 21.506  1.00 106.87 ? 367 LYS A NZ  1 
ATOM   2830 N N   . GLU A 1 368 ? -39.094 23.321 20.363  1.00 72.36  ? 368 GLU A N   1 
ATOM   2831 C CA  . GLU A 1 368 ? -40.094 22.975 21.365  1.00 74.43  ? 368 GLU A CA  1 
ATOM   2832 C C   . GLU A 1 368 ? -40.132 21.456 21.621  1.00 80.90  ? 368 GLU A C   1 
ATOM   2833 O O   . GLU A 1 368 ? -40.234 21.043 22.780  1.00 81.83  ? 368 GLU A O   1 
ATOM   2834 C CB  . GLU A 1 368 ? -41.470 23.548 20.939  1.00 77.78  ? 368 GLU A CB  1 
ATOM   2835 C CG  . GLU A 1 368 ? -42.673 22.606 20.974  1.00 92.54  ? 368 GLU A CG  1 
ATOM   2836 C CD  . GLU A 1 368 ? -43.021 21.877 19.684  1.00 116.18 ? 368 GLU A CD  1 
ATOM   2837 O OE1 . GLU A 1 368 ? -42.100 21.341 19.028  1.00 104.66 ? 368 GLU A OE1 1 
ATOM   2838 O OE2 . GLU A 1 368 ? -44.227 21.806 19.350  1.00 110.60 ? 368 GLU A OE2 1 
ATOM   2839 N N   . LEU A 1 369 ? -40.024 20.642 20.537  1.00 77.44  ? 369 LEU A N   1 
ATOM   2840 C CA  . LEU A 1 369 ? -40.097 19.177 20.525  1.00 76.90  ? 369 LEU A CA  1 
ATOM   2841 C C   . LEU A 1 369 ? -38.954 18.447 21.229  1.00 79.66  ? 369 LEU A C   1 
ATOM   2842 O O   . LEU A 1 369 ? -39.225 17.475 21.936  1.00 79.89  ? 369 LEU A O   1 
ATOM   2843 C CB  . LEU A 1 369 ? -40.219 18.681 19.085  1.00 77.16  ? 369 LEU A CB  1 
ATOM   2844 C CG  . LEU A 1 369 ? -41.283 17.634 18.826  1.00 82.87  ? 369 LEU A CG  1 
ATOM   2845 C CD1 . LEU A 1 369 ? -42.304 18.156 17.860  1.00 84.01  ? 369 LEU A CD1 1 
ATOM   2846 C CD2 . LEU A 1 369 ? -40.662 16.376 18.254  1.00 84.59  ? 369 LEU A CD2 1 
ATOM   2847 N N   . ILE A 1 370 ? -37.688 18.870 21.008  1.00 74.65  ? 370 ILE A N   1 
ATOM   2848 C CA  . ILE A 1 370 ? -36.498 18.256 21.626  1.00 73.56  ? 370 ILE A CA  1 
ATOM   2849 C C   . ILE A 1 370 ? -36.583 18.259 23.182  1.00 78.59  ? 370 ILE A C   1 
ATOM   2850 O O   . ILE A 1 370 ? -36.253 17.246 23.820  1.00 78.39  ? 370 ILE A O   1 
ATOM   2851 C CB  . ILE A 1 370 ? -35.176 18.887 21.063  1.00 75.33  ? 370 ILE A CB  1 
ATOM   2852 C CG1 . ILE A 1 370 ? -34.924 18.413 19.606  1.00 75.09  ? 370 ILE A CG1 1 
ATOM   2853 C CG2 . ILE A 1 370 ? -33.942 18.615 21.982  1.00 74.71  ? 370 ILE A CG2 1 
ATOM   2854 C CD1 . ILE A 1 370 ? -33.947 19.248 18.785  1.00 78.47  ? 370 ILE A CD1 1 
ATOM   2855 N N   . GLU A 1 371 ? -37.052 19.396 23.764  1.00 74.90  ? 371 GLU A N   1 
ATOM   2856 C CA  . GLU A 1 371 ? -37.220 19.617 25.198  1.00 88.38  ? 371 GLU A CA  1 
ATOM   2857 C C   . GLU A 1 371 ? -38.348 18.730 25.732  1.00 112.15 ? 371 GLU A C   1 
ATOM   2858 O O   . GLU A 1 371 ? -38.104 17.584 26.102  1.00 73.36  ? 371 GLU A O   1 
ATOM   2859 C CB  . GLU A 1 371 ? -37.524 21.104 25.458  1.00 90.37  ? 371 GLU A CB  1 
ATOM   2860 C CG  . GLU A 1 371 ? -37.469 21.529 26.922  1.00 102.24 ? 371 GLU A CG  1 
ATOM   2861 C CD  . GLU A 1 371 ? -36.147 22.062 27.451  1.00 126.05 ? 371 GLU A CD  1 
ATOM   2862 O OE1 . GLU A 1 371 ? -35.080 21.635 26.951  1.00 130.68 ? 371 GLU A OE1 1 
ATOM   2863 O OE2 . GLU A 1 371 ? -36.179 22.880 28.400  1.00 115.94 ? 371 GLU A OE2 1 
ATOM   2864 N N   . GLY A 1 378 ? -31.895 14.758 21.481  1.00 81.60  ? 378 GLY A N   1 
ATOM   2865 C CA  . GLY A 1 378 ? -30.521 15.239 21.484  1.00 80.71  ? 378 GLY A CA  1 
ATOM   2866 C C   . GLY A 1 378 ? -29.529 14.166 21.094  1.00 84.85  ? 378 GLY A C   1 
ATOM   2867 O O   . GLY A 1 378 ? -29.897 13.243 20.360  1.00 86.78  ? 378 GLY A O   1 
ATOM   2868 N N   . VAL A 1 379 ? -28.265 14.264 21.605  1.00 78.56  ? 379 VAL A N   1 
ATOM   2869 C CA  . VAL A 1 379 ? -27.131 13.330 21.370  1.00 76.86  ? 379 VAL A CA  1 
ATOM   2870 C C   . VAL A 1 379 ? -26.532 13.570 19.982  1.00 74.92  ? 379 VAL A C   1 
ATOM   2871 O O   . VAL A 1 379 ? -25.399 14.057 19.871  1.00 73.55  ? 379 VAL A O   1 
ATOM   2872 C CB  . VAL A 1 379 ? -27.424 11.798 21.611  1.00 82.01  ? 379 VAL A CB  1 
ATOM   2873 C CG1 . VAL A 1 379 ? -26.157 10.952 21.455  1.00 81.23  ? 379 VAL A CG1 1 
ATOM   2874 C CG2 . VAL A 1 379 ? -28.092 11.537 22.965  1.00 82.69  ? 379 VAL A CG2 1 
ATOM   2875 N N   . LEU A 1 380 ? -27.300 13.192 18.937  1.00 67.60  ? 380 LEU A N   1 
ATOM   2876 C CA  . LEU A 1 380 ? -26.941 13.326 17.527  1.00 65.38  ? 380 LEU A CA  1 
ATOM   2877 C C   . LEU A 1 380 ? -27.736 14.423 16.833  1.00 64.62  ? 380 LEU A C   1 
ATOM   2878 O O   . LEU A 1 380 ? -27.311 14.899 15.781  1.00 63.55  ? 380 LEU A O   1 
ATOM   2879 C CB  . LEU A 1 380 ? -27.058 11.980 16.763  1.00 65.99  ? 380 LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 380 ? -28.404 11.224 16.785  1.00 71.05  ? 380 LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 380 ? -28.780 10.739 15.392  1.00 71.03  ? 380 LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 380 ? -28.344 10.050 17.746  1.00 73.27  ? 380 LEU A CD2 1 
ATOM   2883 N N   . MET A 1 381 ? -28.847 14.868 17.447  1.00 58.91  ? 381 MET A N   1 
ATOM   2884 C CA  . MET A 1 381 ? -29.725 15.890 16.872  1.00 57.98  ? 381 MET A CA  1 
ATOM   2885 C C   . MET A 1 381 ? -29.633 17.249 17.532  1.00 60.14  ? 381 MET A C   1 
ATOM   2886 O O   . MET A 1 381 ? -29.253 17.332 18.696  1.00 60.63  ? 381 MET A O   1 
ATOM   2887 C CB  . MET A 1 381 ? -31.179 15.398 16.842  1.00 60.93  ? 381 MET A CB  1 
ATOM   2888 C CG  . MET A 1 381 ? -31.368 14.160 15.978  1.00 64.22  ? 381 MET A CG  1 
ATOM   2889 S SD  . MET A 1 381 ? -32.995 13.403 16.132  1.00 68.75  ? 381 MET A SD  1 
ATOM   2890 C CE  . MET A 1 381 ? -32.779 12.466 17.615  1.00 65.34  ? 381 MET A CE  1 
ATOM   2891 N N   . LEU A 1 382 ? -29.955 18.316 16.765  1.00 55.06  ? 382 LEU A N   1 
ATOM   2892 C CA  . LEU A 1 382 ? -30.019 19.728 17.186  1.00 54.00  ? 382 LEU A CA  1 
ATOM   2893 C C   . LEU A 1 382 ? -30.992 20.547 16.273  1.00 57.90  ? 382 LEU A C   1 
ATOM   2894 O O   . LEU A 1 382 ? -31.203 20.136 15.125  1.00 57.55  ? 382 LEU A O   1 
ATOM   2895 C CB  . LEU A 1 382 ? -28.626 20.373 17.364  1.00 52.74  ? 382 LEU A CB  1 
ATOM   2896 C CG  . LEU A 1 382 ? -28.123 21.297 16.278  1.00 56.81  ? 382 LEU A CG  1 
ATOM   2897 C CD1 . LEU A 1 382 ? -27.322 22.427 16.865  1.00 56.10  ? 382 LEU A CD1 1 
ATOM   2898 C CD2 . LEU A 1 382 ? -27.296 20.551 15.308  1.00 59.33  ? 382 LEU A CD2 1 
ATOM   2899 N N   . PRO A 1 383 ? -31.635 21.653 16.756  1.00 54.10  ? 383 PRO A N   1 
ATOM   2900 C CA  . PRO A 1 383 ? -32.623 22.359 15.914  1.00 53.72  ? 383 PRO A CA  1 
ATOM   2901 C C   . PRO A 1 383 ? -32.043 23.334 14.903  1.00 52.08  ? 383 PRO A C   1 
ATOM   2902 O O   . PRO A 1 383 ? -31.016 23.972 15.160  1.00 49.44  ? 383 PRO A O   1 
ATOM   2903 C CB  . PRO A 1 383 ? -33.545 23.051 16.928  1.00 56.61  ? 383 PRO A CB  1 
ATOM   2904 C CG  . PRO A 1 383 ? -32.903 22.852 18.274  1.00 61.32  ? 383 PRO A CG  1 
ATOM   2905 C CD  . PRO A 1 383 ? -31.541 22.286 18.081  1.00 55.74  ? 383 PRO A CD  1 
ATOM   2906 N N   . GLY A 1 384 ? -32.744 23.449 13.777  1.00 48.05  ? 384 GLY A N   1 
ATOM   2907 C CA  . GLY A 1 384 ? -32.390 24.291 12.632  1.00 47.84  ? 384 GLY A CA  1 
ATOM   2908 C C   . GLY A 1 384 ? -32.096 25.767 12.869  1.00 51.01  ? 384 GLY A C   1 
ATOM   2909 O O   . GLY A 1 384 ? -31.366 26.377 12.084  1.00 51.12  ? 384 GLY A O   1 
ATOM   2910 N N   . ASN A 1 385 ? -32.672 26.350 13.937  1.00 46.93  ? 385 ASN A N   1 
ATOM   2911 C CA  . ASN A 1 385 ? -32.546 27.753 14.355  1.00 46.32  ? 385 ASN A CA  1 
ATOM   2912 C C   . ASN A 1 385 ? -31.114 28.312 14.247  1.00 49.01  ? 385 ASN A C   1 
ATOM   2913 O O   . ASN A 1 385 ? -30.911 29.368 13.647  1.00 50.72  ? 385 ASN A O   1 
ATOM   2914 C CB  . ASN A 1 385 ? -33.090 27.935 15.779  1.00 45.37  ? 385 ASN A CB  1 
ATOM   2915 C CG  . ASN A 1 385 ? -34.488 27.393 15.970  1.00 74.00  ? 385 ASN A CG  1 
ATOM   2916 O OD1 . ASN A 1 385 ? -34.686 26.224 16.313  1.00 70.21  ? 385 ASN A OD1 1 
ATOM   2917 N ND2 . ASN A 1 385 ? -35.493 28.217 15.727  1.00 70.61  ? 385 ASN A ND2 1 
ATOM   2918 N N   . ALA A 1 386 ? -30.133 27.569 14.764  1.00 42.25  ? 386 ALA A N   1 
ATOM   2919 C CA  . ALA A 1 386 ? -28.705 27.920 14.782  1.00 40.79  ? 386 ALA A CA  1 
ATOM   2920 C C   . ALA A 1 386 ? -28.047 28.250 13.436  1.00 41.92  ? 386 ALA A C   1 
ATOM   2921 O O   . ALA A 1 386 ? -27.002 28.917 13.396  1.00 42.32  ? 386 ALA A O   1 
ATOM   2922 C CB  . ALA A 1 386 ? -27.929 26.785 15.431  1.00 40.79  ? 386 ALA A CB  1 
ATOM   2923 N N   . PHE A 1 387 ? -28.610 27.730 12.349  1.00 36.29  ? 387 PHE A N   1 
ATOM   2924 C CA  . PHE A 1 387 ? -28.024 27.834 11.012  1.00 35.31  ? 387 PHE A CA  1 
ATOM   2925 C C   . PHE A 1 387 ? -28.584 28.969 10.173  1.00 41.12  ? 387 PHE A C   1 
ATOM   2926 O O   . PHE A 1 387 ? -28.395 29.014 8.952   1.00 41.80  ? 387 PHE A O   1 
ATOM   2927 C CB  . PHE A 1 387 ? -28.142 26.466 10.311  1.00 36.31  ? 387 PHE A CB  1 
ATOM   2928 C CG  . PHE A 1 387 ? -27.659 25.328 11.172  1.00 36.01  ? 387 PHE A CG  1 
ATOM   2929 C CD1 . PHE A 1 387 ? -28.546 24.629 11.994  1.00 38.41  ? 387 PHE A CD1 1 
ATOM   2930 C CD2 . PHE A 1 387 ? -26.312 24.965 11.182  1.00 36.65  ? 387 PHE A CD2 1 
ATOM   2931 C CE1 . PHE A 1 387 ? -28.101 23.585 12.804  1.00 38.04  ? 387 PHE A CE1 1 
ATOM   2932 C CE2 . PHE A 1 387 ? -25.871 23.904 11.975  1.00 38.30  ? 387 PHE A CE2 1 
ATOM   2933 C CZ  . PHE A 1 387 ? -26.773 23.220 12.778  1.00 36.37  ? 387 PHE A CZ  1 
ATOM   2934 N N   . TYR A 1 388 ? -29.240 29.908 10.843  1.00 38.33  ? 388 TYR A N   1 
ATOM   2935 C CA  . TYR A 1 388 ? -29.851 31.063 10.203  1.00 39.33  ? 388 TYR A CA  1 
ATOM   2936 C C   . TYR A 1 388 ? -29.363 32.373 10.822  1.00 45.71  ? 388 TYR A C   1 
ATOM   2937 O O   . TYR A 1 388 ? -29.040 32.403 12.019  1.00 46.51  ? 388 TYR A O   1 
ATOM   2938 C CB  . TYR A 1 388 ? -31.386 30.949 10.316  1.00 40.06  ? 388 TYR A CB  1 
ATOM   2939 C CG  . TYR A 1 388 ? -31.970 29.867 9.436   1.00 39.81  ? 388 TYR A CG  1 
ATOM   2940 C CD1 . TYR A 1 388 ? -32.256 30.112 8.096   1.00 42.36  ? 388 TYR A CD1 1 
ATOM   2941 C CD2 . TYR A 1 388 ? -32.207 28.583 9.935   1.00 39.31  ? 388 TYR A CD2 1 
ATOM   2942 C CE1 . TYR A 1 388 ? -32.767 29.107 7.268   1.00 43.82  ? 388 TYR A CE1 1 
ATOM   2943 C CE2 . TYR A 1 388 ? -32.710 27.565 9.115   1.00 40.22  ? 388 TYR A CE2 1 
ATOM   2944 C CZ  . TYR A 1 388 ? -33.007 27.836 7.784   1.00 47.10  ? 388 TYR A CZ  1 
ATOM   2945 O OH  . TYR A 1 388 ? -33.540 26.855 6.971   1.00 43.46  ? 388 TYR A OH  1 
ATOM   2946 N N   . VAL A 1 389 ? -29.339 33.461 10.015  1.00 41.94  ? 389 VAL A N   1 
ATOM   2947 C CA  . VAL A 1 389 ? -28.979 34.810 10.477  1.00 41.66  ? 389 VAL A CA  1 
ATOM   2948 C C   . VAL A 1 389 ? -30.039 35.229 11.548  1.00 50.14  ? 389 VAL A C   1 
ATOM   2949 O O   . VAL A 1 389 ? -29.673 35.690 12.632  1.00 48.39  ? 389 VAL A O   1 
ATOM   2950 C CB  . VAL A 1 389 ? -28.846 35.823 9.297   1.00 44.70  ? 389 VAL A CB  1 
ATOM   2951 C CG1 . VAL A 1 389 ? -28.614 37.230 9.806   1.00 44.10  ? 389 VAL A CG1 1 
ATOM   2952 C CG2 . VAL A 1 389 ? -27.726 35.435 8.336   1.00 43.62  ? 389 VAL A CG2 1 
ATOM   2953 N N   . ASP A 1 390 ? -31.336 34.969 11.258  1.00 51.09  ? 390 ASP A N   1 
ATOM   2954 C CA  . ASP A 1 390 ? -32.442 35.216 12.175  1.00 53.37  ? 390 ASP A CA  1 
ATOM   2955 C C   . ASP A 1 390 ? -32.764 33.889 12.880  1.00 59.20  ? 390 ASP A C   1 
ATOM   2956 O O   . ASP A 1 390 ? -33.666 33.149 12.465  1.00 60.62  ? 390 ASP A O   1 
ATOM   2957 C CB  . ASP A 1 390 ? -33.662 35.768 11.412  1.00 58.17  ? 390 ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 390 ? -34.869 36.189 12.253  1.00 73.94  ? 390 ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 390 ? -35.765 36.871 11.705  1.00 77.70  ? 390 ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 390 ? -34.931 35.813 13.451  1.00 77.56  ? 390 ASP A OD2 1 
ATOM   2961 N N   . SER A 1 391 ? -32.000 33.592 13.944  1.00 54.62  ? 391 SER A N   1 
ATOM   2962 C CA  . SER A 1 391 ? -32.125 32.364 14.739  1.00 53.28  ? 391 SER A CA  1 
ATOM   2963 C C   . SER A 1 391 ? -33.348 32.332 15.652  1.00 58.19  ? 391 SER A C   1 
ATOM   2964 O O   . SER A 1 391 ? -33.636 31.290 16.243  1.00 57.91  ? 391 SER A O   1 
ATOM   2965 C CB  . SER A 1 391 ? -30.845 32.097 15.529  1.00 54.84  ? 391 SER A CB  1 
ATOM   2966 O OG  . SER A 1 391 ? -30.118 33.280 15.815  1.00 63.30  ? 391 SER A OG  1 
ATOM   2967 N N   . SER A 1 392 ? -34.058 33.472 15.776  1.00 55.73  ? 392 SER A N   1 
ATOM   2968 C CA  . SER A 1 392 ? -35.264 33.612 16.599  1.00 56.60  ? 392 SER A CA  1 
ATOM   2969 C C   . SER A 1 392 ? -36.517 33.138 15.862  1.00 60.99  ? 392 SER A C   1 
ATOM   2970 O O   . SER A 1 392 ? -37.528 32.832 16.498  1.00 61.17  ? 392 SER A O   1 
ATOM   2971 C CB  . SER A 1 392 ? -35.429 35.047 17.086  1.00 61.58  ? 392 SER A CB  1 
ATOM   2972 O OG  . SER A 1 392 ? -35.224 35.971 16.031  1.00 74.82  ? 392 SER A OG  1 
ATOM   2973 N N   . ALA A 1 393 ? -36.440 33.063 14.524  1.00 57.84  ? 393 ALA A N   1 
ATOM   2974 C CA  . ALA A 1 393 ? -37.527 32.572 13.677  1.00 58.84  ? 393 ALA A CA  1 
ATOM   2975 C C   . ALA A 1 393 ? -37.738 31.059 13.927  1.00 60.47  ? 393 ALA A C   1 
ATOM   2976 O O   . ALA A 1 393 ? -36.746 30.348 14.154  1.00 57.47  ? 393 ALA A O   1 
ATOM   2977 C CB  . ALA A 1 393 ? -37.186 32.814 12.213  1.00 60.09  ? 393 ALA A CB  1 
ATOM   2978 N N   . PRO A 1 394 ? -39.001 30.546 13.922  1.00 57.68  ? 394 PRO A N   1 
ATOM   2979 C CA  . PRO A 1 394 ? -39.207 29.094 14.149  1.00 56.43  ? 394 PRO A CA  1 
ATOM   2980 C C   . PRO A 1 394 ? -38.698 28.244 12.980  1.00 58.69  ? 394 PRO A C   1 
ATOM   2981 O O   . PRO A 1 394 ? -38.740 28.704 11.835  1.00 59.97  ? 394 PRO A O   1 
ATOM   2982 C CB  . PRO A 1 394 ? -40.718 28.965 14.348  1.00 59.44  ? 394 PRO A CB  1 
ATOM   2983 C CG  . PRO A 1 394 ? -41.285 30.124 13.638  1.00 65.73  ? 394 PRO A CG  1 
ATOM   2984 C CD  . PRO A 1 394 ? -40.283 31.243 13.697  1.00 60.85  ? 394 PRO A CD  1 
ATOM   2985 N N   . SER A 1 395 ? -38.199 27.021 13.268  1.00 51.60  ? 395 SER A N   1 
ATOM   2986 C CA  . SER A 1 395 ? -37.645 26.117 12.253  1.00 49.31  ? 395 SER A CA  1 
ATOM   2987 C C   . SER A 1 395 ? -38.214 24.689 12.367  1.00 50.10  ? 395 SER A C   1 
ATOM   2988 O O   . SER A 1 395 ? -38.119 24.101 13.446  1.00 48.14  ? 395 SER A O   1 
ATOM   2989 C CB  . SER A 1 395 ? -36.114 26.093 12.342  1.00 50.06  ? 395 SER A CB  1 
ATOM   2990 O OG  . SER A 1 395 ? -35.534 25.413 11.241  1.00 53.13  ? 395 SER A OG  1 
ATOM   2991 N N   . PRO A 1 396 ? -38.763 24.091 11.276  1.00 46.58  ? 396 PRO A N   1 
ATOM   2992 C CA  . PRO A 1 396 ? -39.272 22.705 11.377  1.00 46.10  ? 396 PRO A CA  1 
ATOM   2993 C C   . PRO A 1 396 ? -38.174 21.649 11.178  1.00 48.21  ? 396 PRO A C   1 
ATOM   2994 O O   . PRO A 1 396 ? -38.435 20.444 11.332  1.00 48.33  ? 396 PRO A O   1 
ATOM   2995 C CB  . PRO A 1 396 ? -40.309 22.637 10.262  1.00 49.23  ? 396 PRO A CB  1 
ATOM   2996 C CG  . PRO A 1 396 ? -39.735 23.534 9.208   1.00 54.18  ? 396 PRO A CG  1 
ATOM   2997 C CD  . PRO A 1 396 ? -38.951 24.626 9.910   1.00 49.09  ? 396 PRO A CD  1 
ATOM   2998 N N   . TYR A 1 397 ? -36.952 22.110 10.831  1.00 42.17  ? 397 TYR A N   1 
ATOM   2999 C CA  . TYR A 1 397 ? -35.787 21.282 10.540  1.00 40.57  ? 397 TYR A CA  1 
ATOM   3000 C C   . TYR A 1 397 ? -34.944 20.953 11.747  1.00 44.85  ? 397 TYR A C   1 
ATOM   3001 O O   . TYR A 1 397 ? -34.826 21.752 12.682  1.00 45.43  ? 397 TYR A O   1 
ATOM   3002 C CB  . TYR A 1 397 ? -34.862 21.987 9.530   1.00 40.98  ? 397 TYR A CB  1 
ATOM   3003 C CG  . TYR A 1 397 ? -35.455 22.257 8.170   1.00 42.49  ? 397 TYR A CG  1 
ATOM   3004 C CD1 . TYR A 1 397 ? -36.018 23.494 7.867   1.00 45.39  ? 397 TYR A CD1 1 
ATOM   3005 C CD2 . TYR A 1 397 ? -35.409 21.295 7.168   1.00 42.88  ? 397 TYR A CD2 1 
ATOM   3006 C CE1 . TYR A 1 397 ? -36.574 23.746 6.617   1.00 48.38  ? 397 TYR A CE1 1 
ATOM   3007 C CE2 . TYR A 1 397 ? -35.933 21.544 5.905   1.00 45.57  ? 397 TYR A CE2 1 
ATOM   3008 C CZ  . TYR A 1 397 ? -36.541 22.761 5.637   1.00 57.35  ? 397 TYR A CZ  1 
ATOM   3009 O OH  . TYR A 1 397 ? -37.102 22.969 4.391   1.00 59.95  ? 397 TYR A OH  1 
ATOM   3010 N N   . LEU A 1 398 ? -34.266 19.817 11.670  1.00 40.59  ? 398 LEU A N   1 
ATOM   3011 C CA  . LEU A 1 398 ? -33.288 19.436 12.665  1.00 40.26  ? 398 LEU A CA  1 
ATOM   3012 C C   . LEU A 1 398 ? -32.096 18.763 11.979  1.00 43.19  ? 398 LEU A C   1 
ATOM   3013 O O   . LEU A 1 398 ? -32.259 18.156 10.911  1.00 42.37  ? 398 LEU A O   1 
ATOM   3014 C CB  . LEU A 1 398 ? -33.869 18.644 13.867  1.00 40.95  ? 398 LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 398 ? -34.553 17.287 13.622  1.00 47.56  ? 398 LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 398 ? -33.556 16.140 13.721  1.00 47.70  ? 398 LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 398 ? -35.628 17.035 14.652  1.00 49.69  ? 398 LEU A CD2 1 
ATOM   3018 N N   . ARG A 1 399 ? -30.890 18.938 12.552  1.00 38.16  ? 399 ARG A N   1 
ATOM   3019 C CA  . ARG A 1 399 ? -29.664 18.366 12.004  1.00 36.57  ? 399 ARG A CA  1 
ATOM   3020 C C   . ARG A 1 399 ? -29.209 17.175 12.841  1.00 40.10  ? 399 ARG A C   1 
ATOM   3021 O O   . ARG A 1 399 ? -28.935 17.316 14.037  1.00 39.55  ? 399 ARG A O   1 
ATOM   3022 C CB  . ARG A 1 399 ? -28.554 19.433 11.879  1.00 35.39  ? 399 ARG A CB  1 
ATOM   3023 C CG  . ARG A 1 399 ? -27.312 18.929 11.150  1.00 44.23  ? 399 ARG A CG  1 
ATOM   3024 C CD  . ARG A 1 399 ? -26.073 19.773 11.411  1.00 41.45  ? 399 ARG A CD  1 
ATOM   3025 N NE  . ARG A 1 399 ? -25.458 19.494 12.707  1.00 38.25  ? 399 ARG A NE  1 
ATOM   3026 C CZ  . ARG A 1 399 ? -24.428 20.172 13.209  1.00 47.28  ? 399 ARG A CZ  1 
ATOM   3027 N NH1 . ARG A 1 399 ? -23.880 21.168 12.522  1.00 30.83  ? 399 ARG A NH1 1 
ATOM   3028 N NH2 . ARG A 1 399 ? -23.944 19.865 14.409  1.00 32.60  ? 399 ARG A NH2 1 
ATOM   3029 N N   . ALA A 1 400 ? -29.135 16.003 12.196  1.00 36.43  ? 400 ALA A N   1 
ATOM   3030 C CA  . ALA A 1 400 ? -28.701 14.739 12.790  1.00 35.24  ? 400 ALA A CA  1 
ATOM   3031 C C   . ALA A 1 400 ? -27.304 14.390 12.258  1.00 38.57  ? 400 ALA A C   1 
ATOM   3032 O O   . ALA A 1 400 ? -27.071 14.419 11.047  1.00 38.36  ? 400 ALA A O   1 
ATOM   3033 C CB  . ALA A 1 400 ? -29.692 13.628 12.451  1.00 36.56  ? 400 ALA A CB  1 
ATOM   3034 N N   . SER A 1 401 ? -26.371 14.078 13.164  1.00 34.46  ? 401 SER A N   1 
ATOM   3035 C CA  . SER A 1 401 ? -25.001 13.723 12.790  1.00 32.47  ? 401 SER A CA  1 
ATOM   3036 C C   . SER A 1 401 ? -24.802 12.230 12.832  1.00 34.58  ? 401 SER A C   1 
ATOM   3037 O O   . SER A 1 401 ? -25.154 11.578 13.816  1.00 34.41  ? 401 SER A O   1 
ATOM   3038 C CB  . SER A 1 401 ? -23.988 14.430 13.683  1.00 33.11  ? 401 SER A CB  1 
ATOM   3039 O OG  . SER A 1 401 ? -22.666 14.106 13.291  1.00 41.00  ? 401 SER A OG  1 
ATOM   3040 N N   . PHE A 1 402 ? -24.232 11.691 11.760  1.00 29.80  ? 402 PHE A N   1 
ATOM   3041 C CA  . PHE A 1 402 ? -23.931 10.269 11.638  1.00 29.22  ? 402 PHE A CA  1 
ATOM   3042 C C   . PHE A 1 402 ? -22.407 9.968  11.753  1.00 35.49  ? 402 PHE A C   1 
ATOM   3043 O O   . PHE A 1 402 ? -21.961 8.904  11.344  1.00 36.34  ? 402 PHE A O   1 
ATOM   3044 C CB  . PHE A 1 402 ? -24.554 9.691  10.347  1.00 30.42  ? 402 PHE A CB  1 
ATOM   3045 C CG  . PHE A 1 402 ? -24.154 10.329 9.042   1.00 30.48  ? 402 PHE A CG  1 
ATOM   3046 C CD1 . PHE A 1 402 ? -22.989 9.947  8.392   1.00 33.12  ? 402 PHE A CD1 1 
ATOM   3047 C CD2 . PHE A 1 402 ? -24.984 11.254 8.421   1.00 31.42  ? 402 PHE A CD2 1 
ATOM   3048 C CE1 . PHE A 1 402 ? -22.638 10.511 7.163   1.00 34.25  ? 402 PHE A CE1 1 
ATOM   3049 C CE2 . PHE A 1 402 ? -24.647 11.804 7.187   1.00 34.51  ? 402 PHE A CE2 1 
ATOM   3050 C CZ  . PHE A 1 402 ? -23.475 11.432 6.564   1.00 33.16  ? 402 PHE A CZ  1 
ATOM   3051 N N   . SER A 1 403 ? -21.619 10.892 12.313  1.00 31.90  ? 403 SER A N   1 
ATOM   3052 C CA  . SER A 1 403 ? -20.175 10.703 12.431  1.00 32.00  ? 403 SER A CA  1 
ATOM   3053 C C   . SER A 1 403 ? -19.744 9.757  13.552  1.00 38.25  ? 403 SER A C   1 
ATOM   3054 O O   . SER A 1 403 ? -18.635 9.222  13.488  1.00 38.52  ? 403 SER A O   1 
ATOM   3055 C CB  . SER A 1 403 ? -19.458 12.045 12.575  1.00 34.89  ? 403 SER A CB  1 
ATOM   3056 O OG  . SER A 1 403 ? -19.825 12.730 13.763  1.00 46.73  ? 403 SER A OG  1 
ATOM   3057 N N   . SER A 1 404 ? -20.588 9.550  14.575  1.00 35.87  ? 404 SER A N   1 
ATOM   3058 C CA  . SER A 1 404 ? -20.190 8.723  15.714  1.00 36.49  ? 404 SER A CA  1 
ATOM   3059 C C   . SER A 1 404 ? -21.192 7.673  16.207  1.00 41.44  ? 404 SER A C   1 
ATOM   3060 O O   . SER A 1 404 ? -20.755 6.607  16.653  1.00 43.27  ? 404 SER A O   1 
ATOM   3061 C CB  . SER A 1 404 ? -19.748 9.609  16.869  1.00 40.51  ? 404 SER A CB  1 
ATOM   3062 O OG  . SER A 1 404 ? -20.671 10.671 17.067  1.00 54.19  ? 404 SER A OG  1 
ATOM   3063 N N   . ALA A 1 405 ? -22.507 7.967  16.166  1.00 35.47  ? 405 ALA A N   1 
ATOM   3064 C CA  . ALA A 1 405 ? -23.533 7.041  16.640  1.00 35.32  ? 405 ALA A CA  1 
ATOM   3065 C C   . ALA A 1 405 ? -23.478 5.672  15.929  1.00 41.40  ? 405 ALA A C   1 
ATOM   3066 O O   . ALA A 1 405 ? -23.148 5.597  14.745  1.00 41.19  ? 405 ALA A O   1 
ATOM   3067 C CB  . ALA A 1 405 ? -24.908 7.663  16.501  1.00 36.04  ? 405 ALA A CB  1 
ATOM   3068 N N   . SER A 1 406 ? -23.734 4.587  16.674  1.00 39.16  ? 406 SER A N   1 
ATOM   3069 C CA  . SER A 1 406 ? -23.719 3.237  16.117  1.00 39.60  ? 406 SER A CA  1 
ATOM   3070 C C   . SER A 1 406 ? -25.019 3.005  15.334  1.00 46.38  ? 406 SER A C   1 
ATOM   3071 O O   . SER A 1 406 ? -26.013 3.670  15.642  1.00 45.56  ? 406 SER A O   1 
ATOM   3072 C CB  . SER A 1 406 ? -23.558 2.194  17.223  1.00 41.80  ? 406 SER A CB  1 
ATOM   3073 O OG  . SER A 1 406 ? -24.732 2.009  17.995  1.00 49.83  ? 406 SER A OG  1 
ATOM   3074 N N   . PRO A 1 407 ? -25.063 2.068  14.343  1.00 45.57  ? 407 PRO A N   1 
ATOM   3075 C CA  . PRO A 1 407 ? -26.320 1.831  13.605  1.00 46.45  ? 407 PRO A CA  1 
ATOM   3076 C C   . PRO A 1 407 ? -27.545 1.549  14.482  1.00 50.61  ? 407 PRO A C   1 
ATOM   3077 O O   . PRO A 1 407 ? -28.659 1.935  14.123  1.00 49.19  ? 407 PRO A O   1 
ATOM   3078 C CB  . PRO A 1 407 ? -25.965 0.653  12.701  1.00 49.10  ? 407 PRO A CB  1 
ATOM   3079 C CG  . PRO A 1 407 ? -24.492 0.812  12.470  1.00 52.63  ? 407 PRO A CG  1 
ATOM   3080 C CD  . PRO A 1 407 ? -23.982 1.204  13.819  1.00 47.37  ? 407 PRO A CD  1 
ATOM   3081 N N   . GLU A 1 408 ? -27.325 0.920  15.647  1.00 48.70  ? 408 GLU A N   1 
ATOM   3082 C CA  . GLU A 1 408 ? -28.365 0.620  16.632  1.00 49.63  ? 408 GLU A CA  1 
ATOM   3083 C C   . GLU A 1 408 ? -28.629 1.810  17.565  1.00 51.96  ? 408 GLU A C   1 
ATOM   3084 O O   . GLU A 1 408 ? -29.744 1.940  18.073  1.00 53.24  ? 408 GLU A O   1 
ATOM   3085 C CB  . GLU A 1 408 ? -28.133 -0.716 17.373  1.00 52.20  ? 408 GLU A CB  1 
ATOM   3086 C CG  . GLU A 1 408 ? -26.680 -1.040 17.707  1.00 68.12  ? 408 GLU A CG  1 
ATOM   3087 C CD  . GLU A 1 408 ? -25.783 -1.523 16.580  1.00 91.64  ? 408 GLU A CD  1 
ATOM   3088 O OE1 . GLU A 1 408 ? -26.303 -2.157 15.632  1.00 86.65  ? 408 GLU A OE1 1 
ATOM   3089 O OE2 . GLU A 1 408 ? -24.553 -1.285 16.658  1.00 81.10  ? 408 GLU A OE2 1 
ATOM   3090 N N   . GLN A 1 409 ? -27.640 2.714  17.740  1.00 45.69  ? 409 GLN A N   1 
ATOM   3091 C CA  . GLN A 1 409 ? -27.824 3.955  18.518  1.00 44.70  ? 409 GLN A CA  1 
ATOM   3092 C C   . GLN A 1 409 ? -28.797 4.857  17.735  1.00 47.70  ? 409 GLN A C   1 
ATOM   3093 O O   . GLN A 1 409 ? -29.649 5.521  18.329  1.00 46.60  ? 409 GLN A O   1 
ATOM   3094 C CB  . GLN A 1 409 ? -26.487 4.698  18.720  1.00 44.76  ? 409 GLN A CB  1 
ATOM   3095 C CG  . GLN A 1 409 ? -25.851 4.474  20.073  1.00 62.07  ? 409 GLN A CG  1 
ATOM   3096 C CD  . GLN A 1 409 ? -24.536 5.195  20.220  1.00 90.85  ? 409 GLN A CD  1 
ATOM   3097 O OE1 . GLN A 1 409 ? -24.467 6.436  20.195  1.00 84.86  ? 409 GLN A OE1 1 
ATOM   3098 N NE2 . GLN A 1 409 ? -23.461 4.433  20.413  1.00 87.97  ? 409 GLN A NE2 1 
ATOM   3099 N N   . MET A 1 410 ? -28.664 4.835  16.390  1.00 44.00  ? 410 MET A N   1 
ATOM   3100 C CA  . MET A 1 410 ? -29.478 5.559  15.419  1.00 43.79  ? 410 MET A CA  1 
ATOM   3101 C C   . MET A 1 410 ? -30.914 5.047  15.435  1.00 50.09  ? 410 MET A C   1 
ATOM   3102 O O   . MET A 1 410 ? -31.842 5.853  15.479  1.00 50.24  ? 410 MET A O   1 
ATOM   3103 C CB  . MET A 1 410 ? -28.879 5.406  14.014  1.00 45.90  ? 410 MET A CB  1 
ATOM   3104 C CG  . MET A 1 410 ? -27.657 6.282  13.790  1.00 48.07  ? 410 MET A CG  1 
ATOM   3105 S SD  . MET A 1 410 ? -26.619 5.717  12.408  1.00 51.45  ? 410 MET A SD  1 
ATOM   3106 C CE  . MET A 1 410 ? -25.368 6.877  12.479  1.00 46.64  ? 410 MET A CE  1 
ATOM   3107 N N   . ASP A 1 411 ? -31.097 3.709  15.425  1.00 47.86  ? 411 ASP A N   1 
ATOM   3108 C CA  . ASP A 1 411 ? -32.404 3.054  15.463  1.00 48.60  ? 411 ASP A CA  1 
ATOM   3109 C C   . ASP A 1 411 ? -33.158 3.455  16.722  1.00 54.02  ? 411 ASP A C   1 
ATOM   3110 O O   . ASP A 1 411 ? -34.279 3.945  16.618  1.00 54.71  ? 411 ASP A O   1 
ATOM   3111 C CB  . ASP A 1 411 ? -32.235 1.540  15.406  1.00 51.17  ? 411 ASP A CB  1 
ATOM   3112 C CG  . ASP A 1 411 ? -33.453 0.819  14.882  1.00 68.12  ? 411 ASP A CG  1 
ATOM   3113 O OD1 . ASP A 1 411 ? -34.415 0.620  15.669  1.00 71.97  ? 411 ASP A OD1 1 
ATOM   3114 O OD2 . ASP A 1 411 ? -33.445 0.435  13.694  1.00 71.75  ? 411 ASP A OD2 1 
ATOM   3115 N N   . VAL A 1 412 ? -32.518 3.307  17.904  1.00 50.57  ? 412 VAL A N   1 
ATOM   3116 C CA  . VAL A 1 412 ? -33.073 3.660  19.213  1.00 50.28  ? 412 VAL A CA  1 
ATOM   3117 C C   . VAL A 1 412 ? -33.512 5.136  19.251  1.00 53.99  ? 412 VAL A C   1 
ATOM   3118 O O   . VAL A 1 412 ? -34.632 5.421  19.671  1.00 54.71  ? 412 VAL A O   1 
ATOM   3119 C CB  . VAL A 1 412 ? -32.085 3.304  20.367  1.00 53.37  ? 412 VAL A CB  1 
ATOM   3120 C CG1 . VAL A 1 412 ? -32.520 3.928  21.692  1.00 53.12  ? 412 VAL A CG1 1 
ATOM   3121 C CG2 . VAL A 1 412 ? -31.925 1.796  20.520  1.00 53.63  ? 412 VAL A CG2 1 
ATOM   3122 N N   . ALA A 1 413 ? -32.638 6.053  18.790  1.00 49.50  ? 413 ALA A N   1 
ATOM   3123 C CA  . ALA A 1 413 ? -32.870 7.500  18.782  1.00 48.72  ? 413 ALA A CA  1 
ATOM   3124 C C   . ALA A 1 413 ? -33.990 7.963  17.846  1.00 53.99  ? 413 ALA A C   1 
ATOM   3125 O O   . ALA A 1 413 ? -34.825 8.777  18.260  1.00 54.55  ? 413 ALA A O   1 
ATOM   3126 C CB  . ALA A 1 413 ? -31.582 8.232  18.468  1.00 48.27  ? 413 ALA A CB  1 
ATOM   3127 N N   . PHE A 1 414 ? -34.023 7.440  16.599  1.00 50.33  ? 414 PHE A N   1 
ATOM   3128 C CA  . PHE A 1 414 ? -35.059 7.788  15.625  1.00 51.11  ? 414 PHE A CA  1 
ATOM   3129 C C   . PHE A 1 414 ? -36.422 7.225  16.002  1.00 56.32  ? 414 PHE A C   1 
ATOM   3130 O O   . PHE A 1 414 ? -37.440 7.740  15.547  1.00 57.18  ? 414 PHE A O   1 
ATOM   3131 C CB  . PHE A 1 414 ? -34.656 7.391  14.199  1.00 53.40  ? 414 PHE A CB  1 
ATOM   3132 C CG  . PHE A 1 414 ? -33.787 8.381  13.448  1.00 54.59  ? 414 PHE A CG  1 
ATOM   3133 C CD1 . PHE A 1 414 ? -33.639 9.690  13.897  1.00 57.32  ? 414 PHE A CD1 1 
ATOM   3134 C CD2 . PHE A 1 414 ? -33.165 8.022  12.261  1.00 57.17  ? 414 PHE A CD2 1 
ATOM   3135 C CE1 . PHE A 1 414 ? -32.842 10.601 13.196  1.00 57.57  ? 414 PHE A CE1 1 
ATOM   3136 C CE2 . PHE A 1 414 ? -32.372 8.936  11.560  1.00 59.35  ? 414 PHE A CE2 1 
ATOM   3137 C CZ  . PHE A 1 414 ? -32.220 10.219 12.030  1.00 56.52  ? 414 PHE A CZ  1 
ATOM   3138 N N   . GLN A 1 415 ? -36.440 6.194  16.857  1.00 53.11  ? 415 GLN A N   1 
ATOM   3139 C CA  . GLN A 1 415 ? -37.658 5.599  17.393  1.00 54.71  ? 415 GLN A CA  1 
ATOM   3140 C C   . GLN A 1 415 ? -38.260 6.573  18.432  1.00 59.56  ? 415 GLN A C   1 
ATOM   3141 O O   . GLN A 1 415 ? -39.483 6.733  18.483  1.00 61.43  ? 415 GLN A O   1 
ATOM   3142 C CB  . GLN A 1 415 ? -37.332 4.236  18.003  1.00 56.53  ? 415 GLN A CB  1 
ATOM   3143 C CG  . GLN A 1 415 ? -38.453 3.582  18.795  1.00 76.87  ? 415 GLN A CG  1 
ATOM   3144 C CD  . GLN A 1 415 ? -37.997 2.250  19.305  1.00 101.07 ? 415 GLN A CD  1 
ATOM   3145 O OE1 . GLN A 1 415 ? -38.356 1.226  18.746  1.00 95.63  ? 415 GLN A OE1 1 
ATOM   3146 N NE2 . GLN A 1 415 ? -37.143 2.237  20.331  1.00 96.90  ? 415 GLN A NE2 1 
ATOM   3147 N N   . VAL A 1 416 ? -37.396 7.247  19.221  1.00 53.85  ? 416 VAL A N   1 
ATOM   3148 C CA  . VAL A 1 416 ? -37.790 8.249  20.220  1.00 52.98  ? 416 VAL A CA  1 
ATOM   3149 C C   . VAL A 1 416 ? -38.340 9.478  19.478  1.00 55.79  ? 416 VAL A C   1 
ATOM   3150 O O   . VAL A 1 416 ? -39.372 10.016 19.880  1.00 55.32  ? 416 VAL A O   1 
ATOM   3151 C CB  . VAL A 1 416 ? -36.617 8.595  21.200  1.00 55.19  ? 416 VAL A CB  1 
ATOM   3152 C CG1 . VAL A 1 416 ? -36.984 9.733  22.155  1.00 54.69  ? 416 VAL A CG1 1 
ATOM   3153 C CG2 . VAL A 1 416 ? -36.183 7.365  21.995  1.00 54.95  ? 416 VAL A CG2 1 
ATOM   3154 N N   . LEU A 1 417 ? -37.669 9.881  18.372  1.00 52.12  ? 417 LEU A N   1 
ATOM   3155 C CA  . LEU A 1 417 ? -38.069 11.018 17.537  1.00 52.61  ? 417 LEU A CA  1 
ATOM   3156 C C   . LEU A 1 417 ? -39.491 10.817 17.026  1.00 58.79  ? 417 LEU A C   1 
ATOM   3157 O O   . LEU A 1 417 ? -40.334 11.697 17.218  1.00 59.23  ? 417 LEU A O   1 
ATOM   3158 C CB  . LEU A 1 417 ? -37.098 11.208 16.342  1.00 51.90  ? 417 LEU A CB  1 
ATOM   3159 C CG  . LEU A 1 417 ? -36.614 12.641 15.963  1.00 55.16  ? 417 LEU A CG  1 
ATOM   3160 C CD1 . LEU A 1 417 ? -36.309 12.742 14.475  1.00 55.10  ? 417 LEU A CD1 1 
ATOM   3161 C CD2 . LEU A 1 417 ? -37.607 13.728 16.346  1.00 56.69  ? 417 LEU A CD2 1 
ATOM   3162 N N   . ALA A 1 418 ? -39.769 9.628  16.439  1.00 56.46  ? 418 ALA A N   1 
ATOM   3163 C CA  . ALA A 1 418 ? -41.072 9.248  15.884  1.00 57.84  ? 418 ALA A CA  1 
ATOM   3164 C C   . ALA A 1 418 ? -42.201 9.364  16.887  1.00 64.50  ? 418 ALA A C   1 
ATOM   3165 O O   . ALA A 1 418 ? -43.266 9.845  16.514  1.00 66.19  ? 418 ALA A O   1 
ATOM   3166 C CB  . ALA A 1 418 ? -41.021 7.843  15.319  1.00 58.74  ? 418 ALA A CB  1 
ATOM   3167 N N   . GLN A 1 419 ? -41.977 8.959  18.155  1.00 61.56  ? 419 GLN A N   1 
ATOM   3168 C CA  . GLN A 1 419 ? -43.000 9.039  19.204  1.00 63.00  ? 419 GLN A CA  1 
ATOM   3169 C C   . GLN A 1 419 ? -43.304 10.487 19.607  1.00 66.36  ? 419 GLN A C   1 
ATOM   3170 O O   . GLN A 1 419 ? -44.476 10.840 19.782  1.00 65.39  ? 419 GLN A O   1 
ATOM   3171 C CB  . GLN A 1 419 ? -42.609 8.205  20.429  1.00 64.57  ? 419 GLN A CB  1 
ATOM   3172 C CG  . GLN A 1 419 ? -43.812 7.823  21.284  1.00 95.93  ? 419 GLN A CG  1 
ATOM   3173 C CD  . GLN A 1 419 ? -43.395 7.429  22.675  1.00 130.94 ? 419 GLN A CD  1 
ATOM   3174 O OE1 . GLN A 1 419 ? -43.200 6.247  22.982  1.00 127.72 ? 419 GLN A OE1 1 
ATOM   3175 N NE2 . GLN A 1 419 ? -43.244 8.414  23.553  1.00 130.56 ? 419 GLN A NE2 1 
ATOM   3176 N N   . LEU A 1 420 ? -42.246 11.319 19.719  1.00 62.76  ? 420 LEU A N   1 
ATOM   3177 C CA  . LEU A 1 420 ? -42.363 12.731 20.066  1.00 63.02  ? 420 LEU A CA  1 
ATOM   3178 C C   . LEU A 1 420 ? -43.125 13.497 18.996  1.00 69.84  ? 420 LEU A C   1 
ATOM   3179 O O   . LEU A 1 420 ? -43.976 14.330 19.337  1.00 70.94  ? 420 LEU A O   1 
ATOM   3180 C CB  . LEU A 1 420 ? -40.987 13.355 20.326  1.00 61.37  ? 420 LEU A CB  1 
ATOM   3181 C CG  . LEU A 1 420 ? -40.251 12.837 21.559  1.00 65.00  ? 420 LEU A CG  1 
ATOM   3182 C CD1 . LEU A 1 420 ? -38.853 13.383 21.611  1.00 63.69  ? 420 LEU A CD1 1 
ATOM   3183 C CD2 . LEU A 1 420 ? -40.987 13.183 22.840  1.00 68.10  ? 420 LEU A CD2 1 
ATOM   3184 N N   . ILE A 1 421 ? -42.850 13.175 17.707  1.00 66.42  ? 421 ILE A N   1 
ATOM   3185 C CA  . ILE A 1 421 ? -43.517 13.766 16.548  1.00 67.66  ? 421 ILE A CA  1 
ATOM   3186 C C   . ILE A 1 421 ? -45.021 13.426 16.606  1.00 77.28  ? 421 ILE A C   1 
ATOM   3187 O O   . ILE A 1 421 ? -45.861 14.324 16.493  1.00 78.72  ? 421 ILE A O   1 
ATOM   3188 C CB  . ILE A 1 421 ? -42.813 13.324 15.236  1.00 69.67  ? 421 ILE A CB  1 
ATOM   3189 C CG1 . ILE A 1 421 ? -41.474 14.075 15.073  1.00 68.47  ? 421 ILE A CG1 1 
ATOM   3190 C CG2 . ILE A 1 421 ? -43.712 13.528 14.013  1.00 71.55  ? 421 ILE A CG2 1 
ATOM   3191 C CD1 . ILE A 1 421 ? -40.496 13.494 14.064  1.00 74.13  ? 421 ILE A CD1 1 
ATOM   3192 N N   . LYS A 1 422 ? -45.342 12.146 16.876  1.00 75.73  ? 422 LYS A N   1 
ATOM   3193 C CA  . LYS A 1 422 ? -46.702 11.629 17.001  1.00 77.87  ? 422 LYS A CA  1 
ATOM   3194 C C   . LYS A 1 422 ? -47.492 12.301 18.126  1.00 84.62  ? 422 LYS A C   1 
ATOM   3195 O O   . LYS A 1 422 ? -48.706 12.442 17.996  1.00 85.05  ? 422 LYS A O   1 
ATOM   3196 C CB  . LYS A 1 422 ? -46.663 10.112 17.223  1.00 80.51  ? 422 LYS A CB  1 
ATOM   3197 C CG  . LYS A 1 422 ? -46.575 9.313  15.937  1.00 95.18  ? 422 LYS A CG  1 
ATOM   3198 C CD  . LYS A 1 422 ? -46.032 7.927  16.203  1.00 101.48 ? 422 LYS A CD  1 
ATOM   3199 C CE  . LYS A 1 422 ? -45.974 7.121  14.943  1.00 110.34 ? 422 LYS A CE  1 
ATOM   3200 N NZ  . LYS A 1 422 ? -45.132 5.907  15.115  1.00 121.70 ? 422 LYS A NZ  1 
ATOM   3201 N N   . GLU A 1 423 ? -46.808 12.681 19.231  1.00 82.91  ? 423 GLU A N   1 
ATOM   3202 C CA  . GLU A 1 423 ? -47.400 13.331 20.406  1.00 84.66  ? 423 GLU A CA  1 
ATOM   3203 C C   . GLU A 1 423 ? -47.873 14.746 20.082  1.00 90.50  ? 423 GLU A C   1 
ATOM   3204 O O   . GLU A 1 423 ? -48.994 15.103 20.450  1.00 91.09  ? 423 GLU A O   1 
ATOM   3205 C CB  . GLU A 1 423 ? -46.388 13.386 21.563  1.00 85.45  ? 423 GLU A CB  1 
ATOM   3206 C CG  . GLU A 1 423 ? -46.257 12.097 22.362  1.00 100.66 ? 423 GLU A CG  1 
ATOM   3207 C CD  . GLU A 1 423 ? -44.953 11.953 23.134  1.00 124.79 ? 423 GLU A CD  1 
ATOM   3208 O OE1 . GLU A 1 423 ? -44.655 12.822 23.989  1.00 107.20 ? 423 GLU A OE1 1 
ATOM   3209 O OE2 . GLU A 1 423 ? -44.238 10.953 22.893  1.00 123.05 ? 423 GLU A OE2 1 
ATOM   3210 N N   . SER A 1 424 ? -47.005 15.552 19.413  1.00 87.71  ? 424 SER A N   1 
ATOM   3211 C CA  . SER A 1 424 ? -47.270 16.941 19.010  1.00 88.74  ? 424 SER A CA  1 
ATOM   3212 C C   . SER A 1 424 ? -48.399 17.038 17.994  1.00 95.80  ? 424 SER A C   1 
ATOM   3213 O O   . SER A 1 424 ? -49.168 18.004 18.021  1.00 96.87  ? 424 SER A O   1 
ATOM   3214 C CB  . SER A 1 424 ? -46.018 17.582 18.418  1.00 90.94  ? 424 SER A CB  1 
ATOM   3215 O OG  . SER A 1 424 ? -45.072 17.899 19.421  1.00 100.91 ? 424 SER A OG  1 
ATOM   3216 N N   . LEU A 1 425 ? -48.484 16.045 17.087  1.00 93.07  ? 425 LEU A N   1 
ATOM   3217 C CA  . LEU A 1 425 ? -49.503 16.001 16.048  1.00 94.94  ? 425 LEU A CA  1 
ATOM   3218 C C   . LEU A 1 425 ? -50.892 15.708 16.614  1.00 102.90 ? 425 LEU A C   1 
ATOM   3219 O O   . LEU A 1 425 ? -51.886 16.063 15.983  1.00 104.41 ? 425 LEU A O   1 
ATOM   3220 C CB  . LEU A 1 425 ? -49.123 14.996 14.951  1.00 94.41  ? 425 LEU A CB  1 
ATOM   3221 C CG  . LEU A 1 425 ? -47.871 15.316 14.122  1.00 97.27  ? 425 LEU A CG  1 
ATOM   3222 C CD1 . LEU A 1 425 ? -47.409 14.078 13.359  1.00 96.77  ? 425 LEU A CD1 1 
ATOM   3223 C CD2 . LEU A 1 425 ? -48.091 16.522 13.190  1.00 99.56  ? 425 LEU A CD2 1 
ATOM   3224 N N   . LEU A 1 426 ? -50.959 15.093 17.811  1.00 100.88 ? 426 LEU A N   1 
ATOM   3225 C CA  . LEU A 1 426 ? -52.214 14.763 18.486  1.00 103.15 ? 426 LEU A CA  1 
ATOM   3226 C C   . LEU A 1 426 ? -52.909 15.982 19.092  1.00 111.25 ? 426 LEU A C   1 
ATOM   3227 O O   . LEU A 1 426 ? -54.135 15.984 19.244  1.00 112.11 ? 426 LEU A O   1 
ATOM   3228 C CB  . LEU A 1 426 ? -51.986 13.702 19.566  1.00 102.38 ? 426 LEU A CB  1 
ATOM   3229 C CG  . LEU A 1 426 ? -52.021 12.252 19.109  1.00 106.74 ? 426 LEU A CG  1 
ATOM   3230 C CD1 . LEU A 1 426 ? -51.537 11.345 20.213  1.00 106.04 ? 426 LEU A CD1 1 
ATOM   3231 C CD2 . LEU A 1 426 ? -53.435 11.825 18.691  1.00 111.29 ? 426 LEU A CD2 1 
ATOM   3232 N N   . VAL A 1 427 ? -52.129 17.012 19.444  1.00 109.81 ? 427 VAL A N   1 
ATOM   3233 C CA  . VAL A 1 427 ? -52.659 18.235 20.041  1.00 111.77 ? 427 VAL A CA  1 
ATOM   3234 C C   . VAL A 1 427 ? -52.941 19.335 18.969  1.00 119.22 ? 427 VAL A C   1 
ATOM   3235 O O   . VAL A 1 427 ? -52.065 19.593 18.129  1.00 118.38 ? 427 VAL A O   1 
ATOM   3236 C CB  . VAL A 1 427 ? -51.796 18.697 21.261  1.00 114.31 ? 427 VAL A CB  1 
ATOM   3237 C CG1 . VAL A 1 427 ? -50.470 19.343 20.844  1.00 112.24 ? 427 VAL A CG1 1 
ATOM   3238 C CG2 . VAL A 1 427 ? -52.586 19.594 22.209  1.00 115.53 ? 427 VAL A CG2 1 
ATOM   3239 N N   . PRO A 1 428 ? -54.156 19.963 18.953  1.00 118.90 ? 428 PRO A N   1 
ATOM   3240 C CA  . PRO A 1 428 ? -54.433 21.011 17.941  1.00 124.91 ? 428 PRO A CA  1 
ATOM   3241 C C   . PRO A 1 428 ? -53.623 22.300 18.151  1.00 168.36 ? 428 PRO A C   1 
ATOM   3242 O O   . PRO A 1 428 ? -53.120 22.909 17.203  1.00 132.67 ? 428 PRO A O   1 
ATOM   3243 C CB  . PRO A 1 428 ? -55.944 21.267 18.085  1.00 128.41 ? 428 PRO A CB  1 
ATOM   3244 C CG  . PRO A 1 428 ? -56.472 20.163 18.967  1.00 131.30 ? 428 PRO A CG  1 
ATOM   3245 C CD  . PRO A 1 428 ? -55.324 19.763 19.836  1.00 123.59 ? 428 PRO A CD  1 
ATOM   3246 N N   . MET B 1 1   ? -16.138 50.399 37.929  1.00 41.38  ? 1   MET B N   1 
ATOM   3247 C CA  . MET B 1 1   ? -15.361 50.493 36.685  1.00 40.64  ? 1   MET B CA  1 
ATOM   3248 C C   . MET B 1 1   ? -16.159 50.171 35.424  1.00 43.82  ? 1   MET B C   1 
ATOM   3249 O O   . MET B 1 1   ? -16.572 49.028 35.220  1.00 42.65  ? 1   MET B O   1 
ATOM   3250 C CB  . MET B 1 1   ? -14.064 49.656 36.741  1.00 41.98  ? 1   MET B CB  1 
ATOM   3251 C CG  . MET B 1 1   ? -12.824 50.519 36.894  1.00 46.21  ? 1   MET B CG  1 
ATOM   3252 S SD  . MET B 1 1   ? -11.308 49.919 36.102  1.00 49.91  ? 1   MET B SD  1 
ATOM   3253 C CE  . MET B 1 1   ? -11.816 49.856 34.400  1.00 46.72  ? 1   MET B CE  1 
ATOM   3254 N N   . ASN B 1 2   ? -16.370 51.179 34.571  1.00 41.56  ? 2   ASN B N   1 
ATOM   3255 C CA  . ASN B 1 2   ? -17.097 50.952 33.326  1.00 41.50  ? 2   ASN B CA  1 
ATOM   3256 C C   . ASN B 1 2   ? -16.176 50.379 32.241  1.00 45.10  ? 2   ASN B C   1 
ATOM   3257 O O   . ASN B 1 2   ? -15.391 51.117 31.625  1.00 45.95  ? 2   ASN B O   1 
ATOM   3258 C CB  . ASN B 1 2   ? -17.837 52.191 32.839  1.00 40.66  ? 2   ASN B CB  1 
ATOM   3259 C CG  . ASN B 1 2   ? -19.079 51.796 32.093  1.00 76.93  ? 2   ASN B CG  1 
ATOM   3260 O OD1 . ASN B 1 2   ? -19.020 51.243 30.985  1.00 71.96  ? 2   ASN B OD1 1 
ATOM   3261 N ND2 . ASN B 1 2   ? -20.228 51.966 32.735  1.00 74.60  ? 2   ASN B ND2 1 
ATOM   3262 N N   . TYR B 1 3   ? -16.262 49.060 32.031  1.00 38.88  ? 3   TYR B N   1 
ATOM   3263 C CA  . TYR B 1 3   ? -15.450 48.388 31.035  1.00 37.83  ? 3   TYR B CA  1 
ATOM   3264 C C   . TYR B 1 3   ? -15.853 48.731 29.614  1.00 41.69  ? 3   TYR B C   1 
ATOM   3265 O O   . TYR B 1 3   ? -14.984 48.740 28.737  1.00 41.19  ? 3   TYR B O   1 
ATOM   3266 C CB  . TYR B 1 3   ? -15.413 46.867 31.270  1.00 38.90  ? 3   TYR B CB  1 
ATOM   3267 C CG  . TYR B 1 3   ? -14.654 46.466 32.520  1.00 40.79  ? 3   TYR B CG  1 
ATOM   3268 C CD1 . TYR B 1 3   ? -15.306 45.866 33.592  1.00 42.06  ? 3   TYR B CD1 1 
ATOM   3269 C CD2 . TYR B 1 3   ? -13.290 46.734 32.651  1.00 41.90  ? 3   TYR B CD2 1 
ATOM   3270 C CE1 . TYR B 1 3   ? -14.617 45.515 34.753  1.00 41.61  ? 3   TYR B CE1 1 
ATOM   3271 C CE2 . TYR B 1 3   ? -12.595 46.398 33.810  1.00 42.59  ? 3   TYR B CE2 1 
ATOM   3272 C CZ  . TYR B 1 3   ? -13.263 45.787 34.859  1.00 46.64  ? 3   TYR B CZ  1 
ATOM   3273 O OH  . TYR B 1 3   ? -12.581 45.455 36.000  1.00 43.53  ? 3   TYR B OH  1 
ATOM   3274 N N   . ALA B 1 4   ? -17.150 49.069 29.398  1.00 38.24  ? 4   ALA B N   1 
ATOM   3275 C CA  . ALA B 1 4   ? -17.711 49.412 28.089  1.00 37.75  ? 4   ALA B CA  1 
ATOM   3276 C C   . ALA B 1 4   ? -17.112 50.636 27.428  1.00 40.32  ? 4   ALA B C   1 
ATOM   3277 O O   . ALA B 1 4   ? -17.022 50.650 26.201  1.00 40.91  ? 4   ALA B O   1 
ATOM   3278 C CB  . ALA B 1 4   ? -19.214 49.536 28.158  1.00 39.45  ? 4   ALA B CB  1 
ATOM   3279 N N   . ARG B 1 5   ? -16.663 51.637 28.199  1.00 35.00  ? 5   ARG B N   1 
ATOM   3280 C CA  . ARG B 1 5   ? -16.053 52.824 27.582  1.00 35.17  ? 5   ARG B CA  1 
ATOM   3281 C C   . ARG B 1 5   ? -14.722 52.544 26.841  1.00 39.01  ? 5   ARG B C   1 
ATOM   3282 O O   . ARG B 1 5   ? -14.265 53.366 26.031  1.00 38.34  ? 5   ARG B O   1 
ATOM   3283 C CB  . ARG B 1 5   ? -15.943 54.005 28.568  1.00 35.30  ? 5   ARG B CB  1 
ATOM   3284 C CG  . ARG B 1 5   ? -14.934 53.857 29.697  1.00 41.64  ? 5   ARG B CG  1 
ATOM   3285 C CD  . ARG B 1 5   ? -14.863 55.170 30.465  1.00 47.28  ? 5   ARG B CD  1 
ATOM   3286 N NE  . ARG B 1 5   ? -13.512 55.535 30.905  1.00 46.35  ? 5   ARG B NE  1 
ATOM   3287 C CZ  . ARG B 1 5   ? -12.535 55.950 30.102  1.00 60.82  ? 5   ARG B CZ  1 
ATOM   3288 N NH1 . ARG B 1 5   ? -12.720 56.004 28.789  1.00 44.17  ? 5   ARG B NH1 1 
ATOM   3289 N NH2 . ARG B 1 5   ? -11.360 56.290 30.603  1.00 60.05  ? 5   ARG B NH2 1 
ATOM   3290 N N   . PHE B 1 6   ? -14.144 51.355 27.092  1.00 34.91  ? 6   PHE B N   1 
ATOM   3291 C CA  . PHE B 1 6   ? -12.885 50.914 26.508  1.00 33.87  ? 6   PHE B CA  1 
ATOM   3292 C C   . PHE B 1 6   ? -13.023 50.026 25.255  1.00 36.77  ? 6   PHE B C   1 
ATOM   3293 O O   . PHE B 1 6   ? -12.122 50.021 24.422  1.00 35.55  ? 6   PHE B O   1 
ATOM   3294 C CB  . PHE B 1 6   ? -12.040 50.201 27.573  1.00 34.67  ? 6   PHE B CB  1 
ATOM   3295 C CG  . PHE B 1 6   ? -11.730 51.043 28.787  1.00 36.59  ? 6   PHE B CG  1 
ATOM   3296 C CD1 . PHE B 1 6   ? -12.475 50.909 29.956  1.00 40.19  ? 6   PHE B CD1 1 
ATOM   3297 C CD2 . PHE B 1 6   ? -10.669 51.944 28.776  1.00 38.53  ? 6   PHE B CD2 1 
ATOM   3298 C CE1 . PHE B 1 6   ? -12.168 51.669 31.095  1.00 41.35  ? 6   PHE B CE1 1 
ATOM   3299 C CE2 . PHE B 1 6   ? -10.364 52.705 29.912  1.00 42.11  ? 6   PHE B CE2 1 
ATOM   3300 C CZ  . PHE B 1 6   ? -11.119 52.569 31.062  1.00 40.62  ? 6   PHE B CZ  1 
ATOM   3301 N N   . ILE B 1 7   ? -14.124 49.277 25.117  1.00 32.91  ? 7   ILE B N   1 
ATOM   3302 C CA  . ILE B 1 7   ? -14.283 48.349 23.987  1.00 31.91  ? 7   ILE B CA  1 
ATOM   3303 C C   . ILE B 1 7   ? -14.900 48.922 22.687  1.00 36.08  ? 7   ILE B C   1 
ATOM   3304 O O   . ILE B 1 7   ? -15.402 50.045 22.681  1.00 38.29  ? 7   ILE B O   1 
ATOM   3305 C CB  . ILE B 1 7   ? -14.866 46.982 24.449  1.00 34.31  ? 7   ILE B CB  1 
ATOM   3306 C CG1 . ILE B 1 7   ? -16.377 47.055 24.781  1.00 34.50  ? 7   ILE B CG1 1 
ATOM   3307 C CG2 . ILE B 1 7   ? -14.056 46.435 25.637  1.00 34.74  ? 7   ILE B CG2 1 
ATOM   3308 C CD1 . ILE B 1 7   ? -17.061 45.687 24.887  1.00 33.90  ? 7   ILE B CD1 1 
ATOM   3309 N N   . THR B 1 8   ? -14.784 48.187 21.580  1.00 29.69  ? 8   THR B N   1 
ATOM   3310 C CA  . THR B 1 8   ? -15.367 48.602 20.302  1.00 29.17  ? 8   THR B CA  1 
ATOM   3311 C C   . THR B 1 8   ? -16.771 47.987 20.214  1.00 33.02  ? 8   THR B C   1 
ATOM   3312 O O   . THR B 1 8   ? -17.096 47.074 20.987  1.00 32.35  ? 8   THR B O   1 
ATOM   3313 C CB  . THR B 1 8   ? -14.502 48.136 19.111  1.00 31.46  ? 8   THR B CB  1 
ATOM   3314 O OG1 . THR B 1 8   ? -14.400 46.722 19.125  1.00 32.50  ? 8   THR B OG1 1 
ATOM   3315 C CG2 . THR B 1 8   ? -13.124 48.715 19.122  1.00 28.83  ? 8   THR B CG2 1 
ATOM   3316 N N   . ALA B 1 9   ? -17.584 48.463 19.253  1.00 29.40  ? 9   ALA B N   1 
ATOM   3317 C CA  . ALA B 1 9   ? -18.931 47.988 18.972  1.00 29.35  ? 9   ALA B CA  1 
ATOM   3318 C C   . ALA B 1 9   ? -18.880 46.551 18.432  1.00 34.80  ? 9   ALA B C   1 
ATOM   3319 O O   . ALA B 1 9   ? -19.752 45.734 18.752  1.00 34.91  ? 9   ALA B O   1 
ATOM   3320 C CB  . ALA B 1 9   ? -19.589 48.901 17.958  1.00 31.25  ? 9   ALA B CB  1 
ATOM   3321 N N   . ALA B 1 10  ? -17.831 46.229 17.651  1.00 31.84  ? 10  ALA B N   1 
ATOM   3322 C CA  . ALA B 1 10  ? -17.641 44.902 17.070  1.00 31.43  ? 10  ALA B CA  1 
ATOM   3323 C C   . ALA B 1 10  ? -17.387 43.867 18.158  1.00 37.61  ? 10  ALA B C   1 
ATOM   3324 O O   . ALA B 1 10  ? -17.931 42.753 18.095  1.00 36.82  ? 10  ALA B O   1 
ATOM   3325 C CB  . ALA B 1 10  ? -16.488 44.927 16.097  1.00 31.62  ? 10  ALA B CB  1 
ATOM   3326 N N   . SER B 1 11  ? -16.582 44.260 19.172  1.00 35.13  ? 11  SER B N   1 
ATOM   3327 C CA  . SER B 1 11  ? -16.229 43.411 20.305  1.00 34.61  ? 11  SER B CA  1 
ATOM   3328 C C   . SER B 1 11  ? -17.481 43.008 21.086  1.00 36.74  ? 11  SER B C   1 
ATOM   3329 O O   . SER B 1 11  ? -17.701 41.810 21.295  1.00 36.01  ? 11  SER B O   1 
ATOM   3330 C CB  . SER B 1 11  ? -15.219 44.115 21.207  1.00 39.63  ? 11  SER B CB  1 
ATOM   3331 O OG  . SER B 1 11  ? -14.692 43.223 22.174  1.00 52.26  ? 11  SER B OG  1 
ATOM   3332 N N   . ALA B 1 12  ? -18.334 44.001 21.432  1.00 31.49  ? 12  ALA B N   1 
ATOM   3333 C CA  . ALA B 1 12  ? -19.578 43.809 22.180  1.00 30.87  ? 12  ALA B CA  1 
ATOM   3334 C C   . ALA B 1 12  ? -20.553 42.855 21.480  1.00 34.84  ? 12  ALA B C   1 
ATOM   3335 O O   . ALA B 1 12  ? -21.126 41.979 22.127  1.00 35.18  ? 12  ALA B O   1 
ATOM   3336 C CB  . ALA B 1 12  ? -20.238 45.156 22.424  1.00 32.27  ? 12  ALA B CB  1 
ATOM   3337 N N   . ALA B 1 13  ? -20.694 43.011 20.149  1.00 30.06  ? 13  ALA B N   1 
ATOM   3338 C CA  . ALA B 1 13  ? -21.561 42.243 19.258  1.00 29.03  ? 13  ALA B CA  1 
ATOM   3339 C C   . ALA B 1 13  ? -21.416 40.717 19.345  1.00 31.98  ? 13  ALA B C   1 
ATOM   3340 O O   . ALA B 1 13  ? -22.408 40.003 19.202  1.00 32.01  ? 13  ALA B O   1 
ATOM   3341 C CB  . ALA B 1 13  ? -21.335 42.697 17.828  1.00 29.77  ? 13  ALA B CB  1 
ATOM   3342 N N   . ARG B 1 14  ? -20.180 40.229 19.561  1.00 27.38  ? 14  ARG B N   1 
ATOM   3343 C CA  . ARG B 1 14  ? -19.812 38.810 19.632  1.00 25.97  ? 14  ARG B CA  1 
ATOM   3344 C C   . ARG B 1 14  ? -20.672 38.005 20.600  1.00 30.15  ? 14  ARG B C   1 
ATOM   3345 O O   . ARG B 1 14  ? -20.939 38.442 21.723  1.00 30.46  ? 14  ARG B O   1 
ATOM   3346 C CB  . ARG B 1 14  ? -18.321 38.661 19.974  1.00 24.43  ? 14  ARG B CB  1 
ATOM   3347 C CG  . ARG B 1 14  ? -17.388 39.219 18.909  1.00 29.20  ? 14  ARG B CG  1 
ATOM   3348 C CD  . ARG B 1 14  ? -15.939 38.860 19.170  1.00 37.18  ? 14  ARG B CD  1 
ATOM   3349 N NE  . ARG B 1 14  ? -15.008 39.770 18.492  1.00 39.47  ? 14  ARG B NE  1 
ATOM   3350 C CZ  . ARG B 1 14  ? -14.696 39.736 17.196  1.00 50.72  ? 14  ARG B CZ  1 
ATOM   3351 N NH1 . ARG B 1 14  ? -15.231 38.817 16.398  1.00 41.07  ? 14  ARG B NH1 1 
ATOM   3352 N NH2 . ARG B 1 14  ? -13.852 40.619 16.689  1.00 39.84  ? 14  ARG B NH2 1 
ATOM   3353 N N   . ASN B 1 15  ? -21.125 36.845 20.148  1.00 27.31  ? 15  ASN B N   1 
ATOM   3354 C CA  . ASN B 1 15  ? -21.964 35.937 20.932  1.00 28.47  ? 15  ASN B CA  1 
ATOM   3355 C C   . ASN B 1 15  ? -21.301 34.537 21.085  1.00 37.58  ? 15  ASN B C   1 
ATOM   3356 O O   . ASN B 1 15  ? -20.481 34.146 20.245  1.00 38.59  ? 15  ASN B O   1 
ATOM   3357 C CB  . ASN B 1 15  ? -23.325 35.767 20.254  1.00 25.52  ? 15  ASN B CB  1 
ATOM   3358 C CG  . ASN B 1 15  ? -24.110 37.016 20.015  1.00 36.16  ? 15  ASN B CG  1 
ATOM   3359 O OD1 . ASN B 1 15  ? -24.573 37.671 20.948  1.00 37.24  ? 15  ASN B OD1 1 
ATOM   3360 N ND2 . ASN B 1 15  ? -24.365 37.305 18.750  1.00 20.70  ? 15  ASN B ND2 1 
ATOM   3361 N N   . PRO B 1 16  ? -21.650 33.740 22.115  1.00 36.85  ? 16  PRO B N   1 
ATOM   3362 C CA  . PRO B 1 16  ? -21.078 32.379 22.194  1.00 37.42  ? 16  PRO B CA  1 
ATOM   3363 C C   . PRO B 1 16  ? -21.718 31.465 21.142  1.00 44.80  ? 16  PRO B C   1 
ATOM   3364 O O   . PRO B 1 16  ? -22.830 31.743 20.682  1.00 46.53  ? 16  PRO B O   1 
ATOM   3365 C CB  . PRO B 1 16  ? -21.442 31.916 23.613  1.00 39.19  ? 16  PRO B CB  1 
ATOM   3366 C CG  . PRO B 1 16  ? -22.092 33.117 24.299  1.00 43.29  ? 16  PRO B CG  1 
ATOM   3367 C CD  . PRO B 1 16  ? -22.603 33.991 23.218  1.00 39.00  ? 16  PRO B CD  1 
ATOM   3368 N N   . SER B 1 17  ? -21.036 30.382 20.774  1.00 42.01  ? 17  SER B N   1 
ATOM   3369 C CA  . SER B 1 17  ? -21.521 29.432 19.774  1.00 42.77  ? 17  SER B CA  1 
ATOM   3370 C C   . SER B 1 17  ? -22.854 28.786 20.169  1.00 50.40  ? 17  SER B C   1 
ATOM   3371 O O   . SER B 1 17  ? -23.037 28.427 21.343  1.00 50.07  ? 17  SER B O   1 
ATOM   3372 C CB  . SER B 1 17  ? -20.483 28.349 19.518  1.00 44.60  ? 17  SER B CB  1 
ATOM   3373 O OG  . SER B 1 17  ? -20.814 27.617 18.351  1.00 51.56  ? 17  SER B OG  1 
ATOM   3374 N N   . PRO B 1 18  ? -23.803 28.649 19.204  1.00 49.24  ? 18  PRO B N   1 
ATOM   3375 C CA  . PRO B 1 18  ? -25.092 28.013 19.531  1.00 50.47  ? 18  PRO B CA  1 
ATOM   3376 C C   . PRO B 1 18  ? -24.937 26.528 19.855  1.00 57.07  ? 18  PRO B C   1 
ATOM   3377 O O   . PRO B 1 18  ? -25.785 25.961 20.546  1.00 57.57  ? 18  PRO B O   1 
ATOM   3378 C CB  . PRO B 1 18  ? -25.921 28.228 18.265  1.00 52.73  ? 18  PRO B CB  1 
ATOM   3379 C CG  . PRO B 1 18  ? -24.935 28.354 17.182  1.00 56.33  ? 18  PRO B CG  1 
ATOM   3380 C CD  . PRO B 1 18  ? -23.741 29.032 17.778  1.00 50.83  ? 18  PRO B CD  1 
ATOM   3381 N N   . ILE B 1 19  ? -23.840 25.913 19.358  1.00 54.45  ? 19  ILE B N   1 
ATOM   3382 C CA  . ILE B 1 19  ? -23.492 24.506 19.576  1.00 54.42  ? 19  ILE B CA  1 
ATOM   3383 C C   . ILE B 1 19  ? -22.762 24.332 20.935  1.00 56.57  ? 19  ILE B C   1 
ATOM   3384 O O   . ILE B 1 19  ? -21.597 24.711 21.078  1.00 54.30  ? 19  ILE B O   1 
ATOM   3385 C CB  . ILE B 1 19  ? -22.796 23.860 18.320  1.00 57.63  ? 19  ILE B CB  1 
ATOM   3386 C CG1 . ILE B 1 19  ? -21.472 24.583 17.946  1.00 57.63  ? 19  ILE B CG1 1 
ATOM   3387 C CG2 . ILE B 1 19  ? -23.765 23.845 17.122  1.00 58.88  ? 19  ILE B CG2 1 
ATOM   3388 C CD1 . ILE B 1 19  ? -20.713 24.132 16.654  1.00 63.37  ? 19  ILE B CD1 1 
ATOM   3389 N N   . ARG B 1 20  ? -23.496 23.829 21.949  1.00 54.39  ? 20  ARG B N   1 
ATOM   3390 C CA  . ARG B 1 20  ? -22.992 23.629 23.317  1.00 54.66  ? 20  ARG B CA  1 
ATOM   3391 C C   . ARG B 1 20  ? -22.049 22.422 23.505  1.00 58.59  ? 20  ARG B C   1 
ATOM   3392 O O   . ARG B 1 20  ? -22.345 21.337 23.013  1.00 58.07  ? 20  ARG B O   1 
ATOM   3393 C CB  . ARG B 1 20  ? -24.155 23.603 24.332  1.00 56.04  ? 20  ARG B CB  1 
ATOM   3394 C CG  . ARG B 1 20  ? -24.846 24.957 24.528  1.00 65.80  ? 20  ARG B CG  1 
ATOM   3395 C CD  . ARG B 1 20  ? -23.947 25.994 25.183  1.00 77.18  ? 20  ARG B CD  1 
ATOM   3396 N NE  . ARG B 1 20  ? -24.301 27.349 24.761  1.00 96.94  ? 20  ARG B NE  1 
ATOM   3397 C CZ  . ARG B 1 20  ? -23.450 28.371 24.706  1.00 118.36 ? 20  ARG B CZ  1 
ATOM   3398 N NH1 . ARG B 1 20  ? -22.173 28.203 25.035  1.00 105.47 ? 20  ARG B NH1 1 
ATOM   3399 N NH2 . ARG B 1 20  ? -23.866 29.568 24.312  1.00 108.90 ? 20  ARG B NH2 1 
ATOM   3400 N N   . THR B 1 21  ? -20.905 22.624 24.202  1.00 55.53  ? 21  THR B N   1 
ATOM   3401 C CA  . THR B 1 21  ? -19.879 21.582 24.469  1.00 55.69  ? 21  THR B CA  1 
ATOM   3402 C C   . THR B 1 21  ? -19.542 21.498 25.973  1.00 61.35  ? 21  THR B C   1 
ATOM   3403 O O   . THR B 1 21  ? -20.120 22.272 26.738  1.00 61.95  ? 21  THR B O   1 
ATOM   3404 C CB  . THR B 1 21  ? -18.597 21.770 23.591  1.00 56.27  ? 21  THR B CB  1 
ATOM   3405 O OG1 . THR B 1 21  ? -17.899 22.968 23.950  1.00 51.93  ? 21  THR B OG1 1 
ATOM   3406 C CG2 . THR B 1 21  ? -18.867 21.698 22.075  1.00 51.06  ? 21  THR B CG2 1 
ATOM   3407 N N   . MET B 1 22  ? -18.634 20.557 26.401  1.00 58.05  ? 22  MET B N   1 
ATOM   3408 C CA  . MET B 1 22  ? -18.202 20.356 27.809  1.00 58.48  ? 22  MET B CA  1 
ATOM   3409 C C   . MET B 1 22  ? -17.368 19.100 28.036  1.00 63.80  ? 22  MET B C   1 
ATOM   3410 O O   . MET B 1 22  ? -17.558 18.120 27.314  1.00 64.32  ? 22  MET B O   1 
ATOM   3411 C CB  . MET B 1 22  ? -19.408 20.261 28.771  1.00 61.55  ? 22  MET B CB  1 
ATOM   3412 C CG  . MET B 1 22  ? -20.373 19.148 28.434  1.00 65.98  ? 22  MET B CG  1 
ATOM   3413 S SD  . MET B 1 22  ? -21.535 18.891 29.766  1.00 71.38  ? 22  MET B SD  1 
ATOM   3414 C CE  . MET B 1 22  ? -22.662 17.734 28.983  1.00 68.82  ? 22  MET B CE  1 
ATOM   3415 N N   . THR B 1 23  ? -16.555 19.068 29.127  1.00 59.93  ? 23  THR B N   1 
ATOM   3416 C CA  . THR B 1 23  ? -15.829 17.842 29.482  1.00 59.89  ? 23  THR B CA  1 
ATOM   3417 C C   . THR B 1 23  ? -16.769 16.871 30.235  1.00 64.06  ? 23  THR B C   1 
ATOM   3418 O O   . THR B 1 23  ? -17.441 17.276 31.188  1.00 62.34  ? 23  THR B O   1 
ATOM   3419 C CB  . THR B 1 23  ? -14.432 18.077 30.096  1.00 65.06  ? 23  THR B CB  1 
ATOM   3420 O OG1 . THR B 1 23  ? -14.526 18.238 31.508  1.00 66.02  ? 23  THR B OG1 1 
ATOM   3421 C CG2 . THR B 1 23  ? -13.669 19.224 29.440  1.00 60.68  ? 23  THR B CG2 1 
ATOM   3422 N N   . ASP B 1 24  ? -16.826 15.606 29.755  1.00 62.22  ? 24  ASP B N   1 
ATOM   3423 C CA  . ASP B 1 24  ? -17.683 14.502 30.199  1.00 63.50  ? 24  ASP B CA  1 
ATOM   3424 C C   . ASP B 1 24  ? -17.807 14.186 31.694  1.00 70.06  ? 24  ASP B C   1 
ATOM   3425 O O   . ASP B 1 24  ? -18.903 14.349 32.217  1.00 71.95  ? 24  ASP B O   1 
ATOM   3426 C CB  . ASP B 1 24  ? -17.439 13.233 29.375  1.00 65.91  ? 24  ASP B CB  1 
ATOM   3427 C CG  . ASP B 1 24  ? -18.647 12.329 29.203  1.00 80.35  ? 24  ASP B CG  1 
ATOM   3428 O OD1 . ASP B 1 24  ? -18.579 11.406 28.363  1.00 82.76  ? 24  ASP B OD1 1 
ATOM   3429 O OD2 . ASP B 1 24  ? -19.673 12.558 29.892  1.00 86.63  ? 24  ASP B OD2 1 
ATOM   3430 N N   . ILE B 1 25  ? -16.761 13.636 32.353  1.00 65.99  ? 25  ILE B N   1 
ATOM   3431 C CA  . ILE B 1 25  ? -16.767 13.262 33.785  1.00 65.80  ? 25  ILE B CA  1 
ATOM   3432 C C   . ILE B 1 25  ? -17.801 12.172 34.210  1.00 69.44  ? 25  ILE B C   1 
ATOM   3433 O O   . ILE B 1 25  ? -17.441 11.283 34.986  1.00 69.75  ? 25  ILE B O   1 
ATOM   3434 C CB  . ILE B 1 25  ? -16.655 14.505 34.734  1.00 68.40  ? 25  ILE B CB  1 
ATOM   3435 C CG1 . ILE B 1 25  ? -15.250 15.130 34.632  1.00 68.10  ? 25  ILE B CG1 1 
ATOM   3436 C CG2 . ILE B 1 25  ? -16.993 14.189 36.200  1.00 69.63  ? 25  ILE B CG2 1 
ATOM   3437 C CD1 . ILE B 1 25  ? -15.235 16.618 34.460  1.00 77.53  ? 25  ILE B CD1 1 
ATOM   3438 N N   . LEU B 1 26  ? -19.054 12.227 33.686  1.00 65.41  ? 26  LEU B N   1 
ATOM   3439 C CA  . LEU B 1 26  ? -20.152 11.283 33.968  1.00 65.92  ? 26  LEU B CA  1 
ATOM   3440 C C   . LEU B 1 26  ? -20.031 9.903  33.317  1.00 73.23  ? 26  LEU B C   1 
ATOM   3441 O O   . LEU B 1 26  ? -20.817 9.010  33.637  1.00 72.80  ? 26  LEU B O   1 
ATOM   3442 C CB  . LEU B 1 26  ? -21.502 11.883 33.560  1.00 65.41  ? 26  LEU B CB  1 
ATOM   3443 C CG  . LEU B 1 26  ? -22.177 12.861 34.510  1.00 69.75  ? 26  LEU B CG  1 
ATOM   3444 C CD1 . LEU B 1 26  ? -23.631 13.017 34.153  1.00 70.17  ? 26  LEU B CD1 1 
ATOM   3445 C CD2 . LEU B 1 26  ? -22.066 12.436 35.963  1.00 72.35  ? 26  LEU B CD2 1 
ATOM   3446 N N   . SER B 1 27  ? -19.093 9.727  32.383  1.00 73.14  ? 27  SER B N   1 
ATOM   3447 C CA  . SER B 1 27  ? -18.959 8.461  31.673  1.00 75.14  ? 27  SER B CA  1 
ATOM   3448 C C   . SER B 1 27  ? -17.730 7.611  32.033  1.00 82.53  ? 27  SER B C   1 
ATOM   3449 O O   . SER B 1 27  ? -17.056 7.862  33.041  1.00 81.08  ? 27  SER B O   1 
ATOM   3450 C CB  . SER B 1 27  ? -19.055 8.692  30.166  1.00 78.28  ? 27  SER B CB  1 
ATOM   3451 O OG  . SER B 1 27  ? -20.404 8.686  29.728  1.00 88.50  ? 27  SER B OG  1 
ATOM   3452 N N   . ARG B 1 28  ? -17.524 6.550  31.216  1.00 83.06  ? 28  ARG B N   1 
ATOM   3453 C CA  . ARG B 1 28  ? -16.442 5.560  31.164  1.00 85.09  ? 28  ARG B CA  1 
ATOM   3454 C C   . ARG B 1 28  ? -15.396 5.605  32.306  1.00 91.14  ? 28  ARG B C   1 
ATOM   3455 O O   . ARG B 1 28  ? -15.447 4.783  33.233  1.00 92.38  ? 28  ARG B O   1 
ATOM   3456 C CB  . ARG B 1 28  ? -15.777 5.581  29.754  1.00 86.59  ? 28  ARG B CB  1 
ATOM   3457 C CG  . ARG B 1 28  ? -15.291 6.972  29.294  1.00 99.01  ? 28  ARG B CG  1 
ATOM   3458 C CD  . ARG B 1 28  ? -15.172 7.120  27.790  1.00 111.51 ? 28  ARG B CD  1 
ATOM   3459 N NE  . ARG B 1 28  ? -14.715 8.462  27.412  1.00 118.11 ? 28  ARG B NE  1 
ATOM   3460 C CZ  . ARG B 1 28  ? -15.519 9.499  27.184  1.00 127.91 ? 28  ARG B CZ  1 
ATOM   3461 N NH1 . ARG B 1 28  ? -16.836 9.368  27.299  1.00 115.45 ? 28  ARG B NH1 1 
ATOM   3462 N NH2 . ARG B 1 28  ? -15.011 10.675 26.842  1.00 107.56 ? 28  ARG B NH2 1 
ATOM   3463 N N   . GLY B 1 29  ? -14.487 6.574  32.214  1.00 86.52  ? 29  GLY B N   1 
ATOM   3464 C CA  . GLY B 1 29  ? -13.391 6.800  33.140  1.00 86.17  ? 29  GLY B CA  1 
ATOM   3465 C C   . GLY B 1 29  ? -12.568 7.998  32.711  1.00 88.31  ? 29  GLY B C   1 
ATOM   3466 O O   . GLY B 1 29  ? -12.581 9.015  33.414  1.00 87.87  ? 29  GLY B O   1 
ATOM   3467 N N   . PRO B 1 30  ? -11.846 7.939  31.553  1.00 83.19  ? 30  PRO B N   1 
ATOM   3468 C CA  . PRO B 1 30  ? -11.048 9.109  31.147  1.00 80.74  ? 30  PRO B CA  1 
ATOM   3469 C C   . PRO B 1 30  ? -11.924 10.228 30.585  1.00 80.00  ? 30  PRO B C   1 
ATOM   3470 O O   . PRO B 1 30  ? -12.620 10.037 29.580  1.00 79.98  ? 30  PRO B O   1 
ATOM   3471 C CB  . PRO B 1 30  ? -10.043 8.537  30.137  1.00 82.67  ? 30  PRO B CB  1 
ATOM   3472 C CG  . PRO B 1 30  ? -10.716 7.337  29.560  1.00 88.34  ? 30  PRO B CG  1 
ATOM   3473 C CD  . PRO B 1 30  ? -11.709 6.827  30.580  1.00 85.19  ? 30  PRO B CD  1 
ATOM   3474 N N   . LYS B 1 31  ? -11.929 11.380 31.279  1.00 72.38  ? 31  LYS B N   1 
ATOM   3475 C CA  . LYS B 1 31  ? -12.717 12.532 30.864  1.00 69.90  ? 31  LYS B CA  1 
ATOM   3476 C C   . LYS B 1 31  ? -12.080 13.274 29.675  1.00 70.86  ? 31  LYS B C   1 
ATOM   3477 O O   . LYS B 1 31  ? -10.862 13.477 29.630  1.00 70.18  ? 31  LYS B O   1 
ATOM   3478 C CB  . LYS B 1 31  ? -13.088 13.433 32.065  1.00 71.43  ? 31  LYS B CB  1 
ATOM   3479 C CG  . LYS B 1 31  ? -12.617 14.888 32.020  1.00 79.68  ? 31  LYS B CG  1 
ATOM   3480 C CD  . LYS B 1 31  ? -11.225 15.087 32.631  1.00 81.06  ? 31  LYS B CD  1 
ATOM   3481 C CE  . LYS B 1 31  ? -10.692 16.481 32.400  1.00 82.65  ? 31  LYS B CE  1 
ATOM   3482 N NZ  . LYS B 1 31  ? -11.337 17.493 33.282  1.00 88.89  ? 31  LYS B NZ  1 
ATOM   3483 N N   . SER B 1 32  ? -12.931 13.632 28.705  1.00 65.31  ? 32  SER B N   1 
ATOM   3484 C CA  . SER B 1 32  ? -12.630 14.364 27.475  1.00 63.14  ? 32  SER B CA  1 
ATOM   3485 C C   . SER B 1 32  ? -13.872 15.188 27.121  1.00 63.46  ? 32  SER B C   1 
ATOM   3486 O O   . SER B 1 32  ? -14.968 14.855 27.577  1.00 62.91  ? 32  SER B O   1 
ATOM   3487 C CB  . SER B 1 32  ? -12.327 13.388 26.346  1.00 67.17  ? 32  SER B CB  1 
ATOM   3488 O OG  . SER B 1 32  ? -13.488 12.655 25.991  1.00 80.41  ? 32  SER B OG  1 
ATOM   3489 N N   . MET B 1 33  ? -13.721 16.240 26.303  1.00 57.67  ? 33  MET B N   1 
ATOM   3490 C CA  . MET B 1 33  ? -14.888 17.036 25.939  1.00 56.30  ? 33  MET B CA  1 
ATOM   3491 C C   . MET B 1 33  ? -15.810 16.372 24.902  1.00 60.16  ? 33  MET B C   1 
ATOM   3492 O O   . MET B 1 33  ? -15.371 15.584 24.060  1.00 59.26  ? 33  MET B O   1 
ATOM   3493 C CB  . MET B 1 33  ? -14.572 18.531 25.681  1.00 57.44  ? 33  MET B CB  1 
ATOM   3494 C CG  . MET B 1 33  ? -14.518 18.918 24.216  1.00 60.50  ? 33  MET B CG  1 
ATOM   3495 S SD  . MET B 1 33  ? -15.076 20.607 23.858  1.00 63.39  ? 33  MET B SD  1 
ATOM   3496 C CE  . MET B 1 33  ? -15.379 20.446 22.104  1.00 60.17  ? 33  MET B CE  1 
ATOM   3497 N N   . ILE B 1 34  ? -17.098 16.670 25.022  1.00 57.23  ? 34  ILE B N   1 
ATOM   3498 C CA  . ILE B 1 34  ? -18.171 16.167 24.172  1.00 57.75  ? 34  ILE B CA  1 
ATOM   3499 C C   . ILE B 1 34  ? -18.989 17.352 23.620  1.00 63.55  ? 34  ILE B C   1 
ATOM   3500 O O   . ILE B 1 34  ? -19.017 18.419 24.236  1.00 62.30  ? 34  ILE B O   1 
ATOM   3501 C CB  . ILE B 1 34  ? -19.064 15.144 24.959  1.00 61.04  ? 34  ILE B CB  1 
ATOM   3502 C CG1 . ILE B 1 34  ? -19.642 15.738 26.271  1.00 60.57  ? 34  ILE B CG1 1 
ATOM   3503 C CG2 . ILE B 1 34  ? -18.333 13.813 25.220  1.00 61.74  ? 34  ILE B CG2 1 
ATOM   3504 C CD1 . ILE B 1 34  ? -21.088 15.647 26.370  1.00 62.61  ? 34  ILE B CD1 1 
ATOM   3505 N N   . SER B 1 35  ? -19.656 17.164 22.473  1.00 62.72  ? 35  SER B N   1 
ATOM   3506 C CA  . SER B 1 35  ? -20.520 18.204 21.909  1.00 63.65  ? 35  SER B CA  1 
ATOM   3507 C C   . SER B 1 35  ? -21.989 17.789 22.050  1.00 69.27  ? 35  SER B C   1 
ATOM   3508 O O   . SER B 1 35  ? -22.353 16.655 21.701  1.00 68.49  ? 35  SER B O   1 
ATOM   3509 C CB  . SER B 1 35  ? -20.165 18.517 20.459  1.00 67.89  ? 35  SER B CB  1 
ATOM   3510 O OG  . SER B 1 35  ? -20.422 17.411 19.613  1.00 80.30  ? 35  SER B OG  1 
ATOM   3511 N N   . LEU B 1 36  ? -22.817 18.717 22.593  1.00 66.84  ? 36  LEU B N   1 
ATOM   3512 C CA  . LEU B 1 36  ? -24.243 18.521 22.860  1.00 67.55  ? 36  LEU B CA  1 
ATOM   3513 C C   . LEU B 1 36  ? -25.137 18.553 21.620  1.00 71.48  ? 36  LEU B C   1 
ATOM   3514 O O   . LEU B 1 36  ? -26.348 18.318 21.742  1.00 72.43  ? 36  LEU B O   1 
ATOM   3515 C CB  . LEU B 1 36  ? -24.753 19.437 23.998  1.00 67.72  ? 36  LEU B CB  1 
ATOM   3516 C CG  . LEU B 1 36  ? -24.284 19.050 25.416  1.00 72.07  ? 36  LEU B CG  1 
ATOM   3517 C CD1 . LEU B 1 36  ? -23.920 20.281 26.251  1.00 71.58  ? 36  LEU B CD1 1 
ATOM   3518 C CD2 . LEU B 1 36  ? -25.304 18.187 26.116  1.00 74.25  ? 36  LEU B CD2 1 
ATOM   3519 N N   . ALA B 1 37  ? -24.534 18.770 20.423  1.00 66.24  ? 37  ALA B N   1 
ATOM   3520 C CA  . ALA B 1 37  ? -25.251 18.739 19.147  1.00 65.94  ? 37  ALA B CA  1 
ATOM   3521 C C   . ALA B 1 37  ? -25.186 17.371 18.383  1.00 66.77  ? 37  ALA B C   1 
ATOM   3522 O O   . ALA B 1 37  ? -26.206 16.704 18.393  1.00 68.09  ? 37  ALA B O   1 
ATOM   3523 C CB  . ALA B 1 37  ? -24.890 19.927 18.267  1.00 66.63  ? 37  ALA B CB  1 
ATOM   3524 N N   . GLY B 1 38  ? -24.067 16.915 17.784  1.00 59.51  ? 38  GLY B N   1 
ATOM   3525 C CA  . GLY B 1 38  ? -22.746 17.535 17.668  1.00 57.51  ? 38  GLY B CA  1 
ATOM   3526 C C   . GLY B 1 38  ? -21.931 16.943 16.527  1.00 58.97  ? 38  GLY B C   1 
ATOM   3527 O O   . GLY B 1 38  ? -21.977 15.726 16.293  1.00 58.97  ? 38  GLY B O   1 
ATOM   3528 N N   . GLY B 1 39  ? -21.180 17.804 15.820  1.00 52.02  ? 39  GLY B N   1 
ATOM   3529 C CA  . GLY B 1 39  ? -20.448 17.383 14.637  1.00 49.84  ? 39  GLY B CA  1 
ATOM   3530 C C   . GLY B 1 39  ? -18.979 17.144 14.834  1.00 48.76  ? 39  GLY B C   1 
ATOM   3531 O O   . GLY B 1 39  ? -18.182 17.575 13.990  1.00 49.10  ? 39  GLY B O   1 
ATOM   3532 N N   . LEU B 1 40  ? -18.604 16.457 15.939  1.00 40.45  ? 40  LEU B N   1 
ATOM   3533 C CA  . LEU B 1 40  ? -17.199 16.138 16.197  1.00 37.45  ? 40  LEU B CA  1 
ATOM   3534 C C   . LEU B 1 40  ? -16.785 15.006 15.256  1.00 40.88  ? 40  LEU B C   1 
ATOM   3535 O O   . LEU B 1 40  ? -17.532 14.015 15.132  1.00 40.53  ? 40  LEU B O   1 
ATOM   3536 C CB  . LEU B 1 40  ? -16.943 15.722 17.653  1.00 36.28  ? 40  LEU B CB  1 
ATOM   3537 C CG  . LEU B 1 40  ? -17.273 16.687 18.789  1.00 38.55  ? 40  LEU B CG  1 
ATOM   3538 C CD1 . LEU B 1 40  ? -16.725 16.159 20.098  1.00 37.08  ? 40  LEU B CD1 1 
ATOM   3539 C CD2 . LEU B 1 40  ? -16.737 18.089 18.536  1.00 39.95  ? 40  LEU B CD2 1 
ATOM   3540 N N   . PRO B 1 41  ? -15.631 15.140 14.554  1.00 36.34  ? 41  PRO B N   1 
ATOM   3541 C CA  . PRO B 1 41  ? -15.210 14.069 13.643  1.00 36.18  ? 41  PRO B CA  1 
ATOM   3542 C C   . PRO B 1 41  ? -14.882 12.809 14.432  1.00 38.97  ? 41  PRO B C   1 
ATOM   3543 O O   . PRO B 1 41  ? -14.540 12.912 15.617  1.00 37.49  ? 41  PRO B O   1 
ATOM   3544 C CB  . PRO B 1 41  ? -13.969 14.650 12.961  1.00 37.55  ? 41  PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 41  ? -13.437 15.622 13.917  1.00 41.64  ? 41  PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 41  ? -14.636 16.232 14.587  1.00 37.37  ? 41  PRO B CD  1 
ATOM   3547 N N   . ASN B 1 42  ? -15.009 11.630 13.797  1.00 35.54  ? 42  ASN B N   1 
ATOM   3548 C CA  . ASN B 1 42  ? -14.703 10.399 14.493  1.00 36.23  ? 42  ASN B CA  1 
ATOM   3549 C C   . ASN B 1 42  ? -13.183 10.285 14.778  1.00 41.28  ? 42  ASN B C   1 
ATOM   3550 O O   . ASN B 1 42  ? -12.369 10.316 13.839  1.00 41.55  ? 42  ASN B O   1 
ATOM   3551 C CB  . ASN B 1 42  ? -15.259 9.193  13.772  1.00 37.92  ? 42  ASN B CB  1 
ATOM   3552 C CG  . ASN B 1 42  ? -15.359 7.995  14.675  1.00 65.24  ? 42  ASN B CG  1 
ATOM   3553 O OD1 . ASN B 1 42  ? -14.370 7.522  15.235  1.00 59.47  ? 42  ASN B OD1 1 
ATOM   3554 N ND2 . ASN B 1 42  ? -16.563 7.491  14.863  1.00 60.05  ? 42  ASN B ND2 1 
ATOM   3555 N N   . PRO B 1 43  ? -12.791 10.179 16.075  1.00 36.21  ? 43  PRO B N   1 
ATOM   3556 C CA  . PRO B 1 43  ? -11.358 10.063 16.398  1.00 35.84  ? 43  PRO B CA  1 
ATOM   3557 C C   . PRO B 1 43  ? -10.729 8.699  16.051  1.00 39.85  ? 43  PRO B C   1 
ATOM   3558 O O   . PRO B 1 43  ? -9.506  8.599  15.960  1.00 37.99  ? 43  PRO B O   1 
ATOM   3559 C CB  . PRO B 1 43  ? -11.309 10.391 17.891  1.00 36.90  ? 43  PRO B CB  1 
ATOM   3560 C CG  . PRO B 1 43  ? -12.631 9.942  18.399  1.00 41.21  ? 43  PRO B CG  1 
ATOM   3561 C CD  . PRO B 1 43  ? -13.626 10.109 17.291  1.00 36.91  ? 43  PRO B CD  1 
ATOM   3562 N N   . ASN B 1 44  ? -11.557 7.661  15.820  1.00 38.86  ? 44  ASN B N   1 
ATOM   3563 C CA  . ASN B 1 44  ? -11.063 6.340  15.427  1.00 40.58  ? 44  ASN B CA  1 
ATOM   3564 C C   . ASN B 1 44  ? -10.574 6.331  13.952  1.00 46.06  ? 44  ASN B C   1 
ATOM   3565 O O   . ASN B 1 44  ? -10.118 5.297  13.455  1.00 47.11  ? 44  ASN B O   1 
ATOM   3566 C CB  . ASN B 1 44  ? -12.104 5.243  15.692  1.00 42.23  ? 44  ASN B CB  1 
ATOM   3567 C CG  . ASN B 1 44  ? -12.508 5.107  17.146  1.00 70.98  ? 44  ASN B CG  1 
ATOM   3568 O OD1 . ASN B 1 44  ? -11.683 4.834  18.035  1.00 68.12  ? 44  ASN B OD1 1 
ATOM   3569 N ND2 . ASN B 1 44  ? -13.803 5.265  17.412  1.00 62.07  ? 44  ASN B ND2 1 
ATOM   3570 N N   . MET B 1 45  ? -10.613 7.505  13.286  1.00 41.80  ? 45  MET B N   1 
ATOM   3571 C CA  . MET B 1 45  ? -10.173 7.712  11.904  1.00 41.73  ? 45  MET B CA  1 
ATOM   3572 C C   . MET B 1 45  ? -8.809  8.398  11.837  1.00 43.18  ? 45  MET B C   1 
ATOM   3573 O O   . MET B 1 45  ? -8.157  8.358  10.800  1.00 42.12  ? 45  MET B O   1 
ATOM   3574 C CB  . MET B 1 45  ? -11.204 8.563  11.137  1.00 44.26  ? 45  MET B CB  1 
ATOM   3575 C CG  . MET B 1 45  ? -12.563 7.915  10.984  1.00 49.12  ? 45  MET B CG  1 
ATOM   3576 S SD  . MET B 1 45  ? -12.519 6.415  9.997   1.00 55.11  ? 45  MET B SD  1 
ATOM   3577 C CE  . MET B 1 45  ? -12.896 5.187  11.291  1.00 52.65  ? 45  MET B CE  1 
ATOM   3578 N N   . PHE B 1 46  ? -8.402  9.056  12.936  1.00 38.83  ? 46  PHE B N   1 
ATOM   3579 C CA  . PHE B 1 46  ? -7.150  9.799  13.049  1.00 36.91  ? 46  PHE B CA  1 
ATOM   3580 C C   . PHE B 1 46  ? -5.946  8.856  13.019  1.00 40.12  ? 46  PHE B C   1 
ATOM   3581 O O   . PHE B 1 46  ? -5.982  7.808  13.660  1.00 40.06  ? 46  PHE B O   1 
ATOM   3582 C CB  . PHE B 1 46  ? -7.165  10.710 14.291  1.00 37.27  ? 46  PHE B CB  1 
ATOM   3583 C CG  . PHE B 1 46  ? -8.211  11.814 14.307  1.00 37.52  ? 46  PHE B CG  1 
ATOM   3584 C CD1 . PHE B 1 46  ? -8.774  12.292 13.118  1.00 39.76  ? 46  PHE B CD1 1 
ATOM   3585 C CD2 . PHE B 1 46  ? -8.624  12.385 15.509  1.00 38.66  ? 46  PHE B CD2 1 
ATOM   3586 C CE1 . PHE B 1 46  ? -9.755  13.299 13.138  1.00 39.81  ? 46  PHE B CE1 1 
ATOM   3587 C CE2 . PHE B 1 46  ? -9.591  13.404 15.530  1.00 40.41  ? 46  PHE B CE2 1 
ATOM   3588 C CZ  . PHE B 1 46  ? -10.153 13.850 14.347  1.00 38.61  ? 46  PHE B CZ  1 
ATOM   3589 N N   . PRO B 1 47  ? -4.907  9.169  12.211  1.00 36.34  ? 47  PRO B N   1 
ATOM   3590 C CA  . PRO B 1 47  ? -3.764  8.233  12.077  1.00 36.79  ? 47  PRO B CA  1 
ATOM   3591 C C   . PRO B 1 47  ? -2.806  8.086  13.270  1.00 41.44  ? 47  PRO B C   1 
ATOM   3592 O O   . PRO B 1 47  ? -2.137  7.061  13.376  1.00 41.71  ? 47  PRO B O   1 
ATOM   3593 C CB  . PRO B 1 47  ? -3.060  8.716  10.815  1.00 38.10  ? 47  PRO B CB  1 
ATOM   3594 C CG  . PRO B 1 47  ? -3.369  10.162 10.769  1.00 41.31  ? 47  PRO B CG  1 
ATOM   3595 C CD  . PRO B 1 47  ? -4.747  10.344 11.333  1.00 36.11  ? 47  PRO B CD  1 
ATOM   3596 N N   . PHE B 1 48  ? -2.720  9.091  14.153  1.00 37.74  ? 48  PHE B N   1 
ATOM   3597 C CA  . PHE B 1 48  ? -1.832  9.007  15.317  1.00 38.02  ? 48  PHE B CA  1 
ATOM   3598 C C   . PHE B 1 48  ? -2.516  8.211  16.432  1.00 40.71  ? 48  PHE B C   1 
ATOM   3599 O O   . PHE B 1 48  ? -3.692  8.470  16.736  1.00 39.85  ? 48  PHE B O   1 
ATOM   3600 C CB  . PHE B 1 48  ? -1.367  10.402 15.769  1.00 39.13  ? 48  PHE B CB  1 
ATOM   3601 C CG  . PHE B 1 48  ? -0.885  11.263 14.625  1.00 41.13  ? 48  PHE B CG  1 
ATOM   3602 C CD1 . PHE B 1 48  ? 0.327   10.999 13.995  1.00 45.51  ? 48  PHE B CD1 1 
ATOM   3603 C CD2 . PHE B 1 48  ? -1.655  12.321 14.157  1.00 43.22  ? 48  PHE B CD2 1 
ATOM   3604 C CE1 . PHE B 1 48  ? 0.760   11.783 12.916  1.00 46.60  ? 48  PHE B CE1 1 
ATOM   3605 C CE2 . PHE B 1 48  ? -1.217  13.112 13.083  1.00 46.27  ? 48  PHE B CE2 1 
ATOM   3606 C CZ  . PHE B 1 48  ? -0.006  12.845 12.477  1.00 45.05  ? 48  PHE B CZ  1 
ATOM   3607 N N   . LYS B 1 49  ? -1.802  7.209  16.997  1.00 36.10  ? 49  LYS B N   1 
ATOM   3608 C CA  . LYS B 1 49  ? -2.406  6.291  17.970  1.00 35.59  ? 49  LYS B CA  1 
ATOM   3609 C C   . LYS B 1 49  ? -1.989  6.382  19.438  1.00 39.53  ? 49  LYS B C   1 
ATOM   3610 O O   . LYS B 1 49  ? -2.867  6.290  20.309  1.00 38.96  ? 49  LYS B O   1 
ATOM   3611 C CB  . LYS B 1 49  ? -2.430  4.839  17.453  1.00 37.03  ? 49  LYS B CB  1 
ATOM   3612 C CG  . LYS B 1 49  ? -3.154  4.654  16.106  1.00 32.29  ? 49  LYS B CG  1 
ATOM   3613 C CD  . LYS B 1 49  ? -4.674  4.834  16.188  1.00 35.21  ? 49  LYS B CD  1 
ATOM   3614 C CE  . LYS B 1 49  ? -5.357  4.671  14.846  1.00 43.92  ? 49  LYS B CE  1 
ATOM   3615 N NZ  . LYS B 1 49  ? -6.733  5.245  14.860  1.00 55.97  ? 49  LYS B NZ  1 
ATOM   3616 N N   . THR B 1 50  ? -0.670  6.500  19.714  1.00 35.06  ? 50  THR B N   1 
ATOM   3617 C CA  . THR B 1 50  ? -0.093  6.618  21.067  1.00 34.58  ? 50  THR B CA  1 
ATOM   3618 C C   . THR B 1 50  ? 1.161   7.485  20.995  1.00 40.14  ? 50  THR B C   1 
ATOM   3619 O O   . THR B 1 50  ? 1.772   7.590  19.931  1.00 40.39  ? 50  THR B O   1 
ATOM   3620 C CB  . THR B 1 50  ? 0.310   5.260  21.690  1.00 38.80  ? 50  THR B CB  1 
ATOM   3621 O OG1 . THR B 1 50  ? 1.408   4.700  20.976  1.00 42.50  ? 50  THR B OG1 1 
ATOM   3622 C CG2 . THR B 1 50  ? -0.836  4.272  21.837  1.00 34.66  ? 50  THR B CG2 1 
ATOM   3623 N N   . ALA B 1 51  ? 1.569   8.083  22.120  1.00 37.30  ? 51  ALA B N   1 
ATOM   3624 C CA  . ALA B 1 51  ? 2.764   8.921  22.128  1.00 37.52  ? 51  ALA B CA  1 
ATOM   3625 C C   . ALA B 1 51  ? 3.523   8.824  23.431  1.00 41.16  ? 51  ALA B C   1 
ATOM   3626 O O   . ALA B 1 51  ? 2.922   8.674  24.499  1.00 41.02  ? 51  ALA B O   1 
ATOM   3627 C CB  . ALA B 1 51  ? 2.398   10.379 21.845  1.00 37.25  ? 51  ALA B CB  1 
ATOM   3628 N N   . VAL B 1 52  ? 4.849   8.916  23.330  1.00 37.09  ? 52  VAL B N   1 
ATOM   3629 C CA  . VAL B 1 52  ? 5.759   8.910  24.468  1.00 37.14  ? 52  VAL B CA  1 
ATOM   3630 C C   . VAL B 1 52  ? 6.833   9.960  24.231  1.00 38.94  ? 52  VAL B C   1 
ATOM   3631 O O   . VAL B 1 52  ? 7.592   9.878  23.262  1.00 39.01  ? 52  VAL B O   1 
ATOM   3632 C CB  . VAL B 1 52  ? 6.268   7.503  24.928  1.00 42.48  ? 52  VAL B CB  1 
ATOM   3633 C CG1 . VAL B 1 52  ? 6.545   6.593  23.751  1.00 43.69  ? 52  VAL B CG1 1 
ATOM   3634 C CG2 . VAL B 1 52  ? 7.491   7.593  25.847  1.00 42.27  ? 52  VAL B CG2 1 
ATOM   3635 N N   . ILE B 1 53  ? 6.819   10.982 25.092  1.00 33.51  ? 53  ILE B N   1 
ATOM   3636 C CA  . ILE B 1 53  ? 7.730   12.114 25.070  1.00 33.51  ? 53  ILE B CA  1 
ATOM   3637 C C   . ILE B 1 53  ? 8.638   12.042 26.312  1.00 40.24  ? 53  ILE B C   1 
ATOM   3638 O O   . ILE B 1 53  ? 8.141   11.936 27.445  1.00 38.80  ? 53  ILE B O   1 
ATOM   3639 C CB  . ILE B 1 53  ? 6.932   13.456 24.980  1.00 34.96  ? 53  ILE B CB  1 
ATOM   3640 C CG1 . ILE B 1 53  ? 6.042   13.494 23.709  1.00 35.23  ? 53  ILE B CG1 1 
ATOM   3641 C CG2 . ILE B 1 53  ? 7.861   14.698 25.064  1.00 32.83  ? 53  ILE B CG2 1 
ATOM   3642 C CD1 . ILE B 1 53  ? 4.786   14.296 23.821  1.00 35.85  ? 53  ILE B CD1 1 
ATOM   3643 N N   . THR B 1 54  ? 9.963   12.097 26.085  1.00 39.31  ? 54  THR B N   1 
ATOM   3644 C CA  . THR B 1 54  ? 10.958  12.070 27.152  1.00 40.90  ? 54  THR B CA  1 
ATOM   3645 C C   . THR B 1 54  ? 11.148  13.458 27.741  1.00 46.67  ? 54  THR B C   1 
ATOM   3646 O O   . THR B 1 54  ? 11.070  14.456 27.021  1.00 45.69  ? 54  THR B O   1 
ATOM   3647 C CB  . THR B 1 54  ? 12.284  11.416 26.699  1.00 46.97  ? 54  THR B CB  1 
ATOM   3648 O OG1 . THR B 1 54  ? 12.907  12.195 25.662  1.00 41.13  ? 54  THR B OG1 1 
ATOM   3649 C CG2 . THR B 1 54  ? 12.098  9.968  26.278  1.00 46.90  ? 54  THR B CG2 1 
ATOM   3650 N N   . VAL B 1 55  ? 11.351  13.515 29.068  1.00 45.33  ? 55  VAL B N   1 
ATOM   3651 C CA  . VAL B 1 55  ? 11.580  14.760 29.792  1.00 45.20  ? 55  VAL B CA  1 
ATOM   3652 C C   . VAL B 1 55  ? 12.842  14.660 30.654  1.00 53.29  ? 55  VAL B C   1 
ATOM   3653 O O   . VAL B 1 55  ? 12.995  13.712 31.445  1.00 53.40  ? 55  VAL B O   1 
ATOM   3654 C CB  . VAL B 1 55  ? 10.344  15.249 30.593  1.00 47.65  ? 55  VAL B CB  1 
ATOM   3655 C CG1 . VAL B 1 55  ? 10.690  16.432 31.488  1.00 46.48  ? 55  VAL B CG1 1 
ATOM   3656 C CG2 . VAL B 1 55  ? 9.211   15.632 29.659  1.00 46.95  ? 55  VAL B CG2 1 
ATOM   3657 N N   . GLU B 1 56  ? 13.756  15.649 30.461  1.00 51.66  ? 56  GLU B N   1 
ATOM   3658 C CA  . GLU B 1 56  ? 14.974  15.855 31.236  1.00 53.01  ? 56  GLU B CA  1 
ATOM   3659 C C   . GLU B 1 56  ? 14.481  16.532 32.536  1.00 59.42  ? 56  GLU B C   1 
ATOM   3660 O O   . GLU B 1 56  ? 13.793  17.564 32.463  1.00 59.44  ? 56  GLU B O   1 
ATOM   3661 C CB  . GLU B 1 56  ? 15.929  16.774 30.451  1.00 54.08  ? 56  GLU B CB  1 
ATOM   3662 C CG  . GLU B 1 56  ? 17.322  16.913 31.045  1.00 69.51  ? 56  GLU B CG  1 
ATOM   3663 C CD  . GLU B 1 56  ? 18.473  16.741 30.071  1.00 104.29 ? 56  GLU B CD  1 
ATOM   3664 O OE1 . GLU B 1 56  ? 18.982  17.767 29.561  1.00 110.06 ? 56  GLU B OE1 1 
ATOM   3665 O OE2 . GLU B 1 56  ? 18.884  15.581 29.833  1.00 100.04 ? 56  GLU B OE2 1 
ATOM   3666 N N   . ASN B 1 57  ? 14.756  15.910 33.708  1.00 56.81  ? 57  ASN B N   1 
ATOM   3667 C CA  . ASN B 1 57  ? 14.314  16.395 35.034  1.00 56.14  ? 57  ASN B CA  1 
ATOM   3668 C C   . ASN B 1 57  ? 12.807  16.262 35.336  1.00 58.17  ? 57  ASN B C   1 
ATOM   3669 O O   . ASN B 1 57  ? 12.242  17.043 36.108  1.00 57.83  ? 57  ASN B O   1 
ATOM   3670 C CB  . ASN B 1 57  ? 14.868  17.788 35.382  1.00 54.91  ? 57  ASN B CB  1 
ATOM   3671 C CG  . ASN B 1 57  ? 16.134  17.732 36.194  1.00 81.65  ? 57  ASN B CG  1 
ATOM   3672 O OD1 . ASN B 1 57  ? 17.193  18.183 35.750  1.00 80.23  ? 57  ASN B OD1 1 
ATOM   3673 N ND2 . ASN B 1 57  ? 16.056  17.170 37.399  1.00 70.89  ? 57  ASN B ND2 1 
ATOM   3674 N N   . GLY B 1 58  ? 12.194  15.233 34.769  1.00 53.05  ? 58  GLY B N   1 
ATOM   3675 C CA  . GLY B 1 58  ? 10.783  14.921 34.957  1.00 51.67  ? 58  GLY B CA  1 
ATOM   3676 C C   . GLY B 1 58  ? 10.499  13.482 34.591  1.00 55.20  ? 58  GLY B C   1 
ATOM   3677 O O   . GLY B 1 58  ? 11.380  12.794 34.058  1.00 56.64  ? 58  GLY B O   1 
ATOM   3678 N N   . LYS B 1 59  ? 9.285   13.001 34.895  1.00 49.44  ? 59  LYS B N   1 
ATOM   3679 C CA  . LYS B 1 59  ? 8.894   11.641 34.526  1.00 49.15  ? 59  LYS B CA  1 
ATOM   3680 C C   . LYS B 1 59  ? 8.574   11.657 33.009  1.00 51.85  ? 59  LYS B C   1 
ATOM   3681 O O   . LYS B 1 59  ? 8.295   12.732 32.459  1.00 51.12  ? 59  LYS B O   1 
ATOM   3682 C CB  . LYS B 1 59  ? 7.676   11.189 35.353  1.00 50.64  ? 59  LYS B CB  1 
ATOM   3683 C CG  . LYS B 1 59  ? 7.536   9.674  35.447  1.00 62.87  ? 59  LYS B CG  1 
ATOM   3684 C CD  . LYS B 1 59  ? 6.297   9.258  36.235  1.00 70.98  ? 59  LYS B CD  1 
ATOM   3685 C CE  . LYS B 1 59  ? 5.747   7.908  35.810  1.00 80.01  ? 59  LYS B CE  1 
ATOM   3686 N NZ  . LYS B 1 59  ? 4.886   7.982  34.588  1.00 81.79  ? 59  LYS B NZ  1 
ATOM   3687 N N   . THR B 1 60  ? 8.656   10.499 32.329  1.00 47.10  ? 60  THR B N   1 
ATOM   3688 C CA  . THR B 1 60  ? 8.330   10.422 30.899  1.00 45.16  ? 60  THR B CA  1 
ATOM   3689 C C   . THR B 1 60  ? 6.815   10.581 30.679  1.00 45.31  ? 60  THR B C   1 
ATOM   3690 O O   . THR B 1 60  ? 6.043   9.891  31.344  1.00 46.39  ? 60  THR B O   1 
ATOM   3691 C CB  . THR B 1 60  ? 8.986   9.205  30.220  1.00 53.88  ? 60  THR B CB  1 
ATOM   3692 O OG1 . THR B 1 60  ? 8.598   9.170  28.850  1.00 51.24  ? 60  THR B OG1 1 
ATOM   3693 C CG2 . THR B 1 60  ? 8.641   7.872  30.892  1.00 58.25  ? 60  THR B CG2 1 
ATOM   3694 N N   . ILE B 1 61  ? 6.397   11.523 29.792  1.00 37.82  ? 61  ILE B N   1 
ATOM   3695 C CA  . ILE B 1 61  ? 4.991   11.831 29.463  1.00 35.87  ? 61  ILE B CA  1 
ATOM   3696 C C   . ILE B 1 61  ? 4.451   10.755 28.496  1.00 40.47  ? 61  ILE B C   1 
ATOM   3697 O O   . ILE B 1 61  ? 5.159   10.379 27.554  1.00 40.93  ? 61  ILE B O   1 
ATOM   3698 C CB  . ILE B 1 61  ? 4.893   13.273 28.871  1.00 36.96  ? 61  ILE B CB  1 
ATOM   3699 C CG1 . ILE B 1 61  ? 4.996   14.339 29.968  1.00 36.60  ? 61  ILE B CG1 1 
ATOM   3700 C CG2 . ILE B 1 61  ? 3.640   13.477 28.019  1.00 35.99  ? 61  ILE B CG2 1 
ATOM   3701 C CD1 . ILE B 1 61  ? 5.443   15.676 29.517  1.00 36.96  ? 61  ILE B CD1 1 
ATOM   3702 N N   . GLN B 1 62  ? 3.227   10.253 28.731  1.00 36.68  ? 62  GLN B N   1 
ATOM   3703 C CA  . GLN B 1 62  ? 2.639   9.218  27.870  1.00 37.49  ? 62  GLN B CA  1 
ATOM   3704 C C   . GLN B 1 62  ? 1.200   9.474  27.499  1.00 40.41  ? 62  GLN B C   1 
ATOM   3705 O O   . GLN B 1 62  ? 0.358   9.716  28.375  1.00 40.98  ? 62  GLN B O   1 
ATOM   3706 C CB  . GLN B 1 62  ? 2.746   7.822  28.505  1.00 40.54  ? 62  GLN B CB  1 
ATOM   3707 C CG  . GLN B 1 62  ? 4.128   7.191  28.379  1.00 72.42  ? 62  GLN B CG  1 
ATOM   3708 C CD  . GLN B 1 62  ? 4.474   6.307  29.556  1.00 95.36  ? 62  GLN B CD  1 
ATOM   3709 O OE1 . GLN B 1 62  ? 4.748   6.777  30.673  1.00 89.19  ? 62  GLN B OE1 1 
ATOM   3710 N NE2 . GLN B 1 62  ? 4.518   5.005  29.313  1.00 89.02  ? 62  GLN B NE2 1 
ATOM   3711 N N   . PHE B 1 63  ? 0.901   9.399  26.202  1.00 35.35  ? 63  PHE B N   1 
ATOM   3712 C CA  . PHE B 1 63  ? -0.475  9.525  25.739  1.00 33.85  ? 63  PHE B CA  1 
ATOM   3713 C C   . PHE B 1 63  ? -0.900  8.139  25.270  1.00 38.70  ? 63  PHE B C   1 
ATOM   3714 O O   . PHE B 1 63  ? -0.404  7.645  24.256  1.00 39.33  ? 63  PHE B O   1 
ATOM   3715 C CB  . PHE B 1 63  ? -0.646  10.578 24.619  1.00 34.33  ? 63  PHE B CB  1 
ATOM   3716 C CG  . PHE B 1 63  ? -0.411  12.047 24.935  1.00 34.89  ? 63  PHE B CG  1 
ATOM   3717 C CD1 . PHE B 1 63  ? 0.044   12.449 26.188  1.00 37.36  ? 63  PHE B CD1 1 
ATOM   3718 C CD2 . PHE B 1 63  ? -0.603  13.021 23.962  1.00 36.48  ? 63  PHE B CD2 1 
ATOM   3719 C CE1 . PHE B 1 63  ? 0.291   13.796 26.462  1.00 37.04  ? 63  PHE B CE1 1 
ATOM   3720 C CE2 . PHE B 1 63  ? -0.355  14.369 24.241  1.00 38.47  ? 63  PHE B CE2 1 
ATOM   3721 C CZ  . PHE B 1 63  ? 0.095   14.745 25.488  1.00 35.77  ? 63  PHE B CZ  1 
ATOM   3722 N N   . GLY B 1 64  ? -1.763  7.502  26.054  1.00 34.72  ? 64  GLY B N   1 
ATOM   3723 C CA  . GLY B 1 64  ? -2.330  6.202  25.733  1.00 35.31  ? 64  GLY B CA  1 
ATOM   3724 C C   . GLY B 1 64  ? -3.405  6.299  24.667  1.00 39.45  ? 64  GLY B C   1 
ATOM   3725 O O   . GLY B 1 64  ? -3.683  7.386  24.159  1.00 37.02  ? 64  GLY B O   1 
ATOM   3726 N N   . GLU B 1 65  ? -4.025  5.162  24.326  1.00 39.44  ? 65  GLU B N   1 
ATOM   3727 C CA  . GLU B 1 65  ? -5.060  5.056  23.289  1.00 40.42  ? 65  GLU B CA  1 
ATOM   3728 C C   . GLU B 1 65  ? -6.137  6.149  23.377  1.00 44.07  ? 65  GLU B C   1 
ATOM   3729 O O   . GLU B 1 65  ? -6.395  6.856  22.391  1.00 43.58  ? 65  GLU B O   1 
ATOM   3730 C CB  . GLU B 1 65  ? -5.700  3.653  23.302  1.00 43.47  ? 65  GLU B CB  1 
ATOM   3731 C CG  . GLU B 1 65  ? -5.319  2.775  22.115  1.00 61.66  ? 65  GLU B CG  1 
ATOM   3732 C CD  . GLU B 1 65  ? -3.942  2.123  22.115  1.00 101.11 ? 65  GLU B CD  1 
ATOM   3733 O OE1 . GLU B 1 65  ? -3.245  2.173  23.155  1.00 105.39 ? 65  GLU B OE1 1 
ATOM   3734 O OE2 . GLU B 1 65  ? -3.573  1.529  21.074  1.00 98.03  ? 65  GLU B OE2 1 
ATOM   3735 N N   . GLU B 1 66  ? -6.706  6.321  24.574  1.00 40.18  ? 66  GLU B N   1 
ATOM   3736 C CA  . GLU B 1 66  ? -7.771  7.283  24.841  1.00 38.69  ? 66  GLU B CA  1 
ATOM   3737 C C   . GLU B 1 66  ? -7.304  8.726  24.992  1.00 42.07  ? 66  GLU B C   1 
ATOM   3738 O O   . GLU B 1 66  ? -7.977  9.629  24.470  1.00 42.28  ? 66  GLU B O   1 
ATOM   3739 C CB  . GLU B 1 66  ? -8.651  6.814  26.003  1.00 40.01  ? 66  GLU B CB  1 
ATOM   3740 C CG  . GLU B 1 66  ? -9.339  5.483  25.727  1.00 51.26  ? 66  GLU B CG  1 
ATOM   3741 C CD  . GLU B 1 66  ? -10.349 5.426  24.592  1.00 75.08  ? 66  GLU B CD  1 
ATOM   3742 O OE1 . GLU B 1 66  ? -11.169 6.366  24.477  1.00 75.15  ? 66  GLU B OE1 1 
ATOM   3743 O OE2 . GLU B 1 66  ? -10.348 4.420  23.843  1.00 63.53  ? 66  GLU B OE2 1 
ATOM   3744 N N   . MET B 1 67  ? -6.143  8.945  25.668  1.00 36.48  ? 67  MET B N   1 
ATOM   3745 C CA  . MET B 1 67  ? -5.524  10.261 25.848  1.00 34.24  ? 67  MET B CA  1 
ATOM   3746 C C   . MET B 1 67  ? -5.193  10.882 24.473  1.00 36.70  ? 67  MET B C   1 
ATOM   3747 O O   . MET B 1 67  ? -5.421  12.077 24.263  1.00 35.65  ? 67  MET B O   1 
ATOM   3748 C CB  . MET B 1 67  ? -4.276  10.146 26.732  1.00 37.04  ? 67  MET B CB  1 
ATOM   3749 C CG  . MET B 1 67  ? -3.609  11.487 27.055  1.00 40.81  ? 67  MET B CG  1 
ATOM   3750 S SD  . MET B 1 67  ? -4.594  12.549 28.161  1.00 44.97  ? 67  MET B SD  1 
ATOM   3751 C CE  . MET B 1 67  ? -4.009  12.006 29.747  1.00 42.58  ? 67  MET B CE  1 
ATOM   3752 N N   . MET B 1 68  ? -4.704  10.048 23.528  1.00 33.04  ? 68  MET B N   1 
ATOM   3753 C CA  . MET B 1 68  ? -4.388  10.447 22.155  1.00 31.54  ? 68  MET B CA  1 
ATOM   3754 C C   . MET B 1 68  ? -5.656  10.895 21.413  1.00 31.53  ? 68  MET B C   1 
ATOM   3755 O O   . MET B 1 68  ? -5.627  11.918 20.732  1.00 29.32  ? 68  MET B O   1 
ATOM   3756 C CB  . MET B 1 68  ? -3.672  9.312  21.405  1.00 34.84  ? 68  MET B CB  1 
ATOM   3757 C CG  . MET B 1 68  ? -3.068  9.735  20.078  1.00 39.05  ? 68  MET B CG  1 
ATOM   3758 S SD  . MET B 1 68  ? -1.807  11.020 20.247  1.00 43.73  ? 68  MET B SD  1 
ATOM   3759 C CE  . MET B 1 68  ? -0.453  10.258 19.472  1.00 41.75  ? 68  MET B CE  1 
ATOM   3760 N N   . LYS B 1 69  ? -6.772  10.160 21.580  1.00 26.71  ? 69  LYS B N   1 
ATOM   3761 C CA  . LYS B 1 69  ? -8.041  10.518 20.954  1.00 25.78  ? 69  LYS B CA  1 
ATOM   3762 C C   . LYS B 1 69  ? -8.513  11.880 21.462  1.00 29.32  ? 69  LYS B C   1 
ATOM   3763 O O   . LYS B 1 69  ? -8.996  12.694 20.666  1.00 30.94  ? 69  LYS B O   1 
ATOM   3764 C CB  . LYS B 1 69  ? -9.102  9.433  21.166  1.00 27.81  ? 69  LYS B CB  1 
ATOM   3765 C CG  . LYS B 1 69  ? -8.964  8.279  20.187  1.00 29.82  ? 69  LYS B CG  1 
ATOM   3766 C CD  . LYS B 1 69  ? -10.105 7.300  20.309  1.00 30.86  ? 69  LYS B CD  1 
ATOM   3767 C CE  . LYS B 1 69  ? -9.667  5.986  20.877  1.00 42.82  ? 69  LYS B CE  1 
ATOM   3768 N NZ  . LYS B 1 69  ? -10.804 5.040  20.968  1.00 61.67  ? 69  LYS B NZ  1 
ATOM   3769 N N   . ARG B 1 70  ? -8.306  12.156 22.761  1.00 22.85  ? 70  ARG B N   1 
ATOM   3770 C CA  . ARG B 1 70  ? -8.643  13.446 23.346  1.00 21.35  ? 70  ARG B CA  1 
ATOM   3771 C C   . ARG B 1 70  ? -7.736  14.554 22.751  1.00 24.32  ? 70  ARG B C   1 
ATOM   3772 O O   . ARG B 1 70  ? -8.235  15.589 22.317  1.00 22.46  ? 70  ARG B O   1 
ATOM   3773 C CB  . ARG B 1 70  ? -8.517  13.394 24.883  1.00 20.16  ? 70  ARG B CB  1 
ATOM   3774 C CG  . ARG B 1 70  ? -9.039  14.655 25.537  1.00 25.30  ? 70  ARG B CG  1 
ATOM   3775 C CD  . ARG B 1 70  ? -8.692  14.773 26.986  1.00 30.44  ? 70  ARG B CD  1 
ATOM   3776 N NE  . ARG B 1 70  ? -8.965  16.136 27.450  1.00 33.16  ? 70  ARG B NE  1 
ATOM   3777 C CZ  . ARG B 1 70  ? -8.739  16.574 28.685  1.00 45.29  ? 70  ARG B CZ  1 
ATOM   3778 N NH1 . ARG B 1 70  ? -8.253  15.757 29.608  1.00 24.19  ? 70  ARG B NH1 1 
ATOM   3779 N NH2 . ARG B 1 70  ? -8.996  17.835 29.004  1.00 42.97  ? 70  ARG B NH2 1 
ATOM   3780 N N   . ALA B 1 71  ? -6.418  14.304 22.705  1.00 22.09  ? 71  ALA B N   1 
ATOM   3781 C CA  . ALA B 1 71  ? -5.403  15.224 22.201  1.00 23.13  ? 71  ALA B CA  1 
ATOM   3782 C C   . ALA B 1 71  ? -5.602  15.636 20.743  1.00 30.47  ? 71  ALA B C   1 
ATOM   3783 O O   . ALA B 1 71  ? -5.299  16.774 20.387  1.00 31.15  ? 71  ALA B O   1 
ATOM   3784 C CB  . ALA B 1 71  ? -4.023  14.612 22.378  1.00 24.71  ? 71  ALA B CB  1 
ATOM   3785 N N   . LEU B 1 72  ? -6.097  14.714 19.899  1.00 27.87  ? 72  LEU B N   1 
ATOM   3786 C CA  . LEU B 1 72  ? -6.309  14.944 18.470  1.00 26.56  ? 72  LEU B CA  1 
ATOM   3787 C C   . LEU B 1 72  ? -7.685  15.534 18.113  1.00 27.04  ? 72  LEU B C   1 
ATOM   3788 O O   . LEU B 1 72  ? -7.959  15.785 16.929  1.00 25.60  ? 72  LEU B O   1 
ATOM   3789 C CB  . LEU B 1 72  ? -6.085  13.633 17.712  1.00 27.36  ? 72  LEU B CB  1 
ATOM   3790 C CG  . LEU B 1 72  ? -4.681  13.025 17.744  1.00 32.20  ? 72  LEU B CG  1 
ATOM   3791 C CD1 . LEU B 1 72  ? -4.631  11.777 16.877  1.00 32.96  ? 72  LEU B CD1 1 
ATOM   3792 C CD2 . LEU B 1 72  ? -3.602  14.034 17.304  1.00 33.32  ? 72  LEU B CD2 1 
ATOM   3793 N N   . GLN B 1 73  ? -8.528  15.770 19.139  1.00 21.20  ? 73  GLN B N   1 
ATOM   3794 C CA  . GLN B 1 73  ? -9.897  16.269 19.012  1.00 20.19  ? 73  GLN B CA  1 
ATOM   3795 C C   . GLN B 1 73  ? -10.058 17.722 19.501  1.00 22.92  ? 73  GLN B C   1 
ATOM   3796 O O   . GLN B 1 73  ? -9.208  18.217 20.257  1.00 21.27  ? 73  GLN B O   1 
ATOM   3797 C CB  . GLN B 1 73  ? -10.860 15.305 19.761  1.00 21.53  ? 73  GLN B CB  1 
ATOM   3798 C CG  . GLN B 1 73  ? -12.372 15.606 19.693  1.00 22.80  ? 73  GLN B CG  1 
ATOM   3799 C CD  . GLN B 1 73  ? -12.935 15.607 18.292  1.00 37.93  ? 73  GLN B CD  1 
ATOM   3800 O OE1 . GLN B 1 73  ? -12.837 16.588 17.567  1.00 34.62  ? 73  GLN B OE1 1 
ATOM   3801 N NE2 . GLN B 1 73  ? -13.557 14.516 17.886  1.00 32.60  ? 73  GLN B NE2 1 
ATOM   3802 N N   . TYR B 1 74  ? -11.156 18.399 19.067  1.00 18.65  ? 74  TYR B N   1 
ATOM   3803 C CA  . TYR B 1 74  ? -11.475 19.754 19.503  1.00 17.91  ? 74  TYR B CA  1 
ATOM   3804 C C   . TYR B 1 74  ? -11.557 19.803 21.057  1.00 23.51  ? 74  TYR B C   1 
ATOM   3805 O O   . TYR B 1 74  ? -11.756 18.766 21.716  1.00 22.39  ? 74  TYR B O   1 
ATOM   3806 C CB  . TYR B 1 74  ? -12.811 20.226 18.899  1.00 18.53  ? 74  TYR B CB  1 
ATOM   3807 C CG  . TYR B 1 74  ? -12.827 20.446 17.401  1.00 19.90  ? 74  TYR B CG  1 
ATOM   3808 C CD1 . TYR B 1 74  ? -12.074 21.458 16.818  1.00 21.68  ? 74  TYR B CD1 1 
ATOM   3809 C CD2 . TYR B 1 74  ? -13.698 19.731 16.580  1.00 21.30  ? 74  TYR B CD2 1 
ATOM   3810 C CE1 . TYR B 1 74  ? -12.100 21.682 15.438  1.00 23.06  ? 74  TYR B CE1 1 
ATOM   3811 C CE2 . TYR B 1 74  ? -13.763 19.971 15.204  1.00 22.28  ? 74  TYR B CE2 1 
ATOM   3812 C CZ  . TYR B 1 74  ? -12.963 20.953 14.637  1.00 27.70  ? 74  TYR B CZ  1 
ATOM   3813 O OH  . TYR B 1 74  ? -13.026 21.226 13.290  1.00 24.26  ? 74  TYR B OH  1 
ATOM   3814 N N   . SER B 1 75  ? -11.370 21.013 21.628  1.00 20.56  ? 75  SER B N   1 
ATOM   3815 C CA  . SER B 1 75  ? -11.420 21.274 23.070  1.00 19.83  ? 75  SER B CA  1 
ATOM   3816 C C   . SER B 1 75  ? -11.912 22.723 23.354  1.00 27.14  ? 75  SER B C   1 
ATOM   3817 O O   . SER B 1 75  ? -11.966 23.521 22.408  1.00 27.72  ? 75  SER B O   1 
ATOM   3818 C CB  . SER B 1 75  ? -10.072 20.971 23.724  1.00 19.53  ? 75  SER B CB  1 
ATOM   3819 O OG  . SER B 1 75  ? -8.987  21.607 23.070  1.00 20.64  ? 75  SER B OG  1 
ATOM   3820 N N   . PRO B 1 76  ? -12.306 23.088 24.614  1.00 24.49  ? 76  PRO B N   1 
ATOM   3821 C CA  . PRO B 1 76  ? -12.822 24.452 24.858  1.00 24.17  ? 76  PRO B CA  1 
ATOM   3822 C C   . PRO B 1 76  ? -11.924 25.620 24.433  1.00 28.67  ? 76  PRO B C   1 
ATOM   3823 O O   . PRO B 1 76  ? -10.693 25.541 24.526  1.00 27.32  ? 76  PRO B O   1 
ATOM   3824 C CB  . PRO B 1 76  ? -13.083 24.464 26.367  1.00 25.69  ? 76  PRO B CB  1 
ATOM   3825 C CG  . PRO B 1 76  ? -13.226 23.057 26.753  1.00 29.47  ? 76  PRO B CG  1 
ATOM   3826 C CD  . PRO B 1 76  ? -12.327 22.289 25.860  1.00 25.31  ? 76  PRO B CD  1 
ATOM   3827 N N   . SER B 1 77  ? -12.562 26.716 23.998  1.00 26.70  ? 77  SER B N   1 
ATOM   3828 C CA  . SER B 1 77  ? -11.914 27.944 23.529  1.00 26.74  ? 77  SER B CA  1 
ATOM   3829 C C   . SER B 1 77  ? -10.905 28.553 24.506  1.00 30.80  ? 77  SER B C   1 
ATOM   3830 O O   . SER B 1 77  ? -9.845  28.994 24.072  1.00 30.72  ? 77  SER B O   1 
ATOM   3831 C CB  . SER B 1 77  ? -12.962 28.978 23.141  1.00 29.95  ? 77  SER B CB  1 
ATOM   3832 O OG  . SER B 1 77  ? -13.681 28.596 21.978  1.00 35.07  ? 77  SER B OG  1 
ATOM   3833 N N   . ALA B 1 78  ? -11.236 28.574 25.815  1.00 27.34  ? 78  ALA B N   1 
ATOM   3834 C CA  . ALA B 1 78  ? -10.413 29.148 26.892  1.00 26.15  ? 78  ALA B CA  1 
ATOM   3835 C C   . ALA B 1 78  ? -9.214  28.307 27.304  1.00 31.51  ? 78  ALA B C   1 
ATOM   3836 O O   . ALA B 1 78  ? -8.304  28.813 27.951  1.00 31.32  ? 78  ALA B O   1 
ATOM   3837 C CB  . ALA B 1 78  ? -11.279 29.434 28.101  1.00 26.83  ? 78  ALA B CB  1 
ATOM   3838 N N   . GLY B 1 79  ? -9.239  27.027 26.952  1.00 29.29  ? 79  GLY B N   1 
ATOM   3839 C CA  . GLY B 1 79  ? -8.199  26.065 27.290  1.00 27.98  ? 79  GLY B CA  1 
ATOM   3840 C C   . GLY B 1 79  ? -8.772  24.831 27.950  1.00 31.41  ? 79  GLY B C   1 
ATOM   3841 O O   . GLY B 1 79  ? -9.956  24.812 28.326  1.00 31.97  ? 79  GLY B O   1 
ATOM   3842 N N   . ILE B 1 80  ? -7.942  23.778 28.075  1.00 27.10  ? 80  ILE B N   1 
ATOM   3843 C CA  . ILE B 1 80  ? -8.355  22.539 28.740  1.00 27.23  ? 80  ILE B CA  1 
ATOM   3844 C C   . ILE B 1 80  ? -8.512  22.811 30.256  1.00 30.37  ? 80  ILE B C   1 
ATOM   3845 O O   . ILE B 1 80  ? -7.720  23.585 30.812  1.00 28.48  ? 80  ILE B O   1 
ATOM   3846 C CB  . ILE B 1 80  ? -7.444  21.334 28.386  1.00 31.23  ? 80  ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 80  ? -5.961  21.587 28.793  1.00 31.19  ? 80  ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 80  ? -7.575  20.995 26.896  1.00 32.38  ? 80  ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 80  ? -5.099  20.374 29.032  1.00 27.84  ? 80  ILE B CD1 1 
ATOM   3850 N N   . PRO B 1 81  ? -9.572  22.288 30.923  1.00 28.43  ? 81  PRO B N   1 
ATOM   3851 C CA  . PRO B 1 81  ? -9.791  22.634 32.349  1.00 28.19  ? 81  PRO B CA  1 
ATOM   3852 C C   . PRO B 1 81  ? -8.618  22.450 33.305  1.00 33.63  ? 81  PRO B C   1 
ATOM   3853 O O   . PRO B 1 81  ? -8.378  23.336 34.130  1.00 34.34  ? 81  PRO B O   1 
ATOM   3854 C CB  . PRO B 1 81  ? -11.022 21.822 32.748  1.00 30.20  ? 81  PRO B CB  1 
ATOM   3855 C CG  . PRO B 1 81  ? -11.203 20.809 31.668  1.00 35.16  ? 81  PRO B CG  1 
ATOM   3856 C CD  . PRO B 1 81  ? -10.638 21.399 30.418  1.00 30.36  ? 81  PRO B CD  1 
ATOM   3857 N N   . GLU B 1 82  ? -7.869  21.340 33.173  1.00 29.80  ? 82  GLU B N   1 
ATOM   3858 C CA  . GLU B 1 82  ? -6.723  21.038 34.020  1.00 29.96  ? 82  GLU B CA  1 
ATOM   3859 C C   . GLU B 1 82  ? -5.587  22.046 33.914  1.00 34.56  ? 82  GLU B C   1 
ATOM   3860 O O   . GLU B 1 82  ? -4.981  22.378 34.943  1.00 35.01  ? 82  GLU B O   1 
ATOM   3861 C CB  . GLU B 1 82  ? -6.257  19.575 33.886  1.00 32.09  ? 82  GLU B CB  1 
ATOM   3862 C CG  . GLU B 1 82  ? -6.124  19.048 32.467  1.00 44.86  ? 82  GLU B CG  1 
ATOM   3863 C CD  . GLU B 1 82  ? -7.356  18.359 31.915  1.00 55.75  ? 82  GLU B CD  1 
ATOM   3864 O OE1 . GLU B 1 82  ? -8.273  19.066 31.439  1.00 33.70  ? 82  GLU B OE1 1 
ATOM   3865 O OE2 . GLU B 1 82  ? -7.394  17.108 31.931  1.00 51.53  ? 82  GLU B OE2 1 
ATOM   3866 N N   . LEU B 1 83  ? -5.319  22.572 32.690  1.00 30.57  ? 83  LEU B N   1 
ATOM   3867 C CA  . LEU B 1 83  ? -4.287  23.614 32.456  1.00 28.25  ? 83  LEU B CA  1 
ATOM   3868 C C   . LEU B 1 83  ? -4.737  24.961 33.043  1.00 30.17  ? 83  LEU B C   1 
ATOM   3869 O O   . LEU B 1 83  ? -3.931  25.638 33.681  1.00 30.34  ? 83  LEU B O   1 
ATOM   3870 C CB  . LEU B 1 83  ? -3.937  23.740 30.951  1.00 27.13  ? 83  LEU B CB  1 
ATOM   3871 C CG  . LEU B 1 83  ? -2.849  24.741 30.514  1.00 30.36  ? 83  LEU B CG  1 
ATOM   3872 C CD1 . LEU B 1 83  ? -1.531  24.470 31.180  1.00 30.80  ? 83  LEU B CD1 1 
ATOM   3873 C CD2 . LEU B 1 83  ? -2.628  24.676 29.037  1.00 31.62  ? 83  LEU B CD2 1 
ATOM   3874 N N   . LEU B 1 84  ? -6.026  25.335 32.840  1.00 25.13  ? 84  LEU B N   1 
ATOM   3875 C CA  . LEU B 1 84  ? -6.613  26.570 33.375  1.00 24.10  ? 84  LEU B CA  1 
ATOM   3876 C C   . LEU B 1 84  ? -6.586  26.630 34.903  1.00 28.80  ? 84  LEU B C   1 
ATOM   3877 O O   . LEU B 1 84  ? -6.213  27.666 35.450  1.00 27.86  ? 84  LEU B O   1 
ATOM   3878 C CB  . LEU B 1 84  ? -8.043  26.814 32.851  1.00 23.51  ? 84  LEU B CB  1 
ATOM   3879 C CG  . LEU B 1 84  ? -8.157  27.364 31.433  1.00 27.04  ? 84  LEU B CG  1 
ATOM   3880 C CD1 . LEU B 1 84  ? -9.569  27.328 30.968  1.00 26.04  ? 84  LEU B CD1 1 
ATOM   3881 C CD2 . LEU B 1 84  ? -7.616  28.793 31.327  1.00 29.77  ? 84  LEU B CD2 1 
ATOM   3882 N N   . SER B 1 85  ? -6.939  25.531 35.589  1.00 26.95  ? 85  SER B N   1 
ATOM   3883 C CA  . SER B 1 85  ? -6.932  25.516 37.056  1.00 28.31  ? 85  SER B CA  1 
ATOM   3884 C C   . SER B 1 85  ? -5.514  25.616 37.633  1.00 34.32  ? 85  SER B C   1 
ATOM   3885 O O   . SER B 1 85  ? -5.316  26.313 38.632  1.00 36.50  ? 85  SER B O   1 
ATOM   3886 C CB  . SER B 1 85  ? -7.659  24.296 37.608  1.00 32.62  ? 85  SER B CB  1 
ATOM   3887 O OG  . SER B 1 85  ? -7.170  23.103 37.021  1.00 47.50  ? 85  SER B OG  1 
ATOM   3888 N N   . TRP B 1 86  ? -4.534  24.967 36.981  1.00 28.45  ? 86  TRP B N   1 
ATOM   3889 C CA  . TRP B 1 86  ? -3.141  24.985 37.417  1.00 27.80  ? 86  TRP B CA  1 
ATOM   3890 C C   . TRP B 1 86  ? -2.542  26.381 37.306  1.00 29.01  ? 86  TRP B C   1 
ATOM   3891 O O   . TRP B 1 86  ? -1.831  26.836 38.212  1.00 27.05  ? 86  TRP B O   1 
ATOM   3892 C CB  . TRP B 1 86  ? -2.312  23.994 36.590  1.00 26.61  ? 86  TRP B CB  1 
ATOM   3893 C CG  . TRP B 1 86  ? -1.035  23.577 37.267  1.00 27.69  ? 86  TRP B CG  1 
ATOM   3894 C CD1 . TRP B 1 86  ? -0.855  22.511 38.100  1.00 31.36  ? 86  TRP B CD1 1 
ATOM   3895 C CD2 . TRP B 1 86  ? 0.231   24.242 37.184  1.00 27.22  ? 86  TRP B CD2 1 
ATOM   3896 N NE1 . TRP B 1 86  ? 0.443   22.484 38.559  1.00 31.55  ? 86  TRP B NE1 1 
ATOM   3897 C CE2 . TRP B 1 86  ? 1.143   23.512 37.979  1.00 32.23  ? 86  TRP B CE2 1 
ATOM   3898 C CE3 . TRP B 1 86  ? 0.689   25.389 36.510  1.00 27.53  ? 86  TRP B CE3 1 
ATOM   3899 C CZ2 . TRP B 1 86  ? 2.494   23.874 38.095  1.00 31.33  ? 86  TRP B CZ2 1 
ATOM   3900 C CZ3 . TRP B 1 86  ? 2.015   25.766 36.654  1.00 29.01  ? 86  TRP B CZ3 1 
ATOM   3901 C CH2 . TRP B 1 86  ? 2.908   24.994 37.409  1.00 30.52  ? 86  TRP B CH2 1 
ATOM   3902 N N   . LEU B 1 87  ? -2.826  27.055 36.182  1.00 25.06  ? 87  LEU B N   1 
ATOM   3903 C CA  . LEU B 1 87  ? -2.334  28.403 35.913  1.00 23.72  ? 87  LEU B CA  1 
ATOM   3904 C C   . LEU B 1 87  ? -2.950  29.444 36.860  1.00 27.25  ? 87  LEU B C   1 
ATOM   3905 O O   . LEU B 1 87  ? -2.222  30.292 37.347  1.00 25.52  ? 87  LEU B O   1 
ATOM   3906 C CB  . LEU B 1 87  ? -2.524  28.758 34.436  1.00 22.53  ? 87  LEU B CB  1 
ATOM   3907 C CG  . LEU B 1 87  ? -1.689  27.941 33.450  1.00 26.42  ? 87  LEU B CG  1 
ATOM   3908 C CD1 . LEU B 1 87  ? -2.149  28.166 32.022  1.00 29.72  ? 87  LEU B CD1 1 
ATOM   3909 C CD2 . LEU B 1 87  ? -0.186  28.239 33.589  1.00 25.96  ? 87  LEU B CD2 1 
ATOM   3910 N N   . LYS B 1 88  ? -4.270  29.318 37.185  1.00 24.75  ? 88  LYS B N   1 
ATOM   3911 C CA  . LYS B 1 88  ? -5.000  30.165 38.132  1.00 24.32  ? 88  LYS B CA  1 
ATOM   3912 C C   . LYS B 1 88  ? -4.305  30.158 39.504  1.00 29.67  ? 88  LYS B C   1 
ATOM   3913 O O   . LYS B 1 88  ? -4.106  31.205 40.111  1.00 29.65  ? 88  LYS B O   1 
ATOM   3914 C CB  . LYS B 1 88  ? -6.422  29.629 38.297  1.00 26.89  ? 88  LYS B CB  1 
ATOM   3915 C CG  . LYS B 1 88  ? -7.435  30.252 37.357  1.00 49.20  ? 88  LYS B CG  1 
ATOM   3916 C CD  . LYS B 1 88  ? -8.865  29.858 37.758  1.00 64.11  ? 88  LYS B CD  1 
ATOM   3917 C CE  . LYS B 1 88  ? -9.540  30.804 38.727  1.00 73.10  ? 88  LYS B CE  1 
ATOM   3918 N NZ  . LYS B 1 88  ? -10.071 32.005 38.035  1.00 80.48  ? 88  LYS B NZ  1 
ATOM   3919 N N   . GLN B 1 89  ? -3.928  28.968 39.967  1.00 28.01  ? 89  GLN B N   1 
ATOM   3920 C CA  . GLN B 1 89  ? -3.257  28.726 41.238  1.00 29.71  ? 89  GLN B CA  1 
ATOM   3921 C C   . GLN B 1 89  ? -1.857  29.320 41.264  1.00 35.05  ? 89  GLN B C   1 
ATOM   3922 O O   . GLN B 1 89  ? -1.419  29.838 42.306  1.00 36.34  ? 89  GLN B O   1 
ATOM   3923 C CB  . GLN B 1 89  ? -3.212  27.228 41.536  1.00 31.93  ? 89  GLN B CB  1 
ATOM   3924 C CG  . GLN B 1 89  ? -4.569  26.655 41.895  1.00 50.06  ? 89  GLN B CG  1 
ATOM   3925 C CD  . GLN B 1 89  ? -4.559  25.824 43.135  1.00 78.97  ? 89  GLN B CD  1 
ATOM   3926 O OE1 . GLN B 1 89  ? -3.858  26.118 44.122  1.00 76.66  ? 89  GLN B OE1 1 
ATOM   3927 N NE2 . GLN B 1 89  ? -5.394  24.795 43.119  1.00 73.26  ? 89  GLN B NE2 1 
ATOM   3928 N N   . LEU B 1 90  ? -1.161  29.265 40.119  1.00 30.92  ? 90  LEU B N   1 
ATOM   3929 C CA  . LEU B 1 90  ? 0.173   29.849 39.986  1.00 30.71  ? 90  LEU B CA  1 
ATOM   3930 C C   . LEU B 1 90  ? 0.077   31.372 40.128  1.00 33.98  ? 90  LEU B C   1 
ATOM   3931 O O   . LEU B 1 90  ? 0.843   31.946 40.903  1.00 34.87  ? 90  LEU B O   1 
ATOM   3932 C CB  . LEU B 1 90  ? 0.827   29.456 38.648  1.00 29.94  ? 90  LEU B CB  1 
ATOM   3933 C CG  . LEU B 1 90  ? 2.286   29.845 38.473  1.00 33.59  ? 90  LEU B CG  1 
ATOM   3934 C CD1 . LEU B 1 90  ? 3.196   28.972 39.295  1.00 33.77  ? 90  LEU B CD1 1 
ATOM   3935 C CD2 . LEU B 1 90  ? 2.674   29.793 37.037  1.00 36.60  ? 90  LEU B CD2 1 
ATOM   3936 N N   . GLN B 1 91  ? -0.908  32.001 39.436  1.00 28.81  ? 91  GLN B N   1 
ATOM   3937 C CA  . GLN B 1 91  ? -1.191  33.443 39.477  1.00 28.51  ? 91  GLN B CA  1 
ATOM   3938 C C   . GLN B 1 91  ? -1.502  33.891 40.899  1.00 32.54  ? 91  GLN B C   1 
ATOM   3939 O O   . GLN B 1 91  ? -1.029  34.952 41.315  1.00 31.47  ? 91  GLN B O   1 
ATOM   3940 C CB  . GLN B 1 91  ? -2.344  33.827 38.528  1.00 29.56  ? 91  GLN B CB  1 
ATOM   3941 C CG  . GLN B 1 91  ? -2.076  33.569 37.042  1.00 39.57  ? 91  GLN B CG  1 
ATOM   3942 C CD  . GLN B 1 91  ? -0.900  34.323 36.494  1.00 55.63  ? 91  GLN B CD  1 
ATOM   3943 O OE1 . GLN B 1 91  ? -1.016  35.475 36.095  1.00 61.93  ? 91  GLN B OE1 1 
ATOM   3944 N NE2 . GLN B 1 91  ? 0.243   33.680 36.417  1.00 40.37  ? 91  GLN B NE2 1 
ATOM   3945 N N   . ILE B 1 92  ? -2.247  33.059 41.659  1.00 29.98  ? 92  ILE B N   1 
ATOM   3946 C CA  . ILE B 1 92  ? -2.556  33.325 43.066  1.00 31.15  ? 92  ILE B CA  1 
ATOM   3947 C C   . ILE B 1 92  ? -1.272  33.288 43.950  1.00 36.99  ? 92  ILE B C   1 
ATOM   3948 O O   . ILE B 1 92  ? -1.060  34.222 44.718  1.00 36.49  ? 92  ILE B O   1 
ATOM   3949 C CB  . ILE B 1 92  ? -3.732  32.447 43.592  1.00 34.19  ? 92  ILE B CB  1 
ATOM   3950 C CG1 . ILE B 1 92  ? -5.046  32.871 42.922  1.00 34.00  ? 92  ILE B CG1 1 
ATOM   3951 C CG2 . ILE B 1 92  ? -3.874  32.541 45.119  1.00 35.22  ? 92  ILE B CG2 1 
ATOM   3952 C CD1 . ILE B 1 92  ? -6.152  31.885 42.940  1.00 40.07  ? 92  ILE B CD1 1 
ATOM   3953 N N   . LYS B 1 93  ? -0.414  32.250 43.822  1.00 34.94  ? 93  LYS B N   1 
ATOM   3954 C CA  . LYS B 1 93  ? 0.807   32.180 44.651  1.00 36.48  ? 93  LYS B CA  1 
ATOM   3955 C C   . LYS B 1 93  ? 1.854   33.219 44.318  1.00 41.33  ? 93  LYS B C   1 
ATOM   3956 O O   . LYS B 1 93  ? 2.595   33.656 45.198  1.00 42.22  ? 93  LYS B O   1 
ATOM   3957 C CB  . LYS B 1 93  ? 1.427   30.770 44.701  1.00 38.87  ? 93  LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 93  ? 0.746   29.931 45.774  1.00 63.37  ? 93  LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 93  ? 1.307   28.549 45.949  1.00 78.51  ? 93  LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 93  ? 0.344   27.651 46.698  1.00 94.09  ? 93  LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 93  ? -0.819  27.242 45.857  1.00 109.86 ? 93  LYS B NZ  1 
ATOM   3962 N N   . LEU B 1 94  ? 1.904   33.621 43.061  1.00 36.50  ? 94  LEU B N   1 
ATOM   3963 C CA  . LEU B 1 94  ? 2.893   34.569 42.585  1.00 35.60  ? 94  LEU B CA  1 
ATOM   3964 C C   . LEU B 1 94  ? 2.435   36.019 42.726  1.00 40.37  ? 94  LEU B C   1 
ATOM   3965 O O   . LEU B 1 94  ? 3.246   36.872 43.104  1.00 41.97  ? 94  LEU B O   1 
ATOM   3966 C CB  . LEU B 1 94  ? 3.273   34.232 41.118  1.00 34.21  ? 94  LEU B CB  1 
ATOM   3967 C CG  . LEU B 1 94  ? 4.481   33.296 40.863  1.00 38.11  ? 94  LEU B CG  1 
ATOM   3968 C CD1 . LEU B 1 94  ? 4.450   32.052 41.720  1.00 38.53  ? 94  LEU B CD1 1 
ATOM   3969 C CD2 . LEU B 1 94  ? 4.510   32.848 39.429  1.00 40.14  ? 94  LEU B CD2 1 
ATOM   3970 N N   . HIS B 1 95  ? 1.152   36.305 42.430  1.00 35.06  ? 95  HIS B N   1 
ATOM   3971 C CA  . HIS B 1 95  ? 0.665   37.679 42.424  1.00 34.15  ? 95  HIS B CA  1 
ATOM   3972 C C   . HIS B 1 95  ? -0.456  38.027 43.405  1.00 37.18  ? 95  HIS B C   1 
ATOM   3973 O O   . HIS B 1 95  ? -0.680  39.219 43.631  1.00 37.45  ? 95  HIS B O   1 
ATOM   3974 C CB  . HIS B 1 95  ? 0.311   38.119 40.991  1.00 33.93  ? 95  HIS B CB  1 
ATOM   3975 C CG  . HIS B 1 95  ? 1.291   37.654 39.953  1.00 37.07  ? 95  HIS B CG  1 
ATOM   3976 N ND1 . HIS B 1 95  ? 0.972   36.638 39.066  1.00 38.66  ? 95  HIS B ND1 1 
ATOM   3977 C CD2 . HIS B 1 95  ? 2.566   38.046 39.723  1.00 38.77  ? 95  HIS B CD2 1 
ATOM   3978 C CE1 . HIS B 1 95  ? 2.045   36.469 38.307  1.00 37.75  ? 95  HIS B CE1 1 
ATOM   3979 N NE2 . HIS B 1 95  ? 3.029   37.296 38.661  1.00 38.22  ? 95  HIS B NE2 1 
ATOM   3980 N N   . ASN B 1 96  ? -1.148  37.022 43.991  1.00 31.03  ? 96  ASN B N   1 
ATOM   3981 C CA  . ASN B 1 96  ? -2.277  37.220 44.904  1.00 30.55  ? 96  ASN B CA  1 
ATOM   3982 C C   . ASN B 1 96  ? -3.080  38.477 44.514  1.00 35.63  ? 96  ASN B C   1 
ATOM   3983 O O   . ASN B 1 96  ? -3.014  39.497 45.212  1.00 36.30  ? 96  ASN B O   1 
ATOM   3984 C CB  . ASN B 1 96  ? -1.821  37.219 46.372  1.00 27.50  ? 96  ASN B CB  1 
ATOM   3985 C CG  . ASN B 1 96  ? -2.944  37.220 47.406  1.00 43.61  ? 96  ASN B CG  1 
ATOM   3986 O OD1 . ASN B 1 96  ? -4.068  36.718 47.185  1.00 47.39  ? 96  ASN B OD1 1 
ATOM   3987 N ND2 . ASN B 1 96  ? -2.651  37.786 48.569  1.00 21.79  ? 96  ASN B ND2 1 
ATOM   3988 N N   . PRO B 1 97  ? -3.726  38.480 43.323  1.00 31.62  ? 97  PRO B N   1 
ATOM   3989 C CA  . PRO B 1 97  ? -4.432  39.697 42.883  1.00 31.14  ? 97  PRO B CA  1 
ATOM   3990 C C   . PRO B 1 97  ? -5.624  40.036 43.767  1.00 34.17  ? 97  PRO B C   1 
ATOM   3991 O O   . PRO B 1 97  ? -6.325  39.132 44.227  1.00 33.44  ? 97  PRO B O   1 
ATOM   3992 C CB  . PRO B 1 97  ? -4.877  39.363 41.453  1.00 32.20  ? 97  PRO B CB  1 
ATOM   3993 C CG  . PRO B 1 97  ? -4.081  38.153 41.065  1.00 36.51  ? 97  PRO B CG  1 
ATOM   3994 C CD  . PRO B 1 97  ? -3.871  37.402 42.328  1.00 32.49  ? 97  PRO B CD  1 
ATOM   3995 N N   . PRO B 1 98  ? -5.871  41.332 44.020  1.00 30.42  ? 98  PRO B N   1 
ATOM   3996 C CA  . PRO B 1 98  ? -7.029  41.705 44.859  1.00 31.33  ? 98  PRO B CA  1 
ATOM   3997 C C   . PRO B 1 98  ? -8.396  41.282 44.298  1.00 37.09  ? 98  PRO B C   1 
ATOM   3998 O O   . PRO B 1 98  ? -9.327  41.035 45.070  1.00 37.54  ? 98  PRO B O   1 
ATOM   3999 C CB  . PRO B 1 98  ? -6.917  43.228 44.949  1.00 33.18  ? 98  PRO B CB  1 
ATOM   4000 C CG  . PRO B 1 98  ? -5.483  43.547 44.586  1.00 36.78  ? 98  PRO B CG  1 
ATOM   4001 C CD  . PRO B 1 98  ? -5.118  42.518 43.569  1.00 31.35  ? 98  PRO B CD  1 
ATOM   4002 N N   . THR B 1 99  ? -8.493  41.157 42.955  1.00 33.56  ? 99  THR B N   1 
ATOM   4003 C CA  . THR B 1 99  ? -9.698  40.851 42.185  1.00 33.20  ? 99  THR B CA  1 
ATOM   4004 C C   . THR B 1 99  ? -10.286 39.425 42.241  1.00 40.99  ? 99  THR B C   1 
ATOM   4005 O O   . THR B 1 99  ? -11.380 39.216 41.698  1.00 41.95  ? 99  THR B O   1 
ATOM   4006 C CB  . THR B 1 99  ? -9.539  41.353 40.749  1.00 35.18  ? 99  THR B CB  1 
ATOM   4007 O OG1 . THR B 1 99  ? -8.552  40.586 40.071  1.00 35.52  ? 99  THR B OG1 1 
ATOM   4008 C CG2 . THR B 1 99  ? -9.207  42.824 40.677  1.00 31.82  ? 99  THR B CG2 1 
ATOM   4009 N N   . ILE B 1 100 ? -9.595  38.466 42.880  1.00 39.44  ? 100 ILE B N   1 
ATOM   4010 C CA  . ILE B 1 100 ? -10.024 37.057 42.975  1.00 40.92  ? 100 ILE B CA  1 
ATOM   4011 C C   . ILE B 1 100 ? -11.521 36.808 43.310  1.00 45.01  ? 100 ILE B C   1 
ATOM   4012 O O   . ILE B 1 100 ? -12.213 36.129 42.547  1.00 43.80  ? 100 ILE B O   1 
ATOM   4013 C CB  . ILE B 1 100 ? -9.066  36.192 43.862  1.00 45.50  ? 100 ILE B CB  1 
ATOM   4014 C CG1 . ILE B 1 100 ? -7.593  36.271 43.370  1.00 45.48  ? 100 ILE B CG1 1 
ATOM   4015 C CG2 . ILE B 1 100 ? -9.544  34.724 43.957  1.00 47.45  ? 100 ILE B CG2 1 
ATOM   4016 C CD1 . ILE B 1 100 ? -6.553  35.946 44.473  1.00 57.33  ? 100 ILE B CD1 1 
ATOM   4017 N N   . HIS B 1 101 ? -12.008 37.345 44.436  1.00 42.13  ? 101 HIS B N   1 
ATOM   4018 C CA  . HIS B 1 101 ? -13.391 37.120 44.882  1.00 41.92  ? 101 HIS B CA  1 
ATOM   4019 C C   . HIS B 1 101 ? -14.398 38.218 44.581  1.00 44.29  ? 101 HIS B C   1 
ATOM   4020 O O   . HIS B 1 101 ? -15.543 38.137 45.037  1.00 45.33  ? 101 HIS B O   1 
ATOM   4021 C CB  . HIS B 1 101 ? -13.435 36.682 46.350  1.00 43.94  ? 101 HIS B CB  1 
ATOM   4022 C CG  . HIS B 1 101 ? -12.740 35.391 46.576  1.00 47.54  ? 101 HIS B CG  1 
ATOM   4023 N ND1 . HIS B 1 101 ? -11.394 35.343 46.906  1.00 49.56  ? 101 HIS B ND1 1 
ATOM   4024 C CD2 . HIS B 1 101 ? -13.205 34.135 46.428  1.00 49.50  ? 101 HIS B CD2 1 
ATOM   4025 C CE1 . HIS B 1 101 ? -11.095 34.061 46.980  1.00 49.06  ? 101 HIS B CE1 1 
ATOM   4026 N NE2 . HIS B 1 101 ? -12.152 33.296 46.704  1.00 49.43  ? 101 HIS B NE2 1 
ATOM   4027 N N   . TYR B 1 102 ? -14.004 39.199 43.759  1.00 38.94  ? 102 TYR B N   1 
ATOM   4028 C CA  . TYR B 1 102 ? -14.856 40.307 43.326  1.00 39.32  ? 102 TYR B CA  1 
ATOM   4029 C C   . TYR B 1 102 ? -16.043 39.774 42.496  1.00 44.35  ? 102 TYR B C   1 
ATOM   4030 O O   . TYR B 1 102 ? -15.895 38.728 41.868  1.00 43.92  ? 102 TYR B O   1 
ATOM   4031 C CB  . TYR B 1 102 ? -14.025 41.255 42.438  1.00 40.20  ? 102 TYR B CB  1 
ATOM   4032 C CG  . TYR B 1 102 ? -13.108 42.240 43.147  1.00 42.49  ? 102 TYR B CG  1 
ATOM   4033 C CD1 . TYR B 1 102 ? -12.654 43.384 42.502  1.00 44.23  ? 102 TYR B CD1 1 
ATOM   4034 C CD2 . TYR B 1 102 ? -12.654 42.002 44.447  1.00 43.26  ? 102 TYR B CD2 1 
ATOM   4035 C CE1 . TYR B 1 102 ? -11.808 44.289 43.146  1.00 44.88  ? 102 TYR B CE1 1 
ATOM   4036 C CE2 . TYR B 1 102 ? -11.803 42.897 45.095  1.00 43.92  ? 102 TYR B CE2 1 
ATOM   4037 C CZ  . TYR B 1 102 ? -11.374 44.037 44.438  1.00 49.23  ? 102 TYR B CZ  1 
ATOM   4038 O OH  . TYR B 1 102 ? -10.530 44.927 45.070  1.00 48.75  ? 102 TYR B OH  1 
ATOM   4039 N N   . PRO B 1 103 ? -17.210 40.457 42.427  1.00 43.22  ? 103 PRO B N   1 
ATOM   4040 C CA  . PRO B 1 103 ? -18.288 39.966 41.540  1.00 43.68  ? 103 PRO B CA  1 
ATOM   4041 C C   . PRO B 1 103 ? -17.842 39.959 40.067  1.00 47.87  ? 103 PRO B C   1 
ATOM   4042 O O   . PRO B 1 103 ? -17.069 40.839 39.680  1.00 46.15  ? 103 PRO B O   1 
ATOM   4043 C CB  . PRO B 1 103 ? -19.427 40.975 41.743  1.00 46.27  ? 103 PRO B CB  1 
ATOM   4044 C CG  . PRO B 1 103 ? -19.082 41.730 42.939  1.00 51.45  ? 103 PRO B CG  1 
ATOM   4045 C CD  . PRO B 1 103 ? -17.596 41.719 43.084  1.00 46.09  ? 103 PRO B CD  1 
ATOM   4046 N N   . PRO B 1 104 ? -18.289 38.984 39.233  1.00 46.47  ? 104 PRO B N   1 
ATOM   4047 C CA  . PRO B 1 104 ? -17.831 38.937 37.831  1.00 46.16  ? 104 PRO B CA  1 
ATOM   4048 C C   . PRO B 1 104 ? -17.858 40.253 37.059  1.00 51.26  ? 104 PRO B C   1 
ATOM   4049 O O   . PRO B 1 104 ? -16.879 40.568 36.390  1.00 51.05  ? 104 PRO B O   1 
ATOM   4050 C CB  . PRO B 1 104 ? -18.711 37.852 37.212  1.00 47.58  ? 104 PRO B CB  1 
ATOM   4051 C CG  . PRO B 1 104 ? -18.997 36.936 38.336  1.00 51.96  ? 104 PRO B CG  1 
ATOM   4052 C CD  . PRO B 1 104 ? -19.171 37.837 39.529  1.00 48.57  ? 104 PRO B CD  1 
ATOM   4053 N N   . SER B 1 105 ? -18.937 41.039 37.209  1.00 48.63  ? 105 SER B N   1 
ATOM   4054 C CA  . SER B 1 105 ? -19.106 42.347 36.562  1.00 48.38  ? 105 SER B CA  1 
ATOM   4055 C C   . SER B 1 105 ? -18.155 43.425 37.124  1.00 51.54  ? 105 SER B C   1 
ATOM   4056 O O   . SER B 1 105 ? -17.850 44.390 36.419  1.00 51.85  ? 105 SER B O   1 
ATOM   4057 C CB  . SER B 1 105 ? -20.565 42.803 36.637  1.00 51.77  ? 105 SER B CB  1 
ATOM   4058 O OG  . SER B 1 105 ? -21.164 42.495 37.885  1.00 56.90  ? 105 SER B OG  1 
ATOM   4059 N N   . GLN B 1 106 ? -17.671 43.246 38.373  1.00 46.76  ? 106 GLN B N   1 
ATOM   4060 C CA  . GLN B 1 106 ? -16.738 44.176 39.022  1.00 46.26  ? 106 GLN B CA  1 
ATOM   4061 C C   . GLN B 1 106 ? -15.255 43.944 38.656  1.00 47.53  ? 106 GLN B C   1 
ATOM   4062 O O   . GLN B 1 106 ? -14.364 44.604 39.209  1.00 46.34  ? 106 GLN B O   1 
ATOM   4063 C CB  . GLN B 1 106 ? -16.946 44.199 40.537  1.00 48.33  ? 106 GLN B CB  1 
ATOM   4064 C CG  . GLN B 1 106 ? -17.869 45.322 40.980  1.00 64.95  ? 106 GLN B CG  1 
ATOM   4065 C CD  . GLN B 1 106 ? -18.061 45.341 42.475  1.00 89.66  ? 106 GLN B CD  1 
ATOM   4066 O OE1 . GLN B 1 106 ? -17.106 45.492 43.259  1.00 83.48  ? 106 GLN B OE1 1 
ATOM   4067 N NE2 . GLN B 1 106 ? -19.316 45.219 42.899  1.00 87.58  ? 106 GLN B NE2 1 
ATOM   4068 N N   . GLY B 1 107 ? -15.024 43.021 37.716  1.00 42.05  ? 107 GLY B N   1 
ATOM   4069 C CA  . GLY B 1 107 ? -13.707 42.688 37.195  1.00 39.54  ? 107 GLY B CA  1 
ATOM   4070 C C   . GLY B 1 107 ? -13.010 41.515 37.839  1.00 39.26  ? 107 GLY B C   1 
ATOM   4071 O O   . GLY B 1 107 ? -11.779 41.542 37.979  1.00 37.43  ? 107 GLY B O   1 
ATOM   4072 N N   . GLN B 1 108 ? -13.783 40.465 38.205  1.00 34.23  ? 108 GLN B N   1 
ATOM   4073 C CA  . GLN B 1 108 ? -13.261 39.228 38.799  1.00 33.55  ? 108 GLN B CA  1 
ATOM   4074 C C   . GLN B 1 108 ? -12.120 38.652 37.944  1.00 34.95  ? 108 GLN B C   1 
ATOM   4075 O O   . GLN B 1 108 ? -12.209 38.675 36.702  1.00 32.52  ? 108 GLN B O   1 
ATOM   4076 C CB  . GLN B 1 108 ? -14.387 38.193 38.926  1.00 35.22  ? 108 GLN B CB  1 
ATOM   4077 C CG  . GLN B 1 108 ? -13.990 36.927 39.679  1.00 42.17  ? 108 GLN B CG  1 
ATOM   4078 C CD  . GLN B 1 108 ? -15.144 35.984 39.854  1.00 54.68  ? 108 GLN B CD  1 
ATOM   4079 O OE1 . GLN B 1 108 ? -15.903 35.696 38.918  1.00 46.93  ? 108 GLN B OE1 1 
ATOM   4080 N NE2 . GLN B 1 108 ? -15.261 35.436 41.053  1.00 49.04  ? 108 GLN B NE2 1 
ATOM   4081 N N   . MET B 1 109 ? -11.046 38.163 38.613  1.00 31.03  ? 109 MET B N   1 
ATOM   4082 C CA  . MET B 1 109 ? -9.880  37.601 37.932  1.00 29.64  ? 109 MET B CA  1 
ATOM   4083 C C   . MET B 1 109 ? -10.264 36.381 37.105  1.00 32.99  ? 109 MET B C   1 
ATOM   4084 O O   . MET B 1 109 ? -10.890 35.450 37.627  1.00 31.71  ? 109 MET B O   1 
ATOM   4085 C CB  . MET B 1 109 ? -8.744  37.271 38.909  1.00 31.70  ? 109 MET B CB  1 
ATOM   4086 C CG  . MET B 1 109 ? -7.442  36.888 38.198  1.00 34.85  ? 109 MET B CG  1 
ATOM   4087 S SD  . MET B 1 109 ? -6.288  35.917 39.209  1.00 39.73  ? 109 MET B SD  1 
ATOM   4088 C CE  . MET B 1 109 ? -6.548  34.302 38.518  1.00 36.53  ? 109 MET B CE  1 
ATOM   4089 N N   . ASP B 1 110 ? -9.938  36.430 35.799  1.00 30.00  ? 110 ASP B N   1 
ATOM   4090 C CA  . ASP B 1 110 ? -10.195 35.349 34.854  1.00 29.98  ? 110 ASP B CA  1 
ATOM   4091 C C   . ASP B 1 110 ? -8.974  35.130 33.981  1.00 33.72  ? 110 ASP B C   1 
ATOM   4092 O O   . ASP B 1 110 ? -8.144  36.026 33.847  1.00 32.70  ? 110 ASP B O   1 
ATOM   4093 C CB  . ASP B 1 110 ? -11.471 35.587 34.027  1.00 32.35  ? 110 ASP B CB  1 
ATOM   4094 C CG  . ASP B 1 110 ? -12.104 34.321 33.448  1.00 50.46  ? 110 ASP B CG  1 
ATOM   4095 O OD1 . ASP B 1 110 ? -11.670 33.202 33.829  1.00 51.96  ? 110 ASP B OD1 1 
ATOM   4096 O OD2 . ASP B 1 110 ? -13.044 34.448 32.618  1.00 58.73  ? 110 ASP B OD2 1 
ATOM   4097 N N   . LEU B 1 111 ? -8.855  33.920 33.420  1.00 31.04  ? 111 LEU B N   1 
ATOM   4098 C CA  . LEU B 1 111 ? -7.725  33.468 32.617  1.00 30.82  ? 111 LEU B CA  1 
ATOM   4099 C C   . LEU B 1 111 ? -8.140  32.766 31.349  1.00 34.51  ? 111 LEU B C   1 
ATOM   4100 O O   . LEU B 1 111 ? -9.188  32.100 31.309  1.00 36.53  ? 111 LEU B O   1 
ATOM   4101 C CB  . LEU B 1 111 ? -6.949  32.439 33.446  1.00 31.43  ? 111 LEU B CB  1 
ATOM   4102 C CG  . LEU B 1 111 ? -5.519  32.772 33.790  1.00 37.19  ? 111 LEU B CG  1 
ATOM   4103 C CD1 . LEU B 1 111 ? -5.350  32.854 35.291  1.00 39.26  ? 111 LEU B CD1 1 
ATOM   4104 C CD2 . LEU B 1 111 ? -4.594  31.735 33.235  1.00 36.99  ? 111 LEU B CD2 1 
ATOM   4105 N N   . CYS B 1 112 ? -7.273  32.824 30.340  1.00 27.66  ? 112 CYS B N   1 
ATOM   4106 C CA  . CYS B 1 112 ? -7.458  32.038 29.137  1.00 27.69  ? 112 CYS B CA  1 
ATOM   4107 C C   . CYS B 1 112 ? -6.144  31.695 28.457  1.00 30.08  ? 112 CYS B C   1 
ATOM   4108 O O   . CYS B 1 112 ? -5.211  32.493 28.467  1.00 31.12  ? 112 CYS B O   1 
ATOM   4109 C CB  . CYS B 1 112 ? -8.474  32.645 28.176  1.00 28.86  ? 112 CYS B CB  1 
ATOM   4110 S SG  . CYS B 1 112 ? -7.952  34.203 27.441  1.00 33.39  ? 112 CYS B SG  1 
ATOM   4111 N N   . VAL B 1 113 ? -6.062  30.484 27.918  1.00 24.40  ? 113 VAL B N   1 
ATOM   4112 C CA  . VAL B 1 113 ? -4.904  30.001 27.188  1.00 24.38  ? 113 VAL B CA  1 
ATOM   4113 C C   . VAL B 1 113 ? -5.042  30.542 25.762  1.00 29.19  ? 113 VAL B C   1 
ATOM   4114 O O   . VAL B 1 113 ? -6.129  30.474 25.177  1.00 29.90  ? 113 VAL B O   1 
ATOM   4115 C CB  . VAL B 1 113 ? -4.789  28.447 27.212  1.00 28.78  ? 113 VAL B CB  1 
ATOM   4116 C CG1 . VAL B 1 113 ? -3.423  27.994 26.699  1.00 28.94  ? 113 VAL B CG1 1 
ATOM   4117 C CG2 . VAL B 1 113 ? -5.056  27.876 28.612  1.00 28.61  ? 113 VAL B CG2 1 
ATOM   4118 N N   . THR B 1 114 ? -3.947  31.116 25.226  1.00 24.97  ? 114 THR B N   1 
ATOM   4119 C CA  . THR B 1 114 ? -3.895  31.679 23.868  1.00 23.58  ? 114 THR B CA  1 
ATOM   4120 C C   . THR B 1 114 ? -2.828  30.960 23.038  1.00 23.01  ? 114 THR B C   1 
ATOM   4121 O O   . THR B 1 114 ? -1.986  30.254 23.592  1.00 19.11  ? 114 THR B O   1 
ATOM   4122 C CB  . THR B 1 114 ? -3.699  33.217 23.925  1.00 33.49  ? 114 THR B CB  1 
ATOM   4123 O OG1 . THR B 1 114 ? -2.543  33.517 24.705  1.00 34.26  ? 114 THR B OG1 1 
ATOM   4124 C CG2 . THR B 1 114 ? -4.901  33.953 24.505  1.00 30.14  ? 114 THR B CG2 1 
ATOM   4125 N N   . SER B 1 115 ? -2.864  31.121 21.713  1.00 22.30  ? 115 SER B N   1 
ATOM   4126 C CA  . SER B 1 115 ? -1.870  30.480 20.835  1.00 23.65  ? 115 SER B CA  1 
ATOM   4127 C C   . SER B 1 115 ? -0.630  31.367 20.772  1.00 29.72  ? 115 SER B C   1 
ATOM   4128 O O   . SER B 1 115 ? -0.330  31.988 19.743  1.00 29.54  ? 115 SER B O   1 
ATOM   4129 C CB  . SER B 1 115 ? -2.463  30.181 19.463  1.00 28.01  ? 115 SER B CB  1 
ATOM   4130 O OG  . SER B 1 115 ? -3.446  29.159 19.560  1.00 41.38  ? 115 SER B OG  1 
ATOM   4131 N N   . GLY B 1 116 ? 0.042   31.444 21.930  1.00 27.36  ? 116 GLY B N   1 
ATOM   4132 C CA  . GLY B 1 116 ? 1.184   32.306 22.208  1.00 26.75  ? 116 GLY B CA  1 
ATOM   4133 C C   . GLY B 1 116 ? 0.661   33.552 22.886  1.00 31.64  ? 116 GLY B C   1 
ATOM   4134 O O   . GLY B 1 116 ? -0.536  33.845 22.791  1.00 31.43  ? 116 GLY B O   1 
ATOM   4135 N N   . SER B 1 117 ? 1.534   34.311 23.570  1.00 29.06  ? 117 SER B N   1 
ATOM   4136 C CA  . SER B 1 117 ? 1.091   35.535 24.244  1.00 28.80  ? 117 SER B CA  1 
ATOM   4137 C C   . SER B 1 117 ? 0.739   36.643 23.234  1.00 34.32  ? 117 SER B C   1 
ATOM   4138 O O   . SER B 1 117 ? -0.031  37.548 23.564  1.00 36.04  ? 117 SER B O   1 
ATOM   4139 C CB  . SER B 1 117 ? 2.113   36.013 25.263  1.00 32.96  ? 117 SER B CB  1 
ATOM   4140 O OG  . SER B 1 117 ? 3.241   36.610 24.647  1.00 43.61  ? 117 SER B OG  1 
ATOM   4141 N N   . GLN B 1 118 ? 1.259   36.535 21.990  1.00 29.41  ? 118 GLN B N   1 
ATOM   4142 C CA  . GLN B 1 118 ? 1.010   37.467 20.886  1.00 28.52  ? 118 GLN B CA  1 
ATOM   4143 C C   . GLN B 1 118 ? -0.479  37.480 20.484  1.00 30.62  ? 118 GLN B C   1 
ATOM   4144 O O   . GLN B 1 118 ? -0.999  38.514 20.082  1.00 29.40  ? 118 GLN B O   1 
ATOM   4145 C CB  . GLN B 1 118 ? 1.896   37.088 19.676  1.00 29.54  ? 118 GLN B CB  1 
ATOM   4146 C CG  . GLN B 1 118 ? 1.935   38.101 18.529  1.00 27.76  ? 118 GLN B CG  1 
ATOM   4147 C CD  . GLN B 1 118 ? 2.357   39.468 18.973  1.00 57.25  ? 118 GLN B CD  1 
ATOM   4148 O OE1 . GLN B 1 118 ? 3.451   39.645 19.511  1.00 52.85  ? 118 GLN B OE1 1 
ATOM   4149 N NE2 . GLN B 1 118 ? 1.495   40.461 18.778  1.00 57.67  ? 118 GLN B NE2 1 
ATOM   4150 N N   . GLN B 1 119 ? -1.140  36.323 20.562  1.00 27.83  ? 119 GLN B N   1 
ATOM   4151 C CA  . GLN B 1 119 ? -2.537  36.200 20.187  1.00 28.06  ? 119 GLN B CA  1 
ATOM   4152 C C   . GLN B 1 119 ? -3.419  36.966 21.168  1.00 34.67  ? 119 GLN B C   1 
ATOM   4153 O O   . GLN B 1 119 ? -4.310  37.685 20.728  1.00 34.36  ? 119 GLN B O   1 
ATOM   4154 C CB  . GLN B 1 119 ? -2.946  34.724 20.047  1.00 28.76  ? 119 GLN B CB  1 
ATOM   4155 C CG  . GLN B 1 119 ? -4.174  34.555 19.171  1.00 29.02  ? 119 GLN B CG  1 
ATOM   4156 C CD  . GLN B 1 119 ? -4.939  33.279 19.380  1.00 36.08  ? 119 GLN B CD  1 
ATOM   4157 O OE1 . GLN B 1 119 ? -4.841  32.602 20.422  1.00 25.67  ? 119 GLN B OE1 1 
ATOM   4158 N NE2 . GLN B 1 119 ? -5.763  32.956 18.392  1.00 29.75  ? 119 GLN B NE2 1 
ATOM   4159 N N   . GLY B 1 120 ? -3.117  36.854 22.471  1.00 32.91  ? 120 GLY B N   1 
ATOM   4160 C CA  . GLY B 1 120 ? -3.829  37.557 23.537  1.00 32.48  ? 120 GLY B CA  1 
ATOM   4161 C C   . GLY B 1 120 ? -3.712  39.055 23.365  1.00 35.10  ? 120 GLY B C   1 
ATOM   4162 O O   . GLY B 1 120 ? -4.725  39.754 23.321  1.00 34.77  ? 120 GLY B O   1 
ATOM   4163 N N   . LEU B 1 121 ? -2.471  39.540 23.185  1.00 30.98  ? 121 LEU B N   1 
ATOM   4164 C CA  . LEU B 1 121 ? -2.151  40.953 22.950  1.00 31.28  ? 121 LEU B CA  1 
ATOM   4165 C C   . LEU B 1 121 ? -2.931  41.508 21.757  1.00 35.54  ? 121 LEU B C   1 
ATOM   4166 O O   . LEU B 1 121 ? -3.556  42.563 21.872  1.00 37.14  ? 121 LEU B O   1 
ATOM   4167 C CB  . LEU B 1 121 ? -0.634  41.126 22.707  1.00 31.22  ? 121 LEU B CB  1 
ATOM   4168 C CG  . LEU B 1 121 ? 0.280   40.937 23.917  1.00 35.15  ? 121 LEU B CG  1 
ATOM   4169 C CD1 . LEU B 1 121 ? 1.687   40.672 23.485  1.00 34.49  ? 121 LEU B CD1 1 
ATOM   4170 C CD2 . LEU B 1 121 ? 0.202   42.137 24.874  1.00 39.08  ? 121 LEU B CD2 1 
ATOM   4171 N N   . CYS B 1 122 ? -2.932  40.762 20.643  1.00 30.85  ? 122 CYS B N   1 
ATOM   4172 C CA  . CYS B 1 122 ? -3.609  41.096 19.400  1.00 31.94  ? 122 CYS B CA  1 
ATOM   4173 C C   . CYS B 1 122 ? -5.109  41.290 19.584  1.00 32.64  ? 122 CYS B C   1 
ATOM   4174 O O   . CYS B 1 122 ? -5.641  42.326 19.188  1.00 31.55  ? 122 CYS B O   1 
ATOM   4175 C CB  . CYS B 1 122 ? -3.298  40.050 18.328  1.00 33.61  ? 122 CYS B CB  1 
ATOM   4176 S SG  . CYS B 1 122 ? -4.268  40.218 16.807  1.00 38.75  ? 122 CYS B SG  1 
ATOM   4177 N N   . LYS B 1 123 ? -5.778  40.292 20.183  1.00 28.08  ? 123 LYS B N   1 
ATOM   4178 C CA  . LYS B 1 123 ? -7.221  40.302 20.432  1.00 27.83  ? 123 LYS B CA  1 
ATOM   4179 C C   . LYS B 1 123 ? -7.618  41.442 21.370  1.00 31.93  ? 123 LYS B C   1 
ATOM   4180 O O   . LYS B 1 123 ? -8.688  42.034 21.181  1.00 31.45  ? 123 LYS B O   1 
ATOM   4181 C CB  . LYS B 1 123 ? -7.711  38.943 20.988  1.00 29.09  ? 123 LYS B CB  1 
ATOM   4182 C CG  . LYS B 1 123 ? -7.384  37.702 20.130  1.00 35.96  ? 123 LYS B CG  1 
ATOM   4183 C CD  . LYS B 1 123 ? -7.992  37.700 18.722  1.00 41.16  ? 123 LYS B CD  1 
ATOM   4184 C CE  . LYS B 1 123 ? -6.969  37.453 17.640  1.00 36.10  ? 123 LYS B CE  1 
ATOM   4185 N NZ  . LYS B 1 123 ? -7.563  37.626 16.288  1.00 43.79  ? 123 LYS B NZ  1 
ATOM   4186 N N   . VAL B 1 124 ? -6.730  41.760 22.358  1.00 27.41  ? 124 VAL B N   1 
ATOM   4187 C CA  . VAL B 1 124 ? -6.908  42.827 23.346  1.00 26.72  ? 124 VAL B CA  1 
ATOM   4188 C C   . VAL B 1 124 ? -6.833  44.181 22.648  1.00 32.19  ? 124 VAL B C   1 
ATOM   4189 O O   . VAL B 1 124 ? -7.690  45.031 22.889  1.00 34.07  ? 124 VAL B O   1 
ATOM   4190 C CB  . VAL B 1 124 ? -5.910  42.692 24.525  1.00 29.21  ? 124 VAL B CB  1 
ATOM   4191 C CG1 . VAL B 1 124 ? -5.775  43.995 25.321  1.00 29.55  ? 124 VAL B CG1 1 
ATOM   4192 C CG2 . VAL B 1 124 ? -6.317  41.563 25.447  1.00 28.11  ? 124 VAL B CG2 1 
ATOM   4193 N N   . PHE B 1 125 ? -5.826  44.377 21.779  1.00 26.85  ? 125 PHE B N   1 
ATOM   4194 C CA  . PHE B 1 125 ? -5.667  45.624 21.036  1.00 26.59  ? 125 PHE B CA  1 
ATOM   4195 C C   . PHE B 1 125 ? -6.869  45.876 20.125  1.00 30.74  ? 125 PHE B C   1 
ATOM   4196 O O   . PHE B 1 125 ? -7.369  46.996 20.085  1.00 30.80  ? 125 PHE B O   1 
ATOM   4197 C CB  . PHE B 1 125 ? -4.378  45.600 20.201  1.00 27.84  ? 125 PHE B CB  1 
ATOM   4198 C CG  . PHE B 1 125 ? -3.068  45.588 20.945  1.00 28.54  ? 125 PHE B CG  1 
ATOM   4199 C CD1 . PHE B 1 125 ? -1.939  45.041 20.369  1.00 30.96  ? 125 PHE B CD1 1 
ATOM   4200 C CD2 . PHE B 1 125 ? -2.951  46.178 22.207  1.00 30.54  ? 125 PHE B CD2 1 
ATOM   4201 C CE1 . PHE B 1 125 ? -0.720  45.051 21.050  1.00 31.50  ? 125 PHE B CE1 1 
ATOM   4202 C CE2 . PHE B 1 125 ? -1.734  46.187 22.888  1.00 32.25  ? 125 PHE B CE2 1 
ATOM   4203 C CZ  . PHE B 1 125 ? -0.627  45.623 22.308  1.00 29.97  ? 125 PHE B CZ  1 
ATOM   4204 N N   . GLU B 1 126 ? -7.339  44.823 19.427  1.00 28.24  ? 126 GLU B N   1 
ATOM   4205 C CA  . GLU B 1 126 ? -8.475  44.861 18.491  1.00 29.78  ? 126 GLU B CA  1 
ATOM   4206 C C   . GLU B 1 126 ? -9.825  45.142 19.190  1.00 34.59  ? 126 GLU B C   1 
ATOM   4207 O O   . GLU B 1 126 ? -10.716 45.772 18.601  1.00 34.63  ? 126 GLU B O   1 
ATOM   4208 C CB  . GLU B 1 126 ? -8.520  43.577 17.626  1.00 31.01  ? 126 GLU B CB  1 
ATOM   4209 C CG  . GLU B 1 126 ? -7.372  43.510 16.624  1.00 41.57  ? 126 GLU B CG  1 
ATOM   4210 C CD  . GLU B 1 126 ? -7.235  42.324 15.682  1.00 66.17  ? 126 GLU B CD  1 
ATOM   4211 O OE1 . GLU B 1 126 ? -6.291  42.351 14.858  1.00 68.69  ? 126 GLU B OE1 1 
ATOM   4212 O OE2 . GLU B 1 126 ? -8.052  41.377 15.754  1.00 59.84  ? 126 GLU B OE2 1 
ATOM   4213 N N   . MET B 1 127 ? -9.934  44.692 20.466  1.00 29.73  ? 127 MET B N   1 
ATOM   4214 C CA  . MET B 1 127 ? -11.091 44.843 21.334  1.00 29.01  ? 127 MET B CA  1 
ATOM   4215 C C   . MET B 1 127 ? -11.273 46.302 21.735  1.00 35.63  ? 127 MET B C   1 
ATOM   4216 O O   . MET B 1 127 ? -12.413 46.798 21.708  1.00 37.39  ? 127 MET B O   1 
ATOM   4217 C CB  . MET B 1 127 ? -10.927 43.929 22.558  1.00 30.12  ? 127 MET B CB  1 
ATOM   4218 C CG  . MET B 1 127 ? -11.799 44.271 23.732  1.00 33.88  ? 127 MET B CG  1 
ATOM   4219 S SD  . MET B 1 127 ? -11.355 43.287 25.175  1.00 37.73  ? 127 MET B SD  1 
ATOM   4220 C CE  . MET B 1 127 ? -10.013 44.208 25.840  1.00 33.85  ? 127 MET B CE  1 
ATOM   4221 N N   . ILE B 1 128 ? -10.146 46.985 22.067  1.00 30.59  ? 128 ILE B N   1 
ATOM   4222 C CA  . ILE B 1 128 ? -10.070 48.358 22.564  1.00 31.00  ? 128 ILE B CA  1 
ATOM   4223 C C   . ILE B 1 128 ? -10.062 49.482 21.511  1.00 36.06  ? 128 ILE B C   1 
ATOM   4224 O O   . ILE B 1 128 ? -10.882 50.404 21.593  1.00 36.74  ? 128 ILE B O   1 
ATOM   4225 C CB  . ILE B 1 128 ? -8.861  48.498 23.541  1.00 33.25  ? 128 ILE B CB  1 
ATOM   4226 C CG1 . ILE B 1 128 ? -8.972  47.521 24.704  1.00 32.89  ? 128 ILE B CG1 1 
ATOM   4227 C CG2 . ILE B 1 128 ? -8.680  49.954 24.044  1.00 34.83  ? 128 ILE B CG2 1 
ATOM   4228 C CD1 . ILE B 1 128 ? -7.656  47.216 25.373  1.00 44.44  ? 128 ILE B CD1 1 
ATOM   4229 N N   . ILE B 1 129 ? -9.079  49.452 20.594  1.00 31.65  ? 129 ILE B N   1 
ATOM   4230 C CA  . ILE B 1 129 ? -8.804  50.517 19.630  1.00 31.61  ? 129 ILE B CA  1 
ATOM   4231 C C   . ILE B 1 129 ? -9.805  50.805 18.544  1.00 35.55  ? 129 ILE B C   1 
ATOM   4232 O O   . ILE B 1 129 ? -10.086 49.937 17.721  1.00 36.49  ? 129 ILE B O   1 
ATOM   4233 C CB  . ILE B 1 129 ? -7.344  50.486 19.097  1.00 34.14  ? 129 ILE B CB  1 
ATOM   4234 C CG1 . ILE B 1 129 ? -6.323  50.573 20.246  1.00 33.35  ? 129 ILE B CG1 1 
ATOM   4235 C CG2 . ILE B 1 129 ? -7.093  51.600 18.061  1.00 35.81  ? 129 ILE B CG2 1 
ATOM   4236 C CD1 . ILE B 1 129 ? -5.240  49.583 20.118  1.00 37.89  ? 129 ILE B CD1 1 
ATOM   4237 N N   . ASN B 1 130 ? -10.272 52.066 18.505  1.00 31.83  ? 130 ASN B N   1 
ATOM   4238 C CA  . ASN B 1 130 ? -11.126 52.646 17.467  1.00 32.86  ? 130 ASN B CA  1 
ATOM   4239 C C   . ASN B 1 130 ? -10.221 53.645 16.751  1.00 39.23  ? 130 ASN B C   1 
ATOM   4240 O O   . ASN B 1 130 ? -9.375  54.260 17.417  1.00 38.67  ? 130 ASN B O   1 
ATOM   4241 C CB  . ASN B 1 130 ? -12.310 53.399 18.056  1.00 31.27  ? 130 ASN B CB  1 
ATOM   4242 C CG  . ASN B 1 130 ? -13.381 52.514 18.590  1.00 53.98  ? 130 ASN B CG  1 
ATOM   4243 O OD1 . ASN B 1 130 ? -13.947 51.690 17.862  1.00 37.03  ? 130 ASN B OD1 1 
ATOM   4244 N ND2 . ASN B 1 130 ? -13.698 52.688 19.873  1.00 55.95  ? 130 ASN B ND2 1 
ATOM   4245 N N   . PRO B 1 131 ? -10.351 53.837 15.415  1.00 36.32  ? 131 PRO B N   1 
ATOM   4246 C CA  . PRO B 1 131 ? -9.457  54.795 14.735  1.00 36.11  ? 131 PRO B CA  1 
ATOM   4247 C C   . PRO B 1 131 ? -9.527  56.190 15.349  1.00 40.04  ? 131 PRO B C   1 
ATOM   4248 O O   . PRO B 1 131 ? -10.627 56.742 15.496  1.00 39.61  ? 131 PRO B O   1 
ATOM   4249 C CB  . PRO B 1 131 ? -9.928  54.755 13.276  1.00 38.42  ? 131 PRO B CB  1 
ATOM   4250 C CG  . PRO B 1 131 ? -10.664 53.458 13.138  1.00 42.16  ? 131 PRO B CG  1 
ATOM   4251 C CD  . PRO B 1 131 ? -11.281 53.187 14.464  1.00 37.36  ? 131 PRO B CD  1 
ATOM   4252 N N   . GLY B 1 132 ? -8.363  56.687 15.781  1.00 36.47  ? 132 GLY B N   1 
ATOM   4253 C CA  . GLY B 1 132 ? -8.204  58.004 16.400  1.00 37.33  ? 132 GLY B CA  1 
ATOM   4254 C C   . GLY B 1 132 ? -8.080  58.045 17.914  1.00 40.33  ? 132 GLY B C   1 
ATOM   4255 O O   . GLY B 1 132 ? -8.064  59.131 18.503  1.00 39.19  ? 132 GLY B O   1 
ATOM   4256 N N   . ASP B 1 133 ? -7.998  56.869 18.559  1.00 37.29  ? 133 ASP B N   1 
ATOM   4257 C CA  . ASP B 1 133 ? -7.866  56.733 20.011  1.00 36.57  ? 133 ASP B CA  1 
ATOM   4258 C C   . ASP B 1 133 ? -6.427  56.990 20.452  1.00 42.08  ? 133 ASP B C   1 
ATOM   4259 O O   . ASP B 1 133 ? -5.486  56.663 19.725  1.00 41.75  ? 133 ASP B O   1 
ATOM   4260 C CB  . ASP B 1 133 ? -8.327  55.337 20.478  1.00 37.12  ? 133 ASP B CB  1 
ATOM   4261 C CG  . ASP B 1 133 ? -9.839  55.084 20.520  1.00 51.58  ? 133 ASP B CG  1 
ATOM   4262 O OD1 . ASP B 1 133 ? -10.623 56.068 20.407  1.00 54.62  ? 133 ASP B OD1 1 
ATOM   4263 O OD2 . ASP B 1 133 ? -10.239 53.914 20.724  1.00 54.51  ? 133 ASP B OD2 1 
ATOM   4264 N N   . ASN B 1 134 ? -6.252  57.579 21.637  1.00 39.09  ? 134 ASN B N   1 
ATOM   4265 C CA  . ASN B 1 134 ? -4.927  57.856 22.171  1.00 38.49  ? 134 ASN B CA  1 
ATOM   4266 C C   . ASN B 1 134 ? -4.457  56.682 23.009  1.00 41.60  ? 134 ASN B C   1 
ATOM   4267 O O   . ASN B 1 134 ? -5.232  56.162 23.819  1.00 40.27  ? 134 ASN B O   1 
ATOM   4268 C CB  . ASN B 1 134 ? -4.936  59.134 23.001  1.00 39.82  ? 134 ASN B CB  1 
ATOM   4269 C CG  . ASN B 1 134 ? -5.082  60.387 22.189  1.00 60.35  ? 134 ASN B CG  1 
ATOM   4270 O OD1 . ASN B 1 134 ? -4.493  60.539 21.109  1.00 54.62  ? 134 ASN B OD1 1 
ATOM   4271 N ND2 . ASN B 1 134 ? -5.842  61.335 22.718  1.00 50.44  ? 134 ASN B ND2 1 
ATOM   4272 N N   . VAL B 1 135 ? -3.202  56.233 22.788  1.00 37.86  ? 135 VAL B N   1 
ATOM   4273 C CA  . VAL B 1 135 ? -2.591  55.124 23.539  1.00 36.38  ? 135 VAL B CA  1 
ATOM   4274 C C   . VAL B 1 135 ? -1.208  55.522 24.047  1.00 40.39  ? 135 VAL B C   1 
ATOM   4275 O O   . VAL B 1 135 ? -0.471  56.220 23.344  1.00 42.26  ? 135 VAL B O   1 
ATOM   4276 C CB  . VAL B 1 135 ? -2.622  53.717 22.854  1.00 39.05  ? 135 VAL B CB  1 
ATOM   4277 C CG1 . VAL B 1 135 ? -4.042  53.258 22.564  1.00 38.99  ? 135 VAL B CG1 1 
ATOM   4278 C CG2 . VAL B 1 135 ? -1.788  53.674 21.587  1.00 38.91  ? 135 VAL B CG2 1 
ATOM   4279 N N   . LEU B 1 136 ? -0.877  55.105 25.276  1.00 34.00  ? 136 LEU B N   1 
ATOM   4280 C CA  . LEU B 1 136 ? 0.395   55.418 25.924  1.00 32.80  ? 136 LEU B CA  1 
ATOM   4281 C C   . LEU B 1 136 ? 1.333   54.255 25.842  1.00 35.90  ? 136 LEU B C   1 
ATOM   4282 O O   . LEU B 1 136 ? 0.965   53.112 26.144  1.00 34.58  ? 136 LEU B O   1 
ATOM   4283 C CB  . LEU B 1 136 ? 0.196   55.853 27.385  1.00 33.12  ? 136 LEU B CB  1 
ATOM   4284 C CG  . LEU B 1 136 ? -0.589  57.129 27.617  1.00 38.11  ? 136 LEU B CG  1 
ATOM   4285 C CD1 . LEU B 1 136 ? -1.137  57.161 29.006  1.00 38.72  ? 136 LEU B CD1 1 
ATOM   4286 C CD2 . LEU B 1 136 ? 0.259   58.357 27.346  1.00 39.56  ? 136 LEU B CD2 1 
ATOM   4287 N N   . LEU B 1 137 ? 2.570   54.550 25.445  1.00 33.72  ? 137 LEU B N   1 
ATOM   4288 C CA  . LEU B 1 137 ? 3.619   53.556 25.202  1.00 32.56  ? 137 LEU B CA  1 
ATOM   4289 C C   . LEU B 1 137 ? 4.990   54.220 25.369  1.00 38.62  ? 137 LEU B C   1 
ATOM   4290 O O   . LEU B 1 137 ? 5.103   55.452 25.291  1.00 38.74  ? 137 LEU B O   1 
ATOM   4291 C CB  . LEU B 1 137 ? 3.412   53.086 23.744  1.00 32.09  ? 137 LEU B CB  1 
ATOM   4292 C CG  . LEU B 1 137 ? 4.227   51.975 23.193  1.00 36.38  ? 137 LEU B CG  1 
ATOM   4293 C CD1 . LEU B 1 137 ? 3.344   50.916 22.571  1.00 36.59  ? 137 LEU B CD1 1 
ATOM   4294 C CD2 . LEU B 1 137 ? 5.189   52.502 22.184  1.00 39.05  ? 137 LEU B CD2 1 
ATOM   4295 N N   . ASP B 1 138 ? 6.029   53.406 25.599  1.00 36.76  ? 138 ASP B N   1 
ATOM   4296 C CA  . ASP B 1 138 ? 7.407   53.885 25.726  1.00 37.77  ? 138 ASP B CA  1 
ATOM   4297 C C   . ASP B 1 138 ? 8.292   53.398 24.572  1.00 41.84  ? 138 ASP B C   1 
ATOM   4298 O O   . ASP B 1 138 ? 8.405   52.193 24.357  1.00 41.77  ? 138 ASP B O   1 
ATOM   4299 C CB  . ASP B 1 138 ? 8.005   53.523 27.106  1.00 40.45  ? 138 ASP B CB  1 
ATOM   4300 C CG  . ASP B 1 138 ? 7.869   52.062 27.519  1.00 61.65  ? 138 ASP B CG  1 
ATOM   4301 O OD1 . ASP B 1 138 ? 6.713   51.569 27.615  1.00 64.80  ? 138 ASP B OD1 1 
ATOM   4302 O OD2 . ASP B 1 138 ? 8.911   51.422 27.785  1.00 69.69  ? 138 ASP B OD2 1 
ATOM   4303 N N   . GLU B 1 139 ? 8.872   54.336 23.801  1.00 39.32  ? 139 GLU B N   1 
ATOM   4304 C CA  . GLU B 1 139 ? 9.787   54.033 22.704  1.00 39.48  ? 139 GLU B CA  1 
ATOM   4305 C C   . GLU B 1 139 ? 11.205  54.034 23.301  1.00 45.26  ? 139 GLU B C   1 
ATOM   4306 O O   . GLU B 1 139 ? 11.520  54.934 24.099  1.00 45.33  ? 139 GLU B O   1 
ATOM   4307 C CB  . GLU B 1 139 ? 9.717   55.086 21.592  1.00 41.69  ? 139 GLU B CB  1 
ATOM   4308 C CG  . GLU B 1 139 ? 8.537   54.958 20.647  1.00 54.38  ? 139 GLU B CG  1 
ATOM   4309 C CD  . GLU B 1 139 ? 8.532   56.014 19.554  1.00 80.93  ? 139 GLU B CD  1 
ATOM   4310 O OE1 . GLU B 1 139 ? 8.618   55.637 18.363  1.00 71.21  ? 139 GLU B OE1 1 
ATOM   4311 O OE2 . GLU B 1 139 ? 8.474   57.220 19.887  1.00 81.33  ? 139 GLU B OE2 1 
ATOM   4312 N N   . PRO B 1 140 ? 12.079  53.054 22.942  1.00 41.16  ? 140 PRO B N   1 
ATOM   4313 C CA  . PRO B 1 140 ? 11.838  51.931 22.018  1.00 39.62  ? 140 PRO B CA  1 
ATOM   4314 C C   . PRO B 1 140 ? 10.995  50.811 22.623  1.00 39.45  ? 140 PRO B C   1 
ATOM   4315 O O   . PRO B 1 140 ? 11.065  50.534 23.826  1.00 36.16  ? 140 PRO B O   1 
ATOM   4316 C CB  . PRO B 1 140 ? 13.250  51.519 21.599  1.00 42.02  ? 140 PRO B CB  1 
ATOM   4317 C CG  . PRO B 1 140 ? 14.120  51.880 22.771  1.00 46.49  ? 140 PRO B CG  1 
ATOM   4318 C CD  . PRO B 1 140 ? 13.450  53.021 23.496  1.00 42.44  ? 140 PRO B CD  1 
ATOM   4319 N N   . ALA B 1 141 ? 10.167  50.200 21.772  1.00 37.18  ? 141 ALA B N   1 
ATOM   4320 C CA  . ALA B 1 141 ? 9.219   49.144 22.132  1.00 36.96  ? 141 ALA B CA  1 
ATOM   4321 C C   . ALA B 1 141 ? 9.330   47.902 21.239  1.00 43.23  ? 141 ALA B C   1 
ATOM   4322 O O   . ALA B 1 141 ? 9.964   47.959 20.180  1.00 42.25  ? 141 ALA B O   1 
ATOM   4323 C CB  . ALA B 1 141 ? 7.811   49.692 22.061  1.00 37.47  ? 141 ALA B CB  1 
ATOM   4324 N N   . TYR B 1 142 ? 8.709   46.775 21.677  1.00 41.84  ? 142 TYR B N   1 
ATOM   4325 C CA  . TYR B 1 142 ? 8.675   45.509 20.932  1.00 42.38  ? 142 TYR B CA  1 
ATOM   4326 C C   . TYR B 1 142 ? 8.008   45.754 19.583  1.00 46.05  ? 142 TYR B C   1 
ATOM   4327 O O   . TYR B 1 142 ? 6.881   46.250 19.549  1.00 47.30  ? 142 TYR B O   1 
ATOM   4328 C CB  . TYR B 1 142 ? 7.975   44.394 21.754  1.00 43.55  ? 142 TYR B CB  1 
ATOM   4329 C CG  . TYR B 1 142 ? 7.607   43.136 20.988  1.00 46.26  ? 142 TYR B CG  1 
ATOM   4330 C CD1 . TYR B 1 142 ? 6.324   42.614 21.050  1.00 48.27  ? 142 TYR B CD1 1 
ATOM   4331 C CD2 . TYR B 1 142 ? 8.561   42.436 20.247  1.00 47.29  ? 142 TYR B CD2 1 
ATOM   4332 C CE1 . TYR B 1 142 ? 5.987   41.445 20.375  1.00 48.69  ? 142 TYR B CE1 1 
ATOM   4333 C CE2 . TYR B 1 142 ? 8.231   41.272 19.556  1.00 47.65  ? 142 TYR B CE2 1 
ATOM   4334 C CZ  . TYR B 1 142 ? 6.941   40.782 19.623  1.00 53.79  ? 142 TYR B CZ  1 
ATOM   4335 O OH  . TYR B 1 142 ? 6.608   39.642 18.943  1.00 54.34  ? 142 TYR B OH  1 
ATOM   4336 N N   . SER B 1 143 ? 8.727   45.465 18.480  1.00 40.44  ? 143 SER B N   1 
ATOM   4337 C CA  . SER B 1 143 ? 8.269   45.660 17.094  1.00 39.63  ? 143 SER B CA  1 
ATOM   4338 C C   . SER B 1 143 ? 6.937   44.985 16.775  1.00 39.66  ? 143 SER B C   1 
ATOM   4339 O O   . SER B 1 143 ? 6.155   45.537 15.995  1.00 38.82  ? 143 SER B O   1 
ATOM   4340 C CB  . SER B 1 143 ? 9.326   45.215 16.095  1.00 43.88  ? 143 SER B CB  1 
ATOM   4341 O OG  . SER B 1 143 ? 9.592   43.828 16.198  1.00 56.23  ? 143 SER B OG  1 
ATOM   4342 N N   . GLY B 1 144 ? 6.694   43.824 17.392  1.00 33.35  ? 144 GLY B N   1 
ATOM   4343 C CA  . GLY B 1 144 ? 5.453   43.078 17.251  1.00 32.68  ? 144 GLY B CA  1 
ATOM   4344 C C   . GLY B 1 144 ? 4.242   43.883 17.693  1.00 36.46  ? 144 GLY B C   1 
ATOM   4345 O O   . GLY B 1 144 ? 3.196   43.821 17.043  1.00 36.12  ? 144 GLY B O   1 
ATOM   4346 N N   . THR B 1 145 ? 4.385   44.694 18.770  1.00 32.38  ? 145 THR B N   1 
ATOM   4347 C CA  . THR B 1 145 ? 3.263   45.510 19.225  1.00 32.21  ? 145 THR B CA  1 
ATOM   4348 C C   . THR B 1 145 ? 3.058   46.712 18.348  1.00 36.92  ? 145 THR B C   1 
ATOM   4349 O O   . THR B 1 145 ? 1.911   47.071 18.061  1.00 36.57  ? 145 THR B O   1 
ATOM   4350 C CB  . THR B 1 145 ? 3.170   45.706 20.760  1.00 36.04  ? 145 THR B CB  1 
ATOM   4351 O OG1 . THR B 1 145 ? 3.023   47.086 21.108  1.00 37.92  ? 145 THR B OG1 1 
ATOM   4352 C CG2 . THR B 1 145 ? 4.294   45.098 21.493  1.00 31.81  ? 145 THR B CG2 1 
ATOM   4353 N N   . LEU B 1 146 ? 4.171   47.299 17.862  1.00 33.05  ? 146 LEU B N   1 
ATOM   4354 C CA  . LEU B 1 146 ? 4.125   48.471 16.974  1.00 32.12  ? 146 LEU B CA  1 
ATOM   4355 C C   . LEU B 1 146 ? 3.493   48.088 15.645  1.00 34.42  ? 146 LEU B C   1 
ATOM   4356 O O   . LEU B 1 146 ? 2.633   48.809 15.146  1.00 32.73  ? 146 LEU B O   1 
ATOM   4357 C CB  . LEU B 1 146 ? 5.515   49.048 16.764  1.00 31.78  ? 146 LEU B CB  1 
ATOM   4358 C CG  . LEU B 1 146 ? 6.286   49.465 17.997  1.00 34.42  ? 146 LEU B CG  1 
ATOM   4359 C CD1 . LEU B 1 146 ? 7.712   49.679 17.630  1.00 34.67  ? 146 LEU B CD1 1 
ATOM   4360 C CD2 . LEU B 1 146 ? 5.704   50.746 18.640  1.00 33.95  ? 146 LEU B CD2 1 
ATOM   4361 N N   . GLN B 1 147 ? 3.856   46.900 15.131  1.00 32.39  ? 147 GLN B N   1 
ATOM   4362 C CA  . GLN B 1 147 ? 3.325   46.360 13.886  1.00 33.71  ? 147 GLN B CA  1 
ATOM   4363 C C   . GLN B 1 147 ? 1.847   46.005 13.988  1.00 37.48  ? 147 GLN B C   1 
ATOM   4364 O O   . GLN B 1 147 ? 1.141   46.058 12.980  1.00 35.88  ? 147 GLN B O   1 
ATOM   4365 C CB  . GLN B 1 147 ? 4.181   45.195 13.376  1.00 35.42  ? 147 GLN B CB  1 
ATOM   4366 C CG  . GLN B 1 147 ? 5.517   45.655 12.738  1.00 57.20  ? 147 GLN B CG  1 
ATOM   4367 C CD  . GLN B 1 147 ? 5.347   46.618 11.566  1.00 82.24  ? 147 GLN B CD  1 
ATOM   4368 O OE1 . GLN B 1 147 ? 5.690   47.802 11.651  1.00 75.31  ? 147 GLN B OE1 1 
ATOM   4369 N NE2 . GLN B 1 147 ? 4.715   46.170 10.483  1.00 79.35  ? 147 GLN B NE2 1 
ATOM   4370 N N   . SER B 1 148 ? 1.386   45.697 15.223  1.00 34.79  ? 148 SER B N   1 
ATOM   4371 C CA  . SER B 1 148 ? -0.001  45.395 15.561  1.00 34.05  ? 148 SER B CA  1 
ATOM   4372 C C   . SER B 1 148 ? -0.814  46.681 15.638  1.00 38.30  ? 148 SER B C   1 
ATOM   4373 O O   . SER B 1 148 ? -1.919  46.722 15.094  1.00 39.21  ? 148 SER B O   1 
ATOM   4374 C CB  . SER B 1 148 ? -0.074  44.668 16.903  1.00 36.20  ? 148 SER B CB  1 
ATOM   4375 O OG  . SER B 1 148 ? 0.040   43.262 16.747  1.00 44.26  ? 148 SER B OG  1 
ATOM   4376 N N   . LEU B 1 149 ? -0.278  47.725 16.320  1.00 33.18  ? 149 LEU B N   1 
ATOM   4377 C CA  . LEU B 1 149 ? -0.982  48.991 16.525  1.00 33.21  ? 149 LEU B CA  1 
ATOM   4378 C C   . LEU B 1 149 ? -1.109  49.882 15.298  1.00 41.59  ? 149 LEU B C   1 
ATOM   4379 O O   . LEU B 1 149 ? -2.142  50.528 15.135  1.00 41.70  ? 149 LEU B O   1 
ATOM   4380 C CB  . LEU B 1 149 ? -0.429  49.783 17.732  1.00 32.38  ? 149 LEU B CB  1 
ATOM   4381 C CG  . LEU B 1 149 ? -0.426  49.087 19.108  1.00 34.33  ? 149 LEU B CG  1 
ATOM   4382 C CD1 . LEU B 1 149 ? 0.183   49.969 20.168  1.00 33.56  ? 149 LEU B CD1 1 
ATOM   4383 C CD2 . LEU B 1 149 ? -1.792  48.681 19.539  1.00 33.90  ? 149 LEU B CD2 1 
ATOM   4384 N N   . HIS B 1 150 ? -0.068  49.927 14.449  1.00 41.73  ? 150 HIS B N   1 
ATOM   4385 C CA  . HIS B 1 150 ? -0.004  50.755 13.239  1.00 43.66  ? 150 HIS B CA  1 
ATOM   4386 C C   . HIS B 1 150 ? -1.251  50.677 12.320  1.00 44.36  ? 150 HIS B C   1 
ATOM   4387 O O   . HIS B 1 150 ? -1.794  51.736 11.997  1.00 44.61  ? 150 HIS B O   1 
ATOM   4388 C CB  . HIS B 1 150 ? 1.318   50.528 12.479  1.00 46.50  ? 150 HIS B CB  1 
ATOM   4389 C CG  . HIS B 1 150 ? 1.365   51.192 11.135  1.00 52.44  ? 150 HIS B CG  1 
ATOM   4390 N ND1 . HIS B 1 150 ? 1.334   50.447 9.962   1.00 55.13  ? 150 HIS B ND1 1 
ATOM   4391 C CD2 . HIS B 1 150 ? 1.399   52.513 10.819  1.00 55.75  ? 150 HIS B CD2 1 
ATOM   4392 C CE1 . HIS B 1 150 ? 1.373   51.332 8.977   1.00 55.97  ? 150 HIS B CE1 1 
ATOM   4393 N NE2 . HIS B 1 150 ? 1.400   52.589 9.442   1.00 56.67  ? 150 HIS B NE2 1 
ATOM   4394 N N   . PRO B 1 151 ? -1.771  49.485 11.932  1.00 38.41  ? 151 PRO B N   1 
ATOM   4395 C CA  . PRO B 1 151 ? -2.970  49.455 11.072  1.00 38.65  ? 151 PRO B CA  1 
ATOM   4396 C C   . PRO B 1 151 ? -4.281  49.892 11.753  1.00 40.78  ? 151 PRO B C   1 
ATOM   4397 O O   . PRO B 1 151 ? -5.277  50.148 11.067  1.00 38.71  ? 151 PRO B O   1 
ATOM   4398 C CB  . PRO B 1 151 ? -3.050  47.985 10.645  1.00 39.72  ? 151 PRO B CB  1 
ATOM   4399 C CG  . PRO B 1 151 ? -1.739  47.396 11.005  1.00 42.73  ? 151 PRO B CG  1 
ATOM   4400 C CD  . PRO B 1 151 ? -1.305  48.116 12.198  1.00 37.95  ? 151 PRO B CD  1 
ATOM   4401 N N   . LEU B 1 152 ? -4.281  49.954 13.101  1.00 37.34  ? 152 LEU B N   1 
ATOM   4402 C CA  . LEU B 1 152 ? -5.444  50.309 13.918  1.00 36.57  ? 152 LEU B CA  1 
ATOM   4403 C C   . LEU B 1 152 ? -5.738  51.804 13.963  1.00 39.71  ? 152 LEU B C   1 
ATOM   4404 O O   . LEU B 1 152 ? -6.775  52.188 14.505  1.00 40.70  ? 152 LEU B O   1 
ATOM   4405 C CB  . LEU B 1 152 ? -5.355  49.714 15.339  1.00 35.33  ? 152 LEU B CB  1 
ATOM   4406 C CG  . LEU B 1 152 ? -5.389  48.188 15.453  1.00 38.34  ? 152 LEU B CG  1 
ATOM   4407 C CD1 . LEU B 1 152 ? -4.770  47.745 16.757  1.00 40.79  ? 152 LEU B CD1 1 
ATOM   4408 C CD2 . LEU B 1 152 ? -6.794  47.641 15.358  1.00 37.55  ? 152 LEU B CD2 1 
ATOM   4409 N N   . GLY B 1 153 ? -4.866  52.617 13.366  1.00 33.57  ? 153 GLY B N   1 
ATOM   4410 C CA  . GLY B 1 153 ? -5.042  54.061 13.271  1.00 34.21  ? 153 GLY B CA  1 
ATOM   4411 C C   . GLY B 1 153 ? -5.226  54.781 14.590  1.00 38.92  ? 153 GLY B C   1 
ATOM   4412 O O   . GLY B 1 153 ? -6.123  55.617 14.726  1.00 41.53  ? 153 GLY B O   1 
ATOM   4413 N N   . CYS B 1 154 ? -4.403  54.443 15.568  1.00 34.01  ? 154 CYS B N   1 
ATOM   4414 C CA  . CYS B 1 154 ? -4.429  55.048 16.885  1.00 34.70  ? 154 CYS B CA  1 
ATOM   4415 C C   . CYS B 1 154 ? -3.229  55.970 17.021  1.00 42.29  ? 154 CYS B C   1 
ATOM   4416 O O   . CYS B 1 154 ? -2.243  55.793 16.299  1.00 43.24  ? 154 CYS B O   1 
ATOM   4417 C CB  . CYS B 1 154 ? -4.439  53.975 17.972  1.00 34.27  ? 154 CYS B CB  1 
ATOM   4418 S SG  . CYS B 1 154 ? -2.973  52.897 17.989  1.00 37.30  ? 154 CYS B SG  1 
ATOM   4419 N N   . ASN B 1 155 ? -3.296  56.944 17.948  1.00 39.69  ? 155 ASN B N   1 
ATOM   4420 C CA  . ASN B 1 155 ? -2.199  57.876 18.187  1.00 39.15  ? 155 ASN B CA  1 
ATOM   4421 C C   . ASN B 1 155 ? -1.340  57.364 19.331  1.00 41.90  ? 155 ASN B C   1 
ATOM   4422 O O   . ASN B 1 155 ? -1.815  57.281 20.469  1.00 41.11  ? 155 ASN B O   1 
ATOM   4423 C CB  . ASN B 1 155 ? -2.714  59.296 18.476  1.00 39.49  ? 155 ASN B CB  1 
ATOM   4424 C CG  . ASN B 1 155 ? -3.573  59.872 17.382  1.00 70.26  ? 155 ASN B CG  1 
ATOM   4425 O OD1 . ASN B 1 155 ? -3.139  60.035 16.235  1.00 68.99  ? 155 ASN B OD1 1 
ATOM   4426 N ND2 . ASN B 1 155 ? -4.811  60.209 17.718  1.00 62.03  ? 155 ASN B ND2 1 
ATOM   4427 N N   . ILE B 1 156 ? -0.085  56.978 19.019  1.00 38.36  ? 156 ILE B N   1 
ATOM   4428 C CA  . ILE B 1 156 ? 0.864   56.504 20.025  1.00 37.46  ? 156 ILE B CA  1 
ATOM   4429 C C   . ILE B 1 156 ? 1.628   57.713 20.575  1.00 41.12  ? 156 ILE B C   1 
ATOM   4430 O O   . ILE B 1 156 ? 2.350   58.377 19.838  1.00 39.35  ? 156 ILE B O   1 
ATOM   4431 C CB  . ILE B 1 156 ? 1.805   55.373 19.523  1.00 39.82  ? 156 ILE B CB  1 
ATOM   4432 C CG1 . ILE B 1 156 ? 1.029   54.091 19.152  1.00 38.91  ? 156 ILE B CG1 1 
ATOM   4433 C CG2 . ILE B 1 156 ? 2.885   55.075 20.561  1.00 40.58  ? 156 ILE B CG2 1 
ATOM   4434 C CD1 . ILE B 1 156 ? 1.748   53.139 18.236  1.00 38.70  ? 156 ILE B CD1 1 
ATOM   4435 N N   . ILE B 1 157 ? 1.437   57.992 21.878  1.00 39.45  ? 157 ILE B N   1 
ATOM   4436 C CA  . ILE B 1 157 ? 2.078   59.071 22.627  1.00 39.67  ? 157 ILE B CA  1 
ATOM   4437 C C   . ILE B 1 157 ? 3.252   58.445 23.378  1.00 44.00  ? 157 ILE B C   1 
ATOM   4438 O O   . ILE B 1 157 ? 3.045   57.596 24.251  1.00 42.98  ? 157 ILE B O   1 
ATOM   4439 C CB  . ILE B 1 157 ? 1.071   59.772 23.583  1.00 43.12  ? 157 ILE B CB  1 
ATOM   4440 C CG1 . ILE B 1 157 ? -0.254  60.152 22.858  1.00 44.51  ? 157 ILE B CG1 1 
ATOM   4441 C CG2 . ILE B 1 157 ? 1.723   61.000 24.238  1.00 43.73  ? 157 ILE B CG2 1 
ATOM   4442 C CD1 . ILE B 1 157 ? -1.476  60.470 23.765  1.00 51.58  ? 157 ILE B CD1 1 
ATOM   4443 N N   . ASN B 1 158 ? 4.481   58.826 23.010  1.00 42.19  ? 158 ASN B N   1 
ATOM   4444 C CA  . ASN B 1 158 ? 5.681   58.275 23.646  1.00 42.37  ? 158 ASN B CA  1 
ATOM   4445 C C   . ASN B 1 158 ? 5.962   58.848 25.039  1.00 47.00  ? 158 ASN B C   1 
ATOM   4446 O O   . ASN B 1 158 ? 5.943   60.063 25.220  1.00 48.27  ? 158 ASN B O   1 
ATOM   4447 C CB  . ASN B 1 158 ? 6.906   58.359 22.717  1.00 43.39  ? 158 ASN B CB  1 
ATOM   4448 C CG  . ASN B 1 158 ? 8.220   58.073 23.393  1.00 66.75  ? 158 ASN B CG  1 
ATOM   4449 O OD1 . ASN B 1 158 ? 8.453   57.001 23.959  1.00 65.49  ? 158 ASN B OD1 1 
ATOM   4450 N ND2 . ASN B 1 158 ? 9.088   59.057 23.391  1.00 60.44  ? 158 ASN B ND2 1 
ATOM   4451 N N   . VAL B 1 159 ? 6.211   57.965 26.013  1.00 42.83  ? 159 VAL B N   1 
ATOM   4452 C CA  . VAL B 1 159 ? 6.522   58.322 27.399  1.00 43.69  ? 159 VAL B CA  1 
ATOM   4453 C C   . VAL B 1 159 ? 8.017   58.114 27.601  1.00 48.22  ? 159 VAL B C   1 
ATOM   4454 O O   . VAL B 1 159 ? 8.550   57.058 27.225  1.00 48.28  ? 159 VAL B O   1 
ATOM   4455 C CB  . VAL B 1 159 ? 5.686   57.489 28.414  1.00 48.26  ? 159 VAL B CB  1 
ATOM   4456 C CG1 . VAL B 1 159 ? 5.986   57.899 29.855  1.00 48.52  ? 159 VAL B CG1 1 
ATOM   4457 C CG2 . VAL B 1 159 ? 4.183   57.594 28.125  1.00 48.54  ? 159 VAL B CG2 1 
ATOM   4458 N N   . ALA B 1 160 ? 8.701   59.115 28.182  1.00 44.76  ? 160 ALA B N   1 
ATOM   4459 C CA  . ALA B 1 160 ? 10.139  59.027 28.422  1.00 44.25  ? 160 ALA B CA  1 
ATOM   4460 C C   . ALA B 1 160 ? 10.504  57.884 29.373  1.00 48.08  ? 160 ALA B C   1 
ATOM   4461 O O   . ALA B 1 160 ? 9.752   57.574 30.303  1.00 47.19  ? 160 ALA B O   1 
ATOM   4462 C CB  . ALA B 1 160 ? 10.672  60.345 28.947  1.00 45.86  ? 160 ALA B CB  1 
ATOM   4463 N N   . SER B 1 161 ? 11.642  57.230 29.094  1.00 44.92  ? 161 SER B N   1 
ATOM   4464 C CA  . SER B 1 161 ? 12.162  56.118 29.881  1.00 43.82  ? 161 SER B CA  1 
ATOM   4465 C C   . SER B 1 161 ? 13.686  56.199 30.087  1.00 46.65  ? 161 SER B C   1 
ATOM   4466 O O   . SER B 1 161 ? 14.386  56.898 29.343  1.00 46.91  ? 161 SER B O   1 
ATOM   4467 C CB  . SER B 1 161 ? 11.770  54.787 29.248  1.00 46.57  ? 161 SER B CB  1 
ATOM   4468 O OG  . SER B 1 161 ? 12.335  54.639 27.955  1.00 57.68  ? 161 SER B OG  1 
ATOM   4469 N N   . ASP B 1 162 ? 14.184  55.478 31.109  1.00 40.96  ? 162 ASP B N   1 
ATOM   4470 C CA  . ASP B 1 162 ? 15.597  55.385 31.454  1.00 40.00  ? 162 ASP B CA  1 
ATOM   4471 C C   . ASP B 1 162 ? 15.941  53.937 31.895  1.00 41.85  ? 162 ASP B C   1 
ATOM   4472 O O   . ASP B 1 162 ? 15.165  53.032 31.601  1.00 41.46  ? 162 ASP B O   1 
ATOM   4473 C CB  . ASP B 1 162 ? 15.952  56.448 32.515  1.00 42.34  ? 162 ASP B CB  1 
ATOM   4474 C CG  . ASP B 1 162 ? 15.289  56.292 33.874  1.00 49.80  ? 162 ASP B CG  1 
ATOM   4475 O OD1 . ASP B 1 162 ? 14.303  55.528 33.976  1.00 48.31  ? 162 ASP B OD1 1 
ATOM   4476 O OD2 . ASP B 1 162 ? 15.747  56.944 34.830  1.00 56.18  ? 162 ASP B OD2 1 
ATOM   4477 N N   . GLU B 1 163 ? 17.082  53.724 32.585  1.00 38.29  ? 163 GLU B N   1 
ATOM   4478 C CA  . GLU B 1 163 ? 17.559  52.420 33.083  1.00 38.86  ? 163 GLU B CA  1 
ATOM   4479 C C   . GLU B 1 163 ? 16.536  51.702 33.984  1.00 43.61  ? 163 GLU B C   1 
ATOM   4480 O O   . GLU B 1 163 ? 16.578  50.472 34.087  1.00 44.71  ? 163 GLU B O   1 
ATOM   4481 C CB  . GLU B 1 163 ? 18.893  52.534 33.861  1.00 41.29  ? 163 GLU B CB  1 
ATOM   4482 C CG  . GLU B 1 163 ? 19.748  53.766 33.591  1.00 55.65  ? 163 GLU B CG  1 
ATOM   4483 C CD  . GLU B 1 163 ? 19.402  55.028 34.362  1.00 79.82  ? 163 GLU B CD  1 
ATOM   4484 O OE1 . GLU B 1 163 ? 19.198  56.080 33.711  1.00 60.26  ? 163 GLU B OE1 1 
ATOM   4485 O OE2 . GLU B 1 163 ? 19.356  54.973 35.614  1.00 83.50  ? 163 GLU B OE2 1 
ATOM   4486 N N   . SER B 1 164 ? 15.640  52.467 34.646  1.00 37.97  ? 164 SER B N   1 
ATOM   4487 C CA  . SER B 1 164 ? 14.611  51.940 35.543  1.00 36.21  ? 164 SER B CA  1 
ATOM   4488 C C   . SER B 1 164 ? 13.221  51.932 34.875  1.00 37.29  ? 164 SER B C   1 
ATOM   4489 O O   . SER B 1 164 ? 12.194  51.944 35.566  1.00 36.19  ? 164 SER B O   1 
ATOM   4490 C CB  . SER B 1 164 ? 14.604  52.729 36.847  1.00 40.27  ? 164 SER B CB  1 
ATOM   4491 O OG  . SER B 1 164 ? 15.926  52.855 37.343  1.00 48.69  ? 164 SER B OG  1 
ATOM   4492 N N   . GLY B 1 165 ? 13.223  51.883 33.536  1.00 32.30  ? 165 GLY B N   1 
ATOM   4493 C CA  . GLY B 1 165 ? 12.029  51.882 32.701  1.00 31.51  ? 165 GLY B CA  1 
ATOM   4494 C C   . GLY B 1 165 ? 11.314  53.220 32.614  1.00 37.39  ? 165 GLY B C   1 
ATOM   4495 O O   . GLY B 1 165 ? 11.947  54.278 32.685  1.00 38.42  ? 165 GLY B O   1 
ATOM   4496 N N   . ILE B 1 166 ? 9.971   53.176 32.451  1.00 33.72  ? 166 ILE B N   1 
ATOM   4497 C CA  . ILE B 1 166 ? 9.079   54.329 32.362  1.00 33.61  ? 166 ILE B CA  1 
ATOM   4498 C C   . ILE B 1 166 ? 9.375   55.299 33.502  1.00 39.62  ? 166 ILE B C   1 
ATOM   4499 O O   . ILE B 1 166 ? 9.563   54.871 34.650  1.00 38.65  ? 166 ILE B O   1 
ATOM   4500 C CB  . ILE B 1 166 ? 7.587   53.856 32.349  1.00 36.23  ? 166 ILE B CB  1 
ATOM   4501 C CG1 . ILE B 1 166 ? 7.172   53.403 30.937  1.00 35.64  ? 166 ILE B CG1 1 
ATOM   4502 C CG2 . ILE B 1 166 ? 6.599   54.929 32.901  1.00 38.08  ? 166 ILE B CG2 1 
ATOM   4503 C CD1 . ILE B 1 166 ? 5.879   52.621 30.861  1.00 38.18  ? 166 ILE B CD1 1 
ATOM   4504 N N   . VAL B 1 167 ? 9.451   56.597 33.168  1.00 37.81  ? 167 VAL B N   1 
ATOM   4505 C CA  . VAL B 1 167 ? 9.694   57.664 34.137  1.00 38.61  ? 167 VAL B CA  1 
ATOM   4506 C C   . VAL B 1 167 ? 8.311   58.216 34.531  1.00 46.25  ? 167 VAL B C   1 
ATOM   4507 O O   . VAL B 1 167 ? 7.620   58.763 33.666  1.00 48.53  ? 167 VAL B O   1 
ATOM   4508 C CB  . VAL B 1 167 ? 10.639  58.763 33.579  1.00 41.46  ? 167 VAL B CB  1 
ATOM   4509 C CG1 . VAL B 1 167 ? 10.874  59.861 34.614  1.00 41.65  ? 167 VAL B CG1 1 
ATOM   4510 C CG2 . VAL B 1 167 ? 11.961  58.164 33.102  1.00 40.58  ? 167 VAL B CG2 1 
ATOM   4511 N N   . PRO B 1 168 ? 7.885   58.075 35.808  1.00 42.08  ? 168 PRO B N   1 
ATOM   4512 C CA  . PRO B 1 168 ? 6.543   58.560 36.201  1.00 42.19  ? 168 PRO B CA  1 
ATOM   4513 C C   . PRO B 1 168 ? 6.252   60.046 35.989  1.00 47.05  ? 168 PRO B C   1 
ATOM   4514 O O   . PRO B 1 168 ? 5.102   60.392 35.705  1.00 47.01  ? 168 PRO B O   1 
ATOM   4515 C CB  . PRO B 1 168 ? 6.426   58.153 37.670  1.00 44.37  ? 168 PRO B CB  1 
ATOM   4516 C CG  . PRO B 1 168 ? 7.426   57.052 37.840  1.00 48.41  ? 168 PRO B CG  1 
ATOM   4517 C CD  . PRO B 1 168 ? 8.567   57.416 36.936  1.00 43.63  ? 168 PRO B CD  1 
ATOM   4518 N N   . ASP B 1 169 ? 7.272   60.919 36.104  1.00 44.58  ? 169 ASP B N   1 
ATOM   4519 C CA  . ASP B 1 169 ? 7.095   62.360 35.889  1.00 45.54  ? 169 ASP B CA  1 
ATOM   4520 C C   . ASP B 1 169 ? 6.789   62.721 34.433  1.00 47.35  ? 169 ASP B C   1 
ATOM   4521 O O   . ASP B 1 169 ? 6.053   63.677 34.189  1.00 47.09  ? 169 ASP B O   1 
ATOM   4522 C CB  . ASP B 1 169 ? 8.264   63.169 36.451  1.00 48.61  ? 169 ASP B CB  1 
ATOM   4523 C CG  . ASP B 1 169 ? 8.168   63.358 37.951  1.00 67.60  ? 169 ASP B CG  1 
ATOM   4524 O OD1 . ASP B 1 169 ? 7.374   64.226 38.393  1.00 70.36  ? 169 ASP B OD1 1 
ATOM   4525 O OD2 . ASP B 1 169 ? 8.866   62.624 38.687  1.00 76.31  ? 169 ASP B OD2 1 
ATOM   4526 N N   . SER B 1 170 ? 7.314   61.935 33.475  1.00 42.47  ? 170 SER B N   1 
ATOM   4527 C CA  . SER B 1 170 ? 7.042   62.117 32.043  1.00 42.01  ? 170 SER B CA  1 
ATOM   4528 C C   . SER B 1 170 ? 5.562   61.845 31.785  1.00 43.64  ? 170 SER B C   1 
ATOM   4529 O O   . SER B 1 170 ? 4.901   62.640 31.127  1.00 43.15  ? 170 SER B O   1 
ATOM   4530 C CB  . SER B 1 170 ? 7.896   61.163 31.208  1.00 45.47  ? 170 SER B CB  1 
ATOM   4531 O OG  . SER B 1 170 ? 7.642   61.321 29.819  1.00 55.00  ? 170 SER B OG  1 
ATOM   4532 N N   . LEU B 1 171 ? 5.048   60.731 32.352  1.00 39.41  ? 171 LEU B N   1 
ATOM   4533 C CA  . LEU B 1 171 ? 3.659   60.285 32.288  1.00 38.23  ? 171 LEU B CA  1 
ATOM   4534 C C   . LEU B 1 171 ? 2.750   61.336 32.932  1.00 45.10  ? 171 LEU B C   1 
ATOM   4535 O O   . LEU B 1 171 ? 1.689   61.627 32.386  1.00 45.65  ? 171 LEU B O   1 
ATOM   4536 C CB  . LEU B 1 171 ? 3.524   58.918 32.981  1.00 36.75  ? 171 LEU B CB  1 
ATOM   4537 C CG  . LEU B 1 171 ? 2.134   58.274 33.069  1.00 41.12  ? 171 LEU B CG  1 
ATOM   4538 C CD1 . LEU B 1 171 ? 1.603   57.863 31.700  1.00 40.23  ? 171 LEU B CD1 1 
ATOM   4539 C CD2 . LEU B 1 171 ? 2.169   57.054 33.972  1.00 43.73  ? 171 LEU B CD2 1 
ATOM   4540 N N   . ARG B 1 172 ? 3.195   61.947 34.050  1.00 43.15  ? 172 ARG B N   1 
ATOM   4541 C CA  . ARG B 1 172 ? 2.462   63.005 34.747  1.00 44.67  ? 172 ARG B CA  1 
ATOM   4542 C C   . ARG B 1 172 ? 2.316   64.239 33.832  1.00 51.76  ? 172 ARG B C   1 
ATOM   4543 O O   . ARG B 1 172 ? 1.210   64.740 33.653  1.00 51.44  ? 172 ARG B O   1 
ATOM   4544 C CB  . ARG B 1 172 ? 3.184   63.363 36.057  1.00 45.33  ? 172 ARG B CB  1 
ATOM   4545 C CG  . ARG B 1 172 ? 2.288   63.996 37.116  1.00 56.14  ? 172 ARG B CG  1 
ATOM   4546 C CD  . ARG B 1 172 ? 2.927   63.990 38.499  1.00 71.18  ? 172 ARG B CD  1 
ATOM   4547 N NE  . ARG B 1 172 ? 2.983   62.650 39.096  1.00 79.24  ? 172 ARG B NE  1 
ATOM   4548 C CZ  . ARG B 1 172 ? 4.101   62.053 39.507  1.00 86.44  ? 172 ARG B CZ  1 
ATOM   4549 N NH1 . ARG B 1 172 ? 5.271   62.674 39.404  1.00 75.51  ? 172 ARG B NH1 1 
ATOM   4550 N NH2 . ARG B 1 172 ? 4.055   60.840 40.039  1.00 59.37  ? 172 ARG B NH2 1 
ATOM   4551 N N   . ASP B 1 173 ? 3.432   64.674 33.217  1.00 51.45  ? 173 ASP B N   1 
ATOM   4552 C CA  . ASP B 1 173 ? 3.516   65.809 32.304  1.00 53.19  ? 173 ASP B CA  1 
ATOM   4553 C C   . ASP B 1 173 ? 2.619   65.594 31.083  1.00 56.91  ? 173 ASP B C   1 
ATOM   4554 O O   . ASP B 1 173 ? 1.896   66.512 30.692  1.00 58.71  ? 173 ASP B O   1 
ATOM   4555 C CB  . ASP B 1 173 ? 4.985   66.063 31.899  1.00 56.19  ? 173 ASP B CB  1 
ATOM   4556 C CG  . ASP B 1 173 ? 5.201   67.299 31.036  1.00 80.50  ? 173 ASP B CG  1 
ATOM   4557 O OD1 . ASP B 1 173 ? 5.528   68.374 31.604  1.00 84.87  ? 173 ASP B OD1 1 
ATOM   4558 O OD2 . ASP B 1 173 ? 5.047   67.194 29.788  1.00 88.36  ? 173 ASP B OD2 1 
ATOM   4559 N N   . ILE B 1 174 ? 2.643   64.384 30.504  1.00 51.26  ? 174 ILE B N   1 
ATOM   4560 C CA  . ILE B 1 174 ? 1.817   64.034 29.347  1.00 50.82  ? 174 ILE B CA  1 
ATOM   4561 C C   . ILE B 1 174 ? 0.317   64.119 29.708  1.00 54.71  ? 174 ILE B C   1 
ATOM   4562 O O   . ILE B 1 174 ? -0.412  64.888 29.075  1.00 55.46  ? 174 ILE B O   1 
ATOM   4563 C CB  . ILE B 1 174 ? 2.226   62.655 28.753  1.00 52.45  ? 174 ILE B CB  1 
ATOM   4564 C CG1 . ILE B 1 174 ? 3.581   62.760 28.024  1.00 52.80  ? 174 ILE B CG1 1 
ATOM   4565 C CG2 . ILE B 1 174 ? 1.136   62.085 27.820  1.00 52.39  ? 174 ILE B CG2 1 
ATOM   4566 C CD1 . ILE B 1 174 ? 4.398   61.441 27.990  1.00 61.02  ? 174 ILE B CD1 1 
ATOM   4567 N N   . LEU B 1 175 ? -0.108  63.379 30.762  1.00 49.03  ? 175 LEU B N   1 
ATOM   4568 C CA  . LEU B 1 175 ? -1.488  63.306 31.253  1.00 48.25  ? 175 LEU B CA  1 
ATOM   4569 C C   . LEU B 1 175 ? -2.119  64.643 31.601  1.00 54.75  ? 175 LEU B C   1 
ATOM   4570 O O   . LEU B 1 175 ? -3.345  64.753 31.547  1.00 55.43  ? 175 LEU B O   1 
ATOM   4571 C CB  . LEU B 1 175 ? -1.604  62.340 32.448  1.00 47.09  ? 175 LEU B CB  1 
ATOM   4572 C CG  . LEU B 1 175 ? -1.543  60.833 32.139  1.00 49.55  ? 175 LEU B CG  1 
ATOM   4573 C CD1 . LEU B 1 175 ? -1.316  60.039 33.393  1.00 48.60  ? 175 LEU B CD1 1 
ATOM   4574 C CD2 . LEU B 1 175 ? -2.798  60.345 31.419  1.00 51.32  ? 175 LEU B CD2 1 
ATOM   4575 N N   . SER B 1 176 ? -1.296  65.664 31.930  1.00 52.19  ? 176 SER B N   1 
ATOM   4576 C CA  . SER B 1 176 ? -1.755  67.005 32.303  1.00 53.30  ? 176 SER B CA  1 
ATOM   4577 C C   . SER B 1 176 ? -2.543  67.732 31.194  1.00 56.58  ? 176 SER B C   1 
ATOM   4578 O O   . SER B 1 176 ? -3.242  68.711 31.492  1.00 57.91  ? 176 SER B O   1 
ATOM   4579 C CB  . SER B 1 176 ? -0.596  67.854 32.824  1.00 58.23  ? 176 SER B CB  1 
ATOM   4580 O OG  . SER B 1 176 ? 0.054   68.605 31.810  1.00 70.74  ? 176 SER B OG  1 
ATOM   4581 N N   . ARG B 1 177 ? -2.457  67.243 29.925  1.00 50.57  ? 177 ARG B N   1 
ATOM   4582 C CA  . ARG B 1 177 ? -3.183  67.853 28.807  1.00 50.69  ? 177 ARG B CA  1 
ATOM   4583 C C   . ARG B 1 177 ? -4.713  67.715 28.902  1.00 55.30  ? 177 ARG B C   1 
ATOM   4584 O O   . ARG B 1 177 ? -5.441  68.460 28.241  1.00 56.57  ? 177 ARG B O   1 
ATOM   4585 C CB  . ARG B 1 177 ? -2.587  67.487 27.438  1.00 49.00  ? 177 ARG B CB  1 
ATOM   4586 C CG  . ARG B 1 177 ? -3.049  66.182 26.843  1.00 59.31  ? 177 ARG B CG  1 
ATOM   4587 C CD  . ARG B 1 177 ? -2.445  65.929 25.477  1.00 78.38  ? 177 ARG B CD  1 
ATOM   4588 N NE  . ARG B 1 177 ? -1.044  65.507 25.538  1.00 89.76  ? 177 ARG B NE  1 
ATOM   4589 C CZ  . ARG B 1 177 ? -0.383  64.976 24.514  1.00 103.40 ? 177 ARG B CZ  1 
ATOM   4590 N NH1 . ARG B 1 177 ? -0.992  64.785 23.348  1.00 90.53  ? 177 ARG B NH1 1 
ATOM   4591 N NH2 . ARG B 1 177 ? 0.889   64.621 24.650  1.00 87.92  ? 177 ARG B NH2 1 
ATOM   4592 N N   . TRP B 1 178 ? -5.176  66.793 29.775  1.00 50.36  ? 178 TRP B N   1 
ATOM   4593 C CA  . TRP B 1 178 ? -6.567  66.525 30.122  1.00 50.21  ? 178 TRP B CA  1 
ATOM   4594 C C   . TRP B 1 178 ? -6.731  66.744 31.644  1.00 54.31  ? 178 TRP B C   1 
ATOM   4595 O O   . TRP B 1 178 ? -5.737  66.917 32.363  1.00 53.54  ? 178 TRP B O   1 
ATOM   4596 C CB  . TRP B 1 178 ? -6.946  65.064 29.799  1.00 47.81  ? 178 TRP B CB  1 
ATOM   4597 C CG  . TRP B 1 178 ? -6.726  64.627 28.384  1.00 48.42  ? 178 TRP B CG  1 
ATOM   4598 C CD1 . TRP B 1 178 ? -7.588  64.768 27.338  1.00 51.97  ? 178 TRP B CD1 1 
ATOM   4599 C CD2 . TRP B 1 178 ? -5.611  63.875 27.887  1.00 47.17  ? 178 TRP B CD2 1 
ATOM   4600 N NE1 . TRP B 1 178 ? -7.055  64.198 26.204  1.00 50.92  ? 178 TRP B NE1 1 
ATOM   4601 C CE2 . TRP B 1 178 ? -5.843  63.639 26.513  1.00 51.03  ? 178 TRP B CE2 1 
ATOM   4602 C CE3 . TRP B 1 178 ? -4.417  63.405 28.463  1.00 47.55  ? 178 TRP B CE3 1 
ATOM   4603 C CZ2 . TRP B 1 178 ? -4.927  62.964 25.706  1.00 49.43  ? 178 TRP B CZ2 1 
ATOM   4604 C CZ3 . TRP B 1 178 ? -3.506  62.745 27.660  1.00 48.18  ? 178 TRP B CZ3 1 
ATOM   4605 C CH2 . TRP B 1 178 ? -3.764  62.530 26.298  1.00 48.81  ? 178 TRP B CH2 1 
ATOM   4606 N N   . LYS B 1 179 ? -7.990  66.705 32.127  1.00 51.06  ? 179 LYS B N   1 
ATOM   4607 C CA  . LYS B 1 179 ? -8.361  66.816 33.542  1.00 51.36  ? 179 LYS B CA  1 
ATOM   4608 C C   . LYS B 1 179 ? -8.919  65.451 33.972  1.00 55.53  ? 179 LYS B C   1 
ATOM   4609 O O   . LYS B 1 179 ? -9.567  64.808 33.146  1.00 55.00  ? 179 LYS B O   1 
ATOM   4610 C CB  . LYS B 1 179 ? -9.448  67.902 33.755  1.00 55.29  ? 179 LYS B CB  1 
ATOM   4611 C CG  . LYS B 1 179 ? -9.066  69.326 33.327  1.00 68.02  ? 179 LYS B CG  1 
ATOM   4612 C CD  . LYS B 1 179 ? -8.219  70.062 34.366  1.00 80.16  ? 179 LYS B CD  1 
ATOM   4613 C CE  . LYS B 1 179 ? -7.725  71.387 33.831  1.00 96.76  ? 179 LYS B CE  1 
ATOM   4614 N NZ  . LYS B 1 179 ? -6.527  71.875 34.565  1.00 107.04 ? 179 LYS B NZ  1 
ATOM   4615 N N   . PRO B 1 180 ? -8.739  64.982 35.236  1.00 52.64  ? 180 PRO B N   1 
ATOM   4616 C CA  . PRO B 1 180 ? -9.316  63.673 35.627  1.00 51.81  ? 180 PRO B CA  1 
ATOM   4617 C C   . PRO B 1 180 ? -10.804 63.481 35.272  1.00 57.38  ? 180 PRO B C   1 
ATOM   4618 O O   . PRO B 1 180 ? -11.211 62.372 34.907  1.00 56.19  ? 180 PRO B O   1 
ATOM   4619 C CB  . PRO B 1 180 ? -9.074  63.618 37.139  1.00 53.63  ? 180 PRO B CB  1 
ATOM   4620 C CG  . PRO B 1 180 ? -7.884  64.469 37.352  1.00 58.27  ? 180 PRO B CG  1 
ATOM   4621 C CD  . PRO B 1 180 ? -7.995  65.592 36.357  1.00 54.53  ? 180 PRO B CD  1 
ATOM   4622 N N   . GLU B 1 181 ? -11.600 64.570 35.335  1.00 56.21  ? 181 GLU B N   1 
ATOM   4623 C CA  . GLU B 1 181 ? -13.030 64.586 34.996  1.00 57.48  ? 181 GLU B CA  1 
ATOM   4624 C C   . GLU B 1 181 ? -13.314 64.250 33.515  1.00 60.83  ? 181 GLU B C   1 
ATOM   4625 O O   . GLU B 1 181 ? -14.395 63.737 33.207  1.00 60.12  ? 181 GLU B O   1 
ATOM   4626 C CB  . GLU B 1 181 ? -13.694 65.926 35.397  1.00 61.08  ? 181 GLU B CB  1 
ATOM   4627 C CG  . GLU B 1 181 ? -13.009 67.178 34.861  1.00 76.76  ? 181 GLU B CG  1 
ATOM   4628 C CD  . GLU B 1 181 ? -13.892 68.408 34.740  1.00 110.31 ? 181 GLU B CD  1 
ATOM   4629 O OE1 . GLU B 1 181 ? -14.254 68.767 33.595  1.00 111.42 ? 181 GLU B OE1 1 
ATOM   4630 O OE2 . GLU B 1 181 ? -14.209 69.025 35.784  1.00 106.68 ? 181 GLU B OE2 1 
ATOM   4631 N N   . ASP B 1 182 ? -12.342 64.529 32.612  1.00 56.64  ? 182 ASP B N   1 
ATOM   4632 C CA  . ASP B 1 182 ? -12.454 64.277 31.172  1.00 55.95  ? 182 ASP B CA  1 
ATOM   4633 C C   . ASP B 1 182 ? -12.664 62.807 30.794  1.00 60.50  ? 182 ASP B C   1 
ATOM   4634 O O   . ASP B 1 182 ? -13.290 62.557 29.764  1.00 61.72  ? 182 ASP B O   1 
ATOM   4635 C CB  . ASP B 1 182 ? -11.260 64.853 30.401  1.00 57.09  ? 182 ASP B CB  1 
ATOM   4636 C CG  . ASP B 1 182 ? -11.095 66.355 30.479  1.00 67.61  ? 182 ASP B CG  1 
ATOM   4637 O OD1 . ASP B 1 182 ? -11.933 67.014 31.134  1.00 71.32  ? 182 ASP B OD1 1 
ATOM   4638 O OD2 . ASP B 1 182 ? -10.131 66.877 29.875  1.00 69.30  ? 182 ASP B OD2 1 
ATOM   4639 N N   . ALA B 1 183 ? -12.153 61.840 31.608  1.00 54.95  ? 183 ALA B N   1 
ATOM   4640 C CA  . ALA B 1 183 ? -12.304 60.398 31.355  1.00 52.91  ? 183 ALA B CA  1 
ATOM   4641 C C   . ALA B 1 183 ? -13.777 59.999 31.251  1.00 57.53  ? 183 ALA B C   1 
ATOM   4642 O O   . ALA B 1 183 ? -14.131 59.153 30.430  1.00 55.32  ? 183 ALA B O   1 
ATOM   4643 C CB  . ALA B 1 183 ? -11.613 59.595 32.443  1.00 52.51  ? 183 ALA B CB  1 
ATOM   4644 N N   . LYS B 1 184 ? -14.629 60.668 32.044  1.00 57.66  ? 184 LYS B N   1 
ATOM   4645 C CA  . LYS B 1 184 ? -16.083 60.493 32.094  1.00 59.40  ? 184 LYS B CA  1 
ATOM   4646 C C   . LYS B 1 184 ? -16.789 61.099 30.853  1.00 66.13  ? 184 LYS B C   1 
ATOM   4647 O O   . LYS B 1 184 ? -17.919 60.699 30.544  1.00 66.67  ? 184 LYS B O   1 
ATOM   4648 C CB  . LYS B 1 184 ? -16.649 61.108 33.388  1.00 63.02  ? 184 LYS B CB  1 
ATOM   4649 C CG  . LYS B 1 184 ? -16.038 60.543 34.670  1.00 73.07  ? 184 LYS B CG  1 
ATOM   4650 C CD  . LYS B 1 184 ? -16.460 61.347 35.899  1.00 82.53  ? 184 LYS B CD  1 
ATOM   4651 C CE  . LYS B 1 184 ? -15.692 60.964 37.144  1.00 95.19  ? 184 LYS B CE  1 
ATOM   4652 N NZ  . LYS B 1 184 ? -14.327 61.565 37.174  1.00 110.10 ? 184 LYS B NZ  1 
ATOM   4653 N N   . ASN B 1 185 ? -16.130 62.065 30.157  1.00 63.10  ? 185 ASN B N   1 
ATOM   4654 C CA  . ASN B 1 185 ? -16.652 62.714 28.948  1.00 63.70  ? 185 ASN B CA  1 
ATOM   4655 C C   . ASN B 1 185 ? -16.094 62.017 27.688  1.00 66.95  ? 185 ASN B C   1 
ATOM   4656 O O   . ASN B 1 185 ? -14.897 62.149 27.391  1.00 65.48  ? 185 ASN B O   1 
ATOM   4657 C CB  . ASN B 1 185 ? -16.348 64.220 28.947  1.00 65.35  ? 185 ASN B CB  1 
ATOM   4658 C CG  . ASN B 1 185 ? -16.934 65.014 27.797  1.00 87.02  ? 185 ASN B CG  1 
ATOM   4659 O OD1 . ASN B 1 185 ? -17.646 64.503 26.924  1.00 80.40  ? 185 ASN B OD1 1 
ATOM   4660 N ND2 . ASN B 1 185 ? -16.651 66.305 27.780  1.00 80.19  ? 185 ASN B ND2 1 
ATOM   4661 N N   . PRO B 1 186 ? -16.956 61.279 26.935  1.00 63.70  ? 186 PRO B N   1 
ATOM   4662 C CA  . PRO B 1 186 ? -16.463 60.540 25.752  1.00 62.55  ? 186 PRO B CA  1 
ATOM   4663 C C   . PRO B 1 186 ? -15.717 61.353 24.688  1.00 66.97  ? 186 PRO B C   1 
ATOM   4664 O O   . PRO B 1 186 ? -14.660 60.900 24.208  1.00 66.19  ? 186 PRO B O   1 
ATOM   4665 C CB  . PRO B 1 186 ? -17.716 59.852 25.202  1.00 64.17  ? 186 PRO B CB  1 
ATOM   4666 C CG  . PRO B 1 186 ? -18.868 60.530 25.862  1.00 69.76  ? 186 PRO B CG  1 
ATOM   4667 C CD  . PRO B 1 186 ? -18.387 61.002 27.179  1.00 65.37  ? 186 PRO B CD  1 
ATOM   4668 N N   . GLN B 1 187 ? -16.229 62.558 24.356  1.00 63.53  ? 187 GLN B N   1 
ATOM   4669 C CA  . GLN B 1 187 ? -15.616 63.424 23.345  1.00 63.81  ? 187 GLN B CA  1 
ATOM   4670 C C   . GLN B 1 187 ? -14.283 64.105 23.714  1.00 68.51  ? 187 GLN B C   1 
ATOM   4671 O O   . GLN B 1 187 ? -13.689 64.755 22.849  1.00 69.13  ? 187 GLN B O   1 
ATOM   4672 C CB  . GLN B 1 187 ? -16.622 64.406 22.723  1.00 66.70  ? 187 GLN B CB  1 
ATOM   4673 C CG  . GLN B 1 187 ? -17.288 65.344 23.709  1.00 78.55  ? 187 GLN B CG  1 
ATOM   4674 C CD  . GLN B 1 187 ? -18.775 65.140 23.716  1.00 89.45  ? 187 GLN B CD  1 
ATOM   4675 O OE1 . GLN B 1 187 ? -19.296 64.196 24.323  1.00 87.00  ? 187 GLN B OE1 1 
ATOM   4676 N NE2 . GLN B 1 187 ? -19.482 66.019 23.028  1.00 73.91  ? 187 GLN B NE2 1 
ATOM   4677 N N   . LYS B 1 188 ? -13.796 63.947 24.962  1.00 63.99  ? 188 LYS B N   1 
ATOM   4678 C CA  . LYS B 1 188 ? -12.520 64.549 25.367  1.00 63.34  ? 188 LYS B CA  1 
ATOM   4679 C C   . LYS B 1 188 ? -11.298 63.747 24.854  1.00 65.35  ? 188 LYS B C   1 
ATOM   4680 O O   . LYS B 1 188 ? -10.196 64.316 24.731  1.00 65.38  ? 188 LYS B O   1 
ATOM   4681 C CB  . LYS B 1 188 ? -12.460 64.787 26.883  1.00 65.98  ? 188 LYS B CB  1 
ATOM   4682 C CG  . LYS B 1 188 ? -13.267 65.996 27.360  1.00 84.39  ? 188 LYS B CG  1 
ATOM   4683 C CD  . LYS B 1 188 ? -12.503 67.320 27.264  1.00 94.30  ? 188 LYS B CD  1 
ATOM   4684 C CE  . LYS B 1 188 ? -13.277 68.452 27.895  1.00 106.88 ? 188 LYS B CE  1 
ATOM   4685 N NZ  . LYS B 1 188 ? -12.467 69.696 27.986  1.00 118.24 ? 188 LYS B NZ  1 
ATOM   4686 N N   . ASN B 1 189 ? -11.512 62.433 24.545  1.00 58.00  ? 189 ASN B N   1 
ATOM   4687 C CA  . ASN B 1 189 ? -10.536 61.486 23.995  1.00 55.19  ? 189 ASN B CA  1 
ATOM   4688 C C   . ASN B 1 189 ? -9.271  61.209 24.849  1.00 53.25  ? 189 ASN B C   1 
ATOM   4689 O O   . ASN B 1 189 ? -8.144  61.256 24.345  1.00 51.81  ? 189 ASN B O   1 
ATOM   4690 C CB  . ASN B 1 189 ? -10.230 61.800 22.512  1.00 59.12  ? 189 ASN B CB  1 
ATOM   4691 C CG  . ASN B 1 189 ? -9.911  60.588 21.650  1.00 89.72  ? 189 ASN B CG  1 
ATOM   4692 O OD1 . ASN B 1 189 ? -8.853  60.526 21.016  1.00 87.78  ? 189 ASN B OD1 1 
ATOM   4693 N ND2 . ASN B 1 189 ? -10.826 59.617 21.566  1.00 79.24  ? 189 ASN B ND2 1 
ATOM   4694 N N   . THR B 1 190 ? -9.479  60.876 26.139  1.00 46.69  ? 190 THR B N   1 
ATOM   4695 C CA  . THR B 1 190 ? -8.416  60.540 27.105  1.00 44.19  ? 190 THR B CA  1 
ATOM   4696 C C   . THR B 1 190 ? -7.805  59.164 26.773  1.00 43.76  ? 190 THR B C   1 
ATOM   4697 O O   . THR B 1 190 ? -8.486  58.349 26.138  1.00 42.20  ? 190 THR B O   1 
ATOM   4698 C CB  . THR B 1 190 ? -8.958  60.557 28.547  1.00 51.63  ? 190 THR B CB  1 
ATOM   4699 O OG1 . THR B 1 190 ? -10.108 59.716 28.637  1.00 55.16  ? 190 THR B OG1 1 
ATOM   4700 C CG2 . THR B 1 190 ? -9.263  61.961 29.056  1.00 48.36  ? 190 THR B CG2 1 
ATOM   4701 N N   . PRO B 1 191 ? -6.544  58.857 27.194  1.00 38.15  ? 191 PRO B N   1 
ATOM   4702 C CA  . PRO B 1 191 ? -5.950  57.560 26.826  1.00 36.08  ? 191 PRO B CA  1 
ATOM   4703 C C   . PRO B 1 191 ? -6.721  56.318 27.283  1.00 39.66  ? 191 PRO B C   1 
ATOM   4704 O O   . PRO B 1 191 ? -7.228  56.261 28.403  1.00 40.11  ? 191 PRO B O   1 
ATOM   4705 C CB  . PRO B 1 191 ? -4.532  57.644 27.407  1.00 36.86  ? 191 PRO B CB  1 
ATOM   4706 C CG  . PRO B 1 191 ? -4.248  59.078 27.495  1.00 42.08  ? 191 PRO B CG  1 
ATOM   4707 C CD  . PRO B 1 191 ? -5.559  59.688 27.916  1.00 39.05  ? 191 PRO B CD  1 
ATOM   4708 N N   . LYS B 1 192 ? -6.842  55.338 26.383  1.00 35.28  ? 192 LYS B N   1 
ATOM   4709 C CA  . LYS B 1 192 ? -7.539  54.083 26.652  1.00 34.48  ? 192 LYS B CA  1 
ATOM   4710 C C   . LYS B 1 192 ? -6.700  53.153 27.554  1.00 36.99  ? 192 LYS B C   1 
ATOM   4711 O O   . LYS B 1 192 ? -7.231  52.538 28.488  1.00 36.96  ? 192 LYS B O   1 
ATOM   4712 C CB  . LYS B 1 192 ? -7.940  53.382 25.340  1.00 35.86  ? 192 LYS B CB  1 
ATOM   4713 C CG  . LYS B 1 192 ? -8.981  54.135 24.507  1.00 40.38  ? 192 LYS B CG  1 
ATOM   4714 C CD  . LYS B 1 192 ? -10.401 53.862 24.972  1.00 48.09  ? 192 LYS B CD  1 
ATOM   4715 C CE  . LYS B 1 192 ? -11.429 54.066 23.884  1.00 59.86  ? 192 LYS B CE  1 
ATOM   4716 N NZ  . LYS B 1 192 ? -11.487 52.923 22.928  1.00 68.63  ? 192 LYS B NZ  1 
ATOM   4717 N N   . PHE B 1 193 ? -5.391  53.081 27.297  1.00 31.42  ? 193 PHE B N   1 
ATOM   4718 C CA  . PHE B 1 193 ? -4.486  52.239 28.073  1.00 29.48  ? 193 PHE B CA  1 
ATOM   4719 C C   . PHE B 1 193 ? -3.051  52.710 27.990  1.00 32.47  ? 193 PHE B C   1 
ATOM   4720 O O   . PHE B 1 193 ? -2.707  53.546 27.147  1.00 30.83  ? 193 PHE B O   1 
ATOM   4721 C CB  . PHE B 1 193 ? -4.564  50.769 27.593  1.00 30.22  ? 193 PHE B CB  1 
ATOM   4722 C CG  . PHE B 1 193 ? -4.047  50.471 26.191  1.00 31.50  ? 193 PHE B CG  1 
ATOM   4723 C CD1 . PHE B 1 193 ? -4.931  50.258 25.134  1.00 33.96  ? 193 PHE B CD1 1 
ATOM   4724 C CD2 . PHE B 1 193 ? -2.679  50.352 25.941  1.00 32.85  ? 193 PHE B CD2 1 
ATOM   4725 C CE1 . PHE B 1 193 ? -4.455  49.943 23.852  1.00 34.17  ? 193 PHE B CE1 1 
ATOM   4726 C CE2 . PHE B 1 193 ? -2.208  50.042 24.657  1.00 35.04  ? 193 PHE B CE2 1 
ATOM   4727 C CZ  . PHE B 1 193 ? -3.099  49.835 23.624  1.00 33.04  ? 193 PHE B CZ  1 
ATOM   4728 N N   . LEU B 1 194 ? -2.206  52.098 28.836  1.00 29.73  ? 194 LEU B N   1 
ATOM   4729 C CA  . LEU B 1 194 ? -0.755  52.246 28.873  1.00 29.00  ? 194 LEU B CA  1 
ATOM   4730 C C   . LEU B 1 194 ? -0.225  50.836 28.687  1.00 32.50  ? 194 LEU B C   1 
ATOM   4731 O O   . LEU B 1 194 ? -0.639  49.927 29.418  1.00 31.72  ? 194 LEU B O   1 
ATOM   4732 C CB  . LEU B 1 194 ? -0.240  52.869 30.184  1.00 28.91  ? 194 LEU B CB  1 
ATOM   4733 C CG  . LEU B 1 194 ? 1.290   52.887 30.334  1.00 33.15  ? 194 LEU B CG  1 
ATOM   4734 C CD1 . LEU B 1 194 ? 1.821   54.287 30.520  1.00 33.56  ? 194 LEU B CD1 1 
ATOM   4735 C CD2 . LEU B 1 194 ? 1.739   52.011 31.474  1.00 35.35  ? 194 LEU B CD2 1 
ATOM   4736 N N   . TYR B 1 195 ? 0.632   50.646 27.672  1.00 28.68  ? 195 TYR B N   1 
ATOM   4737 C CA  . TYR B 1 195 ? 1.248   49.356 27.370  1.00 27.54  ? 195 TYR B CA  1 
ATOM   4738 C C   . TYR B 1 195 ? 2.694   49.384 27.863  1.00 32.98  ? 195 TYR B C   1 
ATOM   4739 O O   . TYR B 1 195 ? 3.418   50.331 27.565  1.00 33.82  ? 195 TYR B O   1 
ATOM   4740 C CB  . TYR B 1 195 ? 1.189   49.045 25.858  1.00 27.50  ? 195 TYR B CB  1 
ATOM   4741 C CG  . TYR B 1 195 ? 2.075   47.888 25.447  1.00 27.59  ? 195 TYR B CG  1 
ATOM   4742 C CD1 . TYR B 1 195 ? 1.617   46.572 25.521  1.00 28.92  ? 195 TYR B CD1 1 
ATOM   4743 C CD2 . TYR B 1 195 ? 3.385   48.101 25.019  1.00 28.12  ? 195 TYR B CD2 1 
ATOM   4744 C CE1 . TYR B 1 195 ? 2.438   45.499 25.182  1.00 29.37  ? 195 TYR B CE1 1 
ATOM   4745 C CE2 . TYR B 1 195 ? 4.222   47.035 24.695  1.00 28.76  ? 195 TYR B CE2 1 
ATOM   4746 C CZ  . TYR B 1 195 ? 3.745   45.733 24.784  1.00 38.54  ? 195 TYR B CZ  1 
ATOM   4747 O OH  . TYR B 1 195 ? 4.551   44.675 24.433  1.00 37.66  ? 195 TYR B OH  1 
ATOM   4748 N N   . THR B 1 196 ? 3.123   48.332 28.583  1.00 29.55  ? 196 THR B N   1 
ATOM   4749 C CA  . THR B 1 196 ? 4.488   48.227 29.093  1.00 29.87  ? 196 THR B CA  1 
ATOM   4750 C C   . THR B 1 196 ? 4.967   46.803 29.301  1.00 35.55  ? 196 THR B C   1 
ATOM   4751 O O   . THR B 1 196 ? 4.185   45.938 29.708  1.00 37.39  ? 196 THR B O   1 
ATOM   4752 C CB  . THR B 1 196 ? 4.708   49.115 30.340  1.00 39.30  ? 196 THR B CB  1 
ATOM   4753 O OG1 . THR B 1 196 ? 6.099   49.161 30.658  1.00 37.55  ? 196 THR B OG1 1 
ATOM   4754 C CG2 . THR B 1 196 ? 3.885   48.687 31.556  1.00 36.79  ? 196 THR B CG2 1 
ATOM   4755 N N   . VAL B 1 197 ? 6.265   46.570 29.028  1.00 30.55  ? 197 VAL B N   1 
ATOM   4756 C CA  . VAL B 1 197 ? 6.969   45.309 29.264  1.00 28.72  ? 197 VAL B CA  1 
ATOM   4757 C C   . VAL B 1 197 ? 7.746   45.628 30.533  1.00 31.33  ? 197 VAL B C   1 
ATOM   4758 O O   . VAL B 1 197 ? 8.739   46.336 30.450  1.00 31.25  ? 197 VAL B O   1 
ATOM   4759 C CB  . VAL B 1 197 ? 7.879   44.859 28.081  1.00 31.22  ? 197 VAL B CB  1 
ATOM   4760 C CG1 . VAL B 1 197 ? 8.653   43.589 28.435  1.00 30.70  ? 197 VAL B CG1 1 
ATOM   4761 C CG2 . VAL B 1 197 ? 7.066   44.644 26.809  1.00 30.33  ? 197 VAL B CG2 1 
ATOM   4762 N N   . PRO B 1 198 ? 7.251   45.247 31.724  1.00 28.73  ? 198 PRO B N   1 
ATOM   4763 C CA  . PRO B 1 198 ? 7.904   45.700 32.972  1.00 29.40  ? 198 PRO B CA  1 
ATOM   4764 C C   . PRO B 1 198 ? 9.293   45.164 33.299  1.00 30.90  ? 198 PRO B C   1 
ATOM   4765 O O   . PRO B 1 198 ? 10.049  45.845 33.974  1.00 29.20  ? 198 PRO B O   1 
ATOM   4766 C CB  . PRO B 1 198 ? 6.874   45.371 34.065  1.00 31.35  ? 198 PRO B CB  1 
ATOM   4767 C CG  . PRO B 1 198 ? 5.602   45.040 33.323  1.00 35.39  ? 198 PRO B CG  1 
ATOM   4768 C CD  . PRO B 1 198 ? 6.044   44.457 32.024  1.00 30.08  ? 198 PRO B CD  1 
ATOM   4769 N N   . ASN B 1 199 ? 9.608   43.961 32.833  1.00 28.25  ? 199 ASN B N   1 
ATOM   4770 C CA  . ASN B 1 199 ? 10.877  43.297 33.085  1.00 28.81  ? 199 ASN B CA  1 
ATOM   4771 C C   . ASN B 1 199 ? 11.621  43.041 31.788  1.00 34.22  ? 199 ASN B C   1 
ATOM   4772 O O   . ASN B 1 199 ? 11.110  42.340 30.894  1.00 31.81  ? 199 ASN B O   1 
ATOM   4773 C CB  . ASN B 1 199 ? 10.659  41.976 33.833  1.00 28.46  ? 199 ASN B CB  1 
ATOM   4774 C CG  . ASN B 1 199 ? 10.042  42.140 35.202  1.00 41.44  ? 199 ASN B CG  1 
ATOM   4775 O OD1 . ASN B 1 199 ? 10.694  42.578 36.160  1.00 31.44  ? 199 ASN B OD1 1 
ATOM   4776 N ND2 . ASN B 1 199 ? 8.777   41.759 35.328  1.00 28.43  ? 199 ASN B ND2 1 
ATOM   4777 N N   . GLY B 1 200 ? 12.830  43.606 31.715  1.00 32.67  ? 200 GLY B N   1 
ATOM   4778 C CA  . GLY B 1 200 ? 13.733  43.471 30.579  1.00 32.82  ? 200 GLY B CA  1 
ATOM   4779 C C   . GLY B 1 200 ? 13.082  43.789 29.250  1.00 36.64  ? 200 GLY B C   1 
ATOM   4780 O O   . GLY B 1 200 ? 13.005  42.924 28.379  1.00 37.09  ? 200 GLY B O   1 
ATOM   4781 N N   . ASN B 1 201 ? 12.581  45.022 29.112  1.00 32.39  ? 201 ASN B N   1 
ATOM   4782 C CA  . ASN B 1 201 ? 11.922  45.527 27.921  1.00 32.01  ? 201 ASN B CA  1 
ATOM   4783 C C   . ASN B 1 201 ? 12.665  45.181 26.622  1.00 37.44  ? 201 ASN B C   1 
ATOM   4784 O O   . ASN B 1 201 ? 13.889  45.320 26.544  1.00 38.71  ? 201 ASN B O   1 
ATOM   4785 C CB  . ASN B 1 201 ? 11.748  47.040 28.034  1.00 32.91  ? 201 ASN B CB  1 
ATOM   4786 C CG  . ASN B 1 201 ? 11.219  47.696 26.780  1.00 55.18  ? 201 ASN B CG  1 
ATOM   4787 O OD1 . ASN B 1 201 ? 10.066  47.495 26.389  1.00 51.43  ? 201 ASN B OD1 1 
ATOM   4788 N ND2 . ASN B 1 201 ? 12.067  48.457 26.097  1.00 45.30  ? 201 ASN B ND2 1 
ATOM   4789 N N   . ASN B 1 202 ? 11.917  44.720 25.608  1.00 31.70  ? 202 ASN B N   1 
ATOM   4790 C CA  . ASN B 1 202 ? 12.458  44.453 24.291  1.00 30.42  ? 202 ASN B CA  1 
ATOM   4791 C C   . ASN B 1 202 ? 12.390  45.818 23.560  1.00 36.33  ? 202 ASN B C   1 
ATOM   4792 O O   . ASN B 1 202 ? 11.291  46.382 23.463  1.00 36.69  ? 202 ASN B O   1 
ATOM   4793 C CB  . ASN B 1 202 ? 11.608  43.402 23.594  1.00 24.82  ? 202 ASN B CB  1 
ATOM   4794 C CG  . ASN B 1 202 ? 12.174  42.866 22.308  1.00 48.88  ? 202 ASN B CG  1 
ATOM   4795 O OD1 . ASN B 1 202 ? 13.059  43.452 21.660  1.00 48.31  ? 202 ASN B OD1 1 
ATOM   4796 N ND2 . ASN B 1 202 ? 11.659  41.721 21.906  1.00 39.63  ? 202 ASN B ND2 1 
ATOM   4797 N N   . PRO B 1 203 ? 13.510  46.460 23.163  1.00 33.41  ? 203 PRO B N   1 
ATOM   4798 C CA  . PRO B 1 203 ? 14.904  45.974 23.096  1.00 34.00  ? 203 PRO B CA  1 
ATOM   4799 C C   . PRO B 1 203 ? 15.913  46.384 24.189  1.00 38.64  ? 203 PRO B C   1 
ATOM   4800 O O   . PRO B 1 203 ? 17.069  45.931 24.139  1.00 39.52  ? 203 PRO B O   1 
ATOM   4801 C CB  . PRO B 1 203 ? 15.362  46.573 21.761  1.00 36.18  ? 203 PRO B CB  1 
ATOM   4802 C CG  . PRO B 1 203 ? 14.704  47.944 21.762  1.00 41.01  ? 203 PRO B CG  1 
ATOM   4803 C CD  . PRO B 1 203 ? 13.369  47.753 22.455  1.00 35.59  ? 203 PRO B CD  1 
ATOM   4804 N N   . THR B 1 204 ? 15.525  47.280 25.119  1.00 33.60  ? 204 THR B N   1 
ATOM   4805 C CA  . THR B 1 204 ? 16.422  47.870 26.144  1.00 32.16  ? 204 THR B CA  1 
ATOM   4806 C C   . THR B 1 204 ? 17.040  46.935 27.202  1.00 32.90  ? 204 THR B C   1 
ATOM   4807 O O   . THR B 1 204 ? 18.180  47.137 27.611  1.00 32.53  ? 204 THR B O   1 
ATOM   4808 C CB  . THR B 1 204 ? 15.754  49.082 26.803  1.00 28.22  ? 204 THR B CB  1 
ATOM   4809 O OG1 . THR B 1 204 ? 14.696  48.619 27.649  1.00 30.64  ? 204 THR B OG1 1 
ATOM   4810 C CG2 . THR B 1 204 ? 15.226  50.070 25.793  1.00 14.99  ? 204 THR B CG2 1 
ATOM   4811 N N   . GLY B 1 205 ? 16.254  45.984 27.679  1.00 27.92  ? 205 GLY B N   1 
ATOM   4812 C CA  . GLY B 1 205 ? 16.652  45.085 28.753  1.00 27.51  ? 205 GLY B CA  1 
ATOM   4813 C C   . GLY B 1 205 ? 16.474  45.755 30.108  1.00 31.55  ? 205 GLY B C   1 
ATOM   4814 O O   . GLY B 1 205 ? 16.861  45.187 31.130  1.00 30.15  ? 205 GLY B O   1 
ATOM   4815 N N   . ASN B 1 206 ? 15.856  46.971 30.130  1.00 28.72  ? 206 ASN B N   1 
ATOM   4816 C CA  . ASN B 1 206 ? 15.603  47.751 31.345  1.00 28.74  ? 206 ASN B CA  1 
ATOM   4817 C C   . ASN B 1 206 ? 14.322  47.316 32.060  1.00 32.84  ? 206 ASN B C   1 
ATOM   4818 O O   . ASN B 1 206 ? 13.346  46.933 31.390  1.00 33.05  ? 206 ASN B O   1 
ATOM   4819 C CB  . ASN B 1 206 ? 15.614  49.262 31.055  1.00 29.49  ? 206 ASN B CB  1 
ATOM   4820 C CG  . ASN B 1 206 ? 16.949  49.796 30.566  1.00 57.66  ? 206 ASN B CG  1 
ATOM   4821 O OD1 . ASN B 1 206 ? 17.003  50.703 29.737  1.00 51.39  ? 206 ASN B OD1 1 
ATOM   4822 N ND2 . ASN B 1 206 ? 18.063  49.253 31.057  1.00 51.57  ? 206 ASN B ND2 1 
ATOM   4823 N N   . SER B 1 207 ? 14.338  47.362 33.427  1.00 28.24  ? 207 SER B N   1 
ATOM   4824 C CA  . SER B 1 207 ? 13.217  46.934 34.270  1.00 27.38  ? 207 SER B CA  1 
ATOM   4825 C C   . SER B 1 207 ? 12.693  47.988 35.228  1.00 34.39  ? 207 SER B C   1 
ATOM   4826 O O   . SER B 1 207 ? 13.492  48.718 35.821  1.00 35.17  ? 207 SER B O   1 
ATOM   4827 C CB  . SER B 1 207 ? 13.563  45.665 35.036  1.00 27.75  ? 207 SER B CB  1 
ATOM   4828 O OG  . SER B 1 207 ? 13.810  44.593 34.141  1.00 34.30  ? 207 SER B OG  1 
ATOM   4829 N N   . LEU B 1 208 ? 11.340  48.043 35.397  1.00 31.98  ? 208 LEU B N   1 
ATOM   4830 C CA  . LEU B 1 208 ? 10.636  48.962 36.312  1.00 32.79  ? 208 LEU B CA  1 
ATOM   4831 C C   . LEU B 1 208 ? 10.842  48.567 37.770  1.00 37.74  ? 208 LEU B C   1 
ATOM   4832 O O   . LEU B 1 208 ? 10.968  47.380 38.071  1.00 40.04  ? 208 LEU B O   1 
ATOM   4833 C CB  . LEU B 1 208 ? 9.122   48.981 36.020  1.00 32.62  ? 208 LEU B CB  1 
ATOM   4834 C CG  . LEU B 1 208 ? 8.599   50.045 35.053  1.00 37.01  ? 208 LEU B CG  1 
ATOM   4835 C CD1 . LEU B 1 208 ? 7.193   49.720 34.603  1.00 35.86  ? 208 LEU B CD1 1 
ATOM   4836 C CD2 . LEU B 1 208 ? 8.617   51.419 35.687  1.00 40.34  ? 208 LEU B CD2 1 
ATOM   4837 N N   . THR B 1 209 ? 10.819  49.554 38.672  1.00 32.20  ? 209 THR B N   1 
ATOM   4838 C CA  . THR B 1 209 ? 10.960  49.361 40.116  1.00 31.89  ? 209 THR B CA  1 
ATOM   4839 C C   . THR B 1 209 ? 9.583   49.330 40.808  1.00 38.45  ? 209 THR B C   1 
ATOM   4840 O O   . THR B 1 209 ? 8.587   49.763 40.211  1.00 37.25  ? 209 THR B O   1 
ATOM   4841 C CB  . THR B 1 209 ? 11.881  50.437 40.698  1.00 30.35  ? 209 THR B CB  1 
ATOM   4842 O OG1 . THR B 1 209 ? 11.317  51.724 40.460  1.00 31.88  ? 209 THR B OG1 1 
ATOM   4843 C CG2 . THR B 1 209 ? 13.277  50.387 40.113  1.00 23.14  ? 209 THR B CG2 1 
ATOM   4844 N N   . SER B 1 210 ? 9.530   48.838 42.068  1.00 38.17  ? 210 SER B N   1 
ATOM   4845 C CA  . SER B 1 210 ? 8.288   48.742 42.863  1.00 39.39  ? 210 SER B CA  1 
ATOM   4846 C C   . SER B 1 210 ? 7.616   50.103 43.031  1.00 43.11  ? 210 SER B C   1 
ATOM   4847 O O   . SER B 1 210 ? 6.413   50.232 42.801  1.00 42.06  ? 210 SER B O   1 
ATOM   4848 C CB  . SER B 1 210 ? 8.558   48.145 44.247  1.00 45.91  ? 210 SER B CB  1 
ATOM   4849 O OG  . SER B 1 210 ? 9.263   46.916 44.198  1.00 61.29  ? 210 SER B OG  1 
ATOM   4850 N N   . GLU B 1 211 ? 8.419   51.113 43.416  1.00 39.72  ? 211 GLU B N   1 
ATOM   4851 C CA  . GLU B 1 211 ? 8.031   52.500 43.679  1.00 39.54  ? 211 GLU B CA  1 
ATOM   4852 C C   . GLU B 1 211 ? 7.436   53.151 42.434  1.00 42.47  ? 211 GLU B C   1 
ATOM   4853 O O   . GLU B 1 211 ? 6.366   53.771 42.520  1.00 42.96  ? 211 GLU B O   1 
ATOM   4854 C CB  . GLU B 1 211 ? 9.218   53.313 44.230  1.00 41.57  ? 211 GLU B CB  1 
ATOM   4855 C CG  . GLU B 1 211 ? 10.141  52.554 45.183  1.00 56.25  ? 211 GLU B CG  1 
ATOM   4856 C CD  . GLU B 1 211 ? 11.153  51.614 44.536  1.00 79.09  ? 211 GLU B CD  1 
ATOM   4857 O OE1 . GLU B 1 211 ? 10.965  50.378 44.632  1.00 59.88  ? 211 GLU B OE1 1 
ATOM   4858 O OE2 . GLU B 1 211 ? 12.114  52.112 43.905  1.00 77.26  ? 211 GLU B OE2 1 
ATOM   4859 N N   . ARG B 1 212 ? 8.102   52.958 41.267  1.00 36.90  ? 212 ARG B N   1 
ATOM   4860 C CA  . ARG B 1 212 ? 7.649   53.461 39.966  1.00 35.46  ? 212 ARG B CA  1 
ATOM   4861 C C   . ARG B 1 212 ? 6.284   52.858 39.558  1.00 37.37  ? 212 ARG B C   1 
ATOM   4862 O O   . ARG B 1 212 ? 5.382   53.603 39.178  1.00 36.39  ? 212 ARG B O   1 
ATOM   4863 C CB  . ARG B 1 212 ? 8.712   53.233 38.886  1.00 32.80  ? 212 ARG B CB  1 
ATOM   4864 C CG  . ARG B 1 212 ? 9.853   54.235 38.937  1.00 38.66  ? 212 ARG B CG  1 
ATOM   4865 C CD  . ARG B 1 212 ? 10.671  54.244 37.666  1.00 39.76  ? 212 ARG B CD  1 
ATOM   4866 N NE  . ARG B 1 212 ? 11.710  55.275 37.697  1.00 45.75  ? 212 ARG B NE  1 
ATOM   4867 C CZ  . ARG B 1 212 ? 12.471  55.613 36.657  1.00 52.41  ? 212 ARG B CZ  1 
ATOM   4868 N NH1 . ARG B 1 212 ? 12.305  55.020 35.481  1.00 40.47  ? 212 ARG B NH1 1 
ATOM   4869 N NH2 . ARG B 1 212 ? 13.393  56.558 36.783  1.00 23.21  ? 212 ARG B NH2 1 
ATOM   4870 N N   . LYS B 1 213 ? 6.124   51.527 39.706  1.00 32.59  ? 213 LYS B N   1 
ATOM   4871 C CA  . LYS B 1 213 ? 4.875   50.813 39.412  1.00 31.49  ? 213 LYS B CA  1 
ATOM   4872 C C   . LYS B 1 213 ? 3.712   51.369 40.243  1.00 35.32  ? 213 LYS B C   1 
ATOM   4873 O O   . LYS B 1 213 ? 2.662   51.702 39.673  1.00 35.19  ? 213 LYS B O   1 
ATOM   4874 C CB  . LYS B 1 213 ? 5.031   49.294 39.617  1.00 32.75  ? 213 LYS B CB  1 
ATOM   4875 C CG  . LYS B 1 213 ? 5.830   48.601 38.520  1.00 23.59  ? 213 LYS B CG  1 
ATOM   4876 C CD  . LYS B 1 213 ? 6.037   47.146 38.843  1.00 29.97  ? 213 LYS B CD  1 
ATOM   4877 C CE  . LYS B 1 213 ? 6.782   46.418 37.751  1.00 44.28  ? 213 LYS B CE  1 
ATOM   4878 N NZ  . LYS B 1 213 ? 7.118   45.034 38.147  1.00 53.38  ? 213 LYS B NZ  1 
ATOM   4879 N N   . LYS B 1 214 ? 3.926   51.533 41.570  1.00 31.67  ? 214 LYS B N   1 
ATOM   4880 C CA  . LYS B 1 214 ? 2.956   52.118 42.514  1.00 32.13  ? 214 LYS B CA  1 
ATOM   4881 C C   . LYS B 1 214 ? 2.464   53.465 41.971  1.00 37.04  ? 214 LYS B C   1 
ATOM   4882 O O   . LYS B 1 214 ? 1.253   53.645 41.797  1.00 34.98  ? 214 LYS B O   1 
ATOM   4883 C CB  . LYS B 1 214 ? 3.597   52.305 43.907  1.00 34.93  ? 214 LYS B CB  1 
ATOM   4884 C CG  . LYS B 1 214 ? 3.751   51.016 44.708  1.00 47.36  ? 214 LYS B CG  1 
ATOM   4885 C CD  . LYS B 1 214 ? 4.661   51.227 45.910  1.00 58.92  ? 214 LYS B CD  1 
ATOM   4886 C CE  . LYS B 1 214 ? 4.827   49.987 46.761  1.00 59.51  ? 214 LYS B CE  1 
ATOM   4887 N NZ  . LYS B 1 214 ? 5.630   50.258 47.988  1.00 60.23  ? 214 LYS B NZ  1 
ATOM   4888 N N   . GLU B 1 215 ? 3.433   54.372 41.629  1.00 36.33  ? 215 GLU B N   1 
ATOM   4889 C CA  . GLU B 1 215 ? 3.226   55.705 41.033  1.00 36.60  ? 215 GLU B CA  1 
ATOM   4890 C C   . GLU B 1 215 ? 2.453   55.630 39.706  1.00 36.64  ? 215 GLU B C   1 
ATOM   4891 O O   . GLU B 1 215 ? 1.571   56.453 39.489  1.00 36.11  ? 215 GLU B O   1 
ATOM   4892 C CB  . GLU B 1 215 ? 4.574   56.399 40.783  1.00 38.46  ? 215 GLU B CB  1 
ATOM   4893 C CG  . GLU B 1 215 ? 5.108   57.213 41.943  1.00 52.44  ? 215 GLU B CG  1 
ATOM   4894 C CD  . GLU B 1 215 ? 6.324   58.026 41.544  1.00 83.38  ? 215 GLU B CD  1 
ATOM   4895 O OE1 . GLU B 1 215 ? 7.460   57.543 41.753  1.00 79.72  ? 215 GLU B OE1 1 
ATOM   4896 O OE2 . GLU B 1 215 ? 6.140   59.122 40.967  1.00 84.46  ? 215 GLU B OE2 1 
ATOM   4897 N N   . ILE B 1 216 ? 2.799   54.660 38.822  1.00 30.34  ? 216 ILE B N   1 
ATOM   4898 C CA  . ILE B 1 216 ? 2.127   54.460 37.545  1.00 29.51  ? 216 ILE B CA  1 
ATOM   4899 C C   . ILE B 1 216 ? 0.668   54.062 37.801  1.00 37.38  ? 216 ILE B C   1 
ATOM   4900 O O   . ILE B 1 216 ? -0.234  54.725 37.259  1.00 38.85  ? 216 ILE B O   1 
ATOM   4901 C CB  . ILE B 1 216 ? 2.890   53.497 36.588  1.00 30.86  ? 216 ILE B CB  1 
ATOM   4902 C CG1 . ILE B 1 216 ? 4.258   54.084 36.178  1.00 30.37  ? 216 ILE B CG1 1 
ATOM   4903 C CG2 . ILE B 1 216 ? 2.059   53.159 35.326  1.00 30.59  ? 216 ILE B CG2 1 
ATOM   4904 C CD1 . ILE B 1 216 ? 5.327   53.059 35.979  1.00 33.26  ? 216 ILE B CD1 1 
ATOM   4905 N N   . TYR B 1 217 ? 0.429   53.053 38.690  1.00 33.39  ? 217 TYR B N   1 
ATOM   4906 C CA  . TYR B 1 217 ? -0.935  52.628 39.061  1.00 32.86  ? 217 TYR B CA  1 
ATOM   4907 C C   . TYR B 1 217 ? -1.794  53.800 39.576  1.00 40.47  ? 217 TYR B C   1 
ATOM   4908 O O   . TYR B 1 217 ? -2.960  53.902 39.194  1.00 41.28  ? 217 TYR B O   1 
ATOM   4909 C CB  . TYR B 1 217 ? -0.934  51.479 40.094  1.00 32.38  ? 217 TYR B CB  1 
ATOM   4910 C CG  . TYR B 1 217 ? -2.254  50.734 40.157  1.00 31.85  ? 217 TYR B CG  1 
ATOM   4911 C CD1 . TYR B 1 217 ? -2.519  49.672 39.300  1.00 32.23  ? 217 TYR B CD1 1 
ATOM   4912 C CD2 . TYR B 1 217 ? -3.260  51.125 41.041  1.00 33.95  ? 217 TYR B CD2 1 
ATOM   4913 C CE1 . TYR B 1 217 ? -3.746  49.005 39.325  1.00 32.39  ? 217 TYR B CE1 1 
ATOM   4914 C CE2 . TYR B 1 217 ? -4.505  50.479 41.060  1.00 34.85  ? 217 TYR B CE2 1 
ATOM   4915 C CZ  . TYR B 1 217 ? -4.738  49.414 40.204  1.00 40.99  ? 217 TYR B CZ  1 
ATOM   4916 O OH  . TYR B 1 217 ? -5.945  48.756 40.229  1.00 41.42  ? 217 TYR B OH  1 
ATOM   4917 N N   . GLU B 1 218 ? -1.216  54.688 40.414  1.00 39.25  ? 218 GLU B N   1 
ATOM   4918 C CA  . GLU B 1 218 ? -1.930  55.838 40.972  1.00 40.93  ? 218 GLU B CA  1 
ATOM   4919 C C   . GLU B 1 218 ? -2.457  56.775 39.868  1.00 45.57  ? 218 GLU B C   1 
ATOM   4920 O O   . GLU B 1 218 ? -3.592  57.269 39.977  1.00 46.38  ? 218 GLU B O   1 
ATOM   4921 C CB  . GLU B 1 218 ? -1.122  56.533 42.095  1.00 43.37  ? 218 GLU B CB  1 
ATOM   4922 C CG  . GLU B 1 218 ? -0.480  57.872 41.730  1.00 65.38  ? 218 GLU B CG  1 
ATOM   4923 C CD  . GLU B 1 218 ? 0.944   58.188 42.183  1.00 91.86  ? 218 GLU B CD  1 
ATOM   4924 O OE1 . GLU B 1 218 ? 1.641   58.923 41.443  1.00 62.12  ? 218 GLU B OE1 1 
ATOM   4925 O OE2 . GLU B 1 218 ? 1.358   57.731 43.276  1.00 89.68  ? 218 GLU B OE2 1 
ATOM   4926 N N   . LEU B 1 219 ? -1.678  56.923 38.765  1.00 40.28  ? 219 LEU B N   1 
ATOM   4927 C CA  . LEU B 1 219 ? -2.046  57.753 37.613  1.00 39.58  ? 219 LEU B CA  1 
ATOM   4928 C C   . LEU B 1 219 ? -3.141  57.121 36.751  1.00 42.47  ? 219 LEU B C   1 
ATOM   4929 O O   . LEU B 1 219 ? -4.032  57.838 36.277  1.00 42.14  ? 219 LEU B O   1 
ATOM   4930 C CB  . LEU B 1 219 ? -0.817  58.146 36.789  1.00 39.01  ? 219 LEU B CB  1 
ATOM   4931 C CG  . LEU B 1 219 ? 0.048   59.245 37.430  1.00 44.63  ? 219 LEU B CG  1 
ATOM   4932 C CD1 . LEU B 1 219 ? 1.512   59.075 37.077  1.00 44.17  ? 219 LEU B CD1 1 
ATOM   4933 C CD2 . LEU B 1 219 ? -0.452  60.648 37.062  1.00 48.24  ? 219 LEU B CD2 1 
ATOM   4934 N N   . ALA B 1 220 ? -3.096  55.773 36.586  1.00 37.94  ? 220 ALA B N   1 
ATOM   4935 C CA  . ALA B 1 220 ? -4.109  55.001 35.854  1.00 36.71  ? 220 ALA B CA  1 
ATOM   4936 C C   . ALA B 1 220 ? -5.503  55.098 36.520  1.00 42.54  ? 220 ALA B C   1 
ATOM   4937 O O   . ALA B 1 220 ? -6.496  55.105 35.803  1.00 42.29  ? 220 ALA B O   1 
ATOM   4938 C CB  . ALA B 1 220 ? -3.681  53.551 35.699  1.00 35.82  ? 220 ALA B CB  1 
ATOM   4939 N N   . ARG B 1 221 ? -5.578  55.222 37.869  1.00 40.58  ? 221 ARG B N   1 
ATOM   4940 C CA  . ARG B 1 221 ? -6.851  55.381 38.589  1.00 41.94  ? 221 ARG B CA  1 
ATOM   4941 C C   . ARG B 1 221 ? -7.377  56.767 38.273  1.00 46.64  ? 221 ARG B C   1 
ATOM   4942 O O   . ARG B 1 221 ? -8.507  56.897 37.802  1.00 47.16  ? 221 ARG B O   1 
ATOM   4943 C CB  . ARG B 1 221 ? -6.666  55.322 40.117  1.00 46.73  ? 221 ARG B CB  1 
ATOM   4944 C CG  . ARG B 1 221 ? -6.161  54.016 40.709  1.00 64.02  ? 221 ARG B CG  1 
ATOM   4945 C CD  . ARG B 1 221 ? -5.906  54.169 42.206  1.00 72.71  ? 221 ARG B CD  1 
ATOM   4946 N NE  . ARG B 1 221 ? -7.131  54.416 42.976  1.00 64.41  ? 221 ARG B NE  1 
ATOM   4947 C CZ  . ARG B 1 221 ? -7.752  53.497 43.704  1.00 79.53  ? 221 ARG B CZ  1 
ATOM   4948 N NH1 . ARG B 1 221 ? -7.271  52.264 43.775  1.00 63.40  ? 221 ARG B NH1 1 
ATOM   4949 N NH2 . ARG B 1 221 ? -8.852  53.807 44.379  1.00 75.89  ? 221 ARG B NH2 1 
ATOM   4950 N N   . LYS B 1 222 ? -6.533  57.804 38.559  1.00 42.99  ? 222 LYS B N   1 
ATOM   4951 C CA  . LYS B 1 222 ? -6.779  59.238 38.390  1.00 43.04  ? 222 LYS B CA  1 
ATOM   4952 C C   . LYS B 1 222 ? -7.360  59.587 37.018  1.00 46.83  ? 222 LYS B C   1 
ATOM   4953 O O   . LYS B 1 222 ? -8.361  60.298 36.952  1.00 47.83  ? 222 LYS B O   1 
ATOM   4954 C CB  . LYS B 1 222 ? -5.484  60.032 38.667  1.00 45.11  ? 222 LYS B CB  1 
ATOM   4955 C CG  . LYS B 1 222 ? -5.661  61.547 38.675  1.00 57.37  ? 222 LYS B CG  1 
ATOM   4956 C CD  . LYS B 1 222 ? -4.436  62.259 39.218  1.00 65.30  ? 222 LYS B CD  1 
ATOM   4957 C CE  . LYS B 1 222 ? -4.644  63.759 39.283  1.00 72.03  ? 222 LYS B CE  1 
ATOM   4958 N NZ  . LYS B 1 222 ? -3.541  64.461 39.997  1.00 72.23  ? 222 LYS B NZ  1 
ATOM   4959 N N   . TYR B 1 223 ? -6.750  59.060 35.936  1.00 41.87  ? 223 TYR B N   1 
ATOM   4960 C CA  . TYR B 1 223 ? -7.154  59.312 34.554  1.00 41.20  ? 223 TYR B CA  1 
ATOM   4961 C C   . TYR B 1 223 ? -7.927  58.147 33.913  1.00 44.53  ? 223 TYR B C   1 
ATOM   4962 O O   . TYR B 1 223 ? -8.203  58.177 32.704  1.00 45.70  ? 223 TYR B O   1 
ATOM   4963 C CB  . TYR B 1 223 ? -5.925  59.732 33.727  1.00 42.16  ? 223 TYR B CB  1 
ATOM   4964 C CG  . TYR B 1 223 ? -5.350  61.067 34.153  1.00 45.59  ? 223 TYR B CG  1 
ATOM   4965 C CD1 . TYR B 1 223 ? -5.798  62.257 33.583  1.00 48.62  ? 223 TYR B CD1 1 
ATOM   4966 C CD2 . TYR B 1 223 ? -4.373  61.146 35.142  1.00 46.39  ? 223 TYR B CD2 1 
ATOM   4967 C CE1 . TYR B 1 223 ? -5.277  63.489 33.973  1.00 49.79  ? 223 TYR B CE1 1 
ATOM   4968 C CE2 . TYR B 1 223 ? -3.851  62.375 35.547  1.00 48.48  ? 223 TYR B CE2 1 
ATOM   4969 C CZ  . TYR B 1 223 ? -4.305  63.544 34.957  1.00 56.68  ? 223 TYR B CZ  1 
ATOM   4970 O OH  . TYR B 1 223 ? -3.790  64.757 35.342  1.00 59.41  ? 223 TYR B OH  1 
ATOM   4971 N N   . ASP B 1 224 ? -8.305  57.141 34.732  1.00 38.42  ? 224 ASP B N   1 
ATOM   4972 C CA  . ASP B 1 224 ? -9.066  55.962 34.333  1.00 37.59  ? 224 ASP B CA  1 
ATOM   4973 C C   . ASP B 1 224 ? -8.619  55.302 33.004  1.00 40.41  ? 224 ASP B C   1 
ATOM   4974 O O   . ASP B 1 224 ? -9.302  55.392 31.983  1.00 41.78  ? 224 ASP B O   1 
ATOM   4975 C CB  . ASP B 1 224 ? -10.594 56.198 34.434  1.00 40.84  ? 224 ASP B CB  1 
ATOM   4976 C CG  . ASP B 1 224 ? -11.481 54.982 34.175  1.00 58.31  ? 224 ASP B CG  1 
ATOM   4977 O OD1 . ASP B 1 224 ? -11.193 53.891 34.742  1.00 59.06  ? 224 ASP B OD1 1 
ATOM   4978 O OD2 . ASP B 1 224 ? -12.486 55.130 33.444  1.00 66.59  ? 224 ASP B OD2 1 
ATOM   4979 N N   . PHE B 1 225 ? -7.449  54.668 33.020  1.00 33.61  ? 225 PHE B N   1 
ATOM   4980 C CA  . PHE B 1 225 ? -6.954  53.937 31.858  1.00 31.04  ? 225 PHE B CA  1 
ATOM   4981 C C   . PHE B 1 225 ? -6.427  52.571 32.253  1.00 35.21  ? 225 PHE B C   1 
ATOM   4982 O O   . PHE B 1 225 ? -5.927  52.408 33.371  1.00 36.53  ? 225 PHE B O   1 
ATOM   4983 C CB  . PHE B 1 225 ? -5.945  54.741 31.022  1.00 31.39  ? 225 PHE B CB  1 
ATOM   4984 C CG  . PHE B 1 225 ? -4.718  55.258 31.729  1.00 31.52  ? 225 PHE B CG  1 
ATOM   4985 C CD1 . PHE B 1 225 ? -3.590  54.453 31.883  1.00 32.54  ? 225 PHE B CD1 1 
ATOM   4986 C CD2 . PHE B 1 225 ? -4.652  56.575 32.173  1.00 32.81  ? 225 PHE B CD2 1 
ATOM   4987 C CE1 . PHE B 1 225 ? -2.442  54.941 32.520  1.00 32.21  ? 225 PHE B CE1 1 
ATOM   4988 C CE2 . PHE B 1 225 ? -3.500  57.064 32.798  1.00 34.68  ? 225 PHE B CE2 1 
ATOM   4989 C CZ  . PHE B 1 225 ? -2.402  56.246 32.960  1.00 31.62  ? 225 PHE B CZ  1 
ATOM   4990 N N   . LEU B 1 226 ? -6.561  51.576 31.359  1.00 29.73  ? 226 LEU B N   1 
ATOM   4991 C CA  . LEU B 1 226 ? -6.082  50.222 31.659  1.00 27.49  ? 226 LEU B CA  1 
ATOM   4992 C C   . LEU B 1 226 ? -4.557  50.140 31.583  1.00 30.62  ? 226 LEU B C   1 
ATOM   4993 O O   . LEU B 1 226 ? -3.917  51.079 31.102  1.00 29.54  ? 226 LEU B O   1 
ATOM   4994 C CB  . LEU B 1 226 ? -6.770  49.138 30.784  1.00 26.25  ? 226 LEU B CB  1 
ATOM   4995 C CG  . LEU B 1 226 ? -8.307  49.263 30.533  1.00 29.52  ? 226 LEU B CG  1 
ATOM   4996 C CD1 . LEU B 1 226 ? -8.738  48.375 29.401  1.00 28.75  ? 226 LEU B CD1 1 
ATOM   4997 C CD2 . LEU B 1 226 ? -9.128  48.981 31.773  1.00 27.63  ? 226 LEU B CD2 1 
ATOM   4998 N N   . ILE B 1 227 ? -3.976  49.061 32.137  1.00 27.97  ? 227 ILE B N   1 
ATOM   4999 C CA  . ILE B 1 227 ? -2.540  48.799 32.088  1.00 27.64  ? 227 ILE B CA  1 
ATOM   5000 C C   . ILE B 1 227 ? -2.371  47.452 31.406  1.00 32.17  ? 227 ILE B C   1 
ATOM   5001 O O   . ILE B 1 227 ? -2.919  46.451 31.875  1.00 31.17  ? 227 ILE B O   1 
ATOM   5002 C CB  . ILE B 1 227 ? -1.799  48.888 33.459  1.00 30.99  ? 227 ILE B CB  1 
ATOM   5003 C CG1 . ILE B 1 227 ? -1.829  50.316 34.024  1.00 31.90  ? 227 ILE B CG1 1 
ATOM   5004 C CG2 . ILE B 1 227 ? -0.347  48.412 33.322  1.00 32.73  ? 227 ILE B CG2 1 
ATOM   5005 C CD1 . ILE B 1 227 ? -1.318  50.486 35.507  1.00 36.15  ? 227 ILE B CD1 1 
ATOM   5006 N N   . ILE B 1 228 ? -1.650  47.436 30.274  1.00 29.00  ? 228 ILE B N   1 
ATOM   5007 C CA  . ILE B 1 228 ? -1.380  46.195 29.559  1.00 27.20  ? 228 ILE B CA  1 
ATOM   5008 C C   . ILE B 1 228 ? 0.023   45.733 29.920  1.00 30.95  ? 228 ILE B C   1 
ATOM   5009 O O   . ILE B 1 228 ? 1.017   46.255 29.407  1.00 30.15  ? 228 ILE B O   1 
ATOM   5010 C CB  . ILE B 1 228 ? -1.701  46.233 28.039  1.00 28.80  ? 228 ILE B CB  1 
ATOM   5011 C CG1 . ILE B 1 228 ? -3.186  46.623 27.825  1.00 28.63  ? 228 ILE B CG1 1 
ATOM   5012 C CG2 . ILE B 1 228 ? -1.353  44.870 27.370  1.00 26.56  ? 228 ILE B CG2 1 
ATOM   5013 C CD1 . ILE B 1 228 ? -3.588  46.925 26.395  1.00 30.51  ? 228 ILE B CD1 1 
ATOM   5014 N N   . GLU B 1 229 ? 0.082   44.791 30.872  1.00 27.60  ? 229 GLU B N   1 
ATOM   5015 C CA  . GLU B 1 229 ? 1.309   44.205 31.399  1.00 26.44  ? 229 GLU B CA  1 
ATOM   5016 C C   . GLU B 1 229 ? 1.775   43.041 30.541  1.00 26.75  ? 229 GLU B C   1 
ATOM   5017 O O   . GLU B 1 229 ? 1.374   41.901 30.797  1.00 24.12  ? 229 GLU B O   1 
ATOM   5018 C CB  . GLU B 1 229 ? 1.097   43.764 32.858  1.00 28.04  ? 229 GLU B CB  1 
ATOM   5019 C CG  . GLU B 1 229 ? 2.372   43.285 33.528  1.00 37.88  ? 229 GLU B CG  1 
ATOM   5020 C CD  . GLU B 1 229 ? 2.333   43.254 35.037  1.00 53.37  ? 229 GLU B CD  1 
ATOM   5021 O OE1 . GLU B 1 229 ? 3.231   43.869 35.656  1.00 36.91  ? 229 GLU B OE1 1 
ATOM   5022 O OE2 . GLU B 1 229 ? 1.440   42.578 35.602  1.00 50.19  ? 229 GLU B OE2 1 
ATOM   5023 N N   . ASP B 1 230 ? 2.618   43.325 29.527  1.00 23.90  ? 230 ASP B N   1 
ATOM   5024 C CA  . ASP B 1 230 ? 3.180   42.281 28.662  1.00 24.06  ? 230 ASP B CA  1 
ATOM   5025 C C   . ASP B 1 230 ? 4.490   41.831 29.308  1.00 28.43  ? 230 ASP B C   1 
ATOM   5026 O O   . ASP B 1 230 ? 5.515   42.467 29.109  1.00 28.34  ? 230 ASP B O   1 
ATOM   5027 C CB  . ASP B 1 230 ? 3.393   42.803 27.231  1.00 26.23  ? 230 ASP B CB  1 
ATOM   5028 C CG  . ASP B 1 230 ? 3.858   41.770 26.210  1.00 39.83  ? 230 ASP B CG  1 
ATOM   5029 O OD1 . ASP B 1 230 ? 3.682   40.552 26.464  1.00 40.90  ? 230 ASP B OD1 1 
ATOM   5030 O OD2 . ASP B 1 230 ? 4.363   42.180 25.142  1.00 46.27  ? 230 ASP B OD2 1 
ATOM   5031 N N   . ASP B 1 231 ? 4.439   40.758 30.117  1.00 24.99  ? 231 ASP B N   1 
ATOM   5032 C CA  . ASP B 1 231 ? 5.555   40.265 30.914  1.00 25.18  ? 231 ASP B CA  1 
ATOM   5033 C C   . ASP B 1 231 ? 6.104   38.873 30.473  1.00 30.99  ? 231 ASP B C   1 
ATOM   5034 O O   . ASP B 1 231 ? 5.949   37.904 31.221  1.00 31.12  ? 231 ASP B O   1 
ATOM   5035 C CB  . ASP B 1 231 ? 5.128   40.265 32.403  1.00 27.15  ? 231 ASP B CB  1 
ATOM   5036 C CG  . ASP B 1 231 ? 6.069   40.912 33.408  1.00 39.96  ? 231 ASP B CG  1 
ATOM   5037 O OD1 . ASP B 1 231 ? 7.205   41.267 33.024  1.00 43.33  ? 231 ASP B OD1 1 
ATOM   5038 O OD2 . ASP B 1 231 ? 5.682   41.028 34.589  1.00 42.55  ? 231 ASP B OD2 1 
ATOM   5039 N N   . PRO B 1 232 ? 6.775   38.729 29.301  1.00 27.72  ? 232 PRO B N   1 
ATOM   5040 C CA  . PRO B 1 232 ? 7.313   37.407 28.934  1.00 26.41  ? 232 PRO B CA  1 
ATOM   5041 C C   . PRO B 1 232 ? 8.614   37.047 29.647  1.00 32.98  ? 232 PRO B C   1 
ATOM   5042 O O   . PRO B 1 232 ? 8.928   35.854 29.789  1.00 35.36  ? 232 PRO B O   1 
ATOM   5043 C CB  . PRO B 1 232 ? 7.528   37.501 27.426  1.00 27.58  ? 232 PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 232 ? 7.215   38.917 27.030  1.00 32.75  ? 232 PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 232 ? 7.084   39.737 28.265  1.00 29.24  ? 232 PRO B CD  1 
ATOM   5046 N N   . TYR B 1 233 ? 9.371   38.061 30.102  1.00 28.81  ? 233 TYR B N   1 
ATOM   5047 C CA  . TYR B 1 233 ? 10.652  37.866 30.788  1.00 29.89  ? 233 TYR B CA  1 
ATOM   5048 C C   . TYR B 1 233 ? 10.525  37.911 32.313  1.00 35.26  ? 233 TYR B C   1 
ATOM   5049 O O   . TYR B 1 233 ? 11.539  38.087 32.992  1.00 35.42  ? 233 TYR B O   1 
ATOM   5050 C CB  . TYR B 1 233 ? 11.733  38.852 30.268  1.00 32.00  ? 233 TYR B CB  1 
ATOM   5051 C CG  . TYR B 1 233 ? 11.764  38.972 28.761  1.00 35.67  ? 233 TYR B CG  1 
ATOM   5052 C CD1 . TYR B 1 233 ? 11.308  40.125 28.127  1.00 38.09  ? 233 TYR B CD1 1 
ATOM   5053 C CD2 . TYR B 1 233 ? 12.167  37.903 27.965  1.00 37.03  ? 233 TYR B CD2 1 
ATOM   5054 C CE1 . TYR B 1 233 ? 11.275  40.221 26.738  1.00 39.65  ? 233 TYR B CE1 1 
ATOM   5055 C CE2 . TYR B 1 233 ? 12.154  37.991 26.575  1.00 38.62  ? 233 TYR B CE2 1 
ATOM   5056 C CZ  . TYR B 1 233 ? 11.700  39.151 25.966  1.00 52.00  ? 233 TYR B CZ  1 
ATOM   5057 O OH  . TYR B 1 233 ? 11.674  39.237 24.593  1.00 60.61  ? 233 TYR B OH  1 
ATOM   5058 N N   . TYR B 1 234 ? 9.287   37.716 32.854  1.00 31.94  ? 234 TYR B N   1 
ATOM   5059 C CA  . TYR B 1 234 ? 9.010   37.723 34.298  1.00 31.35  ? 234 TYR B CA  1 
ATOM   5060 C C   . TYR B 1 234 ? 9.848   36.659 35.039  1.00 37.29  ? 234 TYR B C   1 
ATOM   5061 O O   . TYR B 1 234 ? 10.343  36.901 36.145  1.00 36.77  ? 234 TYR B O   1 
ATOM   5062 C CB  . TYR B 1 234 ? 7.500   37.578 34.590  1.00 30.67  ? 234 TYR B CB  1 
ATOM   5063 C CG  . TYR B 1 234 ? 7.197   37.431 36.068  1.00 32.22  ? 234 TYR B CG  1 
ATOM   5064 C CD1 . TYR B 1 234 ? 7.392   38.493 36.948  1.00 34.39  ? 234 TYR B CD1 1 
ATOM   5065 C CD2 . TYR B 1 234 ? 6.817   36.200 36.605  1.00 32.74  ? 234 TYR B CD2 1 
ATOM   5066 C CE1 . TYR B 1 234 ? 7.196   38.340 38.322  1.00 35.88  ? 234 TYR B CE1 1 
ATOM   5067 C CE2 . TYR B 1 234 ? 6.616   36.035 37.978  1.00 33.67  ? 234 TYR B CE2 1 
ATOM   5068 C CZ  . TYR B 1 234 ? 6.804   37.109 38.833  1.00 42.14  ? 234 TYR B CZ  1 
ATOM   5069 O OH  . TYR B 1 234 ? 6.603   36.950 40.187  1.00 43.08  ? 234 TYR B OH  1 
ATOM   5070 N N   . PHE B 1 235 ? 10.018  35.497 34.396  1.00 34.93  ? 235 PHE B N   1 
ATOM   5071 C CA  . PHE B 1 235 ? 10.778  34.376 34.921  1.00 35.23  ? 235 PHE B CA  1 
ATOM   5072 C C   . PHE B 1 235 ? 12.230  34.402 34.446  1.00 43.02  ? 235 PHE B C   1 
ATOM   5073 O O   . PHE B 1 235 ? 12.877  33.358 34.455  1.00 45.59  ? 235 PHE B O   1 
ATOM   5074 C CB  . PHE B 1 235 ? 10.102  33.052 34.528  1.00 35.83  ? 235 PHE B CB  1 
ATOM   5075 C CG  . PHE B 1 235 ? 8.712   32.872 35.077  1.00 36.32  ? 235 PHE B CG  1 
ATOM   5076 C CD1 . PHE B 1 235 ? 8.508   32.607 36.426  1.00 39.50  ? 235 PHE B CD1 1 
ATOM   5077 C CD2 . PHE B 1 235 ? 7.602   32.947 34.242  1.00 37.67  ? 235 PHE B CD2 1 
ATOM   5078 C CE1 . PHE B 1 235 ? 7.213   32.438 36.937  1.00 40.05  ? 235 PHE B CE1 1 
ATOM   5079 C CE2 . PHE B 1 235 ? 6.306   32.767 34.751  1.00 39.92  ? 235 PHE B CE2 1 
ATOM   5080 C CZ  . PHE B 1 235 ? 6.122   32.513 36.097  1.00 38.13  ? 235 PHE B CZ  1 
ATOM   5081 N N   . LEU B 1 236 ? 12.733  35.565 33.999  1.00 39.01  ? 236 LEU B N   1 
ATOM   5082 C CA  . LEU B 1 236 ? 14.122  35.722 33.547  1.00 39.72  ? 236 LEU B CA  1 
ATOM   5083 C C   . LEU B 1 236 ? 14.809  36.926 34.203  1.00 41.83  ? 236 LEU B C   1 
ATOM   5084 O O   . LEU B 1 236 ? 15.737  37.504 33.631  1.00 41.36  ? 236 LEU B O   1 
ATOM   5085 C CB  . LEU B 1 236 ? 14.231  35.779 32.015  1.00 40.25  ? 236 LEU B CB  1 
ATOM   5086 C CG  . LEU B 1 236 ? 14.282  34.444 31.309  1.00 47.23  ? 236 LEU B CG  1 
ATOM   5087 C CD1 . LEU B 1 236 ? 12.883  33.987 30.929  1.00 48.56  ? 236 LEU B CD1 1 
ATOM   5088 C CD2 . LEU B 1 236 ? 15.112  34.541 30.050  1.00 50.79  ? 236 LEU B CD2 1 
ATOM   5089 N N   . GLN B 1 237 ? 14.347  37.294 35.407  1.00 37.26  ? 237 GLN B N   1 
ATOM   5090 C CA  . GLN B 1 237 ? 14.900  38.384 36.199  1.00 37.13  ? 237 GLN B CA  1 
ATOM   5091 C C   . GLN B 1 237 ? 16.242  37.892 36.788  1.00 43.73  ? 237 GLN B C   1 
ATOM   5092 O O   . GLN B 1 237 ? 16.313  36.785 37.332  1.00 43.41  ? 237 GLN B O   1 
ATOM   5093 C CB  . GLN B 1 237 ? 13.908  38.809 37.298  1.00 37.96  ? 237 GLN B CB  1 
ATOM   5094 C CG  . GLN B 1 237 ? 12.641  39.466 36.760  1.00 35.00  ? 237 GLN B CG  1 
ATOM   5095 C CD  . GLN B 1 237 ? 11.673  39.921 37.834  1.00 53.12  ? 237 GLN B CD  1 
ATOM   5096 O OE1 . GLN B 1 237 ? 10.480  39.563 37.812  1.00 56.45  ? 237 GLN B OE1 1 
ATOM   5097 N NE2 . GLN B 1 237 ? 12.141  40.744 38.780  1.00 26.61  ? 237 GLN B NE2 1 
ATOM   5098 N N   . PHE B 1 238 ? 17.319  38.688 36.607  1.00 42.16  ? 238 PHE B N   1 
ATOM   5099 C CA  . PHE B 1 238 ? 18.682  38.348 37.044  1.00 42.27  ? 238 PHE B CA  1 
ATOM   5100 C C   . PHE B 1 238 ? 18.998  38.678 38.493  1.00 54.20  ? 238 PHE B C   1 
ATOM   5101 O O   . PHE B 1 238 ? 19.904  38.070 39.064  1.00 56.19  ? 238 PHE B O   1 
ATOM   5102 C CB  . PHE B 1 238 ? 19.748  38.929 36.097  1.00 41.98  ? 238 PHE B CB  1 
ATOM   5103 C CG  . PHE B 1 238 ? 19.657  38.455 34.666  1.00 40.47  ? 238 PHE B CG  1 
ATOM   5104 C CD1 . PHE B 1 238 ? 19.703  39.356 33.617  1.00 42.08  ? 238 PHE B CD1 1 
ATOM   5105 C CD2 . PHE B 1 238 ? 19.539  37.103 34.369  1.00 40.09  ? 238 PHE B CD2 1 
ATOM   5106 C CE1 . PHE B 1 238 ? 19.626  38.914 32.291  1.00 41.97  ? 238 PHE B CE1 1 
ATOM   5107 C CE2 . PHE B 1 238 ? 19.444  36.667 33.047  1.00 41.52  ? 238 PHE B CE2 1 
ATOM   5108 C CZ  . PHE B 1 238 ? 19.485  37.575 32.017  1.00 39.20  ? 238 PHE B CZ  1 
ATOM   5109 N N   . ASN B 1 239 ? 18.273  39.614 39.101  1.00 55.03  ? 239 ASN B N   1 
ATOM   5110 C CA  . ASN B 1 239 ? 18.525  39.928 40.501  1.00 57.51  ? 239 ASN B CA  1 
ATOM   5111 C C   . ASN B 1 239 ? 17.608  39.199 41.490  1.00 63.97  ? 239 ASN B C   1 
ATOM   5112 O O   . ASN B 1 239 ? 16.447  38.909 41.193  1.00 63.09  ? 239 ASN B O   1 
ATOM   5113 C CB  . ASN B 1 239 ? 18.605  41.427 40.733  1.00 59.46  ? 239 ASN B CB  1 
ATOM   5114 C CG  . ASN B 1 239 ? 19.632  42.065 39.843  1.00 91.59  ? 239 ASN B CG  1 
ATOM   5115 O OD1 . ASN B 1 239 ? 19.350  42.432 38.699  1.00 83.82  ? 239 ASN B OD1 1 
ATOM   5116 N ND2 . ASN B 1 239 ? 20.866  42.135 40.320  1.00 88.30  ? 239 ASN B ND2 1 
ATOM   5117 N N   . SER B 1 240 ? 18.175  38.872 42.651  1.00 62.92  ? 240 SER B N   1 
ATOM   5118 C CA  . SER B 1 240 ? 17.538  38.170 43.759  1.00 63.51  ? 240 SER B CA  1 
ATOM   5119 C C   . SER B 1 240 ? 16.191  38.785 44.219  1.00 65.13  ? 240 SER B C   1 
ATOM   5120 O O   . SER B 1 240 ? 16.139  39.944 44.661  1.00 64.64  ? 240 SER B O   1 
ATOM   5121 C CB  . SER B 1 240 ? 18.507  38.085 44.931  1.00 69.66  ? 240 SER B CB  1 
ATOM   5122 O OG  . SER B 1 240 ? 17.970  37.227 45.919  1.00 82.62  ? 240 SER B OG  1 
ATOM   5123 N N   . GLY B 1 241 ? 15.127  37.999 44.091  1.00 59.57  ? 241 GLY B N   1 
ATOM   5124 C CA  . GLY B 1 241 ? 13.792  38.433 44.473  1.00 58.63  ? 241 GLY B CA  1 
ATOM   5125 C C   . GLY B 1 241 ? 13.099  39.247 43.400  1.00 59.86  ? 241 GLY B C   1 
ATOM   5126 O O   . GLY B 1 241 ? 13.530  40.364 43.081  1.00 60.85  ? 241 GLY B O   1 
ATOM   5127 N N   . ARG B 1 242 ? 12.007  38.686 42.849  1.00 52.02  ? 242 ARG B N   1 
ATOM   5128 C CA  . ARG B 1 242 ? 11.189  39.306 41.802  1.00 49.50  ? 242 ARG B CA  1 
ATOM   5129 C C   . ARG B 1 242 ? 10.395  40.517 42.325  1.00 51.73  ? 242 ARG B C   1 
ATOM   5130 O O   . ARG B 1 242 ? 9.944   40.526 43.472  1.00 52.06  ? 242 ARG B O   1 
ATOM   5131 C CB  . ARG B 1 242 ? 10.267  38.274 41.115  1.00 45.63  ? 242 ARG B CB  1 
ATOM   5132 C CG  . ARG B 1 242 ? 11.023  37.093 40.478  1.00 47.41  ? 242 ARG B CG  1 
ATOM   5133 C CD  . ARG B 1 242 ? 10.132  35.975 39.970  1.00 46.47  ? 242 ARG B CD  1 
ATOM   5134 N NE  . ARG B 1 242 ? 8.994   35.697 40.855  1.00 49.20  ? 242 ARG B NE  1 
ATOM   5135 C CZ  . ARG B 1 242 ? 8.889   34.652 41.669  1.00 60.59  ? 242 ARG B CZ  1 
ATOM   5136 N NH1 . ARG B 1 242 ? 9.855   33.745 41.722  1.00 54.11  ? 242 ARG B NH1 1 
ATOM   5137 N NH2 . ARG B 1 242 ? 7.812   34.501 42.429  1.00 45.26  ? 242 ARG B NH2 1 
ATOM   5138 N N   . VAL B 1 243 ? 10.269  41.550 41.478  1.00 45.84  ? 243 VAL B N   1 
ATOM   5139 C CA  . VAL B 1 243 ? 9.570   42.806 41.766  1.00 44.86  ? 243 VAL B CA  1 
ATOM   5140 C C   . VAL B 1 243 ? 8.043   42.561 41.702  1.00 46.81  ? 243 VAL B C   1 
ATOM   5141 O O   . VAL B 1 243 ? 7.603   41.861 40.789  1.00 46.67  ? 243 VAL B O   1 
ATOM   5142 C CB  . VAL B 1 243 ? 10.006  43.903 40.742  1.00 48.24  ? 243 VAL B CB  1 
ATOM   5143 C CG1 . VAL B 1 243 ? 9.482   45.288 41.127  1.00 48.36  ? 243 VAL B CG1 1 
ATOM   5144 C CG2 . VAL B 1 243 ? 11.527  43.934 40.553  1.00 48.00  ? 243 VAL B CG2 1 
ATOM   5145 N N   . PRO B 1 244 ? 7.211   43.128 42.614  1.00 41.59  ? 244 PRO B N   1 
ATOM   5146 C CA  . PRO B 1 244 ? 5.747   42.931 42.497  1.00 39.68  ? 244 PRO B CA  1 
ATOM   5147 C C   . PRO B 1 244 ? 5.221   43.449 41.158  1.00 37.55  ? 244 PRO B C   1 
ATOM   5148 O O   . PRO B 1 244 ? 5.715   44.457 40.645  1.00 36.00  ? 244 PRO B O   1 
ATOM   5149 C CB  . PRO B 1 244 ? 5.170   43.762 43.654  1.00 42.52  ? 244 PRO B CB  1 
ATOM   5150 C CG  . PRO B 1 244 ? 6.295   43.975 44.575  1.00 48.32  ? 244 PRO B CG  1 
ATOM   5151 C CD  . PRO B 1 244 ? 7.542   44.007 43.753  1.00 43.82  ? 244 PRO B CD  1 
ATOM   5152 N N   . THR B 1 245 ? 4.253   42.733 40.578  1.00 30.56  ? 245 THR B N   1 
ATOM   5153 C CA  . THR B 1 245 ? 3.670   43.057 39.273  1.00 28.01  ? 245 THR B CA  1 
ATOM   5154 C C   . THR B 1 245 ? 2.481   44.022 39.409  1.00 29.77  ? 245 THR B C   1 
ATOM   5155 O O   . THR B 1 245 ? 1.894   44.127 40.492  1.00 29.00  ? 245 THR B O   1 
ATOM   5156 C CB  . THR B 1 245 ? 3.247   41.763 38.531  1.00 26.12  ? 245 THR B CB  1 
ATOM   5157 O OG1 . THR B 1 245 ? 2.252   41.089 39.302  1.00 27.69  ? 245 THR B OG1 1 
ATOM   5158 C CG2 . THR B 1 245 ? 4.408   40.831 38.237  1.00 20.82  ? 245 THR B CG2 1 
ATOM   5159 N N   . PHE B 1 246 ? 2.105   44.689 38.291  1.00 24.31  ? 246 PHE B N   1 
ATOM   5160 C CA  . PHE B 1 246 ? 0.939   45.563 38.233  1.00 24.75  ? 246 PHE B CA  1 
ATOM   5161 C C   . PHE B 1 246 ? -0.347  44.827 38.677  1.00 31.38  ? 246 PHE B C   1 
ATOM   5162 O O   . PHE B 1 246 ? -1.164  45.403 39.406  1.00 31.68  ? 246 PHE B O   1 
ATOM   5163 C CB  . PHE B 1 246 ? 0.766   46.183 36.836  1.00 25.41  ? 246 PHE B CB  1 
ATOM   5164 C CG  . PHE B 1 246 ? 1.566   47.446 36.636  1.00 26.48  ? 246 PHE B CG  1 
ATOM   5165 C CD1 . PHE B 1 246 ? 2.591   47.497 35.694  1.00 28.19  ? 246 PHE B CD1 1 
ATOM   5166 C CD2 . PHE B 1 246 ? 1.330   48.572 37.424  1.00 27.88  ? 246 PHE B CD2 1 
ATOM   5167 C CE1 . PHE B 1 246 ? 3.348   48.653 35.532  1.00 28.84  ? 246 PHE B CE1 1 
ATOM   5168 C CE2 . PHE B 1 246 ? 2.088   49.729 37.258  1.00 29.78  ? 246 PHE B CE2 1 
ATOM   5169 C CZ  . PHE B 1 246 ? 3.093   49.761 36.319  1.00 27.61  ? 246 PHE B CZ  1 
ATOM   5170 N N   . LEU B 1 247 ? -0.491  43.549 38.260  1.00 28.04  ? 247 LEU B N   1 
ATOM   5171 C CA  . LEU B 1 247 ? -1.608  42.671 38.602  1.00 28.25  ? 247 LEU B CA  1 
ATOM   5172 C C   . LEU B 1 247 ? -1.710  42.465 40.119  1.00 33.51  ? 247 LEU B C   1 
ATOM   5173 O O   . LEU B 1 247 ? -2.821  42.426 40.647  1.00 32.37  ? 247 LEU B O   1 
ATOM   5174 C CB  . LEU B 1 247 ? -1.455  41.318 37.874  1.00 27.59  ? 247 LEU B CB  1 
ATOM   5175 C CG  . LEU B 1 247 ? -2.419  40.174 38.259  1.00 31.09  ? 247 LEU B CG  1 
ATOM   5176 C CD1 . LEU B 1 247 ? -3.820  40.434 37.752  1.00 30.77  ? 247 LEU B CD1 1 
ATOM   5177 C CD2 . LEU B 1 247 ? -1.922  38.834 37.744  1.00 30.57  ? 247 LEU B CD2 1 
ATOM   5178 N N   . SER B 1 248 ? -0.550  42.369 40.817  1.00 32.57  ? 248 SER B N   1 
ATOM   5179 C CA  . SER B 1 248 ? -0.494  42.172 42.281  1.00 33.26  ? 248 SER B CA  1 
ATOM   5180 C C   . SER B 1 248 ? -1.105  43.341 43.055  1.00 38.36  ? 248 SER B C   1 
ATOM   5181 O O   . SER B 1 248 ? -1.670  43.141 44.119  1.00 38.68  ? 248 SER B O   1 
ATOM   5182 C CB  . SER B 1 248 ? 0.930   41.875 42.754  1.00 35.12  ? 248 SER B CB  1 
ATOM   5183 O OG  . SER B 1 248 ? 1.711   43.034 42.998  1.00 42.61  ? 248 SER B OG  1 
ATOM   5184 N N   . MET B 1 249 ? -1.005  44.550 42.496  1.00 35.80  ? 249 MET B N   1 
ATOM   5185 C CA  . MET B 1 249 ? -1.505  45.781 43.097  1.00 36.09  ? 249 MET B CA  1 
ATOM   5186 C C   . MET B 1 249 ? -2.823  46.271 42.451  1.00 41.29  ? 249 MET B C   1 
ATOM   5187 O O   . MET B 1 249 ? -3.255  47.400 42.727  1.00 41.48  ? 249 MET B O   1 
ATOM   5188 C CB  . MET B 1 249 ? -0.392  46.868 43.119  1.00 37.82  ? 249 MET B CB  1 
ATOM   5189 C CG  . MET B 1 249 ? 0.173   47.214 41.758  1.00 40.14  ? 249 MET B CG  1 
ATOM   5190 S SD  . MET B 1 249 ? 1.565   48.387 41.782  1.00 44.86  ? 249 MET B SD  1 
ATOM   5191 C CE  . MET B 1 249 ? 2.895   47.327 42.208  1.00 40.68  ? 249 MET B CE  1 
ATOM   5192 N N   . ASP B 1 250 ? -3.474  45.409 41.624  1.00 37.49  ? 250 ASP B N   1 
ATOM   5193 C CA  . ASP B 1 250 ? -4.699  45.762 40.890  1.00 37.19  ? 250 ASP B CA  1 
ATOM   5194 C C   . ASP B 1 250 ? -5.996  45.734 41.709  1.00 44.34  ? 250 ASP B C   1 
ATOM   5195 O O   . ASP B 1 250 ? -6.821  44.825 41.566  1.00 45.51  ? 250 ASP B O   1 
ATOM   5196 C CB  . ASP B 1 250 ? -4.820  45.001 39.560  1.00 37.07  ? 250 ASP B CB  1 
ATOM   5197 C CG  . ASP B 1 250 ? -5.953  45.471 38.658  1.00 40.00  ? 250 ASP B CG  1 
ATOM   5198 O OD1 . ASP B 1 250 ? -6.344  46.666 38.752  1.00 38.34  ? 250 ASP B OD1 1 
ATOM   5199 O OD2 . ASP B 1 250 ? -6.422  44.661 37.832  1.00 44.35  ? 250 ASP B OD2 1 
ATOM   5200 N N   . VAL B 1 251 ? -6.184  46.763 42.534  1.00 41.05  ? 251 VAL B N   1 
ATOM   5201 C CA  . VAL B 1 251 ? -7.333  46.927 43.418  1.00 41.56  ? 251 VAL B CA  1 
ATOM   5202 C C   . VAL B 1 251 ? -8.636  47.193 42.626  1.00 42.88  ? 251 VAL B C   1 
ATOM   5203 O O   . VAL B 1 251 ? -9.697  46.717 43.028  1.00 42.26  ? 251 VAL B O   1 
ATOM   5204 C CB  . VAL B 1 251 ? -7.004  48.032 44.463  1.00 47.57  ? 251 VAL B CB  1 
ATOM   5205 C CG1 . VAL B 1 251 ? -8.203  48.371 45.346  1.00 48.99  ? 251 VAL B CG1 1 
ATOM   5206 C CG2 . VAL B 1 251 ? -5.809  47.627 45.320  1.00 47.50  ? 251 VAL B CG2 1 
ATOM   5207 N N   . ASP B 1 252 ? -8.535  47.923 41.494  1.00 37.89  ? 252 ASP B N   1 
ATOM   5208 C CA  . ASP B 1 252 ? -9.653  48.350 40.629  1.00 36.50  ? 252 ASP B CA  1 
ATOM   5209 C C   . ASP B 1 252 ? -10.078 47.372 39.538  1.00 36.16  ? 252 ASP B C   1 
ATOM   5210 O O   . ASP B 1 252 ? -11.197 47.484 39.036  1.00 34.61  ? 252 ASP B O   1 
ATOM   5211 C CB  . ASP B 1 252 ? -9.323  49.692 39.948  1.00 38.32  ? 252 ASP B CB  1 
ATOM   5212 C CG  . ASP B 1 252 ? -8.836  50.804 40.853  1.00 50.54  ? 252 ASP B CG  1 
ATOM   5213 O OD1 . ASP B 1 252 ? -8.738  50.577 42.085  1.00 51.86  ? 252 ASP B OD1 1 
ATOM   5214 O OD2 . ASP B 1 252 ? -8.549  51.897 40.335  1.00 56.64  ? 252 ASP B OD2 1 
ATOM   5215 N N   . GLY B 1 253 ? -9.182  46.478 39.128  1.00 31.06  ? 253 GLY B N   1 
ATOM   5216 C CA  . GLY B 1 253 ? -9.474  45.559 38.033  1.00 29.39  ? 253 GLY B CA  1 
ATOM   5217 C C   . GLY B 1 253 ? -9.297  46.273 36.708  1.00 31.48  ? 253 GLY B C   1 
ATOM   5218 O O   . GLY B 1 253 ? -10.161 46.209 35.835  1.00 29.62  ? 253 GLY B O   1 
ATOM   5219 N N   . ARG B 1 254 ? -8.184  47.016 36.587  1.00 28.16  ? 254 ARG B N   1 
ATOM   5220 C CA  . ARG B 1 254 ? -7.830  47.785 35.395  1.00 27.23  ? 254 ARG B CA  1 
ATOM   5221 C C   . ARG B 1 254 ? -6.584  47.224 34.691  1.00 29.50  ? 254 ARG B C   1 
ATOM   5222 O O   . ARG B 1 254 ? -6.101  47.842 33.743  1.00 28.02  ? 254 ARG B O   1 
ATOM   5223 C CB  . ARG B 1 254 ? -7.665  49.283 35.719  1.00 25.50  ? 254 ARG B CB  1 
ATOM   5224 C CG  . ARG B 1 254 ? -6.625  49.623 36.799  1.00 30.13  ? 254 ARG B CG  1 
ATOM   5225 C CD  . ARG B 1 254 ? -6.408  51.125 36.955  1.00 27.48  ? 254 ARG B CD  1 
ATOM   5226 N NE  . ARG B 1 254 ? -7.567  51.825 37.528  1.00 32.59  ? 254 ARG B NE  1 
ATOM   5227 C CZ  . ARG B 1 254 ? -8.452  52.528 36.823  1.00 48.14  ? 254 ARG B CZ  1 
ATOM   5228 N NH1 . ARG B 1 254 ? -8.344  52.613 35.501  1.00 28.61  ? 254 ARG B NH1 1 
ATOM   5229 N NH2 . ARG B 1 254 ? -9.457  53.141 37.430  1.00 45.96  ? 254 ARG B NH2 1 
ATOM   5230 N N   . VAL B 1 255 ? -6.103  46.034 35.117  1.00 25.09  ? 255 VAL B N   1 
ATOM   5231 C CA  . VAL B 1 255 ? -4.891  45.422 34.568  1.00 23.78  ? 255 VAL B CA  1 
ATOM   5232 C C   . VAL B 1 255 ? -5.148  44.157 33.736  1.00 28.62  ? 255 VAL B C   1 
ATOM   5233 O O   . VAL B 1 255 ? -5.837  43.244 34.201  1.00 29.50  ? 255 VAL B O   1 
ATOM   5234 C CB  . VAL B 1 255 ? -3.813  45.220 35.681  1.00 26.25  ? 255 VAL B CB  1 
ATOM   5235 C CG1 . VAL B 1 255 ? -2.579  44.503 35.159  1.00 24.86  ? 255 VAL B CG1 1 
ATOM   5236 C CG2 . VAL B 1 255 ? -3.417  46.547 36.325  1.00 26.65  ? 255 VAL B CG2 1 
ATOM   5237 N N   . ILE B 1 256 ? -4.585  44.120 32.508  1.00 24.34  ? 256 ILE B N   1 
ATOM   5238 C CA  . ILE B 1 256 ? -4.602  42.966 31.611  1.00 24.15  ? 256 ILE B CA  1 
ATOM   5239 C C   . ILE B 1 256 ? -3.148  42.502 31.509  1.00 30.49  ? 256 ILE B C   1 
ATOM   5240 O O   . ILE B 1 256 ? -2.307  43.226 30.971  1.00 31.58  ? 256 ILE B O   1 
ATOM   5241 C CB  . ILE B 1 256 ? -5.224  43.243 30.213  1.00 27.33  ? 256 ILE B CB  1 
ATOM   5242 C CG1 . ILE B 1 256 ? -6.708  43.631 30.313  1.00 28.21  ? 256 ILE B CG1 1 
ATOM   5243 C CG2 . ILE B 1 256 ? -5.046  42.027 29.290  1.00 28.32  ? 256 ILE B CG2 1 
ATOM   5244 C CD1 . ILE B 1 256 ? -7.211  44.508 29.162  1.00 32.02  ? 256 ILE B CD1 1 
ATOM   5245 N N   . ARG B 1 257 ? -2.856  41.305 32.038  1.00 27.08  ? 257 ARG B N   1 
ATOM   5246 C CA  . ARG B 1 257 ? -1.528  40.700 32.058  1.00 26.02  ? 257 ARG B CA  1 
ATOM   5247 C C   . ARG B 1 257 ? -1.377  39.566 31.056  1.00 29.58  ? 257 ARG B C   1 
ATOM   5248 O O   . ARG B 1 257 ? -2.184  38.639 31.055  1.00 29.08  ? 257 ARG B O   1 
ATOM   5249 C CB  . ARG B 1 257 ? -1.200  40.185 33.479  1.00 25.22  ? 257 ARG B CB  1 
ATOM   5250 C CG  . ARG B 1 257 ? 0.207   39.605 33.581  1.00 34.70  ? 257 ARG B CG  1 
ATOM   5251 C CD  . ARG B 1 257 ? 0.507   38.918 34.895  1.00 40.56  ? 257 ARG B CD  1 
ATOM   5252 N NE  . ARG B 1 257 ? 1.797   38.234 34.834  1.00 44.03  ? 257 ARG B NE  1 
ATOM   5253 C CZ  . ARG B 1 257 ? 2.970   38.838 34.989  1.00 56.75  ? 257 ARG B CZ  1 
ATOM   5254 N NH1 . ARG B 1 257 ? 4.096   38.146 34.900  1.00 40.43  ? 257 ARG B NH1 1 
ATOM   5255 N NH2 . ARG B 1 257 ? 3.027   40.142 35.223  1.00 47.56  ? 257 ARG B NH2 1 
ATOM   5256 N N   . ALA B 1 258 ? -0.299  39.606 30.252  1.00 26.54  ? 258 ALA B N   1 
ATOM   5257 C CA  . ALA B 1 258 ? 0.061   38.541 29.312  1.00 25.06  ? 258 ALA B CA  1 
ATOM   5258 C C   . ALA B 1 258 ? 1.298   37.822 29.832  1.00 30.25  ? 258 ALA B C   1 
ATOM   5259 O O   . ALA B 1 258 ? 2.265   38.471 30.235  1.00 28.76  ? 258 ALA B O   1 
ATOM   5260 C CB  . ALA B 1 258 ? 0.339   39.110 27.941  1.00 25.14  ? 258 ALA B CB  1 
ATOM   5261 N N   . ASP B 1 259 ? 1.237   36.472 29.868  1.00 29.03  ? 259 ASP B N   1 
ATOM   5262 C CA  . ASP B 1 259 ? 2.321   35.564 30.260  1.00 29.05  ? 259 ASP B CA  1 
ATOM   5263 C C   . ASP B 1 259 ? 2.644   34.631 29.093  1.00 35.74  ? 259 ASP B C   1 
ATOM   5264 O O   . ASP B 1 259 ? 1.750   34.272 28.320  1.00 35.29  ? 259 ASP B O   1 
ATOM   5265 C CB  . ASP B 1 259 ? 1.936   34.737 31.479  1.00 30.69  ? 259 ASP B CB  1 
ATOM   5266 C CG  . ASP B 1 259 ? 1.872   35.517 32.776  1.00 46.88  ? 259 ASP B CG  1 
ATOM   5267 O OD1 . ASP B 1 259 ? 2.952   35.854 33.319  1.00 47.55  ? 259 ASP B OD1 1 
ATOM   5268 O OD2 . ASP B 1 259 ? 0.737   35.736 33.286  1.00 55.00  ? 259 ASP B OD2 1 
ATOM   5269 N N   . SER B 1 260 ? 3.918   34.229 28.976  1.00 34.17  ? 260 SER B N   1 
ATOM   5270 C CA  . SER B 1 260 ? 4.377   33.369 27.897  1.00 34.43  ? 260 SER B CA  1 
ATOM   5271 C C   . SER B 1 260 ? 5.306   32.237 28.366  1.00 39.02  ? 260 SER B C   1 
ATOM   5272 O O   . SER B 1 260 ? 6.196   32.458 29.192  1.00 38.94  ? 260 SER B O   1 
ATOM   5273 C CB  . SER B 1 260 ? 5.070   34.205 26.822  1.00 37.29  ? 260 SER B CB  1 
ATOM   5274 O OG  . SER B 1 260 ? 5.445   33.426 25.698  1.00 45.67  ? 260 SER B OG  1 
ATOM   5275 N N   . PHE B 1 261 ? 5.128   31.042 27.777  1.00 34.66  ? 261 PHE B N   1 
ATOM   5276 C CA  . PHE B 1 261 ? 5.985   29.884 28.031  1.00 34.54  ? 261 PHE B CA  1 
ATOM   5277 C C   . PHE B 1 261 ? 7.152   29.795 27.015  1.00 36.44  ? 261 PHE B C   1 
ATOM   5278 O O   . PHE B 1 261 ? 8.014   28.931 27.157  1.00 35.49  ? 261 PHE B O   1 
ATOM   5279 C CB  . PHE B 1 261 ? 5.155   28.589 27.994  1.00 36.58  ? 261 PHE B CB  1 
ATOM   5280 C CG  . PHE B 1 261 ? 4.313   28.336 29.215  1.00 37.78  ? 261 PHE B CG  1 
ATOM   5281 C CD1 . PHE B 1 261 ? 4.869   28.393 30.488  1.00 40.74  ? 261 PHE B CD1 1 
ATOM   5282 C CD2 . PHE B 1 261 ? 2.972   27.996 29.093  1.00 40.00  ? 261 PHE B CD2 1 
ATOM   5283 C CE1 . PHE B 1 261 ? 4.091   28.159 31.617  1.00 42.13  ? 261 PHE B CE1 1 
ATOM   5284 C CE2 . PHE B 1 261 ? 2.192   27.754 30.223  1.00 43.25  ? 261 PHE B CE2 1 
ATOM   5285 C CZ  . PHE B 1 261 ? 2.759   27.827 31.480  1.00 41.77  ? 261 PHE B CZ  1 
ATOM   5286 N N   . SER B 1 262 ? 7.168   30.693 26.005  1.00 32.35  ? 262 SER B N   1 
ATOM   5287 C CA  . SER B 1 262 ? 8.138   30.753 24.909  1.00 32.06  ? 262 SER B CA  1 
ATOM   5288 C C   . SER B 1 262 ? 9.600   30.829 25.320  1.00 36.87  ? 262 SER B C   1 
ATOM   5289 O O   . SER B 1 262 ? 10.451  30.198 24.675  1.00 36.56  ? 262 SER B O   1 
ATOM   5290 C CB  . SER B 1 262 ? 7.803   31.884 23.945  1.00 33.87  ? 262 SER B CB  1 
ATOM   5291 O OG  . SER B 1 262 ? 6.574   31.626 23.294  1.00 43.37  ? 262 SER B OG  1 
ATOM   5292 N N   . LYS B 1 263 ? 9.901   31.586 26.382  1.00 32.94  ? 263 LYS B N   1 
ATOM   5293 C CA  . LYS B 1 263 ? 11.285  31.732 26.828  1.00 32.83  ? 263 LYS B CA  1 
ATOM   5294 C C   . LYS B 1 263 ? 11.701  30.670 27.852  1.00 35.77  ? 263 LYS B C   1 
ATOM   5295 O O   . LYS B 1 263 ? 12.891  30.471 28.064  1.00 35.53  ? 263 LYS B O   1 
ATOM   5296 C CB  . LYS B 1 263 ? 11.543  33.172 27.334  1.00 35.33  ? 263 LYS B CB  1 
ATOM   5297 C CG  . LYS B 1 263 ? 11.769  34.215 26.216  1.00 45.12  ? 263 LYS B CG  1 
ATOM   5298 C CD  . LYS B 1 263 ? 10.482  34.806 25.614  1.00 53.01  ? 263 LYS B CD  1 
ATOM   5299 C CE  . LYS B 1 263 ? 10.711  35.623 24.345  1.00 68.48  ? 263 LYS B CE  1 
ATOM   5300 N NZ  . LYS B 1 263 ? 11.056  34.795 23.145  1.00 70.24  ? 263 LYS B NZ  1 
ATOM   5301 N N   . ILE B 1 264 ? 10.728  29.942 28.430  1.00 32.29  ? 264 ILE B N   1 
ATOM   5302 C CA  . ILE B 1 264 ? 10.965  28.959 29.493  1.00 32.86  ? 264 ILE B CA  1 
ATOM   5303 C C   . ILE B 1 264 ? 10.631  27.483 29.213  1.00 36.72  ? 264 ILE B C   1 
ATOM   5304 O O   . ILE B 1 264 ? 11.309  26.606 29.757  1.00 36.47  ? 264 ILE B O   1 
ATOM   5305 C CB  . ILE B 1 264 ? 10.415  29.465 30.861  1.00 36.50  ? 264 ILE B CB  1 
ATOM   5306 C CG1 . ILE B 1 264 ? 8.922   29.906 30.751  1.00 36.59  ? 264 ILE B CG1 1 
ATOM   5307 C CG2 . ILE B 1 264 ? 11.291  30.613 31.392  1.00 37.84  ? 264 ILE B CG2 1 
ATOM   5308 C CD1 . ILE B 1 264 ? 8.149   30.032 32.070  1.00 42.31  ? 264 ILE B CD1 1 
ATOM   5309 N N   . ILE B 1 265 ? 9.594   27.199 28.394  1.00 33.39  ? 265 ILE B N   1 
ATOM   5310 C CA  . ILE B 1 265 ? 9.190   25.820 28.079  1.00 33.76  ? 265 ILE B CA  1 
ATOM   5311 C C   . ILE B 1 265 ? 9.317   25.463 26.589  1.00 40.95  ? 265 ILE B C   1 
ATOM   5312 O O   . ILE B 1 265 ? 9.985   24.474 26.265  1.00 43.17  ? 265 ILE B O   1 
ATOM   5313 C CB  . ILE B 1 265 ? 7.850   25.422 28.752  1.00 35.95  ? 265 ILE B CB  1 
ATOM   5314 C CG1 . ILE B 1 265 ? 8.121   24.951 30.180  1.00 36.34  ? 265 ILE B CG1 1 
ATOM   5315 C CG2 . ILE B 1 265 ? 7.093   24.343 27.977  1.00 37.18  ? 265 ILE B CG2 1 
ATOM   5316 C CD1 . ILE B 1 265 ? 7.113   25.435 31.225  1.00 45.23  ? 265 ILE B CD1 1 
ATOM   5317 N N   . SER B 1 266 ? 8.692   26.264 25.696  1.00 36.15  ? 266 SER B N   1 
ATOM   5318 C CA  . SER B 1 266 ? 8.733   26.091 24.241  1.00 35.45  ? 266 SER B CA  1 
ATOM   5319 C C   . SER B 1 266 ? 8.043   27.244 23.524  1.00 38.68  ? 266 SER B C   1 
ATOM   5320 O O   . SER B 1 266 ? 6.927   27.627 23.885  1.00 38.07  ? 266 SER B O   1 
ATOM   5321 C CB  . SER B 1 266 ? 8.100   24.768 23.817  1.00 37.97  ? 266 SER B CB  1 
ATOM   5322 O OG  . SER B 1 266 ? 7.935   24.681 22.413  1.00 43.85  ? 266 SER B OG  1 
ATOM   5323 N N   . SER B 1 267 ? 8.698   27.759 22.482  1.00 34.96  ? 267 SER B N   1 
ATOM   5324 C CA  . SER B 1 267 ? 8.179   28.825 21.633  1.00 34.56  ? 267 SER B CA  1 
ATOM   5325 C C   . SER B 1 267 ? 7.340   28.259 20.462  1.00 35.49  ? 267 SER B C   1 
ATOM   5326 O O   . SER B 1 267 ? 6.343   28.867 20.062  1.00 32.95  ? 267 SER B O   1 
ATOM   5327 C CB  . SER B 1 267 ? 9.329   29.682 21.110  1.00 39.34  ? 267 SER B CB  1 
ATOM   5328 O OG  . SER B 1 267 ? 10.329  28.864 20.519  1.00 49.62  ? 267 SER B OG  1 
ATOM   5329 N N   . GLY B 1 268 ? 7.753   27.097 19.953  1.00 32.13  ? 268 GLY B N   1 
ATOM   5330 C CA  . GLY B 1 268 ? 7.101   26.410 18.841  1.00 32.43  ? 268 GLY B CA  1 
ATOM   5331 C C   . GLY B 1 268 ? 5.785   25.729 19.156  1.00 36.35  ? 268 GLY B C   1 
ATOM   5332 O O   . GLY B 1 268 ? 5.065   25.341 18.234  1.00 36.69  ? 268 GLY B O   1 
ATOM   5333 N N   . LEU B 1 269 ? 5.472   25.545 20.450  1.00 32.29  ? 269 LEU B N   1 
ATOM   5334 C CA  . LEU B 1 269 ? 4.231   24.914 20.864  1.00 32.65  ? 269 LEU B CA  1 
ATOM   5335 C C   . LEU B 1 269 ? 3.052   25.893 20.799  1.00 38.60  ? 269 LEU B C   1 
ATOM   5336 O O   . LEU B 1 269 ? 1.903   25.451 20.729  1.00 39.85  ? 269 LEU B O   1 
ATOM   5337 C CB  . LEU B 1 269 ? 4.343   24.288 22.268  1.00 33.01  ? 269 LEU B CB  1 
ATOM   5338 C CG  . LEU B 1 269 ? 5.101   22.959 22.434  1.00 38.61  ? 269 LEU B CG  1 
ATOM   5339 C CD1 . LEU B 1 269 ? 4.961   22.454 23.854  1.00 38.33  ? 269 LEU B CD1 1 
ATOM   5340 C CD2 . LEU B 1 269 ? 4.610   21.882 21.468  1.00 43.60  ? 269 LEU B CD2 1 
ATOM   5341 N N   . ARG B 1 270 ? 3.336   27.223 20.804  1.00 34.51  ? 270 ARG B N   1 
ATOM   5342 C CA  . ARG B 1 270 ? 2.364   28.337 20.734  1.00 32.27  ? 270 ARG B CA  1 
ATOM   5343 C C   . ARG B 1 270 ? 1.343   28.272 21.875  1.00 35.60  ? 270 ARG B C   1 
ATOM   5344 O O   . ARG B 1 270 ? 0.158   28.013 21.650  1.00 35.90  ? 270 ARG B O   1 
ATOM   5345 C CB  . ARG B 1 270 ? 1.675   28.436 19.344  1.00 27.66  ? 270 ARG B CB  1 
ATOM   5346 C CG  . ARG B 1 270 ? 2.582   28.439 18.108  1.00 29.37  ? 270 ARG B CG  1 
ATOM   5347 C CD  . ARG B 1 270 ? 3.673   29.508 18.121  1.00 36.71  ? 270 ARG B CD  1 
ATOM   5348 N NE  . ARG B 1 270 ? 3.168   30.878 18.282  1.00 34.82  ? 270 ARG B NE  1 
ATOM   5349 C CZ  . ARG B 1 270 ? 3.576   31.717 19.227  1.00 41.09  ? 270 ARG B CZ  1 
ATOM   5350 N NH1 . ARG B 1 270 ? 4.486   31.335 20.117  1.00 18.08  ? 270 ARG B NH1 1 
ATOM   5351 N NH2 . ARG B 1 270 ? 3.072   32.944 19.296  1.00 36.89  ? 270 ARG B NH2 1 
ATOM   5352 N N   . ILE B 1 271 ? 1.826   28.441 23.106  1.00 31.86  ? 271 ILE B N   1 
ATOM   5353 C CA  . ILE B 1 271 ? 1.005   28.390 24.312  1.00 31.85  ? 271 ILE B CA  1 
ATOM   5354 C C   . ILE B 1 271 ? 1.407   29.526 25.251  1.00 35.79  ? 271 ILE B C   1 
ATOM   5355 O O   . ILE B 1 271 ? 2.551   29.577 25.729  1.00 38.77  ? 271 ILE B O   1 
ATOM   5356 C CB  . ILE B 1 271 ? 1.057   26.987 25.023  1.00 35.43  ? 271 ILE B CB  1 
ATOM   5357 C CG1 . ILE B 1 271 ? 0.444   25.839 24.167  1.00 35.91  ? 271 ILE B CG1 1 
ATOM   5358 C CG2 . ILE B 1 271 ? 0.455   27.025 26.447  1.00 36.57  ? 271 ILE B CG2 1 
ATOM   5359 C CD1 . ILE B 1 271 ? -1.131  25.910 23.835  1.00 45.02  ? 271 ILE B CD1 1 
ATOM   5360 N N   . GLY B 1 272 ? 0.449   30.409 25.497  1.00 27.52  ? 272 GLY B N   1 
ATOM   5361 C CA  . GLY B 1 272 ? 0.551   31.524 26.420  1.00 25.47  ? 272 GLY B CA  1 
ATOM   5362 C C   . GLY B 1 272 ? -0.751  31.666 27.184  1.00 27.70  ? 272 GLY B C   1 
ATOM   5363 O O   . GLY B 1 272 ? -1.685  30.879 26.981  1.00 25.11  ? 272 GLY B O   1 
ATOM   5364 N N   . PHE B 1 273 ? -0.839  32.686 28.056  1.00 25.40  ? 273 PHE B N   1 
ATOM   5365 C CA  . PHE B 1 273 ? -2.056  32.936 28.823  1.00 25.37  ? 273 PHE B CA  1 
ATOM   5366 C C   . PHE B 1 273 ? -2.263  34.386 29.182  1.00 31.42  ? 273 PHE B C   1 
ATOM   5367 O O   . PHE B 1 273 ? -1.300  35.122 29.419  1.00 33.04  ? 273 PHE B O   1 
ATOM   5368 C CB  . PHE B 1 273 ? -2.209  31.992 30.039  1.00 27.01  ? 273 PHE B CB  1 
ATOM   5369 C CG  . PHE B 1 273 ? -1.038  31.891 30.991  1.00 28.11  ? 273 PHE B CG  1 
ATOM   5370 C CD1 . PHE B 1 273 ? 0.096   31.165 30.652  1.00 30.74  ? 273 PHE B CD1 1 
ATOM   5371 C CD2 . PHE B 1 273 ? -1.096  32.467 32.252  1.00 30.16  ? 273 PHE B CD2 1 
ATOM   5372 C CE1 . PHE B 1 273 ? 1.173   31.074 31.532  1.00 32.02  ? 273 PHE B CE1 1 
ATOM   5373 C CE2 . PHE B 1 273 ? -0.035  32.341 33.147  1.00 33.06  ? 273 PHE B CE2 1 
ATOM   5374 C CZ  . PHE B 1 273 ? 1.091   31.642 32.784  1.00 31.38  ? 273 PHE B CZ  1 
ATOM   5375 N N   . LEU B 1 274 ? -3.531  34.797 29.203  1.00 26.81  ? 274 LEU B N   1 
ATOM   5376 C CA  . LEU B 1 274 ? -3.965  36.151 29.504  1.00 26.42  ? 274 LEU B CA  1 
ATOM   5377 C C   . LEU B 1 274 ? -4.710  36.143 30.827  1.00 30.69  ? 274 LEU B C   1 
ATOM   5378 O O   . LEU B 1 274 ? -5.523  35.251 31.065  1.00 30.50  ? 274 LEU B O   1 
ATOM   5379 C CB  . LEU B 1 274 ? -4.909  36.590 28.387  1.00 26.98  ? 274 LEU B CB  1 
ATOM   5380 C CG  . LEU B 1 274 ? -4.762  37.998 27.863  1.00 32.58  ? 274 LEU B CG  1 
ATOM   5381 C CD1 . LEU B 1 274 ? -3.418  38.193 27.172  1.00 32.72  ? 274 LEU B CD1 1 
ATOM   5382 C CD2 . LEU B 1 274 ? -5.868  38.289 26.890  1.00 35.50  ? 274 LEU B CD2 1 
ATOM   5383 N N   . THR B 1 275 ? -4.429  37.124 31.693  1.00 27.60  ? 275 THR B N   1 
ATOM   5384 C CA  . THR B 1 275 ? -5.061  37.270 33.004  1.00 27.34  ? 275 THR B CA  1 
ATOM   5385 C C   . THR B 1 275 ? -5.598  38.681 33.081  1.00 31.73  ? 275 THR B C   1 
ATOM   5386 O O   . THR B 1 275 ? -4.891  39.619 32.733  1.00 31.93  ? 275 THR B O   1 
ATOM   5387 C CB  . THR B 1 275 ? -4.064  37.021 34.141  1.00 33.24  ? 275 THR B CB  1 
ATOM   5388 O OG1 . THR B 1 275 ? -3.120  36.020 33.758  1.00 33.65  ? 275 THR B OG1 1 
ATOM   5389 C CG2 . THR B 1 275 ? -4.750  36.657 35.447  1.00 32.91  ? 275 THR B CG2 1 
ATOM   5390 N N   . GLY B 1 276 ? -6.843  38.818 33.515  1.00 27.43  ? 276 GLY B N   1 
ATOM   5391 C CA  . GLY B 1 276 ? -7.510  40.101 33.627  1.00 26.26  ? 276 GLY B CA  1 
ATOM   5392 C C   . GLY B 1 276 ? -8.961  39.994 34.035  1.00 28.51  ? 276 GLY B C   1 
ATOM   5393 O O   . GLY B 1 276 ? -9.414  38.915 34.437  1.00 26.51  ? 276 GLY B O   1 
ATOM   5394 N N   . PRO B 1 277 ? -9.700  41.133 33.949  1.00 26.32  ? 277 PRO B N   1 
ATOM   5395 C CA  . PRO B 1 277 ? -11.108 41.138 34.360  1.00 26.73  ? 277 PRO B CA  1 
ATOM   5396 C C   . PRO B 1 277 ? -11.994 40.276 33.462  1.00 31.23  ? 277 PRO B C   1 
ATOM   5397 O O   . PRO B 1 277 ? -11.865 40.334 32.236  1.00 29.38  ? 277 PRO B O   1 
ATOM   5398 C CB  . PRO B 1 277 ? -11.490 42.625 34.287  1.00 28.83  ? 277 PRO B CB  1 
ATOM   5399 C CG  . PRO B 1 277 ? -10.224 43.365 34.239  1.00 32.59  ? 277 PRO B CG  1 
ATOM   5400 C CD  . PRO B 1 277 ? -9.280  42.483 33.517  1.00 27.78  ? 277 PRO B CD  1 
ATOM   5401 N N   . LYS B 1 278 ? -12.889 39.463 34.092  1.00 29.35  ? 278 LYS B N   1 
ATOM   5402 C CA  . LYS B 1 278 ? -13.838 38.572 33.405  1.00 28.82  ? 278 LYS B CA  1 
ATOM   5403 C C   . LYS B 1 278 ? -14.543 39.263 32.190  1.00 31.67  ? 278 LYS B C   1 
ATOM   5404 O O   . LYS B 1 278 ? -14.472 38.703 31.095  1.00 29.30  ? 278 LYS B O   1 
ATOM   5405 C CB  . LYS B 1 278 ? -14.833 37.952 34.409  1.00 31.39  ? 278 LYS B CB  1 
ATOM   5406 C CG  . LYS B 1 278 ? -15.702 36.830 33.837  1.00 51.31  ? 278 LYS B CG  1 
ATOM   5407 C CD  . LYS B 1 278 ? -16.229 35.892 34.932  1.00 67.89  ? 278 LYS B CD  1 
ATOM   5408 C CE  . LYS B 1 278 ? -15.303 34.732 35.243  1.00 82.09  ? 278 LYS B CE  1 
ATOM   5409 N NZ  . LYS B 1 278 ? -15.806 33.906 36.372  1.00 92.50  ? 278 LYS B NZ  1 
ATOM   5410 N N   . PRO B 1 279 ? -15.138 40.488 32.322  1.00 29.39  ? 279 PRO B N   1 
ATOM   5411 C CA  . PRO B 1 279 ? -15.747 41.133 31.141  1.00 29.85  ? 279 PRO B CA  1 
ATOM   5412 C C   . PRO B 1 279 ? -14.838 41.254 29.898  1.00 34.70  ? 279 PRO B C   1 
ATOM   5413 O O   . PRO B 1 279 ? -15.298 40.972 28.779  1.00 35.23  ? 279 PRO B O   1 
ATOM   5414 C CB  . PRO B 1 279 ? -16.188 42.502 31.675  1.00 31.74  ? 279 PRO B CB  1 
ATOM   5415 C CG  . PRO B 1 279 ? -16.338 42.323 33.111  1.00 35.67  ? 279 PRO B CG  1 
ATOM   5416 C CD  . PRO B 1 279 ? -15.307 41.338 33.527  1.00 30.65  ? 279 PRO B CD  1 
ATOM   5417 N N   . LEU B 1 280 ? -13.555 41.639 30.092  1.00 29.89  ? 280 LEU B N   1 
ATOM   5418 C CA  . LEU B 1 280 ? -12.575 41.781 29.006  1.00 28.98  ? 280 LEU B CA  1 
ATOM   5419 C C   . LEU B 1 280 ? -12.010 40.426 28.525  1.00 33.34  ? 280 LEU B C   1 
ATOM   5420 O O   . LEU B 1 280 ? -11.725 40.248 27.334  1.00 33.25  ? 280 LEU B O   1 
ATOM   5421 C CB  . LEU B 1 280 ? -11.446 42.724 29.424  1.00 28.99  ? 280 LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 280 ? -11.877 44.141 29.862  1.00 35.63  ? 280 LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 280 ? -10.756 44.872 30.594  1.00 35.70  ? 280 LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 280 ? -12.422 44.973 28.692  1.00 37.54  ? 280 LEU B CD2 1 
ATOM   5425 N N   . ILE B 1 281 ? -11.849 39.468 29.450  1.00 29.41  ? 281 ILE B N   1 
ATOM   5426 C CA  . ILE B 1 281 ? -11.348 38.140 29.108  1.00 28.03  ? 281 ILE B CA  1 
ATOM   5427 C C   . ILE B 1 281 ? -12.399 37.409 28.216  1.00 34.60  ? 281 ILE B C   1 
ATOM   5428 O O   . ILE B 1 281 ? -12.026 36.791 27.210  1.00 35.31  ? 281 ILE B O   1 
ATOM   5429 C CB  . ILE B 1 281 ? -10.890 37.352 30.375  1.00 29.64  ? 281 ILE B CB  1 
ATOM   5430 C CG1 . ILE B 1 281 ? -9.656  37.991 31.060  1.00 28.21  ? 281 ILE B CG1 1 
ATOM   5431 C CG2 . ILE B 1 281 ? -10.679 35.861 30.099  1.00 30.27  ? 281 ILE B CG2 1 
ATOM   5432 C CD1 . ILE B 1 281 ? -8.302  37.982 30.274  1.00 22.83  ? 281 ILE B CD1 1 
ATOM   5433 N N   . GLU B 1 282 ? -13.707 37.558 28.545  1.00 30.18  ? 282 GLU B N   1 
ATOM   5434 C CA  . GLU B 1 282 ? -14.826 36.990 27.793  1.00 28.85  ? 282 GLU B CA  1 
ATOM   5435 C C   . GLU B 1 282 ? -14.752 37.453 26.318  1.00 30.27  ? 282 GLU B C   1 
ATOM   5436 O O   . GLU B 1 282 ? -14.666 36.609 25.418  1.00 29.42  ? 282 GLU B O   1 
ATOM   5437 C CB  . GLU B 1 282 ? -16.147 37.386 28.471  1.00 31.14  ? 282 GLU B CB  1 
ATOM   5438 C CG  . GLU B 1 282 ? -17.405 36.816 27.828  1.00 49.59  ? 282 GLU B CG  1 
ATOM   5439 C CD  . GLU B 1 282 ? -18.704 37.475 28.262  1.00 91.51  ? 282 GLU B CD  1 
ATOM   5440 O OE1 . GLU B 1 282 ? -18.796 38.724 28.197  1.00 97.76  ? 282 GLU B OE1 1 
ATOM   5441 O OE2 . GLU B 1 282 ? -19.645 36.736 28.632  1.00 94.38  ? 282 GLU B OE2 1 
ATOM   5442 N N   . ARG B 1 283 ? -14.682 38.792 26.089  1.00 25.61  ? 283 ARG B N   1 
ATOM   5443 C CA  . ARG B 1 283 ? -14.555 39.430 24.766  1.00 24.18  ? 283 ARG B CA  1 
ATOM   5444 C C   . ARG B 1 283 ? -13.429 38.774 23.960  1.00 27.13  ? 283 ARG B C   1 
ATOM   5445 O O   . ARG B 1 283 ? -13.593 38.553 22.760  1.00 26.65  ? 283 ARG B O   1 
ATOM   5446 C CB  . ARG B 1 283 ? -14.238 40.940 24.918  1.00 20.99  ? 283 ARG B CB  1 
ATOM   5447 C CG  . ARG B 1 283 ? -15.356 41.833 25.446  1.00 25.84  ? 283 ARG B CG  1 
ATOM   5448 C CD  . ARG B 1 283 ? -16.650 41.803 24.624  1.00 19.32  ? 283 ARG B CD  1 
ATOM   5449 N NE  . ARG B 1 283 ? -17.599 40.908 25.286  1.00 24.75  ? 283 ARG B NE  1 
ATOM   5450 C CZ  . ARG B 1 283 ? -18.554 40.204 24.686  1.00 37.04  ? 283 ARG B CZ  1 
ATOM   5451 N NH1 . ARG B 1 283 ? -19.363 39.438 25.399  1.00 24.75  ? 283 ARG B NH1 1 
ATOM   5452 N NH2 . ARG B 1 283 ? -18.725 40.282 23.370  1.00 24.45  ? 283 ARG B NH2 1 
ATOM   5453 N N   . VAL B 1 284 ? -12.275 38.479 24.636  1.00 22.07  ? 284 VAL B N   1 
ATOM   5454 C CA  . VAL B 1 284 ? -11.089 37.851 24.040  1.00 20.51  ? 284 VAL B CA  1 
ATOM   5455 C C   . VAL B 1 284 ? -11.344 36.385 23.644  1.00 21.71  ? 284 VAL B C   1 
ATOM   5456 O O   . VAL B 1 284 ? -11.067 36.017 22.505  1.00 19.25  ? 284 VAL B O   1 
ATOM   5457 C CB  . VAL B 1 284 ? -9.821  38.080 24.899  1.00 23.53  ? 284 VAL B CB  1 
ATOM   5458 C CG1 . VAL B 1 284 ? -8.653  37.188 24.461  1.00 22.33  ? 284 VAL B CG1 1 
ATOM   5459 C CG2 . VAL B 1 284 ? -9.426  39.553 24.862  1.00 23.30  ? 284 VAL B CG2 1 
ATOM   5460 N N   . ILE B 1 285 ? -11.946 35.585 24.560  1.00 18.58  ? 285 ILE B N   1 
ATOM   5461 C CA  . ILE B 1 285 ? -12.333 34.177 24.322  1.00 17.25  ? 285 ILE B CA  1 
ATOM   5462 C C   . ILE B 1 285 ? -13.294 34.116 23.148  1.00 20.43  ? 285 ILE B C   1 
ATOM   5463 O O   . ILE B 1 285 ? -13.143 33.244 22.288  1.00 19.54  ? 285 ILE B O   1 
ATOM   5464 C CB  . ILE B 1 285 ? -12.942 33.484 25.587  1.00 19.67  ? 285 ILE B CB  1 
ATOM   5465 C CG1 . ILE B 1 285 ? -11.900 33.411 26.735  1.00 19.26  ? 285 ILE B CG1 1 
ATOM   5466 C CG2 . ILE B 1 285 ? -13.468 32.077 25.240  1.00 19.34  ? 285 ILE B CG2 1 
ATOM   5467 C CD1 . ILE B 1 285 ? -12.432 33.173 28.112  1.00 25.10  ? 285 ILE B CD1 1 
ATOM   5468 N N   . LEU B 1 286 ? -14.227 35.079 23.083  1.00 17.54  ? 286 LEU B N   1 
ATOM   5469 C CA  . LEU B 1 286 ? -15.207 35.142 22.013  1.00 19.03  ? 286 LEU B CA  1 
ATOM   5470 C C   . LEU B 1 286 ? -14.665 35.432 20.608  1.00 27.05  ? 286 LEU B C   1 
ATOM   5471 O O   . LEU B 1 286 ? -15.226 34.921 19.625  1.00 28.18  ? 286 LEU B O   1 
ATOM   5472 C CB  . LEU B 1 286 ? -16.391 36.008 22.398  1.00 19.32  ? 286 LEU B CB  1 
ATOM   5473 C CG  . LEU B 1 286 ? -17.233 35.401 23.505  1.00 23.26  ? 286 LEU B CG  1 
ATOM   5474 C CD1 . LEU B 1 286 ? -18.157 36.421 24.072  1.00 24.31  ? 286 LEU B CD1 1 
ATOM   5475 C CD2 . LEU B 1 286 ? -17.996 34.191 23.016  1.00 24.87  ? 286 LEU B CD2 1 
ATOM   5476 N N   . HIS B 1 287 ? -13.541 36.183 20.518  1.00 23.72  ? 287 HIS B N   1 
ATOM   5477 C CA  . HIS B 1 287 ? -12.861 36.457 19.256  1.00 23.94  ? 287 HIS B CA  1 
ATOM   5478 C C   . HIS B 1 287 ? -12.078 35.202 18.853  1.00 28.43  ? 287 HIS B C   1 
ATOM   5479 O O   . HIS B 1 287 ? -12.152 34.776 17.699  1.00 30.13  ? 287 HIS B O   1 
ATOM   5480 C CB  . HIS B 1 287 ? -11.891 37.640 19.405  1.00 24.80  ? 287 HIS B CB  1 
ATOM   5481 C CG  . HIS B 1 287 ? -11.490 38.281 18.099  1.00 28.30  ? 287 HIS B CG  1 
ATOM   5482 N ND1 . HIS B 1 287 ? -10.782 39.474 18.072  1.00 29.47  ? 287 HIS B ND1 1 
ATOM   5483 C CD2 . HIS B 1 287 ? -11.731 37.890 16.820  1.00 30.12  ? 287 HIS B CD2 1 
ATOM   5484 C CE1 . HIS B 1 287 ? -10.644 39.779 16.794  1.00 29.27  ? 287 HIS B CE1 1 
ATOM   5485 N NE2 . HIS B 1 287 ? -11.179 38.845 16.001  1.00 29.86  ? 287 HIS B NE2 1 
ATOM   5486 N N   . ILE B 1 288 ? -11.337 34.609 19.816  1.00 22.83  ? 288 ILE B N   1 
ATOM   5487 C CA  . ILE B 1 288 ? -10.551 33.398 19.616  1.00 21.55  ? 288 ILE B CA  1 
ATOM   5488 C C   . ILE B 1 288 ? -11.418 32.292 19.044  1.00 28.30  ? 288 ILE B C   1 
ATOM   5489 O O   . ILE B 1 288 ? -11.009 31.666 18.048  1.00 29.25  ? 288 ILE B O   1 
ATOM   5490 C CB  . ILE B 1 288 ? -9.796  32.986 20.895  1.00 22.86  ? 288 ILE B CB  1 
ATOM   5491 C CG1 . ILE B 1 288 ? -8.593  33.937 21.131  1.00 20.95  ? 288 ILE B CG1 1 
ATOM   5492 C CG2 . ILE B 1 288 ? -9.359  31.507 20.845  1.00 23.55  ? 288 ILE B CG2 1 
ATOM   5493 C CD1 . ILE B 1 288 ? -7.961  33.840 22.476  1.00 16.34  ? 288 ILE B CD1 1 
ATOM   5494 N N   . GLN B 1 289 ? -12.632 32.092 19.626  1.00 24.17  ? 289 GLN B N   1 
ATOM   5495 C CA  . GLN B 1 289 ? -13.622 31.103 19.167  1.00 23.72  ? 289 GLN B CA  1 
ATOM   5496 C C   . GLN B 1 289 ? -13.894 31.236 17.646  1.00 28.74  ? 289 GLN B C   1 
ATOM   5497 O O   . GLN B 1 289 ? -14.137 30.218 16.999  1.00 28.17  ? 289 GLN B O   1 
ATOM   5498 C CB  . GLN B 1 289 ? -14.919 31.220 19.987  1.00 24.81  ? 289 GLN B CB  1 
ATOM   5499 C CG  . GLN B 1 289 ? -15.957 30.120 19.759  1.00 29.32  ? 289 GLN B CG  1 
ATOM   5500 C CD  . GLN B 1 289 ? -17.188 30.312 20.624  1.00 50.62  ? 289 GLN B CD  1 
ATOM   5501 O OE1 . GLN B 1 289 ? -18.125 31.043 20.271  1.00 49.48  ? 289 GLN B OE1 1 
ATOM   5502 N NE2 . GLN B 1 289 ? -17.224 29.652 21.777  1.00 38.25  ? 289 GLN B NE2 1 
ATOM   5503 N N   . VAL B 1 290 ? -13.795 32.468 17.067  1.00 25.57  ? 290 VAL B N   1 
ATOM   5504 C CA  . VAL B 1 290 ? -14.002 32.658 15.619  1.00 25.96  ? 290 VAL B CA  1 
ATOM   5505 C C   . VAL B 1 290 ? -12.702 32.699 14.798  1.00 33.15  ? 290 VAL B C   1 
ATOM   5506 O O   . VAL B 1 290 ? -12.765 32.793 13.574  1.00 34.62  ? 290 VAL B O   1 
ATOM   5507 C CB  . VAL B 1 290 ? -15.034 33.752 15.210  1.00 28.92  ? 290 VAL B CB  1 
ATOM   5508 C CG1 . VAL B 1 290 ? -16.401 33.493 15.831  1.00 28.12  ? 290 VAL B CG1 1 
ATOM   5509 C CG2 . VAL B 1 290 ? -14.526 35.164 15.519  1.00 28.76  ? 290 VAL B CG2 1 
ATOM   5510 N N   . SER B 1 291 ? -11.534 32.631 15.451  1.00 30.88  ? 291 SER B N   1 
ATOM   5511 C CA  . SER B 1 291 ? -10.263 32.631 14.711  1.00 31.93  ? 291 SER B CA  1 
ATOM   5512 C C   . SER B 1 291 ? -9.694  31.205 14.679  1.00 36.62  ? 291 SER B C   1 
ATOM   5513 O O   . SER B 1 291 ? -9.924  30.476 13.713  1.00 37.06  ? 291 SER B O   1 
ATOM   5514 C CB  . SER B 1 291 ? -9.240  33.597 15.316  1.00 36.38  ? 291 SER B CB  1 
ATOM   5515 O OG  . SER B 1 291 ? -9.824  34.722 15.953  1.00 48.22  ? 291 SER B OG  1 
ATOM   5516 N N   . THR B 1 292 ? -9.009  30.792 15.767  1.00 30.18  ? 292 THR B N   1 
ATOM   5517 C CA  . THR B 1 292 ? -8.352  29.494 15.891  1.00 27.68  ? 292 THR B CA  1 
ATOM   5518 C C   . THR B 1 292 ? -9.211  28.432 16.558  1.00 29.15  ? 292 THR B C   1 
ATOM   5519 O O   . THR B 1 292 ? -8.782  27.294 16.648  1.00 27.71  ? 292 THR B O   1 
ATOM   5520 C CB  . THR B 1 292 ? -7.049  29.690 16.656  1.00 24.57  ? 292 THR B CB  1 
ATOM   5521 O OG1 . THR B 1 292 ? -7.336  30.431 17.841  1.00 27.89  ? 292 THR B OG1 1 
ATOM   5522 C CG2 . THR B 1 292 ? -6.020  30.418 15.851  1.00 12.80  ? 292 THR B CG2 1 
ATOM   5523 N N   . LEU B 1 293 ? -10.393 28.813 17.061  1.00 27.93  ? 293 LEU B N   1 
ATOM   5524 C CA  . LEU B 1 293 ? -11.367 27.982 17.804  1.00 29.47  ? 293 LEU B CA  1 
ATOM   5525 C C   . LEU B 1 293 ? -10.909 27.726 19.228  1.00 31.68  ? 293 LEU B C   1 
ATOM   5526 O O   . LEU B 1 293 ? -11.673 27.959 20.173  1.00 30.02  ? 293 LEU B O   1 
ATOM   5527 C CB  . LEU B 1 293 ? -11.716 26.631 17.124  1.00 30.98  ? 293 LEU B CB  1 
ATOM   5528 C CG  . LEU B 1 293 ? -12.718 26.623 15.976  1.00 37.77  ? 293 LEU B CG  1 
ATOM   5529 C CD1 . LEU B 1 293 ? -12.815 25.236 15.375  1.00 38.24  ? 293 LEU B CD1 1 
ATOM   5530 C CD2 . LEU B 1 293 ? -14.100 27.001 16.460  1.00 43.30  ? 293 LEU B CD2 1 
ATOM   5531 N N   . HIS B 1 294 ? -9.668  27.203 19.366  1.00 28.22  ? 294 HIS B N   1 
ATOM   5532 C CA  . HIS B 1 294 ? -9.008  26.867 20.628  1.00 27.99  ? 294 HIS B CA  1 
ATOM   5533 C C   . HIS B 1 294 ? -7.491  26.658 20.426  1.00 32.26  ? 294 HIS B C   1 
ATOM   5534 O O   . HIS B 1 294 ? -7.076  26.403 19.291  1.00 31.30  ? 294 HIS B O   1 
ATOM   5535 C CB  . HIS B 1 294 ? -9.648  25.592 21.267  1.00 29.22  ? 294 HIS B CB  1 
ATOM   5536 C CG  . HIS B 1 294 ? -9.540  24.340 20.446  1.00 33.13  ? 294 HIS B CG  1 
ATOM   5537 N ND1 . HIS B 1 294 ? -8.431  23.513 20.531  1.00 35.13  ? 294 HIS B ND1 1 
ATOM   5538 C CD2 . HIS B 1 294 ? -10.418 23.802 19.568  1.00 35.12  ? 294 HIS B CD2 1 
ATOM   5539 C CE1 . HIS B 1 294 ? -8.667  22.509 19.706  1.00 34.81  ? 294 HIS B CE1 1 
ATOM   5540 N NE2 . HIS B 1 294 ? -9.843  22.645 19.096  1.00 35.24  ? 294 HIS B NE2 1 
ATOM   5541 N N   . PRO B 1 295 ? -6.642  26.705 21.498  1.00 29.55  ? 295 PRO B N   1 
ATOM   5542 C CA  . PRO B 1 295 ? -5.216  26.378 21.303  1.00 29.00  ? 295 PRO B CA  1 
ATOM   5543 C C   . PRO B 1 295 ? -5.088  24.845 21.197  1.00 32.19  ? 295 PRO B C   1 
ATOM   5544 O O   . PRO B 1 295 ? -5.878  24.135 21.836  1.00 32.73  ? 295 PRO B O   1 
ATOM   5545 C CB  . PRO B 1 295 ? -4.531  26.927 22.576  1.00 30.47  ? 295 PRO B CB  1 
ATOM   5546 C CG  . PRO B 1 295 ? -5.625  27.597 23.396  1.00 35.19  ? 295 PRO B CG  1 
ATOM   5547 C CD  . PRO B 1 295 ? -6.919  26.989 22.922  1.00 31.28  ? 295 PRO B CD  1 
ATOM   5548 N N   . SER B 1 296 ? -4.140  24.340 20.357  1.00 26.17  ? 296 SER B N   1 
ATOM   5549 C CA  . SER B 1 296 ? -3.881  22.919 20.119  1.00 25.77  ? 296 SER B CA  1 
ATOM   5550 C C   . SER B 1 296 ? -4.110  22.052 21.391  1.00 29.04  ? 296 SER B C   1 
ATOM   5551 O O   . SER B 1 296 ? -3.509  22.327 22.437  1.00 26.83  ? 296 SER B O   1 
ATOM   5552 C CB  . SER B 1 296 ? -2.469  22.728 19.571  1.00 29.13  ? 296 SER B CB  1 
ATOM   5553 O OG  . SER B 1 296 ? -2.120  21.356 19.446  1.00 39.33  ? 296 SER B OG  1 
ATOM   5554 N N   . THR B 1 297 ? -5.022  21.051 21.307  1.00 25.83  ? 297 THR B N   1 
ATOM   5555 C CA  . THR B 1 297 ? -5.337  20.169 22.436  1.00 25.91  ? 297 THR B CA  1 
ATOM   5556 C C   . THR B 1 297 ? -4.096  19.364 22.820  1.00 32.21  ? 297 THR B C   1 
ATOM   5557 O O   . THR B 1 297 ? -3.760  19.287 24.011  1.00 32.56  ? 297 THR B O   1 
ATOM   5558 C CB  . THR B 1 297 ? -6.555  19.268 22.153  1.00 28.94  ? 297 THR B CB  1 
ATOM   5559 O OG1 . THR B 1 297 ? -7.589  20.010 21.505  1.00 32.78  ? 297 THR B OG1 1 
ATOM   5560 C CG2 . THR B 1 297 ? -7.097  18.602 23.407  1.00 20.75  ? 297 THR B CG2 1 
ATOM   5561 N N   . PHE B 1 298 ? -3.388  18.816 21.804  1.00 28.50  ? 298 PHE B N   1 
ATOM   5562 C CA  . PHE B 1 298 ? -2.175  18.027 22.003  1.00 28.46  ? 298 PHE B CA  1 
ATOM   5563 C C   . PHE B 1 298 ? -1.136  18.823 22.812  1.00 32.38  ? 298 PHE B C   1 
ATOM   5564 O O   . PHE B 1 298 ? -0.652  18.329 23.832  1.00 32.79  ? 298 PHE B O   1 
ATOM   5565 C CB  . PHE B 1 298 ? -1.593  17.583 20.642  1.00 30.25  ? 298 PHE B CB  1 
ATOM   5566 C CG  . PHE B 1 298 ? -0.538  16.501 20.701  1.00 31.99  ? 298 PHE B CG  1 
ATOM   5567 C CD1 . PHE B 1 298 ? 0.754   16.784 21.134  1.00 33.36  ? 298 PHE B CD1 1 
ATOM   5568 C CD2 . PHE B 1 298 ? -0.813  15.216 20.257  1.00 34.96  ? 298 PHE B CD2 1 
ATOM   5569 C CE1 . PHE B 1 298 ? 1.727   15.788 21.176  1.00 34.38  ? 298 PHE B CE1 1 
ATOM   5570 C CE2 . PHE B 1 298 ? 0.169   14.221 20.294  1.00 37.30  ? 298 PHE B CE2 1 
ATOM   5571 C CZ  . PHE B 1 298 ? 1.426   14.515 20.762  1.00 34.56  ? 298 PHE B CZ  1 
ATOM   5572 N N   . ASN B 1 299 ? -0.821  20.056 22.363  1.00 27.96  ? 299 ASN B N   1 
ATOM   5573 C CA  . ASN B 1 299 ? 0.201   20.923 22.963  1.00 27.30  ? 299 ASN B CA  1 
ATOM   5574 C C   . ASN B 1 299 ? -0.048  21.317 24.419  1.00 30.02  ? 299 ASN B C   1 
ATOM   5575 O O   . ASN B 1 299 ? 0.909   21.389 25.212  1.00 28.75  ? 299 ASN B O   1 
ATOM   5576 C CB  . ASN B 1 299 ? 0.492   22.128 22.068  1.00 25.10  ? 299 ASN B CB  1 
ATOM   5577 C CG  . ASN B 1 299 ? 1.033   21.755 20.701  1.00 39.77  ? 299 ASN B CG  1 
ATOM   5578 O OD1 . ASN B 1 299 ? 1.287   20.581 20.382  1.00 24.92  ? 299 ASN B OD1 1 
ATOM   5579 N ND2 . ASN B 1 299 ? 1.231   22.755 19.860  1.00 30.62  ? 299 ASN B ND2 1 
ATOM   5580 N N   . GLN B 1 300 ? -1.336  21.515 24.771  1.00 25.09  ? 300 GLN B N   1 
ATOM   5581 C CA  . GLN B 1 300 ? -1.780  21.854 26.125  1.00 24.02  ? 300 GLN B CA  1 
ATOM   5582 C C   . GLN B 1 300 ? -1.599  20.669 27.075  1.00 26.90  ? 300 GLN B C   1 
ATOM   5583 O O   . GLN B 1 300 ? -1.101  20.836 28.186  1.00 25.99  ? 300 GLN B O   1 
ATOM   5584 C CB  . GLN B 1 300 ? -3.258  22.243 26.109  1.00 25.30  ? 300 GLN B CB  1 
ATOM   5585 C CG  . GLN B 1 300 ? -3.543  23.590 25.480  1.00 30.62  ? 300 GLN B CG  1 
ATOM   5586 C CD  . GLN B 1 300 ? -4.968  23.952 25.716  1.00 35.04  ? 300 GLN B CD  1 
ATOM   5587 O OE1 . GLN B 1 300 ? -5.333  24.393 26.793  1.00 32.32  ? 300 GLN B OE1 1 
ATOM   5588 N NE2 . GLN B 1 300 ? -5.815  23.716 24.740  1.00 27.04  ? 300 GLN B NE2 1 
ATOM   5589 N N   . LEU B 1 301 ? -2.023  19.480 26.634  1.00 24.02  ? 301 LEU B N   1 
ATOM   5590 C CA  . LEU B 1 301 ? -1.952  18.234 27.389  1.00 24.77  ? 301 LEU B CA  1 
ATOM   5591 C C   . LEU B 1 301 ? -0.509  17.941 27.777  1.00 30.91  ? 301 LEU B C   1 
ATOM   5592 O O   . LEU B 1 301 ? -0.249  17.579 28.929  1.00 30.39  ? 301 LEU B O   1 
ATOM   5593 C CB  . LEU B 1 301 ? -2.556  17.100 26.545  1.00 25.29  ? 301 LEU B CB  1 
ATOM   5594 C CG  . LEU B 1 301 ? -3.991  16.628 26.872  1.00 30.48  ? 301 LEU B CG  1 
ATOM   5595 C CD1 . LEU B 1 301 ? -5.000  17.711 26.700  1.00 30.53  ? 301 LEU B CD1 1 
ATOM   5596 C CD2 . LEU B 1 301 ? -4.411  15.550 25.910  1.00 35.15  ? 301 LEU B CD2 1 
ATOM   5597 N N   . MET B 1 302 ? 0.433   18.193 26.831  1.00 29.05  ? 302 MET B N   1 
ATOM   5598 C CA  . MET B 1 302 ? 1.875   18.062 27.001  1.00 29.71  ? 302 MET B CA  1 
ATOM   5599 C C   . MET B 1 302 ? 2.384   18.961 28.155  1.00 32.05  ? 302 MET B C   1 
ATOM   5600 O O   . MET B 1 302 ? 3.114   18.488 29.019  1.00 32.22  ? 302 MET B O   1 
ATOM   5601 C CB  . MET B 1 302 ? 2.561   18.475 25.703  1.00 32.76  ? 302 MET B CB  1 
ATOM   5602 C CG  . MET B 1 302 ? 2.882   17.326 24.784  1.00 38.90  ? 302 MET B CG  1 
ATOM   5603 S SD  . MET B 1 302 ? 3.722   17.855 23.242  1.00 44.79  ? 302 MET B SD  1 
ATOM   5604 C CE  . MET B 1 302 ? 5.298   18.452 23.909  1.00 41.71  ? 302 MET B CE  1 
ATOM   5605 N N   . ILE B 1 303 ? 2.005   20.253 28.160  1.00 26.82  ? 303 ILE B N   1 
ATOM   5606 C CA  . ILE B 1 303 ? 2.437   21.216 29.176  1.00 26.03  ? 303 ILE B CA  1 
ATOM   5607 C C   . ILE B 1 303 ? 1.746   20.904 30.506  1.00 28.49  ? 303 ILE B C   1 
ATOM   5608 O O   . ILE B 1 303 ? 2.424   20.806 31.535  1.00 28.35  ? 303 ILE B O   1 
ATOM   5609 C CB  . ILE B 1 303 ? 2.269   22.694 28.671  1.00 28.59  ? 303 ILE B CB  1 
ATOM   5610 C CG1 . ILE B 1 303 ? 3.343   23.041 27.619  1.00 28.76  ? 303 ILE B CG1 1 
ATOM   5611 C CG2 . ILE B 1 303 ? 2.272   23.736 29.809  1.00 28.53  ? 303 ILE B CG2 1 
ATOM   5612 C CD1 . ILE B 1 303 ? 2.971   24.149 26.706  1.00 34.01  ? 303 ILE B CD1 1 
ATOM   5613 N N   . SER B 1 304 ? 0.412   20.708 30.468  1.00 23.55  ? 304 SER B N   1 
ATOM   5614 C CA  . SER B 1 304 ? -0.411  20.387 31.635  1.00 23.05  ? 304 SER B CA  1 
ATOM   5615 C C   . SER B 1 304 ? 0.201   19.226 32.438  1.00 29.01  ? 304 SER B C   1 
ATOM   5616 O O   . SER B 1 304 ? 0.460   19.395 33.626  1.00 28.64  ? 304 SER B O   1 
ATOM   5617 C CB  . SER B 1 304 ? -1.833  20.055 31.203  1.00 23.82  ? 304 SER B CB  1 
ATOM   5618 O OG  . SER B 1 304 ? -2.678  19.965 32.333  1.00 29.30  ? 304 SER B OG  1 
ATOM   5619 N N   . GLN B 1 305 ? 0.508   18.092 31.762  1.00 26.75  ? 305 GLN B N   1 
ATOM   5620 C CA  . GLN B 1 305 ? 1.120   16.898 32.362  1.00 27.55  ? 305 GLN B CA  1 
ATOM   5621 C C   . GLN B 1 305 ? 2.523   17.156 32.910  1.00 30.17  ? 305 GLN B C   1 
ATOM   5622 O O   . GLN B 1 305 ? 2.861   16.613 33.957  1.00 31.45  ? 305 GLN B O   1 
ATOM   5623 C CB  . GLN B 1 305 ? 1.152   15.726 31.371  1.00 29.60  ? 305 GLN B CB  1 
ATOM   5624 C CG  . GLN B 1 305 ? -0.184  14.999 31.237  1.00 45.07  ? 305 GLN B CG  1 
ATOM   5625 C CD  . GLN B 1 305 ? -0.133  13.819 30.294  1.00 67.93  ? 305 GLN B CD  1 
ATOM   5626 O OE1 . GLN B 1 305 ? -1.022  13.647 29.450  1.00 67.26  ? 305 GLN B OE1 1 
ATOM   5627 N NE2 . GLN B 1 305 ? 0.877   12.950 30.436  1.00 54.03  ? 305 GLN B NE2 1 
ATOM   5628 N N   . LEU B 1 306 ? 3.336   17.962 32.211  1.00 24.01  ? 306 LEU B N   1 
ATOM   5629 C CA  . LEU B 1 306 ? 4.676   18.301 32.674  1.00 23.47  ? 306 LEU B CA  1 
ATOM   5630 C C   . LEU B 1 306 ? 4.559   19.137 33.954  1.00 27.83  ? 306 LEU B C   1 
ATOM   5631 O O   . LEU B 1 306 ? 5.126   18.730 34.975  1.00 28.51  ? 306 LEU B O   1 
ATOM   5632 C CB  . LEU B 1 306 ? 5.478   19.052 31.583  1.00 22.74  ? 306 LEU B CB  1 
ATOM   5633 C CG  . LEU B 1 306 ? 6.765   19.814 32.019  1.00 26.30  ? 306 LEU B CG  1 
ATOM   5634 C CD1 . LEU B 1 306 ? 7.960   18.869 32.155  1.00 26.76  ? 306 LEU B CD1 1 
ATOM   5635 C CD2 . LEU B 1 306 ? 7.096   20.918 31.030  1.00 25.55  ? 306 LEU B CD2 1 
ATOM   5636 N N   . LEU B 1 307 ? 3.785   20.273 33.898  1.00 22.39  ? 307 LEU B N   1 
ATOM   5637 C CA  . LEU B 1 307 ? 3.548   21.192 35.018  1.00 20.92  ? 307 LEU B CA  1 
ATOM   5638 C C   . LEU B 1 307 ? 2.966   20.475 36.220  1.00 27.06  ? 307 LEU B C   1 
ATOM   5639 O O   . LEU B 1 307 ? 3.448   20.703 37.329  1.00 27.26  ? 307 LEU B O   1 
ATOM   5640 C CB  . LEU B 1 307 ? 2.625   22.366 34.648  1.00 19.24  ? 307 LEU B CB  1 
ATOM   5641 C CG  . LEU B 1 307 ? 3.091   23.419 33.636  1.00 21.67  ? 307 LEU B CG  1 
ATOM   5642 C CD1 . LEU B 1 307 ? 1.942   24.357 33.295  1.00 23.29  ? 307 LEU B CD1 1 
ATOM   5643 C CD2 . LEU B 1 307 ? 4.276   24.236 34.145  1.00 20.85  ? 307 LEU B CD2 1 
ATOM   5644 N N   . HIS B 1 308 ? 1.940   19.601 36.011  1.00 25.13  ? 308 HIS B N   1 
ATOM   5645 C CA  . HIS B 1 308 ? 1.305   18.834 37.094  1.00 25.90  ? 308 HIS B CA  1 
ATOM   5646 C C   . HIS B 1 308 ? 2.264   17.892 37.788  1.00 35.37  ? 308 HIS B C   1 
ATOM   5647 O O   . HIS B 1 308 ? 2.310   17.922 39.013  1.00 38.12  ? 308 HIS B O   1 
ATOM   5648 C CB  . HIS B 1 308 ? 0.054   18.103 36.638  1.00 25.98  ? 308 HIS B CB  1 
ATOM   5649 C CG  . HIS B 1 308 ? -1.182  18.954 36.640  1.00 28.76  ? 308 HIS B CG  1 
ATOM   5650 N ND1 . HIS B 1 308 ? -1.378  19.956 35.696  1.00 29.95  ? 308 HIS B ND1 1 
ATOM   5651 C CD2 . HIS B 1 308 ? -2.275  18.888 37.433  1.00 30.04  ? 308 HIS B CD2 1 
ATOM   5652 C CE1 . HIS B 1 308 ? -2.573  20.464 35.953  1.00 28.72  ? 308 HIS B CE1 1 
ATOM   5653 N NE2 . HIS B 1 308 ? -3.147  19.854 36.988  1.00 29.50  ? 308 HIS B NE2 1 
ATOM   5654 N N   . GLU B 1 309 ? 3.071   17.103 37.031  1.00 32.43  ? 309 GLU B N   1 
ATOM   5655 C CA  . GLU B 1 309 ? 4.073   16.198 37.609  1.00 33.21  ? 309 GLU B CA  1 
ATOM   5656 C C   . GLU B 1 309 ? 5.161   17.006 38.348  1.00 36.76  ? 309 GLU B C   1 
ATOM   5657 O O   . GLU B 1 309 ? 5.560   16.631 39.457  1.00 37.64  ? 309 GLU B O   1 
ATOM   5658 C CB  . GLU B 1 309 ? 4.669   15.255 36.535  1.00 35.02  ? 309 GLU B CB  1 
ATOM   5659 C CG  . GLU B 1 309 ? 5.978   14.567 36.929  1.00 53.25  ? 309 GLU B CG  1 
ATOM   5660 C CD  . GLU B 1 309 ? 5.893   13.364 37.858  1.00 86.23  ? 309 GLU B CD  1 
ATOM   5661 O OE1 . GLU B 1 309 ? 5.293   12.343 37.449  1.00 91.10  ? 309 GLU B OE1 1 
ATOM   5662 O OE2 . GLU B 1 309 ? 6.490   13.413 38.960  1.00 78.21  ? 309 GLU B OE2 1 
ATOM   5663 N N   . TRP B 1 310 ? 5.599   18.128 37.760  1.00 31.30  ? 310 TRP B N   1 
ATOM   5664 C CA  . TRP B 1 310 ? 6.612   18.976 38.385  1.00 31.35  ? 310 TRP B CA  1 
ATOM   5665 C C   . TRP B 1 310 ? 6.166   19.559 39.726  1.00 38.21  ? 310 TRP B C   1 
ATOM   5666 O O   . TRP B 1 310 ? 6.917   19.553 40.695  1.00 41.01  ? 310 TRP B O   1 
ATOM   5667 C CB  . TRP B 1 310 ? 7.001   20.155 37.466  1.00 28.10  ? 310 TRP B CB  1 
ATOM   5668 C CG  . TRP B 1 310 ? 8.199   19.968 36.582  1.00 27.98  ? 310 TRP B CG  1 
ATOM   5669 C CD1 . TRP B 1 310 ? 9.077   18.930 36.586  1.00 31.49  ? 310 TRP B CD1 1 
ATOM   5670 C CD2 . TRP B 1 310 ? 8.645   20.866 35.557  1.00 26.83  ? 310 TRP B CD2 1 
ATOM   5671 N NE1 . TRP B 1 310 ? 10.043  19.123 35.625  1.00 30.32  ? 310 TRP B NE1 1 
ATOM   5672 C CE2 . TRP B 1 310 ? 9.807   20.304 34.984  1.00 30.35  ? 310 TRP B CE2 1 
ATOM   5673 C CE3 . TRP B 1 310 ? 8.158   22.083 35.046  1.00 26.81  ? 310 TRP B CE3 1 
ATOM   5674 C CZ2 . TRP B 1 310 ? 10.505  20.923 33.946  1.00 28.93  ? 310 TRP B CZ2 1 
ATOM   5675 C CZ3 . TRP B 1 310 ? 8.842   22.684 33.998  1.00 27.51  ? 310 TRP B CZ3 1 
ATOM   5676 C CH2 . TRP B 1 310 ? 9.980   22.087 33.438  1.00 28.52  ? 310 TRP B CH2 1 
ATOM   5677 N N   . GLY B 1 311 ? 4.969   20.098 39.747  1.00 33.57  ? 311 GLY B N   1 
ATOM   5678 C CA  . GLY B 1 311 ? 4.455   20.867 40.868  1.00 33.82  ? 311 GLY B CA  1 
ATOM   5679 C C   . GLY B 1 311 ? 5.022   22.274 40.730  1.00 39.08  ? 311 GLY B C   1 
ATOM   5680 O O   . GLY B 1 311 ? 5.844   22.516 39.834  1.00 38.83  ? 311 GLY B O   1 
ATOM   5681 N N   . GLU B 1 312 ? 4.644   23.219 41.616  1.00 36.28  ? 312 GLU B N   1 
ATOM   5682 C CA  . GLU B 1 312 ? 5.229   24.578 41.575  1.00 35.42  ? 312 GLU B CA  1 
ATOM   5683 C C   . GLU B 1 312 ? 6.747   24.529 41.834  1.00 38.65  ? 312 GLU B C   1 
ATOM   5684 O O   . GLU B 1 312 ? 7.492   25.229 41.154  1.00 38.16  ? 312 GLU B O   1 
ATOM   5685 C CB  . GLU B 1 312 ? 4.523   25.570 42.518  1.00 37.00  ? 312 GLU B CB  1 
ATOM   5686 C CG  . GLU B 1 312 ? 4.537   25.224 44.009  1.00 54.30  ? 312 GLU B CG  1 
ATOM   5687 C CD  . GLU B 1 312 ? 4.171   26.328 44.993  1.00 90.23  ? 312 GLU B CD  1 
ATOM   5688 O OE1 . GLU B 1 312 ? 4.330   27.522 44.647  1.00 99.98  ? 312 GLU B OE1 1 
ATOM   5689 O OE2 . GLU B 1 312 ? 3.854   25.991 46.157  1.00 85.20  ? 312 GLU B OE2 1 
ATOM   5690 N N   . GLU B 1 313 ? 7.184   23.622 42.752  1.00 35.36  ? 313 GLU B N   1 
ATOM   5691 C CA  . GLU B 1 313 ? 8.576   23.344 43.139  1.00 35.97  ? 313 GLU B CA  1 
ATOM   5692 C C   . GLU B 1 313 ? 9.406   22.980 41.898  1.00 37.28  ? 313 GLU B C   1 
ATOM   5693 O O   . GLU B 1 313 ? 10.454  23.585 41.647  1.00 35.42  ? 313 GLU B O   1 
ATOM   5694 C CB  . GLU B 1 313 ? 8.659   22.170 44.161  1.00 38.92  ? 313 GLU B CB  1 
ATOM   5695 C CG  . GLU B 1 313 ? 7.878   22.344 45.456  1.00 53.34  ? 313 GLU B CG  1 
ATOM   5696 C CD  . GLU B 1 313 ? 6.424   21.893 45.473  1.00 86.55  ? 313 GLU B CD  1 
ATOM   5697 O OE1 . GLU B 1 313 ? 5.772   21.881 44.401  1.00 75.56  ? 313 GLU B OE1 1 
ATOM   5698 O OE2 . GLU B 1 313 ? 5.922   21.595 46.582  1.00 90.51  ? 313 GLU B OE2 1 
ATOM   5699 N N   . GLY B 1 314 ? 8.903   22.010 41.132  1.00 33.13  ? 314 GLY B N   1 
ATOM   5700 C CA  . GLY B 1 314 ? 9.552   21.515 39.926  1.00 32.92  ? 314 GLY B CA  1 
ATOM   5701 C C   . GLY B 1 314 ? 9.748   22.596 38.891  1.00 35.17  ? 314 GLY B C   1 
ATOM   5702 O O   . GLY B 1 314 ? 10.818  22.690 38.270  1.00 33.07  ? 314 GLY B O   1 
ATOM   5703 N N   . PHE B 1 315 ? 8.681   23.427 38.735  1.00 31.14  ? 315 PHE B N   1 
ATOM   5704 C CA  . PHE B 1 315 ? 8.574   24.563 37.825  1.00 28.99  ? 315 PHE B CA  1 
ATOM   5705 C C   . PHE B 1 315 ? 9.641   25.599 38.145  1.00 33.71  ? 315 PHE B C   1 
ATOM   5706 O O   . PHE B 1 315 ? 10.395  25.990 37.253  1.00 33.51  ? 315 PHE B O   1 
ATOM   5707 C CB  . PHE B 1 315 ? 7.156   25.175 37.904  1.00 29.30  ? 315 PHE B CB  1 
ATOM   5708 C CG  . PHE B 1 315 ? 6.954   26.386 37.032  1.00 29.23  ? 315 PHE B CG  1 
ATOM   5709 C CD1 . PHE B 1 315 ? 6.960   26.275 35.646  1.00 30.97  ? 315 PHE B CD1 1 
ATOM   5710 C CD2 . PHE B 1 315 ? 6.793   27.645 37.593  1.00 31.06  ? 315 PHE B CD2 1 
ATOM   5711 C CE1 . PHE B 1 315 ? 6.834   27.410 34.837  1.00 31.03  ? 315 PHE B CE1 1 
ATOM   5712 C CE2 . PHE B 1 315 ? 6.664   28.782 36.780  1.00 32.65  ? 315 PHE B CE2 1 
ATOM   5713 C CZ  . PHE B 1 315 ? 6.681   28.657 35.410  1.00 29.52  ? 315 PHE B CZ  1 
ATOM   5714 N N   . MET B 1 316 ? 9.735   25.983 39.436  1.00 30.62  ? 316 MET B N   1 
ATOM   5715 C CA  . MET B 1 316 ? 10.643  26.979 39.991  1.00 30.49  ? 316 MET B CA  1 
ATOM   5716 C C   . MET B 1 316 ? 12.107  26.586 39.824  1.00 33.14  ? 316 MET B C   1 
ATOM   5717 O O   . MET B 1 316 ? 12.945  27.423 39.492  1.00 31.65  ? 316 MET B O   1 
ATOM   5718 C CB  . MET B 1 316 ? 10.268  27.213 41.458  1.00 34.05  ? 316 MET B CB  1 
ATOM   5719 C CG  . MET B 1 316 ? 9.619   28.564 41.733  1.00 38.32  ? 316 MET B CG  1 
ATOM   5720 S SD  . MET B 1 316 ? 8.339   29.135 40.576  1.00 42.52  ? 316 MET B SD  1 
ATOM   5721 C CE  . MET B 1 316 ? 9.059   30.635 40.007  1.00 38.58  ? 316 MET B CE  1 
ATOM   5722 N N   . ALA B 1 317 ? 12.388  25.293 40.003  1.00 30.83  ? 317 ALA B N   1 
ATOM   5723 C CA  . ALA B 1 317 ? 13.697  24.669 39.831  1.00 31.19  ? 317 ALA B CA  1 
ATOM   5724 C C   . ALA B 1 317 ? 14.129  24.803 38.356  1.00 33.62  ? 317 ALA B C   1 
ATOM   5725 O O   . ALA B 1 317 ? 15.279  25.194 38.086  1.00 34.35  ? 317 ALA B O   1 
ATOM   5726 C CB  . ALA B 1 317 ? 13.627  23.197 40.239  1.00 32.84  ? 317 ALA B CB  1 
ATOM   5727 N N   . HIS B 1 318 ? 13.194  24.525 37.416  1.00 27.50  ? 318 HIS B N   1 
ATOM   5728 C CA  . HIS B 1 318 ? 13.438  24.684 35.995  1.00 27.40  ? 318 HIS B CA  1 
ATOM   5729 C C   . HIS B 1 318 ? 13.706  26.157 35.638  1.00 32.49  ? 318 HIS B C   1 
ATOM   5730 O O   . HIS B 1 318 ? 14.670  26.392 34.912  1.00 32.86  ? 318 HIS B O   1 
ATOM   5731 C CB  . HIS B 1 318 ? 12.277  24.164 35.170  1.00 27.71  ? 318 HIS B CB  1 
ATOM   5732 C CG  . HIS B 1 318 ? 12.477  24.344 33.697  1.00 30.22  ? 318 HIS B CG  1 
ATOM   5733 N ND1 . HIS B 1 318 ? 13.096  23.376 32.933  1.00 32.63  ? 318 HIS B ND1 1 
ATOM   5734 C CD2 . HIS B 1 318 ? 12.119  25.367 32.895  1.00 30.28  ? 318 HIS B CD2 1 
ATOM   5735 C CE1 . HIS B 1 318 ? 13.101  23.842 31.698  1.00 30.92  ? 318 HIS B CE1 1 
ATOM   5736 N NE2 . HIS B 1 318 ? 12.527  25.037 31.629  1.00 30.20  ? 318 HIS B NE2 1 
ATOM   5737 N N   . VAL B 1 319 ? 12.882  27.140 36.129  1.00 28.04  ? 319 VAL B N   1 
ATOM   5738 C CA  . VAL B 1 319 ? 13.157  28.559 35.837  1.00 28.08  ? 319 VAL B CA  1 
ATOM   5739 C C   . VAL B 1 319 ? 14.527  28.999 36.361  1.00 33.25  ? 319 VAL B C   1 
ATOM   5740 O O   . VAL B 1 319 ? 15.246  29.717 35.655  1.00 32.12  ? 319 VAL B O   1 
ATOM   5741 C CB  . VAL B 1 319 ? 12.022  29.632 35.981  1.00 31.82  ? 319 VAL B CB  1 
ATOM   5742 C CG1 . VAL B 1 319 ? 10.623  29.027 35.870  1.00 31.47  ? 319 VAL B CG1 1 
ATOM   5743 C CG2 . VAL B 1 319 ? 12.166  30.476 37.243  1.00 32.06  ? 319 VAL B CG2 1 
ATOM   5744 N N   . ASP B 1 320 ? 14.918  28.482 37.549  1.00 31.41  ? 320 ASP B N   1 
ATOM   5745 C CA  . ASP B 1 320 ? 16.232  28.727 38.146  1.00 32.45  ? 320 ASP B CA  1 
ATOM   5746 C C   . ASP B 1 320 ? 17.370  28.184 37.271  1.00 36.23  ? 320 ASP B C   1 
ATOM   5747 O O   . ASP B 1 320 ? 18.391  28.864 37.131  1.00 35.22  ? 320 ASP B O   1 
ATOM   5748 C CB  . ASP B 1 320 ? 16.294  28.186 39.577  1.00 35.79  ? 320 ASP B CB  1 
ATOM   5749 C CG  . ASP B 1 320 ? 15.513  29.028 40.572  1.00 55.50  ? 320 ASP B CG  1 
ATOM   5750 O OD1 . ASP B 1 320 ? 14.644  29.828 40.129  1.00 57.93  ? 320 ASP B OD1 1 
ATOM   5751 O OD2 . ASP B 1 320 ? 15.762  28.889 41.796  1.00 61.72  ? 320 ASP B OD2 1 
ATOM   5752 N N   . ARG B 1 321 ? 17.171  26.992 36.641  1.00 33.66  ? 321 ARG B N   1 
ATOM   5753 C CA  . ARG B 1 321 ? 18.148  26.399 35.717  1.00 34.68  ? 321 ARG B CA  1 
ATOM   5754 C C   . ARG B 1 321 ? 18.279  27.300 34.460  1.00 39.79  ? 321 ARG B C   1 
ATOM   5755 O O   . ARG B 1 321 ? 19.388  27.667 34.075  1.00 40.59  ? 321 ARG B O   1 
ATOM   5756 C CB  . ARG B 1 321 ? 17.739  24.976 35.315  1.00 36.39  ? 321 ARG B CB  1 
ATOM   5757 C CG  . ARG B 1 321 ? 17.920  23.912 36.400  1.00 52.19  ? 321 ARG B CG  1 
ATOM   5758 C CD  . ARG B 1 321 ? 17.643  22.491 35.881  1.00 62.49  ? 321 ARG B CD  1 
ATOM   5759 N NE  . ARG B 1 321 ? 16.212  22.183 35.725  1.00 69.19  ? 321 ARG B NE  1 
ATOM   5760 C CZ  . ARG B 1 321 ? 15.505  21.419 36.557  1.00 80.27  ? 321 ARG B CZ  1 
ATOM   5761 N NH1 . ARG B 1 321 ? 16.083  20.869 37.621  1.00 67.13  ? 321 ARG B NH1 1 
ATOM   5762 N NH2 . ARG B 1 321 ? 14.213  21.205 36.336  1.00 62.79  ? 321 ARG B NH2 1 
ATOM   5763 N N   . VAL B 1 322 ? 17.143  27.697 33.868  1.00 35.68  ? 322 VAL B N   1 
ATOM   5764 C CA  . VAL B 1 322 ? 17.074  28.580 32.705  1.00 35.04  ? 322 VAL B CA  1 
ATOM   5765 C C   . VAL B 1 322 ? 17.801  29.915 32.983  1.00 39.59  ? 322 VAL B C   1 
ATOM   5766 O O   . VAL B 1 322 ? 18.741  30.228 32.246  1.00 39.37  ? 322 VAL B O   1 
ATOM   5767 C CB  . VAL B 1 322 ? 15.605  28.732 32.192  1.00 37.86  ? 322 VAL B CB  1 
ATOM   5768 C CG1 . VAL B 1 322 ? 15.399  30.014 31.384  1.00 37.06  ? 322 VAL B CG1 1 
ATOM   5769 C CG2 . VAL B 1 322 ? 15.187  27.505 31.384  1.00 37.46  ? 322 VAL B CG2 1 
ATOM   5770 N N   . ILE B 1 323 ? 17.413  30.651 34.082  1.00 35.51  ? 323 ILE B N   1 
ATOM   5771 C CA  . ILE B 1 323 ? 18.014  31.939 34.509  1.00 34.79  ? 323 ILE B CA  1 
ATOM   5772 C C   . ILE B 1 323 ? 19.545  31.835 34.622  1.00 41.12  ? 323 ILE B C   1 
ATOM   5773 O O   . ILE B 1 323 ? 20.257  32.744 34.185  1.00 40.27  ? 323 ILE B O   1 
ATOM   5774 C CB  . ILE B 1 323 ? 17.357  32.501 35.810  1.00 37.06  ? 323 ILE B CB  1 
ATOM   5775 C CG1 . ILE B 1 323 ? 15.890  32.877 35.572  1.00 36.91  ? 323 ILE B CG1 1 
ATOM   5776 C CG2 . ILE B 1 323 ? 18.088  33.717 36.343  1.00 37.17  ? 323 ILE B CG2 1 
ATOM   5777 C CD1 . ILE B 1 323 ? 15.009  33.039 36.869  1.00 43.12  ? 323 ILE B CD1 1 
ATOM   5778 N N   . ASP B 1 324 ? 20.036  30.705 35.169  1.00 40.02  ? 324 ASP B N   1 
ATOM   5779 C CA  . ASP B 1 324 ? 21.453  30.423 35.375  1.00 41.56  ? 324 ASP B CA  1 
ATOM   5780 C C   . ASP B 1 324 ? 22.281  30.514 34.098  1.00 46.56  ? 324 ASP B C   1 
ATOM   5781 O O   . ASP B 1 324 ? 23.364  31.104 34.106  1.00 46.83  ? 324 ASP B O   1 
ATOM   5782 C CB  . ASP B 1 324 ? 21.630  29.061 36.039  1.00 44.46  ? 324 ASP B CB  1 
ATOM   5783 C CG  . ASP B 1 324 ? 22.608  29.096 37.185  1.00 59.85  ? 324 ASP B CG  1 
ATOM   5784 O OD1 . ASP B 1 324 ? 22.241  29.627 38.261  1.00 61.72  ? 324 ASP B OD1 1 
ATOM   5785 O OD2 . ASP B 1 324 ? 23.743  28.591 37.012  1.00 66.63  ? 324 ASP B OD2 1 
ATOM   5786 N N   . PHE B 1 325 ? 21.742  29.970 33.002  1.00 43.15  ? 325 PHE B N   1 
ATOM   5787 C CA  . PHE B 1 325 ? 22.362  29.970 31.688  1.00 43.28  ? 325 PHE B CA  1 
ATOM   5788 C C   . PHE B 1 325 ? 22.427  31.392 31.102  1.00 48.06  ? 325 PHE B C   1 
ATOM   5789 O O   . PHE B 1 325 ? 23.520  31.835 30.732  1.00 49.21  ? 325 PHE B O   1 
ATOM   5790 C CB  . PHE B 1 325 ? 21.599  29.009 30.762  1.00 45.01  ? 325 PHE B CB  1 
ATOM   5791 C CG  . PHE B 1 325 ? 21.944  29.154 29.300  1.00 46.82  ? 325 PHE B CG  1 
ATOM   5792 C CD1 . PHE B 1 325 ? 23.086  28.556 28.777  1.00 50.18  ? 325 PHE B CD1 1 
ATOM   5793 C CD2 . PHE B 1 325 ? 21.128  29.894 28.445  1.00 47.74  ? 325 PHE B CD2 1 
ATOM   5794 C CE1 . PHE B 1 325 ? 23.412  28.706 27.430  1.00 50.80  ? 325 PHE B CE1 1 
ATOM   5795 C CE2 . PHE B 1 325 ? 21.465  30.053 27.100  1.00 50.22  ? 325 PHE B CE2 1 
ATOM   5796 C CZ  . PHE B 1 325 ? 22.604  29.460 26.603  1.00 48.85  ? 325 PHE B CZ  1 
ATOM   5797 N N   . TYR B 1 326 ? 21.268  32.102 31.023  1.00 43.18  ? 326 TYR B N   1 
ATOM   5798 C CA  . TYR B 1 326 ? 21.185  33.456 30.467  1.00 42.94  ? 326 TYR B CA  1 
ATOM   5799 C C   . TYR B 1 326 ? 22.020  34.484 31.231  1.00 46.87  ? 326 TYR B C   1 
ATOM   5800 O O   . TYR B 1 326 ? 22.515  35.437 30.634  1.00 45.94  ? 326 TYR B O   1 
ATOM   5801 C CB  . TYR B 1 326 ? 19.723  33.925 30.265  1.00 44.20  ? 326 TYR B CB  1 
ATOM   5802 C CG  . TYR B 1 326 ? 18.957  33.173 29.187  1.00 47.17  ? 326 TYR B CG  1 
ATOM   5803 C CD1 . TYR B 1 326 ? 19.230  33.378 27.836  1.00 49.01  ? 326 TYR B CD1 1 
ATOM   5804 C CD2 . TYR B 1 326 ? 17.934  32.287 29.518  1.00 48.28  ? 326 TYR B CD2 1 
ATOM   5805 C CE1 . TYR B 1 326 ? 18.526  32.696 26.843  1.00 49.21  ? 326 TYR B CE1 1 
ATOM   5806 C CE2 . TYR B 1 326 ? 17.206  31.619 28.532  1.00 49.03  ? 326 TYR B CE2 1 
ATOM   5807 C CZ  . TYR B 1 326 ? 17.512  31.820 27.195  1.00 57.47  ? 326 TYR B CZ  1 
ATOM   5808 O OH  . TYR B 1 326 ? 16.809  31.153 26.217  1.00 59.62  ? 326 TYR B OH  1 
ATOM   5809 N N   . SER B 1 327 ? 22.206  34.272 32.537  1.00 45.25  ? 327 SER B N   1 
ATOM   5810 C CA  . SER B 1 327 ? 23.018  35.139 33.393  1.00 46.17  ? 327 SER B CA  1 
ATOM   5811 C C   . SER B 1 327 ? 24.506  35.020 32.978  1.00 49.81  ? 327 SER B C   1 
ATOM   5812 O O   . SER B 1 327 ? 25.200  36.037 32.885  1.00 49.88  ? 327 SER B O   1 
ATOM   5813 C CB  . SER B 1 327 ? 22.826  34.758 34.862  1.00 51.02  ? 327 SER B CB  1 
ATOM   5814 O OG  . SER B 1 327 ? 23.107  35.854 35.717  1.00 62.25  ? 327 SER B OG  1 
ATOM   5815 N N   . ASN B 1 328 ? 24.969  33.779 32.692  1.00 44.49  ? 328 ASN B N   1 
ATOM   5816 C CA  . ASN B 1 328 ? 26.325  33.501 32.233  1.00 44.11  ? 328 ASN B CA  1 
ATOM   5817 C C   . ASN B 1 328 ? 26.518  34.101 30.845  1.00 45.61  ? 328 ASN B C   1 
ATOM   5818 O O   . ASN B 1 328 ? 27.539  34.753 30.599  1.00 45.70  ? 328 ASN B O   1 
ATOM   5819 C CB  . ASN B 1 328 ? 26.591  32.002 32.239  1.00 45.72  ? 328 ASN B CB  1 
ATOM   5820 C CG  . ASN B 1 328 ? 26.729  31.392 33.625  1.00 69.96  ? 328 ASN B CG  1 
ATOM   5821 O OD1 . ASN B 1 328 ? 26.649  30.169 33.790  1.00 59.17  ? 328 ASN B OD1 1 
ATOM   5822 N ND2 . ASN B 1 328 ? 26.966  32.213 34.655  1.00 63.87  ? 328 ASN B ND2 1 
ATOM   5823 N N   . GLN B 1 329 ? 25.494  33.952 29.969  1.00 39.23  ? 329 GLN B N   1 
ATOM   5824 C CA  . GLN B 1 329 ? 25.445  34.550 28.628  1.00 37.42  ? 329 GLN B CA  1 
ATOM   5825 C C   . GLN B 1 329 ? 25.529  36.095 28.701  1.00 39.23  ? 329 GLN B C   1 
ATOM   5826 O O   . GLN B 1 329 ? 26.219  36.717 27.895  1.00 39.77  ? 329 GLN B O   1 
ATOM   5827 C CB  . GLN B 1 329 ? 24.151  34.150 27.917  1.00 37.06  ? 329 GLN B CB  1 
ATOM   5828 C CG  . GLN B 1 329 ? 24.103  32.693 27.504  1.00 36.69  ? 329 GLN B CG  1 
ATOM   5829 C CD  . GLN B 1 329 ? 25.015  32.322 26.357  1.00 39.87  ? 329 GLN B CD  1 
ATOM   5830 O OE1 . GLN B 1 329 ? 25.956  31.545 26.528  1.00 36.99  ? 329 GLN B OE1 1 
ATOM   5831 N NE2 . GLN B 1 329 ? 24.679  32.755 25.143  1.00 19.39  ? 329 GLN B NE2 1 
ATOM   5832 N N   . LYS B 1 330 ? 24.834  36.698 29.677  1.00 32.92  ? 330 LYS B N   1 
ATOM   5833 C CA  . LYS B 1 330 ? 24.834  38.143 29.922  1.00 31.22  ? 330 LYS B CA  1 
ATOM   5834 C C   . LYS B 1 330 ? 26.239  38.598 30.337  1.00 32.89  ? 330 LYS B C   1 
ATOM   5835 O O   . LYS B 1 330 ? 26.695  39.635 29.856  1.00 33.03  ? 330 LYS B O   1 
ATOM   5836 C CB  . LYS B 1 330 ? 23.777  38.500 30.984  1.00 32.20  ? 330 LYS B CB  1 
ATOM   5837 C CG  . LYS B 1 330 ? 23.640  39.972 31.326  1.00 34.75  ? 330 LYS B CG  1 
ATOM   5838 C CD  . LYS B 1 330 ? 23.100  40.155 32.749  1.00 44.84  ? 330 LYS B CD  1 
ATOM   5839 C CE  . LYS B 1 330 ? 24.129  39.850 33.828  1.00 53.79  ? 330 LYS B CE  1 
ATOM   5840 N NZ  . LYS B 1 330 ? 23.549  39.093 34.972  1.00 55.17  ? 330 LYS B NZ  1 
ATOM   5841 N N   . ASP B 1 331 ? 26.935  37.811 31.181  1.00 27.95  ? 331 ASP B N   1 
ATOM   5842 C CA  . ASP B 1 331 ? 28.298  38.136 31.629  1.00 28.36  ? 331 ASP B CA  1 
ATOM   5843 C C   . ASP B 1 331 ? 29.291  38.132 30.460  1.00 32.81  ? 331 ASP B C   1 
ATOM   5844 O O   . ASP B 1 331 ? 30.112  39.048 30.347  1.00 31.69  ? 331 ASP B O   1 
ATOM   5845 C CB  . ASP B 1 331 ? 28.760  37.200 32.754  1.00 30.52  ? 331 ASP B CB  1 
ATOM   5846 C CG  . ASP B 1 331 ? 27.933  37.261 34.028  1.00 45.97  ? 331 ASP B CG  1 
ATOM   5847 O OD1 . ASP B 1 331 ? 27.478  38.376 34.396  1.00 44.92  ? 331 ASP B OD1 1 
ATOM   5848 O OD2 . ASP B 1 331 ? 27.781  36.202 34.690  1.00 59.11  ? 331 ASP B OD2 1 
ATOM   5849 N N   . ALA B 1 332 ? 29.184  37.113 29.580  1.00 30.10  ? 332 ALA B N   1 
ATOM   5850 C CA  . ALA B 1 332 ? 29.998  36.943 28.383  1.00 29.77  ? 332 ALA B CA  1 
ATOM   5851 C C   . ALA B 1 332 ? 29.796  38.136 27.428  1.00 33.60  ? 332 ALA B C   1 
ATOM   5852 O O   . ALA B 1 332 ? 30.785  38.753 27.040  1.00 33.96  ? 332 ALA B O   1 
ATOM   5853 C CB  . ALA B 1 332 ? 29.637  35.631 27.695  1.00 29.93  ? 332 ALA B CB  1 
ATOM   5854 N N   . ILE B 1 333 ? 28.530  38.498 27.108  1.00 30.17  ? 333 ILE B N   1 
ATOM   5855 C CA  . ILE B 1 333 ? 28.241  39.617 26.211  1.00 31.14  ? 333 ILE B CA  1 
ATOM   5856 C C   . ILE B 1 333 ? 28.815  40.942 26.774  1.00 37.18  ? 333 ILE B C   1 
ATOM   5857 O O   . ILE B 1 333 ? 29.339  41.758 26.011  1.00 38.31  ? 333 ILE B O   1 
ATOM   5858 C CB  . ILE B 1 333 ? 26.734  39.720 25.778  1.00 33.81  ? 333 ILE B CB  1 
ATOM   5859 C CG1 . ILE B 1 333 ? 26.567  40.541 24.478  1.00 34.20  ? 333 ILE B CG1 1 
ATOM   5860 C CG2 . ILE B 1 333 ? 25.822  40.284 26.880  1.00 34.15  ? 333 ILE B CG2 1 
ATOM   5861 C CD1 . ILE B 1 333 ? 26.321  39.742 23.299  1.00 43.84  ? 333 ILE B CD1 1 
ATOM   5862 N N   . LEU B 1 334 ? 28.730  41.128 28.107  1.00 32.07  ? 334 LEU B N   1 
ATOM   5863 C CA  . LEU B 1 334 ? 29.227  42.309 28.799  1.00 31.06  ? 334 LEU B CA  1 
ATOM   5864 C C   . LEU B 1 334 ? 30.746  42.398 28.759  1.00 34.14  ? 334 LEU B C   1 
ATOM   5865 O O   . LEU B 1 334 ? 31.289  43.494 28.648  1.00 33.12  ? 334 LEU B O   1 
ATOM   5866 C CB  . LEU B 1 334 ? 28.716  42.301 30.243  1.00 30.81  ? 334 LEU B CB  1 
ATOM   5867 C CG  . LEU B 1 334 ? 27.559  43.239 30.635  1.00 33.65  ? 334 LEU B CG  1 
ATOM   5868 C CD1 . LEU B 1 334 ? 26.979  43.999 29.458  1.00 32.64  ? 334 LEU B CD1 1 
ATOM   5869 C CD2 . LEU B 1 334 ? 26.499  42.511 31.423  1.00 33.59  ? 334 LEU B CD2 1 
ATOM   5870 N N   . ALA B 1 335 ? 31.431  41.239 28.824  1.00 32.76  ? 335 ALA B N   1 
ATOM   5871 C CA  . ALA B 1 335 ? 32.901  41.138 28.757  1.00 33.38  ? 335 ALA B CA  1 
ATOM   5872 C C   . ALA B 1 335 ? 33.367  41.501 27.342  1.00 38.83  ? 335 ALA B C   1 
ATOM   5873 O O   . ALA B 1 335 ? 34.229  42.376 27.191  1.00 37.56  ? 335 ALA B O   1 
ATOM   5874 C CB  . ALA B 1 335 ? 33.356  39.736 29.131  1.00 33.85  ? 335 ALA B CB  1 
ATOM   5875 N N   . ALA B 1 336 ? 32.738  40.877 26.309  1.00 37.30  ? 336 ALA B N   1 
ATOM   5876 C CA  . ALA B 1 336 ? 33.026  41.134 24.897  1.00 38.40  ? 336 ALA B CA  1 
ATOM   5877 C C   . ALA B 1 336 ? 32.751  42.616 24.565  1.00 47.04  ? 336 ALA B C   1 
ATOM   5878 O O   . ALA B 1 336 ? 33.555  43.234 23.864  1.00 49.14  ? 336 ALA B O   1 
ATOM   5879 C CB  . ALA B 1 336 ? 32.214  40.208 24.007  1.00 37.93  ? 336 ALA B CB  1 
ATOM   5880 N N   . ALA B 1 337 ? 31.672  43.201 25.138  1.00 43.76  ? 337 ALA B N   1 
ATOM   5881 C CA  . ALA B 1 337 ? 31.332  44.619 24.978  1.00 43.83  ? 337 ALA B CA  1 
ATOM   5882 C C   . ALA B 1 337 ? 32.408  45.496 25.611  1.00 49.64  ? 337 ALA B C   1 
ATOM   5883 O O   . ALA B 1 337 ? 32.795  46.496 25.004  1.00 50.76  ? 337 ALA B O   1 
ATOM   5884 C CB  . ALA B 1 337 ? 29.980  44.923 25.603  1.00 43.58  ? 337 ALA B CB  1 
ATOM   5885 N N   . ASP B 1 338 ? 32.918  45.106 26.806  1.00 45.71  ? 338 ASP B N   1 
ATOM   5886 C CA  . ASP B 1 338 ? 33.963  45.855 27.526  1.00 45.77  ? 338 ASP B CA  1 
ATOM   5887 C C   . ASP B 1 338 ? 35.267  45.910 26.733  1.00 47.38  ? 338 ASP B C   1 
ATOM   5888 O O   . ASP B 1 338 ? 35.820  46.983 26.531  1.00 45.66  ? 338 ASP B O   1 
ATOM   5889 C CB  . ASP B 1 338 ? 34.210  45.265 28.939  1.00 48.03  ? 338 ASP B CB  1 
ATOM   5890 C CG  . ASP B 1 338 ? 33.225  45.681 30.032  1.00 54.00  ? 338 ASP B CG  1 
ATOM   5891 O OD1 . ASP B 1 338 ? 32.505  46.696 29.842  1.00 51.19  ? 338 ASP B OD1 1 
ATOM   5892 O OD2 . ASP B 1 338 ? 33.208  45.020 31.096  1.00 62.06  ? 338 ASP B OD2 1 
ATOM   5893 N N   . LYS B 1 339 ? 35.715  44.743 26.256  1.00 44.21  ? 339 LYS B N   1 
ATOM   5894 C CA  . LYS B 1 339 ? 36.934  44.512 25.482  1.00 44.20  ? 339 LYS B CA  1 
ATOM   5895 C C   . LYS B 1 339 ? 37.062  45.365 24.214  1.00 46.44  ? 339 LYS B C   1 
ATOM   5896 O O   . LYS B 1 339 ? 38.125  45.938 23.987  1.00 47.17  ? 339 LYS B O   1 
ATOM   5897 C CB  . LYS B 1 339 ? 37.011  43.014 25.120  1.00 45.94  ? 339 LYS B CB  1 
ATOM   5898 C CG  . LYS B 1 339 ? 38.342  42.525 24.567  1.00 50.98  ? 339 LYS B CG  1 
ATOM   5899 C CD  . LYS B 1 339 ? 38.292  41.014 24.471  1.00 62.76  ? 339 LYS B CD  1 
ATOM   5900 C CE  . LYS B 1 339 ? 39.588  40.352 24.092  1.00 70.19  ? 339 LYS B CE  1 
ATOM   5901 N NZ  . LYS B 1 339 ? 39.386  38.899 23.840  1.00 77.60  ? 339 LYS B NZ  1 
ATOM   5902 N N   . TRP B 1 340 ? 36.000  45.434 23.394  1.00 41.52  ? 340 TRP B N   1 
ATOM   5903 C CA  . TRP B 1 340 ? 36.023  46.085 22.088  1.00 41.71  ? 340 TRP B CA  1 
ATOM   5904 C C   . TRP B 1 340 ? 35.286  47.403 21.947  1.00 44.67  ? 340 TRP B C   1 
ATOM   5905 O O   . TRP B 1 340 ? 35.762  48.261 21.212  1.00 44.81  ? 340 TRP B O   1 
ATOM   5906 C CB  . TRP B 1 340 ? 35.529  45.103 21.003  1.00 40.63  ? 340 TRP B CB  1 
ATOM   5907 C CG  . TRP B 1 340 ? 36.204  43.764 21.034  1.00 42.53  ? 340 TRP B CG  1 
ATOM   5908 C CD1 . TRP B 1 340 ? 35.704  42.599 21.546  1.00 44.81  ? 340 TRP B CD1 1 
ATOM   5909 C CD2 . TRP B 1 340 ? 37.532  43.470 20.588  1.00 43.80  ? 340 TRP B CD2 1 
ATOM   5910 N NE1 . TRP B 1 340 ? 36.632  41.589 21.425  1.00 44.96  ? 340 TRP B NE1 1 
ATOM   5911 C CE2 . TRP B 1 340 ? 37.766  42.097 20.844  1.00 48.11  ? 340 TRP B CE2 1 
ATOM   5912 C CE3 . TRP B 1 340 ? 38.546  44.231 19.980  1.00 45.70  ? 340 TRP B CE3 1 
ATOM   5913 C CZ2 . TRP B 1 340 ? 38.980  41.476 20.525  1.00 48.78  ? 340 TRP B CZ2 1 
ATOM   5914 C CZ3 . TRP B 1 340 ? 39.744  43.613 19.662  1.00 48.17  ? 340 TRP B CZ3 1 
ATOM   5915 C CH2 . TRP B 1 340 ? 39.958  42.258 19.946  1.00 49.10  ? 340 TRP B CH2 1 
ATOM   5916 N N   . LEU B 1 341 ? 34.104  47.541 22.562  1.00 41.32  ? 341 LEU B N   1 
ATOM   5917 C CA  . LEU B 1 341 ? 33.229  48.717 22.410  1.00 41.41  ? 341 LEU B CA  1 
ATOM   5918 C C   . LEU B 1 341 ? 33.539  49.933 23.296  1.00 43.50  ? 341 LEU B C   1 
ATOM   5919 O O   . LEU B 1 341 ? 33.073  51.033 22.991  1.00 41.93  ? 341 LEU B O   1 
ATOM   5920 C CB  . LEU B 1 341 ? 31.738  48.323 22.522  1.00 41.01  ? 341 LEU B CB  1 
ATOM   5921 C CG  . LEU B 1 341 ? 31.122  47.464 21.391  1.00 45.84  ? 341 LEU B CG  1 
ATOM   5922 C CD1 . LEU B 1 341 ? 31.489  46.017 21.525  1.00 46.33  ? 341 LEU B CD1 1 
ATOM   5923 C CD2 . LEU B 1 341 ? 29.622  47.505 21.454  1.00 46.64  ? 341 LEU B CD2 1 
ATOM   5924 N N   . THR B 1 342 ? 34.313  49.746 24.382  1.00 39.78  ? 342 THR B N   1 
ATOM   5925 C CA  . THR B 1 342 ? 34.670  50.851 25.279  1.00 39.52  ? 342 THR B CA  1 
ATOM   5926 C C   . THR B 1 342 ? 35.373  51.924 24.472  1.00 41.97  ? 342 THR B C   1 
ATOM   5927 O O   . THR B 1 342 ? 36.294  51.612 23.713  1.00 42.89  ? 342 THR B O   1 
ATOM   5928 C CB  . THR B 1 342 ? 35.463  50.373 26.525  1.00 47.84  ? 342 THR B CB  1 
ATOM   5929 O OG1 . THR B 1 342 ? 34.737  49.339 27.195  1.00 51.85  ? 342 THR B OG1 1 
ATOM   5930 C CG2 . THR B 1 342 ? 35.703  51.497 27.535  1.00 38.19  ? 342 THR B CG2 1 
ATOM   5931 N N   . GLY B 1 343 ? 34.860  53.148 24.587  1.00 36.46  ? 343 GLY B N   1 
ATOM   5932 C CA  . GLY B 1 343 ? 35.330  54.329 23.870  1.00 36.60  ? 343 GLY B CA  1 
ATOM   5933 C C   . GLY B 1 343 ? 34.506  54.628 22.632  1.00 40.60  ? 343 GLY B C   1 
ATOM   5934 O O   . GLY B 1 343 ? 34.442  55.779 22.198  1.00 41.92  ? 343 GLY B O   1 
ATOM   5935 N N   . LEU B 1 344 ? 33.823  53.591 22.083  1.00 34.81  ? 344 LEU B N   1 
ATOM   5936 C CA  . LEU B 1 344 ? 33.006  53.655 20.858  1.00 32.56  ? 344 LEU B CA  1 
ATOM   5937 C C   . LEU B 1 344 ? 31.503  53.599 21.102  1.00 35.32  ? 344 LEU B C   1 
ATOM   5938 O O   . LEU B 1 344 ? 30.745  53.930 20.199  1.00 32.53  ? 344 LEU B O   1 
ATOM   5939 C CB  . LEU B 1 344 ? 33.386  52.491 19.910  1.00 31.46  ? 344 LEU B CB  1 
ATOM   5940 C CG  . LEU B 1 344 ? 34.864  52.211 19.695  1.00 35.41  ? 344 LEU B CG  1 
ATOM   5941 C CD1 . LEU B 1 344 ? 35.039  50.930 18.938  1.00 35.15  ? 344 LEU B CD1 1 
ATOM   5942 C CD2 . LEU B 1 344 ? 35.570  53.379 18.978  1.00 34.86  ? 344 LEU B CD2 1 
ATOM   5943 N N   . ALA B 1 345 ? 31.066  53.107 22.275  1.00 33.67  ? 345 ALA B N   1 
ATOM   5944 C CA  . ALA B 1 345 ? 29.648  52.942 22.590  1.00 32.88  ? 345 ALA B CA  1 
ATOM   5945 C C   . ALA B 1 345 ? 29.345  53.062 24.087  1.00 37.69  ? 345 ALA B C   1 
ATOM   5946 O O   . ALA B 1 345 ? 30.262  53.181 24.903  1.00 37.51  ? 345 ALA B O   1 
ATOM   5947 C CB  . ALA B 1 345 ? 29.158  51.599 22.068  1.00 32.92  ? 345 ALA B CB  1 
ATOM   5948 N N   . GLU B 1 346 ? 28.044  53.086 24.426  1.00 34.70  ? 346 GLU B N   1 
ATOM   5949 C CA  . GLU B 1 346 ? 27.502  53.157 25.783  1.00 34.76  ? 346 GLU B CA  1 
ATOM   5950 C C   . GLU B 1 346 ? 26.337  52.185 25.898  1.00 38.29  ? 346 GLU B C   1 
ATOM   5951 O O   . GLU B 1 346 ? 25.590  51.990 24.936  1.00 37.10  ? 346 GLU B O   1 
ATOM   5952 C CB  . GLU B 1 346 ? 27.033  54.574 26.118  1.00 36.84  ? 346 GLU B CB  1 
ATOM   5953 C CG  . GLU B 1 346 ? 28.174  55.571 26.240  1.00 51.50  ? 346 GLU B CG  1 
ATOM   5954 C CD  . GLU B 1 346 ? 27.935  56.769 27.133  1.00 76.97  ? 346 GLU B CD  1 
ATOM   5955 O OE1 . GLU B 1 346 ? 26.881  57.434 26.989  1.00 79.36  ? 346 GLU B OE1 1 
ATOM   5956 O OE2 . GLU B 1 346 ? 28.833  57.060 27.956  1.00 70.07  ? 346 GLU B OE2 1 
ATOM   5957 N N   . TRP B 1 347 ? 26.208  51.544 27.068  1.00 35.50  ? 347 TRP B N   1 
ATOM   5958 C CA  . TRP B 1 347 ? 25.161  50.554 27.326  1.00 34.45  ? 347 TRP B CA  1 
ATOM   5959 C C   . TRP B 1 347 ? 24.833  50.446 28.806  1.00 40.19  ? 347 TRP B C   1 
ATOM   5960 O O   . TRP B 1 347 ? 25.654  50.792 29.651  1.00 40.88  ? 347 TRP B O   1 
ATOM   5961 C CB  . TRP B 1 347 ? 25.540  49.168 26.741  1.00 32.39  ? 347 TRP B CB  1 
ATOM   5962 C CG  . TRP B 1 347 ? 26.812  48.583 27.282  1.00 34.04  ? 347 TRP B CG  1 
ATOM   5963 C CD1 . TRP B 1 347 ? 26.935  47.710 28.321  1.00 36.85  ? 347 TRP B CD1 1 
ATOM   5964 C CD2 . TRP B 1 347 ? 28.152  48.836 26.808  1.00 35.11  ? 347 TRP B CD2 1 
ATOM   5965 N NE1 . TRP B 1 347 ? 28.263  47.377 28.509  1.00 37.24  ? 347 TRP B NE1 1 
ATOM   5966 C CE2 . TRP B 1 347 ? 29.031  48.064 27.602  1.00 39.27  ? 347 TRP B CE2 1 
ATOM   5967 C CE3 . TRP B 1 347 ? 28.693  49.632 25.773  1.00 36.49  ? 347 TRP B CE3 1 
ATOM   5968 C CZ2 . TRP B 1 347 ? 30.417  48.067 27.400  1.00 39.11  ? 347 TRP B CZ2 1 
ATOM   5969 C CZ3 . TRP B 1 347 ? 30.060  49.623 25.569  1.00 38.42  ? 347 TRP B CZ3 1 
ATOM   5970 C CH2 . TRP B 1 347 ? 30.906  48.847 26.371  1.00 39.51  ? 347 TRP B CH2 1 
ATOM   5971 N N   . HIS B 1 348 ? 23.620  49.976 29.110  1.00 37.41  ? 348 HIS B N   1 
ATOM   5972 C CA  . HIS B 1 348 ? 23.162  49.701 30.468  1.00 37.31  ? 348 HIS B CA  1 
ATOM   5973 C C   . HIS B 1 348 ? 23.184  48.194 30.686  1.00 39.31  ? 348 HIS B C   1 
ATOM   5974 O O   . HIS B 1 348 ? 22.925  47.431 29.747  1.00 38.21  ? 348 HIS B O   1 
ATOM   5975 C CB  . HIS B 1 348 ? 21.746  50.256 30.711  1.00 38.00  ? 348 HIS B CB  1 
ATOM   5976 C CG  . HIS B 1 348 ? 21.690  51.750 30.731  1.00 42.68  ? 348 HIS B CG  1 
ATOM   5977 N ND1 . HIS B 1 348 ? 22.573  52.500 31.498  1.00 45.74  ? 348 HIS B ND1 1 
ATOM   5978 C CD2 . HIS B 1 348 ? 20.845  52.591 30.093  1.00 44.51  ? 348 HIS B CD2 1 
ATOM   5979 C CE1 . HIS B 1 348 ? 22.255  53.763 31.274  1.00 45.39  ? 348 HIS B CE1 1 
ATOM   5980 N NE2 . HIS B 1 348 ? 21.217  53.868 30.443  1.00 45.05  ? 348 HIS B NE2 1 
ATOM   5981 N N   . VAL B 1 349 ? 23.506  47.759 31.910  1.00 35.33  ? 349 VAL B N   1 
ATOM   5982 C CA  . VAL B 1 349 ? 23.490  46.330 32.225  1.00 34.68  ? 349 VAL B CA  1 
ATOM   5983 C C   . VAL B 1 349 ? 22.027  45.829 32.194  1.00 37.62  ? 349 VAL B C   1 
ATOM   5984 O O   . VAL B 1 349 ? 21.177  46.427 32.868  1.00 37.55  ? 349 VAL B O   1 
ATOM   5985 C CB  . VAL B 1 349 ? 24.187  46.011 33.572  1.00 38.49  ? 349 VAL B CB  1 
ATOM   5986 C CG1 . VAL B 1 349 ? 24.116  44.518 33.895  1.00 37.51  ? 349 VAL B CG1 1 
ATOM   5987 C CG2 . VAL B 1 349 ? 25.632  46.492 33.559  1.00 39.25  ? 349 VAL B CG2 1 
ATOM   5988 N N   . PRO B 1 350 ? 21.707  44.786 31.386  1.00 32.95  ? 350 PRO B N   1 
ATOM   5989 C CA  . PRO B 1 350 ? 20.320  44.280 31.355  1.00 31.89  ? 350 PRO B CA  1 
ATOM   5990 C C   . PRO B 1 350 ? 19.899  43.647 32.687  1.00 36.91  ? 350 PRO B C   1 
ATOM   5991 O O   . PRO B 1 350 ? 20.649  42.836 33.254  1.00 36.74  ? 350 PRO B O   1 
ATOM   5992 C CB  . PRO B 1 350 ? 20.340  43.232 30.231  1.00 33.17  ? 350 PRO B CB  1 
ATOM   5993 C CG  . PRO B 1 350 ? 21.642  43.432 29.506  1.00 38.18  ? 350 PRO B CG  1 
ATOM   5994 C CD  . PRO B 1 350 ? 22.588  43.989 30.510  1.00 34.45  ? 350 PRO B CD  1 
ATOM   5995 N N   . ALA B 1 351 ? 18.712  44.051 33.203  1.00 34.01  ? 351 ALA B N   1 
ATOM   5996 C CA  . ALA B 1 351 ? 18.135  43.530 34.451  1.00 34.20  ? 351 ALA B CA  1 
ATOM   5997 C C   . ALA B 1 351 ? 17.442  42.153 34.245  1.00 37.67  ? 351 ALA B C   1 
ATOM   5998 O O   . ALA B 1 351 ? 17.373  41.341 35.173  1.00 35.80  ? 351 ALA B O   1 
ATOM   5999 C CB  . ALA B 1 351 ? 17.155  44.534 35.036  1.00 34.57  ? 351 ALA B CB  1 
ATOM   6000 N N   . ALA B 1 352 ? 16.934  41.907 33.025  1.00 34.73  ? 352 ALA B N   1 
ATOM   6001 C CA  . ALA B 1 352 ? 16.223  40.689 32.656  1.00 34.73  ? 352 ALA B CA  1 
ATOM   6002 C C   . ALA B 1 352 ? 16.256  40.459 31.143  1.00 37.81  ? 352 ALA B C   1 
ATOM   6003 O O   . ALA B 1 352 ? 16.648  41.343 30.373  1.00 36.56  ? 352 ALA B O   1 
ATOM   6004 C CB  . ALA B 1 352 ? 14.763  40.775 33.141  1.00 35.42  ? 352 ALA B CB  1 
ATOM   6005 N N   . GLY B 1 353 ? 15.847  39.261 30.742  1.00 36.15  ? 353 GLY B N   1 
ATOM   6006 C CA  . GLY B 1 353 ? 15.716  38.880 29.341  1.00 36.47  ? 353 GLY B CA  1 
ATOM   6007 C C   . GLY B 1 353 ? 16.947  38.342 28.653  1.00 40.67  ? 353 GLY B C   1 
ATOM   6008 O O   . GLY B 1 353 ? 17.771  37.688 29.292  1.00 39.86  ? 353 GLY B O   1 
ATOM   6009 N N   . MET B 1 354 ? 17.064  38.642 27.325  1.00 38.37  ? 354 MET B N   1 
ATOM   6010 C CA  . MET B 1 354 ? 18.127  38.183 26.407  1.00 39.13  ? 354 MET B CA  1 
ATOM   6011 C C   . MET B 1 354 ? 18.760  39.247 25.481  1.00 40.64  ? 354 MET B C   1 
ATOM   6012 O O   . MET B 1 354 ? 19.522  38.890 24.580  1.00 39.32  ? 354 MET B O   1 
ATOM   6013 C CB  . MET B 1 354 ? 17.656  36.948 25.605  1.00 42.17  ? 354 MET B CB  1 
ATOM   6014 C CG  . MET B 1 354 ? 16.288  37.122 24.959  1.00 46.19  ? 354 MET B CG  1 
ATOM   6015 S SD  . MET B 1 354 ? 15.716  35.650 24.080  1.00 51.11  ? 354 MET B SD  1 
ATOM   6016 C CE  . MET B 1 354 ? 15.350  34.549 25.464  1.00 47.86  ? 354 MET B CE  1 
ATOM   6017 N N   . PHE B 1 355 ? 18.509  40.543 25.734  1.00 37.46  ? 355 PHE B N   1 
ATOM   6018 C CA  . PHE B 1 355 ? 19.073  41.592 24.875  1.00 37.52  ? 355 PHE B CA  1 
ATOM   6019 C C   . PHE B 1 355 ? 20.016  42.599 25.537  1.00 40.62  ? 355 PHE B C   1 
ATOM   6020 O O   . PHE B 1 355 ? 19.823  42.966 26.691  1.00 41.19  ? 355 PHE B O   1 
ATOM   6021 C CB  . PHE B 1 355 ? 17.961  42.337 24.097  1.00 39.22  ? 355 PHE B CB  1 
ATOM   6022 C CG  . PHE B 1 355 ? 16.999  41.436 23.362  1.00 41.40  ? 355 PHE B CG  1 
ATOM   6023 C CD1 . PHE B 1 355 ? 17.438  40.616 22.320  1.00 45.56  ? 355 PHE B CD1 1 
ATOM   6024 C CD2 . PHE B 1 355 ? 15.656  41.397 23.712  1.00 42.82  ? 355 PHE B CD2 1 
ATOM   6025 C CE1 . PHE B 1 355 ? 16.548  39.771 21.649  1.00 45.75  ? 355 PHE B CE1 1 
ATOM   6026 C CE2 . PHE B 1 355 ? 14.771  40.541 23.049  1.00 45.27  ? 355 PHE B CE2 1 
ATOM   6027 C CZ  . PHE B 1 355 ? 15.221  39.740 22.017  1.00 43.56  ? 355 PHE B CZ  1 
ATOM   6028 N N   . LEU B 1 356 ? 21.022  43.063 24.763  1.00 35.03  ? 356 LEU B N   1 
ATOM   6029 C CA  . LEU B 1 356 ? 21.947  44.134 25.113  1.00 33.73  ? 356 LEU B CA  1 
ATOM   6030 C C   . LEU B 1 356 ? 21.725  45.259 24.101  1.00 34.96  ? 356 LEU B C   1 
ATOM   6031 O O   . LEU B 1 356 ? 21.859  45.034 22.899  1.00 34.19  ? 356 LEU B O   1 
ATOM   6032 C CB  . LEU B 1 356 ? 23.410  43.655 25.104  1.00 34.43  ? 356 LEU B CB  1 
ATOM   6033 C CG  . LEU B 1 356 ? 24.457  44.678 25.578  1.00 38.81  ? 356 LEU B CG  1 
ATOM   6034 C CD1 . LEU B 1 356 ? 24.310  44.999 27.076  1.00 38.26  ? 356 LEU B CD1 1 
ATOM   6035 C CD2 . LEU B 1 356 ? 25.847  44.197 25.259  1.00 41.36  ? 356 LEU B CD2 1 
ATOM   6036 N N   . TRP B 1 357 ? 21.326  46.443 24.594  1.00 31.28  ? 357 TRP B N   1 
ATOM   6037 C CA  . TRP B 1 357 ? 21.004  47.648 23.813  1.00 30.64  ? 357 TRP B CA  1 
ATOM   6038 C C   . TRP B 1 357 ? 22.223  48.575 23.786  1.00 33.27  ? 357 TRP B C   1 
ATOM   6039 O O   . TRP B 1 357 ? 22.573  49.180 24.807  1.00 32.93  ? 357 TRP B O   1 
ATOM   6040 C CB  . TRP B 1 357 ? 19.773  48.315 24.455  1.00 28.78  ? 357 TRP B CB  1 
ATOM   6041 C CG  . TRP B 1 357 ? 19.142  49.479 23.738  1.00 29.70  ? 357 TRP B CG  1 
ATOM   6042 C CD1 . TRP B 1 357 ? 18.865  50.699 24.277  1.00 32.67  ? 357 TRP B CD1 1 
ATOM   6043 C CD2 . TRP B 1 357 ? 18.528  49.470 22.433  1.00 29.42  ? 357 TRP B CD2 1 
ATOM   6044 N NE1 . TRP B 1 357 ? 18.170  51.472 23.373  1.00 32.06  ? 357 TRP B NE1 1 
ATOM   6045 C CE2 . TRP B 1 357 ? 17.956  50.745 22.231  1.00 33.11  ? 357 TRP B CE2 1 
ATOM   6046 C CE3 . TRP B 1 357 ? 18.445  48.523 21.393  1.00 30.41  ? 357 TRP B CE3 1 
ATOM   6047 C CZ2 . TRP B 1 357 ? 17.295  51.090 21.045  1.00 32.49  ? 357 TRP B CZ2 1 
ATOM   6048 C CZ3 . TRP B 1 357 ? 17.814  48.879 20.204  1.00 31.34  ? 357 TRP B CZ3 1 
ATOM   6049 C CH2 . TRP B 1 357 ? 17.241  50.144 20.042  1.00 32.06  ? 357 TRP B CH2 1 
ATOM   6050 N N   . ILE B 1 358 ? 22.890  48.646 22.621  1.00 29.08  ? 358 ILE B N   1 
ATOM   6051 C CA  . ILE B 1 358 ? 24.123  49.417 22.403  1.00 29.07  ? 358 ILE B CA  1 
ATOM   6052 C C   . ILE B 1 358 ? 23.876  50.755 21.675  1.00 34.65  ? 358 ILE B C   1 
ATOM   6053 O O   . ILE B 1 358 ? 23.259  50.766 20.615  1.00 35.12  ? 358 ILE B O   1 
ATOM   6054 C CB  . ILE B 1 358 ? 25.153  48.519 21.643  1.00 31.38  ? 358 ILE B CB  1 
ATOM   6055 C CG1 . ILE B 1 358 ? 25.569  47.285 22.474  1.00 29.56  ? 358 ILE B CG1 1 
ATOM   6056 C CG2 . ILE B 1 358 ? 26.373  49.308 21.165  1.00 33.96  ? 358 ILE B CG2 1 
ATOM   6057 C CD1 . ILE B 1 358 ? 25.620  46.059 21.689  1.00 28.99  ? 358 ILE B CD1 1 
ATOM   6058 N N   . LYS B 1 359 ? 24.390  51.867 22.228  1.00 31.62  ? 359 LYS B N   1 
ATOM   6059 C CA  . LYS B 1 359 ? 24.317  53.190 21.601  1.00 31.60  ? 359 LYS B CA  1 
ATOM   6060 C C   . LYS B 1 359 ? 25.684  53.516 21.063  1.00 37.25  ? 359 LYS B C   1 
ATOM   6061 O O   . LYS B 1 359 ? 26.601  53.706 21.858  1.00 36.84  ? 359 LYS B O   1 
ATOM   6062 C CB  . LYS B 1 359 ? 23.930  54.282 22.608  1.00 33.20  ? 359 LYS B CB  1 
ATOM   6063 C CG  . LYS B 1 359 ? 23.764  55.647 21.940  1.00 34.38  ? 359 LYS B CG  1 
ATOM   6064 C CD  . LYS B 1 359 ? 23.424  56.734 22.923  1.00 33.88  ? 359 LYS B CD  1 
ATOM   6065 C CE  . LYS B 1 359 ? 22.973  57.959 22.181  1.00 47.09  ? 359 LYS B CE  1 
ATOM   6066 N NZ  . LYS B 1 359 ? 22.729  59.091 23.113  1.00 65.31  ? 359 LYS B NZ  1 
ATOM   6067 N N   . VAL B 1 360 ? 25.821  53.618 19.737  1.00 35.30  ? 360 VAL B N   1 
ATOM   6068 C CA  . VAL B 1 360 ? 27.100  53.974 19.120  1.00 36.61  ? 360 VAL B CA  1 
ATOM   6069 C C   . VAL B 1 360 ? 27.332  55.483 19.301  1.00 44.60  ? 360 VAL B C   1 
ATOM   6070 O O   . VAL B 1 360 ? 26.511  56.293 18.875  1.00 44.76  ? 360 VAL B O   1 
ATOM   6071 C CB  . VAL B 1 360 ? 27.267  53.485 17.657  1.00 39.87  ? 360 VAL B CB  1 
ATOM   6072 C CG1 . VAL B 1 360 ? 28.692  53.704 17.182  1.00 40.34  ? 360 VAL B CG1 1 
ATOM   6073 C CG2 . VAL B 1 360 ? 26.889  52.005 17.517  1.00 38.89  ? 360 VAL B CG2 1 
ATOM   6074 N N   . LYS B 1 361 ? 28.431  55.836 19.996  1.00 43.50  ? 361 LYS B N   1 
ATOM   6075 C CA  . LYS B 1 361 ? 28.831  57.193 20.378  1.00 43.93  ? 361 LYS B CA  1 
ATOM   6076 C C   . LYS B 1 361 ? 28.844  58.263 19.307  1.00 51.92  ? 361 LYS B C   1 
ATOM   6077 O O   . LYS B 1 361 ? 28.219  59.304 19.519  1.00 53.89  ? 361 LYS B O   1 
ATOM   6078 C CB  . LYS B 1 361 ? 30.141  57.197 21.166  1.00 46.01  ? 361 LYS B CB  1 
ATOM   6079 C CG  . LYS B 1 361 ? 29.986  56.946 22.662  1.00 47.81  ? 361 LYS B CG  1 
ATOM   6080 C CD  . LYS B 1 361 ? 31.035  57.734 23.436  1.00 57.96  ? 361 LYS B CD  1 
ATOM   6081 C CE  . LYS B 1 361 ? 31.066  57.433 24.912  1.00 69.11  ? 361 LYS B CE  1 
ATOM   6082 N NZ  . LYS B 1 361 ? 31.859  56.211 25.228  1.00 76.07  ? 361 LYS B NZ  1 
ATOM   6083 N N   . GLY B 1 362 ? 29.540  58.029 18.194  1.00 49.80  ? 362 GLY B N   1 
ATOM   6084 C CA  . GLY B 1 362 ? 29.689  59.023 17.124  1.00 51.28  ? 362 GLY B CA  1 
ATOM   6085 C C   . GLY B 1 362 ? 28.585  59.139 16.089  1.00 56.49  ? 362 GLY B C   1 
ATOM   6086 O O   . GLY B 1 362 ? 28.010  60.214 15.904  1.00 53.97  ? 362 GLY B O   1 
ATOM   6087 N N   . ILE B 1 363 ? 28.306  58.030 15.394  1.00 56.93  ? 363 ILE B N   1 
ATOM   6088 C CA  . ILE B 1 363 ? 27.328  57.910 14.310  1.00 58.46  ? 363 ILE B CA  1 
ATOM   6089 C C   . ILE B 1 363 ? 25.873  58.279 14.683  1.00 62.64  ? 363 ILE B C   1 
ATOM   6090 O O   . ILE B 1 363 ? 25.475  58.173 15.851  1.00 61.74  ? 363 ILE B O   1 
ATOM   6091 C CB  . ILE B 1 363 ? 27.403  56.560 13.527  1.00 62.27  ? 363 ILE B CB  1 
ATOM   6092 C CG1 . ILE B 1 363 ? 28.423  55.511 14.067  1.00 62.96  ? 363 ILE B CG1 1 
ATOM   6093 C CG2 . ILE B 1 363 ? 27.436  56.774 12.010  1.00 64.62  ? 363 ILE B CG2 1 
ATOM   6094 C CD1 . ILE B 1 363 ? 29.912  55.712 13.850  1.00 68.97  ? 363 ILE B CD1 1 
ATOM   6095 N N   . ASN B 1 364 ? 25.097  58.718 13.665  1.00 59.69  ? 364 ASN B N   1 
ATOM   6096 C CA  . ASN B 1 364 ? 23.697  59.123 13.775  1.00 59.19  ? 364 ASN B CA  1 
ATOM   6097 C C   . ASN B 1 364 ? 22.762  58.015 13.287  1.00 59.44  ? 364 ASN B C   1 
ATOM   6098 O O   . ASN B 1 364 ? 21.692  57.835 13.868  1.00 57.86  ? 364 ASN B O   1 
ATOM   6099 C CB  . ASN B 1 364 ? 23.451  60.428 12.988  1.00 65.06  ? 364 ASN B CB  1 
ATOM   6100 C CG  . ASN B 1 364 ? 24.276  61.621 13.437  1.00 92.76  ? 364 ASN B CG  1 
ATOM   6101 O OD1 . ASN B 1 364 ? 24.478  61.881 14.635  1.00 86.53  ? 364 ASN B OD1 1 
ATOM   6102 N ND2 . ASN B 1 364 ? 24.741  62.397 12.472  1.00 85.58  ? 364 ASN B ND2 1 
ATOM   6103 N N   . ASP B 1 365 ? 23.164  57.285 12.219  1.00 54.17  ? 365 ASP B N   1 
ATOM   6104 C CA  . ASP B 1 365 ? 22.399  56.179 11.629  1.00 51.90  ? 365 ASP B CA  1 
ATOM   6105 C C   . ASP B 1 365 ? 23.261  54.919 11.534  1.00 51.15  ? 365 ASP B C   1 
ATOM   6106 O O   . ASP B 1 365 ? 24.239  54.885 10.792  1.00 51.86  ? 365 ASP B O   1 
ATOM   6107 C CB  . ASP B 1 365 ? 21.814  56.572 10.256  1.00 54.56  ? 365 ASP B CB  1 
ATOM   6108 C CG  . ASP B 1 365 ? 21.063  55.454 9.563   1.00 68.63  ? 365 ASP B CG  1 
ATOM   6109 O OD1 . ASP B 1 365 ? 21.607  54.893 8.576   1.00 69.95  ? 365 ASP B OD1 1 
ATOM   6110 O OD2 . ASP B 1 365 ? 19.961  55.096 10.040  1.00 76.61  ? 365 ASP B OD2 1 
ATOM   6111 N N   . VAL B 1 366 ? 22.886  53.893 12.290  1.00 43.73  ? 366 VAL B N   1 
ATOM   6112 C CA  . VAL B 1 366 ? 23.589  52.613 12.369  1.00 42.95  ? 366 VAL B CA  1 
ATOM   6113 C C   . VAL B 1 366 ? 23.124  51.579 11.295  1.00 46.59  ? 366 VAL B C   1 
ATOM   6114 O O   . VAL B 1 366 ? 23.741  50.525 11.146  1.00 44.73  ? 366 VAL B O   1 
ATOM   6115 C CB  . VAL B 1 366 ? 23.542  52.091 13.838  1.00 46.07  ? 366 VAL B CB  1 
ATOM   6116 C CG1 . VAL B 1 366 ? 22.378  51.123 14.084  1.00 45.29  ? 366 VAL B CG1 1 
ATOM   6117 C CG2 . VAL B 1 366 ? 24.866  51.482 14.250  1.00 45.94  ? 366 VAL B CG2 1 
ATOM   6118 N N   . LYS B 1 367 ? 22.079  51.943 10.514  1.00 45.44  ? 367 LYS B N   1 
ATOM   6119 C CA  . LYS B 1 367 ? 21.399  51.142 9.481   1.00 46.45  ? 367 LYS B CA  1 
ATOM   6120 C C   . LYS B 1 367 ? 22.204  50.488 8.354   1.00 53.56  ? 367 LYS B C   1 
ATOM   6121 O O   . LYS B 1 367 ? 22.115  49.270 8.235   1.00 53.24  ? 367 LYS B O   1 
ATOM   6122 C CB  . LYS B 1 367 ? 20.126  51.830 8.947   1.00 49.42  ? 367 LYS B CB  1 
ATOM   6123 C CG  . LYS B 1 367 ? 19.018  50.841 8.561   1.00 61.53  ? 367 LYS B CG  1 
ATOM   6124 C CD  . LYS B 1 367 ? 17.768  51.536 8.040   1.00 74.23  ? 367 LYS B CD  1 
ATOM   6125 C CE  . LYS B 1 367 ? 16.787  50.575 7.401   1.00 90.24  ? 367 LYS B CE  1 
ATOM   6126 N NZ  . LYS B 1 367 ? 17.152  50.247 5.993   1.00 102.14 ? 367 LYS B NZ  1 
ATOM   6127 N N   . GLU B 1 368 ? 22.921  51.247 7.491   1.00 53.06  ? 368 GLU B N   1 
ATOM   6128 C CA  . GLU B 1 368 ? 23.667  50.586 6.405   1.00 54.52  ? 368 GLU B CA  1 
ATOM   6129 C C   . GLU B 1 368 ? 24.849  49.765 6.936   1.00 59.18  ? 368 GLU B C   1 
ATOM   6130 O O   . GLU B 1 368 ? 25.163  48.713 6.389   1.00 59.63  ? 368 GLU B O   1 
ATOM   6131 C CB  . GLU B 1 368 ? 24.053  51.545 5.259   1.00 57.62  ? 368 GLU B CB  1 
ATOM   6132 C CG  . GLU B 1 368 ? 25.321  52.366 5.475   1.00 76.82  ? 368 GLU B CG  1 
ATOM   6133 C CD  . GLU B 1 368 ? 25.765  53.252 4.322   1.00 111.12 ? 368 GLU B CD  1 
ATOM   6134 O OE1 . GLU B 1 368 ? 26.136  54.419 4.589   1.00 102.08 ? 368 GLU B OE1 1 
ATOM   6135 O OE2 . GLU B 1 368 ? 25.767  52.779 3.160   1.00 112.59 ? 368 GLU B OE2 1 
ATOM   6136 N N   . LEU B 1 369 ? 25.453  50.230 8.040   1.00 55.32  ? 369 LEU B N   1 
ATOM   6137 C CA  . LEU B 1 369 ? 26.566  49.600 8.746   1.00 54.37  ? 369 LEU B CA  1 
ATOM   6138 C C   . LEU B 1 369 ? 26.177  48.177 9.181   1.00 56.49  ? 369 LEU B C   1 
ATOM   6139 O O   . LEU B 1 369 ? 26.970  47.255 9.005   1.00 56.05  ? 369 LEU B O   1 
ATOM   6140 C CB  . LEU B 1 369 ? 26.890  50.480 9.968   1.00 53.99  ? 369 LEU B CB  1 
ATOM   6141 C CG  . LEU B 1 369 ? 28.085  50.123 10.827  1.00 58.98  ? 369 LEU B CG  1 
ATOM   6142 C CD1 . LEU B 1 369 ? 28.842  51.355 11.209  1.00 60.10  ? 369 LEU B CD1 1 
ATOM   6143 C CD2 . LEU B 1 369 ? 27.655  49.431 12.095  1.00 61.03  ? 369 LEU B CD2 1 
ATOM   6144 N N   . ILE B 1 370 ? 24.941  48.009 9.707   1.00 52.09  ? 370 ILE B N   1 
ATOM   6145 C CA  . ILE B 1 370 ? 24.395  46.753 10.245  1.00 51.30  ? 370 ILE B CA  1 
ATOM   6146 C C   . ILE B 1 370 ? 23.715  45.802 9.231   1.00 56.34  ? 370 ILE B C   1 
ATOM   6147 O O   . ILE B 1 370 ? 23.838  44.581 9.374   1.00 55.30  ? 370 ILE B O   1 
ATOM   6148 C CB  . ILE B 1 370 ? 23.578  47.043 11.553  1.00 53.17  ? 370 ILE B CB  1 
ATOM   6149 C CG1 . ILE B 1 370 ? 24.502  47.364 12.753  1.00 53.17  ? 370 ILE B CG1 1 
ATOM   6150 C CG2 . ILE B 1 370 ? 22.546  45.974 11.917  1.00 53.78  ? 370 ILE B CG2 1 
ATOM   6151 C CD1 . ILE B 1 370 ? 25.600  46.332 13.091  1.00 57.29  ? 370 ILE B CD1 1 
ATOM   6152 N N   . GLU B 1 371 ? 23.021  46.359 8.213   1.00 54.29  ? 371 GLU B N   1 
ATOM   6153 C CA  . GLU B 1 371 ? 22.305  45.604 7.166   1.00 54.24  ? 371 GLU B CA  1 
ATOM   6154 C C   . GLU B 1 371 ? 23.168  45.292 5.923   1.00 59.58  ? 371 GLU B C   1 
ATOM   6155 O O   . GLU B 1 371 ? 22.813  44.402 5.142   1.00 60.93  ? 371 GLU B O   1 
ATOM   6156 C CB  . GLU B 1 371 ? 21.042  46.362 6.714   1.00 55.16  ? 371 GLU B CB  1 
ATOM   6157 C CG  . GLU B 1 371 ? 19.920  46.394 7.734   1.00 64.29  ? 371 GLU B CG  1 
ATOM   6158 C CD  . GLU B 1 371 ? 18.738  47.288 7.401   1.00 86.00  ? 371 GLU B CD  1 
ATOM   6159 O OE1 . GLU B 1 371 ? 18.670  47.803 6.259   1.00 95.87  ? 371 GLU B OE1 1 
ATOM   6160 O OE2 . GLU B 1 371 ? 17.871  47.471 8.288   1.00 67.67  ? 371 GLU B OE2 1 
ATOM   6161 N N   . GLU B 1 372 ? 24.257  46.035 5.710   1.00 54.38  ? 372 GLU B N   1 
ATOM   6162 C CA  . GLU B 1 372 ? 25.073  45.819 4.524   1.00 55.17  ? 372 GLU B CA  1 
ATOM   6163 C C   . GLU B 1 372 ? 26.503  45.402 4.867   1.00 57.70  ? 372 GLU B C   1 
ATOM   6164 O O   . GLU B 1 372 ? 26.897  44.263 4.593   1.00 57.22  ? 372 GLU B O   1 
ATOM   6165 C CB  . GLU B 1 372 ? 25.035  47.056 3.591   1.00 57.71  ? 372 GLU B CB  1 
ATOM   6166 C CG  . GLU B 1 372 ? 23.678  47.288 2.939   1.00 72.14  ? 372 GLU B CG  1 
ATOM   6167 C CD  . GLU B 1 372 ? 23.388  48.700 2.458   1.00 100.55 ? 372 GLU B CD  1 
ATOM   6168 O OE1 . GLU B 1 372 ? 22.619  49.411 3.146   1.00 96.05  ? 372 GLU B OE1 1 
ATOM   6169 O OE2 . GLU B 1 372 ? 23.875  49.074 1.365   1.00 96.44  ? 372 GLU B OE2 1 
ATOM   6170 N N   . LYS B 1 373 ? 27.268  46.327 5.470   1.00 52.26  ? 373 LYS B N   1 
ATOM   6171 C CA  . LYS B 1 373 ? 28.663  46.150 5.857   1.00 51.22  ? 373 LYS B CA  1 
ATOM   6172 C C   . LYS B 1 373 ? 28.885  44.970 6.809   1.00 51.98  ? 373 LYS B C   1 
ATOM   6173 O O   . LYS B 1 373 ? 29.874  44.246 6.660   1.00 52.09  ? 373 LYS B O   1 
ATOM   6174 C CB  . LYS B 1 373 ? 29.228  47.462 6.445   1.00 53.24  ? 373 LYS B CB  1 
ATOM   6175 C CG  . LYS B 1 373 ? 29.455  48.577 5.423   1.00 62.48  ? 373 LYS B CG  1 
ATOM   6176 C CD  . LYS B 1 373 ? 28.267  49.528 5.321   1.00 70.75  ? 373 LYS B CD  1 
ATOM   6177 C CE  . LYS B 1 373 ? 28.315  50.358 4.062   1.00 82.98  ? 373 LYS B CE  1 
ATOM   6178 N NZ  . LYS B 1 373 ? 27.033  50.284 3.306   1.00 90.84  ? 373 LYS B NZ  1 
ATOM   6179 N N   . ALA B 1 374 ? 27.968  44.774 7.772   1.00 46.70  ? 374 ALA B N   1 
ATOM   6180 C CA  . ALA B 1 374 ? 28.069  43.705 8.772   1.00 46.17  ? 374 ALA B CA  1 
ATOM   6181 C C   . ALA B 1 374 ? 27.722  42.295 8.259   1.00 48.90  ? 374 ALA B C   1 
ATOM   6182 O O   . ALA B 1 374 ? 28.372  41.328 8.665   1.00 47.18  ? 374 ALA B O   1 
ATOM   6183 C CB  . ALA B 1 374 ? 27.247  44.049 10.003  1.00 45.84  ? 374 ALA B CB  1 
ATOM   6184 N N   . VAL B 1 375 ? 26.697  42.181 7.385   1.00 45.74  ? 375 VAL B N   1 
ATOM   6185 C CA  . VAL B 1 375 ? 26.289  40.904 6.794   1.00 46.13  ? 375 VAL B CA  1 
ATOM   6186 C C   . VAL B 1 375 ? 27.415  40.394 5.867   1.00 52.21  ? 375 VAL B C   1 
ATOM   6187 O O   . VAL B 1 375 ? 27.824  39.239 5.986   1.00 51.43  ? 375 VAL B O   1 
ATOM   6188 C CB  . VAL B 1 375 ? 24.899  40.972 6.119   1.00 49.63  ? 375 VAL B CB  1 
ATOM   6189 C CG1 . VAL B 1 375 ? 24.439  39.591 5.675   1.00 49.24  ? 375 VAL B CG1 1 
ATOM   6190 C CG2 . VAL B 1 375 ? 23.866  41.591 7.060   1.00 48.35  ? 375 VAL B CG2 1 
ATOM   6191 N N   . LYS B 1 376 ? 27.973  41.283 5.022   1.00 51.49  ? 376 LYS B N   1 
ATOM   6192 C CA  . LYS B 1 376 ? 29.118  40.989 4.159   1.00 54.11  ? 376 LYS B CA  1 
ATOM   6193 C C   . LYS B 1 376 ? 30.221  40.389 5.030   1.00 62.61  ? 376 LYS B C   1 
ATOM   6194 O O   . LYS B 1 376 ? 30.781  39.350 4.682   1.00 64.65  ? 376 LYS B O   1 
ATOM   6195 C CB  . LYS B 1 376 ? 29.619  42.276 3.465   1.00 57.38  ? 376 LYS B CB  1 
ATOM   6196 C CG  . LYS B 1 376 ? 30.992  42.160 2.799   1.00 74.95  ? 376 LYS B CG  1 
ATOM   6197 C CD  . LYS B 1 376 ? 32.069  42.866 3.624   1.00 89.58  ? 376 LYS B CD  1 
ATOM   6198 C CE  . LYS B 1 376 ? 33.472  42.488 3.210   1.00 98.18  ? 376 LYS B CE  1 
ATOM   6199 N NZ  . LYS B 1 376 ? 34.492  43.296 3.933   1.00 102.23 ? 376 LYS B NZ  1 
ATOM   6200 N N   . MET B 1 377 ? 30.492  41.020 6.184   1.00 60.06  ? 377 MET B N   1 
ATOM   6201 C CA  . MET B 1 377 ? 31.501  40.550 7.122   1.00 60.91  ? 377 MET B CA  1 
ATOM   6202 C C   . MET B 1 377 ? 31.128  39.297 7.947   1.00 61.94  ? 377 MET B C   1 
ATOM   6203 O O   . MET B 1 377 ? 31.960  38.810 8.710   1.00 60.99  ? 377 MET B O   1 
ATOM   6204 C CB  . MET B 1 377 ? 32.054  41.706 7.959   1.00 64.04  ? 377 MET B CB  1 
ATOM   6205 C CG  . MET B 1 377 ? 33.194  42.402 7.266   1.00 70.60  ? 377 MET B CG  1 
ATOM   6206 S SD  . MET B 1 377 ? 34.233  43.360 8.387   1.00 76.92  ? 377 MET B SD  1 
ATOM   6207 C CE  . MET B 1 377 ? 35.636  43.706 7.310   1.00 75.62  ? 377 MET B CE  1 
ATOM   6208 N N   . GLY B 1 378 ? 29.902  38.787 7.766   1.00 57.24  ? 378 GLY B N   1 
ATOM   6209 C CA  . GLY B 1 378 ? 29.396  37.573 8.406   1.00 56.08  ? 378 GLY B CA  1 
ATOM   6210 C C   . GLY B 1 378 ? 28.818  37.651 9.811   1.00 58.11  ? 378 GLY B C   1 
ATOM   6211 O O   . GLY B 1 378 ? 28.705  36.611 10.469  1.00 58.13  ? 378 GLY B O   1 
ATOM   6212 N N   . VAL B 1 379 ? 28.425  38.865 10.284  1.00 51.98  ? 379 VAL B N   1 
ATOM   6213 C CA  . VAL B 1 379 ? 27.849  39.084 11.622  1.00 49.49  ? 379 VAL B CA  1 
ATOM   6214 C C   . VAL B 1 379 ? 26.438  39.679 11.514  1.00 53.67  ? 379 VAL B C   1 
ATOM   6215 O O   . VAL B 1 379 ? 26.219  40.660 10.798  1.00 53.43  ? 379 VAL B O   1 
ATOM   6216 C CB  . VAL B 1 379 ? 28.809  39.883 12.556  1.00 52.38  ? 379 VAL B CB  1 
ATOM   6217 C CG1 . VAL B 1 379 ? 28.122  40.369 13.832  1.00 50.65  ? 379 VAL B CG1 1 
ATOM   6218 C CG2 . VAL B 1 379 ? 30.043  39.061 12.902  1.00 52.86  ? 379 VAL B CG2 1 
ATOM   6219 N N   . LEU B 1 380 ? 25.482  39.061 12.217  1.00 50.14  ? 380 LEU B N   1 
ATOM   6220 C CA  . LEU B 1 380 ? 24.079  39.465 12.226  1.00 48.89  ? 380 LEU B CA  1 
ATOM   6221 C C   . LEU B 1 380 ? 23.670  40.073 13.537  1.00 49.83  ? 380 LEU B C   1 
ATOM   6222 O O   . LEU B 1 380 ? 23.910  39.489 14.594  1.00 47.83  ? 380 LEU B O   1 
ATOM   6223 C CB  . LEU B 1 380 ? 23.173  38.272 11.900  1.00 48.98  ? 380 LEU B CB  1 
ATOM   6224 C CG  . LEU B 1 380 ? 23.303  37.727 10.490  1.00 55.12  ? 380 LEU B CG  1 
ATOM   6225 C CD1 . LEU B 1 380 ? 22.631  36.378 10.365  1.00 54.73  ? 380 LEU B CD1 1 
ATOM   6226 C CD2 . LEU B 1 380 ? 22.785  38.738 9.451   1.00 59.31  ? 380 LEU B CD2 1 
ATOM   6227 N N   . MET B 1 381 ? 23.057  41.266 13.451  1.00 45.82  ? 381 MET B N   1 
ATOM   6228 C CA  . MET B 1 381 ? 22.528  42.083 14.549  1.00 44.46  ? 381 MET B CA  1 
ATOM   6229 C C   . MET B 1 381 ? 21.349  42.907 13.991  1.00 46.22  ? 381 MET B C   1 
ATOM   6230 O O   . MET B 1 381 ? 21.145  42.906 12.773  1.00 46.70  ? 381 MET B O   1 
ATOM   6231 C CB  . MET B 1 381 ? 23.620  43.014 15.096  1.00 47.44  ? 381 MET B CB  1 
ATOM   6232 C CG  . MET B 1 381 ? 24.570  42.361 16.053  1.00 52.11  ? 381 MET B CG  1 
ATOM   6233 S SD  . MET B 1 381 ? 26.034  43.400 16.260  1.00 58.55  ? 381 MET B SD  1 
ATOM   6234 C CE  . MET B 1 381 ? 27.126  42.295 17.141  1.00 55.67  ? 381 MET B CE  1 
ATOM   6235 N N   . LEU B 1 382 ? 20.591  43.613 14.860  1.00 40.28  ? 382 LEU B N   1 
ATOM   6236 C CA  . LEU B 1 382 ? 19.458  44.445 14.437  1.00 39.41  ? 382 LEU B CA  1 
ATOM   6237 C C   . LEU B 1 382 ? 19.623  45.955 14.682  1.00 43.19  ? 382 LEU B C   1 
ATOM   6238 O O   . LEU B 1 382 ? 19.946  46.350 15.803  1.00 43.17  ? 382 LEU B O   1 
ATOM   6239 C CB  . LEU B 1 382 ? 18.155  43.983 15.106  1.00 38.45  ? 382 LEU B CB  1 
ATOM   6240 C CG  . LEU B 1 382 ? 17.465  42.764 14.524  1.00 42.44  ? 382 LEU B CG  1 
ATOM   6241 C CD1 . LEU B 1 382 ? 16.433  42.272 15.463  1.00 41.19  ? 382 LEU B CD1 1 
ATOM   6242 C CD2 . LEU B 1 382 ? 16.792  43.086 13.200  1.00 45.44  ? 382 LEU B CD2 1 
ATOM   6243 N N   . PRO B 1 383 ? 19.315  46.834 13.705  1.00 38.99  ? 383 PRO B N   1 
ATOM   6244 C CA  . PRO B 1 383 ? 19.381  48.269 13.997  1.00 39.23  ? 383 PRO B CA  1 
ATOM   6245 C C   . PRO B 1 383 ? 18.133  48.747 14.739  1.00 42.14  ? 383 PRO B C   1 
ATOM   6246 O O   . PRO B 1 383 ? 17.044  48.224 14.521  1.00 41.27  ? 383 PRO B O   1 
ATOM   6247 C CB  . PRO B 1 383 ? 19.509  48.925 12.609  1.00 41.75  ? 383 PRO B CB  1 
ATOM   6248 C CG  . PRO B 1 383 ? 19.376  47.822 11.599  1.00 45.28  ? 383 PRO B CG  1 
ATOM   6249 C CD  . PRO B 1 383 ? 18.879  46.598 12.313  1.00 40.17  ? 383 PRO B CD  1 
ATOM   6250 N N   . GLY B 1 384 ? 18.316  49.768 15.572  1.00 38.45  ? 384 GLY B N   1 
ATOM   6251 C CA  . GLY B 1 384 ? 17.295  50.381 16.409  1.00 38.04  ? 384 GLY B CA  1 
ATOM   6252 C C   . GLY B 1 384 ? 16.021  50.863 15.749  1.00 42.94  ? 384 GLY B C   1 
ATOM   6253 O O   . GLY B 1 384 ? 14.997  50.926 16.432  1.00 42.19  ? 384 GLY B O   1 
ATOM   6254 N N   . ASN B 1 385 ? 16.069  51.211 14.437  1.00 40.45  ? 385 ASN B N   1 
ATOM   6255 C CA  . ASN B 1 385 ? 14.962  51.720 13.609  1.00 41.04  ? 385 ASN B CA  1 
ATOM   6256 C C   . ASN B 1 385 ? 13.641  50.977 13.840  1.00 47.49  ? 385 ASN B C   1 
ATOM   6257 O O   . ASN B 1 385 ? 12.616  51.614 14.079  1.00 49.01  ? 385 ASN B O   1 
ATOM   6258 C CB  . ASN B 1 385 ? 15.341  51.679 12.123  1.00 42.22  ? 385 ASN B CB  1 
ATOM   6259 C CG  . ASN B 1 385 ? 16.645  52.379 11.823  1.00 85.37  ? 385 ASN B CG  1 
ATOM   6260 O OD1 . ASN B 1 385 ? 17.720  51.773 11.872  1.00 83.86  ? 385 ASN B OD1 1 
ATOM   6261 N ND2 . ASN B 1 385 ? 16.586  53.680 11.531  1.00 80.16  ? 385 ASN B ND2 1 
ATOM   6262 N N   . ALA B 1 386 ? 13.684  49.634 13.837  1.00 42.70  ? 386 ALA B N   1 
ATOM   6263 C CA  . ALA B 1 386 ? 12.559  48.722 14.017  1.00 41.51  ? 386 ALA B CA  1 
ATOM   6264 C C   . ALA B 1 386 ? 11.735  48.915 15.290  1.00 43.98  ? 386 ALA B C   1 
ATOM   6265 O O   . ALA B 1 386 ? 10.578  48.506 15.318  1.00 44.56  ? 386 ALA B O   1 
ATOM   6266 C CB  . ALA B 1 386 ? 13.071  47.287 13.975  1.00 41.91  ? 386 ALA B CB  1 
ATOM   6267 N N   . PHE B 1 387 ? 12.334  49.467 16.346  1.00 37.29  ? 387 PHE B N   1 
ATOM   6268 C CA  . PHE B 1 387 ? 11.715  49.590 17.659  1.00 35.31  ? 387 PHE B CA  1 
ATOM   6269 C C   . PHE B 1 387 ? 11.065  50.947 17.921  1.00 38.37  ? 387 PHE B C   1 
ATOM   6270 O O   . PHE B 1 387 ? 10.741  51.282 19.065  1.00 35.86  ? 387 PHE B O   1 
ATOM   6271 C CB  . PHE B 1 387 ? 12.733  49.201 18.736  1.00 36.26  ? 387 PHE B CB  1 
ATOM   6272 C CG  . PHE B 1 387 ? 13.442  47.894 18.440  1.00 36.72  ? 387 PHE B CG  1 
ATOM   6273 C CD1 . PHE B 1 387 ? 14.623  47.874 17.718  1.00 39.14  ? 387 PHE B CD1 1 
ATOM   6274 C CD2 . PHE B 1 387 ? 12.919  46.686 18.872  1.00 37.56  ? 387 PHE B CD2 1 
ATOM   6275 C CE1 . PHE B 1 387 ? 15.263  46.666 17.433  1.00 39.73  ? 387 PHE B CE1 1 
ATOM   6276 C CE2 . PHE B 1 387 ? 13.572  45.483 18.605  1.00 39.68  ? 387 PHE B CE2 1 
ATOM   6277 C CZ  . PHE B 1 387 ? 14.737  45.480 17.884  1.00 38.19  ? 387 PHE B CZ  1 
ATOM   6278 N N   . TYR B 1 388 ? 10.820  51.697 16.839  1.00 35.97  ? 388 TYR B N   1 
ATOM   6279 C CA  . TYR B 1 388 ? 10.213  53.019 16.883  1.00 36.44  ? 388 TYR B CA  1 
ATOM   6280 C C   . TYR B 1 388 ? 9.001   53.113 15.972  1.00 41.54  ? 388 TYR B C   1 
ATOM   6281 O O   . TYR B 1 388 ? 8.951   52.440 14.939  1.00 40.79  ? 388 TYR B O   1 
ATOM   6282 C CB  . TYR B 1 388 ? 11.257  54.084 16.487  1.00 38.09  ? 388 TYR B CB  1 
ATOM   6283 C CG  . TYR B 1 388 ? 12.326  54.276 17.539  1.00 38.69  ? 388 TYR B CG  1 
ATOM   6284 C CD1 . TYR B 1 388 ? 12.117  55.121 18.629  1.00 39.81  ? 388 TYR B CD1 1 
ATOM   6285 C CD2 . TYR B 1 388 ? 13.525  53.574 17.478  1.00 39.60  ? 388 TYR B CD2 1 
ATOM   6286 C CE1 . TYR B 1 388 ? 13.081  55.273 19.621  1.00 39.96  ? 388 TYR B CE1 1 
ATOM   6287 C CE2 . TYR B 1 388 ? 14.493  53.708 18.474  1.00 40.71  ? 388 TYR B CE2 1 
ATOM   6288 C CZ  . TYR B 1 388 ? 14.269  54.571 19.535  1.00 49.29  ? 388 TYR B CZ  1 
ATOM   6289 O OH  . TYR B 1 388 ? 15.221  54.747 20.500  1.00 53.41  ? 388 TYR B OH  1 
ATOM   6290 N N   . VAL B 1 389 ? 8.035   53.977 16.337  1.00 40.13  ? 389 VAL B N   1 
ATOM   6291 C CA  . VAL B 1 389 ? 6.832   54.263 15.537  1.00 40.59  ? 389 VAL B CA  1 
ATOM   6292 C C   . VAL B 1 389 ? 7.289   54.860 14.199  1.00 46.71  ? 389 VAL B C   1 
ATOM   6293 O O   . VAL B 1 389 ? 6.851   54.398 13.140  1.00 47.59  ? 389 VAL B O   1 
ATOM   6294 C CB  . VAL B 1 389 ? 5.844   55.173 16.302  1.00 43.96  ? 389 VAL B CB  1 
ATOM   6295 C CG1 . VAL B 1 389 ? 4.704   55.670 15.408  1.00 44.09  ? 389 VAL B CG1 1 
ATOM   6296 C CG2 . VAL B 1 389 ? 5.304   54.443 17.526  1.00 43.04  ? 389 VAL B CG2 1 
ATOM   6297 N N   . ASP B 1 390 ? 8.236   55.817 14.258  1.00 44.58  ? 390 ASP B N   1 
ATOM   6298 C CA  . ASP B 1 390 ? 8.838   56.441 13.082  1.00 46.14  ? 390 ASP B CA  1 
ATOM   6299 C C   . ASP B 1 390 ? 10.157  55.711 12.813  1.00 50.81  ? 390 ASP B C   1 
ATOM   6300 O O   . ASP B 1 390 ? 11.228  56.156 13.248  1.00 51.06  ? 390 ASP B O   1 
ATOM   6301 C CB  . ASP B 1 390 ? 9.047   57.959 13.313  1.00 48.91  ? 390 ASP B CB  1 
ATOM   6302 C CG  . ASP B 1 390 ? 9.531   58.765 12.115  1.00 59.31  ? 390 ASP B CG  1 
ATOM   6303 O OD1 . ASP B 1 390 ? 9.445   60.012 12.169  1.00 61.11  ? 390 ASP B OD1 1 
ATOM   6304 O OD2 . ASP B 1 390 ? 10.024  58.150 11.133  1.00 61.87  ? 390 ASP B OD2 1 
ATOM   6305 N N   . SER B 1 391 ? 10.062  54.570 12.108  1.00 47.25  ? 391 SER B N   1 
ATOM   6306 C CA  . SER B 1 391 ? 11.195  53.704 11.768  1.00 47.30  ? 391 SER B CA  1 
ATOM   6307 C C   . SER B 1 391 ? 12.087  54.261 10.669  1.00 54.17  ? 391 SER B C   1 
ATOM   6308 O O   . SER B 1 391 ? 13.163  53.708 10.430  1.00 54.61  ? 391 SER B O   1 
ATOM   6309 C CB  . SER B 1 391 ? 10.728  52.290 11.427  1.00 50.11  ? 391 SER B CB  1 
ATOM   6310 O OG  . SER B 1 391 ? 9.406   52.260 10.920  1.00 61.10  ? 391 SER B OG  1 
ATOM   6311 N N   . SER B 1 392 ? 11.650  55.357 10.010  1.00 51.79  ? 392 SER B N   1 
ATOM   6312 C CA  . SER B 1 392 ? 12.384  56.027 8.938   1.00 52.38  ? 392 SER B CA  1 
ATOM   6313 C C   . SER B 1 392 ? 13.412  57.016 9.492   1.00 55.76  ? 392 SER B C   1 
ATOM   6314 O O   . SER B 1 392 ? 14.364  57.383 8.791   1.00 58.90  ? 392 SER B O   1 
ATOM   6315 C CB  . SER B 1 392 ? 11.420  56.714 7.973   1.00 57.68  ? 392 SER B CB  1 
ATOM   6316 O OG  . SER B 1 392 ? 10.432  57.455 8.668   1.00 69.32  ? 392 SER B OG  1 
ATOM   6317 N N   . ALA B 1 393 ? 13.226  57.445 10.745  1.00 47.96  ? 393 ALA B N   1 
ATOM   6318 C CA  . ALA B 1 393 ? 14.149  58.344 11.429  1.00 46.76  ? 393 ALA B CA  1 
ATOM   6319 C C   . ALA B 1 393 ? 15.479  57.597 11.696  1.00 49.80  ? 393 ALA B C   1 
ATOM   6320 O O   . ALA B 1 393 ? 15.464  56.377 11.935  1.00 48.85  ? 393 ALA B O   1 
ATOM   6321 C CB  . ALA B 1 393 ? 13.534  58.810 12.743  1.00 46.68  ? 393 ALA B CB  1 
ATOM   6322 N N   . PRO B 1 394 ? 16.636  58.286 11.634  1.00 45.66  ? 394 PRO B N   1 
ATOM   6323 C CA  . PRO B 1 394 ? 17.903  57.591 11.904  1.00 44.65  ? 394 PRO B CA  1 
ATOM   6324 C C   . PRO B 1 394 ? 18.060  57.193 13.378  1.00 46.59  ? 394 PRO B C   1 
ATOM   6325 O O   . PRO B 1 394 ? 17.552  57.899 14.258  1.00 44.81  ? 394 PRO B O   1 
ATOM   6326 C CB  . PRO B 1 394 ? 18.956  58.600 11.458  1.00 47.69  ? 394 PRO B CB  1 
ATOM   6327 C CG  . PRO B 1 394 ? 18.306  59.923 11.568  1.00 52.85  ? 394 PRO B CG  1 
ATOM   6328 C CD  . PRO B 1 394 ? 16.851  59.719 11.337  1.00 48.35  ? 394 PRO B CD  1 
ATOM   6329 N N   . SER B 1 395 ? 18.744  56.047 13.640  1.00 42.88  ? 395 SER B N   1 
ATOM   6330 C CA  . SER B 1 395 ? 18.959  55.518 14.993  1.00 41.56  ? 395 SER B CA  1 
ATOM   6331 C C   . SER B 1 395 ? 20.422  55.150 15.261  1.00 44.37  ? 395 SER B C   1 
ATOM   6332 O O   . SER B 1 395 ? 20.987  54.364 14.498  1.00 44.00  ? 395 SER B O   1 
ATOM   6333 C CB  . SER B 1 395 ? 18.072  54.300 15.235  1.00 43.49  ? 395 SER B CB  1 
ATOM   6334 O OG  . SER B 1 395 ? 18.103  53.903 16.598  1.00 50.62  ? 395 SER B OG  1 
ATOM   6335 N N   . PRO B 1 396 ? 21.051  55.658 16.351  1.00 39.88  ? 396 PRO B N   1 
ATOM   6336 C CA  . PRO B 1 396 ? 22.453  55.283 16.622  1.00 39.76  ? 396 PRO B CA  1 
ATOM   6337 C C   . PRO B 1 396 ? 22.575  53.954 17.388  1.00 42.14  ? 396 PRO B C   1 
ATOM   6338 O O   . PRO B 1 396 ? 23.689  53.457 17.595  1.00 42.10  ? 396 PRO B O   1 
ATOM   6339 C CB  . PRO B 1 396 ? 22.960  56.462 17.456  1.00 41.61  ? 396 PRO B CB  1 
ATOM   6340 C CG  . PRO B 1 396 ? 21.763  56.888 18.237  1.00 45.25  ? 396 PRO B CG  1 
ATOM   6341 C CD  . PRO B 1 396 ? 20.543  56.594 17.377  1.00 40.46  ? 396 PRO B CD  1 
ATOM   6342 N N   . TYR B 1 397 ? 21.422  53.394 17.821  1.00 35.81  ? 397 TYR B N   1 
ATOM   6343 C CA  . TYR B 1 397 ? 21.326  52.170 18.620  1.00 33.45  ? 397 TYR B CA  1 
ATOM   6344 C C   . TYR B 1 397 ? 21.244  50.895 17.809  1.00 35.94  ? 397 TYR B C   1 
ATOM   6345 O O   . TYR B 1 397 ? 20.692  50.876 16.704  1.00 35.42  ? 397 TYR B O   1 
ATOM   6346 C CB  . TYR B 1 397 ? 20.068  52.202 19.509  1.00 32.84  ? 397 TYR B CB  1 
ATOM   6347 C CG  . TYR B 1 397 ? 20.018  53.307 20.532  1.00 33.85  ? 397 TYR B CG  1 
ATOM   6348 C CD1 . TYR B 1 397 ? 19.372  54.508 20.258  1.00 35.97  ? 397 TYR B CD1 1 
ATOM   6349 C CD2 . TYR B 1 397 ? 20.584  53.143 21.794  1.00 34.11  ? 397 TYR B CD2 1 
ATOM   6350 C CE1 . TYR B 1 397 ? 19.321  55.535 21.200  1.00 36.85  ? 397 TYR B CE1 1 
ATOM   6351 C CE2 . TYR B 1 397 ? 20.513  54.152 22.755  1.00 34.91  ? 397 TYR B CE2 1 
ATOM   6352 C CZ  . TYR B 1 397 ? 19.897  55.355 22.446  1.00 43.95  ? 397 TYR B CZ  1 
ATOM   6353 O OH  . TYR B 1 397 ? 19.849  56.376 23.366  1.00 48.52  ? 397 TYR B OH  1 
ATOM   6354 N N   . LEU B 1 398 ? 21.703  49.802 18.413  1.00 31.71  ? 398 LEU B N   1 
ATOM   6355 C CA  . LEU B 1 398 ? 21.553  48.466 17.859  1.00 31.03  ? 398 LEU B CA  1 
ATOM   6356 C C   . LEU B 1 398 ? 21.252  47.455 18.974  1.00 33.37  ? 398 LEU B C   1 
ATOM   6357 O O   . LEU B 1 398 ? 21.667  47.664 20.124  1.00 32.66  ? 398 LEU B O   1 
ATOM   6358 C CB  . LEU B 1 398 ? 22.689  48.053 16.899  1.00 31.82  ? 398 LEU B CB  1 
ATOM   6359 C CG  . LEU B 1 398 ? 24.094  47.962 17.432  1.00 37.09  ? 398 LEU B CG  1 
ATOM   6360 C CD1 . LEU B 1 398 ? 24.387  46.538 17.948  1.00 37.79  ? 398 LEU B CD1 1 
ATOM   6361 C CD2 . LEU B 1 398 ? 25.081  48.280 16.341  1.00 39.94  ? 398 LEU B CD2 1 
ATOM   6362 N N   . ARG B 1 399 ? 20.475  46.404 18.648  1.00 29.09  ? 399 ARG B N   1 
ATOM   6363 C CA  . ARG B 1 399 ? 20.111  45.367 19.615  1.00 28.36  ? 399 ARG B CA  1 
ATOM   6364 C C   . ARG B 1 399 ? 20.894  44.063 19.358  1.00 33.87  ? 399 ARG B C   1 
ATOM   6365 O O   . ARG B 1 399 ? 20.795  43.466 18.276  1.00 33.28  ? 399 ARG B O   1 
ATOM   6366 C CB  . ARG B 1 399 ? 18.591  45.128 19.630  1.00 24.81  ? 399 ARG B CB  1 
ATOM   6367 C CG  . ARG B 1 399 ? 18.132  44.196 20.750  1.00 28.46  ? 399 ARG B CG  1 
ATOM   6368 C CD  . ARG B 1 399 ? 16.767  43.601 20.493  1.00 32.32  ? 399 ARG B CD  1 
ATOM   6369 N NE  . ARG B 1 399 ? 16.796  42.493 19.535  1.00 35.09  ? 399 ARG B NE  1 
ATOM   6370 C CZ  . ARG B 1 399 ? 15.710  41.889 19.059  1.00 40.73  ? 399 ARG B CZ  1 
ATOM   6371 N NH1 . ARG B 1 399 ? 14.497  42.265 19.463  1.00 17.03  ? 399 ARG B NH1 1 
ATOM   6372 N NH2 . ARG B 1 399 ? 15.825  40.896 18.188  1.00 20.12  ? 399 ARG B NH2 1 
ATOM   6373 N N   . ALA B 1 400 ? 21.656  43.634 20.371  1.00 31.17  ? 400 ALA B N   1 
ATOM   6374 C CA  . ALA B 1 400 ? 22.451  42.409 20.346  1.00 31.73  ? 400 ALA B CA  1 
ATOM   6375 C C   . ALA B 1 400 ? 21.808  41.357 21.253  1.00 35.58  ? 400 ALA B C   1 
ATOM   6376 O O   . ALA B 1 400 ? 21.475  41.656 22.406  1.00 33.72  ? 400 ALA B O   1 
ATOM   6377 C CB  . ALA B 1 400 ? 23.872  42.700 20.815  1.00 33.36  ? 400 ALA B CB  1 
ATOM   6378 N N   . SER B 1 401 ? 21.628  40.129 20.734  1.00 34.06  ? 401 SER B N   1 
ATOM   6379 C CA  . SER B 1 401 ? 21.029  39.039 21.505  1.00 34.30  ? 401 SER B CA  1 
ATOM   6380 C C   . SER B 1 401 ? 22.092  38.084 22.005  1.00 39.19  ? 401 SER B C   1 
ATOM   6381 O O   . SER B 1 401 ? 22.948  37.637 21.238  1.00 38.96  ? 401 SER B O   1 
ATOM   6382 C CB  . SER B 1 401 ? 19.966  38.296 20.694  1.00 38.48  ? 401 SER B CB  1 
ATOM   6383 O OG  . SER B 1 401 ? 19.384  37.238 21.441  1.00 47.59  ? 401 SER B OG  1 
ATOM   6384 N N   . PHE B 1 402 ? 22.023  37.769 23.301  1.00 36.80  ? 402 PHE B N   1 
ATOM   6385 C CA  . PHE B 1 402 ? 22.948  36.839 23.950  1.00 37.01  ? 402 PHE B CA  1 
ATOM   6386 C C   . PHE B 1 402 ? 22.303  35.483 24.277  1.00 40.64  ? 402 PHE B C   1 
ATOM   6387 O O   . PHE B 1 402 ? 22.839  34.757 25.109  1.00 40.52  ? 402 PHE B O   1 
ATOM   6388 C CB  . PHE B 1 402 ? 23.572  37.487 25.207  1.00 38.88  ? 402 PHE B CB  1 
ATOM   6389 C CG  . PHE B 1 402 ? 22.614  38.006 26.266  1.00 39.31  ? 402 PHE B CG  1 
ATOM   6390 C CD1 . PHE B 1 402 ? 22.102  37.156 27.244  1.00 41.18  ? 402 PHE B CD1 1 
ATOM   6391 C CD2 . PHE B 1 402 ? 22.299  39.357 26.337  1.00 40.82  ? 402 PHE B CD2 1 
ATOM   6392 C CE1 . PHE B 1 402 ? 21.260  37.637 28.245  1.00 41.16  ? 402 PHE B CE1 1 
ATOM   6393 C CE2 . PHE B 1 402 ? 21.477  39.844 27.357  1.00 43.15  ? 402 PHE B CE2 1 
ATOM   6394 C CZ  . PHE B 1 402 ? 20.961  38.978 28.303  1.00 40.69  ? 402 PHE B CZ  1 
ATOM   6395 N N   . SER B 1 403 ? 21.168  35.135 23.637  1.00 37.50  ? 403 SER B N   1 
ATOM   6396 C CA  . SER B 1 403 ? 20.474  33.882 23.928  1.00 38.06  ? 403 SER B CA  1 
ATOM   6397 C C   . SER B 1 403 ? 21.135  32.622 23.373  1.00 45.12  ? 403 SER B C   1 
ATOM   6398 O O   . SER B 1 403 ? 20.917  31.537 23.917  1.00 44.99  ? 403 SER B O   1 
ATOM   6399 C CB  . SER B 1 403 ? 19.018  33.955 23.495  1.00 41.45  ? 403 SER B CB  1 
ATOM   6400 O OG  . SER B 1 403 ? 18.894  34.118 22.094  1.00 52.13  ? 403 SER B OG  1 
ATOM   6401 N N   . SER B 1 404 ? 21.955  32.747 22.318  1.00 43.94  ? 404 SER B N   1 
ATOM   6402 C CA  . SER B 1 404 ? 22.539  31.560 21.684  1.00 44.57  ? 404 SER B CA  1 
ATOM   6403 C C   . SER B 1 404 ? 24.031  31.586 21.366  1.00 48.28  ? 404 SER B C   1 
ATOM   6404 O O   . SER B 1 404 ? 24.674  30.530 21.422  1.00 47.10  ? 404 SER B O   1 
ATOM   6405 C CB  . SER B 1 404 ? 21.745  31.196 20.434  1.00 48.98  ? 404 SER B CB  1 
ATOM   6406 O OG  . SER B 1 404 ? 21.493  32.344 19.638  1.00 61.77  ? 404 SER B OG  1 
ATOM   6407 N N   . ALA B 1 405 ? 24.573  32.761 20.986  1.00 45.62  ? 405 ALA B N   1 
ATOM   6408 C CA  . ALA B 1 405 ? 25.987  32.903 20.620  1.00 46.25  ? 405 ALA B CA  1 
ATOM   6409 C C   . ALA B 1 405 ? 26.942  32.425 21.731  1.00 49.70  ? 405 ALA B C   1 
ATOM   6410 O O   . ALA B 1 405 ? 26.654  32.607 22.917  1.00 49.59  ? 405 ALA B O   1 
ATOM   6411 C CB  . ALA B 1 405 ? 26.283  34.342 20.234  1.00 46.76  ? 405 ALA B CB  1 
ATOM   6412 N N   . SER B 1 406 ? 28.040  31.768 21.343  1.00 45.60  ? 406 SER B N   1 
ATOM   6413 C CA  . SER B 1 406 ? 29.031  31.268 22.287  1.00 46.37  ? 406 SER B CA  1 
ATOM   6414 C C   . SER B 1 406 ? 29.896  32.431 22.781  1.00 55.56  ? 406 SER B C   1 
ATOM   6415 O O   . SER B 1 406 ? 30.004  33.426 22.058  1.00 55.52  ? 406 SER B O   1 
ATOM   6416 C CB  . SER B 1 406 ? 29.897  30.192 21.634  1.00 48.12  ? 406 SER B CB  1 
ATOM   6417 O OG  . SER B 1 406 ? 30.848  30.707 20.717  1.00 49.80  ? 406 SER B OG  1 
ATOM   6418 N N   . PRO B 1 407 ? 30.543  32.341 23.975  1.00 55.25  ? 407 PRO B N   1 
ATOM   6419 C CA  . PRO B 1 407 ? 31.395  33.450 24.443  1.00 56.25  ? 407 PRO B CA  1 
ATOM   6420 C C   . PRO B 1 407 ? 32.458  33.924 23.440  1.00 61.74  ? 407 PRO B C   1 
ATOM   6421 O O   . PRO B 1 407 ? 32.776  35.118 23.394  1.00 62.97  ? 407 PRO B O   1 
ATOM   6422 C CB  . PRO B 1 407 ? 32.018  32.881 25.720  1.00 58.81  ? 407 PRO B CB  1 
ATOM   6423 C CG  . PRO B 1 407 ? 30.988  31.942 26.223  1.00 62.57  ? 407 PRO B CG  1 
ATOM   6424 C CD  . PRO B 1 407 ? 30.516  31.258 24.976  1.00 57.70  ? 407 PRO B CD  1 
ATOM   6425 N N   . GLU B 1 408 ? 32.966  33.001 22.613  1.00 57.64  ? 408 GLU B N   1 
ATOM   6426 C CA  . GLU B 1 408 ? 33.947  33.289 21.567  1.00 57.92  ? 408 GLU B CA  1 
ATOM   6427 C C   . GLU B 1 408 ? 33.278  33.773 20.277  1.00 59.73  ? 408 GLU B C   1 
ATOM   6428 O O   . GLU B 1 408 ? 33.902  34.521 19.527  1.00 59.63  ? 408 GLU B O   1 
ATOM   6429 C CB  . GLU B 1 408 ? 34.948  32.132 21.344  1.00 60.76  ? 408 GLU B CB  1 
ATOM   6430 C CG  . GLU B 1 408 ? 34.379  30.718 21.460  1.00 76.04  ? 408 GLU B CG  1 
ATOM   6431 C CD  . GLU B 1 408 ? 34.088  30.185 22.858  1.00 103.26 ? 408 GLU B CD  1 
ATOM   6432 O OE1 . GLU B 1 408 ? 34.777  30.600 23.820  1.00 117.53 ? 408 GLU B OE1 1 
ATOM   6433 O OE2 . GLU B 1 408 ? 33.175  29.337 22.988  1.00 84.74  ? 408 GLU B OE2 1 
ATOM   6434 N N   . GLN B 1 409 ? 31.990  33.410 20.049  1.00 54.16  ? 409 GLN B N   1 
ATOM   6435 C CA  . GLN B 1 409 ? 31.206  33.906 18.902  1.00 52.26  ? 409 GLN B CA  1 
ATOM   6436 C C   . GLN B 1 409 ? 30.955  35.402 19.125  1.00 52.93  ? 409 GLN B C   1 
ATOM   6437 O O   . GLN B 1 409 ? 31.001  36.181 18.175  1.00 51.99  ? 409 GLN B O   1 
ATOM   6438 C CB  . GLN B 1 409 ? 29.863  33.175 18.779  1.00 52.57  ? 409 GLN B CB  1 
ATOM   6439 C CG  . GLN B 1 409 ? 29.855  32.037 17.767  1.00 63.22  ? 409 GLN B CG  1 
ATOM   6440 C CD  . GLN B 1 409 ? 28.512  31.341 17.700  1.00 78.65  ? 409 GLN B CD  1 
ATOM   6441 O OE1 . GLN B 1 409 ? 27.477  31.924 17.340  1.00 75.77  ? 409 GLN B OE1 1 
ATOM   6442 N NE2 . GLN B 1 409 ? 28.506  30.062 18.018  1.00 66.25  ? 409 GLN B NE2 1 
ATOM   6443 N N   . MET B 1 410 ? 30.735  35.787 20.404  1.00 48.01  ? 410 MET B N   1 
ATOM   6444 C CA  . MET B 1 410 ? 30.515  37.149 20.888  1.00 47.24  ? 410 MET B CA  1 
ATOM   6445 C C   . MET B 1 410 ? 31.759  38.002 20.694  1.00 51.44  ? 410 MET B C   1 
ATOM   6446 O O   . MET B 1 410 ? 31.660  39.124 20.177  1.00 51.18  ? 410 MET B O   1 
ATOM   6447 C CB  . MET B 1 410 ? 30.109  37.127 22.368  1.00 49.28  ? 410 MET B CB  1 
ATOM   6448 C CG  . MET B 1 410 ? 28.680  36.740 22.565  1.00 52.76  ? 410 MET B CG  1 
ATOM   6449 S SD  . MET B 1 410 ? 28.345  36.206 24.239  1.00 57.86  ? 410 MET B SD  1 
ATOM   6450 C CE  . MET B 1 410 ? 26.620  35.813 24.060  1.00 53.51  ? 410 MET B CE  1 
ATOM   6451 N N   . ASP B 1 411 ? 32.931  37.456 21.080  1.00 47.58  ? 411 ASP B N   1 
ATOM   6452 C CA  . ASP B 1 411 ? 34.219  38.123 20.953  1.00 47.64  ? 411 ASP B CA  1 
ATOM   6453 C C   . ASP B 1 411 ? 34.504  38.443 19.490  1.00 50.53  ? 411 ASP B C   1 
ATOM   6454 O O   . ASP B 1 411 ? 34.749  39.604 19.167  1.00 51.76  ? 411 ASP B O   1 
ATOM   6455 C CB  . ASP B 1 411 ? 35.327  37.244 21.530  1.00 50.72  ? 411 ASP B CB  1 
ATOM   6456 C CG  . ASP B 1 411 ? 36.534  38.036 21.976  1.00 63.17  ? 411 ASP B CG  1 
ATOM   6457 O OD1 . ASP B 1 411 ? 37.376  38.374 21.109  1.00 63.32  ? 411 ASP B OD1 1 
ATOM   6458 O OD2 . ASP B 1 411 ? 36.643  38.313 23.197  1.00 71.11  ? 411 ASP B OD2 1 
ATOM   6459 N N   . VAL B 1 412 ? 34.403  37.429 18.607  1.00 44.77  ? 412 VAL B N   1 
ATOM   6460 C CA  . VAL B 1 412 ? 34.607  37.547 17.159  1.00 44.67  ? 412 VAL B CA  1 
ATOM   6461 C C   . VAL B 1 412 ? 33.694  38.623 16.552  1.00 49.39  ? 412 VAL B C   1 
ATOM   6462 O O   . VAL B 1 412 ? 34.181  39.473 15.808  1.00 49.65  ? 412 VAL B O   1 
ATOM   6463 C CB  . VAL B 1 412 ? 34.456  36.172 16.435  1.00 47.74  ? 412 VAL B CB  1 
ATOM   6464 C CG1 . VAL B 1 412 ? 34.365  36.330 14.916  1.00 47.23  ? 412 VAL B CG1 1 
ATOM   6465 C CG2 . VAL B 1 412 ? 35.599  35.229 16.803  1.00 48.52  ? 412 VAL B CG2 1 
ATOM   6466 N N   . ALA B 1 413 ? 32.390  38.586 16.887  1.00 45.63  ? 413 ALA B N   1 
ATOM   6467 C CA  . ALA B 1 413 ? 31.373  39.507 16.384  1.00 45.32  ? 413 ALA B CA  1 
ATOM   6468 C C   . ALA B 1 413 ? 31.554  40.960 16.822  1.00 51.32  ? 413 ALA B C   1 
ATOM   6469 O O   . ALA B 1 413 ? 31.448  41.860 15.979  1.00 50.78  ? 413 ALA B O   1 
ATOM   6470 C CB  . ALA B 1 413 ? 29.990  39.012 16.751  1.00 44.75  ? 413 ALA B CB  1 
ATOM   6471 N N   . PHE B 1 414 ? 31.828  41.195 18.125  1.00 48.88  ? 414 PHE B N   1 
ATOM   6472 C CA  . PHE B 1 414 ? 32.031  42.547 18.658  1.00 48.59  ? 414 PHE B CA  1 
ATOM   6473 C C   . PHE B 1 414 ? 33.337  43.174 18.161  1.00 52.76  ? 414 PHE B C   1 
ATOM   6474 O O   . PHE B 1 414 ? 33.478  44.401 18.165  1.00 52.94  ? 414 PHE B O   1 
ATOM   6475 C CB  . PHE B 1 414 ? 31.927  42.576 20.193  1.00 49.93  ? 414 PHE B CB  1 
ATOM   6476 C CG  . PHE B 1 414 ? 30.536  42.720 20.756  1.00 50.46  ? 414 PHE B CG  1 
ATOM   6477 C CD1 . PHE B 1 414 ? 29.478  43.121 19.951  1.00 53.82  ? 414 PHE B CD1 1 
ATOM   6478 C CD2 . PHE B 1 414 ? 30.291  42.502 22.100  1.00 52.99  ? 414 PHE B CD2 1 
ATOM   6479 C CE1 . PHE B 1 414 ? 28.184  43.258 20.477  1.00 53.70  ? 414 PHE B CE1 1 
ATOM   6480 C CE2 . PHE B 1 414 ? 28.997  42.643 22.625  1.00 55.18  ? 414 PHE B CE2 1 
ATOM   6481 C CZ  . PHE B 1 414 ? 27.954  43.024 21.810  1.00 52.23  ? 414 PHE B CZ  1 
ATOM   6482 N N   . GLN B 1 415 ? 34.271  42.335 17.710  1.00 48.76  ? 415 GLN B N   1 
ATOM   6483 C CA  . GLN B 1 415 ? 35.531  42.770 17.125  1.00 49.74  ? 415 GLN B CA  1 
ATOM   6484 C C   . GLN B 1 415 ? 35.249  43.326 15.704  1.00 52.04  ? 415 GLN B C   1 
ATOM   6485 O O   . GLN B 1 415 ? 35.856  44.320 15.300  1.00 53.14  ? 415 GLN B O   1 
ATOM   6486 C CB  . GLN B 1 415 ? 36.506  41.589 17.103  1.00 52.46  ? 415 GLN B CB  1 
ATOM   6487 C CG  . GLN B 1 415 ? 37.790  41.812 16.332  1.00 84.96  ? 415 GLN B CG  1 
ATOM   6488 C CD  . GLN B 1 415 ? 38.653  40.582 16.423  1.00 121.24 ? 415 GLN B CD  1 
ATOM   6489 O OE1 . GLN B 1 415 ? 39.615  40.534 17.194  1.00 119.25 ? 415 GLN B OE1 1 
ATOM   6490 N NE2 . GLN B 1 415 ? 38.297  39.536 15.680  1.00 118.45 ? 415 GLN B NE2 1 
ATOM   6491 N N   . VAL B 1 416 ? 34.299  42.698 14.975  1.00 45.73  ? 416 VAL B N   1 
ATOM   6492 C CA  . VAL B 1 416 ? 33.848  43.114 13.637  1.00 44.84  ? 416 VAL B CA  1 
ATOM   6493 C C   . VAL B 1 416 ? 33.084  44.439 13.774  1.00 46.37  ? 416 VAL B C   1 
ATOM   6494 O O   . VAL B 1 416 ? 33.303  45.356 12.975  1.00 46.35  ? 416 VAL B O   1 
ATOM   6495 C CB  . VAL B 1 416 ? 33.016  42.014 12.911  1.00 48.30  ? 416 VAL B CB  1 
ATOM   6496 C CG1 . VAL B 1 416 ? 32.436  42.513 11.586  1.00 48.28  ? 416 VAL B CG1 1 
ATOM   6497 C CG2 . VAL B 1 416 ? 33.846  40.756 12.687  1.00 48.61  ? 416 VAL B CG2 1 
ATOM   6498 N N   . LEU B 1 417 ? 32.230  44.548 14.820  1.00 40.73  ? 417 LEU B N   1 
ATOM   6499 C CA  . LEU B 1 417 ? 31.458  45.759 15.128  1.00 39.01  ? 417 LEU B CA  1 
ATOM   6500 C C   . LEU B 1 417 ? 32.397  46.948 15.303  1.00 42.31  ? 417 LEU B C   1 
ATOM   6501 O O   . LEU B 1 417 ? 32.213  47.968 14.632  1.00 42.77  ? 417 LEU B O   1 
ATOM   6502 C CB  . LEU B 1 417 ? 30.613  45.588 16.404  1.00 37.61  ? 417 LEU B CB  1 
ATOM   6503 C CG  . LEU B 1 417 ? 29.157  46.113 16.405  1.00 41.07  ? 417 LEU B CG  1 
ATOM   6504 C CD1 . LEU B 1 417 ? 28.727  46.532 17.812  1.00 40.18  ? 417 LEU B CD1 1 
ATOM   6505 C CD2 . LEU B 1 417 ? 28.933  47.295 15.454  1.00 42.30  ? 417 LEU B CD2 1 
ATOM   6506 N N   . ALA B 1 418 ? 33.422  46.791 16.160  1.00 36.63  ? 418 ALA B N   1 
ATOM   6507 C CA  . ALA B 1 418 ? 34.388  47.841 16.421  1.00 36.16  ? 418 ALA B CA  1 
ATOM   6508 C C   . ALA B 1 418 ? 35.045  48.357 15.151  1.00 40.56  ? 418 ALA B C   1 
ATOM   6509 O O   . ALA B 1 418 ? 35.117  49.570 14.994  1.00 41.25  ? 418 ALA B O   1 
ATOM   6510 C CB  . ALA B 1 418 ? 35.432  47.369 17.416  1.00 37.21  ? 418 ALA B CB  1 
ATOM   6511 N N   . GLN B 1 419 ? 35.465  47.463 14.222  1.00 36.83  ? 419 GLN B N   1 
ATOM   6512 C CA  . GLN B 1 419 ? 36.119  47.889 12.981  1.00 37.41  ? 419 GLN B CA  1 
ATOM   6513 C C   . GLN B 1 419 ? 35.185  48.720 12.103  1.00 42.32  ? 419 GLN B C   1 
ATOM   6514 O O   . GLN B 1 419 ? 35.601  49.749 11.564  1.00 42.39  ? 419 GLN B O   1 
ATOM   6515 C CB  . GLN B 1 419 ? 36.702  46.707 12.202  1.00 38.85  ? 419 GLN B CB  1 
ATOM   6516 C CG  . GLN B 1 419 ? 37.818  47.145 11.264  1.00 43.36  ? 419 GLN B CG  1 
ATOM   6517 C CD  . GLN B 1 419 ? 38.080  46.135 10.191  1.00 67.58  ? 419 GLN B CD  1 
ATOM   6518 O OE1 . GLN B 1 419 ? 38.967  45.289 10.314  1.00 67.66  ? 419 GLN B OE1 1 
ATOM   6519 N NE2 . GLN B 1 419 ? 37.320  46.206 9.106   1.00 57.15  ? 419 GLN B NE2 1 
ATOM   6520 N N   . LEU B 1 420 ? 33.914  48.291 11.996  1.00 38.51  ? 420 LEU B N   1 
ATOM   6521 C CA  . LEU B 1 420 ? 32.887  48.987 11.219  1.00 37.54  ? 420 LEU B CA  1 
ATOM   6522 C C   . LEU B 1 420 ? 32.604  50.376 11.786  1.00 39.32  ? 420 LEU B C   1 
ATOM   6523 O O   . LEU B 1 420 ? 32.493  51.334 11.007  1.00 40.28  ? 420 LEU B O   1 
ATOM   6524 C CB  . LEU B 1 420 ? 31.612  48.147 11.118  1.00 36.50  ? 420 LEU B CB  1 
ATOM   6525 C CG  . LEU B 1 420 ? 31.756  46.842 10.320  1.00 42.31  ? 420 LEU B CG  1 
ATOM   6526 C CD1 . LEU B 1 420 ? 30.515  45.992 10.442  1.00 41.87  ? 420 LEU B CD1 1 
ATOM   6527 C CD2 . LEU B 1 420 ? 32.074  47.113 8.858   1.00 46.27  ? 420 LEU B CD2 1 
ATOM   6528 N N   . ILE B 1 421 ? 32.551  50.494 13.145  1.00 31.01  ? 421 ILE B N   1 
ATOM   6529 C CA  . ILE B 1 421 ? 32.359  51.752 13.870  1.00 27.76  ? 421 ILE B CA  1 
ATOM   6530 C C   . ILE B 1 421 ? 33.538  52.668 13.552  1.00 32.87  ? 421 ILE B C   1 
ATOM   6531 O O   . ILE B 1 421 ? 33.327  53.796 13.114  1.00 34.76  ? 421 ILE B O   1 
ATOM   6532 C CB  . ILE B 1 421 ? 32.126  51.529 15.398  1.00 28.16  ? 421 ILE B CB  1 
ATOM   6533 C CG1 . ILE B 1 421 ? 30.732  50.873 15.636  1.00 26.22  ? 421 ILE B CG1 1 
ATOM   6534 C CG2 . ILE B 1 421 ? 32.270  52.846 16.196  1.00 27.04  ? 421 ILE B CG2 1 
ATOM   6535 C CD1 . ILE B 1 421 ? 30.405  50.413 17.047  1.00 25.28  ? 421 ILE B CD1 1 
ATOM   6536 N N   . LYS B 1 422 ? 34.764  52.148 13.671  1.00 28.13  ? 422 LYS B N   1 
ATOM   6537 C CA  . LYS B 1 422 ? 35.996  52.868 13.385  1.00 29.16  ? 422 LYS B CA  1 
ATOM   6538 C C   . LYS B 1 422 ? 36.078  53.398 11.958  1.00 37.89  ? 422 LYS B C   1 
ATOM   6539 O O   . LYS B 1 422 ? 36.699  54.440 11.744  1.00 39.92  ? 422 LYS B O   1 
ATOM   6540 C CB  . LYS B 1 422 ? 37.202  51.978 13.680  1.00 31.49  ? 422 LYS B CB  1 
ATOM   6541 C CG  . LYS B 1 422 ? 37.627  51.964 15.148  1.00 28.96  ? 422 LYS B CG  1 
ATOM   6542 C CD  . LYS B 1 422 ? 38.379  50.690 15.500  1.00 35.01  ? 422 LYS B CD  1 
ATOM   6543 C CE  . LYS B 1 422 ? 39.816  50.674 15.043  1.00 40.98  ? 422 LYS B CE  1 
ATOM   6544 N NZ  . LYS B 1 422 ? 40.385  49.299 15.086  1.00 49.07  ? 422 LYS B NZ  1 
ATOM   6545 N N   . GLU B 1 423 ? 35.471  52.679 10.981  1.00 36.29  ? 423 GLU B N   1 
ATOM   6546 C CA  . GLU B 1 423 ? 35.438  53.051 9.556   1.00 37.44  ? 423 GLU B CA  1 
ATOM   6547 C C   . GLU B 1 423 ? 34.564  54.289 9.329   1.00 41.89  ? 423 GLU B C   1 
ATOM   6548 O O   . GLU B 1 423 ? 34.988  55.208 8.618   1.00 43.69  ? 423 GLU B O   1 
ATOM   6549 C CB  . GLU B 1 423 ? 34.913  51.891 8.705   1.00 38.62  ? 423 GLU B CB  1 
ATOM   6550 C CG  . GLU B 1 423 ? 35.947  50.836 8.365   1.00 53.30  ? 423 GLU B CG  1 
ATOM   6551 C CD  . GLU B 1 423 ? 35.394  49.465 8.013   1.00 73.65  ? 423 GLU B CD  1 
ATOM   6552 O OE1 . GLU B 1 423 ? 34.629  49.364 7.025   1.00 62.40  ? 423 GLU B OE1 1 
ATOM   6553 O OE2 . GLU B 1 423 ? 35.754  48.486 8.707   1.00 66.15  ? 423 GLU B OE2 1 
ATOM   6554 N N   . SER B 1 424 ? 33.351  54.301 9.927   1.00 36.15  ? 424 SER B N   1 
ATOM   6555 C CA  . SER B 1 424 ? 32.380  55.389 9.842   1.00 36.66  ? 424 SER B CA  1 
ATOM   6556 C C   . SER B 1 424 ? 32.871  56.664 10.515  1.00 44.94  ? 424 SER B C   1 
ATOM   6557 O O   . SER B 1 424 ? 32.555  57.765 10.045  1.00 48.20  ? 424 SER B O   1 
ATOM   6558 C CB  . SER B 1 424 ? 31.060  54.978 10.469  1.00 39.80  ? 424 SER B CB  1 
ATOM   6559 O OG  . SER B 1 424 ? 30.336  54.067 9.656   1.00 54.44  ? 424 SER B OG  1 
ATOM   6560 N N   . LEU B 1 425 ? 33.646  56.529 11.610  1.00 39.09  ? 425 LEU B N   1 
ATOM   6561 C CA  . LEU B 1 425 ? 34.202  57.666 12.343  1.00 37.43  ? 425 LEU B CA  1 
ATOM   6562 C C   . LEU B 1 425 ? 35.315  58.357 11.568  1.00 46.10  ? 425 LEU B C   1 
ATOM   6563 O O   . LEU B 1 425 ? 35.595  59.529 11.829  1.00 47.31  ? 425 LEU B O   1 
ATOM   6564 C CB  . LEU B 1 425 ? 34.693  57.233 13.727  1.00 35.63  ? 425 LEU B CB  1 
ATOM   6565 C CG  . LEU B 1 425 ? 33.630  56.761 14.713  1.00 36.71  ? 425 LEU B CG  1 
ATOM   6566 C CD1 . LEU B 1 425 ? 34.249  56.098 15.886  1.00 35.83  ? 425 LEU B CD1 1 
ATOM   6567 C CD2 . LEU B 1 425 ? 32.796  57.891 15.209  1.00 37.67  ? 425 LEU B CD2 1 
ATOM   6568 N N   . LEU B 1 426 ? 35.933  57.650 10.607  1.00 46.07  ? 426 LEU B N   1 
ATOM   6569 C CA  . LEU B 1 426 ? 37.002  58.189 9.775   1.00 49.27  ? 426 LEU B CA  1 
ATOM   6570 C C   . LEU B 1 426 ? 36.484  59.164 8.707   1.00 59.96  ? 426 LEU B C   1 
ATOM   6571 O O   . LEU B 1 426 ? 37.224  60.053 8.270   1.00 60.98  ? 426 LEU B O   1 
ATOM   6572 C CB  . LEU B 1 426 ? 37.800  57.056 9.133   1.00 49.61  ? 426 LEU B CB  1 
ATOM   6573 C CG  . LEU B 1 426 ? 38.934  56.476 9.965   1.00 54.53  ? 426 LEU B CG  1 
ATOM   6574 C CD1 . LEU B 1 426 ? 39.468  55.228 9.327   1.00 55.03  ? 426 LEU B CD1 1 
ATOM   6575 C CD2 . LEU B 1 426 ? 40.093  57.468 10.105  1.00 59.48  ? 426 LEU B CD2 1 
ATOM   6576 N N   . VAL B 1 427 ? 35.219  59.005 8.299   1.00 60.11  ? 427 VAL B N   1 
ATOM   6577 C CA  . VAL B 1 427 ? 34.598  59.870 7.300   1.00 62.90  ? 427 VAL B CA  1 
ATOM   6578 C C   . VAL B 1 427 ? 33.793  61.046 7.953   1.00 70.30  ? 427 VAL B C   1 
ATOM   6579 O O   . VAL B 1 427 ? 33.001  60.791 8.873   1.00 68.84  ? 427 VAL B O   1 
ATOM   6580 C CB  . VAL B 1 427 ? 33.820  59.042 6.232   1.00 66.92  ? 427 VAL B CB  1 
ATOM   6581 C CG1 . VAL B 1 427 ? 32.489  58.503 6.757   1.00 64.79  ? 427 VAL B CG1 1 
ATOM   6582 C CG2 . VAL B 1 427 ? 33.628  59.828 4.939   1.00 68.30  ? 427 VAL B CG2 1 
ATOM   6583 N N   . PRO B 1 428 ? 34.003  62.329 7.529   1.00 69.84  ? 428 PRO B N   1 
ATOM   6584 C CA  . PRO B 1 428 ? 33.262  63.448 8.158   1.00 73.26  ? 428 PRO B CA  1 
ATOM   6585 C C   . PRO B 1 428 ? 31.751  63.421 7.910   1.00 104.13 ? 428 PRO B C   1 
ATOM   6586 O O   . PRO B 1 428 ? 30.945  63.756 8.781   1.00 61.16  ? 428 PRO B O   1 
ATOM   6587 C CB  . PRO B 1 428 ? 33.920  64.698 7.551   1.00 75.98  ? 428 PRO B CB  1 
ATOM   6588 C CG  . PRO B 1 428 ? 35.231  64.221 6.962   1.00 80.03  ? 428 PRO B CG  1 
ATOM   6589 C CD  . PRO B 1 428 ? 34.935  62.832 6.497   1.00 74.09  ? 428 PRO B CD  1 
HETATM 6590 C C1  . 0X1 C 2 .   ? -16.160 22.310 16.767  1.00 33.19  ? 501 0X1 A C1  1 
HETATM 6591 C C2  . 0X1 C 2 .   ? -16.588 22.006 18.045  1.00 34.28  ? 501 0X1 A C2  1 
HETATM 6592 C C3  . 0X1 C 2 .   ? -18.715 21.306 17.184  1.00 35.28  ? 501 0X1 A C3  1 
HETATM 6593 C C4  . 0X1 C 2 .   ? -14.945 25.674 8.959   1.00 35.40  ? 501 0X1 A C4  1 
HETATM 6594 C C5  . 0X1 C 2 .   ? -15.791 23.951 10.356  1.00 35.25  ? 501 0X1 A C5  1 
HETATM 6595 C C6  . 0X1 C 2 .   ? -17.019 22.120 15.704  1.00 36.14  ? 501 0X1 A C6  1 
HETATM 6596 C C7  . 0X1 C 2 .   ? -14.822 24.911 10.105  1.00 35.69  ? 501 0X1 A C7  1 
HETATM 6597 C C8  . 0X1 C 2 .   ? -18.297 21.631 15.906  1.00 39.16  ? 501 0X1 A C8  1 
HETATM 6598 C C9  . 0X1 C 2 .   ? -17.856 21.495 18.247  1.00 34.71  ? 501 0X1 A C9  1 
HETATM 6599 C C10 . 0X1 C 2 .   ? -16.798 23.812 9.419   1.00 34.75  ? 501 0X1 A C10 1 
HETATM 6600 C C11 . 0X1 C 2 .   ? -16.839 24.625 8.308   1.00 34.24  ? 501 0X1 A C11 1 
HETATM 6601 C C12 . 0X1 C 2 .   ? -18.730 21.801 13.504  1.00 42.32  ? 501 0X1 A C12 1 
HETATM 6602 C C13 . 0X1 C 2 .   ? -15.724 23.092 11.593  1.00 35.76  ? 501 0X1 A C13 1 
HETATM 6603 C C14 . 0X1 C 2 .   ? -16.584 22.472 14.366  1.00 38.17  ? 501 0X1 A C14 1 
HETATM 6604 C C15 . 0X1 C 2 .   ? -17.372 22.344 13.289  1.00 39.30  ? 501 0X1 A C15 1 
HETATM 6605 C C16 . 0X1 C 2 .   ? -17.953 24.491 7.324   1.00 37.02  ? 501 0X1 A C16 1 
HETATM 6606 C C17 . 0X1 C 2 .   ? -13.645 25.117 11.009  1.00 33.88  ? 501 0X1 A C17 1 
HETATM 6607 N N18 . 0X1 C 2 .   ? -15.934 25.577 8.064   1.00 33.36  ? 501 0X1 A N18 1 
HETATM 6608 N N19 . 0X1 C 2 .   ? -17.058 22.670 11.997  1.00 36.63  ? 501 0X1 A N19 1 
HETATM 6609 N N20 . 0X1 C 2 .   ? -19.124 21.472 14.764  1.00 43.29  ? 501 0X1 A N20 1 
HETATM 6610 O O21 . 0X1 C 2 .   ? -10.585 23.605 9.927   1.00 37.53  ? 501 0X1 A O21 1 
HETATM 6611 O O22 . 0X1 C 2 .   ? -11.182 22.800 12.227  1.00 39.12  ? 501 0X1 A O22 1 
HETATM 6612 O O23 . 0X1 C 2 .   ? -10.935 25.291 11.737  1.00 38.23  ? 501 0X1 A O23 1 
HETATM 6613 O O24 . 0X1 C 2 .   ? -17.796 22.876 9.607   1.00 38.21  ? 501 0X1 A O24 1 
HETATM 6614 C C25 . 0X1 C 2 .   ? -20.425 21.035 14.681  1.00 46.48  ? 501 0X1 A C25 1 
HETATM 6615 O O26 . 0X1 C 2 .   ? -12.852 23.945 10.857  1.00 35.95  ? 501 0X1 A O26 1 
HETATM 6616 P P27 . 0X1 C 2 .   ? -11.262 23.917 11.216  1.00 37.32  ? 501 0X1 A P27 1 
HETATM 6617 O O28 . 0X1 C 2 .   ? -15.751 22.172 19.147  1.00 34.90  ? 501 0X1 A O28 1 
HETATM 6618 C C29 . 0X1 C 2 .   ? -15.521 23.491 19.507  1.00 35.51  ? 501 0X1 A C29 1 
HETATM 6619 C C30 . 0X1 C 2 .   ? -14.451 23.767 20.337  1.00 35.95  ? 501 0X1 A C30 1 
HETATM 6620 C C31 . 0X1 C 2 .   ? -14.175 25.069 20.708  1.00 39.21  ? 501 0X1 A C31 1 
HETATM 6621 C C32 . 0X1 C 2 .   ? -14.974 26.093 20.248  1.00 40.78  ? 501 0X1 A C32 1 
HETATM 6622 C C33 . 0X1 C 2 .   ? -16.057 25.813 19.437  1.00 39.47  ? 501 0X1 A C33 1 
HETATM 6623 C C34 . 0X1 C 2 .   ? -16.339 24.512 19.068  1.00 37.70  ? 501 0X1 A C34 1 
HETATM 6624 N N35 . 0X1 C 2 .   ? -20.704 21.113 13.332  1.00 45.85  ? 501 0X1 A N35 1 
HETATM 6625 O O36 . 0X1 C 2 .   ? -21.196 20.661 15.559  1.00 48.95  ? 501 0X1 A O36 1 
HETATM 6626 N N37 . 0X1 C 2 .   ? -19.651 21.599 12.621  1.00 44.36  ? 501 0X1 A N37 1 
HETATM 6627 C C1  . 0X1 D 2 .   ? 9.830   35.321 16.947  1.00 41.30  ? 501 0X1 B C1  1 
HETATM 6628 C C2  . 0X1 D 2 .   ? 10.564  35.026 15.815  1.00 42.27  ? 501 0X1 B C2  1 
HETATM 6629 C C3  . 0X1 D 2 .   ? 12.209  36.621 16.384  1.00 43.42  ? 501 0X1 B C3  1 
HETATM 6630 C C4  . 0X1 D 2 .   ? 5.280   39.081 23.360  1.00 35.23  ? 501 0X1 B C4  1 
HETATM 6631 C C5  . 0X1 D 2 .   ? 7.268   38.470 22.240  1.00 38.70  ? 501 0X1 B C5  1 
HETATM 6632 C C6  . 0X1 D 2 .   ? 10.293  36.304 17.793  1.00 41.20  ? 501 0X1 B C6  1 
HETATM 6633 C C7  . 0X1 D 2 .   ? 5.929   38.246 22.473  1.00 36.08  ? 501 0X1 B C7  1 
HETATM 6634 C C8  . 0X1 D 2 .   ? 11.473  36.951 17.499  1.00 43.87  ? 501 0X1 B C8  1 
HETATM 6635 C C9  . 0X1 D 2 .   ? 11.752  35.651 15.526  1.00 41.26  ? 501 0X1 B C9  1 
HETATM 6636 C C10 . 0X1 D 2 .   ? 7.863   39.538 22.898  1.00 38.63  ? 501 0X1 B C10 1 
HETATM 6637 C C11 . 0X1 D 2 .   ? 7.125   40.328 23.759  1.00 34.25  ? 501 0X1 B C11 1 
HETATM 6638 C C12 . 0X1 D 2 .   ? 11.226  38.303 19.503  1.00 44.41  ? 501 0X1 B C12 1 
HETATM 6639 C C13 . 0X1 D 2 .   ? 7.985   37.581 21.286  1.00 38.67  ? 501 0X1 B C13 1 
HETATM 6640 C C14 . 0X1 D 2 .   ? 9.534   36.667 18.981  1.00 40.46  ? 501 0X1 B C14 1 
HETATM 6641 C C15 . 0X1 D 2 .   ? 9.949   37.617 19.833  1.00 41.18  ? 501 0X1 B C15 1 
HETATM 6642 C C16 . 0X1 D 2 .   ? 7.767   41.486 24.448  1.00 30.42  ? 501 0X1 B C16 1 
HETATM 6643 C C17 . 0X1 D 2 .   ? 5.195   37.151 21.788  1.00 34.42  ? 501 0X1 B C17 1 
HETATM 6644 N N18 . 0X1 D 2 .   ? 5.831   40.111 24.014  1.00 33.73  ? 501 0X1 B N18 1 
HETATM 6645 N N19 . 0X1 D 2 .   ? 9.314   38.044 20.975  1.00 39.43  ? 501 0X1 B N19 1 
HETATM 6646 N N20 . 0X1 D 2 .   ? 11.908  37.941 18.381  1.00 46.45  ? 501 0X1 B N20 1 
HETATM 6647 O O21 . 0X1 D 2 .   ? 4.352   34.269 23.626  1.00 34.78  ? 501 0X1 B O21 1 
HETATM 6648 O O22 . 0X1 D 2 .   ? 5.687   33.612 21.567  1.00 37.40  ? 501 0X1 B O22 1 
HETATM 6649 O O23 . 0X1 D 2 .   ? 3.578   34.908 21.286  1.00 39.29  ? 501 0X1 B O23 1 
HETATM 6650 O O24 . 0X1 D 2 .   ? 9.201   39.837 22.727  1.00 38.52  ? 501 0X1 B O24 1 
HETATM 6651 C C25 . 0X1 D 2 .   ? 13.035  38.701 18.294  1.00 46.73  ? 501 0X1 B C25 1 
HETATM 6652 O O26 . 0X1 D 2 .   ? 5.592   35.957 22.421  1.00 35.68  ? 501 0X1 B O26 1 
HETATM 6653 P P27 . 0X1 D 2 .   ? 4.728   34.583 22.204  1.00 35.94  ? 501 0X1 B P27 1 
HETATM 6654 O O28 . 0X1 D 2 .   ? 10.133  34.059 14.934  1.00 45.31  ? 501 0X1 B O28 1 
HETATM 6655 C C29 . 0X1 D 2 .   ? 9.064   34.452 14.138  1.00 48.33  ? 501 0X1 B C29 1 
HETATM 6656 C C30 . 0X1 D 2 .   ? 8.426   33.461 13.437  1.00 48.65  ? 501 0X1 B C30 1 
HETATM 6657 C C31 . 0X1 D 2 .   ? 7.358   33.804 12.641  1.00 48.67  ? 501 0X1 B C31 1 
HETATM 6658 C C32 . 0X1 D 2 .   ? 6.932   35.115 12.541  1.00 48.88  ? 501 0X1 B C32 1 
HETATM 6659 C C33 . 0X1 D 2 .   ? 7.571   36.112 13.239  1.00 49.56  ? 501 0X1 B C33 1 
HETATM 6660 C C34 . 0X1 D 2 .   ? 8.641   35.767 14.033  1.00 49.97  ? 501 0X1 B C34 1 
HETATM 6661 N N35 . 0X1 D 2 .   ? 12.937  39.513 19.412  1.00 44.62  ? 501 0X1 B N35 1 
HETATM 6662 O O36 . 0X1 D 2 .   ? 13.915  38.674 17.440  1.00 45.84  ? 501 0X1 B O36 1 
HETATM 6663 N N37 . 0X1 D 2 .   ? 11.824  39.253 20.149  1.00 43.57  ? 501 0X1 B N37 1 
HETATM 6664 O O   . HOH E 3 .   ? -7.162  21.162 11.984  1.00 33.91  ? 601 HOH A O   1 
HETATM 6665 O O   . HOH E 3 .   ? -26.242 17.399 14.847  1.00 21.64  ? 602 HOH A O   1 
HETATM 6666 O O   . HOH E 3 .   ? 7.379   15.695 2.749   1.00 35.52  ? 603 HOH A O   1 
HETATM 6667 O O   . HOH E 3 .   ? 5.189   42.342 12.195  1.00 25.79  ? 604 HOH A O   1 
HETATM 6668 O O   . HOH E 3 .   ? 1.524   42.623 9.536   1.00 32.24  ? 605 HOH A O   1 
HETATM 6669 O O   . HOH E 3 .   ? -4.430  41.761 6.428   1.00 26.23  ? 606 HOH A O   1 
HETATM 6670 O O   . HOH E 3 .   ? -31.067 17.218 24.424  1.00 42.97  ? 607 HOH A O   1 
HETATM 6671 O O   . HOH E 3 .   ? -7.442  2.183  1.056   1.00 35.04  ? 608 HOH A O   1 
HETATM 6672 O O   . HOH E 3 .   ? 2.829   50.404 3.973   1.00 35.93  ? 609 HOH A O   1 
HETATM 6673 O O   . HOH E 3 .   ? -35.387 26.324 -3.361  1.00 28.80  ? 610 HOH A O   1 
HETATM 6674 O O   . HOH E 3 .   ? -20.071 16.299 -3.036  1.00 28.38  ? 611 HOH A O   1 
HETATM 6675 O O   . HOH E 3 .   ? -29.795 1.527  4.474   1.00 21.50  ? 612 HOH A O   1 
HETATM 6676 O O   . HOH E 3 .   ? -33.746 9.935  25.664  1.00 25.30  ? 613 HOH A O   1 
HETATM 6677 O O   . HOH E 3 .   ? -49.808 8.197  27.444  1.00 45.55  ? 614 HOH A O   1 
HETATM 6678 O O   . HOH E 3 .   ? -6.269  44.466 12.887  1.00 26.00  ? 615 HOH A O   1 
HETATM 6679 O O   . HOH E 3 .   ? -33.508 15.563 24.629  1.00 38.39  ? 616 HOH A O   1 
HETATM 6680 O O   . HOH E 3 .   ? 11.067  22.065 1.376   1.00 27.43  ? 617 HOH A O   1 
HETATM 6681 O O   . HOH E 3 .   ? -15.921 9.739  -4.394  1.00 28.65  ? 618 HOH A O   1 
HETATM 6682 O O   . HOH E 3 .   ? -19.151 19.743 -5.645  1.00 48.01  ? 619 HOH A O   1 
HETATM 6683 O O   . HOH E 3 .   ? -7.654  36.426 -17.298 1.00 43.69  ? 620 HOH A O   1 
HETATM 6684 O O   . HOH E 3 .   ? -45.265 16.652 0.053   1.00 49.13  ? 621 HOH A O   1 
HETATM 6685 O O   . HOH E 3 .   ? 12.216  2.661  15.639  1.00 42.37  ? 622 HOH A O   1 
HETATM 6686 O O   . HOH E 3 .   ? 11.983  25.662 14.437  1.00 33.92  ? 623 HOH A O   1 
HETATM 6687 O O   . HOH E 3 .   ? 10.527  10.339 11.776  1.00 42.56  ? 624 HOH A O   1 
HETATM 6688 O O   . HOH E 3 .   ? 11.267  32.676 11.649  1.00 38.39  ? 625 HOH A O   1 
HETATM 6689 O O   . HOH E 3 .   ? -30.658 13.611 24.491  1.00 61.49  ? 626 HOH A O   1 
HETATM 6690 O O   . HOH E 3 .   ? -7.387  43.244 8.558   1.00 35.50  ? 627 HOH A O   1 
HETATM 6691 O O   . HOH E 3 .   ? -32.589 26.981 -14.609 1.00 39.90  ? 628 HOH A O   1 
HETATM 6692 O O   . HOH E 3 .   ? -7.210  49.321 -0.099  1.00 57.87  ? 629 HOH A O   1 
HETATM 6693 O O   . HOH E 3 .   ? -30.479 29.963 -16.430 1.00 56.53  ? 630 HOH A O   1 
HETATM 6694 O O   . HOH E 3 .   ? 5.584   27.401 10.523  1.00 30.30  ? 631 HOH A O   1 
HETATM 6695 O O   . HOH E 3 .   ? -33.271 17.255 3.637   1.00 28.30  ? 632 HOH A O   1 
HETATM 6696 O O   . HOH E 3 .   ? -36.987 42.428 -14.964 1.00 49.83  ? 633 HOH A O   1 
HETATM 6697 O O   . HOH E 3 .   ? -21.891 17.649 6.280   1.00 39.34  ? 634 HOH A O   1 
HETATM 6698 O O   . HOH E 3 .   ? -15.159 6.406  -5.236  1.00 51.94  ? 635 HOH A O   1 
HETATM 6699 O O   . HOH E 3 .   ? 5.901   33.688 5.647   1.00 36.40  ? 636 HOH A O   1 
HETATM 6700 O O   . HOH E 3 .   ? -12.426 1.652  6.409   1.00 18.51  ? 637 HOH A O   1 
HETATM 6701 O O   . HOH E 3 .   ? -5.093  37.870 -16.197 1.00 55.28  ? 638 HOH A O   1 
HETATM 6702 O O   . HOH E 3 .   ? -35.778 11.192 26.831  1.00 41.29  ? 639 HOH A O   1 
HETATM 6703 O O   . HOH E 3 .   ? -0.723  35.083 -17.770 1.00 50.48  ? 640 HOH A O   1 
HETATM 6704 O O   . HOH E 3 .   ? -4.434  37.083 -21.787 1.00 36.27  ? 641 HOH A O   1 
HETATM 6705 O O   . HOH E 3 .   ? -45.257 12.495 -4.556  1.00 45.44  ? 642 HOH A O   1 
HETATM 6706 O O   . HOH E 3 .   ? -47.787 9.390  31.180  1.00 32.72  ? 643 HOH A O   1 
HETATM 6707 O O   . HOH E 3 .   ? 16.634  14.503 15.020  1.00 39.20  ? 644 HOH A O   1 
HETATM 6708 O O   . HOH E 3 .   ? -21.921 5.122  24.205  1.00 44.20  ? 645 HOH A O   1 
HETATM 6709 O O   . HOH E 3 .   ? -43.388 21.875 7.997   1.00 51.58  ? 646 HOH A O   1 
HETATM 6710 O O   . HOH E 3 .   ? -32.382 24.394 21.409  1.00 50.92  ? 647 HOH A O   1 
HETATM 6711 O O   . HOH E 3 .   ? -33.818 31.022 25.366  1.00 53.63  ? 648 HOH A O   1 
HETATM 6712 O O   . HOH E 3 .   ? -10.430 19.866 2.690   1.00 31.00  ? 649 HOH A O   1 
HETATM 6713 O O   . HOH E 3 .   ? 0.493   26.290 -16.872 1.00 44.86  ? 650 HOH A O   1 
HETATM 6714 O O   . HOH E 3 .   ? -42.929 28.915 -5.900  1.00 24.81  ? 651 HOH A O   1 
HETATM 6715 O O   . HOH E 3 .   ? -19.040 48.265 -4.522  1.00 71.04  ? 652 HOH A O   1 
HETATM 6716 O O   . HOH E 3 .   ? -37.477 41.520 -7.380  1.00 45.27  ? 653 HOH A O   1 
HETATM 6717 O O   . HOH E 3 .   ? -4.281  52.014 4.236   1.00 52.83  ? 654 HOH A O   1 
HETATM 6718 O O   . HOH E 3 .   ? -32.465 1.857  3.911   1.00 43.81  ? 655 HOH A O   1 
HETATM 6719 O O   . HOH E 3 .   ? 13.010  31.058 12.892  1.00 41.15  ? 656 HOH A O   1 
HETATM 6720 O O   . HOH E 3 .   ? -40.484 28.729 -17.837 1.00 41.08  ? 657 HOH A O   1 
HETATM 6721 O O   . HOH E 3 .   ? -6.922  37.931 -19.973 1.00 59.61  ? 658 HOH A O   1 
HETATM 6722 O O   . HOH E 3 .   ? -9.488  40.073 -14.237 1.00 47.65  ? 659 HOH A O   1 
HETATM 6723 O O   . HOH E 3 .   ? -34.038 34.079 -0.243  1.00 44.45  ? 660 HOH A O   1 
HETATM 6724 O O   . HOH E 3 .   ? -12.300 18.489 -7.914  1.00 32.50  ? 661 HOH A O   1 
HETATM 6725 O O   . HOH E 3 .   ? 0.940   52.093 5.726   1.00 44.88  ? 662 HOH A O   1 
HETATM 6726 O O   . HOH E 3 .   ? 7.971   27.663 -10.068 1.00 46.67  ? 663 HOH A O   1 
HETATM 6727 O O   . HOH E 3 .   ? 14.484  18.631 10.843  1.00 24.83  ? 664 HOH A O   1 
HETATM 6728 O O   . HOH E 3 .   ? -31.046 25.641 18.243  1.00 59.27  ? 665 HOH A O   1 
HETATM 6729 O O   . HOH E 3 .   ? -44.983 14.918 11.210  1.00 41.66  ? 666 HOH A O   1 
HETATM 6730 O O   . HOH E 3 .   ? -18.837 -3.508 5.946   1.00 40.49  ? 667 HOH A O   1 
HETATM 6731 O O   . HOH E 3 .   ? -12.801 11.626 11.125  1.00 31.52  ? 668 HOH A O   1 
HETATM 6732 O O   . HOH E 3 .   ? 6.718   4.125  21.595  1.00 41.94  ? 669 HOH A O   1 
HETATM 6733 O O   . HOH E 3 .   ? -46.432 20.493 5.973   1.00 63.90  ? 670 HOH A O   1 
HETATM 6734 O O   . HOH E 3 .   ? 4.476   5.927  21.208  1.00 49.37  ? 671 HOH A O   1 
HETATM 6735 O O   . HOH E 3 .   ? -17.308 0.562  0.547   1.00 40.09  ? 672 HOH A O   1 
HETATM 6736 O O   . HOH E 3 .   ? 23.570  32.146 4.508   1.00 42.28  ? 673 HOH A O   1 
HETATM 6737 O O   . HOH E 3 .   ? -9.757  49.605 7.242   1.00 37.99  ? 674 HOH A O   1 
HETATM 6738 O O   . HOH E 3 .   ? 20.905  40.056 1.870   1.00 37.41  ? 675 HOH A O   1 
HETATM 6739 O O   . HOH E 3 .   ? 21.519  36.729 1.377   1.00 58.74  ? 676 HOH A O   1 
HETATM 6740 O O   . HOH E 3 .   ? -4.113  4.934  -2.733  1.00 39.21  ? 677 HOH A O   1 
HETATM 6741 O O   . HOH E 3 .   ? -31.074 29.534 -19.070 1.00 47.13  ? 678 HOH A O   1 
HETATM 6742 O O   . HOH E 3 .   ? 21.788  31.984 7.241   1.00 43.70  ? 679 HOH A O   1 
HETATM 6743 O O   . HOH E 3 .   ? -35.420 25.861 -7.550  1.00 36.04  ? 680 HOH A O   1 
HETATM 6744 O O   . HOH E 3 .   ? -11.140 37.230 -17.116 1.00 46.95  ? 681 HOH A O   1 
HETATM 6745 O O   . HOH E 3 .   ? 21.060  32.662 10.637  1.00 40.57  ? 682 HOH A O   1 
HETATM 6746 O O   . HOH E 3 .   ? 20.155  34.584 6.169   1.00 58.57  ? 683 HOH A O   1 
HETATM 6747 O O   . HOH E 3 .   ? -1.718  36.978 -20.777 1.00 41.57  ? 684 HOH A O   1 
HETATM 6748 O O   . HOH E 3 .   ? -3.463  19.895 -18.699 1.00 34.60  ? 685 HOH A O   1 
HETATM 6749 O O   . HOH E 3 .   ? -26.895 7.937  20.348  1.00 60.86  ? 686 HOH A O   1 
HETATM 6750 O O   . HOH E 3 .   ? -10.712 20.440 -8.755  1.00 40.89  ? 687 HOH A O   1 
HETATM 6751 O O   . HOH E 3 .   ? -21.797 17.475 -10.877 1.00 48.50  ? 688 HOH A O   1 
HETATM 6752 O O   . HOH E 3 .   ? 20.989  36.984 5.316   1.00 68.64  ? 689 HOH A O   1 
HETATM 6753 O O   . HOH E 3 .   ? -6.777  41.030 -20.096 1.00 60.31  ? 690 HOH A O   1 
HETATM 6754 O O   . HOH E 3 .   ? -9.553  45.429 8.572   1.00 45.92  ? 691 HOH A O   1 
HETATM 6755 O O   . HOH E 3 .   ? -28.963 46.200 -1.767  1.00 41.55  ? 692 HOH A O   1 
HETATM 6756 O O   . HOH E 3 .   ? -32.949 14.132 27.548  1.00 46.75  ? 693 HOH A O   1 
HETATM 6757 O O   . HOH E 3 .   ? -33.218 29.108 0.404   1.00 62.72  ? 694 HOH A O   1 
HETATM 6758 O O   . HOH F 3 .   ? -5.680  34.371 15.641  1.00 3.00   ? 601 HOH B O   1 
HETATM 6759 O O   . HOH F 3 .   ? 9.814   60.065 38.157  1.00 23.39  ? 602 HOH B O   1 
HETATM 6760 O O   . HOH F 3 .   ? -8.556  23.655 24.965  1.00 27.85  ? 603 HOH B O   1 
HETATM 6761 O O   . HOH F 3 .   ? -6.217  30.190 20.252  1.00 18.52  ? 604 HOH B O   1 
HETATM 6762 O O   . HOH F 3 .   ? 22.808  34.924 20.663  1.00 28.74  ? 605 HOH B O   1 
HETATM 6763 O O   . HOH F 3 .   ? -8.273  57.623 23.070  1.00 18.19  ? 606 HOH B O   1 
HETATM 6764 O O   . HOH F 3 .   ? -4.719  6.685  27.911  1.00 32.21  ? 607 HOH B O   1 
HETATM 6765 O O   . HOH F 3 .   ? 8.772   40.981 30.708  1.00 26.00  ? 608 HOH B O   1 
HETATM 6766 O O   . HOH F 3 .   ? -11.000 19.706 27.564  1.00 14.10  ? 609 HOH B O   1 
HETATM 6767 O O   . HOH F 3 .   ? -15.372 26.624 24.290  1.00 19.24  ? 610 HOH B O   1 
HETATM 6768 O O   . HOH F 3 .   ? 5.774   34.911 31.532  1.00 16.26  ? 611 HOH B O   1 
HETATM 6769 O O   . HOH F 3 .   ? 13.480  42.438 36.095  1.00 23.27  ? 612 HOH B O   1 
HETATM 6770 O O   . HOH F 3 .   ? -3.613  44.890 13.823  1.00 17.46  ? 613 HOH B O   1 
HETATM 6771 O O   . HOH F 3 .   ? 14.061  54.947 13.755  1.00 29.09  ? 614 HOH B O   1 
HETATM 6772 O O   . HOH F 3 .   ? 4.809   29.178 23.199  1.00 36.44  ? 615 HOH B O   1 
HETATM 6773 O O   . HOH F 3 .   ? -13.534 46.905 45.982  1.00 34.45  ? 616 HOH B O   1 
HETATM 6774 O O   . HOH F 3 .   ? -13.865 27.959 26.357  1.00 16.10  ? 617 HOH B O   1 
HETATM 6775 O O   . HOH F 3 .   ? -2.912  16.928 32.862  1.00 18.88  ? 618 HOH B O   1 
HETATM 6776 O O   . HOH F 3 .   ? -5.591  7.939  18.621  1.00 28.58  ? 619 HOH B O   1 
HETATM 6777 O O   . HOH F 3 .   ? 25.860  65.226 13.698  1.00 50.67  ? 620 HOH B O   1 
HETATM 6778 O O   . HOH F 3 .   ? -20.932 36.598 17.201  1.00 21.81  ? 621 HOH B O   1 
HETATM 6779 O O   . HOH F 3 .   ? 2.140   47.087 10.287  1.00 39.20  ? 622 HOH B O   1 
HETATM 6780 O O   . HOH F 3 .   ? 9.840   60.899 42.205  1.00 46.30  ? 623 HOH B O   1 
HETATM 6781 O O   . HOH F 3 .   ? 39.336  48.438 17.967  1.00 32.45  ? 624 HOH B O   1 
HETATM 6782 O O   . HOH F 3 .   ? 28.852  50.498 31.930  1.00 47.40  ? 625 HOH B O   1 
HETATM 6783 O O   . HOH F 3 .   ? 29.108  51.695 29.212  1.00 35.53  ? 626 HOH B O   1 
HETATM 6784 O O   . HOH F 3 .   ? -17.736 35.937 18.185  1.00 33.04  ? 627 HOH B O   1 
HETATM 6785 O O   . HOH F 3 .   ? -1.679  26.182 19.497  1.00 41.29  ? 628 HOH B O   1 
HETATM 6786 O O   . HOH F 3 .   ? 25.157  57.532 9.714   1.00 35.85  ? 629 HOH B O   1 
HETATM 6787 O O   . HOH F 3 .   ? 0.998   57.194 16.307  1.00 27.24  ? 630 HOH B O   1 
HETATM 6788 O O   . HOH F 3 .   ? -12.966 44.765 17.688  1.00 37.88  ? 631 HOH B O   1 
HETATM 6789 O O   . HOH F 3 .   ? -11.147 17.470 25.614  1.00 22.75  ? 632 HOH B O   1 
HETATM 6790 O O   . HOH F 3 .   ? 3.908   39.839 42.048  1.00 22.74  ? 633 HOH B O   1 
HETATM 6791 O O   . HOH F 3 .   ? -8.727  25.908 40.089  1.00 51.57  ? 634 HOH B O   1 
HETATM 6792 O O   . HOH F 3 .   ? -20.708 35.679 41.474  1.00 25.55  ? 635 HOH B O   1 
HETATM 6793 O O   . HOH F 3 .   ? 21.283  49.696 27.402  1.00 39.56  ? 636 HOH B O   1 
HETATM 6794 O O   . HOH F 3 .   ? -13.687 41.147 13.929  1.00 27.09  ? 637 HOH B O   1 
HETATM 6795 O O   . HOH F 3 .   ? 14.911  41.146 26.951  1.00 34.74  ? 638 HOH B O   1 
HETATM 6796 O O   . HOH F 3 .   ? -4.629  65.843 23.329  1.00 46.94  ? 639 HOH B O   1 
HETATM 6797 O O   . HOH F 3 .   ? -16.514 50.495 16.867  1.00 36.91  ? 640 HOH B O   1 
HETATM 6798 O O   . HOH F 3 .   ? 3.759   56.068 8.073   1.00 49.68  ? 641 HOH B O   1 
HETATM 6799 O O   . HOH F 3 .   ? -10.065 1.700  17.502  1.00 57.37  ? 642 HOH B O   1 
HETATM 6800 O O   . HOH F 3 .   ? -6.001  51.075 47.207  1.00 34.11  ? 643 HOH B O   1 
HETATM 6801 O O   . HOH F 3 .   ? 4.328   59.677 47.813  1.00 42.62  ? 644 HOH B O   1 
HETATM 6802 O O   . HOH F 3 .   ? -16.102 34.536 43.995  1.00 43.77  ? 645 HOH B O   1 
HETATM 6803 O O   . HOH F 3 .   ? -11.374 57.084 18.018  1.00 40.54  ? 646 HOH B O   1 
HETATM 6804 O O   . HOH F 3 .   ? -3.151  61.415 48.244  1.00 41.61  ? 647 HOH B O   1 
HETATM 6805 O O   . HOH F 3 .   ? -10.132 30.926 34.978  1.00 35.12  ? 648 HOH B O   1 
HETATM 6806 O O   . HOH F 3 .   ? -14.227 27.234 40.859  1.00 41.14  ? 649 HOH B O   1 
HETATM 6807 O O   . HOH F 3 .   ? -6.144  68.143 24.612  1.00 57.35  ? 650 HOH B O   1 
HETATM 6808 O O   . HOH F 3 .   ? 5.702   60.246 20.350  1.00 36.18  ? 651 HOH B O   1 
HETATM 6809 O O   . HOH F 3 .   ? 34.158  62.473 11.155  1.00 36.99  ? 652 HOH B O   1 
HETATM 6810 O O   . HOH F 3 .   ? -1.850  53.426 14.430  1.00 30.97  ? 653 HOH B O   1 
HETATM 6811 O O   . HOH F 3 .   ? -13.204 50.244 15.664  1.00 32.58  ? 654 HOH B O   1 
HETATM 6812 O O   . HOH F 3 .   ? -15.398 45.103 45.562  1.00 41.68  ? 655 HOH B O   1 
HETATM 6813 O O   . HOH F 3 .   ? 6.460   39.412 41.260  1.00 21.03  ? 656 HOH B O   1 
HETATM 6814 O O   . HOH F 3 .   ? 9.103   63.883 41.810  1.00 35.95  ? 657 HOH B O   1 
HETATM 6815 O O   . HOH F 3 .   ? 15.118  29.231 27.167  1.00 32.22  ? 658 HOH B O   1 
HETATM 6816 O O   . HOH F 3 .   ? -1.269  60.733 40.475  1.00 26.14  ? 659 HOH B O   1 
HETATM 6817 O O   . HOH F 3 .   ? 21.063  46.606 27.584  1.00 29.84  ? 660 HOH B O   1 
HETATM 6818 O O   . HOH F 3 .   ? 23.645  31.990 38.437  1.00 29.52  ? 661 HOH B O   1 
HETATM 6819 O O   . HOH F 3 .   ? 20.781  46.551 35.837  1.00 34.39  ? 662 HOH B O   1 
HETATM 6820 O O   . HOH F 3 .   ? -4.241  57.557 42.926  1.00 51.90  ? 663 HOH B O   1 
HETATM 6821 O O   . HOH F 3 .   ? -2.969  49.487 45.044  1.00 34.52  ? 664 HOH B O   1 
HETATM 6822 O O   . HOH F 3 .   ? 22.882  60.536 18.013  1.00 34.90  ? 665 HOH B O   1 
HETATM 6823 O O   . HOH F 3 .   ? -9.330  70.175 16.202  1.00 44.84  ? 666 HOH B O   1 
HETATM 6824 O O   . HOH F 3 .   ? 13.652  27.723 43.514  1.00 39.79  ? 667 HOH B O   1 
HETATM 6825 O O   . HOH F 3 .   ? 3.717   70.469 31.679  1.00 49.42  ? 668 HOH B O   1 
HETATM 6826 O O   . HOH F 3 .   ? -10.469 47.968 16.347  1.00 28.93  ? 669 HOH B O   1 
HETATM 6827 O O   . HOH F 3 .   ? -11.373 41.475 19.764  1.00 31.40  ? 670 HOH B O   1 
HETATM 6828 O O   . HOH F 3 .   ? -13.516 55.872 15.158  1.00 41.22  ? 671 HOH B O   1 
HETATM 6829 O O   . HOH F 3 .   ? -1.271  41.395 46.109  1.00 31.87  ? 672 HOH B O   1 
HETATM 6830 O O   . HOH F 3 .   ? -12.898 48.222 43.816  1.00 55.44  ? 673 HOH B O   1 
HETATM 6831 O O   . HOH F 3 .   ? -7.217  63.496 21.260  1.00 38.56  ? 674 HOH B O   1 
HETATM 6832 O O   . HOH F 3 .   ? 14.915  64.812 33.484  1.00 40.91  ? 675 HOH B O   1 
HETATM 6833 O O   . HOH F 3 .   ? 22.929  39.426 39.057  1.00 38.89  ? 676 HOH B O   1 
HETATM 6834 O O   . HOH F 3 .   ? -6.405  61.399 15.292  1.00 37.33  ? 677 HOH B O   1 
HETATM 6835 O O   . HOH F 3 .   ? 30.291  63.891 11.883  1.00 38.69  ? 678 HOH B O   1 
HETATM 6836 O O   . HOH F 3 .   ? -1.921  50.450 48.351  1.00 44.30  ? 679 HOH B O   1 
HETATM 6837 O O   . HOH F 3 .   ? -14.537 52.864 13.346  1.00 36.46  ? 680 HOH B O   1 
HETATM 6838 O O   . HOH F 3 .   ? 28.771  40.715 42.271  1.00 42.48  ? 681 HOH B O   1 
HETATM 6839 O O   . HOH F 3 .   ? -13.044 50.225 47.266  1.00 43.92  ? 682 HOH B O   1 
HETATM 6840 O O   . HOH F 3 .   ? 27.650  41.815 39.650  1.00 53.16  ? 683 HOH B O   1 
HETATM 6841 O O   . HOH F 3 .   ? -2.625  8.086  28.707  1.00 38.76  ? 684 HOH B O   1 
HETATM 6842 O O   . HOH F 3 .   ? -6.228  7.935  29.824  1.00 29.84  ? 685 HOH B O   1 
HETATM 6843 O O   . HOH F 3 .   ? -9.184  42.111 47.629  1.00 42.63  ? 686 HOH B O   1 
HETATM 6844 O O   . HOH F 3 .   ? 6.408   61.972 13.086  1.00 41.34  ? 687 HOH B O   1 
HETATM 6845 O O   . HOH F 3 .   ? 5.833   43.105 36.699  1.00 28.47  ? 688 HOH B O   1 
HETATM 6846 O O   . HOH F 3 .   ? -16.492 32.258 42.538  1.00 57.47  ? 689 HOH B O   1 
HETATM 6847 O O   . HOH F 3 .   ? 32.386  61.603 12.878  1.00 47.47  ? 690 HOH B O   1 
HETATM 6848 O O   . HOH F 3 .   ? -13.428 45.311 48.139  1.00 57.99  ? 691 HOH B O   1 
HETATM 6849 O O   . HOH F 3 .   ? 28.147  62.070 12.217  1.00 47.48  ? 692 HOH B O   1 
HETATM 6850 O O   . HOH F 3 .   ? -17.652 47.140 46.803  1.00 58.94  ? 693 HOH B O   1 
HETATM 6851 O O   . HOH F 3 .   ? 36.120  42.060 29.495  1.00 55.90  ? 694 HOH B O   1 
HETATM 6852 O O   . HOH F 3 .   ? 3.076   50.191 50.243  1.00 41.18  ? 695 HOH B O   1 
HETATM 6853 O O   . HOH F 3 .   ? 8.479   63.978 44.447  1.00 54.46  ? 696 HOH B O   1 
HETATM 6854 O O   . HOH F 3 .   ? -13.352 33.129 37.544  1.00 41.55  ? 697 HOH B O   1 
HETATM 6855 O O   . HOH F 3 .   ? 35.890  31.929 18.385  1.00 54.77  ? 698 HOH B O   1 
HETATM 6856 O O   . HOH F 3 .   ? -10.470 16.825 23.062  1.00 28.57  ? 699 HOH B O   1 
HETATM 6857 O O   . HOH F 3 .   ? -19.136 31.302 17.780  1.00 30.95  ? 700 HOH B O   1 
HETATM 6858 O O   . HOH F 3 .   ? 10.631  47.663 31.899  1.00 30.28  ? 701 HOH B O   1 
HETATM 6859 O O   . HOH F 3 .   ? 20.180  42.726 8.992   1.00 53.65  ? 702 HOH B O   1 
HETATM 6860 O O   . HOH F 3 .   ? 3.467   51.985 14.912  1.00 44.89  ? 703 HOH B O   1 
HETATM 6861 O O   . HOH F 3 .   ? 11.957  10.474 30.001  1.00 53.50  ? 704 HOH B O   1 
HETATM 6862 O O   . HOH F 3 .   ? -12.928 14.973 22.981  1.00 44.85  ? 705 HOH B O   1 
HETATM 6863 O O   . HOH F 3 .   ? 30.815  52.164 1.534   1.00 49.35  ? 706 HOH B O   1 
HETATM 6864 O O   . HOH F 3 .   ? 30.087  33.633 33.238  1.00 37.43  ? 707 HOH B O   1 
HETATM 6865 O O   . HOH F 3 .   ? 38.924  35.877 22.213  1.00 52.73  ? 708 HOH B O   1 
HETATM 6866 O O   . HOH F 3 .   ? 7.232   53.067 47.232  1.00 52.87  ? 709 HOH B O   1 
HETATM 6867 O O   . HOH F 3 .   ? -10.810 39.041 46.074  1.00 31.94  ? 710 HOH B O   1 
HETATM 6868 O O   . HOH F 3 .   ? 22.160  42.641 1.344   1.00 51.21  ? 711 HOH B O   1 
HETATM 6869 O O   . HOH F 3 .   ? 20.350  20.112 29.625  1.00 53.12  ? 712 HOH B O   1 
HETATM 6870 O O   . HOH F 3 .   ? 3.041   63.479 54.477  1.00 30.37  ? 713 HOH B O   1 
HETATM 6871 O O   . HOH F 3 .   ? 7.738   69.099 44.805  1.00 45.82  ? 714 HOH B O   1 
HETATM 6872 O O   . HOH F 3 .   ? 10.911  44.487 44.689  1.00 46.76  ? 715 HOH B O   1 
HETATM 6873 O O   . HOH F 3 .   ? 31.683  55.698 18.253  1.00 36.06  ? 716 HOH B O   1 
HETATM 6874 O O   . HOH F 3 .   ? 6.384   52.195 50.074  1.00 42.82  ? 717 HOH B O   1 
HETATM 6875 O O   . HOH F 3 .   ? -2.631  57.191 12.084  1.00 68.87  ? 718 HOH B O   1 
HETATM 6876 O O   . HOH F 3 .   ? 11.224  42.017 46.290  1.00 56.59  ? 719 HOH B O   1 
HETATM 6877 O O   . HOH F 3 .   ? 20.862  49.792 34.605  1.00 42.70  ? 720 HOH B O   1 
HETATM 6878 O O   . HOH F 3 .   ? -12.494 30.786 31.432  1.00 46.87  ? 721 HOH B O   1 
HETATM 6879 O O   . HOH F 3 .   ? 18.429  48.204 33.292  1.00 25.37  ? 722 HOH B O   1 
HETATM 6880 O O   . HOH F 3 .   ? -13.962 40.745 21.172  1.00 34.12  ? 723 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 1.0287 1.1219 0.7868 -0.1830 -0.0607 0.2295  1   MET A N   
2    C CA  . MET A 1   ? 0.9893 1.0800 0.7894 -0.1626 -0.0671 0.2265  1   MET A CA  
3    C C   . MET A 1   ? 1.0088 1.0814 0.8358 -0.1525 -0.0621 0.2335  1   MET A C   
4    O O   . MET A 1   ? 1.0021 1.0677 0.8297 -0.1557 -0.0449 0.2227  1   MET A O   
5    C CB  . MET A 1   ? 0.9867 1.0876 0.8013 -0.1566 -0.0568 0.1987  1   MET A CB  
6    C CG  . MET A 1   ? 1.0418 1.1601 0.8436 -0.1606 -0.0656 0.1918  1   MET A CG  
7    S SD  . MET A 1   ? 1.0834 1.2077 0.9139 -0.1449 -0.0875 0.2017  1   MET A SD  
8    C CE  . MET A 1   ? 0.9911 1.1116 0.8617 -0.1278 -0.0763 0.1806  1   MET A CE  
9    N N   . ASN A 2   ? 0.9353 1.0005 0.7863 -0.1405 -0.0768 0.2508  2   ASN A N   
10   C CA  . ASN A 2   ? 0.9073 0.9551 0.7874 -0.1299 -0.0729 0.2568  2   ASN A CA  
11   C C   . ASN A 2   ? 0.8867 0.9368 0.8025 -0.1141 -0.0685 0.2379  2   ASN A C   
12   O O   . ASN A 2   ? 0.8805 0.9329 0.8206 -0.1021 -0.0806 0.2421  2   ASN A O   
13   C CB  . ASN A 2   ? 0.9167 0.9541 0.8054 -0.1259 -0.0901 0.2854  2   ASN A CB  
14   C CG  . ASN A 2   ? 1.1321 1.1510 1.0544 -0.1142 -0.0863 0.2908  2   ASN A CG  
15   O OD1 . ASN A 2   ? 1.0462 1.0554 0.9720 -0.1160 -0.0702 0.2814  2   ASN A OD1 
16   N ND2 . ASN A 2   ? 1.0180 1.0322 0.9675 -0.1022 -0.1011 0.3053  2   ASN A ND2 
17   N N   . TYR A 3   ? 0.7877 0.8384 0.7058 -0.1150 -0.0513 0.2165  3   TYR A N   
18   C CA  . TYR A 3   ? 0.7338 0.7866 0.6812 -0.1022 -0.0457 0.1975  3   TYR A CA  
19   C C   . TYR A 3   ? 0.7695 0.8086 0.7512 -0.0888 -0.0474 0.2029  3   TYR A C   
20   O O   . TYR A 3   ? 0.7363 0.7778 0.7431 -0.0773 -0.0480 0.1919  3   TYR A O   
21   C CB  . TYR A 3   ? 0.7208 0.7775 0.6619 -0.1072 -0.0280 0.1749  3   TYR A CB  
22   C CG  . TYR A 3   ? 0.7313 0.8030 0.6451 -0.1182 -0.0255 0.1647  3   TYR A CG  
23   C CD1 . TYR A 3   ? 0.7601 0.8331 0.6478 -0.1327 -0.0136 0.1604  3   TYR A CD1 
24   C CD2 . TYR A 3   ? 0.7325 0.8170 0.6470 -0.1147 -0.0343 0.1588  3   TYR A CD2 
25   C CE1 . TYR A 3   ? 0.7672 0.8538 0.6306 -0.1435 -0.0100 0.1494  3   TYR A CE1 
26   C CE2 . TYR A 3   ? 0.7514 0.8493 0.6414 -0.1255 -0.0315 0.1485  3   TYR A CE2 
27   C CZ  . TYR A 3   ? 0.8438 0.9424 0.7083 -0.1398 -0.0191 0.1435  3   TYR A CZ  
28   O OH  . TYR A 3   ? 0.8447 0.9563 0.6857 -0.1510 -0.0153 0.1319  3   TYR A OH  
29   N N   . ALA A 4   ? 0.7528 0.7772 0.7351 -0.0911 -0.0482 0.2201  4   ALA A N   
30   C CA  . ALA A 4   ? 0.7427 0.7517 0.7564 -0.0803 -0.0489 0.2269  4   ALA A CA  
31   C C   . ALA A 4   ? 0.7715 0.7824 0.8128 -0.0668 -0.0626 0.2327  4   ALA A C   
32   O O   . ALA A 4   ? 0.7480 0.7504 0.8203 -0.0560 -0.0597 0.2278  4   ALA A O   
33   C CB  . ALA A 4   ? 0.7826 0.7764 0.7873 -0.0873 -0.0492 0.2472  4   ALA A CB  
34   N N   . ARG A 5   ? 0.7265 0.7493 0.7573 -0.0682 -0.0770 0.2418  5   ARG A N   
35   C CA  . ARG A 5   ? 0.7146 0.7417 0.7723 -0.0561 -0.0904 0.2469  5   ARG A CA  
36   C C   . ARG A 5   ? 0.7289 0.7680 0.8012 -0.0487 -0.0865 0.2247  5   ARG A C   
37   O O   . ARG A 5   ? 0.7149 0.7575 0.8137 -0.0381 -0.0947 0.2253  5   ARG A O   
38   C CB  . ARG A 5   ? 0.7459 0.7800 0.7900 -0.0603 -0.1093 0.2686  5   ARG A CB  
39   C CG  . ARG A 5   ? 0.8677 0.9208 0.8812 -0.0702 -0.1139 0.2629  5   ARG A CG  
40   C CD  . ARG A 5   ? 0.9751 1.0358 0.9791 -0.0733 -0.1348 0.2848  5   ARG A CD  
41   N NE  . ARG A 5   ? 0.9851 1.0493 1.0259 -0.0591 -0.1481 0.2904  5   ARG A NE  
42   C CZ  . ARG A 5   ? 1.0619 1.1435 1.1089 -0.0559 -0.1574 0.2839  5   ARG A CZ  
43   N NH1 . ARG A 5   ? 0.8762 0.9605 0.9597 -0.0430 -0.1683 0.2889  5   ARG A NH1 
44   N NH2 . ARG A 5   ? 0.7954 0.8918 0.8136 -0.0660 -0.1551 0.2718  5   ARG A NH2 
45   N N   . PHE A 6   ? 0.6616 0.7066 0.7183 -0.0542 -0.0737 0.2053  6   PHE A N   
46   C CA  . PHE A 6   ? 0.6260 0.6811 0.6926 -0.0488 -0.0689 0.1843  6   PHE A CA  
47   C C   . PHE A 6   ? 0.6226 0.6694 0.7042 -0.0443 -0.0541 0.1676  6   PHE A C   
48   O O   . PHE A 6   ? 0.5894 0.6424 0.6797 -0.0399 -0.0495 0.1508  6   PHE A O   
49   C CB  . PHE A 6   ? 0.6557 0.7260 0.6938 -0.0585 -0.0682 0.1751  6   PHE A CB  
50   C CG  . PHE A 6   ? 0.7079 0.7887 0.7288 -0.0644 -0.0832 0.1895  6   PHE A CG  
51   C CD1 . PHE A 6   ? 0.7809 0.8627 0.7688 -0.0780 -0.0842 0.1995  6   PHE A CD1 
52   C CD2 . PHE A 6   ? 0.7326 0.8227 0.7699 -0.0571 -0.0964 0.1930  6   PHE A CD2 
53   C CE1 . PHE A 6   ? 0.8152 0.9074 0.7846 -0.0847 -0.0990 0.2129  6   PHE A CE1 
54   C CE2 . PHE A 6   ? 0.7931 0.8943 0.8146 -0.0631 -0.1116 0.2064  6   PHE A CE2 
55   C CZ  . PHE A 6   ? 0.7982 0.9003 0.7850 -0.0770 -0.1133 0.2166  6   PHE A CZ  
56   N N   . ILE A 7   ? 0.5705 0.6032 0.6545 -0.0461 -0.0470 0.1727  7   ILE A N   
57   C CA  . ILE A 7   ? 0.5439 0.5682 0.6422 -0.0427 -0.0340 0.1586  7   ILE A CA  
58   C C   . ILE A 7   ? 0.5633 0.5743 0.6917 -0.0333 -0.0361 0.1656  7   ILE A C   
59   O O   . ILE A 7   ? 0.5776 0.5801 0.7084 -0.0337 -0.0427 0.1840  7   ILE A O   
60   C CB  . ILE A 7   ? 0.5996 0.6194 0.6788 -0.0532 -0.0222 0.1554  7   ILE A CB  
61   C CG1 . ILE A 7   ? 0.6637 0.6738 0.7306 -0.0603 -0.0252 0.1759  7   ILE A CG1 
62   C CG2 . ILE A 7   ? 0.5839 0.6172 0.6395 -0.0612 -0.0176 0.1434  7   ILE A CG2 
63   C CD1 . ILE A 7   ? 0.8517 0.8536 0.9050 -0.0708 -0.0118 0.1745  7   ILE A CD1 
64   N N   . THR A 8   ? 0.4772 0.4863 0.6284 -0.0250 -0.0312 0.1516  8   THR A N   
65   C CA  . THR A 8   ? 0.4691 0.4653 0.6500 -0.0168 -0.0311 0.1557  8   THR A CA  
66   C C   . THR A 8   ? 0.5042 0.4849 0.6874 -0.0205 -0.0214 0.1571  8   THR A C   
67   O O   . THR A 8   ? 0.4814 0.4628 0.6450 -0.0290 -0.0139 0.1528  8   THR A O   
68   C CB  . THR A 8   ? 0.5127 0.5116 0.7157 -0.0084 -0.0279 0.1397  8   THR A CB  
69   O OG1 . THR A 8   ? 0.5501 0.5528 0.7431 -0.0117 -0.0181 0.1219  8   THR A OG1 
70   C CG2 . THR A 8   ? 0.4444 0.4553 0.6553 -0.0028 -0.0380 0.1410  8   THR A CG2 
71   N N   . ALA A 9   ? 0.4592 0.4263 0.6686 -0.0143 -0.0208 0.1621  9   ALA A N   
72   C CA  . ALA A 9   ? 0.4620 0.4140 0.6771 -0.0176 -0.0113 0.1622  9   ALA A CA  
73   C C   . ALA A 9   ? 0.5001 0.4543 0.7144 -0.0195 0.0006  0.1405  9   ALA A C   
74   O O   . ALA A 9   ? 0.4990 0.4488 0.7032 -0.0267 0.0087  0.1375  9   ALA A O   
75   C CB  . ALA A 9   ? 0.4762 0.4135 0.7219 -0.0101 -0.0129 0.1699  9   ALA A CB  
76   N N   . ALA A 10  ? 0.4307 0.3926 0.6545 -0.0138 0.0011  0.1260  10  ALA A N   
77   C CA  . ALA A 10  ? 0.4116 0.3767 0.6339 -0.0153 0.0100  0.1066  10  ALA A CA  
78   C C   . ALA A 10  ? 0.4592 0.4353 0.6560 -0.0227 0.0123  0.1012  10  ALA A C   
79   O O   . ALA A 10  ? 0.4262 0.4009 0.6191 -0.0273 0.0203  0.0918  10  ALA A O   
80   C CB  . ALA A 10  ? 0.4046 0.3758 0.6402 -0.0083 0.0086  0.0950  10  ALA A CB  
81   N N   . SER A 11  ? 0.4457 0.4330 0.6264 -0.0240 0.0053  0.1066  11  SER A N   
82   C CA  . SER A 11  ? 0.4469 0.4448 0.6047 -0.0311 0.0080  0.1008  11  SER A CA  
83   C C   . SER A 11  ? 0.5239 0.5166 0.6685 -0.0400 0.0135  0.1075  11  SER A C   
84   O O   . SER A 11  ? 0.5179 0.5141 0.6552 -0.0450 0.0214  0.0970  11  SER A O   
85   C CB  . SER A 11  ? 0.5065 0.5168 0.6510 -0.0311 -0.0005 0.1048  11  SER A CB  
86   O OG  . SER A 11  ? 0.6345 0.6550 0.7588 -0.0379 0.0032  0.0971  11  SER A OG  
87   N N   . ALA A 12  ? 0.4991 0.4830 0.6422 -0.0419 0.0095  0.1252  12  ALA A N   
88   C CA  . ALA A 12  ? 0.5117 0.4890 0.6418 -0.0513 0.0151  0.1334  12  ALA A CA  
89   C C   . ALA A 12  ? 0.5323 0.5013 0.6740 -0.0532 0.0261  0.1238  12  ALA A C   
90   O O   . ALA A 12  ? 0.5214 0.4925 0.6513 -0.0615 0.0340  0.1197  12  ALA A O   
91   C CB  . ALA A 12  ? 0.5517 0.5189 0.6818 -0.0518 0.0077  0.1551  12  ALA A CB  
92   N N   . ALA A 13  ? 0.4886 0.4492 0.6541 -0.0459 0.0269  0.1190  13  ALA A N   
93   C CA  . ALA A 13  ? 0.4808 0.4332 0.6605 -0.0470 0.0360  0.1091  13  ALA A CA  
94   C C   . ALA A 13  ? 0.5275 0.4896 0.7017 -0.0508 0.0429  0.0920  13  ALA A C   
95   O O   . ALA A 13  ? 0.5342 0.4917 0.7123 -0.0560 0.0508  0.0872  13  ALA A O   
96   C CB  . ALA A 13  ? 0.4832 0.4281 0.6873 -0.0384 0.0346  0.1045  13  ALA A CB  
97   N N   . ARG A 14  ? 0.4788 0.4540 0.6456 -0.0482 0.0398  0.0831  14  ARG A N   
98   C CA  . ARG A 14  ? 0.4657 0.4510 0.6292 -0.0505 0.0445  0.0674  14  ARG A CA  
99   C C   . ARG A 14  ? 0.5495 0.5377 0.7025 -0.0599 0.0522  0.0664  14  ARG A C   
100  O O   . ARG A 14  ? 0.5575 0.5471 0.6947 -0.0655 0.0523  0.0761  14  ARG A O   
101  C CB  . ARG A 14  ? 0.4350 0.4327 0.5901 -0.0469 0.0392  0.0618  14  ARG A CB  
102  C CG  . ARG A 14  ? 0.3911 0.3876 0.5580 -0.0383 0.0332  0.0594  14  ARG A CG  
103  C CD  . ARG A 14  ? 0.3431 0.3515 0.5034 -0.0356 0.0297  0.0510  14  ARG A CD  
104  N NE  . ARG A 14  ? 0.3557 0.3641 0.5239 -0.0286 0.0232  0.0530  14  ARG A NE  
105  C CZ  . ARG A 14  ? 0.4504 0.4545 0.6331 -0.0237 0.0238  0.0459  14  ARG A CZ  
106  N NH1 . ARG A 14  ? 0.2980 0.2976 0.4876 -0.0252 0.0293  0.0366  14  ARG A NH1 
107  N NH2 . ARG A 14  ? 0.2225 0.2274 0.4133 -0.0179 0.0188  0.0476  14  ARG A NH2 
108  N N   . ASN A 15  ? 0.5205 0.5098 0.6829 -0.0621 0.0585  0.0545  15  ASN A N   
109  C CA  . ASN A 15  ? 0.5272 0.5204 0.6851 -0.0707 0.0669  0.0506  15  ASN A CA  
110  C C   . ASN A 15  ? 0.5712 0.5774 0.7317 -0.0703 0.0687  0.0351  15  ASN A C   
111  O O   . ASN A 15  ? 0.5155 0.5241 0.6843 -0.0639 0.0641  0.0271  15  ASN A O   
112  C CB  . ASN A 15  ? 0.5201 0.5029 0.6910 -0.0745 0.0730  0.0510  15  ASN A CB  
113  C CG  . ASN A 15  ? 0.7829 0.7509 0.9551 -0.0747 0.0718  0.0661  15  ASN A CG  
114  O OD1 . ASN A 15  ? 0.7901 0.7551 0.9488 -0.0799 0.0725  0.0789  15  ASN A OD1 
115  N ND2 . ASN A 15  ? 0.6398 0.5977 0.8289 -0.0699 0.0705  0.0647  15  ASN A ND2 
116  N N   . PRO A 16  ? 0.5816 0.5960 0.7365 -0.0774 0.0757  0.0305  16  PRO A N   
117  C CA  . PRO A 16  ? 0.5821 0.6082 0.7436 -0.0763 0.0771  0.0161  16  PRO A CA  
118  C C   . PRO A 16  ? 0.6580 0.6832 0.8389 -0.0750 0.0780  0.0068  16  PRO A C   
119  O O   . PRO A 16  ? 0.6502 0.6669 0.8386 -0.0778 0.0810  0.0098  16  PRO A O   
120  C CB  . PRO A 16  ? 0.6092 0.6432 0.7621 -0.0850 0.0859  0.0140  16  PRO A CB  
121  C CG  . PRO A 16  ? 0.6783 0.7050 0.8146 -0.0908 0.0877  0.0282  16  PRO A CG  
122  C CD  . PRO A 16  ? 0.6210 0.6341 0.7642 -0.0870 0.0831  0.0376  16  PRO A CD  
123  N N   . SER A 17  ? 0.6375 0.6713 0.8261 -0.0711 0.0749  -0.0042 17  SER A N   
124  C CA  . SER A 17  ? 0.6446 0.6798 0.8502 -0.0700 0.0736  -0.0134 17  SER A CA  
125  C C   . SER A 17  ? 0.7611 0.8009 0.9772 -0.0772 0.0816  -0.0183 17  SER A C   
126  O O   . SER A 17  ? 0.7538 0.8017 0.9671 -0.0813 0.0876  -0.0207 17  SER A O   
127  C CB  . SER A 17  ? 0.6663 0.7094 0.8757 -0.0645 0.0673  -0.0218 17  SER A CB  
128  O OG  . SER A 17  ? 0.7531 0.7966 0.9765 -0.0637 0.0638  -0.0288 17  SER A OG  
129  N N   . PRO A 18  ? 0.7698 0.8049 0.9989 -0.0795 0.0826  -0.0208 18  PRO A N   
130  C CA  . PRO A 18  ? 0.7915 0.8316 1.0331 -0.0869 0.0904  -0.0258 18  PRO A CA  
131  C C   . PRO A 18  ? 0.9010 0.9557 1.1566 -0.0868 0.0902  -0.0373 18  PRO A C   
132  O O   . PRO A 18  ? 0.9000 0.9613 1.1656 -0.0931 0.0981  -0.0418 18  PRO A O   
133  C CB  . PRO A 18  ? 0.8111 0.8422 1.0631 -0.0886 0.0896  -0.0263 18  PRO A CB  
134  C CG  . PRO A 18  ? 0.8577 0.8771 1.1004 -0.0831 0.0839  -0.0192 18  PRO A CG  
135  C CD  . PRO A 18  ? 0.7863 0.8117 1.0198 -0.0764 0.0774  -0.0200 18  PRO A CD  
136  N N   . ILE A 19  ? 0.9049 0.9644 1.1624 -0.0800 0.0815  -0.0418 19  ILE A N   
137  C CA  . ILE A 19  ? 0.9230 0.9954 1.1957 -0.0783 0.0790  -0.0515 19  ILE A CA  
138  C C   . ILE A 19  ? 1.0281 1.1070 1.2930 -0.0755 0.0805  -0.0526 19  ILE A C   
139  O O   . ILE A 19  ? 1.0198 1.1069 1.2953 -0.0715 0.0761  -0.0592 19  ILE A O   
140  C CB  . ILE A 19  ? 0.9555 1.0283 1.2368 -0.0736 0.0676  -0.0557 19  ILE A CB  
141  C CG1 . ILE A 19  ? 0.9608 1.0225 1.2394 -0.0751 0.0652  -0.0528 19  ILE A CG1 
142  C CG2 . ILE A 19  ? 0.9601 1.0455 1.2638 -0.0742 0.0649  -0.0648 19  ILE A CG2 
143  C CD1 . ILE A 19  ? 1.0065 1.0600 1.2715 -0.0696 0.0583  -0.0489 19  ILE A CD1 
144  N N   . ARG A 20  ? 1.0264 1.1013 1.2732 -0.0781 0.0864  -0.0460 20  ARG A N   
145  C CA  . ARG A 20  ? 1.0376 1.1182 1.2747 -0.0769 0.0885  -0.0475 20  ARG A CA  
146  C C   . ARG A 20  ? 1.1349 1.2149 1.3547 -0.0841 0.0982  -0.0426 20  ARG A C   
147  O O   . ARG A 20  ? 1.1371 1.2142 1.3386 -0.0824 0.0955  -0.0368 20  ARG A O   
148  C CB  . ARG A 20  ? 1.0291 1.1068 1.2572 -0.0689 0.0784  -0.0454 20  ARG A CB  
149  C CG  . ARG A 20  ? 1.1238 1.2100 1.3641 -0.0643 0.0745  -0.0541 20  ARG A CG  
150  C CD  . ARG A 20  ? 1.1488 1.2323 1.3770 -0.0583 0.0674  -0.0518 20  ARG A CD  
151  N NE  . ARG A 20  ? 1.1266 1.2141 1.3433 -0.0602 0.0727  -0.0527 20  ARG A NE  
152  C CZ  . ARG A 20  ? 1.1409 1.2241 1.3375 -0.0605 0.0719  -0.0457 20  ARG A CZ  
153  N NH1 . ARG A 20  ? 0.9504 1.0249 1.1386 -0.0582 0.0663  -0.0372 20  ARG A NH1 
154  N NH2 . ARG A 20  ? 0.8757 0.9636 1.0617 -0.0634 0.0766  -0.0476 20  ARG A NH2 
155  N N   . THR A 21  ? 1.1189 1.2026 1.3431 -0.0927 0.1094  -0.0450 21  THR A N   
156  C CA  . THR A 21  ? 1.1243 1.2129 1.3694 -0.0976 0.1159  -0.0516 21  THR A CA  
157  C C   . THR A 21  ? 1.1752 1.2742 1.4475 -0.0932 0.1120  -0.0633 21  THR A C   
158  O O   . THR A 21  ? 1.1564 1.2566 1.4320 -0.0852 0.1022  -0.0652 21  THR A O   
159  C CB  . THR A 21  ? 1.2391 1.3170 1.4819 -0.1021 0.1175  -0.0436 21  THR A CB  
160  O OG1 . THR A 21  ? 1.2480 1.3137 1.4725 -0.0985 0.1108  -0.0319 21  THR A OG1 
161  C CG2 . THR A 21  ? 1.2334 1.3121 1.4725 -0.1133 0.1312  -0.0424 21  THR A CG2 
162  N N   . MET A 22  ? 1.1463 1.2531 1.4390 -0.0988 0.1197  -0.0706 22  MET A N   
163  C CA  . MET A 22  ? 1.1369 1.2554 1.4596 -0.0958 0.1165  -0.0815 22  MET A CA  
164  C C   . MET A 22  ? 1.1878 1.3162 1.5184 -0.0920 0.1178  -0.0895 22  MET A C   
165  O O   . MET A 22  ? 1.1872 1.3267 1.5367 -0.0957 0.1271  -0.0991 22  MET A O   
166  C CB  . MET A 22  ? 1.1544 1.2695 1.4859 -0.0894 0.1021  -0.0800 22  MET A CB  
167  C CG  . MET A 22  ? 1.2055 1.3084 1.5264 -0.0921 0.1002  -0.0722 22  MET A CG  
168  S SD  . MET A 22  ? 1.2700 1.3736 1.6022 -0.1032 0.1125  -0.0738 22  MET A SD  
169  C CE  . MET A 22  ? 1.2434 1.3302 1.5463 -0.1070 0.1174  -0.0603 22  MET A CE  
170  N N   . THR A 23  ? 1.1359 1.2598 1.4528 -0.0849 0.1093  -0.0860 23  THR A N   
171  C CA  . THR A 23  ? 1.3464 1.4764 1.6673 -0.0805 0.1091  -0.0922 23  THR A CA  
172  C C   . THR A 23  ? 1.5898 1.7214 1.8938 -0.0871 0.1221  -0.0939 23  THR A C   
173  O O   . THR A 23  ? 1.0927 1.2279 1.3977 -0.0960 0.1346  -0.0967 23  THR A O   
174  C CB  . THR A 23  ? 1.4109 1.5340 1.7205 -0.0718 0.0956  -0.0867 23  THR A CB  
175  O OG1 . THR A 23  ? 1.4042 1.5161 1.6866 -0.0729 0.0937  -0.0762 23  THR A OG1 
176  C CG2 . THR A 23  ? 1.3666 1.4900 1.6935 -0.0658 0.0828  -0.0871 23  THR A CG2 
177  N N   . LYS A 31  ? 0.9337 1.1847 1.5447 -0.1034 0.1977  -0.2056 31  LYS A N   
178  C CA  . LYS A 31  ? 0.9147 1.1635 1.5387 -0.0896 0.1790  -0.2019 31  LYS A CA  
179  C C   . LYS A 31  ? 0.9328 1.1897 1.5936 -0.0819 0.1617  -0.1996 31  LYS A C   
180  O O   . LYS A 31  ? 0.9208 1.1745 1.5889 -0.0712 0.1439  -0.1938 31  LYS A O   
181  C CB  . LYS A 31  ? 0.9497 1.2022 1.5879 -0.0859 0.1870  -0.2130 31  LYS A CB  
182  C CG  . LYS A 31  ? 1.1380 1.4069 1.8187 -0.0900 0.2049  -0.2315 31  LYS A CG  
183  C CD  . LYS A 31  ? 1.2554 1.5251 1.9437 -0.0874 0.2143  -0.2426 31  LYS A CD  
184  C CE  . LYS A 31  ? 1.3215 1.6074 2.0563 -0.0904 0.2322  -0.2624 31  LYS A CE  
185  N NZ  . LYS A 31  ? 1.3726 1.6578 2.1147 -0.0878 0.2414  -0.2738 31  LYS A NZ  
186  N N   . SER A 32  ? 0.8656 1.1324 1.5477 -0.0882 0.1666  -0.2037 32  SER A N   
187  C CA  . SER A 32  ? 0.8382 1.1140 1.5539 -0.0830 0.1504  -0.2019 32  SER A CA  
188  C C   . SER A 32  ? 0.8450 1.1126 1.5350 -0.0878 0.1421  -0.1906 32  SER A C   
189  O O   . SER A 32  ? 0.8486 1.1255 1.5619 -0.0912 0.1393  -0.1928 32  SER A O   
190  C CB  . SER A 32  ? 0.8841 1.1799 1.6516 -0.0857 0.1609  -0.2168 32  SER A CB  
191  O OG  . SER A 32  ? 1.0151 1.3145 1.7764 -0.0990 0.1811  -0.2231 32  SER A OG  
192  N N   . MET A 33  ? 0.7490 0.9992 1.3923 -0.0880 0.1383  -0.1791 33  MET A N   
193  C CA  . MET A 33  ? 0.7162 0.9551 1.3306 -0.0916 0.1310  -0.1679 33  MET A CA  
194  C C   . MET A 33  ? 0.6861 0.9244 1.3092 -0.0839 0.1080  -0.1611 33  MET A C   
195  O O   . MET A 33  ? 0.6761 0.9139 1.3049 -0.0746 0.0956  -0.1589 33  MET A O   
196  C CB  . MET A 33  ? 0.7518 0.9732 1.3180 -0.0924 0.1334  -0.1584 33  MET A CB  
197  C CG  . MET A 33  ? 0.8199 1.0378 1.3650 -0.1033 0.1534  -0.1601 33  MET A CG  
198  S SD  . MET A 33  ? 0.8935 1.1034 1.4214 -0.1133 0.1568  -0.1526 33  MET A SD  
199  C CE  . MET A 33  ? 0.8739 1.0845 1.3880 -0.1263 0.1819  -0.1576 33  MET A CE  
200  N N   . ILE A 34  ? 0.5990 0.8363 1.2203 -0.0886 0.1024  -0.1574 34  ILE A N   
201  C CA  . ILE A 34  ? 0.5698 0.8051 1.1920 -0.0836 0.0811  -0.1506 34  ILE A CA  
202  C C   . ILE A 34  ? 0.5997 0.8161 1.1772 -0.0852 0.0785  -0.1399 34  ILE A C   
203  O O   . ILE A 34  ? 0.6025 0.8131 1.1659 -0.0933 0.0871  -0.1384 34  ILE A O   
204  C CB  . ILE A 34  ? 0.6012 0.8502 1.2564 -0.0875 0.0749  -0.1554 34  ILE A CB  
205  C CG1 . ILE A 34  ? 0.5975 0.8661 1.3013 -0.0843 0.0761  -0.1659 34  ILE A CG1 
206  C CG2 . ILE A 34  ? 0.6053 0.8501 1.2527 -0.0845 0.0531  -0.1477 34  ILE A CG2 
207  C CD1 . ILE A 34  ? 0.6128 0.8976 1.3529 -0.0898 0.0749  -0.1728 34  ILE A CD1 
208  N N   . SER A 35  ? 0.5335 0.7400 1.0898 -0.0778 0.0679  -0.1327 35  SER A N   
209  C CA  . SER A 35  ? 0.5249 0.7141 1.0413 -0.0782 0.0651  -0.1231 35  SER A CA  
210  C C   . SER A 35  ? 0.5335 0.7178 1.0430 -0.0770 0.0481  -0.1176 35  SER A C   
211  O O   . SER A 35  ? 0.5228 0.7084 1.0363 -0.0705 0.0333  -0.1151 35  SER A O   
212  C CB  . SER A 35  ? 0.5779 0.7585 1.0717 -0.0726 0.0668  -0.1192 35  SER A CB  
213  O OG  . SER A 35  ? 0.7118 0.8768 1.1695 -0.0731 0.0656  -0.1104 35  SER A OG  
214  N N   . LEU A 36  ? 0.4598 0.6379 0.9581 -0.0840 0.0509  -0.1158 36  LEU A N   
215  C CA  . LEU A 36  ? 0.4395 0.6110 0.9264 -0.0852 0.0383  -0.1118 36  LEU A CA  
216  C C   . LEU A 36  ? 0.4605 0.6144 0.9133 -0.0871 0.0447  -0.1051 36  LEU A C   
217  O O   . LEU A 36  ? 0.4405 0.5865 0.8821 -0.0905 0.0402  -0.1030 36  LEU A O   
218  C CB  . LEU A 36  ? 0.4383 0.6186 0.9470 -0.0927 0.0370  -0.1173 36  LEU A CB  
219  C CG  . LEU A 36  ? 0.4828 0.6815 1.0278 -0.0910 0.0279  -0.1233 36  LEU A CG  
220  C CD1 . LEU A 36  ? 0.4868 0.6975 1.0589 -0.0964 0.0413  -0.1314 36  LEU A CD1 
221  C CD2 . LEU A 36  ? 0.4994 0.7014 1.0494 -0.0936 0.0117  -0.1232 36  LEU A CD2 
222  N N   . ALA A 37  ? 0.4228 0.5710 0.8603 -0.0853 0.0553  -0.1022 37  ALA A N   
223  C CA  . ALA A 37  ? 0.4362 0.5689 0.8438 -0.0865 0.0616  -0.0950 37  ALA A CA  
224  C C   . ALA A 37  ? 0.5214 0.6451 0.9086 -0.0798 0.0510  -0.0894 37  ALA A C   
225  O O   . ALA A 37  ? 0.5192 0.6351 0.8964 -0.0806 0.0441  -0.0869 37  ALA A O   
226  C CB  . ALA A 37  ? 0.4480 0.5802 0.8480 -0.0882 0.0759  -0.0942 37  ALA A CB  
227  N N   . GLY A 38  ? 0.5088 0.6342 0.8914 -0.0739 0.0506  -0.0884 38  GLY A N   
228  C CA  . GLY A 38  ? 0.5069 0.6248 0.8710 -0.0675 0.0423  -0.0835 38  GLY A CA  
229  C C   . GLY A 38  ? 0.5571 0.6756 0.9246 -0.0647 0.0271  -0.0834 38  GLY A C   
230  O O   . GLY A 38  ? 0.5516 0.6807 0.9410 -0.0637 0.0198  -0.0873 38  GLY A O   
231  N N   . GLY A 39  ? 0.5135 0.6208 0.8597 -0.0641 0.0225  -0.0787 39  GLY A N   
232  C CA  . GLY A 39  ? 0.5092 0.6142 0.8503 -0.0626 0.0091  -0.0777 39  GLY A CA  
233  C C   . GLY A 39  ? 0.5404 0.6446 0.8747 -0.0560 0.0021  -0.0748 39  GLY A C   
234  O O   . GLY A 39  ? 0.5423 0.6383 0.8587 -0.0548 -0.0040 -0.0714 39  GLY A O   
235  N N   . LEU A 40  ? 0.4692 0.5814 0.8185 -0.0521 0.0037  -0.0767 40  LEU A N   
236  C CA  . LEU A 40  ? 0.4442 0.5558 0.7911 -0.0459 -0.0024 -0.0746 40  LEU A CA  
237  C C   . LEU A 40  ? 0.4799 0.5951 0.8366 -0.0449 -0.0179 -0.0735 40  LEU A C   
238  O O   . LEU A 40  ? 0.4852 0.6101 0.8639 -0.0470 -0.0224 -0.0767 40  LEU A O   
239  C CB  . LEU A 40  ? 0.4321 0.5509 0.7944 -0.0426 0.0052  -0.0783 40  LEU A CB  
240  C CG  . LEU A 40  ? 0.4877 0.6046 0.8399 -0.0445 0.0203  -0.0794 40  LEU A CG  
241  C CD1 . LEU A 40  ? 0.5014 0.6251 0.8672 -0.0416 0.0263  -0.0843 40  LEU A CD1 
242  C CD2 . LEU A 40  ? 0.4851 0.5902 0.8079 -0.0438 0.0218  -0.0736 40  LEU A CD2 
243  N N   . PRO A 41  ? 0.4115 0.5193 0.7520 -0.0424 -0.0267 -0.0688 41  PRO A N   
244  C CA  . PRO A 41  ? 0.4138 0.5244 0.7610 -0.0423 -0.0425 -0.0662 41  PRO A CA  
245  C C   . PRO A 41  ? 0.4645 0.5846 0.8397 -0.0372 -0.0477 -0.0670 41  PRO A C   
246  O O   . PRO A 41  ? 0.4617 0.5832 0.8449 -0.0329 -0.0388 -0.0693 41  PRO A O   
247  C CB  . PRO A 41  ? 0.4365 0.5355 0.7570 -0.0414 -0.0473 -0.0609 41  PRO A CB  
248  C CG  . PRO A 41  ? 0.4759 0.5699 0.7867 -0.0377 -0.0356 -0.0611 41  PRO A CG  
249  C CD  . PRO A 41  ? 0.4151 0.5123 0.7313 -0.0400 -0.0230 -0.0652 41  PRO A CD  
250  N N   . ASN A 42  ? 0.4114 0.5382 0.8025 -0.0378 -0.0620 -0.0652 42  ASN A N   
251  C CA  . ASN A 42  ? 0.4063 0.5420 0.8279 -0.0322 -0.0681 -0.0653 42  ASN A CA  
252  C C   . ASN A 42  ? 0.4881 0.6157 0.9025 -0.0261 -0.0724 -0.0600 42  ASN A C   
253  O O   . ASN A 42  ? 0.4704 0.5895 0.8642 -0.0272 -0.0827 -0.0531 42  ASN A O   
254  C CB  . ASN A 42  ? 0.3858 0.5315 0.8279 -0.0344 -0.0838 -0.0638 42  ASN A CB  
255  C CG  . ASN A 42  ? 0.6153 0.7733 1.0978 -0.0288 -0.0865 -0.0664 42  ASN A CG  
256  O OD1 . ASN A 42  ? 0.5217 0.6777 1.0143 -0.0221 -0.0901 -0.0634 42  ASN A OD1 
257  N ND2 . ASN A 42  ? 0.5280 0.6990 1.0362 -0.0314 -0.0828 -0.0730 42  ASN A ND2 
258  N N   . PRO A 43  ? 0.4797 0.6096 0.9101 -0.0205 -0.0633 -0.0638 43  PRO A N   
259  C CA  . PRO A 43  ? 0.4933 0.6150 0.9182 -0.0151 -0.0661 -0.0596 43  PRO A CA  
260  C C   . PRO A 43  ? 0.5485 0.6717 0.9929 -0.0111 -0.0833 -0.0532 43  PRO A C   
261  O O   . PRO A 43  ? 0.5847 0.6984 1.0189 -0.0081 -0.0889 -0.0472 43  PRO A O   
262  C CB  . PRO A 43  ? 0.5080 0.6326 0.9448 -0.0119 -0.0499 -0.0675 43  PRO A CB  
263  C CG  . PRO A 43  ? 0.5550 0.6928 1.0187 -0.0137 -0.0439 -0.0748 43  PRO A CG  
264  C CD  . PRO A 43  ? 0.4960 0.6356 0.9498 -0.0199 -0.0494 -0.0727 43  PRO A CD  
265  N N   . ASN A 44  ? 0.4396 0.5745 0.9119 -0.0114 -0.0925 -0.0537 44  ASN A N   
266  C CA  . ASN A 44  ? 0.4310 0.5681 0.9234 -0.0078 -0.1111 -0.0461 44  ASN A CA  
267  C C   . ASN A 44  ? 0.4829 0.6115 0.9458 -0.0127 -0.1271 -0.0355 44  ASN A C   
268  O O   . ASN A 44  ? 0.4981 0.6269 0.9714 -0.0111 -0.1446 -0.0269 44  ASN A O   
269  C CB  . ASN A 44  ? 0.4344 0.5882 0.9686 -0.0064 -0.1163 -0.0500 44  ASN A CB  
270  C CG  . ASN A 44  ? 0.7299 0.8923 1.2958 -0.0019 -0.1003 -0.0609 44  ASN A CG  
271  O OD1 . ASN A 44  ? 0.6826 0.8421 1.2632 0.0045  -0.0961 -0.0623 44  ASN A OD1 
272  N ND2 . ASN A 44  ? 0.6148 0.7883 1.1931 -0.0059 -0.0907 -0.0695 44  ASN A ND2 
273  N N   . MET A 45  ? 0.4335 0.5542 0.8597 -0.0190 -0.1208 -0.0362 45  MET A N   
274  C CA  . MET A 45  ? 0.4421 0.5541 0.8361 -0.0256 -0.1319 -0.0288 45  MET A CA  
275  C C   . MET A 45  ? 0.4816 0.5788 0.8470 -0.0247 -0.1284 -0.0244 45  MET A C   
276  O O   . MET A 45  ? 0.4842 0.5734 0.8247 -0.0296 -0.1381 -0.0174 45  MET A O   
277  C CB  . MET A 45  ? 0.4734 0.5871 0.8491 -0.0338 -0.1262 -0.0342 45  MET A CB  
278  C CG  . MET A 45  ? 0.5194 0.6475 0.9203 -0.0367 -0.1307 -0.0385 45  MET A CG  
279  S SD  . MET A 45  ? 0.5912 0.7267 1.0060 -0.0389 -0.1568 -0.0295 45  MET A SD  
280  C CE  . MET A 45  ? 0.5424 0.6923 1.0099 -0.0298 -0.1583 -0.0320 45  MET A CE  
281  N N   . PHE A 46  ? 0.4298 0.5238 0.7979 -0.0194 -0.1140 -0.0290 46  PHE A N   
282  C CA  . PHE A 46  ? 0.4260 0.5073 0.7701 -0.0184 -0.1086 -0.0265 46  PHE A CA  
283  C C   . PHE A 46  ? 0.4387 0.5132 0.7873 -0.0150 -0.1211 -0.0174 46  PHE A C   
284  O O   . PHE A 46  ? 0.4159 0.4960 0.7961 -0.0094 -0.1270 -0.0162 46  PHE A O   
285  C CB  . PHE A 46  ? 0.4483 0.5299 0.7951 -0.0147 -0.0903 -0.0346 46  PHE A CB  
286  C CG  . PHE A 46  ? 0.4771 0.5621 0.8133 -0.0186 -0.0777 -0.0415 46  PHE A CG  
287  C CD1 . PHE A 46  ? 0.5211 0.6042 0.8375 -0.0253 -0.0805 -0.0404 46  PHE A CD1 
288  C CD2 . PHE A 46  ? 0.5046 0.5941 0.8501 -0.0163 -0.0629 -0.0488 46  PHE A CD2 
289  C CE1 . PHE A 46  ? 0.5308 0.6156 0.8395 -0.0285 -0.0690 -0.0460 46  PHE A CE1 
290  C CE2 . PHE A 46  ? 0.5373 0.6287 0.8726 -0.0201 -0.0521 -0.0534 46  PHE A CE2 
291  C CZ  . PHE A 46  ? 0.5172 0.6059 0.8355 -0.0258 -0.0554 -0.0516 46  PHE A CZ  
292  N N   . PRO A 47  ? 0.3927 0.4551 0.7116 -0.0188 -0.1256 -0.0107 47  PRO A N   
293  C CA  . PRO A 47  ? 0.3918 0.4463 0.7131 -0.0168 -0.1387 -0.0003 47  PRO A CA  
294  C C   . PRO A 47  ? 0.4045 0.4539 0.7418 -0.0091 -0.1329 -0.0008 47  PRO A C   
295  O O   . PRO A 47  ? 0.3960 0.4415 0.7486 -0.0056 -0.1445 0.0073  47  PRO A O   
296  C CB  . PRO A 47  ? 0.4223 0.4659 0.7043 -0.0251 -0.1430 0.0056  47  PRO A CB  
297  C CG  . PRO A 47  ? 0.4663 0.5093 0.7285 -0.0280 -0.1269 -0.0033 47  PRO A CG  
298  C CD  . PRO A 47  ? 0.4020 0.4573 0.6849 -0.0257 -0.1192 -0.0121 47  PRO A CD  
299  N N   . PHE A 48  ? 0.3387 0.3877 0.6725 -0.0069 -0.1156 -0.0098 48  PHE A N   
300  C CA  . PHE A 48  ? 0.3335 0.3781 0.6815 -0.0007 -0.1086 -0.0122 48  PHE A CA  
301  C C   . PHE A 48  ? 0.3721 0.4275 0.7605 0.0057  -0.1055 -0.0187 48  PHE A C   
302  O O   . PHE A 48  ? 0.3645 0.4308 0.7619 0.0050  -0.0981 -0.0265 48  PHE A O   
303  C CB  . PHE A 48  ? 0.3512 0.3912 0.6770 -0.0022 -0.0928 -0.0188 48  PHE A CB  
304  C CG  . PHE A 48  ? 0.3745 0.4064 0.6636 -0.0089 -0.0939 -0.0146 48  PHE A CG  
305  C CD1 . PHE A 48  ? 0.4296 0.4497 0.7030 -0.0111 -0.1020 -0.0058 48  PHE A CD1 
306  C CD2 . PHE A 48  ? 0.3964 0.4320 0.6676 -0.0133 -0.0864 -0.0194 48  PHE A CD2 
307  C CE1 . PHE A 48  ? 0.4533 0.4665 0.6937 -0.0181 -0.1016 -0.0032 48  PHE A CE1 
308  C CE2 . PHE A 48  ? 0.4403 0.4688 0.6807 -0.0194 -0.0863 -0.0168 48  PHE A CE2 
309  C CZ  . PHE A 48  ? 0.4359 0.4536 0.6610 -0.0220 -0.0933 -0.0094 48  PHE A CZ  
310  N N   . LYS A 49  ? 0.3216 0.3737 0.7356 0.0116  -0.1113 -0.0154 49  LYS A N   
311  C CA  . LYS A 49  ? 0.3161 0.3786 0.7731 0.0179  -0.1097 -0.0213 49  LYS A CA  
312  C C   . LYS A 49  ? 0.3655 0.4281 0.8425 0.0229  -0.0945 -0.0318 49  LYS A C   
313  O O   . LYS A 49  ? 0.3462 0.4202 0.8460 0.0246  -0.0841 -0.0426 49  LYS A O   
314  C CB  . LYS A 49  ? 0.3597 0.4231 0.8417 0.0212  -0.1299 -0.0105 49  LYS A CB  
315  C CG  . LYS A 49  ? 0.5551 0.6231 1.0222 0.0152  -0.1444 -0.0027 49  LYS A CG  
316  C CD  . LYS A 49  ? 0.6487 0.7324 1.1275 0.0132  -0.1383 -0.0121 49  LYS A CD  
317  C CE  . LYS A 49  ? 0.7161 0.8043 1.1793 0.0062  -0.1513 -0.0062 49  LYS A CE  
318  N NZ  . LYS A 49  ? 0.7751 0.8754 1.2408 0.0027  -0.1413 -0.0164 49  LYS A NZ  
319  N N   . THR A 50  ? 0.3354 0.3853 0.8053 0.0246  -0.0932 -0.0292 50  THR A N   
320  C CA  . THR A 50  ? 0.3330 0.3811 0.8188 0.0283  -0.0789 -0.0395 50  THR A CA  
321  C C   . THR A 50  ? 0.4019 0.4368 0.8568 0.0254  -0.0745 -0.0373 50  THR A C   
322  O O   . THR A 50  ? 0.4162 0.4416 0.8469 0.0224  -0.0853 -0.0260 50  THR A O   
323  C CB  . THR A 50  ? 0.4096 0.4563 0.9390 0.0360  -0.0845 -0.0386 50  THR A CB  
324  O OG1 . THR A 50  ? 0.4224 0.4554 0.9463 0.0372  -0.1001 -0.0241 50  THR A OG1 
325  C CG2 . THR A 50  ? 0.3681 0.4290 0.9356 0.0397  -0.0892 -0.0413 50  THR A CG2 
326  N N   . ALA A 51  ? 0.3518 0.3863 0.8071 0.0255  -0.0587 -0.0485 51  ALA A N   
327  C CA  . ALA A 51  ? 0.3561 0.3795 0.7847 0.0225  -0.0540 -0.0477 51  ALA A CA  
328  C C   . ALA A 51  ? 0.4269 0.4470 0.8739 0.0252  -0.0426 -0.0577 51  ALA A C   
329  O O   . ALA A 51  ? 0.4266 0.4561 0.8966 0.0269  -0.0317 -0.0697 51  ALA A O   
330  C CB  . ALA A 51  ? 0.3521 0.3792 0.7455 0.0164  -0.0459 -0.0510 51  ALA A CB  
331  N N   . VAL A 52  ? 0.3716 0.3783 0.8088 0.0247  -0.0445 -0.0532 52  VAL A N   
332  C CA  . VAL A 52  ? 0.3692 0.3706 0.8204 0.0261  -0.0339 -0.0625 52  VAL A CA  
333  C C   . VAL A 52  ? 0.4067 0.3989 0.8252 0.0209  -0.0304 -0.0610 52  VAL A C   
334  O O   . VAL A 52  ? 0.4150 0.3960 0.8181 0.0196  -0.0408 -0.0489 52  VAL A O   
335  C CB  . VAL A 52  ? 0.4337 0.4284 0.9259 0.0331  -0.0390 -0.0610 52  VAL A CB  
336  C CG1 . VAL A 52  ? 0.4473 0.4331 0.9429 0.0358  -0.0591 -0.0429 52  VAL A CG1 
337  C CG2 . VAL A 52  ? 0.4329 0.4177 0.9330 0.0332  -0.0291 -0.0688 52  VAL A CG2 
338  N N   . ILE A 53  ? 0.3367 0.3350 0.7434 0.0171  -0.0158 -0.0734 53  ILE A N   
339  C CA  . ILE A 53  ? 0.3242 0.3175 0.7023 0.0118  -0.0104 -0.0749 53  ILE A CA  
340  C C   . ILE A 53  ? 0.3936 0.3829 0.7868 0.0117  0.0006  -0.0864 53  ILE A C   
341  O O   . ILE A 53  ? 0.3726 0.3704 0.7832 0.0121  0.0116  -0.0994 53  ILE A O   
342  C CB  . ILE A 53  ? 0.3412 0.3460 0.6922 0.0069  -0.0040 -0.0789 53  ILE A CB  
343  C CG1 . ILE A 53  ? 0.3426 0.3500 0.6801 0.0067  -0.0144 -0.0682 53  ILE A CG1 
344  C CG2 . ILE A 53  ? 0.3309 0.3332 0.6558 0.0016  0.0020  -0.0818 53  ILE A CG2 
345  C CD1 . ILE A 53  ? 0.4348 0.4553 0.7620 0.0044  -0.0085 -0.0729 53  ILE A CD1 
346  N N   . THR A 54  ? 0.3722 0.3482 0.7584 0.0103  -0.0019 -0.0820 54  THR A N   
347  C CA  . THR A 54  ? 0.3833 0.3537 0.7816 0.0091  0.0084  -0.0928 54  THR A CA  
348  C C   . THR A 54  ? 0.4393 0.4167 0.8110 0.0020  0.0192  -0.1024 54  THR A C   
349  O O   . THR A 54  ? 0.3895 0.3694 0.7323 -0.0015 0.0156  -0.0962 54  THR A O   
350  C CB  . THR A 54  ? 0.4236 0.3758 0.8311 0.0109  0.0012  -0.0841 54  THR A CB  
351  O OG1 . THR A 54  ? 0.4934 0.4390 0.8691 0.0060  -0.0039 -0.0748 54  THR A OG1 
352  C CG2 . THR A 54  ? 0.3133 0.2586 0.7472 0.0179  -0.0114 -0.0728 54  THR A CG2 
353  N N   . VAL A 55  ? 0.4588 0.4398 0.8415 -0.0003 0.0322  -0.1178 55  VAL A N   
354  C CA  . VAL A 55  ? 0.4858 0.4751 0.8462 -0.0076 0.0425  -0.1284 55  VAL A CA  
355  C C   . VAL A 55  ? 0.6201 0.6000 0.9834 -0.0113 0.0486  -0.1357 55  VAL A C   
356  O O   . VAL A 55  ? 0.6277 0.5931 1.0063 -0.0081 0.0437  -0.1300 55  VAL A O   
357  C CB  . VAL A 55  ? 0.5256 0.5303 0.8904 -0.0097 0.0532  -0.1411 55  VAL A CB  
358  C CG1 . VAL A 55  ? 0.5174 0.5321 0.8547 -0.0178 0.0611  -0.1489 55  VAL A CG1 
359  C CG2 . VAL A 55  ? 0.5116 0.5237 0.8785 -0.0058 0.0472  -0.1337 55  VAL A CG2 
360  N N   . GLU A 56  ? 0.6304 0.6182 0.9781 -0.0185 0.0585  -0.1475 56  GLU A N   
361  C CA  . GLU A 56  ? 0.6651 0.6469 1.0134 -0.0237 0.0657  -0.1570 56  GLU A CA  
362  C C   . GLU A 56  ? 0.7970 0.7812 1.1686 -0.0257 0.0795  -0.1756 56  GLU A C   
363  O O   . GLU A 56  ? 0.8120 0.8088 1.1719 -0.0323 0.0890  -0.1881 56  GLU A O   
364  C CB  . GLU A 56  ? 0.6759 0.6656 0.9922 -0.0312 0.0666  -0.1581 56  GLU A CB  
365  C CG  . GLU A 56  ? 0.7523 0.7598 1.0512 -0.0356 0.0714  -0.1643 56  GLU A CG  
366  C CD  . GLU A 56  ? 1.0739 1.0896 1.3460 -0.0431 0.0724  -0.1667 56  GLU A CD  
367  O OE1 . GLU A 56  ? 0.9551 0.9804 1.2217 -0.0500 0.0812  -0.1798 56  GLU A OE1 
368  O OE2 . GLU A 56  ? 1.0811 1.0945 1.3379 -0.0426 0.0642  -0.1556 56  GLU A OE2 
369  N N   . ASN A 57  ? 0.7902 0.7627 1.1949 -0.0206 0.0811  -0.1782 57  ASN A N   
370  C CA  . ASN A 57  ? 0.8079 0.7642 1.2306 -0.0130 0.0700  -0.1639 57  ASN A CA  
371  C C   . ASN A 57  ? 0.8798 0.8332 1.3430 -0.0061 0.0729  -0.1690 57  ASN A C   
372  O O   . ASN A 57  ? 0.8805 0.8393 1.3606 -0.0085 0.0867  -0.1868 57  ASN A O   
373  C CB  . ASN A 57  ? 0.8625 0.8034 1.2841 -0.0160 0.0698  -0.1626 57  ASN A CB  
374  C CG  . ASN A 57  ? 1.2103 1.1324 1.6568 -0.0091 0.0611  -0.1508 57  ASN A CG  
375  O OD1 . ASN A 57  ? 1.1772 1.0943 1.6189 -0.0044 0.0475  -0.1332 57  ASN A OD1 
376  N ND2 . ASN A 57  ? 1.1017 1.0131 1.5764 -0.0084 0.0687  -0.1603 57  ASN A ND2 
377  N N   . GLY A 58  ? 0.8349 0.7806 1.3136 0.0020  0.0600  -0.1537 58  GLY A N   
378  C CA  . GLY A 58  ? 0.8330 0.7767 1.3533 0.0098  0.0600  -0.1559 58  GLY A CA  
379  C C   . GLY A 58  ? 0.8640 0.8253 1.3874 0.0110  0.0633  -0.1611 58  GLY A C   
380  O O   . GLY A 58  ? 0.8717 0.8346 1.4275 0.0179  0.0608  -0.1605 58  GLY A O   
381  N N   . LYS A 59  ? 0.7913 0.7659 1.2814 0.0039  0.0687  -0.1661 59  LYS A N   
382  C CA  . LYS A 59  ? 0.7689 0.7603 1.2529 0.0028  0.0724  -0.1701 59  LYS A CA  
383  C C   . LYS A 59  ? 0.7707 0.7623 1.2465 0.0079  0.0561  -0.1513 59  LYS A C   
384  O O   . LYS A 59  ? 0.7530 0.7360 1.2089 0.0081  0.0448  -0.1372 59  LYS A O   
385  C CB  . LYS A 59  ? 0.7967 0.7995 1.2453 -0.0068 0.0814  -0.1786 59  LYS A CB  
386  C CG  . LYS A 59  ? 0.9170 0.9207 1.3685 -0.0139 0.0971  -0.1977 59  LYS A CG  
387  C CD  . LYS A 59  ? 0.9650 0.9757 1.3769 -0.0232 0.0998  -0.2000 59  LYS A CD  
388  C CE  . LYS A 59  ? 1.0175 1.0305 1.4290 -0.0317 0.1145  -0.2192 59  LYS A CE  
389  N NZ  . LYS A 59  ? 1.1073 1.1296 1.4806 -0.0410 0.1156  -0.2207 59  LYS A NZ  
390  N N   . THR A 60  ? 0.6955 0.6970 1.1880 0.0116  0.0555  -0.1518 60  THR A N   
391  C CA  . THR A 60  ? 0.6709 0.6736 1.1603 0.0161  0.0406  -0.1358 60  THR A CA  
392  C C   . THR A 60  ? 0.6658 0.6843 1.1485 0.0144  0.0437  -0.1386 60  THR A C   
393  O O   . THR A 60  ? 0.6772 0.7048 1.1835 0.0149  0.0538  -0.1506 60  THR A O   
394  C CB  . THR A 60  ? 0.7876 0.7799 1.3132 0.0247  0.0296  -0.1272 60  THR A CB  
395  O OG1 . THR A 60  ? 0.7939 0.7700 1.3090 0.0250  0.0208  -0.1162 60  THR A OG1 
396  C CG2 . THR A 60  ? 0.7713 0.7693 1.3061 0.0296  0.0166  -0.1156 60  THR A CG2 
397  N N   . ILE A 61  ? 0.5648 0.5861 1.0164 0.0122  0.0356  -0.1277 61  ILE A N   
398  C CA  . ILE A 61  ? 0.5281 0.5618 0.9707 0.0108  0.0355  -0.1264 61  ILE A CA  
399  C C   . ILE A 61  ? 0.5165 0.5487 0.9785 0.0173  0.0212  -0.1146 61  ILE A C   
400  O O   . ILE A 61  ? 0.5111 0.5326 0.9692 0.0200  0.0080  -0.1018 61  ILE A O   
401  C CB  . ILE A 61  ? 0.5608 0.5970 0.9616 0.0051  0.0343  -0.1210 61  ILE A CB  
402  C CG1 . ILE A 61  ? 0.5612 0.6046 0.9463 -0.0020 0.0489  -0.1338 61  ILE A CG1 
403  C CG2 . ILE A 61  ? 0.5717 0.6148 0.9622 0.0053  0.0274  -0.1126 61  ILE A CG2 
404  C CD1 . ILE A 61  ? 0.6586 0.7012 1.0078 -0.0068 0.0470  -0.1288 61  ILE A CD1 
405  N N   . GLN A 62  ? 0.4378 0.4812 0.9201 0.0190  0.0235  -0.1188 62  GLN A N   
406  C CA  . GLN A 62  ? 0.4194 0.4637 0.9221 0.0246  0.0096  -0.1085 62  GLN A CA  
407  C C   . GLN A 62  ? 0.4321 0.4889 0.9282 0.0223  0.0095  -0.1079 62  GLN A C   
408  O O   . GLN A 62  ? 0.4451 0.5128 0.9477 0.0194  0.0227  -0.1198 62  GLN A O   
409  C CB  . GLN A 62  ? 0.4406 0.4848 0.9912 0.0313  0.0099  -0.1137 62  GLN A CB  
410  C CG  . GLN A 62  ? 0.7600 0.7887 1.3229 0.0358  0.0020  -0.1071 62  GLN A CG  
411  C CD  . GLN A 62  ? 1.0442 1.0720 1.6499 0.0402  0.0113  -0.1193 62  GLN A CD  
412  O OE1 . GLN A 62  ? 0.9912 1.0202 1.5966 0.0364  0.0280  -0.1346 62  GLN A OE1 
413  N NE2 . GLN A 62  ? 0.9385 0.9642 1.5827 0.0480  0.0004  -0.1130 62  GLN A NE2 
414  N N   . PHE A 63  ? 0.3354 0.3903 0.8185 0.0229  -0.0051 -0.0944 63  PHE A N   
415  C CA  . PHE A 63  ? 0.3043 0.3701 0.7846 0.0210  -0.0066 -0.0933 63  PHE A CA  
416  C C   . PHE A 63  ? 0.3226 0.3913 0.8367 0.0267  -0.0194 -0.0875 63  PHE A C   
417  O O   . PHE A 63  ? 0.3217 0.3824 0.8326 0.0290  -0.0354 -0.0745 63  PHE A O   
418  C CB  . PHE A 63  ? 0.3162 0.3793 0.7567 0.0163  -0.0123 -0.0842 63  PHE A CB  
419  C CG  . PHE A 63  ? 0.3232 0.3857 0.7309 0.0107  -0.0015 -0.0884 63  PHE A CG  
420  C CD1 . PHE A 63  ? 0.3481 0.4115 0.7571 0.0090  0.0119  -0.0994 63  PHE A CD1 
421  C CD2 . PHE A 63  ? 0.3467 0.4075 0.7229 0.0069  -0.0055 -0.0813 63  PHE A CD2 
422  C CE1 . PHE A 63  ? 0.3542 0.4177 0.7331 0.0036  0.0198  -0.1021 63  PHE A CE1 
423  C CE2 . PHE A 63  ? 0.3742 0.4349 0.7232 0.0024  0.0030  -0.0842 63  PHE A CE2 
424  C CZ  . PHE A 63  ? 0.3490 0.4115 0.6993 0.0007  0.0149  -0.0941 63  PHE A CZ  
425  N N   . GLY A 64  ? 0.2525 0.3326 0.7994 0.0286  -0.0120 -0.0973 64  GLY A N   
426  C CA  . GLY A 64  ? 0.2516 0.3377 0.8356 0.0339  -0.0231 -0.0936 64  GLY A CA  
427  C C   . GLY A 64  ? 0.3039 0.3970 0.8759 0.0311  -0.0329 -0.0860 64  GLY A C   
428  O O   . GLY A 64  ? 0.2970 0.3889 0.8323 0.0253  -0.0306 -0.0836 64  GLY A O   
429  N N   . GLU A 65  ? 0.2696 0.3702 0.8743 0.0351  -0.0440 -0.0824 65  GLU A N   
430  C CA  . GLU A 65  ? 0.2693 0.3774 0.8682 0.0323  -0.0548 -0.0757 65  GLU A CA  
431  C C   . GLU A 65  ? 0.3192 0.4351 0.8956 0.0252  -0.0418 -0.0831 65  GLU A C   
432  O O   . GLU A 65  ? 0.2963 0.4094 0.8405 0.0204  -0.0472 -0.0762 65  GLU A O   
433  C CB  . GLU A 65  ? 0.2909 0.4099 0.9373 0.0377  -0.0649 -0.0751 65  GLU A CB  
434  C CG  . GLU A 65  ? 0.4520 0.5662 1.1008 0.0402  -0.0894 -0.0586 65  GLU A CG  
435  C CD  . GLU A 65  ? 0.8902 0.9908 1.5476 0.0459  -0.0997 -0.0494 65  GLU A CD  
436  O OE1 . GLU A 65  ? 1.0933 1.1887 1.7642 0.0495  -0.0878 -0.0573 65  GLU A OE1 
437  O OE2 . GLU A 65  ? 0.7895 0.8844 1.4407 0.0463  -0.1200 -0.0343 65  GLU A OE2 
438  N N   . GLU A 66  ? 0.2968 0.4214 0.8890 0.0240  -0.0240 -0.0971 66  GLU A N   
439  C CA  . GLU A 66  ? 0.2963 0.4282 0.8704 0.0170  -0.0105 -0.1041 66  GLU A CA  
440  C C   . GLU A 66  ? 0.3682 0.4918 0.8995 0.0120  -0.0010 -0.1044 66  GLU A C   
441  O O   . GLU A 66  ? 0.3361 0.4603 0.8409 0.0066  0.0005  -0.1016 66  GLU A O   
442  C CB  . GLU A 66  ? 0.3094 0.4547 0.9175 0.0165  0.0042  -0.1183 66  GLU A CB  
443  C CG  . GLU A 66  ? 0.4224 0.5784 1.0739 0.0209  -0.0061 -0.1176 66  GLU A CG  
444  C CD  . GLU A 66  ? 0.7343 0.8963 1.3801 0.0178  -0.0175 -0.1103 66  GLU A CD  
445  O OE1 . GLU A 66  ? 0.7299 0.8943 1.3511 0.0108  -0.0090 -0.1125 66  GLU A OE1 
446  O OE2 . GLU A 66  ? 0.6562 0.8207 1.3230 0.0221  -0.0353 -0.1022 66  GLU A OE2 
447  N N   . MET A 67  ? 0.3705 0.4860 0.8960 0.0136  0.0046  -0.1074 67  MET A N   
448  C CA  . MET A 67  ? 0.3892 0.4972 0.8765 0.0092  0.0121  -0.1074 67  MET A CA  
449  C C   . MET A 67  ? 0.4106 0.5099 0.8655 0.0080  -0.0008 -0.0942 67  MET A C   
450  O O   . MET A 67  ? 0.3787 0.4765 0.8031 0.0032  0.0041  -0.0930 67  MET A O   
451  C CB  . MET A 67  ? 0.4435 0.5449 0.9364 0.0116  0.0180  -0.1130 67  MET A CB  
452  C CG  . MET A 67  ? 0.5215 0.6169 0.9783 0.0068  0.0259  -0.1144 67  MET A CG  
453  S SD  . MET A 67  ? 0.6050 0.7100 1.0464 -0.0015 0.0454  -0.1260 67  MET A SD  
454  C CE  . MET A 67  ? 0.5701 0.6770 1.0359 -0.0013 0.0595  -0.1416 67  MET A CE  
455  N N   . MET A 68  ? 0.3751 0.4689 0.8378 0.0121  -0.0170 -0.0844 68  MET A N   
456  C CA  . MET A 68  ? 0.3742 0.4600 0.8090 0.0102  -0.0295 -0.0726 68  MET A CA  
457  C C   . MET A 68  ? 0.3916 0.4837 0.8150 0.0057  -0.0307 -0.0710 68  MET A C   
458  O O   . MET A 68  ? 0.4005 0.4875 0.7929 0.0017  -0.0306 -0.0670 68  MET A O   
459  C CB  . MET A 68  ? 0.4195 0.4989 0.8670 0.0144  -0.0466 -0.0627 68  MET A CB  
460  C CG  . MET A 68  ? 0.4852 0.5543 0.9004 0.0114  -0.0578 -0.0513 68  MET A CG  
461  S SD  . MET A 68  ? 0.5563 0.6140 0.9379 0.0089  -0.0493 -0.0517 68  MET A SD  
462  C CE  . MET A 68  ? 0.5319 0.5762 0.9100 0.0106  -0.0644 -0.0397 68  MET A CE  
463  N N   . LYS A 69  ? 0.3193 0.4225 0.7691 0.0061  -0.0309 -0.0748 69  LYS A N   
464  C CA  . LYS A 69  ? 0.2981 0.4077 0.7408 0.0013  -0.0311 -0.0745 69  LYS A CA  
465  C C   . LYS A 69  ? 0.3249 0.4347 0.7445 -0.0036 -0.0158 -0.0797 69  LYS A C   
466  O O   . LYS A 69  ? 0.3178 0.4251 0.7146 -0.0078 -0.0167 -0.0759 69  LYS A O   
467  C CB  . LYS A 69  ? 0.3199 0.4424 0.7994 0.0026  -0.0328 -0.0789 69  LYS A CB  
468  C CG  . LYS A 69  ? 0.4039 0.5272 0.8997 0.0054  -0.0521 -0.0705 69  LYS A CG  
469  C CD  . LYS A 69  ? 0.4474 0.5852 0.9795 0.0060  -0.0544 -0.0750 69  LYS A CD  
470  C CE  . LYS A 69  ? 0.4608 0.6026 1.0329 0.0133  -0.0621 -0.0749 69  LYS A CE  
471  N NZ  . LYS A 69  ? 0.5861 0.7436 1.1965 0.0139  -0.0644 -0.0797 69  LYS A NZ  
472  N N   . ARG A 70  ? 0.2552 0.3672 0.6799 -0.0035 -0.0021 -0.0880 70  ARG A N   
473  C CA  . ARG A 70  ? 0.2346 0.3468 0.6367 -0.0085 0.0114  -0.0920 70  ARG A CA  
474  C C   . ARG A 70  ? 0.2751 0.3765 0.6428 -0.0095 0.0084  -0.0851 70  ARG A C   
475  O O   . ARG A 70  ? 0.2618 0.3615 0.6076 -0.0134 0.0108  -0.0821 70  ARG A O   
476  C CB  . ARG A 70  ? 0.2060 0.3234 0.6209 -0.0091 0.0259  -0.1029 70  ARG A CB  
477  C CG  . ARG A 70  ? 0.2597 0.3788 0.6519 -0.0157 0.0393  -0.1064 70  ARG A CG  
478  C CD  . ARG A 70  ? 0.2837 0.4062 0.6799 -0.0178 0.0533  -0.1169 70  ARG A CD  
479  N NE  . ARG A 70  ? 0.3726 0.4946 0.7389 -0.0245 0.0626  -0.1168 70  ARG A NE  
480  C CZ  . ARG A 70  ? 0.5583 0.6829 0.9172 -0.0291 0.0751  -0.1249 70  ARG A CZ  
481  N NH1 . ARG A 70  ? 0.5011 0.6288 0.8815 -0.0276 0.0814  -0.1352 70  ARG A NH1 
482  N NH2 . ARG A 70  ? 0.2900 0.4140 0.6205 -0.0354 0.0812  -0.1227 70  ARG A NH2 
483  N N   . ALA A 71  ? 0.2338 0.3279 0.5991 -0.0059 0.0031  -0.0827 71  ALA A N   
484  C CA  . ALA A 71  ? 0.2195 0.3039 0.5564 -0.0066 0.0004  -0.0772 71  ALA A CA  
485  C C   . ALA A 71  ? 0.2638 0.3432 0.5819 -0.0084 -0.0089 -0.0687 71  ALA A C   
486  O O   . ALA A 71  ? 0.2669 0.3414 0.5604 -0.0107 -0.0067 -0.0660 71  ALA A O   
487  C CB  . ALA A 71  ? 0.2276 0.3053 0.5711 -0.0026 -0.0042 -0.0762 71  ALA A CB  
488  N N   . LEU A 72  ? 0.2036 0.2846 0.5339 -0.0078 -0.0191 -0.0649 72  LEU A N   
489  C CA  . LEU A 72  ? 0.1943 0.2707 0.5078 -0.0105 -0.0281 -0.0581 72  LEU A CA  
490  C C   . LEU A 72  ? 0.2532 0.3345 0.5624 -0.0147 -0.0239 -0.0597 72  LEU A C   
491  O O   . LEU A 72  ? 0.2648 0.3427 0.5611 -0.0178 -0.0298 -0.0557 72  LEU A O   
492  C CB  . LEU A 72  ? 0.1982 0.2737 0.5251 -0.0088 -0.0429 -0.0526 72  LEU A CB  
493  C CG  . LEU A 72  ? 0.2604 0.3281 0.5892 -0.0053 -0.0501 -0.0481 72  LEU A CG  
494  C CD1 . LEU A 72  ? 0.2703 0.3374 0.6106 -0.0046 -0.0663 -0.0407 72  LEU A CD1 
495  C CD2 . LEU A 72  ? 0.2881 0.3455 0.5871 -0.0074 -0.0484 -0.0448 72  LEU A CD2 
496  N N   . GLN A 73  ? 0.2048 0.2935 0.5243 -0.0156 -0.0129 -0.0659 73  GLN A N   
497  C CA  . GLN A 73  ? 0.1920 0.2851 0.5103 -0.0198 -0.0072 -0.0677 73  GLN A CA  
498  C C   . GLN A 73  ? 0.2161 0.3065 0.5139 -0.0226 0.0038  -0.0681 73  GLN A C   
499  O O   . GLN A 73  ? 0.2146 0.3028 0.5039 -0.0212 0.0086  -0.0691 73  GLN A O   
500  C CB  . GLN A 73  ? 0.1992 0.3035 0.5469 -0.0198 -0.0033 -0.0739 73  GLN A CB  
501  C CG  . GLN A 73  ? 0.2120 0.3219 0.5634 -0.0248 0.0028  -0.0763 73  GLN A CG  
502  C CD  . GLN A 73  ? 0.3975 0.5048 0.7423 -0.0277 -0.0061 -0.0720 73  GLN A CD  
503  O OE1 . GLN A 73  ? 0.4399 0.5390 0.7612 -0.0298 -0.0065 -0.0680 73  GLN A OE1 
504  N NE2 . GLN A 73  ? 0.1195 0.2343 0.4860 -0.0282 -0.0133 -0.0734 73  GLN A NE2 
505  N N   . TYR A 74  ? 0.1546 0.2449 0.4454 -0.0267 0.0073  -0.0670 74  TYR A N   
506  C CA  . TYR A 74  ? 0.1549 0.2427 0.4289 -0.0295 0.0167  -0.0658 74  TYR A CA  
507  C C   . TYR A 74  ? 0.2277 0.3214 0.5065 -0.0306 0.0276  -0.0708 74  TYR A C   
508  O O   . TYR A 74  ? 0.2056 0.3070 0.5052 -0.0303 0.0305  -0.0766 74  TYR A O   
509  C CB  . TYR A 74  ? 0.1675 0.2547 0.4404 -0.0339 0.0190  -0.0644 74  TYR A CB  
510  C CG  . TYR A 74  ? 0.2074 0.2877 0.4710 -0.0347 0.0113  -0.0606 74  TYR A CG  
511  C CD1 . TYR A 74  ? 0.2447 0.3166 0.4886 -0.0339 0.0103  -0.0565 74  TYR A CD1 
512  C CD2 . TYR A 74  ? 0.2098 0.2925 0.4844 -0.0373 0.0062  -0.0620 74  TYR A CD2 
513  C CE1 . TYR A 74  ? 0.2500 0.3156 0.4857 -0.0356 0.0052  -0.0547 74  TYR A CE1 
514  C CE2 . TYR A 74  ? 0.2182 0.2946 0.4828 -0.0396 0.0005  -0.0599 74  TYR A CE2 
515  C CZ  . TYR A 74  ? 0.2937 0.3613 0.5388 -0.0388 0.0006  -0.0567 74  TYR A CZ  
516  O OH  . TYR A 74  ? 0.2031 0.2644 0.4388 -0.0417 -0.0034 -0.0562 74  TYR A OH  
517  N N   . SER A 75  ? 0.2150 0.3059 0.4751 -0.0323 0.0337  -0.0687 75  SER A N   
518  C CA  . SER A 75  ? 0.2296 0.3256 0.4883 -0.0351 0.0442  -0.0731 75  SER A CA  
519  C C   . SER A 75  ? 0.2949 0.3881 0.5328 -0.0395 0.0500  -0.0679 75  SER A C   
520  O O   . SER A 75  ? 0.2685 0.3549 0.4948 -0.0386 0.0452  -0.0612 75  SER A O   
521  C CB  . SER A 75  ? 0.2726 0.3691 0.5315 -0.0320 0.0438  -0.0769 75  SER A CB  
522  O OG  . SER A 75  ? 0.3185 0.4078 0.5622 -0.0291 0.0368  -0.0717 75  SER A OG  
523  N N   . PRO A 76  ? 0.2675 0.3655 0.5008 -0.0446 0.0603  -0.0708 76  PRO A N   
524  C CA  . PRO A 76  ? 0.2590 0.3539 0.4721 -0.0492 0.0643  -0.0640 76  PRO A CA  
525  C C   . PRO A 76  ? 0.2970 0.3857 0.4911 -0.0467 0.0582  -0.0567 76  PRO A C   
526  O O   . PRO A 76  ? 0.2773 0.3663 0.4688 -0.0434 0.0547  -0.0590 76  PRO A O   
527  C CB  . PRO A 76  ? 0.2837 0.3855 0.4936 -0.0557 0.0757  -0.0696 76  PRO A CB  
528  C CG  . PRO A 76  ? 0.3327 0.4415 0.5666 -0.0550 0.0796  -0.0798 76  PRO A CG  
529  C CD  . PRO A 76  ? 0.2745 0.3809 0.5208 -0.0471 0.0690  -0.0805 76  PRO A CD  
530  N N   . SER A 77  ? 0.2677 0.3510 0.4505 -0.0483 0.0574  -0.0481 77  SER A N   
531  C CA  . SER A 77  ? 0.2693 0.3472 0.4374 -0.0460 0.0518  -0.0404 77  SER A CA  
532  C C   . SER A 77  ? 0.3640 0.4458 0.5185 -0.0473 0.0525  -0.0407 77  SER A C   
533  O O   . SER A 77  ? 0.3695 0.4493 0.5191 -0.0433 0.0464  -0.0390 77  SER A O   
534  C CB  . SER A 77  ? 0.2841 0.3561 0.4455 -0.0484 0.0525  -0.0312 77  SER A CB  
535  O OG  . SER A 77  ? 0.3158 0.3828 0.4886 -0.0467 0.0504  -0.0310 77  SER A OG  
536  N N   . ALA A 78  ? 0.3473 0.4348 0.4954 -0.0536 0.0602  -0.0434 78  ALA A N   
537  C CA  . ALA A 78  ? 0.3631 0.4554 0.4964 -0.0570 0.0618  -0.0446 78  ALA A CA  
538  C C   . ALA A 78  ? 0.4105 0.5070 0.5509 -0.0546 0.0622  -0.0549 78  ALA A C   
539  O O   . ALA A 78  ? 0.4107 0.5101 0.5396 -0.0564 0.0617  -0.0563 78  ALA A O   
540  C CB  . ALA A 78  ? 0.3885 0.4852 0.5109 -0.0662 0.0709  -0.0445 78  ALA A CB  
541  N N   . GLY A 79  ? 0.3522 0.4488 0.5120 -0.0510 0.0627  -0.0617 79  GLY A N   
542  C CA  . GLY A 79  ? 0.3358 0.4349 0.5065 -0.0482 0.0630  -0.0709 79  GLY A CA  
543  C C   . GLY A 79  ? 0.3678 0.4722 0.5568 -0.0501 0.0710  -0.0805 79  GLY A C   
544  O O   . GLY A 79  ? 0.3763 0.4838 0.5666 -0.0551 0.0779  -0.0809 79  GLY A O   
545  N N   . ILE A 80  ? 0.2792 0.3845 0.4844 -0.0461 0.0702  -0.0882 80  ILE A N   
546  C CA  . ILE A 80  ? 0.2578 0.3688 0.4854 -0.0470 0.0777  -0.0984 80  ILE A CA  
547  C C   . ILE A 80  ? 0.2960 0.4139 0.5156 -0.0554 0.0907  -0.1068 80  ILE A C   
548  O O   . ILE A 80  ? 0.2809 0.3988 0.4822 -0.0584 0.0916  -0.1072 80  ILE A O   
549  C CB  . ILE A 80  ? 0.2894 0.3986 0.5387 -0.0400 0.0722  -0.1030 80  ILE A CB  
550  C CG1 . ILE A 80  ? 0.3061 0.4124 0.5469 -0.0388 0.0708  -0.1056 80  ILE A CG1 
551  C CG2 . ILE A 80  ? 0.2798 0.3834 0.5357 -0.0340 0.0603  -0.0948 80  ILE A CG2 
552  C CD1 . ILE A 80  ? 0.3341 0.4394 0.5975 -0.0343 0.0705  -0.1133 80  ILE A CD1 
553  N N   . PRO A 81  ? 0.2571 0.3813 0.4883 -0.0603 0.1011  -0.1134 81  PRO A N   
554  C CA  . PRO A 81  ? 0.2635 0.3941 0.4835 -0.0702 0.1147  -0.1215 81  PRO A CA  
555  C C   . PRO A 81  ? 0.3240 0.4570 0.5429 -0.0720 0.1198  -0.1321 81  PRO A C   
556  O O   . PRO A 81  ? 0.3476 0.4828 0.5424 -0.0799 0.1247  -0.1331 81  PRO A O   
557  C CB  . PRO A 81  ? 0.2748 0.4118 0.5149 -0.0739 0.1251  -0.1286 81  PRO A CB  
558  C CG  . PRO A 81  ? 0.3148 0.4499 0.5811 -0.0649 0.1164  -0.1266 81  PRO A CG  
559  C CD  . PRO A 81  ? 0.2597 0.3861 0.5135 -0.0584 0.1015  -0.1140 81  PRO A CD  
560  N N   . GLU A 82  ? 0.2504 0.3826 0.4949 -0.0650 0.1180  -0.1394 82  GLU A N   
561  C CA  . GLU A 82  ? 0.2514 0.3845 0.4996 -0.0660 0.1230  -0.1504 82  GLU A CA  
562  C C   . GLU A 82  ? 0.3516 0.4802 0.5750 -0.0661 0.1157  -0.1447 82  GLU A C   
563  O O   . GLU A 82  ? 0.3724 0.5042 0.5847 -0.0725 0.1229  -0.1530 82  GLU A O   
564  C CB  . GLU A 82  ? 0.2554 0.3875 0.5395 -0.0580 0.1221  -0.1581 82  GLU A CB  
565  C CG  . GLU A 82  ? 0.3793 0.5048 0.6768 -0.0476 0.1070  -0.1476 82  GLU A CG  
566  C CD  . GLU A 82  ? 0.6376 0.7665 0.9543 -0.0453 0.1055  -0.1450 82  GLU A CD  
567  O OE1 . GLU A 82  ? 0.5685 0.6977 0.8696 -0.0483 0.1039  -0.1369 82  GLU A OE1 
568  O OE2 . GLU A 82  ? 0.4994 0.6303 0.8483 -0.0402 0.1052  -0.1506 82  GLU A OE2 
569  N N   . LEU A 83  ? 0.3118 0.4339 0.5264 -0.0599 0.1021  -0.1313 83  LEU A N   
570  C CA  . LEU A 83  ? 0.3107 0.4294 0.5036 -0.0599 0.0948  -0.1252 83  LEU A CA  
571  C C   . LEU A 83  ? 0.4018 0.5247 0.5658 -0.0688 0.0979  -0.1212 83  LEU A C   
572  O O   . LEU A 83  ? 0.4265 0.5521 0.5753 -0.0739 0.0996  -0.1250 83  LEU A O   
573  C CB  . LEU A 83  ? 0.2930 0.4040 0.4862 -0.0515 0.0810  -0.1132 83  LEU A CB  
574  C CG  . LEU A 83  ? 0.3358 0.4427 0.5153 -0.0494 0.0730  -0.1086 83  LEU A CG  
575  C CD1 . LEU A 83  ? 0.3262 0.4332 0.5118 -0.0503 0.0769  -0.1193 83  LEU A CD1 
576  C CD2 . LEU A 83  ? 0.3347 0.4339 0.5193 -0.0416 0.0618  -0.0993 83  LEU A CD2 
577  N N   . LEU A 84  ? 0.3601 0.4839 0.5171 -0.0715 0.0986  -0.1136 84  LEU A N   
578  C CA  . LEU A 84  ? 0.3722 0.4991 0.5023 -0.0802 0.1007  -0.1073 84  LEU A CA  
579  C C   . LEU A 84  ? 0.4439 0.5783 0.5623 -0.0915 0.1131  -0.1184 84  LEU A C   
580  O O   . LEU A 84  ? 0.4727 0.6098 0.5666 -0.0981 0.1114  -0.1153 84  LEU A O   
581  C CB  . LEU A 84  ? 0.3764 0.5013 0.5053 -0.0809 0.1004  -0.0979 84  LEU A CB  
582  C CG  . LEU A 84  ? 0.4354 0.5529 0.5638 -0.0732 0.0880  -0.0843 84  LEU A CG  
583  C CD1 . LEU A 84  ? 0.4401 0.5554 0.5736 -0.0740 0.0899  -0.0785 84  LEU A CD1 
584  C CD2 . LEU A 84  ? 0.4923 0.6085 0.5975 -0.0746 0.0802  -0.0741 84  LEU A CD2 
585  N N   . SER A 85  ? 0.3921 0.5306 0.5287 -0.0942 0.1253  -0.1317 85  SER A N   
586  C CA  . SER A 85  ? 0.4222 0.5680 0.5490 -0.1060 0.1393  -0.1448 85  SER A CA  
587  C C   . SER A 85  ? 0.4992 0.6463 0.6206 -0.1075 0.1393  -0.1535 85  SER A C   
588  O O   . SER A 85  ? 0.5169 0.6692 0.6144 -0.1186 0.1445  -0.1576 85  SER A O   
589  C CB  . SER A 85  ? 0.4704 0.6204 0.6223 -0.1080 0.1532  -0.1582 85  SER A CB  
590  O OG  . SER A 85  ? 0.6158 0.7629 0.8011 -0.0968 0.1500  -0.1634 85  SER A OG  
591  N N   . TRP A 86  ? 0.4395 0.5816 0.5817 -0.0972 0.1328  -0.1558 86  TRP A N   
592  C CA  . TRP A 86  ? 0.4471 0.5888 0.5879 -0.0976 0.1324  -0.1640 86  TRP A CA  
593  C C   . TRP A 86  ? 0.5285 0.6709 0.6399 -0.1009 0.1227  -0.1543 86  TRP A C   
594  O O   . TRP A 86  ? 0.5415 0.6885 0.6378 -0.1091 0.1266  -0.1621 86  TRP A O   
595  C CB  . TRP A 86  ? 0.4113 0.5456 0.5803 -0.0853 0.1258  -0.1648 86  TRP A CB  
596  C CG  . TRP A 86  ? 0.4251 0.5585 0.6029 -0.0861 0.1303  -0.1778 86  TRP A CG  
597  C CD1 . TRP A 86  ? 0.4626 0.5966 0.6654 -0.0864 0.1415  -0.1933 86  TRP A CD1 
598  C CD2 . TRP A 86  ? 0.4237 0.5551 0.5879 -0.0868 0.1240  -0.1769 86  TRP A CD2 
599  N NE1 . TRP A 86  ? 0.4531 0.5847 0.6584 -0.0872 0.1428  -0.2021 86  TRP A NE1 
600  C CE2 . TRP A 86  ? 0.4706 0.6007 0.6519 -0.0877 0.1321  -0.1923 86  TRP A CE2 
601  C CE3 . TRP A 86  ? 0.4354 0.5659 0.5777 -0.0862 0.1122  -0.1647 86  TRP A CE3 
602  C CZ2 . TRP A 86  ? 0.4635 0.5911 0.6383 -0.0890 0.1292  -0.1959 86  TRP A CZ2 
603  C CZ3 . TRP A 86  ? 0.4521 0.5816 0.5886 -0.0875 0.1091  -0.1685 86  TRP A CZ3 
604  C CH2 . TRP A 86  ? 0.4657 0.5938 0.6172 -0.0894 0.1177  -0.1841 86  TRP A CH2 
605  N N   . LEU A 87  ? 0.4737 0.6118 0.5786 -0.0946 0.1102  -0.1379 87  LEU A N   
606  C CA  . LEU A 87  ? 0.4738 0.6125 0.5557 -0.0960 0.0996  -0.1269 87  LEU A CA  
607  C C   . LEU A 87  ? 0.5564 0.7023 0.6097 -0.1083 0.1029  -0.1239 87  LEU A C   
608  O O   . LEU A 87  ? 0.5501 0.7005 0.5846 -0.1140 0.0990  -0.1236 87  LEU A O   
609  C CB  . LEU A 87  ? 0.4545 0.5865 0.5413 -0.0858 0.0870  -0.1117 87  LEU A CB  
610  C CG  . LEU A 87  ? 0.4891 0.6140 0.5976 -0.0750 0.0813  -0.1130 87  LEU A CG  
611  C CD1 . LEU A 87  ? 0.5042 0.6227 0.6172 -0.0668 0.0716  -0.0998 87  LEU A CD1 
612  C CD2 . LEU A 87  ? 0.4801 0.6052 0.5849 -0.0750 0.0776  -0.1173 87  LEU A CD2 
613  N N   . LYS A 88  ? 0.5383 0.6856 0.5882 -0.1135 0.1104  -0.1225 88  LYS A N   
614  C CA  . LYS A 88  ? 0.5674 0.7206 0.5893 -0.1267 0.1151  -0.1194 88  LYS A CA  
615  C C   . LYS A 88  ? 0.6430 0.8040 0.6511 -0.1386 0.1243  -0.1344 88  LYS A C   
616  O O   . LYS A 88  ? 0.6544 0.8206 0.6346 -0.1481 0.1206  -0.1300 88  LYS A O   
617  C CB  . LYS A 88  ? 0.6076 0.7604 0.6345 -0.1304 0.1252  -0.1198 88  LYS A CB  
618  C CG  . LYS A 88  ? 0.8578 1.0049 0.8812 -0.1260 0.1167  -0.1018 88  LYS A CG  
619  C CD  . LYS A 88  ? 1.0005 1.1483 1.0242 -0.1328 0.1281  -0.1026 88  LYS A CD  
620  C CE  . LYS A 88  ? 1.1844 1.3359 1.1750 -0.1475 0.1318  -0.0963 88  LYS A CE  
621  N NZ  . LYS A 88  ? 1.3300 1.4758 1.3054 -0.1454 0.1188  -0.0752 88  LYS A NZ  
622  N N   . GLN A 89  ? 0.5931 0.7548 0.6223 -0.1382 0.1359  -0.1521 89  GLN A N   
623  C CA  . GLN A 89  ? 0.6010 0.7690 0.6235 -0.1489 0.1474  -0.1700 89  GLN A CA  
624  C C   . GLN A 89  ? 0.6540 0.8231 0.6671 -0.1485 0.1382  -0.1705 89  GLN A C   
625  O O   . GLN A 89  ? 0.6892 0.8654 0.6805 -0.1611 0.1426  -0.1785 89  GLN A O   
626  C CB  . GLN A 89  ? 0.6071 0.7736 0.6622 -0.1452 0.1605  -0.1875 89  GLN A CB  
627  C CG  . GLN A 89  ? 0.7697 0.9385 0.8334 -0.1496 0.1737  -0.1924 89  GLN A CG  
628  C CD  . GLN A 89  ? 1.0513 1.2248 1.1295 -0.1569 0.1922  -0.2155 89  GLN A CD  
629  O OE1 . GLN A 89  ? 1.0456 1.2242 1.1060 -0.1683 0.1991  -0.2268 89  GLN A OE1 
630  N NE2 . GLN A 89  ? 0.9047 1.0770 1.0171 -0.1506 0.2005  -0.2239 89  GLN A NE2 
631  N N   . LEU A 90  ? 0.5514 0.7140 0.5803 -0.1352 0.1260  -0.1626 90  LEU A N   
632  C CA  . LEU A 90  ? 0.5291 0.6925 0.5519 -0.1339 0.1167  -0.1621 90  LEU A CA  
633  C C   . LEU A 90  ? 0.5476 0.7171 0.5390 -0.1409 0.1063  -0.1491 90  LEU A C   
634  O O   . LEU A 90  ? 0.5297 0.7059 0.5043 -0.1499 0.1055  -0.1548 90  LEU A O   
635  C CB  . LEU A 90  ? 0.5058 0.6602 0.5519 -0.1187 0.1068  -0.1556 90  LEU A CB  
636  C CG  . LEU A 90  ? 0.5680 0.7222 0.6135 -0.1168 0.0993  -0.1574 90  LEU A CG  
637  C CD1 . LEU A 90  ? 0.5772 0.7311 0.6351 -0.1205 0.1102  -0.1768 90  LEU A CD1 
638  C CD2 . LEU A 90  ? 0.5732 0.7192 0.6340 -0.1034 0.0880  -0.1463 90  LEU A CD2 
639  N N   . GLN A 91  ? 0.4946 0.6619 0.4790 -0.1375 0.0987  -0.1319 91  GLN A N   
640  C CA  . GLN A 91  ? 0.4895 0.6614 0.4476 -0.1428 0.0876  -0.1165 91  GLN A CA  
641  C C   . GLN A 91  ? 0.5705 0.7514 0.4995 -0.1602 0.0948  -0.1221 91  GLN A C   
642  O O   . GLN A 91  ? 0.5921 0.7799 0.4988 -0.1673 0.0860  -0.1165 91  GLN A O   
643  C CB  . GLN A 91  ? 0.4886 0.6545 0.4490 -0.1359 0.0809  -0.0987 91  GLN A CB  
644  C CG  . GLN A 91  ? 0.4954 0.6528 0.4802 -0.1201 0.0725  -0.0917 91  GLN A CG  
645  C CD  . GLN A 91  ? 0.7401 0.8988 0.7251 -0.1151 0.0600  -0.0867 91  GLN A CD  
646  O OE1 . GLN A 91  ? 0.7313 0.8917 0.7064 -0.1141 0.0487  -0.0725 91  GLN A OE1 
647  N NE2 . GLN A 91  ? 0.6437 0.8015 0.6427 -0.1114 0.0618  -0.0980 91  GLN A NE2 
648  N N   . ILE A 92  ? 0.5238 0.7053 0.4535 -0.1676 0.1108  -0.1338 92  ILE A N   
649  C CA  . ILE A 92  ? 0.5536 0.7435 0.4553 -0.1858 0.1207  -0.1419 92  ILE A CA  
650  C C   . ILE A 92  ? 0.6380 0.8349 0.5329 -0.1940 0.1245  -0.1587 92  ILE A C   
651  O O   . ILE A 92  ? 0.6543 0.8594 0.5190 -0.2069 0.1204  -0.1568 92  ILE A O   
652  C CB  . ILE A 92  ? 0.5963 0.7851 0.5030 -0.1915 0.1381  -0.1505 92  ILE A CB  
653  C CG1 . ILE A 92  ? 0.6009 0.7844 0.5039 -0.1879 0.1329  -0.1316 92  ILE A CG1 
654  C CG2 . ILE A 92  ? 0.6422 0.8397 0.5221 -0.2116 0.1520  -0.1641 92  ILE A CG2 
655  C CD1 . ILE A 92  ? 0.6754 0.8558 0.5952 -0.1877 0.1473  -0.1379 92  ILE A CD1 
656  N N   . LYS A 93  ? 0.5906 0.7841 0.5131 -0.1870 0.1313  -0.1744 93  LYS A N   
657  C CA  . LYS A 93  ? 0.6020 0.8007 0.5203 -0.1948 0.1358  -0.1912 93  LYS A CA  
658  C C   . LYS A 93  ? 0.6608 0.8631 0.5686 -0.1932 0.1193  -0.1827 93  LYS A C   
659  O O   . LYS A 93  ? 0.6931 0.9035 0.5833 -0.2050 0.1202  -0.1921 93  LYS A O   
660  C CB  . LYS A 93  ? 0.6294 0.8223 0.5817 -0.1879 0.1478  -0.2097 93  LYS A CB  
661  C CG  . LYS A 93  ? 1.0899 1.2852 1.0459 -0.1979 0.1686  -0.2282 93  LYS A CG  
662  C CD  . LYS A 93  ? 1.3050 1.4941 1.2988 -0.1900 0.1797  -0.2458 93  LYS A CD  
663  C CE  . LYS A 93  ? 1.5285 1.7192 1.5344 -0.1962 0.1997  -0.2613 93  LYS A CE  
664  N NZ  . LYS A 93  ? 1.6133 1.8003 1.6319 -0.1878 0.1986  -0.2493 93  LYS A NZ  
665  N N   . LEU A 94  ? 0.5887 0.7857 0.5077 -0.1794 0.1047  -0.1657 94  LEU A N   
666  C CA  . LEU A 94  ? 0.5705 0.7708 0.4852 -0.1760 0.0891  -0.1571 94  LEU A CA  
667  C C   . LEU A 94  ? 0.6600 0.8679 0.5459 -0.1828 0.0758  -0.1398 94  LEU A C   
668  O O   . LEU A 94  ? 0.6756 0.8922 0.5474 -0.1890 0.0669  -0.1391 94  LEU A O   
669  C CB  . LEU A 94  ? 0.5273 0.7177 0.4708 -0.1577 0.0811  -0.1489 94  LEU A CB  
670  C CG  . LEU A 94  ? 0.5541 0.7388 0.5228 -0.1509 0.0855  -0.1625 94  LEU A CG  
671  C CD1 . LEU A 94  ? 0.5531 0.7356 0.5328 -0.1557 0.1031  -0.1822 94  LEU A CD1 
672  C CD2 . LEU A 94  ? 0.5555 0.7297 0.5489 -0.1347 0.0793  -0.1530 94  LEU A CD2 
673  N N   . HIS A 95  ? 0.6248 0.8298 0.5034 -0.1816 0.0740  -0.1255 95  HIS A N   
674  C CA  . HIS A 95  ? 0.6457 0.8558 0.5005 -0.1862 0.0599  -0.1062 95  HIS A CA  
675  C C   . HIS A 95  ? 0.7411 0.9552 0.5661 -0.2011 0.0652  -0.1022 95  HIS A C   
676  O O   . HIS A 95  ? 0.7542 0.9742 0.5554 -0.2079 0.0528  -0.0875 95  HIS A O   
677  C CB  . HIS A 95  ? 0.6395 0.8421 0.5116 -0.1703 0.0471  -0.0870 95  HIS A CB  
678  C CG  . HIS A 95  ? 0.6612 0.8584 0.5625 -0.1560 0.0439  -0.0911 95  HIS A CG  
679  N ND1 . HIS A 95  ? 0.6647 0.8511 0.5915 -0.1441 0.0497  -0.0929 95  HIS A ND1 
680  C CD2 . HIS A 95  ? 0.6805 0.8821 0.5880 -0.1534 0.0360  -0.0941 95  HIS A CD2 
681  C CE1 . HIS A 95  ? 0.6400 0.8239 0.5856 -0.1348 0.0449  -0.0959 95  HIS A CE1 
682  N NE2 . HIS A 95  ? 0.6515 0.8441 0.5870 -0.1399 0.0371  -0.0969 95  HIS A NE2 
683  N N   . ASN A 96  ? 0.7194 0.9304 0.5457 -0.2067 0.0833  -0.1148 96  ASN A N   
684  C CA  . ASN A 96  ? 0.7493 0.9631 0.5478 -0.2219 0.0916  -0.1126 96  ASN A CA  
685  C C   . ASN A 96  ? 0.8197 1.0327 0.5991 -0.2222 0.0756  -0.0864 96  ASN A C   
686  O O   . ASN A 96  ? 0.8466 1.0678 0.5950 -0.2350 0.0673  -0.0788 96  ASN A O   
687  C CB  . ASN A 96  ? 0.7918 1.0160 0.5642 -0.2414 0.1015  -0.1299 96  ASN A CB  
688  C CG  . ASN A 96  ? 1.1711 1.3979 0.9150 -0.2590 0.1143  -0.1321 96  ASN A CG  
689  O OD1 . ASN A 96  ? 1.0931 1.3134 0.8448 -0.2567 0.1234  -0.1291 96  ASN A OD1 
690  N ND2 . ASN A 96  ? 1.0721 1.3091 0.7817 -0.2782 0.1159  -0.1381 96  ASN A ND2 
691  N N   . PRO A 97  ? 0.7545 0.9578 0.5542 -0.2075 0.0693  -0.0718 97  PRO A N   
692  C CA  . PRO A 97  ? 0.7565 0.9578 0.5428 -0.2063 0.0538  -0.0468 97  PRO A CA  
693  C C   . PRO A 97  ? 0.8222 1.0241 0.5771 -0.2221 0.0592  -0.0392 97  PRO A C   
694  O O   . PRO A 97  ? 0.8090 1.0085 0.5635 -0.2283 0.0766  -0.0505 97  PRO A O   
695  C CB  . PRO A 97  ? 0.7534 0.9431 0.5716 -0.1878 0.0506  -0.0381 97  PRO A CB  
696  C CG  . PRO A 97  ? 0.7847 0.9721 0.6317 -0.1783 0.0595  -0.0568 97  PRO A CG  
697  C CD  . PRO A 97  ? 0.7471 0.9407 0.5826 -0.1918 0.0756  -0.0771 97  PRO A CD  
698  N N   . PRO A 98  ? 0.8124 1.0178 0.5414 -0.2292 0.0444  -0.0197 98  PRO A N   
699  C CA  . PRO A 98  ? 0.8450 1.0501 0.5410 -0.2456 0.0489  -0.0105 98  PRO A CA  
700  C C   . PRO A 98  ? 0.8983 1.0911 0.6054 -0.2407 0.0570  -0.0025 98  PRO A C   
701  O O   . PRO A 98  ? 0.9205 1.1124 0.6072 -0.2546 0.0697  -0.0045 98  PRO A O   
702  C CB  . PRO A 98  ? 0.8871 1.0969 0.5607 -0.2497 0.0268  0.0124  98  PRO A CB  
703  C CG  . PRO A 98  ? 0.9219 1.1392 0.6103 -0.2411 0.0148  0.0077  98  PRO A CG  
704  C CD  . PRO A 98  ? 0.8288 1.0389 0.5577 -0.2233 0.0226  -0.0046 98  PRO A CD  
705  N N   . THR A 99  ? 0.8378 1.0216 0.5776 -0.2218 0.0507  0.0052  99  THR A N   
706  C CA  . THR A 99  ? 0.8355 1.0071 0.5903 -0.2147 0.0552  0.0143  99  THR A CA  
707  C C   . THR A 99  ? 0.8939 1.0618 0.6657 -0.2144 0.0760  -0.0034 99  THR A C   
708  O O   . THR A 99  ? 0.8824 1.0411 0.6642 -0.2106 0.0799  0.0043  99  THR A O   
709  C CB  . THR A 99  ? 0.9011 1.0652 0.6831 -0.1958 0.0400  0.0288  99  THR A CB  
710  O OG1 . THR A 99  ? 0.8658 1.0311 0.6766 -0.1829 0.0413  0.0139  99  THR A OG1 
711  C CG2 . THR A 99  ? 0.8769 1.0437 0.6447 -0.1961 0.0193  0.0496  99  THR A CG2 
712  N N   . ILE A 100 ? 0.8678 1.0427 0.6443 -0.2185 0.0891  -0.0268 100 ILE A N   
713  C CA  . ILE A 100 ? 0.8620 1.0349 0.6596 -0.2173 0.1082  -0.0451 100 ILE A CA  
714  C C   . ILE A 100 ? 0.9665 1.1350 0.7550 -0.2267 0.1208  -0.0415 100 ILE A C   
715  O O   . ILE A 100 ? 0.9495 1.1107 0.7632 -0.2172 0.1250  -0.0406 100 ILE A O   
716  C CB  . ILE A 100 ? 0.8974 1.0788 0.6992 -0.2227 0.1210  -0.0708 100 ILE A CB  
717  C CG1 . ILE A 100 ? 0.8765 1.0607 0.6926 -0.2119 0.1098  -0.0752 100 ILE A CG1 
718  C CG2 . ILE A 100 ? 0.8922 1.0713 0.7221 -0.2191 0.1393  -0.0881 100 ILE A CG2 
719  C CD1 . ILE A 100 ? 0.9599 1.1536 0.7676 -0.2220 0.1187  -0.0962 100 ILE A CD1 
720  N N   . HIS A 101 ? 0.9868 1.1600 0.7391 -0.2462 0.1269  -0.0399 101 HIS A N   
721  C CA  . HIS A 101 ? 1.0130 1.1825 0.7534 -0.2578 0.1407  -0.0377 101 HIS A CA  
722  C C   . HIS A 101 ? 1.0546 1.2161 0.7740 -0.2619 0.1302  -0.0112 101 HIS A C   
723  O O   . HIS A 101 ? 1.0863 1.2448 0.7902 -0.2744 0.1417  -0.0082 101 HIS A O   
724  C CB  . HIS A 101 ? 1.0561 1.2347 0.7774 -0.2770 0.1612  -0.0584 101 HIS A CB  
725  C CG  . HIS A 101 ? 1.0807 1.2639 0.8343 -0.2703 0.1748  -0.0846 101 HIS A CG  
726  N ND1 . HIS A 101 ? 1.0975 1.2876 0.8541 -0.2684 0.1721  -0.0981 101 HIS A ND1 
727  C CD2 . HIS A 101 ? 1.0866 1.2676 0.8730 -0.2639 0.1891  -0.0977 101 HIS A CD2 
728  C CE1 . HIS A 101 ? 1.0709 1.2620 0.8614 -0.2610 0.1852  -0.1184 101 HIS A CE1 
729  N NE2 . HIS A 101 ? 1.0668 1.2531 0.8767 -0.2578 0.1951  -0.1188 101 HIS A NE2 
730  N N   . TYR A 102 ? 0.9636 1.1207 0.6862 -0.2506 0.1091  0.0080  102 TYR A N   
731  C CA  . TYR A 102 ? 0.9653 1.1133 0.6743 -0.2511 0.0962  0.0350  102 TYR A CA  
732  C C   . TYR A 102 ? 0.9760 1.1123 0.7084 -0.2437 0.1038  0.0393  102 TYR A C   
733  O O   . TYR A 102 ? 0.9429 1.0784 0.7087 -0.2319 0.1110  0.0249  102 TYR A O   
734  C CB  . TYR A 102 ? 0.9661 1.1127 0.6861 -0.2364 0.0732  0.0500  102 TYR A CB  
735  C CG  . TYR A 102 ? 1.0100 1.1663 0.7032 -0.2440 0.0593  0.0559  102 TYR A CG  
736  C CD1 . TYR A 102 ? 1.0305 1.1854 0.7277 -0.2345 0.0375  0.0751  102 TYR A CD1 
737  C CD2 . TYR A 102 ? 1.0411 1.2090 0.7076 -0.2607 0.0683  0.0409  102 TYR A CD2 
738  C CE1 . TYR A 102 ? 1.0548 1.2201 0.7296 -0.2415 0.0236  0.0806  102 TYR A CE1 
739  C CE2 . TYR A 102 ? 1.0699 1.2476 0.7112 -0.2686 0.0550  0.0459  102 TYR A CE2 
740  C CZ  . TYR A 102 ? 1.1440 1.3209 0.7901 -0.2587 0.0320  0.0660  102 TYR A CZ  
741  O OH  . TYR A 102 ? 1.1609 1.3488 0.7843 -0.2665 0.0177  0.0711  102 TYR A OH  
742  N N   . PRO A 103 ? 0.9285 1.0553 0.6458 -0.2502 0.1016  0.0591  103 PRO A N   
743  C CA  . PRO A 103 ? 0.9005 1.0160 0.6430 -0.2424 0.1080  0.0627  103 PRO A CA  
744  C C   . PRO A 103 ? 0.9064 1.0156 0.6850 -0.2203 0.0952  0.0671  103 PRO A C   
745  O O   . PRO A 103 ? 0.8925 1.0022 0.6698 -0.2129 0.0779  0.0784  103 PRO A O   
746  C CB  . PRO A 103 ? 0.9567 1.0624 0.6726 -0.2537 0.1042  0.0864  103 PRO A CB  
747  C CG  . PRO A 103 ? 1.0518 1.1653 0.7259 -0.2706 0.1004  0.0915  103 PRO A CG  
748  C CD  . PRO A 103 ? 0.9834 1.1087 0.6614 -0.2644 0.0921  0.0801  103 PRO A CD  
749  N N   . PRO A 104 ? 0.8533 0.9577 0.6647 -0.2100 0.1033  0.0578  104 PRO A N   
750  C CA  . PRO A 104 ? 0.8234 0.9223 0.6672 -0.1903 0.0920  0.0605  104 PRO A CA  
751  C C   . PRO A 104 ? 0.8892 0.9793 0.7316 -0.1830 0.0736  0.0838  104 PRO A C   
752  O O   . PRO A 104 ? 0.8603 0.9520 0.7167 -0.1706 0.0613  0.0847  104 PRO A O   
753  C CB  . PRO A 104 ? 0.8230 0.9166 0.6937 -0.1857 0.1041  0.0516  104 PRO A CB  
754  C CG  . PRO A 104 ? 0.8919 0.9938 0.7538 -0.1988 0.1225  0.0346  104 PRO A CG  
755  C CD  . PRO A 104 ? 0.8755 0.9803 0.6968 -0.2162 0.1231  0.0433  104 PRO A CD  
756  N N   . SER A 105 ? 0.8820 0.9629 0.7075 -0.1913 0.0721  0.1026  105 SER A N   
757  C CA  . SER A 105 ? 0.8886 0.9598 0.7128 -0.1858 0.0552  0.1268  105 SER A CA  
758  C C   . SER A 105 ? 0.9608 1.0396 0.7628 -0.1890 0.0398  0.1369  105 SER A C   
759  O O   . SER A 105 ? 0.9569 1.0311 0.7675 -0.1798 0.0234  0.1530  105 SER A O   
760  C CB  . SER A 105 ? 0.9566 1.0151 0.7694 -0.1948 0.0592  0.1433  105 SER A CB  
761  O OG  . SER A 105 ? 1.0901 1.1529 0.8728 -0.2138 0.0723  0.1394  105 SER A OG  
762  N N   . GLN A 106 ? 0.9375 1.0286 0.7129 -0.2021 0.0451  0.1268  106 GLN A N   
763  C CA  . GLN A 106 ? 0.9549 1.0555 0.7078 -0.2070 0.0310  0.1341  106 GLN A CA  
764  C C   . GLN A 106 ? 0.9693 1.0799 0.7414 -0.1949 0.0241  0.1206  106 GLN A C   
765  O O   . GLN A 106 ? 0.9803 1.1005 0.7368 -0.1984 0.0128  0.1238  106 GLN A O   
766  C CB  . GLN A 106 ? 1.0091 1.1178 0.7212 -0.2288 0.0393  0.1307  106 GLN A CB  
767  C CG  . GLN A 106 ? 1.3985 1.4997 1.0802 -0.2414 0.0319  0.1560  106 GLN A CG  
768  C CD  . GLN A 106 ? 1.7777 1.8872 1.4160 -0.2646 0.0406  0.1521  106 GLN A CD  
769  O OE1 . GLN A 106 ? 1.7764 1.8991 1.3961 -0.2716 0.0369  0.1438  106 GLN A OE1 
770  N NE2 . GLN A 106 ? 1.6752 1.7768 1.2951 -0.2780 0.0525  0.1582  106 GLN A NE2 
771  N N   . GLY A 107 ? 0.8789 0.9871 0.6837 -0.1815 0.0306  0.1064  107 GLY A N   
772  C CA  . GLY A 107 ? 0.8386 0.9540 0.6637 -0.1696 0.0256  0.0937  107 GLY A CA  
773  C C   . GLY A 107 ? 0.8367 0.9618 0.6623 -0.1735 0.0389  0.0689  107 GLY A C   
774  O O   . GLY A 107 ? 0.8248 0.9591 0.6499 -0.1717 0.0337  0.0606  107 GLY A O   
775  N N   . GLN A 108 ? 0.7564 0.8794 0.5860 -0.1783 0.0562  0.0566  108 GLN A N   
776  C CA  . GLN A 108 ? 0.7281 0.8591 0.5635 -0.1813 0.0707  0.0325  108 GLN A CA  
777  C C   . GLN A 108 ? 0.7018 0.8345 0.5666 -0.1658 0.0665  0.0210  108 GLN A C   
778  O O   . GLN A 108 ? 0.6668 0.7918 0.5551 -0.1523 0.0600  0.0271  108 GLN A O   
779  C CB  . GLN A 108 ? 0.7443 0.8714 0.5874 -0.1861 0.0883  0.0237  108 GLN A CB  
780  C CG  . GLN A 108 ? 0.9876 1.1233 0.8367 -0.1911 0.1046  -0.0009 108 GLN A CG  
781  C CD  . GLN A 108 ? 1.3336 1.4668 1.1920 -0.1963 0.1217  -0.0091 108 GLN A CD  
782  O OE1 . GLN A 108 ? 1.2406 1.3656 1.1195 -0.1882 0.1216  -0.0036 108 GLN A OE1 
783  N NE2 . GLN A 108 ? 1.3430 1.4840 1.1883 -0.2103 0.1375  -0.0241 108 GLN A NE2 
784  N N   . MET A 109 ? 0.6316 0.7740 0.4941 -0.1688 0.0707  0.0043  109 MET A N   
785  C CA  . MET A 109 ? 0.5913 0.7352 0.4785 -0.1561 0.0676  -0.0069 109 MET A CA  
786  C C   . MET A 109 ? 0.6014 0.7391 0.5187 -0.1463 0.0760  -0.0158 109 MET A C   
787  O O   . MET A 109 ? 0.5916 0.7302 0.5120 -0.1522 0.0904  -0.0267 109 MET A O   
788  C CB  . MET A 109 ? 0.6288 0.7833 0.5071 -0.1631 0.0724  -0.0237 109 MET A CB  
789  C CG  . MET A 109 ? 0.6526 0.8080 0.5540 -0.1506 0.0672  -0.0327 109 MET A CG  
790  S SD  . MET A 109 ? 0.7046 0.8687 0.6077 -0.1565 0.0786  -0.0577 109 MET A SD  
791  C CE  . MET A 109 ? 0.6369 0.7944 0.5749 -0.1462 0.0902  -0.0707 109 MET A CE  
792  N N   . ASP A 110 ? 0.5450 0.6768 0.4844 -0.1320 0.0668  -0.0108 110 ASP A N   
793  C CA  . ASP A 110 ? 0.5266 0.6525 0.4942 -0.1220 0.0717  -0.0178 110 ASP A CA  
794  C C   . ASP A 110 ? 0.5485 0.6740 0.5346 -0.1099 0.0640  -0.0226 110 ASP A C   
795  O O   . ASP A 110 ? 0.5341 0.6617 0.5137 -0.1075 0.0533  -0.0164 110 ASP A O   
796  C CB  . ASP A 110 ? 0.5588 0.6751 0.5333 -0.1186 0.0700  -0.0048 110 ASP A CB  
797  C CG  . ASP A 110 ? 0.7506 0.8631 0.7489 -0.1138 0.0788  -0.0137 110 ASP A CG  
798  O OD1 . ASP A 110 ? 0.7624 0.8799 0.7718 -0.1139 0.0871  -0.0296 110 ASP A OD1 
799  O OD2 . ASP A 110 ? 0.8362 0.9406 0.8431 -0.1102 0.0772  -0.0047 110 ASP A OD2 
800  N N   . LEU A 111 ? 0.4941 0.6173 0.5034 -0.1030 0.0693  -0.0336 111 LEU A N   
801  C CA  . LEU A 111 ? 0.4712 0.5931 0.4981 -0.0927 0.0640  -0.0395 111 LEU A CA  
802  C C   . LEU A 111 ? 0.4893 0.6036 0.5388 -0.0830 0.0628  -0.0387 111 LEU A C   
803  O O   . LEU A 111 ? 0.4861 0.5982 0.5434 -0.0844 0.0697  -0.0404 111 LEU A O   
804  C CB  . LEU A 111 ? 0.4744 0.6021 0.5064 -0.0958 0.0728  -0.0569 111 LEU A CB  
805  C CG  . LEU A 111 ? 0.5417 0.6742 0.5674 -0.0961 0.0683  -0.0620 111 LEU A CG  
806  C CD1 . LEU A 111 ? 0.5667 0.7075 0.5751 -0.1085 0.0768  -0.0714 111 LEU A CD1 
807  C CD2 . LEU A 111 ? 0.5677 0.6974 0.6153 -0.0875 0.0682  -0.0716 111 LEU A CD2 
808  N N   . CYS A 112 ? 0.4325 0.5436 0.4931 -0.0738 0.0547  -0.0379 112 CYS A N   
809  C CA  . CYS A 112 ? 0.4239 0.5284 0.5047 -0.0653 0.0532  -0.0390 112 CYS A CA  
810  C C   . CYS A 112 ? 0.4153 0.5185 0.5060 -0.0582 0.0477  -0.0438 112 CYS A C   
811  O O   . CYS A 112 ? 0.4113 0.5163 0.4944 -0.0574 0.0418  -0.0411 112 CYS A O   
812  C CB  . CYS A 112 ? 0.4449 0.5423 0.5280 -0.0624 0.0491  -0.0273 112 CYS A CB  
813  S SG  . CYS A 112 ? 0.5046 0.5992 0.5810 -0.0581 0.0375  -0.0144 112 CYS A SG  
814  N N   . VAL A 113 ? 0.3264 0.4267 0.4342 -0.0537 0.0497  -0.0509 113 VAL A N   
815  C CA  . VAL A 113 ? 0.2973 0.3947 0.4148 -0.0474 0.0448  -0.0546 113 VAL A CA  
816  C C   . VAL A 113 ? 0.3913 0.4820 0.5118 -0.0417 0.0373  -0.0460 113 VAL A C   
817  O O   . VAL A 113 ? 0.4108 0.4977 0.5362 -0.0408 0.0378  -0.0418 113 VAL A O   
818  C CB  . VAL A 113 ? 0.3138 0.4104 0.4486 -0.0452 0.0487  -0.0643 113 VAL A CB  
819  C CG1 . VAL A 113 ? 0.2944 0.3877 0.4358 -0.0403 0.0439  -0.0677 113 VAL A CG1 
820  C CG2 . VAL A 113 ? 0.3140 0.4171 0.4497 -0.0513 0.0586  -0.0735 113 VAL A CG2 
821  N N   . THR A 114 ? 0.3435 0.4329 0.4616 -0.0384 0.0313  -0.0441 114 THR A N   
822  C CA  . THR A 114 ? 0.3242 0.4077 0.4456 -0.0336 0.0255  -0.0377 114 THR A CA  
823  C C   . THR A 114 ? 0.3605 0.4402 0.4895 -0.0295 0.0227  -0.0423 114 THR A C   
824  O O   . THR A 114 ? 0.3467 0.4283 0.4773 -0.0302 0.0241  -0.0491 114 THR A O   
825  C CB  . THR A 114 ? 0.3990 0.4850 0.5114 -0.0340 0.0211  -0.0298 114 THR A CB  
826  O OG1 . THR A 114 ? 0.4179 0.5103 0.5236 -0.0362 0.0199  -0.0334 114 THR A OG1 
827  C CG2 . THR A 114 ? 0.3271 0.4144 0.4319 -0.0379 0.0224  -0.0220 114 THR A CG2 
828  N N   . SER A 115 ? 0.3352 0.4089 0.4686 -0.0260 0.0191  -0.0390 115 SER A N   
829  C CA  . SER A 115 ? 0.3336 0.4027 0.4713 -0.0234 0.0164  -0.0424 115 SER A CA  
830  C C   . SER A 115 ? 0.3999 0.4711 0.5328 -0.0229 0.0140  -0.0421 115 SER A C   
831  O O   . SER A 115 ? 0.3967 0.4649 0.5306 -0.0210 0.0116  -0.0395 115 SER A O   
832  C CB  . SER A 115 ? 0.3679 0.4302 0.5106 -0.0215 0.0146  -0.0403 115 SER A CB  
833  O OG  . SER A 115 ? 0.4463 0.5078 0.5952 -0.0223 0.0163  -0.0418 115 SER A OG  
834  N N   . GLY A 116 ? 0.3677 0.4445 0.4965 -0.0252 0.0153  -0.0458 116 GLY A N   
835  C CA  . GLY A 116 ? 0.3707 0.4521 0.4948 -0.0262 0.0132  -0.0464 116 GLY A CA  
836  C C   . GLY A 116 ? 0.4419 0.5303 0.5589 -0.0284 0.0121  -0.0412 116 GLY A C   
837  O O   . GLY A 116 ? 0.4551 0.5427 0.5712 -0.0287 0.0130  -0.0362 116 GLY A O   
838  N N   . SER A 117 ? 0.3962 0.4917 0.5079 -0.0306 0.0098  -0.0417 117 SER A N   
839  C CA  . SER A 117 ? 0.4002 0.5028 0.5041 -0.0333 0.0067  -0.0350 117 SER A CA  
840  C C   . SER A 117 ? 0.4224 0.5232 0.5324 -0.0290 0.0018  -0.0261 117 SER A C   
841  O O   . SER A 117 ? 0.4184 0.5221 0.5247 -0.0300 -0.0012 -0.0179 117 SER A O   
842  C CB  . SER A 117 ? 0.4587 0.5706 0.5551 -0.0378 0.0049  -0.0388 117 SER A CB  
843  O OG  . SER A 117 ? 0.5954 0.7094 0.6974 -0.0356 0.0008  -0.0393 117 SER A OG  
844  N N   . GLN A 118 ? 0.3552 0.4508 0.4749 -0.0248 0.0014  -0.0279 118 GLN A N   
845  C CA  . GLN A 118 ? 0.3545 0.4475 0.4835 -0.0206 -0.0014 -0.0222 118 GLN A CA  
846  C C   . GLN A 118 ? 0.4135 0.5001 0.5450 -0.0191 -0.0001 -0.0161 118 GLN A C   
847  O O   . GLN A 118 ? 0.4207 0.5068 0.5583 -0.0167 -0.0030 -0.0088 118 GLN A O   
848  C CB  . GLN A 118 ? 0.3649 0.4529 0.5014 -0.0183 0.0003  -0.0279 118 GLN A CB  
849  C CG  . GLN A 118 ? 0.5609 0.6480 0.7089 -0.0147 -0.0013 -0.0249 118 GLN A CG  
850  C CD  . GLN A 118 ? 0.7530 0.8498 0.9052 -0.0142 -0.0067 -0.0203 118 GLN A CD  
851  O OE1 . GLN A 118 ? 0.7963 0.9005 0.9464 -0.0163 -0.0086 -0.0238 118 GLN A OE1 
852  N NE2 . GLN A 118 ? 0.4814 0.5783 0.6408 -0.0114 -0.0097 -0.0121 118 GLN A NE2 
853  N N   . GLN A 119 ? 0.3445 0.4261 0.4733 -0.0204 0.0042  -0.0193 119 GLN A N   
854  C CA  . GLN A 119 ? 0.3236 0.3992 0.4551 -0.0199 0.0062  -0.0149 119 GLN A CA  
855  C C   . GLN A 119 ? 0.3702 0.4494 0.4951 -0.0225 0.0050  -0.0068 119 GLN A C   
856  O O   . GLN A 119 ? 0.3598 0.4350 0.4893 -0.0210 0.0038  0.0007  119 GLN A O   
857  C CB  . GLN A 119 ? 0.3287 0.3998 0.4608 -0.0210 0.0105  -0.0209 119 GLN A CB  
858  C CG  . GLN A 119 ? 0.3736 0.4375 0.5120 -0.0200 0.0123  -0.0184 119 GLN A CG  
859  C CD  . GLN A 119 ? 0.5227 0.5850 0.6619 -0.0221 0.0159  -0.0222 119 GLN A CD  
860  O OE1 . GLN A 119 ? 0.4537 0.5206 0.5892 -0.0246 0.0180  -0.0258 119 GLN A OE1 
861  N NE2 . GLN A 119 ? 0.3337 0.3896 0.4793 -0.0215 0.0169  -0.0222 119 GLN A NE2 
862  N N   . GLY A 120 ? 0.3399 0.4264 0.4539 -0.0270 0.0053  -0.0085 120 GLY A N   
863  C CA  . GLY A 120 ? 0.3544 0.4452 0.4577 -0.0315 0.0040  -0.0010 120 GLY A CA  
864  C C   . GLY A 120 ? 0.4247 0.5181 0.5298 -0.0296 -0.0036 0.0092  120 GLY A C   
865  O O   . GLY A 120 ? 0.4169 0.5070 0.5220 -0.0296 -0.0055 0.0193  120 GLY A O   
866  N N   . LEU A 121 ? 0.4072 0.5061 0.5161 -0.0275 -0.0080 0.0066  121 LEU A N   
867  C CA  . LEU A 121 ? 0.4262 0.5295 0.5416 -0.0247 -0.0160 0.0150  121 LEU A CA  
868  C C   . LEU A 121 ? 0.4881 0.5827 0.6189 -0.0188 -0.0166 0.0215  121 LEU A C   
869  O O   . LEU A 121 ? 0.4933 0.5878 0.6269 -0.0179 -0.0219 0.0329  121 LEU A O   
870  C CB  . LEU A 121 ? 0.4237 0.5335 0.5447 -0.0232 -0.0185 0.0081  121 LEU A CB  
871  C CG  . LEU A 121 ? 0.4981 0.6178 0.6060 -0.0292 -0.0195 0.0025  121 LEU A CG  
872  C CD1 . LEU A 121 ? 0.4973 0.6195 0.6123 -0.0277 -0.0187 -0.0070 121 LEU A CD1 
873  C CD2 . LEU A 121 ? 0.5360 0.6655 0.6364 -0.0327 -0.0281 0.0116  121 LEU A CD2 
874  N N   . CYS A 122 ? 0.4307 0.5176 0.5710 -0.0155 -0.0110 0.0142  122 CYS A N   
875  C CA  . CYS A 122 ? 0.4292 0.5071 0.5843 -0.0109 -0.0095 0.0168  122 CYS A CA  
876  C C   . CYS A 122 ? 0.4288 0.5003 0.5824 -0.0120 -0.0087 0.0257  122 CYS A C   
877  O O   . CYS A 122 ? 0.4183 0.4864 0.5828 -0.0088 -0.0120 0.0345  122 CYS A O   
878  C CB  . CYS A 122 ? 0.4417 0.5134 0.6015 -0.0097 -0.0034 0.0061  122 CYS A CB  
879  S SG  . CYS A 122 ? 0.4989 0.5587 0.6738 -0.0063 0.0007  0.0064  122 CYS A SG  
880  N N   . LYS A 123 ? 0.3465 0.4160 0.4885 -0.0166 -0.0040 0.0234  123 LYS A N   
881  C CA  . LYS A 123 ? 0.3323 0.3957 0.4716 -0.0190 -0.0017 0.0307  123 LYS A CA  
882  C C   . LYS A 123 ? 0.3912 0.4580 0.5227 -0.0215 -0.0077 0.0438  123 LYS A C   
883  O O   . LYS A 123 ? 0.4139 0.4737 0.5495 -0.0212 -0.0084 0.0538  123 LYS A O   
884  C CB  . LYS A 123 ? 0.3589 0.4218 0.4886 -0.0239 0.0051  0.0238  123 LYS A CB  
885  C CG  . LYS A 123 ? 0.5986 0.6585 0.7350 -0.0222 0.0096  0.0121  123 LYS A CG  
886  C CD  . LYS A 123 ? 0.7265 0.7768 0.8761 -0.0190 0.0116  0.0115  123 LYS A CD  
887  C CE  . LYS A 123 ? 0.9072 0.9563 1.0640 -0.0155 0.0112  0.0036  123 LYS A CE  
888  N NZ  . LYS A 123 ? 1.0263 1.0665 1.1951 -0.0134 0.0136  0.0027  123 LYS A NZ  
889  N N   . VAL A 124 ? 0.3244 0.4019 0.4447 -0.0244 -0.0124 0.0442  124 VAL A N   
890  C CA  . VAL A 124 ? 0.3222 0.4051 0.4321 -0.0279 -0.0199 0.0567  124 VAL A CA  
891  C C   . VAL A 124 ? 0.3744 0.4559 0.5011 -0.0215 -0.0284 0.0671  124 VAL A C   
892  O O   . VAL A 124 ? 0.3888 0.4666 0.5151 -0.0221 -0.0332 0.0809  124 VAL A O   
893  C CB  . VAL A 124 ? 0.3557 0.4509 0.4491 -0.0336 -0.0222 0.0517  124 VAL A CB  
894  C CG1 . VAL A 124 ? 0.3624 0.4655 0.4478 -0.0364 -0.0330 0.0642  124 VAL A CG1 
895  C CG2 . VAL A 124 ? 0.3527 0.4487 0.4296 -0.0412 -0.0138 0.0445  124 VAL A CG2 
896  N N   . PHE A 125 ? 0.3161 0.4001 0.4585 -0.0155 -0.0298 0.0604  125 PHE A N   
897  C CA  . PHE A 125 ? 0.3211 0.4047 0.4844 -0.0087 -0.0365 0.0678  125 PHE A CA  
898  C C   . PHE A 125 ? 0.3615 0.4316 0.5394 -0.0048 -0.0332 0.0736  125 PHE A C   
899  O O   . PHE A 125 ? 0.3772 0.4449 0.5658 -0.0019 -0.0400 0.0867  125 PHE A O   
900  C CB  . PHE A 125 ? 0.3408 0.4291 0.5183 -0.0042 -0.0354 0.0566  125 PHE A CB  
901  C CG  . PHE A 125 ? 0.3726 0.4741 0.5409 -0.0072 -0.0393 0.0511  125 PHE A CG  
902  C CD1 . PHE A 125 ? 0.4100 0.5141 0.5838 -0.0058 -0.0350 0.0381  125 PHE A CD1 
903  C CD2 . PHE A 125 ? 0.4188 0.5298 0.5727 -0.0121 -0.0474 0.0591  125 PHE A CD2 
904  C CE1 . PHE A 125 ? 0.4202 0.5358 0.5869 -0.0089 -0.0382 0.0328  125 PHE A CE1 
905  C CE2 . PHE A 125 ? 0.4547 0.5781 0.6010 -0.0156 -0.0508 0.0531  125 PHE A CE2 
906  C CZ  . PHE A 125 ? 0.4145 0.5398 0.5680 -0.0137 -0.0460 0.0398  125 PHE A CZ  
907  N N   . GLU A 126 ? 0.2936 0.3550 0.4725 -0.0051 -0.0234 0.0642  126 GLU A N   
908  C CA  . GLU A 126 ? 0.2894 0.3376 0.4815 -0.0026 -0.0185 0.0665  126 GLU A CA  
909  C C   . GLU A 126 ? 0.3853 0.4271 0.5687 -0.0066 -0.0197 0.0798  126 GLU A C   
910  O O   . GLU A 126 ? 0.3990 0.4305 0.5967 -0.0037 -0.0194 0.0874  126 GLU A O   
911  C CB  . GLU A 126 ? 0.2900 0.3327 0.4832 -0.0032 -0.0088 0.0521  126 GLU A CB  
912  C CG  . GLU A 126 ? 0.4802 0.5253 0.6852 0.0008  -0.0071 0.0410  126 GLU A CG  
913  C CD  . GLU A 126 ? 0.7723 0.8126 0.9774 -0.0003 0.0009  0.0273  126 GLU A CD  
914  O OE1 . GLU A 126 ? 0.5577 0.5995 0.7707 0.0020  0.0024  0.0191  126 GLU A OE1 
915  O OE2 . GLU A 126 ? 0.6713 0.7066 0.8684 -0.0039 0.0053  0.0250  126 GLU A OE2 
916  N N   . MET A 127 ? 0.3546 0.4024 0.5149 -0.0137 -0.0205 0.0825  127 MET A N   
917  C CA  . MET A 127 ? 0.3703 0.4135 0.5172 -0.0198 -0.0207 0.0944  127 MET A CA  
918  C C   . MET A 127 ? 0.4630 0.5067 0.6124 -0.0185 -0.0318 0.1123  127 MET A C   
919  O O   . MET A 127 ? 0.4921 0.5263 0.6431 -0.0197 -0.0330 0.1251  127 MET A O   
920  C CB  . MET A 127 ? 0.3990 0.4506 0.5205 -0.0285 -0.0173 0.0891  127 MET A CB  
921  C CG  . MET A 127 ? 0.4592 0.5089 0.5616 -0.0371 -0.0171 0.1007  127 MET A CG  
922  S SD  . MET A 127 ? 0.5068 0.5681 0.5810 -0.0478 -0.0121 0.0919  127 MET A SD  
923  C CE  . MET A 127 ? 0.4731 0.5477 0.5387 -0.0480 -0.0243 0.0964  127 MET A CE  
924  N N   . ILE A 128 ? 0.4152 0.4704 0.5653 -0.0164 -0.0406 0.1134  128 ILE A N   
925  C CA  . ILE A 128 ? 0.4292 0.4883 0.5812 -0.0155 -0.0536 0.1302  128 ILE A CA  
926  C C   . ILE A 128 ? 0.5102 0.5642 0.6939 -0.0055 -0.0593 0.1371  128 ILE A C   
927  O O   . ILE A 128 ? 0.5265 0.5730 0.7173 -0.0042 -0.0654 0.1535  128 ILE A O   
928  C CB  . ILE A 128 ? 0.4653 0.5411 0.6020 -0.0195 -0.0606 0.1276  128 ILE A CB  
929  C CG1 . ILE A 128 ? 0.4723 0.5527 0.5780 -0.0303 -0.0547 0.1215  128 ILE A CG1 
930  C CG2 . ILE A 128 ? 0.4920 0.5741 0.6317 -0.0186 -0.0760 0.1448  128 ILE A CG2 
931  C CD1 . ILE A 128 ? 0.5290 0.6240 0.6231 -0.0337 -0.0563 0.1107  128 ILE A CD1 
932  N N   . ILE A 129 ? 0.4667 0.5252 0.6696 0.0012  -0.0576 0.1250  129 ILE A N   
933  C CA  . ILE A 129 ? 0.4638 0.5205 0.6992 0.0106  -0.0621 0.1283  129 ILE A CA  
934  C C   . ILE A 129 ? 0.5188 0.5594 0.7777 0.0160  -0.0565 0.1308  129 ILE A C   
935  O O   . ILE A 129 ? 0.5150 0.5477 0.7769 0.0160  -0.0447 0.1179  129 ILE A O   
936  C CB  . ILE A 129 ? 0.4807 0.5484 0.7281 0.0145  -0.0613 0.1142  129 ILE A CB  
937  C CG1 . ILE A 129 ? 0.4942 0.5784 0.7232 0.0097  -0.0697 0.1149  129 ILE A CG1 
938  C CG2 . ILE A 129 ? 0.4678 0.5342 0.7515 0.0240  -0.0642 0.1159  129 ILE A CG2 
939  C CD1 . ILE A 129 ? 0.5578 0.6492 0.7779 0.0074  -0.0627 0.0969  129 ILE A CD1 
940  N N   . ASN A 130 ? 0.4875 0.5240 0.7650 0.0208  -0.0656 0.1471  130 ASN A N   
941  C CA  . ASN A 130 ? 0.4950 0.5168 0.8019 0.0274  -0.0623 0.1512  130 ASN A CA  
942  C C   . ASN A 130 ? 0.5629 0.5916 0.9030 0.0365  -0.0675 0.1493  130 ASN A C   
943  O O   . ASN A 130 ? 0.5533 0.5962 0.8917 0.0371  -0.0789 0.1552  130 ASN A O   
944  C CB  . ASN A 130 ? 0.4994 0.5115 0.8049 0.0261  -0.0702 0.1733  130 ASN A CB  
945  C CG  . ASN A 130 ? 0.6859 0.6888 0.9645 0.0173  -0.0632 0.1755  130 ASN A CG  
946  O OD1 . ASN A 130 ? 0.7265 0.7193 1.0074 0.0162  -0.0505 0.1641  130 ASN A OD1 
947  N ND2 . ASN A 130 ? 0.4568 0.4630 0.7101 0.0102  -0.0715 0.1905  130 ASN A ND2 
948  N N   . PRO A 131 ? 0.5309 0.5510 0.9017 0.0431  -0.0590 0.1400  131 PRO A N   
949  C CA  . PRO A 131 ? 0.5233 0.5512 0.9276 0.0514  -0.0627 0.1367  131 PRO A CA  
950  C C   . PRO A 131 ? 0.5713 0.6037 0.9928 0.0564  -0.0794 0.1578  131 PRO A C   
951  O O   . PRO A 131 ? 0.5817 0.6020 1.0112 0.0581  -0.0838 0.1737  131 PRO A O   
952  C CB  . PRO A 131 ? 0.5408 0.5550 0.9730 0.0560  -0.0493 0.1247  131 PRO A CB  
953  C CG  . PRO A 131 ? 0.5921 0.5959 0.9996 0.0488  -0.0378 0.1162  131 PRO A CG  
954  C CD  . PRO A 131 ? 0.5477 0.5513 0.9248 0.0426  -0.0454 0.1313  131 PRO A CD  
955  N N   . GLY A 132 ? 0.5210 0.5710 0.9456 0.0578  -0.0893 0.1585  132 GLY A N   
956  C CA  . GLY A 132 ? 0.5377 0.5962 0.9784 0.0622  -0.1074 0.1778  132 GLY A CA  
957  C C   . GLY A 132 ? 0.6111 0.6803 1.0168 0.0543  -0.1212 0.1916  132 GLY A C   
958  O O   . GLY A 132 ? 0.6302 0.7063 1.0453 0.0566  -0.1379 0.2097  132 GLY A O   
959  N N   . ASP A 133 ? 0.5656 0.6367 0.9316 0.0447  -0.1144 0.1830  133 ASP A N   
960  C CA  . ASP A 133 ? 0.5763 0.6574 0.9056 0.0353  -0.1243 0.1925  133 ASP A CA  
961  C C   . ASP A 133 ? 0.6165 0.7185 0.9448 0.0345  -0.1326 0.1867  133 ASP A C   
962  O O   . ASP A 133 ? 0.6064 0.7143 0.9491 0.0379  -0.1248 0.1692  133 ASP A O   
963  C CB  . ASP A 133 ? 0.5998 0.6748 0.8913 0.0256  -0.1122 0.1834  133 ASP A CB  
964  C CG  . ASP A 133 ? 0.7892 0.8460 1.0714 0.0227  -0.1069 0.1929  133 ASP A CG  
965  O OD1 . ASP A 133 ? 0.8261 0.8740 1.1261 0.0269  -0.1146 0.2103  133 ASP A OD1 
966  O OD2 . ASP A 133 ? 0.8603 0.9121 1.1182 0.0159  -0.0955 0.1834  133 ASP A OD2 
967  N N   . ASN A 134 ? 0.5707 0.6840 0.8813 0.0291  -0.1482 0.2014  134 ASN A N   
968  C CA  . ASN A 134 ? 0.5505 0.6845 0.8582 0.0269  -0.1572 0.1966  134 ASN A CA  
969  C C   . ASN A 134 ? 0.5844 0.7246 0.8520 0.0158  -0.1498 0.1835  134 ASN A C   
970  O O   . ASN A 134 ? 0.5920 0.7260 0.8275 0.0073  -0.1478 0.1890  134 ASN A O   
971  C CB  . ASN A 134 ? 0.5382 0.6824 0.8487 0.0262  -0.1790 0.2189  134 ASN A CB  
972  C CG  . ASN A 134 ? 0.8535 0.9959 1.2107 0.0384  -0.1884 0.2306  134 ASN A CG  
973  O OD1 . ASN A 134 ? 0.7946 0.9391 1.1872 0.0473  -0.1821 0.2181  134 ASN A OD1 
974  N ND2 . ASN A 134 ? 0.7987 0.9374 1.1573 0.0386  -0.2039 0.2551  134 ASN A ND2 
975  N N   . VAL A 135 ? 0.5132 0.6646 0.7841 0.0158  -0.1446 0.1656  135 VAL A N   
976  C CA  . VAL A 135 ? 0.5014 0.6590 0.7391 0.0062  -0.1374 0.1517  135 VAL A CA  
977  C C   . VAL A 135 ? 0.5368 0.7145 0.7751 0.0035  -0.1462 0.1465  135 VAL A C   
978  O O   . VAL A 135 ? 0.5075 0.6929 0.7773 0.0108  -0.1501 0.1436  135 VAL A O   
979  C CB  . VAL A 135 ? 0.5290 0.6757 0.7608 0.0061  -0.1179 0.1326  135 VAL A CB  
980  C CG1 . VAL A 135 ? 0.5326 0.6610 0.7578 0.0061  -0.1100 0.1380  135 VAL A CG1 
981  C CG2 . VAL A 135 ? 0.5030 0.6504 0.7649 0.0141  -0.1106 0.1184  135 VAL A CG2 
982  N N   . LEU A 136 ? 0.5111 0.6975 0.7153 -0.0076 -0.1490 0.1448  136 LEU A N   
983  C CA  . LEU A 136 ? 0.5107 0.7163 0.7104 -0.0125 -0.1573 0.1394  136 LEU A CA  
984  C C   . LEU A 136 ? 0.5784 0.7859 0.7687 -0.0159 -0.1434 0.1172  136 LEU A C   
985  O O   . LEU A 136 ? 0.5577 0.7565 0.7244 -0.0212 -0.1315 0.1089  136 LEU A O   
986  C CB  . LEU A 136 ? 0.5324 0.7473 0.7010 -0.0237 -0.1703 0.1520  136 LEU A CB  
987  C CG  . LEU A 136 ? 0.6124 0.8281 0.7888 -0.0216 -0.1878 0.1765  136 LEU A CG  
988  C CD1 . LEU A 136 ? 0.6452 0.8634 0.7808 -0.0350 -0.1952 0.1881  136 LEU A CD1 
989  C CD2 . LEU A 136 ? 0.6428 0.8746 0.8507 -0.0155 -0.2037 0.1823  136 LEU A CD2 
990  N N   . LEU A 137 ? 0.5702 0.7894 0.7808 -0.0129 -0.1452 0.1077  137 LEU A N   
991  C CA  . LEU A 137 ? 0.5597 0.7807 0.7672 -0.0151 -0.1329 0.0873  137 LEU A CA  
992  C C   . LEU A 137 ? 0.6142 0.8543 0.8354 -0.0164 -0.1417 0.0824  137 LEU A C   
993  O O   . LEU A 137 ? 0.5981 0.8486 0.8404 -0.0124 -0.1557 0.0937  137 LEU A O   
994  C CB  . LEU A 137 ? 0.5429 0.7500 0.7728 -0.0060 -0.1197 0.0791  137 LEU A CB  
995  C CG  . LEU A 137 ? 0.5882 0.7920 0.8168 -0.0069 -0.1054 0.0597  137 LEU A CG  
996  C CD1 . LEU A 137 ? 0.5866 0.7722 0.8086 -0.0049 -0.0919 0.0551  137 LEU A CD1 
997  C CD2 . LEU A 137 ? 0.6118 0.8222 0.8726 -0.0008 -0.1046 0.0526  137 LEU A CD2 
998  N N   . ASP A 138 ? 0.5823 0.8268 0.7926 -0.0220 -0.1337 0.0659  138 ASP A N   
999  C CA  . ASP A 138 ? 0.5832 0.8450 0.8057 -0.0243 -0.1396 0.0585  138 ASP A CA  
1000 C C   . ASP A 138 ? 0.5873 0.8458 0.8310 -0.0196 -0.1269 0.0426  138 ASP A C   
1001 O O   . ASP A 138 ? 0.5568 0.8040 0.7873 -0.0215 -0.1128 0.0308  138 ASP A O   
1002 C CB  . ASP A 138 ? 0.6294 0.9017 0.8214 -0.0370 -0.1428 0.0531  138 ASP A CB  
1003 C CG  . ASP A 138 ? 0.8629 1.1233 1.0269 -0.0432 -0.1279 0.0411  138 ASP A CG  
1004 O OD1 . ASP A 138 ? 0.8785 1.1258 1.0279 -0.0428 -0.1229 0.0467  138 ASP A OD1 
1005 O OD2 . ASP A 138 ? 0.9907 1.2554 1.1482 -0.0487 -0.1216 0.0263  138 ASP A OD2 
1006 N N   . GLU A 139 ? 0.5339 0.8019 0.8111 -0.0134 -0.1319 0.0430  139 GLU A N   
1007 C CA  . GLU A 139 ? 0.5018 0.7690 0.8004 -0.0101 -0.1206 0.0284  139 GLU A CA  
1008 C C   . GLU A 139 ? 0.5213 0.8041 0.8165 -0.0179 -0.1232 0.0180  139 GLU A C   
1009 O O   . GLU A 139 ? 0.5267 0.8263 0.8238 -0.0213 -0.1380 0.0248  139 GLU A O   
1010 C CB  . GLU A 139 ? 0.5169 0.7873 0.8563 -0.0001 -0.1235 0.0328  139 GLU A CB  
1011 C CG  . GLU A 139 ? 0.6555 0.9084 1.0044 0.0079  -0.1162 0.0377  139 GLU A CG  
1012 C CD  . GLU A 139 ? 1.0017 1.2582 1.3935 0.0174  -0.1178 0.0401  139 GLU A CD  
1013 O OE1 . GLU A 139 ? 0.9502 1.1975 1.3567 0.0210  -0.1037 0.0293  139 GLU A OE1 
1014 O OE2 . GLU A 139 ? 0.9987 1.2676 1.4102 0.0209  -0.1332 0.0526  139 GLU A OE2 
1015 N N   . PRO A 140 ? 0.4411 0.7189 0.7312 -0.0213 -0.1096 0.0019  140 PRO A N   
1016 C CA  . PRO A 140 ? 0.4163 0.6752 0.7022 -0.0187 -0.0929 -0.0067 140 PRO A CA  
1017 C C   . PRO A 140 ? 0.4648 0.7092 0.7191 -0.0218 -0.0873 -0.0055 140 PRO A C   
1018 O O   . PRO A 140 ? 0.4779 0.7265 0.7086 -0.0292 -0.0913 -0.0053 140 PRO A O   
1019 C CB  . PRO A 140 ? 0.4236 0.6863 0.7162 -0.0227 -0.0844 -0.0221 140 PRO A CB  
1020 C CG  . PRO A 140 ? 0.4853 0.7647 0.7695 -0.0307 -0.0939 -0.0239 140 PRO A CG  
1021 C CD  . PRO A 140 ? 0.4466 0.7381 0.7340 -0.0292 -0.1110 -0.0087 140 PRO A CD  
1022 N N   . ALA A 141 ? 0.4001 0.6279 0.6551 -0.0166 -0.0779 -0.0052 141 ALA A N   
1023 C CA  . ALA A 141 ? 0.3933 0.6070 0.6235 -0.0184 -0.0720 -0.0039 141 ALA A CA  
1024 C C   . ALA A 141 ? 0.4337 0.6323 0.6604 -0.0177 -0.0575 -0.0146 141 ALA A C   
1025 O O   . ALA A 141 ? 0.4144 0.6116 0.6583 -0.0150 -0.0516 -0.0214 141 ALA A O   
1026 C CB  . ALA A 141 ? 0.4071 0.6152 0.6401 -0.0132 -0.0772 0.0101  141 ALA A CB  
1027 N N   . TYR A 142 ? 0.3835 0.5712 0.5876 -0.0205 -0.0520 -0.0158 142 TYR A N   
1028 C CA  . TYR A 142 ? 0.3584 0.5313 0.5568 -0.0200 -0.0402 -0.0238 142 TYR A CA  
1029 C C   . TYR A 142 ? 0.3924 0.5567 0.6074 -0.0131 -0.0365 -0.0208 142 TYR A C   
1030 O O   . TYR A 142 ? 0.3872 0.5489 0.6056 -0.0093 -0.0405 -0.0111 142 TYR A O   
1031 C CB  . TYR A 142 ? 0.3612 0.5261 0.5361 -0.0236 -0.0369 -0.0239 142 TYR A CB  
1032 C CG  . TYR A 142 ? 0.3520 0.5016 0.5227 -0.0220 -0.0271 -0.0288 142 TYR A CG  
1033 C CD1 . TYR A 142 ? 0.3723 0.5130 0.5350 -0.0205 -0.0252 -0.0238 142 TYR A CD1 
1034 C CD2 . TYR A 142 ? 0.3474 0.4915 0.5212 -0.0228 -0.0201 -0.0382 142 TYR A CD2 
1035 C CE1 . TYR A 142 ? 0.3680 0.4960 0.5274 -0.0195 -0.0175 -0.0281 142 TYR A CE1 
1036 C CE2 . TYR A 142 ? 0.3507 0.4812 0.5196 -0.0219 -0.0128 -0.0414 142 TYR A CE2 
1037 C CZ  . TYR A 142 ? 0.4531 0.5761 0.6153 -0.0201 -0.0119 -0.0365 142 TYR A CZ  
1038 O OH  . TYR A 142 ? 0.4851 0.5960 0.6434 -0.0194 -0.0060 -0.0394 142 TYR A OH  
1039 N N   . SER A 143 ? 0.3495 0.5095 0.5749 -0.0123 -0.0288 -0.0294 143 SER A N   
1040 C CA  . SER A 143 ? 0.3541 0.5061 0.5954 -0.0073 -0.0230 -0.0301 143 SER A CA  
1041 C C   . SER A 143 ? 0.3923 0.5305 0.6241 -0.0053 -0.0194 -0.0262 143 SER A C   
1042 O O   . SER A 143 ? 0.3753 0.5088 0.6205 -0.0007 -0.0184 -0.0223 143 SER A O   
1043 C CB  . SER A 143 ? 0.4041 0.5531 0.6508 -0.0097 -0.0140 -0.0413 143 SER A CB  
1044 O OG  . SER A 143 ? 0.5143 0.6542 0.7406 -0.0143 -0.0084 -0.0470 143 SER A OG  
1045 N N   . GLY A 144 ? 0.3559 0.4883 0.5665 -0.0089 -0.0177 -0.0273 144 GLY A N   
1046 C CA  . GLY A 144 ? 0.3582 0.4791 0.5592 -0.0080 -0.0145 -0.0243 144 GLY A CA  
1047 C C   . GLY A 144 ? 0.4148 0.5365 0.6184 -0.0050 -0.0203 -0.0131 144 GLY A C   
1048 O O   . GLY A 144 ? 0.4202 0.5324 0.6262 -0.0026 -0.0172 -0.0103 144 GLY A O   
1049 N N   . THR A 145 ? 0.3587 0.4915 0.5612 -0.0060 -0.0291 -0.0064 145 THR A N   
1050 C CA  . THR A 145 ? 0.3455 0.4789 0.5495 -0.0038 -0.0358 0.0062  145 THR A CA  
1051 C C   . THR A 145 ? 0.3557 0.4901 0.5851 0.0025  -0.0389 0.0115  145 THR A C   
1052 O O   . THR A 145 ? 0.3547 0.4819 0.5903 0.0059  -0.0396 0.0195  145 THR A O   
1053 C CB  . THR A 145 ? 0.3747 0.5167 0.5611 -0.0090 -0.0432 0.0124  145 THR A CB  
1054 O OG1 . THR A 145 ? 0.3872 0.5379 0.5837 -0.0069 -0.0540 0.0238  145 THR A OG1 
1055 C CG2 . THR A 145 ? 0.3245 0.4740 0.4992 -0.0146 -0.0423 0.0032  145 THR A CG2 
1056 N N   . LEU A 146 ? 0.2896 0.4323 0.5356 0.0040  -0.0396 0.0062  146 LEU A N   
1057 C CA  . LEU A 146 ? 0.2794 0.4245 0.5548 0.0103  -0.0414 0.0091  146 LEU A CA  
1058 C C   . LEU A 146 ? 0.3066 0.4375 0.5910 0.0134  -0.0308 0.0040  146 LEU A C   
1059 O O   . LEU A 146 ? 0.2864 0.4124 0.5877 0.0185  -0.0318 0.0105  146 LEU A O   
1060 C CB  . LEU A 146 ? 0.2715 0.4292 0.5630 0.0101  -0.0424 0.0018  146 LEU A CB  
1061 C CG  . LEU A 146 ? 0.3455 0.5188 0.6297 0.0061  -0.0526 0.0046  146 LEU A CG  
1062 C CD1 . LEU A 146 ? 0.3502 0.5334 0.6465 0.0042  -0.0500 -0.0063 146 LEU A CD1 
1063 C CD2 . LEU A 146 ? 0.3921 0.5744 0.6870 0.0093  -0.0665 0.0194  146 LEU A CD2 
1064 N N   . GLN A 147 ? 0.2584 0.3818 0.5293 0.0096  -0.0212 -0.0070 147 GLN A N   
1065 C CA  . GLN A 147 ? 0.2530 0.3633 0.5271 0.0104  -0.0111 -0.0132 147 GLN A CA  
1066 C C   . GLN A 147 ? 0.3054 0.4053 0.5715 0.0113  -0.0111 -0.0062 147 GLN A C   
1067 O O   . GLN A 147 ? 0.3007 0.3911 0.5771 0.0134  -0.0051 -0.0082 147 GLN A O   
1068 C CB  . GLN A 147 ? 0.2667 0.3728 0.5268 0.0052  -0.0029 -0.0251 147 GLN A CB  
1069 C CG  . GLN A 147 ? 0.6341 0.7471 0.9064 0.0040  0.0007  -0.0338 147 GLN A CG  
1070 C CD  . GLN A 147 ? 1.0043 1.1162 1.3024 0.0076  0.0062  -0.0376 147 GLN A CD  
1071 O OE1 . GLN A 147 ? 0.9976 1.1010 1.2956 0.0052  0.0161  -0.0463 147 GLN A OE1 
1072 N NE2 . GLN A 147 ? 0.8850 1.0063 1.2065 0.0127  -0.0001 -0.0317 147 GLN A NE2 
1073 N N   . SER A 148 ? 0.2597 0.3617 0.5082 0.0091  -0.0171 0.0014  148 SER A N   
1074 C CA  . SER A 148 ? 0.2593 0.3530 0.4988 0.0089  -0.0175 0.0089  148 SER A CA  
1075 C C   . SER A 148 ? 0.3047 0.3984 0.5606 0.0137  -0.0239 0.0213  148 SER A C   
1076 O O   . SER A 148 ? 0.2964 0.3796 0.5584 0.0156  -0.0207 0.0246  148 SER A O   
1077 C CB  . SER A 148 ? 0.3171 0.4144 0.5325 0.0039  -0.0208 0.0116  148 SER A CB  
1078 O OG  . SER A 148 ? 0.4327 0.5244 0.6337 0.0002  -0.0139 0.0026  148 SER A OG  
1079 N N   . LEU A 149 ? 0.2742 0.3796 0.5374 0.0151  -0.0335 0.0285  149 LEU A N   
1080 C CA  . LEU A 149 ? 0.2987 0.4050 0.5775 0.0196  -0.0421 0.0427  149 LEU A CA  
1081 C C   . LEU A 149 ? 0.3734 0.4756 0.6849 0.0267  -0.0395 0.0420  149 LEU A C   
1082 O O   . LEU A 149 ? 0.3650 0.4600 0.6891 0.0305  -0.0422 0.0522  149 LEU A O   
1083 C CB  . LEU A 149 ? 0.3069 0.4277 0.5811 0.0180  -0.0550 0.0520  149 LEU A CB  
1084 C CG  . LEU A 149 ? 0.3708 0.4959 0.6129 0.0102  -0.0579 0.0538  149 LEU A CG  
1085 C CD1 . LEU A 149 ? 0.3926 0.5330 0.6317 0.0079  -0.0706 0.0615  149 LEU A CD1 
1086 C CD2 . LEU A 149 ? 0.3910 0.5059 0.6173 0.0077  -0.0566 0.0621  149 LEU A CD2 
1087 N N   . HIS A 150 ? 0.3459 0.4522 0.6717 0.0279  -0.0336 0.0297  150 HIS A N   
1088 C CA  . HIS A 150 ? 0.3501 0.4538 0.7086 0.0337  -0.0288 0.0254  150 HIS A CA  
1089 C C   . HIS A 150 ? 0.3847 0.4724 0.7527 0.0362  -0.0212 0.0255  150 HIS A C   
1090 O O   . HIS A 150 ? 0.3768 0.4620 0.7714 0.0423  -0.0242 0.0328  150 HIS A O   
1091 C CB  . HIS A 150 ? 0.3559 0.4652 0.7211 0.0320  -0.0206 0.0096  150 HIS A CB  
1092 C CG  . HIS A 150 ? 0.4082 0.5138 0.8047 0.0363  -0.0122 0.0018  150 HIS A CG  
1093 N ND1 . HIS A 150 ? 0.4313 0.5262 0.8247 0.0333  0.0016  -0.0113 150 HIS A ND1 
1094 C CD2 . HIS A 150 ? 0.4387 0.5501 0.8701 0.0429  -0.0157 0.0054  150 HIS A CD2 
1095 C CE1 . HIS A 150 ? 0.4261 0.5206 0.8516 0.0376  0.0073  -0.0166 150 HIS A CE1 
1096 N NE2 . HIS A 150 ? 0.4343 0.5385 0.8853 0.0440  -0.0026 -0.0070 150 HIS A NE2 
1097 N N   . PRO A 151 ? 0.3345 0.4112 0.6826 0.0316  -0.0123 0.0184  151 PRO A N   
1098 C CA  . PRO A 151 ? 0.3371 0.3991 0.6947 0.0332  -0.0053 0.0179  151 PRO A CA  
1099 C C   . PRO A 151 ? 0.4045 0.4602 0.7617 0.0352  -0.0122 0.0338  151 PRO A C   
1100 O O   . PRO A 151 ? 0.4046 0.4486 0.7761 0.0375  -0.0075 0.0351  151 PRO A O   
1101 C CB  . PRO A 151 ? 0.3489 0.4038 0.6826 0.0266  0.0039  0.0065  151 PRO A CB  
1102 C CG  . PRO A 151 ? 0.3951 0.4600 0.7132 0.0229  0.0032  -0.0004 151 PRO A CG  
1103 C CD  . PRO A 151 ? 0.3385 0.4154 0.6573 0.0249  -0.0083 0.0101  151 PRO A CD  
1104 N N   . LEU A 152 ? 0.3816 0.4448 0.7219 0.0334  -0.0228 0.0455  152 LEU A N   
1105 C CA  . LEU A 152 ? 0.3977 0.4557 0.7317 0.0334  -0.0299 0.0618  152 LEU A CA  
1106 C C   . LEU A 152 ? 0.4619 0.5203 0.8232 0.0402  -0.0390 0.0760  152 LEU A C   
1107 O O   . LEU A 152 ? 0.4859 0.5374 0.8445 0.0403  -0.0445 0.0907  152 LEU A O   
1108 C CB  . LEU A 152 ? 0.4002 0.4655 0.7022 0.0271  -0.0362 0.0675  152 LEU A CB  
1109 C CG  . LEU A 152 ? 0.4414 0.5037 0.7174 0.0206  -0.0280 0.0568  152 LEU A CG  
1110 C CD1 . LEU A 152 ? 0.4674 0.5406 0.7188 0.0152  -0.0334 0.0583  152 LEU A CD1 
1111 C CD2 . LEU A 152 ? 0.4453 0.4944 0.7142 0.0184  -0.0228 0.0602  152 LEU A CD2 
1112 N N   . GLY A 153 ? 0.4045 0.4704 0.7929 0.0456  -0.0402 0.0717  153 GLY A N   
1113 C CA  . GLY A 153 ? 0.4099 0.4775 0.8310 0.0533  -0.0490 0.0838  153 GLY A CA  
1114 C C   . GLY A 153 ? 0.4609 0.5359 0.8732 0.0530  -0.0657 0.1038  153 GLY A C   
1115 O O   . GLY A 153 ? 0.4572 0.5250 0.8835 0.0568  -0.0727 0.1194  153 GLY A O   
1116 N N   . CYS A 154 ? 0.4260 0.5146 0.8141 0.0476  -0.0720 0.1035  154 CYS A N   
1117 C CA  . CYS A 154 ? 0.4443 0.5422 0.8188 0.0451  -0.0879 0.1206  154 CYS A CA  
1118 C C   . CYS A 154 ? 0.5052 0.6210 0.8994 0.0486  -0.0982 0.1212  154 CYS A C   
1119 O O   . CYS A 154 ? 0.5089 0.6308 0.9160 0.0502  -0.0909 0.1055  154 CYS A O   
1120 C CB  . CYS A 154 ? 0.4500 0.5503 0.7817 0.0352  -0.0868 0.1187  154 CYS A CB  
1121 S SG  . CYS A 154 ? 0.4791 0.5904 0.7946 0.0303  -0.0787 0.0976  154 CYS A SG  
1122 N N   . ASN A 155 ? 0.4633 0.5878 0.8587 0.0489  -0.1153 0.1392  155 ASN A N   
1123 C CA  . ASN A 155 ? 0.4579 0.6012 0.8721 0.0516  -0.1274 0.1414  155 ASN A CA  
1124 C C   . ASN A 155 ? 0.4860 0.6437 0.8666 0.0422  -0.1322 0.1376  155 ASN A C   
1125 O O   . ASN A 155 ? 0.5076 0.6661 0.8582 0.0353  -0.1402 0.1491  155 ASN A O   
1126 C CB  . ASN A 155 ? 0.4956 0.6414 0.9334 0.0574  -0.1448 0.1635  155 ASN A CB  
1127 C CG  . ASN A 155 ? 0.7181 0.8494 1.1937 0.0672  -0.1403 0.1675  155 ASN A CG  
1128 O OD1 . ASN A 155 ? 0.5954 0.7266 1.1040 0.0737  -0.1309 0.1541  155 ASN A OD1 
1129 N ND2 . ASN A 155 ? 0.6302 0.7485 1.1017 0.0677  -0.1461 0.1856  155 ASN A ND2 
1130 N N   . ILE A 156 ? 0.3898 0.5580 0.7745 0.0412  -0.1261 0.1205  156 ILE A N   
1131 C CA  . ILE A 156 ? 0.3719 0.5538 0.7288 0.0325  -0.1295 0.1145  156 ILE A CA  
1132 C C   . ILE A 156 ? 0.4397 0.6412 0.8122 0.0334  -0.1473 0.1239  156 ILE A C   
1133 O O   . ILE A 156 ? 0.4244 0.6345 0.8316 0.0397  -0.1484 0.1189  156 ILE A O   
1134 C CB  . ILE A 156 ? 0.3758 0.5580 0.7255 0.0295  -0.1142 0.0922  156 ILE A CB  
1135 C CG1 . ILE A 156 ? 0.3599 0.5242 0.6896 0.0272  -0.0992 0.0845  156 ILE A CG1 
1136 C CG2 . ILE A 156 ? 0.3753 0.5726 0.7020 0.0211  -0.1191 0.0866  156 ILE A CG2 
1137 C CD1 . ILE A 156 ? 0.3152 0.4760 0.6462 0.0266  -0.0842 0.0650  156 ILE A CD1 
1138 N N   . ILE A 157 ? 0.4186 0.6275 0.7651 0.0263  -0.1608 0.1369  157 ILE A N   
1139 C CA  . ILE A 157 ? 0.4252 0.6537 0.7793 0.0248  -0.1800 0.1474  157 ILE A CA  
1140 C C   . ILE A 157 ? 0.4948 0.7370 0.8242 0.0151  -0.1783 0.1336  157 ILE A C   
1141 O O   . ILE A 157 ? 0.4948 0.7336 0.7856 0.0056  -0.1743 0.1310  157 ILE A O   
1142 C CB  . ILE A 157 ? 0.4820 0.7092 0.8212 0.0218  -0.1966 0.1717  157 ILE A CB  
1143 C CG1 . ILE A 157 ? 0.4827 0.6915 0.8419 0.0305  -0.1951 0.1846  157 ILE A CG1 
1144 C CG2 . ILE A 157 ? 0.5048 0.7531 0.8553 0.0208  -0.2185 0.1840  157 ILE A CG2 
1145 C CD1 . ILE A 157 ? 0.4719 0.6722 0.8062 0.0255  -0.2056 0.2071  157 ILE A CD1 
1146 N N   . ASN A 158 ? 0.4657 0.7228 0.8190 0.0173  -0.1799 0.1235  158 ASN A N   
1147 C CA  . ASN A 158 ? 0.4716 0.7416 0.8060 0.0083  -0.1780 0.1097  158 ASN A CA  
1148 C C   . ASN A 158 ? 0.5713 0.8580 0.8851 -0.0007 -0.1963 0.1204  158 ASN A C   
1149 O O   . ASN A 158 ? 0.5769 0.8754 0.9105 0.0024  -0.2139 0.1350  158 ASN A O   
1150 C CB  . ASN A 158 ? 0.4451 0.7237 0.8103 0.0126  -0.1710 0.0937  158 ASN A CB  
1151 C CG  . ASN A 158 ? 0.8463 1.1410 1.1985 0.0036  -0.1727 0.0821  158 ASN A CG  
1152 O OD1 . ASN A 158 ? 0.7033 0.9936 1.0229 -0.0048 -0.1640 0.0720  158 ASN A OD1 
1153 N ND2 . ASN A 158 ? 0.8384 1.1525 1.2169 0.0050  -0.1848 0.0836  158 ASN A ND2 
1154 N N   . VAL A 159 ? 0.5575 0.8451 0.8321 -0.0122 -0.1919 0.1127  159 VAL A N   
1155 C CA  . VAL A 159 ? 0.5902 0.8931 0.8385 -0.0235 -0.2061 0.1191  159 VAL A CA  
1156 C C   . VAL A 159 ? 0.6524 0.9709 0.9032 -0.0289 -0.2042 0.1019  159 VAL A C   
1157 O O   . VAL A 159 ? 0.6526 0.9640 0.8993 -0.0298 -0.1873 0.0838  159 VAL A O   
1158 C CB  . VAL A 159 ? 0.6619 0.9546 0.8646 -0.0338 -0.2010 0.1214  159 VAL A CB  
1159 C CG1 . VAL A 159 ? 0.6878 0.9964 0.8614 -0.0470 -0.2156 0.1277  159 VAL A CG1 
1160 C CG2 . VAL A 159 ? 0.6702 0.9455 0.8714 -0.0286 -0.2002 0.1368  159 VAL A CG2 
1161 N N   . ALA A 160 ? 0.6038 0.9433 0.8620 -0.0329 -0.2220 0.1079  160 ALA A N   
1162 C CA  . ALA A 160 ? 0.5900 0.9460 0.8520 -0.0389 -0.2217 0.0923  160 ALA A CA  
1163 C C   . ALA A 160 ? 0.6278 0.9815 0.8490 -0.0520 -0.2115 0.0782  160 ALA A C   
1164 O O   . ALA A 160 ? 0.6238 0.9727 0.8104 -0.0600 -0.2133 0.0848  160 ALA A O   
1165 C CB  . ALA A 160 ? 0.6178 0.9976 0.8948 -0.0413 -0.2445 0.1031  160 ALA A CB  
1166 N N   . SER A 161 ? 0.5763 0.9325 0.8029 -0.0542 -0.1997 0.0585  161 SER A N   
1167 C CA  . SER A 161 ? 0.5773 0.9309 0.7722 -0.0655 -0.1885 0.0428  161 SER A CA  
1168 C C   . SER A 161 ? 0.6303 1.0001 0.8336 -0.0720 -0.1893 0.0279  161 SER A C   
1169 O O   . SER A 161 ? 0.6230 1.0037 0.8602 -0.0661 -0.1943 0.0270  161 SER A O   
1170 C CB  . SER A 161 ? 0.6034 0.9346 0.7910 -0.0615 -0.1675 0.0327  161 SER A CB  
1171 O OG  . SER A 161 ? 0.7217 1.0484 0.9401 -0.0524 -0.1583 0.0242  161 SER A OG  
1172 N N   . ASP A 162 ? 0.5866 0.9582 0.7601 -0.0844 -0.1837 0.0158  162 ASP A N   
1173 C CA  . ASP A 162 ? 0.5754 0.9604 0.7518 -0.0927 -0.1825 -0.0001 162 ASP A CA  
1174 C C   . ASP A 162 ? 0.6054 0.9776 0.7570 -0.1002 -0.1642 -0.0178 162 ASP A C   
1175 O O   . ASP A 162 ? 0.5878 0.9405 0.7297 -0.0957 -0.1514 -0.0184 162 ASP A O   
1176 C CB  . ASP A 162 ? 0.6205 1.0291 0.7890 -0.1028 -0.2028 0.0065  162 ASP A CB  
1177 C CG  . ASP A 162 ? 0.7762 1.1856 0.9027 -0.1151 -0.2078 0.0115  162 ASP A CG  
1178 O OD1 . ASP A 162 ? 0.7655 1.1571 0.8714 -0.1141 -0.1975 0.0138  162 ASP A OD1 
1179 O OD2 . ASP A 162 ? 0.9000 1.3285 1.0145 -0.1264 -0.2221 0.0130  162 ASP A OD2 
1180 N N   . GLU A 163 ? 0.5607 0.9435 0.7039 -0.1114 -0.1630 -0.0322 163 GLU A N   
1181 C CA  . GLU A 163 ? 0.5474 0.9195 0.6705 -0.1193 -0.1464 -0.0500 163 GLU A CA  
1182 C C   . GLU A 163 ? 0.5903 0.9514 0.6790 -0.1249 -0.1409 -0.0482 163 GLU A C   
1183 O O   . GLU A 163 ? 0.5828 0.9293 0.6603 -0.1268 -0.1248 -0.0602 163 GLU A O   
1184 C CB  . GLU A 163 ? 0.5760 0.9639 0.6956 -0.1320 -0.1487 -0.0645 163 GLU A CB  
1185 C CG  . GLU A 163 ? 0.7573 1.1671 0.9033 -0.1318 -0.1636 -0.0617 163 GLU A CG  
1186 C CD  . GLU A 163 ? 1.1247 1.5550 1.2635 -0.1373 -0.1857 -0.0476 163 GLU A CD  
1187 O OE1 . GLU A 163 ? 1.1546 1.5942 1.3192 -0.1284 -0.1989 -0.0338 163 GLU A OE1 
1188 O OE2 . GLU A 163 ? 1.0774 1.5147 1.1855 -0.1508 -0.1900 -0.0505 163 GLU A OE2 
1189 N N   . SER A 164 ? 0.5465 0.9151 0.6194 -0.1282 -0.1544 -0.0331 164 SER A N   
1190 C CA  . SER A 164 ? 0.5555 0.9156 0.5952 -0.1349 -0.1500 -0.0302 164 SER A CA  
1191 C C   . SER A 164 ? 0.5807 0.9263 0.6233 -0.1239 -0.1493 -0.0143 164 SER A C   
1192 O O   . SER A 164 ? 0.5701 0.9125 0.5882 -0.1288 -0.1514 -0.0053 164 SER A O   
1193 C CB  . SER A 164 ? 0.6491 1.0270 0.6631 -0.1495 -0.1644 -0.0256 164 SER A CB  
1194 O OG  . SER A 164 ? 0.7865 1.1794 0.8016 -0.1593 -0.1666 -0.0400 164 SER A OG  
1195 N N   . GLY A 165 ? 0.5232 0.8598 0.5954 -0.1100 -0.1450 -0.0121 165 GLY A N   
1196 C CA  . GLY A 165 ? 0.5110 0.8334 0.5918 -0.0985 -0.1432 0.0010  165 GLY A CA  
1197 C C   . GLY A 165 ? 0.5649 0.8957 0.6542 -0.0944 -0.1613 0.0219  165 GLY A C   
1198 O O   . GLY A 165 ? 0.5762 0.9243 0.6799 -0.0953 -0.1759 0.0266  165 GLY A O   
1199 N N   . ILE A 166 ? 0.4978 0.8160 0.5797 -0.0899 -0.1607 0.0351  166 ILE A N   
1200 C CA  . ILE A 166 ? 0.4997 0.8213 0.5882 -0.0855 -0.1766 0.0569  166 ILE A CA  
1201 C C   . ILE A 166 ? 0.5872 0.9286 0.6600 -0.0966 -0.1951 0.0652  166 ILE A C   
1202 O O   . ILE A 166 ? 0.6084 0.9544 0.6491 -0.1103 -0.1929 0.0579  166 ILE A O   
1203 C CB  . ILE A 166 ? 0.5365 0.8400 0.6094 -0.0833 -0.1700 0.0667  166 ILE A CB  
1204 C CG1 . ILE A 166 ? 0.5067 0.7937 0.6058 -0.0693 -0.1585 0.0649  166 ILE A CG1 
1205 C CG2 . ILE A 166 ? 0.5743 0.8819 0.6371 -0.0856 -0.1871 0.0898  166 ILE A CG2 
1206 C CD1 . ILE A 166 ? 0.5330 0.8015 0.6174 -0.0680 -0.1475 0.0681  166 ILE A CD1 
1207 N N   . VAL A 167 ? 0.5441 0.8976 0.6408 -0.0910 -0.2132 0.0798  167 VAL A N   
1208 C CA  . VAL A 167 ? 0.5696 0.9431 0.6551 -0.1005 -0.2342 0.0909  167 VAL A CA  
1209 C C   . VAL A 167 ? 0.6459 1.0131 0.7142 -0.1015 -0.2447 0.1137  167 VAL A C   
1210 O O   . VAL A 167 ? 0.6328 0.9920 0.7262 -0.0890 -0.2493 0.1281  167 VAL A O   
1211 C CB  . VAL A 167 ? 0.6153 1.0071 0.7393 -0.0940 -0.2491 0.0939  167 VAL A CB  
1212 C CG1 . VAL A 167 ? 0.6423 1.0561 0.7544 -0.1045 -0.2728 0.1062  167 VAL A CG1 
1213 C CG2 . VAL A 167 ? 0.5908 0.9869 0.7319 -0.0933 -0.2367 0.0711  167 VAL A CG2 
1214 N N   . PRO A 168 ? 0.6468 1.0164 0.6723 -0.1168 -0.2476 0.1170  168 PRO A N   
1215 C CA  . PRO A 168 ? 0.6697 1.0319 0.6755 -0.1192 -0.2566 0.1393  168 PRO A CA  
1216 C C   . PRO A 168 ? 0.7390 1.1107 0.7653 -0.1134 -0.2814 0.1643  168 PRO A C   
1217 O O   . PRO A 168 ? 0.7412 1.1004 0.7699 -0.1076 -0.2854 0.1828  168 PRO A O   
1218 C CB  . PRO A 168 ? 0.7207 1.0878 0.6768 -0.1392 -0.2549 0.1344  168 PRO A CB  
1219 C CG  . PRO A 168 ? 0.7663 1.1344 0.7178 -0.1439 -0.2368 0.1067  168 PRO A CG  
1220 C CD  . PRO A 168 ? 0.6844 1.0621 0.6768 -0.1332 -0.2409 0.0996  168 PRO A CD  
1221 N N   . ASP A 169 ? 0.7065 1.0999 0.7499 -0.1147 -0.2980 0.1649  169 ASP A N   
1222 C CA  . ASP A 169 ? 0.7252 1.1300 0.7931 -0.1086 -0.3233 0.1884  169 ASP A CA  
1223 C C   . ASP A 169 ? 0.7397 1.1344 0.8575 -0.0882 -0.3216 0.1951  169 ASP A C   
1224 O O   . ASP A 169 ? 0.7400 1.1330 0.8735 -0.0815 -0.3374 0.2183  169 ASP A O   
1225 C CB  . ASP A 169 ? 0.7742 1.2063 0.8477 -0.1162 -0.3415 0.1861  169 ASP A CB  
1226 C CG  . ASP A 169 ? 1.0622 1.5061 1.0870 -0.1366 -0.3540 0.1924  169 ASP A CG  
1227 O OD1 . ASP A 169 ? 1.1273 1.5729 1.1402 -0.1397 -0.3730 0.2175  169 ASP A OD1 
1228 O OD2 . ASP A 169 ? 1.1659 1.6165 1.1639 -0.1501 -0.3444 0.1724  169 ASP A OD2 
1229 N N   . SER A 170 ? 0.6688 1.0556 0.8104 -0.0790 -0.3020 0.1751  170 SER A N   
1230 C CA  . SER A 170 ? 0.6406 1.0164 0.8272 -0.0609 -0.2960 0.1773  170 SER A CA  
1231 C C   . SER A 170 ? 0.6748 1.0273 0.8513 -0.0562 -0.2893 0.1902  170 SER A C   
1232 O O   . SER A 170 ? 0.6644 1.0112 0.8694 -0.0451 -0.2978 0.2069  170 SER A O   
1233 C CB  . SER A 170 ? 0.6574 1.0287 0.8609 -0.0558 -0.2748 0.1519  170 SER A CB  
1234 O OG  . SER A 170 ? 0.7873 1.1475 1.0312 -0.0400 -0.2675 0.1525  170 SER A OG  
1235 N N   . LEU A 171 ? 0.6233 0.9629 0.7600 -0.0654 -0.2740 0.1821  171 LEU A N   
1236 C CA  . LEU A 171 ? 0.6212 0.9394 0.7415 -0.0641 -0.2653 0.1915  171 LEU A CA  
1237 C C   . LEU A 171 ? 0.7054 1.0248 0.8135 -0.0680 -0.2857 0.2193  171 LEU A C   
1238 O O   . LEU A 171 ? 0.6992 1.0032 0.8196 -0.0598 -0.2860 0.2340  171 LEU A O   
1239 C CB  . LEU A 171 ? 0.6152 0.9250 0.6948 -0.0756 -0.2466 0.1751  171 LEU A CB  
1240 C CG  . LEU A 171 ? 0.6710 0.9600 0.7286 -0.0772 -0.2351 0.1813  171 LEU A CG  
1241 C CD1 . LEU A 171 ? 0.6477 0.9189 0.7362 -0.0622 -0.2219 0.1780  171 LEU A CD1 
1242 C CD2 . LEU A 171 ? 0.6809 0.9672 0.6990 -0.0906 -0.2196 0.1650  171 LEU A CD2 
1243 N N   . ARG A 172 ? 0.6930 1.0308 0.7785 -0.0805 -0.3033 0.2267  172 ARG A N   
1244 C CA  . ARG A 172 ? 0.7271 1.0688 0.7980 -0.0862 -0.3255 0.2543  172 ARG A CA  
1245 C C   . ARG A 172 ? 0.7833 1.1269 0.9034 -0.0704 -0.3425 0.2731  172 ARG A C   
1246 O O   . ARG A 172 ? 0.7892 1.1198 0.9132 -0.0658 -0.3496 0.2948  172 ARG A O   
1247 C CB  . ARG A 172 ? 0.7374 1.1010 0.7754 -0.1035 -0.3405 0.2546  172 ARG A CB  
1248 C CG  . ARG A 172 ? 0.8720 1.2357 0.8717 -0.1166 -0.3569 0.2789  172 ARG A CG  
1249 C CD  . ARG A 172 ? 1.0572 1.4398 1.0139 -0.1373 -0.3647 0.2730  172 ARG A CD  
1250 N NE  . ARG A 172 ? 1.2176 1.5934 1.1374 -0.1492 -0.3407 0.2495  172 ARG A NE  
1251 C CZ  . ARG A 172 ? 1.3981 1.7864 1.3090 -0.1571 -0.3321 0.2251  172 ARG A CZ  
1252 N NH1 . ARG A 172 ? 1.2397 1.6484 1.1739 -0.1552 -0.3454 0.2205  172 ARG A NH1 
1253 N NH2 . ARG A 172 ? 1.1927 1.5731 1.0730 -0.1670 -0.3100 0.2050  172 ARG A NH2 
1254 N N   . ASP A 173 ? 0.7402 1.0991 0.8996 -0.0619 -0.3474 0.2638  173 ASP A N   
1255 C CA  . ASP A 173 ? 0.7444 1.1085 0.9574 -0.0464 -0.3620 0.2771  173 ASP A CA  
1256 C C   . ASP A 173 ? 0.7432 1.0840 0.9858 -0.0311 -0.3480 0.2792  173 ASP A C   
1257 O O   . ASP A 173 ? 0.7467 1.0819 1.0155 -0.0220 -0.3611 0.3006  173 ASP A O   
1258 C CB  . ASP A 173 ? 0.7642 1.1494 1.0106 -0.0423 -0.3642 0.2604  173 ASP A CB  
1259 C CG  . ASP A 173 ? 1.0060 1.4006 1.3107 -0.0273 -0.3797 0.2722  173 ASP A CG  
1260 O OD1 . ASP A 173 ? 1.0527 1.4666 1.3650 -0.0303 -0.4052 0.2881  173 ASP A OD1 
1261 O OD2 . ASP A 173 ? 1.0898 1.4731 1.4335 -0.0129 -0.3663 0.2646  173 ASP A OD2 
1262 N N   . ILE A 174 ? 0.6522 0.9790 0.8902 -0.0289 -0.3220 0.2573  174 ILE A N   
1263 C CA  . ILE A 174 ? 0.6229 0.9274 0.8848 -0.0162 -0.3064 0.2557  174 ILE A CA  
1264 C C   . ILE A 174 ? 0.6806 0.9667 0.9199 -0.0188 -0.3091 0.2765  174 ILE A C   
1265 O O   . ILE A 174 ? 0.6938 0.9704 0.9632 -0.0082 -0.3163 0.2933  174 ILE A O   
1266 C CB  . ILE A 174 ? 0.6256 0.9212 0.8826 -0.0155 -0.2794 0.2277  174 ILE A CB  
1267 C CG1 . ILE A 174 ? 0.6042 0.9143 0.8952 -0.0095 -0.2762 0.2097  174 ILE A CG1 
1268 C CG2 . ILE A 174 ? 0.6204 0.8911 0.8877 -0.0067 -0.2627 0.2268  174 ILE A CG2 
1269 C CD1 . ILE A 174 ? 0.6694 0.9784 0.9425 -0.0150 -0.2556 0.1827  174 ILE A CD1 
1270 N N   . LEU A 175 ? 0.6297 0.9115 0.8174 -0.0336 -0.3037 0.2756  175 LEU A N   
1271 C CA  . LEU A 175 ? 0.6486 0.9136 0.8074 -0.0394 -0.3039 0.2930  175 LEU A CA  
1272 C C   . LEU A 175 ? 0.7394 1.0061 0.9040 -0.0389 -0.3289 0.3243  175 LEU A C   
1273 O O   . LEU A 175 ? 0.7374 0.9858 0.8960 -0.0379 -0.3284 0.3408  175 LEU A O   
1274 C CB  . LEU A 175 ? 0.6580 0.9231 0.7604 -0.0573 -0.2944 0.2840  175 LEU A CB  
1275 C CG  . LEU A 175 ? 0.6746 0.9287 0.7654 -0.0582 -0.2672 0.2583  175 LEU A CG  
1276 C CD1 . LEU A 175 ? 0.6830 0.9440 0.7253 -0.0758 -0.2607 0.2469  175 LEU A CD1 
1277 C CD2 . LEU A 175 ? 0.6735 0.9035 0.7693 -0.0519 -0.2536 0.2627  175 LEU A CD2 
1278 N N   . SER A 176 ? 0.7359 1.0242 0.9140 -0.0394 -0.3510 0.3330  176 SER A N   
1279 C CA  . SER A 176 ? 0.7824 1.0756 0.9682 -0.0391 -0.3783 0.3639  176 SER A CA  
1280 C C   . SER A 176 ? 0.8627 1.1408 1.0972 -0.0216 -0.3826 0.3803  176 SER A C   
1281 O O   . SER A 176 ? 0.8788 1.1541 1.1162 -0.0213 -0.4030 0.4087  176 SER A O   
1282 C CB  . SER A 176 ? 0.8313 1.1529 1.0244 -0.0431 -0.4005 0.3666  176 SER A CB  
1283 O OG  . SER A 176 ? 0.9149 1.2462 1.1678 -0.0269 -0.4083 0.3658  176 SER A OG  
1284 N N   . ARG A 177 ? 0.8116 1.0790 1.0833 -0.0077 -0.3631 0.3625  177 ARG A N   
1285 C CA  . ARG A 177 ? 0.8185 1.0707 1.1384 0.0087  -0.3638 0.3741  177 ARG A CA  
1286 C C   . ARG A 177 ? 0.9166 1.1430 1.2173 0.0067  -0.3592 0.3913  177 ARG A C   
1287 O O   . ARG A 177 ? 0.9156 1.1292 1.2515 0.0180  -0.3654 0.4080  177 ARG A O   
1288 C CB  . ARG A 177 ? 0.7746 1.0254 1.1402 0.0227  -0.3458 0.3501  177 ARG A CB  
1289 C CG  . ARG A 177 ? 0.9050 1.1364 1.2573 0.0229  -0.3172 0.3297  177 ARG A CG  
1290 C CD  . ARG A 177 ? 1.0090 1.2393 1.4057 0.0357  -0.3012 0.3080  177 ARG A CD  
1291 N NE  . ARG A 177 ? 1.0400 1.2893 1.4345 0.0323  -0.2961 0.2856  177 ARG A NE  
1292 C CZ  . ARG A 177 ? 1.1260 1.3750 1.5445 0.0389  -0.2784 0.2623  177 ARG A CZ  
1293 N NH1 . ARG A 177 ? 0.8947 1.1259 1.3402 0.0489  -0.2638 0.2568  177 ARG A NH1 
1294 N NH2 . ARG A 177 ? 0.9493 1.2152 1.3638 0.0346  -0.2749 0.2440  177 ARG A NH2 
1295 N N   . TRP A 178 ? 0.9043 1.1239 1.1499 -0.0084 -0.3489 0.3873  178 TRP A N   
1296 C CA  . TRP A 178 ? 0.9329 1.1304 1.1497 -0.0146 -0.3436 0.4019  178 TRP A CA  
1297 C C   . TRP A 178 ? 1.0191 1.2248 1.1820 -0.0333 -0.3583 0.4180  178 TRP A C   
1298 O O   . TRP A 178 ? 1.0177 1.2455 1.1639 -0.0417 -0.3686 0.4130  178 TRP A O   
1299 C CB  . TRP A 178 ? 0.9012 1.0838 1.0993 -0.0172 -0.3143 0.3784  178 TRP A CB  
1300 C CG  . TRP A 178 ? 0.8826 1.0576 1.1237 -0.0022 -0.2969 0.3586  178 TRP A CG  
1301 C CD1 . TRP A 178 ? 0.9144 1.0694 1.1882 0.0094  -0.2892 0.3629  178 TRP A CD1 
1302 C CD2 . TRP A 178 ? 0.8480 1.0337 1.0994 0.0008  -0.2832 0.3301  178 TRP A CD2 
1303 N NE1 . TRP A 178 ? 0.8716 1.0256 1.1756 0.0193  -0.2722 0.3388  178 TRP A NE1 
1304 C CE2 . TRP A 178 ? 0.8727 1.0450 1.1631 0.0143  -0.2684 0.3190  178 TRP A CE2 
1305 C CE3 . TRP A 178 ? 0.8554 1.0605 1.0868 -0.0071 -0.2820 0.3129  178 TRP A CE3 
1306 C CZ2 . TRP A 178 ? 0.8319 1.0096 1.1402 0.0197  -0.2531 0.2926  178 TRP A CZ2 
1307 C CZ3 . TRP A 178 ? 0.8433 1.0531 1.0946 -0.0010 -0.2670 0.2873  178 TRP A CZ3 
1308 C CH2 . TRP A 178 ? 0.8292 1.0255 1.1175 0.0121  -0.2530 0.2778  178 TRP A CH2 
1309 N N   . LYS A 179 ? 1.0090 1.1968 1.1437 -0.0409 -0.3580 0.4364  179 LYS A N   
1310 C CA  . LYS A 179 ? 1.0469 1.2383 1.1257 -0.0606 -0.3685 0.4521  179 LYS A CA  
1311 C C   . LYS A 179 ? 1.0877 1.2676 1.1233 -0.0727 -0.3428 0.4346  179 LYS A C   
1312 O O   . LYS A 179 ? 1.0529 1.2144 1.1048 -0.0647 -0.3236 0.4252  179 LYS A O   
1313 C CB  . LYS A 179 ? 1.1157 1.2938 1.1957 -0.0607 -0.3879 0.4888  179 LYS A CB  
1314 C CG  . LYS A 179 ? 1.2422 1.4294 1.3693 -0.0476 -0.4147 0.5097  179 LYS A CG  
1315 C CD  . LYS A 179 ? 1.3935 1.6063 1.4989 -0.0587 -0.4404 0.5211  179 LYS A CD  
1316 C CE  . LYS A 179 ? 1.4817 1.7068 1.6394 -0.0446 -0.4663 0.5382  179 LYS A CE  
1317 N NZ  . LYS A 179 ? 1.5440 1.7976 1.6832 -0.0552 -0.4894 0.5433  179 LYS A NZ  
1318 N N   . PRO A 180 ? 1.0644 1.2544 1.0462 -0.0923 -0.3415 0.4297  180 PRO A N   
1319 C CA  . PRO A 180 ? 1.0610 1.2401 1.0060 -0.1033 -0.3162 0.4126  180 PRO A CA  
1320 C C   . PRO A 180 ? 1.1507 1.3035 1.0942 -0.1020 -0.3057 0.4248  180 PRO A C   
1321 O O   . PRO A 180 ? 1.1247 1.2661 1.0657 -0.1012 -0.2819 0.4062  180 PRO A O   
1322 C CB  . PRO A 180 ? 1.1109 1.3042 1.0000 -0.1255 -0.3228 0.4145  180 PRO A CB  
1323 C CG  . PRO A 180 ? 1.1641 1.3808 1.0658 -0.1240 -0.3448 0.4179  180 PRO A CG  
1324 C CD  . PRO A 180 ? 1.1053 1.3175 1.0585 -0.1057 -0.3621 0.4381  180 PRO A CD  
1325 N N   . GLU A 181 ? 1.1631 1.3063 1.1112 -0.1011 -0.3238 0.4564  181 GLU A N   
1326 C CA  . GLU A 181 ? 1.1813 1.2987 1.1310 -0.0997 -0.3168 0.4721  181 GLU A CA  
1327 C C   . GLU A 181 ? 1.2021 1.3041 1.2024 -0.0804 -0.3019 0.4603  181 GLU A C   
1328 O O   . GLU A 181 ? 1.2044 1.2860 1.2017 -0.0810 -0.2864 0.4605  181 GLU A O   
1329 C CB  . GLU A 181 ? 1.2465 1.3577 1.1921 -0.1028 -0.3423 0.5103  181 GLU A CB  
1330 C CG  . GLU A 181 ? 1.4061 1.5276 1.3971 -0.0881 -0.3673 0.5253  181 GLU A CG  
1331 C CD  . GLU A 181 ? 1.7912 1.8982 1.7984 -0.0837 -0.3879 0.5621  181 GLU A CD  
1332 O OE1 . GLU A 181 ? 1.8169 1.9096 1.8749 -0.0659 -0.3861 0.5664  181 GLU A OE1 
1333 O OE2 . GLU A 181 ? 1.7544 1.8643 1.7242 -0.0983 -0.4061 0.5868  181 GLU A OE2 
1334 N N   . ASP A 182 ? 1.1268 1.2391 1.1724 -0.0645 -0.3059 0.4492  182 ASP A N   
1335 C CA  . ASP A 182 ? 1.0904 1.1906 1.1851 -0.0466 -0.2926 0.4366  182 ASP A CA  
1336 C C   . ASP A 182 ? 1.0973 1.1892 1.1824 -0.0481 -0.2641 0.4088  182 ASP A C   
1337 O O   . ASP A 182 ? 1.0732 1.1481 1.1866 -0.0380 -0.2517 0.4041  182 ASP A O   
1338 C CB  . ASP A 182 ? 1.0943 1.2101 1.2355 -0.0317 -0.3023 0.4288  182 ASP A CB  
1339 C CG  . ASP A 182 ? 1.2973 1.4202 1.4629 -0.0259 -0.3305 0.4560  182 ASP A CG  
1340 O OD1 . ASP A 182 ? 1.3675 1.4829 1.5117 -0.0338 -0.3449 0.4835  182 ASP A OD1 
1341 O OD2 . ASP A 182 ? 1.3515 1.4877 1.5581 -0.0137 -0.3384 0.4501  182 ASP A OD2 
1342 N N   . ALA A 183 ? 1.0459 1.1495 1.0925 -0.0607 -0.2539 0.3903  183 ALA A N   
1343 C CA  . ALA A 183 ? 1.0157 1.1134 1.0521 -0.0629 -0.2281 0.3640  183 ALA A CA  
1344 C C   . ALA A 183 ? 1.0763 1.1514 1.1020 -0.0669 -0.2154 0.3711  183 ALA A C   
1345 O O   . ALA A 183 ? 1.0441 1.1088 1.0844 -0.0612 -0.1967 0.3544  183 ALA A O   
1346 C CB  . ALA A 183 ? 1.0238 1.1374 1.0190 -0.0775 -0.2222 0.3478  183 ALA A CB  
1347 N N   . LYS A 184 ? 1.0770 1.1447 1.0783 -0.0769 -0.2264 0.3969  184 LYS A N   
1348 C CA  . LYS A 184 ? 1.0978 1.1439 1.0861 -0.0828 -0.2172 0.4087  184 LYS A CA  
1349 C C   . LYS A 184 ? 1.1559 1.1827 1.1902 -0.0672 -0.2184 0.4200  184 LYS A C   
1350 O O   . LYS A 184 ? 1.1559 1.1635 1.1897 -0.0688 -0.2055 0.4220  184 LYS A O   
1351 C CB  . LYS A 184 ? 1.1784 1.2243 1.1230 -0.0999 -0.2301 0.4336  184 LYS A CB  
1352 C CG  . LYS A 184 ? 1.3778 1.4418 1.2745 -0.1174 -0.2273 0.4219  184 LYS A CG  
1353 C CD  . LYS A 184 ? 1.5924 1.6582 1.4470 -0.1344 -0.2434 0.4480  184 LYS A CD  
1354 C CE  . LYS A 184 ? 1.7335 1.8197 1.5438 -0.1514 -0.2435 0.4364  184 LYS A CE  
1355 N NZ  . LYS A 184 ? 1.7946 1.9023 1.6182 -0.1458 -0.2617 0.4343  184 LYS A NZ  
1356 N N   . ASN A 185 ? 1.1173 1.1494 1.1925 -0.0526 -0.2334 0.4265  185 ASN A N   
1357 C CA  . ASN A 185 ? 1.1190 1.1346 1.2432 -0.0369 -0.2349 0.4354  185 ASN A CA  
1358 C C   . ASN A 185 ? 1.1386 1.1555 1.2989 -0.0236 -0.2188 0.4068  185 ASN A C   
1359 O O   . ASN A 185 ? 1.1170 1.1509 1.2959 -0.0164 -0.2241 0.3953  185 ASN A O   
1360 C CB  . ASN A 185 ? 1.1726 1.1927 1.3220 -0.0293 -0.2613 0.4613  185 ASN A CB  
1361 C CG  . ASN A 185 ? 1.4816 1.4838 1.6834 -0.0134 -0.2644 0.4730  185 ASN A CG  
1362 O OD1 . ASN A 185 ? 1.4112 1.3956 1.6313 -0.0081 -0.2466 0.4628  185 ASN A OD1 
1363 N ND2 . ASN A 185 ? 1.3682 1.3749 1.5965 -0.0058 -0.2874 0.4949  185 ASN A ND2 
1364 N N   . PRO A 186 ? 1.0868 1.0863 1.2568 -0.0211 -0.1992 0.3952  186 PRO A N   
1365 C CA  . PRO A 186 ? 1.0425 1.0433 1.2420 -0.0105 -0.1835 0.3678  186 PRO A CA  
1366 C C   . PRO A 186 ? 1.0679 1.0727 1.3182 0.0059  -0.1910 0.3657  186 PRO A C   
1367 O O   . PRO A 186 ? 1.0255 1.0435 1.2880 0.0111  -0.1853 0.3442  186 PRO A O   
1368 C CB  . PRO A 186 ? 1.0634 1.0429 1.2641 -0.0120 -0.1648 0.3619  186 PRO A CB  
1369 C CG  . PRO A 186 ? 1.1608 1.1251 1.3463 -0.0193 -0.1728 0.3896  186 PRO A CG  
1370 C CD  . PRO A 186 ? 1.1298 1.1088 1.2810 -0.0296 -0.1898 0.4053  186 PRO A CD  
1371 N N   . GLN A 187 ? 1.0451 1.0391 1.3256 0.0138  -0.2038 0.3880  187 GLN A N   
1372 C CA  . GLN A 187 ? 1.0263 1.0233 1.3597 0.0297  -0.2107 0.3872  187 GLN A CA  
1373 C C   . GLN A 187 ? 1.0533 1.0744 1.3953 0.0330  -0.2287 0.3898  187 GLN A C   
1374 O O   . GLN A 187 ? 1.0426 1.0684 1.4303 0.0461  -0.2326 0.3858  187 GLN A O   
1375 C CB  . GLN A 187 ? 1.0657 1.0414 1.4355 0.0384  -0.2157 0.4072  187 GLN A CB  
1376 C CG  . GLN A 187 ? 1.3664 1.3357 1.7189 0.0321  -0.2353 0.4411  187 GLN A CG  
1377 C CD  . GLN A 187 ? 1.6579 1.6017 1.9982 0.0263  -0.2254 0.4516  187 GLN A CD  
1378 O OE1 . GLN A 187 ? 1.6022 1.5427 1.8997 0.0131  -0.2138 0.4456  187 GLN A OE1 
1379 N NE2 . GLN A 187 ? 1.5853 1.5102 1.9651 0.0360  -0.2290 0.4665  187 GLN A NE2 
1380 N N   . LYS A 188 ? 0.9953 1.0321 1.2949 0.0208  -0.2385 0.3948  188 LYS A N   
1381 C CA  . LYS A 188 ? 0.9805 1.0415 1.2853 0.0222  -0.2556 0.3962  188 LYS A CA  
1382 C C   . LYS A 188 ? 0.9652 1.0416 1.2780 0.0256  -0.2434 0.3657  188 LYS A C   
1383 O O   . LYS A 188 ? 0.9517 1.0461 1.2862 0.0312  -0.2545 0.3631  188 LYS A O   
1384 C CB  . LYS A 188 ? 1.0409 1.1129 1.2981 0.0072  -0.2713 0.4132  188 LYS A CB  
1385 C CG  . LYS A 188 ? 1.2554 1.3184 1.5139 0.0060  -0.2923 0.4482  188 LYS A CG  
1386 C CD  . LYS A 188 ? 1.3744 1.4522 1.6683 0.0154  -0.3170 0.4636  188 LYS A CD  
1387 C CE  . LYS A 188 ? 1.5502 1.6207 1.8381 0.0119  -0.3399 0.5001  188 LYS A CE  
1388 N NZ  . LYS A 188 ? 1.6612 1.7497 1.9784 0.0190  -0.3665 0.5158  188 LYS A NZ  
1389 N N   . ASN A 189 ? 0.8728 0.9420 1.1690 0.0219  -0.2208 0.3433  189 ASN A N   
1390 C CA  . ASN A 189 ? 0.8165 0.8955 1.1171 0.0242  -0.2059 0.3139  189 ASN A CA  
1391 C C   . ASN A 189 ? 0.8025 0.9047 1.0778 0.0165  -0.2117 0.3043  189 ASN A C   
1392 O O   . ASN A 189 ? 0.7433 0.8588 1.0403 0.0226  -0.2114 0.2900  189 ASN A O   
1393 C CB  . ASN A 189 ? 0.8302 0.9059 1.1841 0.0394  -0.2004 0.3034  189 ASN A CB  
1394 C CG  . ASN A 189 ? 1.1742 1.2468 1.5318 0.0412  -0.1784 0.2752  189 ASN A CG  
1395 O OD1 . ASN A 189 ? 1.0897 1.1736 1.4680 0.0468  -0.1750 0.2589  189 ASN A OD1 
1396 N ND2 . ASN A 189 ? 1.0918 1.1484 1.4308 0.0365  -0.1634 0.2694  189 ASN A ND2 
1397 N N   . THR A 190 ? 0.7807 0.8870 1.0092 0.0023  -0.2154 0.3110  190 THR A N   
1398 C CA  . THR A 190 ? 0.7756 0.9023 0.9744 -0.0075 -0.2196 0.3019  190 THR A CA  
1399 C C   . THR A 190 ? 0.7833 0.9126 0.9738 -0.0089 -0.1994 0.2725  190 THR A C   
1400 O O   . THR A 190 ? 0.7657 0.8797 0.9589 -0.0067 -0.1827 0.2630  190 THR A O   
1401 C CB  . THR A 190 ? 0.9347 1.0628 1.0853 -0.0235 -0.2270 0.3168  190 THR A CB  
1402 O OG1 . THR A 190 ? 0.9704 1.0806 1.0993 -0.0294 -0.2114 0.3151  190 THR A OG1 
1403 C CG2 . THR A 190 ? 0.9496 1.0799 1.1035 -0.0241 -0.2510 0.3465  190 THR A CG2 
1404 N N   . PRO A 191 ? 0.7182 0.8659 0.8987 -0.0129 -0.2005 0.2581  191 PRO A N   
1405 C CA  . PRO A 191 ? 0.6789 0.8274 0.8534 -0.0137 -0.1817 0.2315  191 PRO A CA  
1406 C C   . PRO A 191 ? 0.7184 0.8563 0.8590 -0.0231 -0.1661 0.2238  191 PRO A C   
1407 O O   . PRO A 191 ? 0.7452 0.8840 0.8516 -0.0348 -0.1698 0.2332  191 PRO A O   
1408 C CB  . PRO A 191 ? 0.6936 0.8637 0.8604 -0.0182 -0.1888 0.2221  191 PRO A CB  
1409 C CG  . PRO A 191 ? 0.7733 0.9540 0.9606 -0.0140 -0.2102 0.2404  191 PRO A CG  
1410 C CD  . PRO A 191 ? 0.7487 0.9171 0.9261 -0.0164 -0.2189 0.2649  191 PRO A CD  
1411 N N   . LYS A 192 ? 0.6273 0.7550 0.7786 -0.0182 -0.1488 0.2070  192 LYS A N   
1412 C CA  . LYS A 192 ? 0.6064 0.7243 0.7325 -0.0254 -0.1331 0.1978  192 LYS A CA  
1413 C C   . LYS A 192 ? 0.6350 0.7649 0.7327 -0.0351 -0.1273 0.1819  192 LYS A C   
1414 O O   . LYS A 192 ? 0.6473 0.7752 0.7140 -0.0459 -0.1216 0.1816  192 LYS A O   
1415 C CB  . LYS A 192 ? 0.5982 0.7019 0.7472 -0.0169 -0.1184 0.1860  192 LYS A CB  
1416 C CG  . LYS A 192 ? 0.5728 0.6615 0.7475 -0.0090 -0.1209 0.2003  192 LYS A CG  
1417 C CD  . LYS A 192 ? 0.6083 0.6830 0.7631 -0.0160 -0.1172 0.2123  192 LYS A CD  
1418 C CE  . LYS A 192 ? 0.7291 0.7856 0.9106 -0.0081 -0.1118 0.2172  192 LYS A CE  
1419 N NZ  . LYS A 192 ? 0.8690 0.9184 1.0587 -0.0053 -0.0945 0.1966  192 LYS A NZ  
1420 N N   . PHE A 193 ? 0.5496 0.6915 0.6587 -0.0317 -0.1280 0.1684  193 PHE A N   
1421 C CA  . PHE A 193 ? 0.5289 0.6817 0.6154 -0.0400 -0.1224 0.1525  193 PHE A CA  
1422 C C   . PHE A 193 ? 0.5547 0.7233 0.6543 -0.0374 -0.1302 0.1455  193 PHE A C   
1423 O O   . PHE A 193 ? 0.5363 0.7071 0.6664 -0.0278 -0.1375 0.1500  193 PHE A O   
1424 C CB  . PHE A 193 ? 0.5284 0.6724 0.6128 -0.0394 -0.1038 0.1336  193 PHE A CB  
1425 C CG  . PHE A 193 ? 0.5242 0.6635 0.6387 -0.0283 -0.0971 0.1220  193 PHE A CG  
1426 C CD1 . PHE A 193 ? 0.5602 0.6845 0.6919 -0.0214 -0.0899 0.1232  193 PHE A CD1 
1427 C CD2 . PHE A 193 ? 0.5307 0.6804 0.6547 -0.0261 -0.0969 0.1090  193 PHE A CD2 
1428 C CE1 . PHE A 193 ? 0.5432 0.6635 0.6996 -0.0129 -0.0828 0.1115  193 PHE A CE1 
1429 C CE2 . PHE A 193 ? 0.5437 0.6887 0.6925 -0.0175 -0.0898 0.0981  193 PHE A CE2 
1430 C CZ  . PHE A 193 ? 0.5141 0.6446 0.6780 -0.0112 -0.0827 0.0993  193 PHE A CZ  
1431 N N   . LEU A 194 ? 0.5046 0.6838 0.5826 -0.0462 -0.1270 0.1328  194 LEU A N   
1432 C CA  . LEU A 194 ? 0.4886 0.6825 0.5746 -0.0460 -0.1309 0.1219  194 LEU A CA  
1433 C C   . LEU A 194 ? 0.5113 0.7013 0.5923 -0.0472 -0.1142 0.1004  194 LEU A C   
1434 O O   . LEU A 194 ? 0.5109 0.6968 0.5672 -0.0552 -0.1050 0.0943  194 LEU A O   
1435 C CB  . LEU A 194 ? 0.5132 0.7234 0.5763 -0.0571 -0.1436 0.1273  194 LEU A CB  
1436 C CG  . LEU A 194 ? 0.5698 0.7956 0.6389 -0.0588 -0.1462 0.1137  194 LEU A CG  
1437 C CD1 . LEU A 194 ? 0.5772 0.8183 0.6592 -0.0578 -0.1659 0.1263  194 LEU A CD1 
1438 C CD2 . LEU A 194 ? 0.6314 0.8628 0.6688 -0.0717 -0.1388 0.1001  194 LEU A CD2 
1439 N N   . TYR A 195 ? 0.4356 0.6260 0.5413 -0.0391 -0.1099 0.0894  195 TYR A N   
1440 C CA  . TYR A 195 ? 0.4084 0.5946 0.5126 -0.0392 -0.0957 0.0704  195 TYR A CA  
1441 C C   . TYR A 195 ? 0.4856 0.6862 0.5872 -0.0439 -0.0985 0.0596  195 TYR A C   
1442 O O   . TYR A 195 ? 0.4772 0.6881 0.5967 -0.0405 -0.1082 0.0626  195 TYR A O   
1443 C CB  . TYR A 195 ? 0.3856 0.5609 0.5164 -0.0285 -0.0880 0.0653  195 TYR A CB  
1444 C CG  . TYR A 195 ? 0.3641 0.5369 0.4958 -0.0284 -0.0763 0.0471  195 TYR A CG  
1445 C CD1 . TYR A 195 ? 0.3753 0.5380 0.4935 -0.0310 -0.0645 0.0389  195 TYR A CD1 
1446 C CD2 . TYR A 195 ? 0.3533 0.5343 0.4995 -0.0264 -0.0773 0.0385  195 TYR A CD2 
1447 C CE1 . TYR A 195 ? 0.3631 0.5232 0.4824 -0.0310 -0.0552 0.0238  195 TYR A CE1 
1448 C CE2 . TYR A 195 ? 0.3390 0.5168 0.4844 -0.0272 -0.0671 0.0231  195 TYR A CE2 
1449 C CZ  . TYR A 195 ? 0.4083 0.5754 0.5401 -0.0294 -0.0566 0.0164  195 TYR A CZ  
1450 O OH  . TYR A 195 ? 0.3892 0.5525 0.5215 -0.0298 -0.0478 0.0028  195 TYR A OH  
1451 N N   . THR A 196 ? 0.4603 0.6613 0.5423 -0.0515 -0.0895 0.0463  196 THR A N   
1452 C CA  . THR A 196 ? 0.4601 0.6731 0.5386 -0.0569 -0.0903 0.0343  196 THR A CA  
1453 C C   . THR A 196 ? 0.4924 0.6998 0.5615 -0.0605 -0.0762 0.0170  196 THR A C   
1454 O O   . THR A 196 ? 0.4808 0.6796 0.5352 -0.0637 -0.0676 0.0146  196 THR A O   
1455 C CB  . THR A 196 ? 0.5874 0.8159 0.6484 -0.0666 -0.1031 0.0412  196 THR A CB  
1456 O OG1 . THR A 196 ? 0.6012 0.8421 0.6648 -0.0708 -0.1050 0.0297  196 THR A OG1 
1457 C CG2 . THR A 196 ? 0.5368 0.7635 0.5656 -0.0775 -0.0998 0.0430  196 THR A CG2 
1458 N N   . VAL A 197 ? 0.4445 0.6567 0.5238 -0.0601 -0.0740 0.0052  197 VAL A N   
1459 C CA  . VAL A 197 ? 0.4384 0.6464 0.5116 -0.0638 -0.0623 -0.0112 197 VAL A CA  
1460 C C   . VAL A 197 ? 0.4967 0.7188 0.5541 -0.0747 -0.0671 -0.0165 197 VAL A C   
1461 O O   . VAL A 197 ? 0.4877 0.7210 0.5551 -0.0753 -0.0744 -0.0179 197 VAL A O   
1462 C CB  . VAL A 197 ? 0.4669 0.6696 0.5612 -0.0569 -0.0567 -0.0198 197 VAL A CB  
1463 C CG1 . VAL A 197 ? 0.4526 0.6505 0.5403 -0.0612 -0.0460 -0.0352 197 VAL A CG1 
1464 C CG2 . VAL A 197 ? 0.4514 0.6412 0.5599 -0.0473 -0.0530 -0.0143 197 VAL A CG2 
1465 N N   . PRO A 198 ? 0.4626 0.6858 0.4957 -0.0841 -0.0639 -0.0186 198 PRO A N   
1466 C CA  . PRO A 198 ? 0.4820 0.7197 0.4977 -0.0961 -0.0694 -0.0228 198 PRO A CA  
1467 C C   . PRO A 198 ? 0.5287 0.7709 0.5465 -0.1010 -0.0638 -0.0400 198 PRO A C   
1468 O O   . PRO A 198 ? 0.5461 0.8025 0.5574 -0.1088 -0.0715 -0.0424 198 PRO A O   
1469 C CB  . PRO A 198 ? 0.5226 0.7583 0.5116 -0.1051 -0.0651 -0.0211 198 PRO A CB  
1470 C CG  . PRO A 198 ? 0.5694 0.7914 0.5644 -0.0968 -0.0611 -0.0117 198 PRO A CG  
1471 C CD  . PRO A 198 ? 0.4839 0.6964 0.5042 -0.0853 -0.0554 -0.0170 198 PRO A CD  
1472 N N   . ASN A 199 ? 0.4571 0.6874 0.4840 -0.0969 -0.0511 -0.0514 199 ASN A N   
1473 C CA  . ASN A 199 ? 0.4414 0.6724 0.4718 -0.1010 -0.0442 -0.0677 199 ASN A CA  
1474 C C   . ASN A 199 ? 0.4699 0.6941 0.5240 -0.0917 -0.0418 -0.0701 199 ASN A C   
1475 O O   . ASN A 199 ? 0.4407 0.6514 0.5039 -0.0836 -0.0355 -0.0683 199 ASN A O   
1476 C CB  . ASN A 199 ? 0.4220 0.6443 0.4410 -0.1061 -0.0305 -0.0799 199 ASN A CB  
1477 C CG  . ASN A 199 ? 0.6111 0.8405 0.6050 -0.1176 -0.0301 -0.0808 199 ASN A CG  
1478 O OD1 . ASN A 199 ? 0.6387 0.8803 0.6200 -0.1283 -0.0335 -0.0870 199 ASN A OD1 
1479 N ND2 . ASN A 199 ? 0.3852 0.6073 0.3710 -0.1165 -0.0256 -0.0752 199 ASN A ND2 
1480 N N   . GLY A 200 ? 0.4478 0.6819 0.5108 -0.0941 -0.0467 -0.0748 200 GLY A N   
1481 C CA  . GLY A 200 ? 0.4395 0.6692 0.5235 -0.0879 -0.0441 -0.0787 200 GLY A CA  
1482 C C   . GLY A 200 ? 0.4880 0.7109 0.5876 -0.0767 -0.0461 -0.0678 200 GLY A C   
1483 O O   . GLY A 200 ? 0.4792 0.6882 0.5865 -0.0709 -0.0377 -0.0704 200 GLY A O   
1484 N N   . ASN A 201 ? 0.4423 0.6748 0.5467 -0.0741 -0.0574 -0.0556 201 ASN A N   
1485 C CA  . ASN A 201 ? 0.4273 0.6549 0.5483 -0.0640 -0.0601 -0.0451 201 ASN A CA  
1486 C C   . ASN A 201 ? 0.4595 0.6799 0.6001 -0.0582 -0.0533 -0.0512 201 ASN A C   
1487 O O   . ASN A 201 ? 0.4628 0.6899 0.6118 -0.0613 -0.0529 -0.0593 201 ASN A O   
1488 C CB  . ASN A 201 ? 0.4307 0.6729 0.5594 -0.0631 -0.0747 -0.0332 201 ASN A CB  
1489 C CG  . ASN A 201 ? 0.5895 0.8279 0.7404 -0.0526 -0.0774 -0.0237 201 ASN A CG  
1490 O OD1 . ASN A 201 ? 0.5969 0.8241 0.7461 -0.0474 -0.0748 -0.0164 201 ASN A OD1 
1491 N ND2 . ASN A 201 ? 0.3621 0.6095 0.5358 -0.0495 -0.0815 -0.0250 201 ASN A ND2 
1492 N N   . ASN A 202 ? 0.3853 0.5922 0.5322 -0.0507 -0.0477 -0.0476 202 ASN A N   
1493 C CA  . ASN A 202 ? 0.3710 0.5704 0.5343 -0.0459 -0.0412 -0.0521 202 ASN A CA  
1494 C C   . ASN A 202 ? 0.4361 0.6448 0.6205 -0.0405 -0.0488 -0.0446 202 ASN A C   
1495 O O   . ASN A 202 ? 0.4487 0.6566 0.6352 -0.0360 -0.0539 -0.0339 202 ASN A O   
1496 C CB  . ASN A 202 ? 0.3741 0.5562 0.5334 -0.0413 -0.0329 -0.0513 202 ASN A CB  
1497 C CG  . ASN A 202 ? 0.4370 0.6093 0.6071 -0.0383 -0.0250 -0.0568 202 ASN A CG  
1498 O OD1 . ASN A 202 ? 0.2524 0.4304 0.4369 -0.0382 -0.0251 -0.0601 202 ASN A OD1 
1499 N ND2 . ASN A 202 ? 0.2767 0.4344 0.4398 -0.0366 -0.0181 -0.0580 202 ASN A ND2 
1500 N N   . PRO A 203 ? 0.3679 0.5866 0.5691 -0.0413 -0.0505 -0.0495 203 PRO A N   
1501 C CA  . PRO A 203 ? 0.3547 0.5746 0.5577 -0.0467 -0.0445 -0.0617 203 PRO A CA  
1502 C C   . PRO A 203 ? 0.3668 0.6021 0.5662 -0.0548 -0.0504 -0.0671 203 PRO A C   
1503 O O   . PRO A 203 ? 0.3409 0.5759 0.5421 -0.0595 -0.0446 -0.0776 203 PRO A O   
1504 C CB  . PRO A 203 ? 0.3742 0.5962 0.6022 -0.0420 -0.0421 -0.0631 203 PRO A CB  
1505 C CG  . PRO A 203 ? 0.4364 0.6702 0.6795 -0.0370 -0.0534 -0.0522 203 PRO A CG  
1506 C CD  . PRO A 203 ? 0.3858 0.6136 0.6110 -0.0355 -0.0576 -0.0424 203 PRO A CD  
1507 N N   . THR A 204 ? 0.3191 0.5678 0.5139 -0.0569 -0.0623 -0.0598 204 THR A N   
1508 C CA  . THR A 204 ? 0.3134 0.5795 0.5054 -0.0652 -0.0702 -0.0640 204 THR A CA  
1509 C C   . THR A 204 ? 0.3529 0.6167 0.5243 -0.0749 -0.0644 -0.0752 204 THR A C   
1510 O O   . THR A 204 ? 0.3390 0.6130 0.5135 -0.0818 -0.0655 -0.0841 204 THR A O   
1511 C CB  . THR A 204 ? 0.4032 0.6838 0.5943 -0.0653 -0.0856 -0.0514 204 THR A CB  
1512 O OG1 . THR A 204 ? 0.4469 0.7206 0.6134 -0.0675 -0.0859 -0.0456 204 THR A OG1 
1513 C CG2 . THR A 204 ? 0.3757 0.6595 0.5919 -0.0557 -0.0918 -0.0407 204 THR A CG2 
1514 N N   . GLY A 205 ? 0.3074 0.5588 0.4592 -0.0756 -0.0586 -0.0751 205 GLY A N   
1515 C CA  . GLY A 205 ? 0.3093 0.5579 0.4427 -0.0843 -0.0525 -0.0857 205 GLY A CA  
1516 C C   . GLY A 205 ? 0.3658 0.6294 0.4830 -0.0930 -0.0618 -0.0841 205 GLY A C   
1517 O O   . GLY A 205 ? 0.3901 0.6544 0.4922 -0.1020 -0.0573 -0.0943 205 GLY A O   
1518 N N   . ASN A 206 ? 0.2992 0.5744 0.4193 -0.0908 -0.0749 -0.0709 206 ASN A N   
1519 C CA  . ASN A 206 ? 0.3139 0.6041 0.4172 -0.0994 -0.0862 -0.0663 206 ASN A CA  
1520 C C   . ASN A 206 ? 0.3815 0.6640 0.4611 -0.1014 -0.0842 -0.0602 206 ASN A C   
1521 O O   . ASN A 206 ? 0.3530 0.6222 0.4356 -0.0931 -0.0797 -0.0531 206 ASN A O   
1522 C CB  . ASN A 206 ? 0.2959 0.6029 0.4152 -0.0965 -0.1026 -0.0544 206 ASN A CB  
1523 C CG  . ASN A 206 ? 0.5597 0.8783 0.7018 -0.0971 -0.1053 -0.0618 206 ASN A CG  
1524 O OD1 . ASN A 206 ? 0.5385 0.8635 0.7056 -0.0896 -0.1120 -0.0548 206 ASN A OD1 
1525 N ND2 . ASN A 206 ? 0.4201 0.7419 0.5559 -0.1062 -0.0995 -0.0769 206 ASN A ND2 
1526 N N   . SER A 207 ? 0.3686 0.6598 0.4245 -0.1134 -0.0868 -0.0640 207 SER A N   
1527 C CA  . SER A 207 ? 0.3904 0.6759 0.4215 -0.1181 -0.0835 -0.0605 207 SER A CA  
1528 C C   . SER A 207 ? 0.5041 0.8041 0.5161 -0.1266 -0.0974 -0.0496 207 SER A C   
1529 O O   . SER A 207 ? 0.5394 0.8558 0.5481 -0.1347 -0.1071 -0.0521 207 SER A O   
1530 C CB  . SER A 207 ? 0.4320 0.7103 0.4490 -0.1260 -0.0688 -0.0778 207 SER A CB  
1531 O OG  . SER A 207 ? 0.5370 0.7996 0.5698 -0.1179 -0.0564 -0.0854 207 SER A OG  
1532 N N   . LEU A 208 ? 0.4664 0.7600 0.4644 -0.1256 -0.0984 -0.0376 208 LEU A N   
1533 C CA  . LEU A 208 ? 0.4917 0.7959 0.4677 -0.1341 -0.1111 -0.0248 208 LEU A CA  
1534 C C   . LEU A 208 ? 0.5921 0.9027 0.5373 -0.1509 -0.1061 -0.0368 208 LEU A C   
1535 O O   . LEU A 208 ? 0.5835 0.8847 0.5228 -0.1539 -0.0898 -0.0525 208 LEU A O   
1536 C CB  . LEU A 208 ? 0.4906 0.7832 0.4611 -0.1283 -0.1110 -0.0091 208 LEU A CB  
1537 C CG  . LEU A 208 ? 0.5395 0.8326 0.5311 -0.1168 -0.1243 0.0103  208 LEU A CG  
1538 C CD1 . LEU A 208 ? 0.5381 0.8154 0.5277 -0.1103 -0.1191 0.0210  208 LEU A CD1 
1539 C CD2 . LEU A 208 ? 0.5995 0.9096 0.5833 -0.1231 -0.1441 0.0242  208 LEU A CD2 
1540 N N   . THR A 209 ? 0.5873 0.9138 0.5131 -0.1620 -0.1202 -0.0292 209 THR A N   
1541 C CA  . THR A 209 ? 0.6094 0.9441 0.5025 -0.1801 -0.1171 -0.0398 209 THR A CA  
1542 C C   . THR A 209 ? 0.6887 1.0184 0.5529 -0.1870 -0.1159 -0.0294 209 THR A C   
1543 O O   . THR A 209 ? 0.6826 1.0061 0.5523 -0.1783 -0.1226 -0.0108 209 THR A O   
1544 C CB  . THR A 209 ? 0.7065 1.0629 0.5947 -0.1900 -0.1336 -0.0393 209 THR A CB  
1545 O OG1 . THR A 209 ? 0.7345 1.0993 0.6247 -0.1866 -0.1538 -0.0161 209 THR A OG1 
1546 C CG2 . THR A 209 ? 0.6589 1.0204 0.5748 -0.1851 -0.1328 -0.0518 209 THR A CG2 
1547 N N   . SER A 210 ? 0.6702 1.0026 0.5040 -0.2032 -0.1066 -0.0421 210 SER A N   
1548 C CA  . SER A 210 ? 0.6919 1.0205 0.4943 -0.2131 -0.1029 -0.0352 210 SER A CA  
1549 C C   . SER A 210 ? 0.7503 1.0881 0.5381 -0.2165 -0.1239 -0.0106 210 SER A C   
1550 O O   . SER A 210 ? 0.7420 1.0704 0.5247 -0.2124 -0.1250 0.0053  210 SER A O   
1551 C CB  . SER A 210 ? 0.7740 1.1080 0.5468 -0.2322 -0.0908 -0.0549 210 SER A CB  
1552 O OG  . SER A 210 ? 0.9210 1.2468 0.7089 -0.2295 -0.0721 -0.0778 210 SER A OG  
1553 N N   . GLU A 211 ? 0.7215 1.0776 0.5046 -0.2238 -0.1411 -0.0073 211 GLU A N   
1554 C CA  . GLU A 211 ? 0.7427 1.1112 0.5131 -0.2285 -0.1644 0.0157  211 GLU A CA  
1555 C C   . GLU A 211 ? 0.7509 1.1121 0.5509 -0.2098 -0.1757 0.0378  211 GLU A C   
1556 O O   . GLU A 211 ? 0.7611 1.1194 0.5484 -0.2107 -0.1856 0.0588  211 GLU A O   
1557 C CB  . GLU A 211 ? 0.7781 1.1686 0.5453 -0.2384 -0.1798 0.0113  211 GLU A CB  
1558 C CG  . GLU A 211 ? 0.9971 1.3939 0.7466 -0.2538 -0.1663 -0.0157 211 GLU A CG  
1559 C CD  . GLU A 211 ? 1.3870 1.7773 1.1672 -0.2442 -0.1511 -0.0370 211 GLU A CD  
1560 O OE1 . GLU A 211 ? 1.3266 1.7026 1.1047 -0.2439 -0.1296 -0.0526 211 GLU A OE1 
1561 O OE2 . GLU A 211 ? 1.3631 1.7622 1.1706 -0.2368 -0.1608 -0.0374 211 GLU A OE2 
1562 N N   . ARG A 212 ? 0.6565 1.0136 0.4956 -0.1936 -0.1728 0.0323  212 ARG A N   
1563 C CA  . ARG A 212 ? 0.6320 0.9817 0.5041 -0.1752 -0.1804 0.0490  212 ARG A CA  
1564 C C   . ARG A 212 ? 0.6478 0.9772 0.5171 -0.1684 -0.1691 0.0568  212 ARG A C   
1565 O O   . ARG A 212 ? 0.6419 0.9674 0.5164 -0.1623 -0.1802 0.0781  212 ARG A O   
1566 C CB  . ARG A 212 ? 0.6094 0.9590 0.5204 -0.1621 -0.1763 0.0376  212 ARG A CB  
1567 C CG  . ARG A 212 ? 0.6663 1.0366 0.5912 -0.1642 -0.1934 0.0385  212 ARG A CG  
1568 C CD  . ARG A 212 ? 0.6971 1.0662 0.6639 -0.1493 -0.1912 0.0330  212 ARG A CD  
1569 N NE  . ARG A 212 ? 0.7766 1.1666 0.7596 -0.1512 -0.2079 0.0344  212 ARG A NE  
1570 C CZ  . ARG A 212 ? 0.8769 1.2708 0.8979 -0.1397 -0.2101 0.0320  212 ARG A CZ  
1571 N NH1 . ARG A 212 ? 0.6828 1.0606 0.7277 -0.1259 -0.1970 0.0285  212 ARG A NH1 
1572 N NH2 . ARG A 212 ? 0.6194 1.0339 0.6549 -0.1428 -0.2254 0.0327  212 ARG A NH2 
1573 N N   . LYS A 213 ? 0.5675 0.8847 0.4290 -0.1702 -0.1476 0.0397  213 LYS A N   
1574 C CA  . LYS A 213 ? 0.5423 0.8414 0.4004 -0.1653 -0.1352 0.0439  213 LYS A CA  
1575 C C   . LYS A 213 ? 0.6240 0.9233 0.4502 -0.1763 -0.1421 0.0609  213 LYS A C   
1576 O O   . LYS A 213 ? 0.6184 0.9073 0.4513 -0.1686 -0.1457 0.0782  213 LYS A O   
1577 C CB  . LYS A 213 ? 0.5426 0.8321 0.3968 -0.1677 -0.1123 0.0213  213 LYS A CB  
1578 C CG  . LYS A 213 ? 0.5253 0.8080 0.4128 -0.1541 -0.1038 0.0087  213 LYS A CG  
1579 C CD  . LYS A 213 ? 0.5238 0.7986 0.4072 -0.1576 -0.0834 -0.0130 213 LYS A CD  
1580 C CE  . LYS A 213 ? 0.5234 0.7897 0.4376 -0.1446 -0.0754 -0.0234 213 LYS A CE  
1581 N NZ  . LYS A 213 ? 0.5843 0.8438 0.4961 -0.1484 -0.0573 -0.0440 213 LYS A NZ  
1582 N N   . LYS A 214 ? 0.6254 0.9366 0.4168 -0.1949 -0.1446 0.0565  214 LYS A N   
1583 C CA  . LYS A 214 ? 0.6671 0.9806 0.4222 -0.2090 -0.1520 0.0720  214 LYS A CA  
1584 C C   . LYS A 214 ? 0.7413 1.0568 0.5076 -0.2013 -0.1748 0.1004  214 LYS A C   
1585 O O   . LYS A 214 ? 0.7306 1.0347 0.4908 -0.1992 -0.1758 0.1173  214 LYS A O   
1586 C CB  . LYS A 214 ? 0.7291 1.0591 0.4492 -0.2300 -0.1551 0.0620  214 LYS A CB  
1587 C CG  . LYS A 214 ? 0.9598 1.2866 0.6612 -0.2415 -0.1316 0.0362  214 LYS A CG  
1588 C CD  . LYS A 214 ? 1.1488 1.4931 0.8221 -0.2610 -0.1350 0.0233  214 LYS A CD  
1589 C CE  . LYS A 214 ? 1.3360 1.6772 0.9931 -0.2728 -0.1110 -0.0037 214 LYS A CE  
1590 N NZ  . LYS A 214 ? 1.5039 1.8621 1.1321 -0.2932 -0.1138 -0.0167 214 LYS A NZ  
1591 N N   . GLU A 215 ? 0.7175 1.0470 0.5045 -0.1960 -0.1922 0.1048  215 GLU A N   
1592 C CA  . GLU A 215 ? 0.7289 1.0630 0.5353 -0.1869 -0.2151 0.1297  215 GLU A CA  
1593 C C   . GLU A 215 ? 0.7760 1.0925 0.6154 -0.1678 -0.2110 0.1399  215 GLU A C   
1594 O O   . GLU A 215 ? 0.7785 1.0904 0.6205 -0.1640 -0.2238 0.1634  215 GLU A O   
1595 C CB  . GLU A 215 ? 0.7387 1.0910 0.5690 -0.1832 -0.2292 0.1257  215 GLU A CB  
1596 C CG  . GLU A 215 ? 0.9385 1.3117 0.7412 -0.2003 -0.2467 0.1298  215 GLU A CG  
1597 C CD  . GLU A 215 ? 1.2586 1.6499 1.0913 -0.1946 -0.2626 0.1287  215 GLU A CD  
1598 O OE1 . GLU A 215 ? 1.1206 1.5207 0.9558 -0.1992 -0.2548 0.1065  215 GLU A OE1 
1599 O OE2 . GLU A 215 ? 1.2859 1.6819 1.1429 -0.1847 -0.2820 0.1494  215 GLU A OE2 
1600 N N   . ILE A 216 ? 0.7228 1.0295 0.5877 -0.1561 -0.1937 0.1225  216 ILE A N   
1601 C CA  . ILE A 216 ? 0.7031 0.9930 0.5986 -0.1390 -0.1876 0.1285  216 ILE A CA  
1602 C C   . ILE A 216 ? 0.7633 1.0374 0.6378 -0.1428 -0.1791 0.1379  216 ILE A C   
1603 O O   . ILE A 216 ? 0.7689 1.0345 0.6550 -0.1352 -0.1873 0.1577  216 ILE A O   
1604 C CB  . ILE A 216 ? 0.7129 0.9971 0.6366 -0.1279 -0.1719 0.1075  216 ILE A CB  
1605 C CG1 . ILE A 216 ? 0.7100 1.0092 0.6591 -0.1229 -0.1819 0.1018  216 ILE A CG1 
1606 C CG2 . ILE A 216 ? 0.7099 0.9758 0.6594 -0.1126 -0.1634 0.1121  216 ILE A CG2 
1607 C CD1 . ILE A 216 ? 0.7919 1.0907 0.7505 -0.1215 -0.1666 0.0772  216 ILE A CD1 
1608 N N   . TYR A 217 ? 0.7243 0.9953 0.5682 -0.1554 -0.1633 0.1241  217 TYR A N   
1609 C CA  . TYR A 217 ? 0.7385 0.9961 0.5600 -0.1614 -0.1536 0.1309  217 TYR A CA  
1610 C C   . TYR A 217 ? 0.8122 1.0711 0.6136 -0.1687 -0.1708 0.1575  217 TYR A C   
1611 O O   . TYR A 217 ? 0.7989 1.0436 0.6031 -0.1642 -0.1694 0.1719  217 TYR A O   
1612 C CB  . TYR A 217 ? 0.7671 1.0251 0.5588 -0.1761 -0.1350 0.1106  217 TYR A CB  
1613 C CG  . TYR A 217 ? 0.8062 1.0486 0.5862 -0.1785 -0.1196 0.1119  217 TYR A CG  
1614 C CD1 . TYR A 217 ? 0.8046 1.0339 0.6081 -0.1670 -0.1035 0.1004  217 TYR A CD1 
1615 C CD2 . TYR A 217 ? 0.8520 1.0929 0.5977 -0.1926 -0.1219 0.1254  217 TYR A CD2 
1616 C CE1 . TYR A 217 ? 0.8207 1.0367 0.6161 -0.1691 -0.0901 0.1017  217 TYR A CE1 
1617 C CE2 . TYR A 217 ? 0.8685 1.0953 0.6052 -0.1951 -0.1075 0.1267  217 TYR A CE2 
1618 C CZ  . TYR A 217 ? 0.9478 1.1626 0.7106 -0.1831 -0.0916 0.1145  217 TYR A CZ  
1619 O OH  . TYR A 217 ? 0.9929 1.1950 0.7489 -0.1856 -0.0776 0.1151  217 TYR A OH  
1620 N N   . GLU A 218 ? 0.8018 1.0774 0.5837 -0.1799 -0.1877 0.1645  218 GLU A N   
1621 C CA  . GLU A 218 ? 0.8322 1.1107 0.5928 -0.1882 -0.2067 0.1911  218 GLU A CA  
1622 C C   . GLU A 218 ? 0.8583 1.1288 0.6534 -0.1713 -0.2212 0.2142  218 GLU A C   
1623 O O   . GLU A 218 ? 0.8773 1.1378 0.6611 -0.1735 -0.2273 0.2357  218 GLU A O   
1624 C CB  . GLU A 218 ? 0.8826 1.1823 0.6158 -0.2042 -0.2221 0.1920  218 GLU A CB  
1625 C CG  . GLU A 218 ? 1.0882 1.4017 0.8440 -0.1971 -0.2486 0.2085  218 GLU A CG  
1626 C CD  . GLU A 218 ? 1.3932 1.7288 1.1481 -0.2036 -0.2580 0.1959  218 GLU A CD  
1627 O OE1 . GLU A 218 ? 1.2692 1.6138 1.0601 -0.1913 -0.2722 0.2008  218 GLU A OE1 
1628 O OE2 . GLU A 218 ? 1.3505 1.6949 1.0703 -0.2214 -0.2510 0.1809  218 GLU A OE2 
1629 N N   . LEU A 219 ? 0.7779 1.0511 0.6161 -0.1545 -0.2242 0.2084  219 LEU A N   
1630 C CA  . LEU A 219 ? 0.7646 1.0306 0.6421 -0.1372 -0.2354 0.2260  219 LEU A CA  
1631 C C   . LEU A 219 ? 0.7972 1.0407 0.6888 -0.1272 -0.2197 0.2269  219 LEU A C   
1632 O O   . LEU A 219 ? 0.7921 1.0253 0.6973 -0.1202 -0.2285 0.2480  219 LEU A O   
1633 C CB  . LEU A 219 ? 0.7364 1.0141 0.6540 -0.1245 -0.2423 0.2177  219 LEU A CB  
1634 C CG  . LEU A 219 ? 0.8139 1.1138 0.7280 -0.1310 -0.2655 0.2265  219 LEU A CG  
1635 C CD1 . LEU A 219 ? 0.7918 1.1059 0.7294 -0.1262 -0.2638 0.2064  219 LEU A CD1 
1636 C CD2 . LEU A 219 ? 0.8339 1.1343 0.7693 -0.1230 -0.2886 0.2555  219 LEU A CD2 
1637 N N   . ALA A 220 ? 0.7340 0.9701 0.6214 -0.1276 -0.1970 0.2046  220 ALA A N   
1638 C CA  . ALA A 220 ? 0.7089 0.9252 0.6062 -0.1204 -0.1801 0.2014  220 ALA A CA  
1639 C C   . ALA A 220 ? 0.7739 0.9789 0.6420 -0.1305 -0.1784 0.2172  220 ALA A C   
1640 O O   . ALA A 220 ? 0.7616 0.9501 0.6437 -0.1229 -0.1720 0.2242  220 ALA A O   
1641 C CB  . ALA A 220 ? 0.6905 0.9048 0.5872 -0.1206 -0.1587 0.1741  220 ALA A CB  
1642 N N   . ARG A 221 ? 0.7528 0.9665 0.5798 -0.1486 -0.1834 0.2221  221 ARG A N   
1643 C CA  . ARG A 221 ? 0.7787 0.9830 0.5735 -0.1608 -0.1827 0.2383  221 ARG A CA  
1644 C C   . ARG A 221 ? 0.8473 1.0479 0.6538 -0.1552 -0.2046 0.2685  221 ARG A C   
1645 O O   . ARG A 221 ? 0.8459 1.0295 0.6606 -0.1503 -0.2023 0.2826  221 ARG A O   
1646 C CB  . ARG A 221 ? 0.8003 1.0168 0.5468 -0.1830 -0.1831 0.2346  221 ARG A CB  
1647 C CG  . ARG A 221 ? 0.8633 1.0848 0.5941 -0.1916 -0.1621 0.2052  221 ARG A CG  
1648 C CD  . ARG A 221 ? 0.8548 1.0900 0.5395 -0.2140 -0.1647 0.2023  221 ARG A CD  
1649 N NE  . ARG A 221 ? 0.8700 1.0980 0.5177 -0.2292 -0.1640 0.2182  221 ARG A NE  
1650 C CZ  . ARG A 221 ? 1.1277 1.3509 0.7472 -0.2430 -0.1440 0.2059  221 ARG A CZ  
1651 N NH1 . ARG A 221 ? 0.9696 1.1946 0.5952 -0.2428 -0.1236 0.1774  221 ARG A NH1 
1652 N NH2 . ARG A 221 ? 1.0766 1.2932 0.6624 -0.2573 -0.1441 0.2219  221 ARG A NH2 
1653 N N   . LYS A 222 ? 0.8126 1.0295 0.6215 -0.1561 -0.2262 0.2781  222 LYS A N   
1654 C CA  . LYS A 222 ? 0.8312 1.0494 0.6531 -0.1513 -0.2511 0.3070  222 LYS A CA  
1655 C C   . LYS A 222 ? 0.8643 1.0668 0.7322 -0.1314 -0.2518 0.3171  222 LYS A C   
1656 O O   . LYS A 222 ? 0.8742 1.0646 0.7426 -0.1304 -0.2610 0.3415  222 LYS A O   
1657 C CB  . LYS A 222 ? 0.8614 1.1024 0.6905 -0.1518 -0.2706 0.3071  222 LYS A CB  
1658 C CG  . LYS A 222 ? 1.0152 1.2612 0.8547 -0.1491 -0.2992 0.3377  222 LYS A CG  
1659 C CD  . LYS A 222 ? 1.1736 1.4445 1.0109 -0.1543 -0.3182 0.3368  222 LYS A CD  
1660 C CE  . LYS A 222 ? 1.4423 1.7192 1.2897 -0.1523 -0.3481 0.3683  222 LYS A CE  
1661 N NZ  . LYS A 222 ? 1.5991 1.9020 1.4371 -0.1611 -0.3680 0.3685  222 LYS A NZ  
1662 N N   . TYR A 223 ? 0.7816 0.9834 0.6868 -0.1164 -0.2411 0.2980  223 TYR A N   
1663 C CA  . TYR A 223 ? 0.7499 0.9381 0.7005 -0.0977 -0.2396 0.3030  223 TYR A CA  
1664 C C   . TYR A 223 ? 0.7747 0.9443 0.7298 -0.0936 -0.2157 0.2896  223 TYR A C   
1665 O O   . TYR A 223 ? 0.7489 0.9070 0.7409 -0.0789 -0.2113 0.2895  223 TYR A O   
1666 C CB  . TYR A 223 ? 0.7325 0.9334 0.7241 -0.0842 -0.2468 0.2940  223 TYR A CB  
1667 C CG  . TYR A 223 ? 0.7723 0.9898 0.7697 -0.0852 -0.2731 0.3119  223 TYR A CG  
1668 C CD1 . TYR A 223 ? 0.8055 1.0183 0.8340 -0.0746 -0.2901 0.3356  223 TYR A CD1 
1669 C CD2 . TYR A 223 ? 0.7962 1.0344 0.7686 -0.0974 -0.2814 0.3054  223 TYR A CD2 
1670 C CE1 . TYR A 223 ? 0.8364 1.0654 0.8723 -0.0753 -0.3158 0.3532  223 TYR A CE1 
1671 C CE2 . TYR A 223 ? 0.8306 1.0854 0.8079 -0.0992 -0.3069 0.3223  223 TYR A CE2 
1672 C CZ  . TYR A 223 ? 0.9236 1.1741 0.9331 -0.0879 -0.3247 0.3466  223 TYR A CZ  
1673 O OH  . TYR A 223 ? 0.9494 1.2172 0.9664 -0.0892 -0.3511 0.3640  223 TYR A OH  
1674 N N   . ASP A 224 ? 0.7400 0.9070 0.6581 -0.1072 -0.2006 0.2786  224 ASP A N   
1675 C CA  . ASP A 224 ? 0.7258 0.8774 0.6433 -0.1061 -0.1781 0.2653  224 ASP A CA  
1676 C C   . ASP A 224 ? 0.7234 0.8704 0.6796 -0.0902 -0.1665 0.2469  224 ASP A C   
1677 O O   . ASP A 224 ? 0.7172 0.8500 0.7009 -0.0791 -0.1636 0.2525  224 ASP A O   
1678 C CB  . ASP A 224 ? 0.7799 0.9135 0.6867 -0.1100 -0.1766 0.2848  224 ASP A CB  
1679 C CG  . ASP A 224 ? 0.9137 1.0328 0.8169 -0.1112 -0.1536 0.2712  224 ASP A CG  
1680 O OD1 . ASP A 224 ? 0.9181 1.0430 0.7998 -0.1201 -0.1394 0.2518  224 ASP A OD1 
1681 O OD2 . ASP A 224 ? 0.9534 1.0557 0.8766 -0.1033 -0.1500 0.2800  224 ASP A OD2 
1682 N N   . PHE A 225 ? 0.6374 0.7965 0.5957 -0.0898 -0.1605 0.2254  225 PHE A N   
1683 C CA  . PHE A 225 ? 0.5944 0.7497 0.5838 -0.0772 -0.1488 0.2071  225 PHE A CA  
1684 C C   . PHE A 225 ? 0.6325 0.7918 0.6056 -0.0834 -0.1324 0.1829  225 PHE A C   
1685 O O   . PHE A 225 ? 0.6367 0.8075 0.5816 -0.0956 -0.1331 0.1774  225 PHE A O   
1686 C CB  . PHE A 225 ? 0.5990 0.7630 0.6235 -0.0649 -0.1604 0.2075  225 PHE A CB  
1687 C CG  . PHE A 225 ? 0.6160 0.8004 0.6326 -0.0701 -0.1729 0.2053  225 PHE A CG  
1688 C CD1 . PHE A 225 ? 0.6299 0.8243 0.6422 -0.0727 -0.1644 0.1831  225 PHE A CD1 
1689 C CD2 . PHE A 225 ? 0.6449 0.8383 0.6616 -0.0719 -0.1940 0.2256  225 PHE A CD2 
1690 C CE1 . PHE A 225 ? 0.6416 0.8548 0.6477 -0.0781 -0.1756 0.1802  225 PHE A CE1 
1691 C CE2 . PHE A 225 ? 0.6841 0.8975 0.6947 -0.0772 -0.2062 0.2230  225 PHE A CE2 
1692 C CZ  . PHE A 225 ? 0.6466 0.8697 0.6520 -0.0804 -0.1965 0.1998  225 PHE A CZ  
1693 N N   . LEU A 226 ? 0.5708 0.7207 0.5624 -0.0752 -0.1177 0.1685  226 LEU A N   
1694 C CA  . LEU A 226 ? 0.5506 0.7021 0.5325 -0.0791 -0.1018 0.1459  226 LEU A CA  
1695 C C   . LEU A 226 ? 0.5471 0.7117 0.5377 -0.0768 -0.1033 0.1308  226 LEU A C   
1696 O O   . LEU A 226 ? 0.5264 0.6965 0.5397 -0.0685 -0.1136 0.1348  226 LEU A O   
1697 C CB  . LEU A 226 ? 0.5305 0.6669 0.5284 -0.0719 -0.0869 0.1377  226 LEU A CB  
1698 C CG  . LEU A 226 ? 0.6053 0.7279 0.5953 -0.0751 -0.0826 0.1500  226 LEU A CG  
1699 C CD1 . LEU A 226 ? 0.5947 0.7046 0.6025 -0.0680 -0.0688 0.1398  226 LEU A CD1 
1700 C CD2 . LEU A 226 ? 0.6217 0.7471 0.5754 -0.0906 -0.0777 0.1508  226 LEU A CD2 
1701 N N   . ILE A 227 ? 0.4775 0.6474 0.4511 -0.0845 -0.0929 0.1135  227 ILE A N   
1702 C CA  . ILE A 227 ? 0.4615 0.6421 0.4430 -0.0829 -0.0927 0.0981  227 ILE A CA  
1703 C C   . ILE A 227 ? 0.4874 0.6597 0.4809 -0.0775 -0.0768 0.0804  227 ILE A C   
1704 O O   . ILE A 227 ? 0.4819 0.6490 0.4612 -0.0833 -0.0646 0.0723  227 ILE A O   
1705 C CB  . ILE A 227 ? 0.5191 0.7144 0.4734 -0.0965 -0.0962 0.0926  227 ILE A CB  
1706 C CG1 . ILE A 227 ? 0.5519 0.7572 0.4960 -0.1015 -0.1152 0.1115  227 ILE A CG1 
1707 C CG2 . ILE A 227 ? 0.5035 0.7073 0.4680 -0.0947 -0.0928 0.0741  227 ILE A CG2 
1708 C CD1 . ILE A 227 ? 0.6422 0.8620 0.5530 -0.1179 -0.1193 0.1078  227 ILE A CD1 
1709 N N   . ILE A 228 ? 0.4217 0.5928 0.4422 -0.0666 -0.0772 0.0747  228 ILE A N   
1710 C CA  . ILE A 228 ? 0.4006 0.5639 0.4327 -0.0615 -0.0639 0.0590  228 ILE A CA  
1711 C C   . ILE A 228 ? 0.4699 0.6426 0.5001 -0.0645 -0.0615 0.0435  228 ILE A C   
1712 O O   . ILE A 228 ? 0.4615 0.6405 0.5074 -0.0597 -0.0676 0.0417  228 ILE A O   
1713 C CB  . ILE A 228 ? 0.4065 0.5591 0.4661 -0.0492 -0.0624 0.0615  228 ILE A CB  
1714 C CG1 . ILE A 228 ? 0.4081 0.5502 0.4681 -0.0477 -0.0634 0.0761  228 ILE A CG1 
1715 C CG2 . ILE A 228 ? 0.3778 0.5234 0.4455 -0.0457 -0.0498 0.0454  228 ILE A CG2 
1716 C CD1 . ILE A 228 ? 0.4485 0.5808 0.5352 -0.0368 -0.0634 0.0803  228 ILE A CD1 
1717 N N   . GLU A 229 ? 0.4226 0.5965 0.4339 -0.0732 -0.0523 0.0325  229 GLU A N   
1718 C CA  . GLU A 229 ? 0.4122 0.5934 0.4195 -0.0777 -0.0482 0.0168  229 GLU A CA  
1719 C C   . GLU A 229 ? 0.4423 0.6149 0.4663 -0.0707 -0.0380 0.0038  229 GLU A C   
1720 O O   . GLU A 229 ? 0.4218 0.5878 0.4412 -0.0726 -0.0270 -0.0045 229 GLU A O   
1721 C CB  . GLU A 229 ? 0.4443 0.6305 0.4248 -0.0908 -0.0425 0.0106  229 GLU A CB  
1722 C CG  . GLU A 229 ? 0.5195 0.7138 0.4951 -0.0969 -0.0386 -0.0056 229 GLU A CG  
1723 C CD  . GLU A 229 ? 0.6885 0.8913 0.6365 -0.1116 -0.0360 -0.0106 229 GLU A CD  
1724 O OE1 . GLU A 229 ? 0.6486 0.8635 0.5878 -0.1184 -0.0432 -0.0132 229 GLU A OE1 
1725 O OE2 . GLU A 229 ? 0.5212 0.7190 0.4565 -0.1171 -0.0263 -0.0132 229 GLU A OE2 
1726 N N   . ASP A 230 ? 0.4017 0.5746 0.4455 -0.0629 -0.0417 0.0024  230 ASP A N   
1727 C CA  . ASP A 230 ? 0.3949 0.5598 0.4531 -0.0571 -0.0334 -0.0087 230 ASP A CA  
1728 C C   . ASP A 230 ? 0.4868 0.6585 0.5406 -0.0625 -0.0306 -0.0221 230 ASP A C   
1729 O O   . ASP A 230 ? 0.4954 0.6746 0.5568 -0.0619 -0.0364 -0.0235 230 ASP A O   
1730 C CB  . ASP A 230 ? 0.4036 0.5648 0.4837 -0.0474 -0.0373 -0.0040 230 ASP A CB  
1731 C CG  . ASP A 230 ? 0.5494 0.7009 0.6419 -0.0421 -0.0292 -0.0135 230 ASP A CG  
1732 O OD1 . ASP A 230 ? 0.5874 0.7327 0.6739 -0.0440 -0.0209 -0.0211 230 ASP A OD1 
1733 O OD2 . ASP A 230 ? 0.5645 0.7148 0.6733 -0.0362 -0.0311 -0.0130 230 ASP A OD2 
1734 N N   . ASP A 231 ? 0.4447 0.6140 0.4874 -0.0683 -0.0214 -0.0322 231 ASP A N   
1735 C CA  . ASP A 231 ? 0.4423 0.6169 0.4797 -0.0748 -0.0173 -0.0458 231 ASP A CA  
1736 C C   . ASP A 231 ? 0.4962 0.6610 0.5450 -0.0712 -0.0075 -0.0578 231 ASP A C   
1737 O O   . ASP A 231 ? 0.5095 0.6715 0.5527 -0.0754 0.0012  -0.0667 231 ASP A O   
1738 C CB  . ASP A 231 ? 0.4809 0.6623 0.4962 -0.0861 -0.0146 -0.0487 231 ASP A CB  
1739 C CG  . ASP A 231 ? 0.6092 0.8040 0.6121 -0.0958 -0.0193 -0.0539 231 ASP A CG  
1740 O OD1 . ASP A 231 ? 0.6136 0.8129 0.6269 -0.0939 -0.0237 -0.0574 231 ASP A OD1 
1741 O OD2 . ASP A 231 ? 0.6594 0.8603 0.6417 -0.1062 -0.0179 -0.0553 231 ASP A OD2 
1742 N N   . PRO A 232 ? 0.4392 0.5986 0.5042 -0.0639 -0.0084 -0.0584 232 PRO A N   
1743 C CA  . PRO A 232 ? 0.4198 0.5692 0.4936 -0.0614 -0.0003 -0.0681 232 PRO A CA  
1744 C C   . PRO A 232 ? 0.4606 0.6134 0.5335 -0.0670 0.0031  -0.0804 232 PRO A C   
1745 O O   . PRO A 232 ? 0.4412 0.5862 0.5188 -0.0669 0.0106  -0.0890 232 PRO A O   
1746 C CB  . PRO A 232 ? 0.4331 0.5756 0.5214 -0.0531 -0.0028 -0.0632 232 PRO A CB  
1747 C CG  . PRO A 232 ? 0.4954 0.6453 0.5856 -0.0511 -0.0116 -0.0528 232 PRO A CG  
1748 C CD  . PRO A 232 ? 0.4555 0.6174 0.5320 -0.0583 -0.0164 -0.0506 232 PRO A CD  
1749 N N   . TYR A 233 ? 0.4422 0.6067 0.5104 -0.0721 -0.0027 -0.0812 233 TYR A N   
1750 C CA  . TYR A 233 ? 0.4377 0.6066 0.5049 -0.0786 0.0000  -0.0932 233 TYR A CA  
1751 C C   . TYR A 233 ? 0.4856 0.6630 0.5363 -0.0891 0.0026  -0.1003 233 TYR A C   
1752 O O   . TYR A 233 ? 0.4794 0.6637 0.5269 -0.0962 0.0031  -0.1096 233 TYR A O   
1753 C CB  . TYR A 233 ? 0.4441 0.6209 0.5191 -0.0783 -0.0073 -0.0918 233 TYR A CB  
1754 C CG  . TYR A 233 ? 0.4416 0.6114 0.5316 -0.0691 -0.0095 -0.0847 233 TYR A CG  
1755 C CD1 . TYR A 233 ? 0.4553 0.6313 0.5501 -0.0650 -0.0179 -0.0736 233 TYR A CD1 
1756 C CD2 . TYR A 233 ? 0.4480 0.6047 0.5474 -0.0648 -0.0029 -0.0889 233 TYR A CD2 
1757 C CE1 . TYR A 233 ? 0.4551 0.6247 0.5641 -0.0572 -0.0184 -0.0688 233 TYR A CE1 
1758 C CE2 . TYR A 233 ? 0.4555 0.6059 0.5660 -0.0578 -0.0041 -0.0832 233 TYR A CE2 
1759 C CZ  . TYR A 233 ? 0.5530 0.7099 0.6684 -0.0542 -0.0110 -0.0740 233 TYR A CZ  
1760 O OH  . TYR A 233 ? 0.5383 0.6891 0.6653 -0.0482 -0.0107 -0.0701 233 TYR A OH  
1761 N N   . TYR A 234 ? 0.4561 0.6328 0.4959 -0.0910 0.0054  -0.0968 234 TYR A N   
1762 C CA  . TYR A 234 ? 0.4767 0.6607 0.4984 -0.1021 0.0095  -0.1036 234 TYR A CA  
1763 C C   . TYR A 234 ? 0.5566 0.7373 0.5817 -0.1072 0.0206  -0.1212 234 TYR A C   
1764 O O   . TYR A 234 ? 0.5653 0.7546 0.5782 -0.1179 0.0227  -0.1307 234 TYR A O   
1765 C CB  . TYR A 234 ? 0.4918 0.6733 0.5035 -0.1027 0.0123  -0.0967 234 TYR A CB  
1766 C CG  . TYR A 234 ? 0.5336 0.7216 0.5262 -0.1151 0.0191  -0.1053 234 TYR A CG  
1767 C CD1 . TYR A 234 ? 0.5809 0.7822 0.5536 -0.1257 0.0126  -0.1038 234 TYR A CD1 
1768 C CD2 . TYR A 234 ? 0.5406 0.7222 0.5360 -0.1171 0.0324  -0.1165 234 TYR A CD2 
1769 C CE1 . TYR A 234 ? 0.5989 0.8064 0.5519 -0.1390 0.0199  -0.1134 234 TYR A CE1 
1770 C CE2 . TYR A 234 ? 0.5724 0.7602 0.5512 -0.1296 0.0407  -0.1270 234 TYR A CE2 
1771 C CZ  . TYR A 234 ? 0.6769 0.8775 0.6330 -0.1410 0.0348  -0.1257 234 TYR A CZ  
1772 O OH  . TYR A 234 ? 0.7147 0.9217 0.6517 -0.1549 0.0435  -0.1366 234 TYR A OH  
1773 N N   . PHE A 235 ? 0.5266 0.6944 0.5687 -0.0998 0.0272  -0.1253 235 PHE A N   
1774 C CA  . PHE A 235 ? 0.5422 0.7036 0.5931 -0.1022 0.0375  -0.1404 235 PHE A CA  
1775 C C   . PHE A 235 ? 0.6368 0.7960 0.6985 -0.1010 0.0355  -0.1452 235 PHE A C   
1776 O O   . PHE A 235 ? 0.6457 0.7957 0.7196 -0.1001 0.0430  -0.1548 235 PHE A O   
1777 C CB  . PHE A 235 ? 0.5569 0.7056 0.6216 -0.0949 0.0447  -0.1410 235 PHE A CB  
1778 C CG  . PHE A 235 ? 0.5913 0.7421 0.6474 -0.0973 0.0493  -0.1393 235 PHE A CG  
1779 C CD1 . PHE A 235 ? 0.6431 0.7994 0.6898 -0.1074 0.0585  -0.1513 235 PHE A CD1 
1780 C CD2 . PHE A 235 ? 0.6176 0.7648 0.6751 -0.0905 0.0453  -0.1266 235 PHE A CD2 
1781 C CE1 . PHE A 235 ? 0.6568 0.8150 0.6954 -0.1106 0.0639  -0.1501 235 PHE A CE1 
1782 C CE2 . PHE A 235 ? 0.6571 0.8059 0.7072 -0.0934 0.0502  -0.1252 235 PHE A CE2 
1783 C CZ  . PHE A 235 ? 0.6439 0.7983 0.6845 -0.1035 0.0595  -0.1368 235 PHE A CZ  
1784 N N   . LEU A 236 ? 0.6050 0.7726 0.6637 -0.1012 0.0256  -0.1383 236 LEU A N   
1785 C CA  . LEU A 236 ? 0.5940 0.7613 0.6624 -0.1013 0.0237  -0.1427 236 LEU A CA  
1786 C C   . LEU A 236 ? 0.6744 0.8579 0.7324 -0.1104 0.0170  -0.1453 236 LEU A C   
1787 O O   . LEU A 236 ? 0.6690 0.8565 0.7346 -0.1098 0.0117  -0.1443 236 LEU A O   
1788 C CB  . LEU A 236 ? 0.5731 0.7329 0.6545 -0.0911 0.0189  -0.1323 236 LEU A CB  
1789 C CG  . LEU A 236 ? 0.6169 0.7597 0.7111 -0.0840 0.0253  -0.1331 236 LEU A CG  
1790 C CD1 . LEU A 236 ? 0.6169 0.7541 0.7104 -0.0776 0.0253  -0.1244 236 LEU A CD1 
1791 C CD2 . LEU A 236 ? 0.6283 0.7652 0.7334 -0.0793 0.0224  -0.1293 236 LEU A CD2 
1792 N N   . GLN A 237 ? 0.6644 0.8578 0.7050 -0.1196 0.0175  -0.1490 237 GLN A N   
1793 C CA  . GLN A 237 ? 0.6806 0.8905 0.7081 -0.1301 0.0107  -0.1518 237 GLN A CA  
1794 C C   . GLN A 237 ? 0.7306 0.9404 0.7624 -0.1378 0.0177  -0.1690 237 GLN A C   
1795 O O   . GLN A 237 ? 0.7245 0.9254 0.7586 -0.1403 0.0297  -0.1811 237 GLN A O   
1796 C CB  . GLN A 237 ? 0.7158 0.9349 0.7202 -0.1388 0.0096  -0.1499 237 GLN A CB  
1797 C CG  . GLN A 237 ? 0.7747 0.9952 0.7738 -0.1326 0.0009  -0.1315 237 GLN A CG  
1798 C CD  . GLN A 237 ? 0.9678 1.1969 0.9421 -0.1425 -0.0005 -0.1286 237 GLN A CD  
1799 O OE1 . GLN A 237 ? 0.9956 1.2185 0.9646 -0.1402 0.0035  -0.1229 237 GLN A OE1 
1800 N NE2 . GLN A 237 ? 0.7497 0.9935 0.7075 -0.1546 -0.0065 -0.1321 237 GLN A NE2 
1801 N N   . PHE A 238 ? 0.6943 0.9138 0.7297 -0.1411 0.0104  -0.1702 238 PHE A N   
1802 C CA  . PHE A 238 ? 0.6970 0.9158 0.7386 -0.1483 0.0168  -0.1862 238 PHE A CA  
1803 C C   . PHE A 238 ? 0.8109 1.0411 0.8354 -0.1631 0.0194  -0.1993 238 PHE A C   
1804 O O   . PHE A 238 ? 0.8305 1.0550 0.8591 -0.1692 0.0302  -0.2155 238 PHE A O   
1805 C CB  . PHE A 238 ? 0.6987 0.9211 0.7549 -0.1455 0.0100  -0.1836 238 PHE A CB  
1806 C CG  . PHE A 238 ? 0.6881 0.8968 0.7616 -0.1324 0.0107  -0.1741 238 PHE A CG  
1807 C CD1 . PHE A 238 ? 0.7065 0.9211 0.7873 -0.1259 0.0006  -0.1614 238 PHE A CD1 
1808 C CD2 . PHE A 238 ? 0.6980 0.8879 0.7807 -0.1270 0.0212  -0.1780 238 PHE A CD2 
1809 C CE1 . PHE A 238 ? 0.7009 0.9028 0.7955 -0.1153 0.0023  -0.1540 238 PHE A CE1 
1810 C CE2 . PHE A 238 ? 0.7162 0.8938 0.8117 -0.1163 0.0211  -0.1689 238 PHE A CE2 
1811 C CZ  . PHE A 238 ? 0.6847 0.8683 0.7848 -0.1110 0.0122  -0.1575 238 PHE A CZ  
1812 N N   . ASN A 239 ? 0.7824 1.0283 0.7876 -0.1698 0.0098  -0.1927 239 ASN A N   
1813 C CA  . ASN A 239 ? 0.8005 1.0587 0.7867 -0.1859 0.0115  -0.2057 239 ASN A CA  
1814 C C   . ASN A 239 ? 0.8253 1.0839 0.7905 -0.1938 0.0189  -0.2102 239 ASN A C   
1815 O O   . ASN A 239 ? 0.8016 1.0576 0.7599 -0.1884 0.0168  -0.1975 239 ASN A O   
1816 C CB  . ASN A 239 ? 0.8739 1.1516 0.8538 -0.1932 -0.0031 -0.2023 239 ASN A CB  
1817 C CG  . ASN A 239 ? 1.2625 1.5387 1.2659 -0.1878 -0.0056 -0.2041 239 ASN A CG  
1818 O OD1 . ASN A 239 ? 1.2150 1.4930 1.2313 -0.1780 -0.0152 -0.1902 239 ASN A OD1 
1819 N ND2 . ASN A 239 ? 1.1724 1.4409 1.1850 -0.1923 0.0058  -0.2211 239 ASN A ND2 
1820 N N   . SER A 240 ? 0.7897 1.0507 0.7467 -0.2070 0.0293  -0.2299 240 SER A N   
1821 C CA  . SER A 240 ? 0.7995 1.0616 0.7375 -0.2189 0.0409  -0.2424 240 SER A CA  
1822 C C   . SER A 240 ? 0.8363 1.1050 0.7507 -0.2219 0.0358  -0.2298 240 SER A C   
1823 O O   . SER A 240 ? 0.8531 1.1373 0.7468 -0.2301 0.0227  -0.2213 240 SER A O   
1824 C CB  . SER A 240 ? 0.8681 1.1410 0.7938 -0.2364 0.0447  -0.2617 240 SER A CB  
1825 O OG  . SER A 240 ? 1.0198 1.3005 0.9176 -0.2507 0.0501  -0.2685 240 SER A OG  
1826 N N   . GLY A 241 ? 0.7537 1.0104 0.6716 -0.2161 0.0465  -0.2291 241 GLY A N   
1827 C CA  . GLY A 241 ? 0.7401 0.9995 0.6384 -0.2180 0.0449  -0.2177 241 GLY A CA  
1828 C C   . GLY A 241 ? 0.7176 0.9774 0.6190 -0.2059 0.0292  -0.1932 241 GLY A C   
1829 O O   . GLY A 241 ? 0.7150 0.9859 0.6122 -0.2066 0.0136  -0.1828 241 GLY A O   
1830 N N   . ARG A 242 ? 0.6121 0.8604 0.5217 -0.1955 0.0337  -0.1843 242 ARG A N   
1831 C CA  . ARG A 242 ? 0.5733 0.8193 0.4875 -0.1836 0.0217  -0.1622 242 ARG A CA  
1832 C C   . ARG A 242 ? 0.6045 0.8626 0.4914 -0.1920 0.0101  -0.1481 242 ARG A C   
1833 O O   . ARG A 242 ? 0.6093 0.8728 0.4718 -0.2056 0.0159  -0.1540 242 ARG A O   
1834 C CB  . ARG A 242 ? 0.5410 0.7715 0.4706 -0.1720 0.0310  -0.1591 242 ARG A CB  
1835 C CG  . ARG A 242 ? 0.6130 0.8307 0.5705 -0.1626 0.0399  -0.1697 242 ARG A CG  
1836 C CD  . ARG A 242 ? 0.6915 0.8951 0.6644 -0.1522 0.0484  -0.1676 242 ARG A CD  
1837 N NE  . ARG A 242 ? 0.7939 0.9987 0.7524 -0.1594 0.0573  -0.1704 242 ARG A NE  
1838 C CZ  . ARG A 242 ? 0.9171 1.1181 0.8793 -0.1647 0.0727  -0.1868 242 ARG A CZ  
1839 N NH1 . ARG A 242 ? 0.7224 0.9169 0.7036 -0.1627 0.0807  -0.2013 242 ARG A NH1 
1840 N NH2 . ARG A 242 ? 0.7437 0.9469 0.6922 -0.1719 0.0809  -0.1888 242 ARG A NH2 
1841 N N   . VAL A 243 ? 0.5466 0.8090 0.4381 -0.1844 -0.0064 -0.1296 243 VAL A N   
1842 C CA  . VAL A 243 ? 0.5623 0.8356 0.4329 -0.1899 -0.0210 -0.1124 243 VAL A CA  
1843 C C   . VAL A 243 ? 0.6339 0.8985 0.4959 -0.1873 -0.0167 -0.1014 243 VAL A C   
1844 O O   . VAL A 243 ? 0.6188 0.8702 0.5011 -0.1742 -0.0110 -0.0985 243 VAL A O   
1845 C CB  . VAL A 243 ? 0.5935 0.8726 0.4806 -0.1799 -0.0390 -0.0968 243 VAL A CB  
1846 C CG1 . VAL A 243 ? 0.6096 0.9015 0.4775 -0.1861 -0.0564 -0.0789 243 VAL A CG1 
1847 C CG2 . VAL A 243 ? 0.5791 0.8640 0.4822 -0.1796 -0.0407 -0.1086 243 VAL A CG2 
1848 N N   . PRO A 244 ? 0.6136 0.8851 0.4456 -0.1998 -0.0198 -0.0944 244 PRO A N   
1849 C CA  . PRO A 244 ? 0.6055 0.8681 0.4302 -0.1975 -0.0156 -0.0830 244 PRO A CA  
1850 C C   . PRO A 244 ? 0.6158 0.8714 0.4605 -0.1813 -0.0267 -0.0631 244 PRO A C   
1851 O O   . PRO A 244 ? 0.6143 0.8770 0.4665 -0.1767 -0.0424 -0.0521 244 PRO A O   
1852 C CB  . PRO A 244 ? 0.6630 0.9363 0.4505 -0.2148 -0.0214 -0.0761 244 PRO A CB  
1853 C CG  . PRO A 244 ? 0.7399 1.0262 0.5138 -0.2282 -0.0221 -0.0908 244 PRO A CG  
1854 C CD  . PRO A 244 ? 0.6625 0.9500 0.4650 -0.2172 -0.0277 -0.0956 244 PRO A CD  
1855 N N   . THR A 245 ? 0.5379 0.7802 0.3934 -0.1727 -0.0180 -0.0598 245 THR A N   
1856 C CA  . THR A 245 ? 0.5034 0.7371 0.3791 -0.1575 -0.0255 -0.0433 245 THR A CA  
1857 C C   . THR A 245 ? 0.5559 0.7904 0.4147 -0.1607 -0.0351 -0.0228 245 THR A C   
1858 O O   . THR A 245 ? 0.5711 0.8099 0.4019 -0.1745 -0.0323 -0.0223 245 THR A O   
1859 C CB  . THR A 245 ? 0.5311 0.7500 0.4275 -0.1471 -0.0116 -0.0506 245 THR A CB  
1860 O OG1 . THR A 245 ? 0.4939 0.7090 0.3751 -0.1552 0.0008  -0.0550 245 THR A OG1 
1861 C CG2 . THR A 245 ? 0.4466 0.6626 0.3626 -0.1423 -0.0037 -0.0681 245 THR A CG2 
1862 N N   . PHE A 246 ? 0.5143 0.7437 0.3905 -0.1482 -0.0457 -0.0061 246 PHE A N   
1863 C CA  . PHE A 246 ? 0.5307 0.7579 0.3964 -0.1489 -0.0550 0.0151  246 PHE A CA  
1864 C C   . PHE A 246 ? 0.6301 0.8481 0.4813 -0.1546 -0.0418 0.0146  246 PHE A C   
1865 O O   . PHE A 246 ? 0.6481 0.8683 0.4742 -0.1651 -0.0455 0.0257  246 PHE A O   
1866 C CB  . PHE A 246 ? 0.5234 0.7443 0.4169 -0.1329 -0.0650 0.0295  246 PHE A CB  
1867 C CG  . PHE A 246 ? 0.5338 0.7664 0.4348 -0.1307 -0.0830 0.0391  246 PHE A CG  
1868 C CD1 . PHE A 246 ? 0.5323 0.7668 0.4608 -0.1202 -0.0858 0.0331  246 PHE A CD1 
1869 C CD2 . PHE A 246 ? 0.5775 0.8199 0.4577 -0.1400 -0.0973 0.0538  246 PHE A CD2 
1870 C CE1 . PHE A 246 ? 0.5413 0.7880 0.4793 -0.1183 -0.1019 0.0409  246 PHE A CE1 
1871 C CE2 . PHE A 246 ? 0.6098 0.8645 0.4996 -0.1377 -0.1150 0.0627  246 PHE A CE2 
1872 C CZ  . PHE A 246 ? 0.5567 0.8139 0.4766 -0.1267 -0.1169 0.0557  246 PHE A CZ  
1873 N N   . LEU A 247 ? 0.6010 0.8091 0.4678 -0.1484 -0.0266 0.0014  247 LEU A N   
1874 C CA  . LEU A 247 ? 0.6114 0.8113 0.4706 -0.1528 -0.0120 -0.0026 247 LEU A CA  
1875 C C   . LEU A 247 ? 0.7046 0.9124 0.5329 -0.1711 -0.0035 -0.0122 247 LEU A C   
1876 O O   . LEU A 247 ? 0.7149 0.9196 0.5255 -0.1794 0.0024  -0.0069 247 LEU A O   
1877 C CB  . LEU A 247 ? 0.5836 0.7744 0.4690 -0.1425 0.0008  -0.0168 247 LEU A CB  
1878 C CG  . LEU A 247 ? 0.6530 0.8373 0.5364 -0.1465 0.0175  -0.0257 247 LEU A CG  
1879 C CD1 . LEU A 247 ? 0.6607 0.8364 0.5432 -0.1440 0.0165  -0.0099 247 LEU A CD1 
1880 C CD2 . LEU A 247 ? 0.6650 0.8434 0.5738 -0.1378 0.0280  -0.0418 247 LEU A CD2 
1881 N N   . SER A 248 ? 0.6788 0.8967 0.5003 -0.1783 -0.0024 -0.0267 248 SER A N   
1882 C CA  . SER A 248 ? 0.7091 0.9353 0.5014 -0.1968 0.0065  -0.0389 248 SER A CA  
1883 C C   . SER A 248 ? 0.8049 1.0383 0.5632 -0.2103 -0.0041 -0.0229 248 SER A C   
1884 O O   . SER A 248 ? 0.8338 1.0699 0.5650 -0.2260 0.0055  -0.0281 248 SER A O   
1885 C CB  . SER A 248 ? 0.7494 0.9840 0.5445 -0.2007 0.0092  -0.0578 248 SER A CB  
1886 O OG  . SER A 248 ? 0.9025 1.1489 0.6864 -0.2053 -0.0073 -0.0506 248 SER A OG  
1887 N N   . MET A 249 ? 0.7721 1.0086 0.5327 -0.2046 -0.0239 -0.0033 249 MET A N   
1888 C CA  . MET A 249 ? 0.8068 1.0498 0.5382 -0.2156 -0.0381 0.0159  249 MET A CA  
1889 C C   . MET A 249 ? 0.8428 1.0746 0.5774 -0.2088 -0.0441 0.0389  249 MET A C   
1890 O O   . MET A 249 ? 0.8538 1.0891 0.5706 -0.2144 -0.0593 0.0591  249 MET A O   
1891 C CB  . MET A 249 ? 0.8423 1.0989 0.5735 -0.2159 -0.0576 0.0218  249 MET A CB  
1892 C CG  . MET A 249 ? 0.8601 1.1138 0.6288 -0.1963 -0.0684 0.0288  249 MET A CG  
1893 S SD  . MET A 249 ? 0.9196 1.1907 0.6927 -0.1967 -0.0896 0.0331  249 MET A SD  
1894 C CE  . MET A 249 ? 0.8635 1.1404 0.6408 -0.2014 -0.0750 0.0024  249 MET A CE  
1895 N N   . ASP A 250 ? 0.7705 0.9889 0.5279 -0.1975 -0.0324 0.0358  250 ASP A N   
1896 C CA  . ASP A 250 ? 0.7698 0.9762 0.5345 -0.1902 -0.0360 0.0550  250 ASP A CA  
1897 C C   . ASP A 250 ? 0.8505 1.0525 0.5856 -0.2045 -0.0282 0.0621  250 ASP A C   
1898 O O   . ASP A 250 ? 0.8483 1.0412 0.5891 -0.2039 -0.0125 0.0552  250 ASP A O   
1899 C CB  . ASP A 250 ? 0.7561 0.9508 0.5579 -0.1722 -0.0294 0.0503  250 ASP A CB  
1900 C CG  . ASP A 250 ? 0.8949 1.0773 0.7087 -0.1633 -0.0348 0.0698  250 ASP A CG  
1901 O OD1 . ASP A 250 ? 0.9111 1.0944 0.7135 -0.1659 -0.0494 0.0904  250 ASP A OD1 
1902 O OD2 . ASP A 250 ? 0.9545 1.1263 0.7902 -0.1535 -0.0251 0.0648  250 ASP A OD2 
1903 N N   . VAL A 251 ? 0.8258 1.0345 0.5298 -0.2176 -0.0400 0.0767  251 VAL A N   
1904 C CA  . VAL A 251 ? 0.8550 1.0608 0.5250 -0.2339 -0.0351 0.0861  251 VAL A CA  
1905 C C   . VAL A 251 ? 0.9058 1.0962 0.5862 -0.2261 -0.0370 0.1061  251 VAL A C   
1906 O O   . VAL A 251 ? 0.9181 1.1012 0.5840 -0.2350 -0.0236 0.1059  251 VAL A O   
1907 C CB  . VAL A 251 ? 0.9343 1.1527 0.5675 -0.2502 -0.0502 0.0972  251 VAL A CB  
1908 C CG1 . VAL A 251 ? 0.9740 1.1887 0.5687 -0.2680 -0.0477 0.1110  251 VAL A CG1 
1909 C CG2 . VAL A 251 ? 0.9313 1.1642 0.5525 -0.2602 -0.0448 0.0744  251 VAL A CG2 
1910 N N   . ASP A 252 ? 0.8338 1.0193 0.5412 -0.2098 -0.0525 0.1218  252 ASP A N   
1911 C CA  . ASP A 252 ? 0.8232 0.9939 0.5448 -0.2008 -0.0570 0.1417  252 ASP A CA  
1912 C C   . ASP A 252 ? 0.8389 0.9975 0.5935 -0.1867 -0.0435 0.1319  252 ASP A C   
1913 O O   . ASP A 252 ? 0.8476 0.9932 0.6079 -0.1838 -0.0413 0.1442  252 ASP A O   
1914 C CB  . ASP A 252 ? 0.8394 1.0111 0.5765 -0.1901 -0.0804 0.1629  252 ASP A CB  
1915 C CG  . ASP A 252 ? 0.9338 1.1186 0.6438 -0.2016 -0.0984 0.1755  252 ASP A CG  
1916 O OD1 . ASP A 252 ? 0.9414 1.1351 0.6162 -0.2196 -0.0927 0.1674  252 ASP A OD1 
1917 O OD2 . ASP A 252 ? 1.0035 1.1901 0.7283 -0.1930 -0.1180 0.1931  252 ASP A OD2 
1918 N N   . GLY A 253 ? 0.7517 0.9140 0.5282 -0.1780 -0.0359 0.1113  253 GLY A N   
1919 C CA  . GLY A 253 ? 0.7141 0.8660 0.5224 -0.1644 -0.0255 0.1024  253 GLY A CA  
1920 C C   . GLY A 253 ? 0.7408 0.8869 0.5792 -0.1475 -0.0387 0.1144  253 GLY A C   
1921 O O   . GLY A 253 ? 0.7282 0.8617 0.5841 -0.1393 -0.0364 0.1217  253 GLY A O   
1922 N N   . ARG A 254 ? 0.6816 0.8373 0.5261 -0.1430 -0.0525 0.1164  254 ARG A N   
1923 C CA  . ARG A 254 ? 0.6438 0.7968 0.5179 -0.1277 -0.0655 0.1263  254 ARG A CA  
1924 C C   . ARG A 254 ? 0.6254 0.7832 0.5239 -0.1173 -0.0630 0.1090  254 ARG A C   
1925 O O   . ARG A 254 ? 0.6217 0.7795 0.5445 -0.1057 -0.0728 0.1145  254 ARG A O   
1926 C CB  . ARG A 254 ? 0.6536 0.8132 0.5187 -0.1303 -0.0857 0.1469  254 ARG A CB  
1927 C CG  . ARG A 254 ? 0.7326 0.9092 0.5748 -0.1414 -0.0931 0.1422  254 ARG A CG  
1928 C CD  . ARG A 254 ? 0.8321 1.0161 0.6714 -0.1420 -0.1154 0.1635  254 ARG A CD  
1929 N NE  . ARG A 254 ? 0.8997 1.0775 0.7157 -0.1511 -0.1221 0.1854  254 ARG A NE  
1930 C CZ  . ARG A 254 ? 0.9708 1.1366 0.8027 -0.1429 -0.1299 0.2056  254 ARG A CZ  
1931 N NH1 . ARG A 254 ? 0.7554 0.9144 0.6267 -0.1254 -0.1311 0.2053  254 ARG A NH1 
1932 N NH2 . ARG A 254 ? 0.7127 0.8726 0.5209 -0.1526 -0.1359 0.2258  254 ARG A NH2 
1933 N N   . VAL A 255 ? 0.5346 0.6958 0.4281 -0.1215 -0.0494 0.0884  255 VAL A N   
1934 C CA  . VAL A 255 ? 0.4993 0.6643 0.4128 -0.1134 -0.0464 0.0718  255 VAL A CA  
1935 C C   . VAL A 255 ? 0.5372 0.6919 0.4707 -0.1052 -0.0326 0.0594  255 VAL A C   
1936 O O   . VAL A 255 ? 0.5416 0.6922 0.4662 -0.1110 -0.0199 0.0522  255 VAL A O   
1937 C CB  . VAL A 255 ? 0.5431 0.7217 0.4384 -0.1239 -0.0450 0.0582  255 VAL A CB  
1938 C CG1 . VAL A 255 ? 0.5167 0.6978 0.4323 -0.1164 -0.0407 0.0410  255 VAL A CG1 
1939 C CG2 . VAL A 255 ? 0.5606 0.7508 0.4394 -0.1310 -0.0613 0.0709  255 VAL A CG2 
1940 N N   . ILE A 256 ? 0.4636 0.6148 0.4241 -0.0922 -0.0353 0.0568  256 ILE A N   
1941 C CA  . ILE A 256 ? 0.4321 0.5749 0.4121 -0.0842 -0.0248 0.0449  256 ILE A CA  
1942 C C   . ILE A 256 ? 0.4711 0.6204 0.4595 -0.0815 -0.0238 0.0302  256 ILE A C   
1943 O O   . ILE A 256 ? 0.4597 0.6132 0.4595 -0.0759 -0.0329 0.0330  256 ILE A O   
1944 C CB  . ILE A 256 ? 0.4541 0.5858 0.4567 -0.0728 -0.0274 0.0538  256 ILE A CB  
1945 C CG1 . ILE A 256 ? 0.4688 0.5924 0.4641 -0.0758 -0.0273 0.0681  256 ILE A CG1 
1946 C CG2 . ILE A 256 ? 0.4408 0.5654 0.4611 -0.0658 -0.0176 0.0405  256 ILE A CG2 
1947 C CD1 . ILE A 256 ? 0.5207 0.6357 0.5359 -0.0662 -0.0349 0.0817  256 ILE A CD1 
1948 N N   . ARG A 257 ? 0.4204 0.5704 0.4043 -0.0859 -0.0124 0.0145  257 ARG A N   
1949 C CA  . ARG A 257 ? 0.3999 0.5545 0.3908 -0.0845 -0.0097 -0.0002 257 ARG A CA  
1950 C C   . ARG A 257 ? 0.4136 0.5591 0.4252 -0.0756 -0.0026 -0.0091 257 ARG A C   
1951 O O   . ARG A 257 ? 0.4207 0.5597 0.4345 -0.0757 0.0062  -0.0127 257 ARG A O   
1952 C CB  . ARG A 257 ? 0.3917 0.5538 0.3638 -0.0965 -0.0023 -0.0123 257 ARG A CB  
1953 C CG  . ARG A 257 ? 0.3467 0.5129 0.3261 -0.0958 0.0003  -0.0273 257 ARG A CG  
1954 C CD  . ARG A 257 ? 0.2605 0.4321 0.2259 -0.1068 0.0103  -0.0419 257 ARG A CD  
1955 N NE  . ARG A 257 ? 0.2890 0.4614 0.2662 -0.1046 0.0139  -0.0563 257 ARG A NE  
1956 C CZ  . ARG A 257 ? 0.5554 0.7355 0.5311 -0.1065 0.0071  -0.0590 257 ARG A CZ  
1957 N NH1 . ARG A 257 ? 0.3872 0.5662 0.3746 -0.1047 0.0115  -0.0720 257 ARG A NH1 
1958 N NH2 . ARG A 257 ? 0.4082 0.5972 0.3719 -0.1104 -0.0045 -0.0483 257 ARG A NH2 
1959 N N   . ALA A 258 ? 0.3446 0.4904 0.3705 -0.0690 -0.0062 -0.0134 258 ALA A N   
1960 C CA  . ALA A 258 ? 0.3226 0.4602 0.3658 -0.0616 -0.0007 -0.0216 258 ALA A CA  
1961 C C   . ALA A 258 ? 0.3756 0.5166 0.4206 -0.0637 0.0033  -0.0356 258 ALA A C   
1962 O O   . ALA A 258 ? 0.3642 0.5121 0.4080 -0.0651 -0.0020 -0.0373 258 ALA A O   
1963 C CB  . ALA A 258 ? 0.3195 0.4522 0.3789 -0.0524 -0.0068 -0.0145 258 ALA A CB  
1964 N N   . ASP A 259 ? 0.3488 0.4847 0.3982 -0.0639 0.0126  -0.0455 259 ASP A N   
1965 C CA  . ASP A 259 ? 0.3583 0.4944 0.4122 -0.0653 0.0178  -0.0588 259 ASP A CA  
1966 C C   . ASP A 259 ? 0.4146 0.5409 0.4861 -0.0570 0.0192  -0.0615 259 ASP A C   
1967 O O   . ASP A 259 ? 0.3972 0.5167 0.4756 -0.0523 0.0199  -0.0567 259 ASP A O   
1968 C CB  . ASP A 259 ? 0.3999 0.5381 0.4466 -0.0726 0.0276  -0.0685 259 ASP A CB  
1969 C CG  . ASP A 259 ? 0.6473 0.7958 0.6735 -0.0834 0.0275  -0.0690 259 ASP A CG  
1970 O OD1 . ASP A 259 ? 0.6670 0.8223 0.6878 -0.0878 0.0254  -0.0750 259 ASP A OD1 
1971 O OD2 . ASP A 259 ? 0.7687 0.9186 0.7834 -0.0884 0.0301  -0.0642 259 ASP A OD2 
1972 N N   . SER A 260 ? 0.3852 0.5106 0.4630 -0.0561 0.0196  -0.0692 260 SER A N   
1973 C CA  . SER A 260 ? 0.3803 0.4963 0.4724 -0.0495 0.0202  -0.0710 260 SER A CA  
1974 C C   . SER A 260 ? 0.4276 0.5402 0.5262 -0.0508 0.0258  -0.0825 260 SER A C   
1975 O O   . SER A 260 ? 0.4267 0.5448 0.5206 -0.0561 0.0274  -0.0896 260 SER A O   
1976 C CB  . SER A 260 ? 0.4356 0.5512 0.5315 -0.0456 0.0134  -0.0656 260 SER A CB  
1977 O OG  . SER A 260 ? 0.5794 0.6855 0.6860 -0.0404 0.0140  -0.0665 260 SER A OG  
1978 N N   . PHE A 261 ? 0.3705 0.4739 0.4809 -0.0461 0.0283  -0.0840 261 PHE A N   
1979 C CA  . PHE A 261 ? 0.3666 0.4645 0.4871 -0.0458 0.0324  -0.0929 261 PHE A CA  
1980 C C   . PHE A 261 ? 0.3834 0.4746 0.5092 -0.0425 0.0283  -0.0913 261 PHE A C   
1981 O O   . PHE A 261 ? 0.3726 0.4580 0.5063 -0.0424 0.0307  -0.0973 261 PHE A O   
1982 C CB  . PHE A 261 ? 0.3918 0.4840 0.5239 -0.0428 0.0363  -0.0946 261 PHE A CB  
1983 C CG  . PHE A 261 ? 0.4323 0.5305 0.5630 -0.0474 0.0437  -0.1007 261 PHE A CG  
1984 C CD1 . PHE A 261 ? 0.4892 0.5928 0.6158 -0.0539 0.0498  -0.1109 261 PHE A CD1 
1985 C CD2 . PHE A 261 ? 0.4619 0.5602 0.5956 -0.0462 0.0455  -0.0972 261 PHE A CD2 
1986 C CE1 . PHE A 261 ? 0.5069 0.6162 0.6311 -0.0595 0.0581  -0.1176 261 PHE A CE1 
1987 C CE2 . PHE A 261 ? 0.4993 0.6033 0.6316 -0.0514 0.0536  -0.1035 261 PHE A CE2 
1988 C CZ  . PHE A 261 ? 0.4851 0.5946 0.6124 -0.0582 0.0601  -0.1138 261 PHE A CZ  
1989 N N   . SER A 262 ? 0.3200 0.4116 0.4420 -0.0402 0.0226  -0.0835 262 SER A N   
1990 C CA  . SER A 262 ? 0.3180 0.4040 0.4434 -0.0380 0.0195  -0.0816 262 SER A CA  
1991 C C   . SER A 262 ? 0.3905 0.4773 0.5165 -0.0416 0.0208  -0.0883 262 SER A C   
1992 O O   . SER A 262 ? 0.3943 0.4725 0.5254 -0.0405 0.0209  -0.0891 262 SER A O   
1993 C CB  . SER A 262 ? 0.3537 0.4424 0.4760 -0.0359 0.0148  -0.0737 262 SER A CB  
1994 O OG  . SER A 262 ? 0.4626 0.5472 0.5864 -0.0323 0.0141  -0.0680 262 SER A OG  
1995 N N   . LYS A 263 ? 0.3498 0.4466 0.4698 -0.0466 0.0216  -0.0928 263 LYS A N   
1996 C CA  . LYS A 263 ? 0.3575 0.4560 0.4783 -0.0509 0.0230  -0.1002 263 LYS A CA  
1997 C C   . LYS A 263 ? 0.4265 0.5211 0.5520 -0.0540 0.0296  -0.1103 263 LYS A C   
1998 O O   . LYS A 263 ? 0.4111 0.5033 0.5402 -0.0570 0.0317  -0.1168 263 LYS A O   
1999 C CB  . LYS A 263 ? 0.3923 0.5046 0.5052 -0.0555 0.0193  -0.1002 263 LYS A CB  
2000 C CG  . LYS A 263 ? 0.5291 0.6443 0.6440 -0.0526 0.0134  -0.0927 263 LYS A CG  
2001 C CD  . LYS A 263 ? 0.6046 0.7216 0.7178 -0.0481 0.0093  -0.0826 263 LYS A CD  
2002 C CE  . LYS A 263 ? 0.7385 0.8558 0.8581 -0.0444 0.0053  -0.0766 263 LYS A CE  
2003 N NZ  . LYS A 263 ? 0.8094 0.9143 0.9347 -0.0411 0.0081  -0.0765 263 LYS A NZ  
2004 N N   . ILE A 264 ? 0.4084 0.5019 0.5357 -0.0532 0.0334  -0.1120 264 ILE A N   
2005 C CA  . ILE A 264 ? 0.4201 0.5110 0.5544 -0.0560 0.0408  -0.1228 264 ILE A CA  
2006 C C   . ILE A 264 ? 0.4666 0.5463 0.6160 -0.0506 0.0434  -0.1229 264 ILE A C   
2007 O O   . ILE A 264 ? 0.4708 0.5449 0.6313 -0.0516 0.0484  -0.1312 264 ILE A O   
2008 C CB  . ILE A 264 ? 0.4680 0.5705 0.5922 -0.0631 0.0454  -0.1296 264 ILE A CB  
2009 C CG1 . ILE A 264 ? 0.4784 0.5862 0.5943 -0.0618 0.0434  -0.1215 264 ILE A CG1 
2010 C CG2 . ILE A 264 ? 0.4656 0.5778 0.5787 -0.0701 0.0434  -0.1335 264 ILE A CG2 
2011 C CD1 . ILE A 264 ? 0.6146 0.7307 0.7216 -0.0689 0.0499  -0.1281 264 ILE A CD1 
2012 N N   . ILE A 265 ? 0.3981 0.4750 0.5494 -0.0453 0.0398  -0.1143 265 ILE A N   
2013 C CA  . ILE A 265 ? 0.3840 0.4519 0.5502 -0.0402 0.0404  -0.1133 265 ILE A CA  
2014 C C   . ILE A 265 ? 0.4148 0.4732 0.5834 -0.0350 0.0332  -0.1034 265 ILE A C   
2015 O O   . ILE A 265 ? 0.4156 0.4640 0.5951 -0.0327 0.0321  -0.1032 265 ILE A O   
2016 C CB  . ILE A 265 ? 0.4194 0.4924 0.5897 -0.0402 0.0449  -0.1158 265 ILE A CB  
2017 C CG1 . ILE A 265 ? 0.4500 0.5261 0.6275 -0.0448 0.0542  -0.1290 265 ILE A CG1 
2018 C CG2 . ILE A 265 ? 0.3950 0.4612 0.5787 -0.0340 0.0418  -0.1103 265 ILE A CG2 
2019 C CD1 . ILE A 265 ? 0.6234 0.7105 0.7919 -0.0504 0.0605  -0.1339 265 ILE A CD1 
2020 N N   . SER A 266 ? 0.3416 0.4028 0.5002 -0.0337 0.0285  -0.0952 266 SER A N   
2021 C CA  . SER A 266 ? 0.3305 0.3840 0.4881 -0.0304 0.0226  -0.0868 266 SER A CA  
2022 C C   . SER A 266 ? 0.3745 0.4332 0.5218 -0.0301 0.0197  -0.0806 266 SER A C   
2023 O O   . SER A 266 ? 0.3777 0.4427 0.5227 -0.0299 0.0206  -0.0793 266 SER A O   
2024 C CB  . SER A 266 ? 0.3773 0.4234 0.5458 -0.0265 0.0203  -0.0838 266 SER A CB  
2025 O OG  . SER A 266 ? 0.4692 0.5093 0.6335 -0.0246 0.0145  -0.0757 266 SER A OG  
2026 N N   . SER A 267 ? 0.3116 0.3672 0.4540 -0.0302 0.0167  -0.0768 267 SER A N   
2027 C CA  . SER A 267 ? 0.2971 0.3563 0.4332 -0.0294 0.0143  -0.0713 267 SER A CA  
2028 C C   . SER A 267 ? 0.3549 0.4072 0.4919 -0.0266 0.0115  -0.0657 267 SER A C   
2029 O O   . SER A 267 ? 0.3493 0.4047 0.4844 -0.0253 0.0107  -0.0621 267 SER A O   
2030 C CB  . SER A 267 ? 0.3198 0.3800 0.4524 -0.0314 0.0137  -0.0717 267 SER A CB  
2031 O OG  . SER A 267 ? 0.4037 0.4540 0.5374 -0.0323 0.0135  -0.0720 267 SER A OG  
2032 N N   . GLY A 268 ? 0.3147 0.3577 0.4548 -0.0261 0.0097  -0.0649 268 GLY A N   
2033 C CA  . GLY A 268 ? 0.3116 0.3482 0.4515 -0.0248 0.0062  -0.0600 268 GLY A CA  
2034 C C   . GLY A 268 ? 0.3644 0.4027 0.5112 -0.0225 0.0053  -0.0592 268 GLY A C   
2035 O O   . GLY A 268 ? 0.3596 0.3945 0.5058 -0.0219 0.0021  -0.0554 268 GLY A O   
2036 N N   . LEU A 269 ? 0.3140 0.3576 0.4675 -0.0219 0.0086  -0.0635 269 LEU A N   
2037 C CA  . LEU A 269 ? 0.2980 0.3445 0.4598 -0.0203 0.0092  -0.0638 269 LEU A CA  
2038 C C   . LEU A 269 ? 0.3374 0.3901 0.4938 -0.0207 0.0109  -0.0616 269 LEU A C   
2039 O O   . LEU A 269 ? 0.3308 0.3847 0.4927 -0.0198 0.0108  -0.0604 269 LEU A O   
2040 C CB  . LEU A 269 ? 0.2961 0.3459 0.4681 -0.0204 0.0138  -0.0705 269 LEU A CB  
2041 C CG  . LEU A 269 ? 0.3422 0.3850 0.5269 -0.0187 0.0120  -0.0724 269 LEU A CG  
2042 C CD1 . LEU A 269 ? 0.3426 0.3896 0.5399 -0.0189 0.0182  -0.0806 269 LEU A CD1 
2043 C CD2 . LEU A 269 ? 0.3498 0.3869 0.5420 -0.0161 0.0053  -0.0667 269 LEU A CD2 
2044 N N   . ARG A 270 ? 0.2871 0.3439 0.4343 -0.0221 0.0120  -0.0605 270 ARG A N   
2045 C CA  . ARG A 270 ? 0.2869 0.3485 0.4291 -0.0223 0.0127  -0.0569 270 ARG A CA  
2046 C C   . ARG A 270 ? 0.3503 0.4181 0.4942 -0.0236 0.0166  -0.0583 270 ARG A C   
2047 O O   . ARG A 270 ? 0.3454 0.4128 0.4925 -0.0231 0.0171  -0.0560 270 ARG A O   
2048 C CB  . ARG A 270 ? 0.2587 0.3154 0.4007 -0.0209 0.0101  -0.0521 270 ARG A CB  
2049 C CG  . ARG A 270 ? 0.2726 0.3228 0.4114 -0.0210 0.0074  -0.0513 270 ARG A CG  
2050 C CD  . ARG A 270 ? 0.3048 0.3577 0.4393 -0.0218 0.0081  -0.0520 270 ARG A CD  
2051 N NE  . ARG A 270 ? 0.3616 0.4206 0.4951 -0.0212 0.0088  -0.0493 270 ARG A NE  
2052 C CZ  . ARG A 270 ? 0.4832 0.5497 0.6148 -0.0221 0.0092  -0.0498 270 ARG A CZ  
2053 N NH1 . ARG A 270 ? 0.1410 0.2099 0.2713 -0.0239 0.0101  -0.0543 270 ARG A NH1 
2054 N NH2 . ARG A 270 ? 0.3813 0.4529 0.5128 -0.0214 0.0082  -0.0456 270 ARG A NH2 
2055 N N   . ILE A 271 ? 0.3065 0.3798 0.4480 -0.0262 0.0200  -0.0631 271 ILE A N   
2056 C CA  . ILE A 271 ? 0.3164 0.3959 0.4572 -0.0292 0.0251  -0.0660 271 ILE A CA  
2057 C C   . ILE A 271 ? 0.4163 0.5033 0.5455 -0.0334 0.0264  -0.0667 271 ILE A C   
2058 O O   . ILE A 271 ? 0.4206 0.5093 0.5481 -0.0352 0.0269  -0.0717 271 ILE A O   
2059 C CB  . ILE A 271 ? 0.3527 0.4316 0.5056 -0.0294 0.0295  -0.0737 271 ILE A CB  
2060 C CG1 . ILE A 271 ? 0.3366 0.4098 0.5024 -0.0255 0.0268  -0.0719 271 ILE A CG1 
2061 C CG2 . ILE A 271 ? 0.3726 0.4591 0.5235 -0.0342 0.0371  -0.0793 271 ILE A CG2 
2062 C CD1 . ILE A 271 ? 0.2929 0.3676 0.4602 -0.0256 0.0274  -0.0678 271 ILE A CD1 
2063 N N   . GLY A 272 ? 0.3966 0.4877 0.5180 -0.0355 0.0266  -0.0613 272 GLY A N   
2064 C CA  . GLY A 272 ? 0.4035 0.5025 0.5122 -0.0403 0.0265  -0.0598 272 GLY A CA  
2065 C C   . GLY A 272 ? 0.4512 0.5536 0.5535 -0.0446 0.0306  -0.0575 272 GLY A C   
2066 O O   . GLY A 272 ? 0.4354 0.5344 0.5452 -0.0434 0.0340  -0.0579 272 GLY A O   
2067 N N   . PHE A 273 ? 0.4130 0.5224 0.5011 -0.0502 0.0302  -0.0548 273 PHE A N   
2068 C CA  . PHE A 273 ? 0.4143 0.5267 0.4930 -0.0558 0.0341  -0.0514 273 PHE A CA  
2069 C C   . PHE A 273 ? 0.4631 0.5804 0.5264 -0.0596 0.0285  -0.0414 273 PHE A C   
2070 O O   . PHE A 273 ? 0.4730 0.5954 0.5303 -0.0608 0.0233  -0.0410 273 PHE A O   
2071 C CB  . PHE A 273 ? 0.4390 0.5553 0.5164 -0.0620 0.0441  -0.0626 273 PHE A CB  
2072 C CG  . PHE A 273 ? 0.4542 0.5761 0.5267 -0.0666 0.0466  -0.0727 273 PHE A CG  
2073 C CD1 . PHE A 273 ? 0.4896 0.6082 0.5747 -0.0621 0.0462  -0.0800 273 PHE A CD1 
2074 C CD2 . PHE A 273 ? 0.4958 0.6258 0.5508 -0.0764 0.0501  -0.0754 273 PHE A CD2 
2075 C CE1 . PHE A 273 ? 0.5153 0.6383 0.5971 -0.0667 0.0492  -0.0900 273 PHE A CE1 
2076 C CE2 . PHE A 273 ? 0.5452 0.6804 0.5958 -0.0816 0.0534  -0.0864 273 PHE A CE2 
2077 C CZ  . PHE A 273 ? 0.5171 0.6486 0.5822 -0.0765 0.0532  -0.0939 273 PHE A CZ  
2078 N N   . LEU A 274 ? 0.3928 0.5083 0.4507 -0.0617 0.0292  -0.0329 274 LEU A N   
2079 C CA  . LEU A 274 ? 0.3892 0.5077 0.4334 -0.0652 0.0232  -0.0208 274 LEU A CA  
2080 C C   . LEU A 274 ? 0.4552 0.5784 0.4821 -0.0757 0.0295  -0.0214 274 LEU A C   
2081 O O   . LEU A 274 ? 0.4564 0.5770 0.4864 -0.0781 0.0383  -0.0262 274 LEU A O   
2082 C CB  . LEU A 274 ? 0.3805 0.4908 0.4335 -0.0593 0.0194  -0.0096 274 LEU A CB  
2083 C CG  . LEU A 274 ? 0.4344 0.5449 0.4870 -0.0561 0.0091  0.0028  274 LEU A CG  
2084 C CD1 . LEU A 274 ? 0.4299 0.5422 0.4927 -0.0501 0.0039  -0.0010 274 LEU A CD1 
2085 C CD2 . LEU A 274 ? 0.4379 0.5392 0.4998 -0.0515 0.0081  0.0122  274 LEU A CD2 
2086 N N   . THR A 275 ? 0.4210 0.5516 0.4295 -0.0828 0.0250  -0.0170 275 THR A N   
2087 C CA  . THR A 275 ? 0.4262 0.5621 0.4133 -0.0950 0.0304  -0.0170 275 THR A CA  
2088 C C   . THR A 275 ? 0.4765 0.6132 0.4493 -0.0979 0.0204  0.0005  275 THR A C   
2089 O O   . THR A 275 ? 0.4655 0.6053 0.4391 -0.0943 0.0093  0.0073  275 THR A O   
2090 C CB  . THR A 275 ? 0.4922 0.6373 0.4681 -0.1029 0.0345  -0.0300 275 THR A CB  
2091 O OG1 . THR A 275 ? 0.5086 0.6521 0.5028 -0.0967 0.0384  -0.0433 275 THR A OG1 
2092 C CG2 . THR A 275 ? 0.4690 0.6182 0.4273 -0.1157 0.0455  -0.0363 275 THR A CG2 
2093 N N   . GLY A 276 ? 0.4573 0.5907 0.4188 -0.1041 0.0245  0.0080  276 GLY A N   
2094 C CA  . GLY A 276 ? 0.4806 0.6128 0.4284 -0.1074 0.0153  0.0265  276 GLY A CA  
2095 C C   . GLY A 276 ? 0.5564 0.6835 0.4920 -0.1154 0.0226  0.0330  276 GLY A C   
2096 O O   . GLY A 276 ? 0.5436 0.6702 0.4801 -0.1198 0.0359  0.0213  276 GLY A O   
2097 N N   . PRO A 277 ? 0.5396 0.6628 0.4647 -0.1178 0.0143  0.0518  277 PRO A N   
2098 C CA  . PRO A 277 ? 0.5656 0.6828 0.4776 -0.1265 0.0214  0.0593  277 PRO A CA  
2099 C C   . PRO A 277 ? 0.6121 0.7190 0.5460 -0.1195 0.0297  0.0562  277 PRO A C   
2100 O O   . PRO A 277 ? 0.6007 0.7015 0.5573 -0.1072 0.0241  0.0590  277 PRO A O   
2101 C CB  . PRO A 277 ? 0.6107 0.7246 0.5116 -0.1278 0.0076  0.0821  277 PRO A CB  
2102 C CG  . PRO A 277 ? 0.6616 0.7834 0.5653 -0.1227 -0.0060 0.0843  277 PRO A CG  
2103 C CD  . PRO A 277 ? 0.5677 0.6913 0.4946 -0.1125 -0.0021 0.0675  277 PRO A CD  
2104 N N   . LYS A 278 ? 0.5543 0.6601 0.4815 -0.1282 0.0433  0.0499  278 LYS A N   
2105 C CA  . LYS A 278 ? 0.5311 0.6288 0.4772 -0.1243 0.0525  0.0458  278 LYS A CA  
2106 C C   . LYS A 278 ? 0.5384 0.6240 0.4989 -0.1156 0.0448  0.0610  278 LYS A C   
2107 O O   . LYS A 278 ? 0.4956 0.5767 0.4805 -0.1053 0.0452  0.0551  278 LYS A O   
2108 C CB  . LYS A 278 ? 0.5893 0.6884 0.5217 -0.1376 0.0672  0.0406  278 LYS A CB  
2109 C CG  . LYS A 278 ? 0.8183 0.9123 0.7726 -0.1345 0.0781  0.0324  278 LYS A CG  
2110 C CD  . LYS A 278 ? 1.0365 1.1367 0.9837 -0.1465 0.0947  0.0192  278 LYS A CD  
2111 C CE  . LYS A 278 ? 1.2071 1.3163 1.1680 -0.1437 0.1016  -0.0016 278 LYS A CE  
2112 N NZ  . LYS A 278 ? 1.3743 1.4901 1.3299 -0.1558 0.1185  -0.0150 278 LYS A NZ  
2113 N N   . PRO A 279 ? 0.4983 0.5783 0.4453 -0.1193 0.0369  0.0803  279 PRO A N   
2114 C CA  . PRO A 279 ? 0.4886 0.5562 0.4530 -0.1106 0.0305  0.0934  279 PRO A CA  
2115 C C   . PRO A 279 ? 0.5611 0.6279 0.5500 -0.0962 0.0226  0.0897  279 PRO A C   
2116 O O   . PRO A 279 ? 0.5575 0.6162 0.5679 -0.0886 0.0251  0.0869  279 PRO A O   
2117 C CB  . PRO A 279 ? 0.5272 0.5916 0.4723 -0.1165 0.0205  0.1146  279 PRO A CB  
2118 C CG  . PRO A 279 ? 0.6056 0.6774 0.5209 -0.1318 0.0273  0.1124  279 PRO A CG  
2119 C CD  . PRO A 279 ? 0.5371 0.6210 0.4531 -0.1322 0.0338  0.0914  279 PRO A CD  
2120 N N   . LEU A 280 ? 0.5231 0.5987 0.5081 -0.0935 0.0138  0.0884  280 LEU A N   
2121 C CA  . LEU A 280 ? 0.4925 0.5687 0.4985 -0.0812 0.0066  0.0846  280 LEU A CA  
2122 C C   . LEU A 280 ? 0.5380 0.6163 0.5586 -0.0763 0.0146  0.0658  280 LEU A C   
2123 O O   . LEU A 280 ? 0.5418 0.6144 0.5832 -0.0668 0.0130  0.0633  280 LEU A O   
2124 C CB  . LEU A 280 ? 0.4866 0.5720 0.4845 -0.0807 -0.0052 0.0895  280 LEU A CB  
2125 C CG  . LEU A 280 ? 0.5455 0.6304 0.5290 -0.0855 -0.0160 0.1094  280 LEU A CG  
2126 C CD1 . LEU A 280 ? 0.5524 0.6497 0.5268 -0.0867 -0.0268 0.1109  280 LEU A CD1 
2127 C CD2 . LEU A 280 ? 0.5390 0.6120 0.5417 -0.0771 -0.0224 0.1240  280 LEU A CD2 
2128 N N   . ILE A 281 ? 0.4757 0.5616 0.4862 -0.0830 0.0232  0.0527  281 ILE A N   
2129 C CA  . ILE A 281 ? 0.4495 0.5372 0.4743 -0.0788 0.0304  0.0356  281 ILE A CA  
2130 C C   . ILE A 281 ? 0.4744 0.5532 0.5160 -0.0754 0.0365  0.0339  281 ILE A C   
2131 O O   . ILE A 281 ? 0.4284 0.5045 0.4878 -0.0675 0.0362  0.0267  281 ILE A O   
2132 C CB  . ILE A 281 ? 0.4891 0.5865 0.5015 -0.0872 0.0387  0.0225  281 ILE A CB  
2133 C CG1 . ILE A 281 ? 0.4999 0.6065 0.4990 -0.0896 0.0321  0.0215  281 ILE A CG1 
2134 C CG2 . ILE A 281 ? 0.4681 0.5662 0.4976 -0.0836 0.0471  0.0064  281 ILE A CG2 
2135 C CD1 . ILE A 281 ? 0.5753 0.6838 0.5893 -0.0797 0.0252  0.0156  281 ILE A CD1 
2136 N N   . GLU A 282 ? 0.4643 0.5382 0.4989 -0.0820 0.0414  0.0415  282 GLU A N   
2137 C CA  . GLU A 282 ? 0.4653 0.5307 0.5139 -0.0808 0.0473  0.0413  282 GLU A CA  
2138 C C   . GLU A 282 ? 0.4913 0.5480 0.5583 -0.0704 0.0402  0.0462  282 GLU A C   
2139 O O   . GLU A 282 ? 0.4667 0.5211 0.5506 -0.0652 0.0426  0.0371  282 GLU A O   
2140 C CB  . GLU A 282 ? 0.5096 0.5707 0.5439 -0.0907 0.0522  0.0518  282 GLU A CB  
2141 C CG  . GLU A 282 ? 0.6723 0.7237 0.7195 -0.0909 0.0580  0.0541  282 GLU A CG  
2142 C CD  . GLU A 282 ? 0.9748 1.0219 1.0059 -0.1020 0.0636  0.0646  282 GLU A CD  
2143 O OE1 . GLU A 282 ? 0.7515 0.7948 0.7679 -0.1047 0.0565  0.0802  282 GLU A OE1 
2144 O OE2 . GLU A 282 ? 0.9972 1.0450 1.0308 -0.1085 0.0749  0.0574  282 GLU A OE2 
2145 N N   . ARG A 283 ? 0.4343 0.4870 0.4983 -0.0676 0.0311  0.0598  283 ARG A N   
2146 C CA  . ARG A 283 ? 0.4155 0.4602 0.4977 -0.0582 0.0249  0.0642  283 ARG A CA  
2147 C C   . ARG A 283 ? 0.4452 0.4937 0.5403 -0.0506 0.0235  0.0515  283 ARG A C   
2148 O O   . ARG A 283 ? 0.4247 0.4666 0.5363 -0.0452 0.0245  0.0476  283 ARG A O   
2149 C CB  . ARG A 283 ? 0.4101 0.4530 0.4886 -0.0562 0.0145  0.0799  283 ARG A CB  
2150 C CG  . ARG A 283 ? 0.4938 0.5313 0.5588 -0.0635 0.0137  0.0957  283 ARG A CG  
2151 C CD  . ARG A 283 ? 0.5522 0.5763 0.6296 -0.0631 0.0187  0.1007  283 ARG A CD  
2152 N NE  . ARG A 283 ? 0.5449 0.5688 0.6141 -0.0717 0.0300  0.0946  283 ARG A NE  
2153 C CZ  . ARG A 283 ? 0.5896 0.6045 0.6706 -0.0724 0.0371  0.0927  283 ARG A CZ  
2154 N NH1 . ARG A 283 ? 0.5562 0.5730 0.6309 -0.0807 0.0474  0.0867  283 ARG A NH1 
2155 N NH2 . ARG A 283 ? 0.2252 0.2296 0.3257 -0.0653 0.0346  0.0959  283 ARG A NH2 
2156 N N   . VAL A 284 ? 0.3768 0.4356 0.4633 -0.0514 0.0217  0.0447  284 VAL A N   
2157 C CA  . VAL A 284 ? 0.3452 0.4077 0.4410 -0.0456 0.0204  0.0332  284 VAL A CA  
2158 C C   . VAL A 284 ? 0.3876 0.4487 0.4923 -0.0455 0.0278  0.0213  284 VAL A C   
2159 O O   . VAL A 284 ? 0.3858 0.4428 0.5037 -0.0398 0.0267  0.0165  284 VAL A O   
2160 C CB  . VAL A 284 ? 0.3820 0.4550 0.4665 -0.0472 0.0167  0.0299  284 VAL A CB  
2161 C CG1 . VAL A 284 ? 0.3538 0.4299 0.4463 -0.0429 0.0174  0.0170  284 VAL A CG1 
2162 C CG2 . VAL A 284 ? 0.3862 0.4608 0.4678 -0.0452 0.0071  0.0413  284 VAL A CG2 
2163 N N   . ILE A 285 ? 0.3263 0.3909 0.4246 -0.0521 0.0351  0.0168  285 ILE A N   
2164 C CA  . ILE A 285 ? 0.2977 0.3624 0.4068 -0.0524 0.0416  0.0062  285 ILE A CA  
2165 C C   . ILE A 285 ? 0.3167 0.3723 0.4390 -0.0499 0.0422  0.0088  285 ILE A C   
2166 O O   . ILE A 285 ? 0.2892 0.3435 0.4238 -0.0463 0.0421  0.0012  285 ILE A O   
2167 C CB  . ILE A 285 ? 0.3340 0.4050 0.4362 -0.0605 0.0504  0.0006  285 ILE A CB  
2168 C CG1 . ILE A 285 ? 0.3385 0.4185 0.4291 -0.0633 0.0509  -0.0049 285 ILE A CG1 
2169 C CG2 . ILE A 285 ? 0.3216 0.3932 0.4398 -0.0599 0.0561  -0.0096 285 ILE A CG2 
2170 C CD1 . ILE A 285 ? 0.4043 0.4902 0.4831 -0.0731 0.0598  -0.0081 285 ILE A CD1 
2171 N N   . LEU A 286 ? 0.2806 0.3293 0.4000 -0.0521 0.0423  0.0199  286 LEU A N   
2172 C CA  . LEU A 286 ? 0.2821 0.3212 0.4147 -0.0502 0.0434  0.0221  286 LEU A CA  
2173 C C   . LEU A 286 ? 0.3336 0.3678 0.4778 -0.0426 0.0379  0.0202  286 LEU A C   
2174 O O   . LEU A 286 ? 0.3132 0.3426 0.4691 -0.0413 0.0398  0.0150  286 LEU A O   
2175 C CB  . LEU A 286 ? 0.2937 0.3251 0.4222 -0.0543 0.0449  0.0347  286 LEU A CB  
2176 C CG  . LEU A 286 ? 0.3479 0.3816 0.4659 -0.0635 0.0524  0.0367  286 LEU A CG  
2177 C CD1 . LEU A 286 ? 0.3609 0.3852 0.4737 -0.0671 0.0522  0.0514  286 LEU A CD1 
2178 C CD2 . LEU A 286 ? 0.3547 0.3900 0.4838 -0.0663 0.0601  0.0258  286 LEU A CD2 
2179 N N   . HIS A 287 ? 0.2984 0.3345 0.4393 -0.0382 0.0316  0.0236  287 HIS A N   
2180 C CA  . HIS A 287 ? 0.2860 0.3185 0.4374 -0.0318 0.0276  0.0206  287 HIS A CA  
2181 C C   . HIS A 287 ? 0.3495 0.3864 0.5035 -0.0305 0.0283  0.0082  287 HIS A C   
2182 O O   . HIS A 287 ? 0.3415 0.3736 0.5048 -0.0285 0.0286  0.0028  287 HIS A O   
2183 C CB  . HIS A 287 ? 0.2922 0.3277 0.4407 -0.0281 0.0211  0.0269  287 HIS A CB  
2184 C CG  . HIS A 287 ? 0.3297 0.3598 0.4917 -0.0221 0.0184  0.0264  287 HIS A CG  
2185 N ND1 . HIS A 287 ? 0.3519 0.3840 0.5169 -0.0182 0.0126  0.0327  287 HIS A ND1 
2186 C CD2 . HIS A 287 ? 0.3446 0.3682 0.5182 -0.0202 0.0213  0.0197  287 HIS A CD2 
2187 C CE1 . HIS A 287 ? 0.3400 0.3665 0.5195 -0.0138 0.0132  0.0291  287 HIS A CE1 
2188 N NE2 . HIS A 287 ? 0.3396 0.3605 0.5232 -0.0153 0.0186  0.0210  287 HIS A NE2 
2189 N N   . ILE A 288 ? 0.3085 0.3540 0.4542 -0.0322 0.0284  0.0037  288 ILE A N   
2190 C CA  . ILE A 288 ? 0.3018 0.3511 0.4502 -0.0311 0.0284  -0.0066 288 ILE A CA  
2191 C C   . ILE A 288 ? 0.3601 0.4067 0.5177 -0.0326 0.0315  -0.0119 288 ILE A C   
2192 O O   . ILE A 288 ? 0.3608 0.4054 0.5242 -0.0305 0.0293  -0.0176 288 ILE A O   
2193 C CB  . ILE A 288 ? 0.3404 0.3986 0.4801 -0.0333 0.0292  -0.0104 288 ILE A CB  
2194 C CG1 . ILE A 288 ? 0.3486 0.4101 0.4814 -0.0311 0.0244  -0.0077 288 ILE A CG1 
2195 C CG2 . ILE A 288 ? 0.3331 0.3942 0.4791 -0.0328 0.0304  -0.0205 288 ILE A CG2 
2196 C CD1 . ILE A 288 ? 0.5057 0.5755 0.6279 -0.0347 0.0255  -0.0102 288 ILE A CD1 
2197 N N   . GLN A 289 ? 0.3152 0.3613 0.4735 -0.0370 0.0364  -0.0094 289 GLN A N   
2198 C CA  . GLN A 289 ? 0.3076 0.3521 0.4757 -0.0396 0.0400  -0.0137 289 GLN A CA  
2199 C C   . GLN A 289 ? 0.3499 0.3864 0.5267 -0.0377 0.0379  -0.0147 289 GLN A C   
2200 O O   . GLN A 289 ? 0.3447 0.3813 0.5300 -0.0392 0.0384  -0.0206 289 GLN A O   
2201 C CB  . GLN A 289 ? 0.3319 0.3763 0.4976 -0.0453 0.0462  -0.0090 289 GLN A CB  
2202 C CG  . GLN A 289 ? 0.5132 0.5608 0.6891 -0.0493 0.0512  -0.0157 289 GLN A CG  
2203 C CD  . GLN A 289 ? 0.6438 0.6921 0.8152 -0.0560 0.0586  -0.0114 289 GLN A CD  
2204 O OE1 . GLN A 289 ? 0.5885 0.6295 0.7613 -0.0587 0.0612  -0.0054 289 GLN A OE1 
2205 N NE2 . GLN A 289 ? 0.4259 0.4823 0.5906 -0.0593 0.0627  -0.0142 289 GLN A NE2 
2206 N N   . VAL A 290 ? 0.2948 0.3250 0.4704 -0.0347 0.0356  -0.0095 290 VAL A N   
2207 C CA  . VAL A 290 ? 0.2934 0.3159 0.4771 -0.0333 0.0349  -0.0118 290 VAL A CA  
2208 C C   . VAL A 290 ? 0.3401 0.3627 0.5223 -0.0295 0.0307  -0.0162 290 VAL A C   
2209 O O   . VAL A 290 ? 0.3229 0.3397 0.5103 -0.0292 0.0308  -0.0198 290 VAL A O   
2210 C CB  . VAL A 290 ? 0.3508 0.3638 0.5400 -0.0337 0.0376  -0.0047 290 VAL A CB  
2211 C CG1 . VAL A 290 ? 0.3520 0.3637 0.5428 -0.0389 0.0426  -0.0014 290 VAL A CG1 
2212 C CG2 . VAL A 290 ? 0.3513 0.3627 0.5376 -0.0300 0.0350  0.0042  290 VAL A CG2 
2213 N N   . SER A 291 ? 0.3200 0.3491 0.4951 -0.0275 0.0279  -0.0166 291 SER A N   
2214 C CA  . SER A 291 ? 0.3303 0.3596 0.5035 -0.0248 0.0246  -0.0208 291 SER A CA  
2215 C C   . SER A 291 ? 0.3832 0.4164 0.5544 -0.0259 0.0224  -0.0276 291 SER A C   
2216 O O   . SER A 291 ? 0.3874 0.4177 0.5616 -0.0276 0.0215  -0.0323 291 SER A O   
2217 C CB  . SER A 291 ? 0.3984 0.4313 0.5666 -0.0218 0.0224  -0.0166 291 SER A CB  
2218 O OG  . SER A 291 ? 0.5943 0.6268 0.7623 -0.0214 0.0228  -0.0079 291 SER A OG  
2219 N N   . THR A 292 ? 0.3362 0.3760 0.5029 -0.0254 0.0214  -0.0280 292 THR A N   
2220 C CA  . THR A 292 ? 0.3236 0.3669 0.4906 -0.0255 0.0189  -0.0335 292 THR A CA  
2221 C C   . THR A 292 ? 0.3828 0.4303 0.5563 -0.0277 0.0205  -0.0359 292 THR A C   
2222 O O   . THR A 292 ? 0.3803 0.4306 0.5573 -0.0273 0.0178  -0.0400 292 THR A O   
2223 C CB  . THR A 292 ? 0.3227 0.3703 0.4835 -0.0237 0.0176  -0.0337 292 THR A CB  
2224 O OG1 . THR A 292 ? 0.2739 0.3257 0.4310 -0.0245 0.0204  -0.0299 292 THR A OG1 
2225 C CG2 . THR A 292 ? 0.3155 0.3599 0.4722 -0.0218 0.0154  -0.0333 292 THR A CG2 
2226 N N   . LEU A 293 ? 0.3177 0.3655 0.4942 -0.0302 0.0250  -0.0332 293 LEU A N   
2227 C CA  . LEU A 293 ? 0.2986 0.3515 0.4824 -0.0331 0.0287  -0.0357 293 LEU A CA  
2228 C C   . LEU A 293 ? 0.3555 0.4157 0.5368 -0.0333 0.0312  -0.0377 293 LEU A C   
2229 O O   . LEU A 293 ? 0.3775 0.4410 0.5578 -0.0367 0.0370  -0.0368 293 LEU A O   
2230 C CB  . LEU A 293 ? 0.2909 0.3449 0.4860 -0.0340 0.0258  -0.0410 293 LEU A CB  
2231 C CG  . LEU A 293 ? 0.3394 0.3876 0.5381 -0.0357 0.0238  -0.0414 293 LEU A CG  
2232 C CD1 . LEU A 293 ? 0.3300 0.3824 0.5408 -0.0379 0.0212  -0.0462 293 LEU A CD1 
2233 C CD2 . LEU A 293 ? 0.3831 0.4266 0.5817 -0.0381 0.0291  -0.0373 293 LEU A CD2 
2234 N N   . HIS A 294 ? 0.2944 0.3564 0.4741 -0.0306 0.0277  -0.0409 294 HIS A N   
2235 C CA  . HIS A 294 ? 0.2965 0.3646 0.4751 -0.0309 0.0305  -0.0445 294 HIS A CA  
2236 C C   . HIS A 294 ? 0.3193 0.3864 0.4952 -0.0277 0.0257  -0.0466 294 HIS A C   
2237 O O   . HIS A 294 ? 0.2914 0.3536 0.4686 -0.0256 0.0203  -0.0461 294 HIS A O   
2238 C CB  . HIS A 294 ? 0.3130 0.3867 0.5056 -0.0326 0.0341  -0.0506 294 HIS A CB  
2239 C CG  . HIS A 294 ? 0.3505 0.4235 0.5567 -0.0301 0.0283  -0.0537 294 HIS A CG  
2240 N ND1 . HIS A 294 ? 0.3647 0.4383 0.5760 -0.0271 0.0242  -0.0570 294 HIS A ND1 
2241 C CD2 . HIS A 294 ? 0.3697 0.4414 0.5846 -0.0309 0.0255  -0.0535 294 HIS A CD2 
2242 C CE1 . HIS A 294 ? 0.3537 0.4263 0.5760 -0.0260 0.0183  -0.0576 294 HIS A CE1 
2243 N NE2 . HIS A 294 ? 0.3599 0.4320 0.5844 -0.0284 0.0187  -0.0560 294 HIS A NE2 
2244 N N   . PRO A 295 ? 0.2947 0.3659 0.4668 -0.0280 0.0280  -0.0496 295 PRO A N   
2245 C CA  . PRO A 295 ? 0.2945 0.3639 0.4660 -0.0253 0.0239  -0.0521 295 PRO A CA  
2246 C C   . PRO A 295 ? 0.3280 0.3973 0.5141 -0.0236 0.0218  -0.0567 295 PRO A C   
2247 O O   . PRO A 295 ? 0.3210 0.3948 0.5182 -0.0248 0.0257  -0.0602 295 PRO A O   
2248 C CB  . PRO A 295 ? 0.3194 0.3939 0.4834 -0.0273 0.0279  -0.0546 295 PRO A CB  
2249 C CG  . PRO A 295 ? 0.3870 0.4659 0.5453 -0.0315 0.0335  -0.0526 295 PRO A CG  
2250 C CD  . PRO A 295 ? 0.3302 0.4077 0.4979 -0.0318 0.0348  -0.0516 295 PRO A CD  
2251 N N   . SER A 296 ? 0.2703 0.3345 0.4574 -0.0212 0.0155  -0.0561 296 SER A N   
2252 C CA  . SER A 296 ? 0.2612 0.3241 0.4616 -0.0192 0.0110  -0.0582 296 SER A CA  
2253 C C   . SER A 296 ? 0.3128 0.3816 0.5286 -0.0190 0.0158  -0.0643 296 SER A C   
2254 O O   . SER A 296 ? 0.3312 0.4025 0.5447 -0.0197 0.0210  -0.0684 296 SER A O   
2255 C CB  . SER A 296 ? 0.2920 0.3486 0.4872 -0.0177 0.0055  -0.0567 296 SER A CB  
2256 O OG  . SER A 296 ? 0.3276 0.3819 0.5355 -0.0158 0.0001  -0.0572 296 SER A OG  
2257 N N   . THR A 297 ? 0.2583 0.3302 0.4904 -0.0185 0.0147  -0.0658 297 THR A N   
2258 C CA  . THR A 297 ? 0.2522 0.3307 0.5034 -0.0183 0.0201  -0.0727 297 THR A CA  
2259 C C   . THR A 297 ? 0.3117 0.3875 0.5726 -0.0151 0.0178  -0.0757 297 THR A C   
2260 O O   . THR A 297 ? 0.3126 0.3920 0.5790 -0.0159 0.0255  -0.0826 297 THR A O   
2261 C CB  . THR A 297 ? 0.2930 0.3761 0.5624 -0.0183 0.0185  -0.0735 297 THR A CB  
2262 O OG1 . THR A 297 ? 0.3160 0.3986 0.5751 -0.0213 0.0188  -0.0695 297 THR A OG1 
2263 C CG2 . THR A 297 ? 0.2162 0.3077 0.5048 -0.0193 0.0274  -0.0818 297 THR A CG2 
2264 N N   . PHE A 298 ? 0.2672 0.3362 0.5288 -0.0124 0.0077  -0.0706 298 PHE A N   
2265 C CA  . PHE A 298 ? 0.2606 0.3247 0.5311 -0.0093 0.0039  -0.0712 298 PHE A CA  
2266 C C   . PHE A 298 ? 0.3089 0.3713 0.5678 -0.0106 0.0104  -0.0750 298 PHE A C   
2267 O O   . PHE A 298 ? 0.3076 0.3713 0.5792 -0.0097 0.0153  -0.0816 298 PHE A O   
2268 C CB  . PHE A 298 ? 0.2818 0.3376 0.5466 -0.0081 -0.0082 -0.0629 298 PHE A CB  
2269 C CG  . PHE A 298 ? 0.3068 0.3565 0.5843 -0.0049 -0.0145 -0.0612 298 PHE A CG  
2270 C CD1 . PHE A 298 ? 0.3629 0.4065 0.6335 -0.0047 -0.0122 -0.0623 298 PHE A CD1 
2271 C CD2 . PHE A 298 ? 0.3381 0.3877 0.6347 -0.0023 -0.0237 -0.0578 298 PHE A CD2 
2272 C CE1 . PHE A 298 ? 0.3785 0.4149 0.6616 -0.0019 -0.0178 -0.0601 298 PHE A CE1 
2273 C CE2 . PHE A 298 ? 0.3792 0.4220 0.6886 0.0009  -0.0305 -0.0546 298 PHE A CE2 
2274 C CZ  . PHE A 298 ? 0.3608 0.3964 0.6632 0.0011  -0.0272 -0.0556 298 PHE A CZ  
2275 N N   . ASN A 299 ? 0.2670 0.3271 0.5033 -0.0129 0.0106  -0.0715 299 ASN A N   
2276 C CA  . ASN A 299 ? 0.2715 0.3308 0.4952 -0.0146 0.0151  -0.0742 299 ASN A CA  
2277 C C   . ASN A 299 ? 0.3289 0.3960 0.5539 -0.0175 0.0254  -0.0822 299 ASN A C   
2278 O O   . ASN A 299 ? 0.3234 0.3903 0.5478 -0.0186 0.0293  -0.0876 299 ASN A O   
2279 C CB  . ASN A 299 ? 0.2621 0.3188 0.4653 -0.0162 0.0125  -0.0685 299 ASN A CB  
2280 C CG  . ASN A 299 ? 0.4198 0.4682 0.6187 -0.0150 0.0040  -0.0623 299 ASN A CG  
2281 O OD1 . ASN A 299 ? 0.3586 0.4025 0.5681 -0.0131 -0.0016 -0.0606 299 ASN A OD1 
2282 N ND2 . ASN A 299 ? 0.2235 0.2697 0.4069 -0.0165 0.0029  -0.0586 299 ASN A ND2 
2283 N N   . GLN A 300 ? 0.2589 0.3326 0.4852 -0.0195 0.0301  -0.0833 300 GLN A N   
2284 C CA  . GLN A 300 ? 0.2553 0.3367 0.4808 -0.0238 0.0404  -0.0906 300 GLN A CA  
2285 C C   . GLN A 300 ? 0.3144 0.3981 0.5623 -0.0229 0.0459  -0.1002 300 GLN A C   
2286 O O   . GLN A 300 ? 0.3074 0.3939 0.5542 -0.0261 0.0536  -0.1084 300 GLN A O   
2287 C CB  . GLN A 300 ? 0.2676 0.3539 0.4900 -0.0265 0.0436  -0.0882 300 GLN A CB  
2288 C CG  . GLN A 300 ? 0.2725 0.3574 0.4740 -0.0282 0.0408  -0.0800 300 GLN A CG  
2289 C CD  . GLN A 300 ? 0.3070 0.3961 0.5060 -0.0318 0.0457  -0.0784 300 GLN A CD  
2290 O OE1 . GLN A 300 ? 0.2269 0.3216 0.4190 -0.0370 0.0535  -0.0818 300 GLN A OE1 
2291 N NE2 . GLN A 300 ? 0.1036 0.1902 0.3082 -0.0300 0.0415  -0.0735 300 GLN A NE2 
2292 N N   . LEU A 301 ? 0.2654 0.3480 0.5350 -0.0187 0.0417  -0.0994 301 LEU A N   
2293 C CA  . LEU A 301 ? 0.2540 0.3386 0.5516 -0.0163 0.0452  -0.1074 301 LEU A CA  
2294 C C   . LEU A 301 ? 0.2905 0.3686 0.5932 -0.0141 0.0440  -0.1103 301 LEU A C   
2295 O O   . LEU A 301 ? 0.2758 0.3560 0.5963 -0.0141 0.0514  -0.1200 301 LEU A O   
2296 C CB  . LEU A 301 ? 0.2518 0.3358 0.5695 -0.0116 0.0365  -0.1025 301 LEU A CB  
2297 C CG  . LEU A 301 ? 0.3051 0.3982 0.6435 -0.0123 0.0414  -0.1072 301 LEU A CG  
2298 C CD1 . LEU A 301 ? 0.3103 0.4116 0.6454 -0.0184 0.0564  -0.1169 301 LEU A CD1 
2299 C CD2 . LEU A 301 ? 0.3087 0.4022 0.6426 -0.0121 0.0335  -0.0989 301 LEU A CD2 
2300 N N   . MET A 302 ? 0.2785 0.3484 0.5667 -0.0125 0.0354  -0.1024 302 MET A N   
2301 C CA  . MET A 302 ? 0.2932 0.3553 0.5831 -0.0111 0.0338  -0.1038 302 MET A CA  
2302 C C   . MET A 302 ? 0.3289 0.3949 0.6090 -0.0162 0.0444  -0.1134 302 MET A C   
2303 O O   . MET A 302 ? 0.3613 0.4250 0.6553 -0.0160 0.0494  -0.1215 302 MET A O   
2304 C CB  . MET A 302 ? 0.3340 0.3881 0.6054 -0.0104 0.0241  -0.0934 302 MET A CB  
2305 C CG  . MET A 302 ? 0.4015 0.4482 0.6825 -0.0062 0.0126  -0.0847 302 MET A CG  
2306 S SD  . MET A 302 ? 0.4789 0.5157 0.7353 -0.0075 0.0045  -0.0752 302 MET A SD  
2307 C CE  . MET A 302 ? 0.4390 0.4687 0.7002 -0.0078 0.0083  -0.0803 302 MET A CE  
2308 N N   . ILE A 303 ? 0.2282 0.2999 0.4850 -0.0211 0.0475  -0.1123 303 ILE A N   
2309 C CA  . ILE A 303 ? 0.1992 0.2760 0.4416 -0.0273 0.0559  -0.1198 303 ILE A CA  
2310 C C   . ILE A 303 ? 0.2385 0.3232 0.4918 -0.0312 0.0677  -0.1313 303 ILE A C   
2311 O O   . ILE A 303 ? 0.2401 0.3260 0.4973 -0.0347 0.0755  -0.1420 303 ILE A O   
2312 C CB  . ILE A 303 ? 0.2267 0.3065 0.4422 -0.0305 0.0526  -0.1123 303 ILE A CB  
2313 C CG1 . ILE A 303 ? 0.2289 0.3010 0.4358 -0.0276 0.0434  -0.1045 303 ILE A CG1 
2314 C CG2 . ILE A 303 ? 0.2190 0.3068 0.4185 -0.0380 0.0603  -0.1187 303 ILE A CG2 
2315 C CD1 . ILE A 303 ? 0.2673 0.3399 0.4566 -0.0275 0.0373  -0.0943 303 ILE A CD1 
2316 N N   . SER A 304 ? 0.2016 0.2913 0.4616 -0.0312 0.0698  -0.1302 304 SER A N   
2317 C CA  . SER A 304 ? 0.2141 0.3117 0.4854 -0.0357 0.0824  -0.1419 304 SER A CA  
2318 C C   . SER A 304 ? 0.3049 0.4006 0.6074 -0.0324 0.0874  -0.1525 304 SER A C   
2319 O O   . SER A 304 ? 0.3392 0.4399 0.6474 -0.0377 0.1000  -0.1659 304 SER A O   
2320 C CB  . SER A 304 ? 0.2518 0.3552 0.5236 -0.0370 0.0840  -0.1383 304 SER A CB  
2321 O OG  . SER A 304 ? 0.3835 0.4864 0.6828 -0.0311 0.0808  -0.1377 304 SER A OG  
2322 N N   . GLN A 305 ? 0.2550 0.3431 0.5773 -0.0242 0.0776  -0.1467 305 GLN A N   
2323 C CA  . GLN A 305 ? 0.2636 0.3483 0.6183 -0.0199 0.0803  -0.1547 305 GLN A CA  
2324 C C   . GLN A 305 ? 0.3336 0.4130 0.6840 -0.0223 0.0848  -0.1620 305 GLN A C   
2325 O O   . GLN A 305 ? 0.3354 0.4157 0.7060 -0.0235 0.0952  -0.1753 305 GLN A O   
2326 C CB  . GLN A 305 ? 0.2716 0.3493 0.6466 -0.0111 0.0666  -0.1442 305 GLN A CB  
2327 C CG  . GLN A 305 ? 0.4134 0.4975 0.8058 -0.0083 0.0638  -0.1412 305 GLN A CG  
2328 C CD  . GLN A 305 ? 0.7909 0.8840 1.2113 -0.0095 0.0763  -0.1547 305 GLN A CD  
2329 O OE1 . GLN A 305 ? 0.7684 0.8709 1.1820 -0.0150 0.0851  -0.1594 305 GLN A OE1 
2330 N NE2 . GLN A 305 ? 0.7077 0.7981 1.1617 -0.0045 0.0775  -0.1610 305 GLN A NE2 
2331 N N   . LEU A 306 ? 0.2743 0.3484 0.5993 -0.0233 0.0777  -0.1540 306 LEU A N   
2332 C CA  . LEU A 306 ? 0.2713 0.3408 0.5887 -0.0265 0.0811  -0.1600 306 LEU A CA  
2333 C C   . LEU A 306 ? 0.3635 0.4427 0.6699 -0.0358 0.0951  -0.1738 306 LEU A C   
2334 O O   . LEU A 306 ? 0.3679 0.4462 0.6865 -0.0386 0.1044  -0.1869 306 LEU A O   
2335 C CB  . LEU A 306 ? 0.2569 0.3213 0.5486 -0.0265 0.0708  -0.1484 306 LEU A CB  
2336 C CG  . LEU A 306 ? 0.3066 0.3686 0.5847 -0.0313 0.0735  -0.1534 306 LEU A CG  
2337 C CD1 . LEU A 306 ? 0.3024 0.3529 0.6007 -0.0278 0.0727  -0.1563 306 LEU A CD1 
2338 C CD2 . LEU A 306 ? 0.3197 0.3813 0.5711 -0.0325 0.0651  -0.1427 306 LEU A CD2 
2339 N N   . LEU A 307 ? 0.3359 0.4240 0.6198 -0.0410 0.0967  -0.1708 307 LEU A N   
2340 C CA  . LEU A 307 ? 0.3439 0.4417 0.6113 -0.0513 0.1086  -0.1814 307 LEU A CA  
2341 C C   . LEU A 307 ? 0.3976 0.5004 0.6872 -0.0544 0.1229  -0.1968 307 LEU A C   
2342 O O   . LEU A 307 ? 0.4079 0.5149 0.6924 -0.0626 0.1344  -0.2106 307 LEU A O   
2343 C CB  . LEU A 307 ? 0.3379 0.4426 0.5777 -0.0557 0.1057  -0.1721 307 LEU A CB  
2344 C CG  . LEU A 307 ? 0.3756 0.4776 0.5913 -0.0546 0.0939  -0.1591 307 LEU A CG  
2345 C CD1 . LEU A 307 ? 0.3798 0.4875 0.5748 -0.0577 0.0913  -0.1498 307 LEU A CD1 
2346 C CD2 . LEU A 307 ? 0.3796 0.4821 0.5816 -0.0600 0.0952  -0.1649 307 LEU A CD2 
2347 N N   . HIS A 308 ? 0.3387 0.4412 0.6545 -0.0481 0.1223  -0.1955 308 HIS A N   
2348 C CA  . HIS A 308 ? 0.3430 0.4506 0.6858 -0.0500 0.1362  -0.2107 308 HIS A CA  
2349 C C   . HIS A 308 ? 0.3503 0.4521 0.7176 -0.0483 0.1424  -0.2234 308 HIS A C   
2350 O O   . HIS A 308 ? 0.3337 0.4405 0.7124 -0.0545 0.1579  -0.2406 308 HIS A O   
2351 C CB  . HIS A 308 ? 0.3496 0.4592 0.7182 -0.0431 0.1327  -0.2057 308 HIS A CB  
2352 C CG  . HIS A 308 ? 0.4058 0.5220 0.8053 -0.0450 0.1475  -0.2219 308 HIS A CG  
2353 N ND1 . HIS A 308 ? 0.4307 0.5422 0.8702 -0.0375 0.1483  -0.2284 308 HIS A ND1 
2354 C CD2 . HIS A 308 ? 0.4421 0.5686 0.8375 -0.0542 0.1628  -0.2334 308 HIS A CD2 
2355 C CE1 . HIS A 308 ? 0.4327 0.5526 0.8938 -0.0417 0.1641  -0.2441 308 HIS A CE1 
2356 N NE2 . HIS A 308 ? 0.4450 0.5742 0.8797 -0.0523 0.1738  -0.2481 308 HIS A NE2 
2357 N N   . GLU A 309 ? 0.3058 0.3962 0.6809 -0.0406 0.1307  -0.2150 309 GLU A N   
2358 C CA  . GLU A 309 ? 0.3087 0.3902 0.7079 -0.0375 0.1337  -0.2235 309 GLU A CA  
2359 C C   . GLU A 309 ? 0.3593 0.4413 0.7383 -0.0470 0.1425  -0.2349 309 GLU A C   
2360 O O   . GLU A 309 ? 0.3435 0.4261 0.7392 -0.0511 0.1561  -0.2522 309 GLU A O   
2361 C CB  . GLU A 309 ? 0.3185 0.3875 0.7260 -0.0275 0.1170  -0.2078 309 GLU A CB  
2362 C CG  . GLU A 309 ? 0.5369 0.5957 0.9825 -0.0208 0.1175  -0.2127 309 GLU A CG  
2363 C CD  . GLU A 309 ? 0.9688 1.0298 1.4538 -0.0137 0.1180  -0.2144 309 GLU A CD  
2364 O OE1 . GLU A 309 ? 0.9264 0.9900 1.4121 -0.0088 0.1073  -0.2017 309 GLU A OE1 
2365 O OE2 . GLU A 309 ? 0.9894 1.0497 1.5067 -0.0130 0.1291  -0.2289 309 GLU A OE2 
2366 N N   . TRP A 310 ? 0.3378 0.4203 0.6818 -0.0508 0.1349  -0.2257 310 TRP A N   
2367 C CA  . TRP A 310 ? 0.3614 0.4458 0.6813 -0.0600 0.1395  -0.2332 310 TRP A CA  
2368 C C   . TRP A 310 ? 0.4126 0.5094 0.7168 -0.0725 0.1542  -0.2479 310 TRP A C   
2369 O O   . TRP A 310 ? 0.4161 0.5138 0.7213 -0.0800 0.1651  -0.2637 310 TRP A O   
2370 C CB  . TRP A 310 ? 0.3553 0.4396 0.6436 -0.0600 0.1260  -0.2172 310 TRP A CB  
2371 C CG  . TRP A 310 ? 0.3763 0.4488 0.6674 -0.0539 0.1151  -0.2081 310 TRP A CG  
2372 C CD1 . TRP A 310 ? 0.4213 0.4823 0.7380 -0.0488 0.1151  -0.2114 310 TRP A CD1 
2373 C CD2 . TRP A 310 ? 0.3678 0.4389 0.6355 -0.0529 0.1030  -0.1941 310 TRP A CD2 
2374 N NE1 . TRP A 310 ? 0.4121 0.4642 0.7203 -0.0454 0.1039  -0.1999 310 TRP A NE1 
2375 C CE2 . TRP A 310 ? 0.4201 0.4786 0.6989 -0.0478 0.0968  -0.1897 310 TRP A CE2 
2376 C CE3 . TRP A 310 ? 0.3797 0.4585 0.6193 -0.0559 0.0972  -0.1848 310 TRP A CE3 
2377 C CZ2 . TRP A 310 ? 0.4028 0.4572 0.6650 -0.0462 0.0860  -0.1775 310 TRP A CZ2 
2378 C CZ3 . TRP A 310 ? 0.3952 0.4700 0.6212 -0.0533 0.0861  -0.1729 310 TRP A CZ3 
2379 C CH2 . TRP A 310 ? 0.3998 0.4629 0.6366 -0.0489 0.0812  -0.1699 310 TRP A CH2 
2380 N N   . GLY A 311 ? 0.3558 0.4616 0.6430 -0.0756 0.1540  -0.2419 311 GLY A N   
2381 C CA  . GLY A 311 ? 0.3575 0.4751 0.6219 -0.0885 0.1655  -0.2513 311 GLY A CA  
2382 C C   . GLY A 311 ? 0.4260 0.5473 0.6528 -0.0959 0.1591  -0.2456 311 GLY A C   
2383 O O   . GLY A 311 ? 0.4029 0.5180 0.6247 -0.0904 0.1467  -0.2351 311 GLY A O   
2384 N N   . GLU A 312 ? 0.4113 0.5431 0.6114 -0.1091 0.1671  -0.2524 312 GLU A N   
2385 C CA  . GLU A 312 ? 0.4078 0.5448 0.5731 -0.1173 0.1606  -0.2477 312 GLU A CA  
2386 C C   . GLU A 312 ? 0.4117 0.5447 0.5794 -0.1189 0.1599  -0.2558 312 GLU A C   
2387 O O   . GLU A 312 ? 0.3783 0.5101 0.5320 -0.1167 0.1473  -0.2448 312 GLU A O   
2388 C CB  . GLU A 312 ? 0.4497 0.5986 0.5864 -0.1324 0.1697  -0.2540 312 GLU A CB  
2389 C CG  . GLU A 312 ? 0.6198 0.7725 0.7379 -0.1317 0.1620  -0.2368 312 GLU A CG  
2390 C CD  . GLU A 312 ? 1.0575 1.2207 1.1463 -0.1465 0.1700  -0.2398 312 GLU A CD  
2391 O OE1 . GLU A 312 ? 1.0362 1.2044 1.1236 -0.1578 0.1858  -0.2583 312 GLU A OE1 
2392 O OE2 . GLU A 312 ? 1.0499 1.2155 1.1184 -0.1470 0.1613  -0.2237 312 GLU A OE2 
2393 N N   . GLU A 313 ? 0.3703 0.5008 0.5584 -0.1223 0.1736  -0.2752 313 GLU A N   
2394 C CA  . GLU A 313 ? 0.3706 0.4961 0.5648 -0.1247 0.1756  -0.2860 313 GLU A CA  
2395 C C   . GLU A 313 ? 0.4251 0.5386 0.6351 -0.1119 0.1625  -0.2734 313 GLU A C   
2396 O O   . GLU A 313 ? 0.4121 0.5247 0.6086 -0.1138 0.1549  -0.2697 313 GLU A O   
2397 C CB  . GLU A 313 ? 0.3957 0.5189 0.6157 -0.1289 0.1937  -0.3087 313 GLU A CB  
2398 C CG  . GLU A 313 ? 0.5407 0.6755 0.7387 -0.1463 0.2081  -0.3264 313 GLU A CG  
2399 C CD  . GLU A 313 ? 0.9040 1.0392 1.1274 -0.1504 0.2284  -0.3478 313 GLU A CD  
2400 O OE1 . GLU A 313 ? 0.7753 0.9002 1.0376 -0.1409 0.2324  -0.3540 313 GLU A OE1 
2401 O OE2 . GLU A 313 ? 0.9508 1.0968 1.1555 -0.1637 0.2404  -0.3584 313 GLU A OE2 
2402 N N   . GLY A 314 ? 0.3942 0.4992 0.6318 -0.0998 0.1598  -0.2668 314 GLY A N   
2403 C CA  . GLY A 314 ? 0.3721 0.4647 0.6253 -0.0877 0.1474  -0.2537 314 GLY A CA  
2404 C C   . GLY A 314 ? 0.3766 0.4706 0.6053 -0.0851 0.1322  -0.2354 314 GLY A C   
2405 O O   . GLY A 314 ? 0.3567 0.4429 0.5864 -0.0811 0.1240  -0.2289 314 GLY A O   
2406 N N   . PHE A 315 ? 0.3399 0.4434 0.5471 -0.0879 0.1293  -0.2274 315 PHE A N   
2407 C CA  . PHE A 315 ? 0.3376 0.4441 0.5217 -0.0862 0.1160  -0.2107 315 PHE A CA  
2408 C C   . PHE A 315 ? 0.3822 0.4951 0.5431 -0.0952 0.1139  -0.2138 315 PHE A C   
2409 O O   . PHE A 315 ? 0.3646 0.4757 0.5176 -0.0920 0.1031  -0.2033 315 PHE A O   
2410 C CB  . PHE A 315 ? 0.3663 0.4804 0.5370 -0.0872 0.1148  -0.2024 315 PHE A CB  
2411 C CG  . PHE A 315 ? 0.3892 0.5071 0.5363 -0.0866 0.1025  -0.1867 315 PHE A CG  
2412 C CD1 . PHE A 315 ? 0.4307 0.5414 0.5834 -0.0767 0.0911  -0.1723 315 PHE A CD1 
2413 C CD2 . PHE A 315 ? 0.4255 0.5541 0.5456 -0.0964 0.1021  -0.1863 315 PHE A CD2 
2414 C CE1 . PHE A 315 ? 0.4364 0.5505 0.5707 -0.0759 0.0807  -0.1590 315 PHE A CE1 
2415 C CE2 . PHE A 315 ? 0.4619 0.5939 0.5642 -0.0951 0.0901  -0.1713 315 PHE A CE2 
2416 C CZ  . PHE A 315 ? 0.4257 0.5502 0.5365 -0.0846 0.0801  -0.1584 315 PHE A CZ  
2417 N N   . MET A 316 ? 0.3460 0.4674 0.4959 -0.1071 0.1244  -0.2286 316 MET A N   
2418 C CA  . MET A 316 ? 0.3446 0.4737 0.4726 -0.1171 0.1224  -0.2330 316 MET A CA  
2419 C C   . MET A 316 ? 0.3708 0.4918 0.5129 -0.1155 0.1222  -0.2396 316 MET A C   
2420 O O   . MET A 316 ? 0.3726 0.4958 0.5031 -0.1166 0.1131  -0.2336 316 MET A O   
2421 C CB  . MET A 316 ? 0.3983 0.5390 0.5081 -0.1318 0.1335  -0.2470 316 MET A CB  
2422 C CG  . MET A 316 ? 0.4523 0.6018 0.5413 -0.1356 0.1321  -0.2380 316 MET A CG  
2423 S SD  . MET A 316 ? 0.4939 0.6462 0.5648 -0.1291 0.1130  -0.2126 316 MET A SD  
2424 C CE  . MET A 316 ? 0.4698 0.6343 0.5119 -0.1416 0.1067  -0.2142 316 MET A CE  
2425 N N   . ALA A 317 ? 0.3162 0.4270 0.4858 -0.1120 0.1315  -0.2506 317 ALA A N   
2426 C CA  . ALA A 317 ? 0.3054 0.4051 0.4928 -0.1095 0.1321  -0.2562 317 ALA A CA  
2427 C C   . ALA A 317 ? 0.3403 0.4316 0.5304 -0.0992 0.1180  -0.2382 317 ALA A C   
2428 O O   . ALA A 317 ? 0.3181 0.4060 0.5064 -0.1007 0.1141  -0.2383 317 ALA A O   
2429 C CB  . ALA A 317 ? 0.3108 0.4003 0.5302 -0.1057 0.1435  -0.2683 317 ALA A CB  
2430 N N   . HIS A 318 ? 0.2935 0.3823 0.4867 -0.0899 0.1107  -0.2235 318 HIS A N   
2431 C CA  . HIS A 318 ? 0.2882 0.3701 0.4810 -0.0814 0.0982  -0.2069 318 HIS A CA  
2432 C C   . HIS A 318 ? 0.3647 0.4563 0.5326 -0.0858 0.0899  -0.1996 318 HIS A C   
2433 O O   . HIS A 318 ? 0.3713 0.4579 0.5393 -0.0838 0.0836  -0.1942 318 HIS A O   
2434 C CB  . HIS A 318 ? 0.2879 0.3658 0.4889 -0.0719 0.0929  -0.1944 318 HIS A CB  
2435 C CG  . HIS A 318 ? 0.3266 0.3987 0.5231 -0.0652 0.0807  -0.1784 318 HIS A CG  
2436 N ND1 . HIS A 318 ? 0.3504 0.4090 0.5611 -0.0599 0.0771  -0.1744 318 HIS A ND1 
2437 C CD2 . HIS A 318 ? 0.3436 0.4216 0.5229 -0.0639 0.0724  -0.1664 318 HIS A CD2 
2438 C CE1 . HIS A 318 ? 0.3330 0.3902 0.5334 -0.0562 0.0673  -0.1609 318 HIS A CE1 
2439 N NE2 . HIS A 318 ? 0.3330 0.4016 0.5160 -0.0580 0.0644  -0.1561 318 HIS A NE2 
2440 N N   . VAL A 319 ? 0.3209 0.4260 0.4682 -0.0920 0.0897  -0.1990 319 VAL A N   
2441 C CA  . VAL A 319 ? 0.3189 0.4338 0.4453 -0.0957 0.0806  -0.1913 319 VAL A CA  
2442 C C   . VAL A 319 ? 0.3901 0.5076 0.5135 -0.1029 0.0813  -0.2005 319 VAL A C   
2443 O O   . VAL A 319 ? 0.3820 0.5004 0.5019 -0.1014 0.0730  -0.1932 319 VAL A O   
2444 C CB  . VAL A 319 ? 0.3670 0.4946 0.4719 -0.1000 0.0773  -0.1849 319 VAL A CB  
2445 C CG1 . VAL A 319 ? 0.3593 0.4840 0.4691 -0.0946 0.0794  -0.1790 319 VAL A CG1 
2446 C CG2 . VAL A 319 ? 0.3843 0.5240 0.4722 -0.1133 0.0830  -0.1968 319 VAL A CG2 
2447 N N   . ASP A 320 ? 0.3678 0.4854 0.4958 -0.1104 0.0922  -0.2174 320 ASP A N   
2448 C CA  . ASP A 320 ? 0.3830 0.5023 0.5101 -0.1184 0.0946  -0.2288 320 ASP A CA  
2449 C C   . ASP A 320 ? 0.4230 0.5289 0.5673 -0.1123 0.0921  -0.2262 320 ASP A C   
2450 O O   . ASP A 320 ? 0.4265 0.5357 0.5661 -0.1172 0.0889  -0.2285 320 ASP A O   
2451 C CB  . ASP A 320 ? 0.4290 0.5511 0.5572 -0.1286 0.1082  -0.2487 320 ASP A CB  
2452 C CG  . ASP A 320 ? 0.6552 0.7943 0.7564 -0.1402 0.1084  -0.2523 320 ASP A CG  
2453 O OD1 . ASP A 320 ? 0.6848 0.8344 0.7696 -0.1472 0.1013  -0.2513 320 ASP A OD1 
2454 O OD2 . ASP A 320 ? 0.7545 0.8970 0.8508 -0.1423 0.1147  -0.2548 320 ASP A OD2 
2455 N N   . ARG A 321 ? 0.3588 0.4502 0.5222 -0.1022 0.0927  -0.2203 321 ARG A N   
2456 C CA  . ARG A 321 ? 0.3426 0.4195 0.5209 -0.0964 0.0898  -0.2156 321 ARG A CA  
2457 C C   . ARG A 321 ? 0.3805 0.4599 0.5482 -0.0924 0.0781  -0.2000 321 ARG A C   
2458 O O   . ARG A 321 ? 0.3824 0.4567 0.5527 -0.0930 0.0754  -0.1983 321 ARG A O   
2459 C CB  . ARG A 321 ? 0.3284 0.3902 0.5292 -0.0875 0.0926  -0.2129 321 ARG A CB  
2460 C CG  . ARG A 321 ? 0.4529 0.5089 0.6720 -0.0907 0.1049  -0.2295 321 ARG A CG  
2461 C CD  . ARG A 321 ? 0.6243 0.6641 0.8700 -0.0810 0.1059  -0.2256 321 ARG A CD  
2462 N NE  . ARG A 321 ? 0.7425 0.7855 0.9921 -0.0747 0.1046  -0.2194 321 ARG A NE  
2463 C CZ  . ARG A 321 ? 0.9521 1.0000 1.2107 -0.0766 0.1141  -0.2304 321 ARG A CZ  
2464 N NH1 . ARG A 321 ? 0.8500 0.9005 1.1133 -0.0849 0.1262  -0.2488 321 ARG A NH1 
2465 N NH2 . ARG A 321 ? 0.7515 0.8022 1.0145 -0.0709 0.1125  -0.2240 321 ARG A NH2 
2466 N N   . VAL A 322 ? 0.3198 0.4071 0.4759 -0.0890 0.0721  -0.1896 322 VAL A N   
2467 C CA  . VAL A 322 ? 0.2997 0.3905 0.4468 -0.0853 0.0620  -0.1759 322 VAL A CA  
2468 C C   . VAL A 322 ? 0.3742 0.4787 0.5084 -0.0934 0.0586  -0.1794 322 VAL A C   
2469 O O   . VAL A 322 ? 0.3692 0.4725 0.5052 -0.0930 0.0542  -0.1756 322 VAL A O   
2470 C CB  . VAL A 322 ? 0.3118 0.4056 0.4529 -0.0792 0.0572  -0.1643 322 VAL A CB  
2471 C CG1 . VAL A 322 ? 0.2880 0.3856 0.4215 -0.0757 0.0478  -0.1516 322 VAL A CG1 
2472 C CG2 . VAL A 322 ? 0.2986 0.3795 0.4545 -0.0716 0.0595  -0.1611 322 VAL A CG2 
2473 N N   . ILE A 323 ? 0.3537 0.4714 0.4755 -0.1016 0.0609  -0.1872 323 ILE A N   
2474 C CA  . ILE A 323 ? 0.3792 0.5116 0.4885 -0.1105 0.0568  -0.1911 323 ILE A CA  
2475 C C   . ILE A 323 ? 0.4362 0.5637 0.5552 -0.1148 0.0602  -0.2007 323 ILE A C   
2476 O O   . ILE A 323 ? 0.4321 0.5659 0.5492 -0.1167 0.0539  -0.1976 323 ILE A O   
2477 C CB  . ILE A 323 ? 0.4459 0.5916 0.5391 -0.1205 0.0601  -0.1998 323 ILE A CB  
2478 C CG1 . ILE A 323 ? 0.4645 0.6151 0.5467 -0.1174 0.0569  -0.1897 323 ILE A CG1 
2479 C CG2 . ILE A 323 ? 0.4591 0.6203 0.5398 -0.1304 0.0544  -0.2038 323 ILE A CG2 
2480 C CD1 . ILE A 323 ? 0.6121 0.7724 0.6781 -0.1279 0.0633  -0.1990 323 ILE A CD1 
2481 N N   . ASP A 324 ? 0.3991 0.5149 0.5304 -0.1162 0.0702  -0.2122 324 ASP A N   
2482 C CA  . ASP A 324 ? 0.4075 0.5159 0.5497 -0.1206 0.0748  -0.2218 324 ASP A CA  
2483 C C   . ASP A 324 ? 0.4392 0.5384 0.5896 -0.1143 0.0693  -0.2111 324 ASP A C   
2484 O O   . ASP A 324 ? 0.4457 0.5472 0.5974 -0.1196 0.0684  -0.2149 324 ASP A O   
2485 C CB  . ASP A 324 ? 0.4450 0.5405 0.6024 -0.1217 0.0868  -0.2348 324 ASP A CB  
2486 C CG  . ASP A 324 ? 0.6051 0.6901 0.7761 -0.1257 0.0921  -0.2442 324 ASP A CG  
2487 O OD1 . ASP A 324 ? 0.6250 0.7197 0.7892 -0.1359 0.0930  -0.2543 324 ASP A OD1 
2488 O OD2 . ASP A 324 ? 0.6688 0.7356 0.8570 -0.1191 0.0948  -0.2409 324 ASP A OD2 
2489 N N   . PHE A 325 ? 0.3589 0.4483 0.5138 -0.1041 0.0659  -0.1980 325 PHE A N   
2490 C CA  . PHE A 325 ? 0.3463 0.4273 0.5060 -0.0994 0.0612  -0.1878 325 PHE A CA  
2491 C C   . PHE A 325 ? 0.4290 0.5247 0.5787 -0.1011 0.0532  -0.1815 325 PHE A C   
2492 O O   . PHE A 325 ? 0.4594 0.5545 0.6128 -0.1041 0.0524  -0.1823 325 PHE A O   
2493 C CB  . PHE A 325 ? 0.3517 0.4190 0.5173 -0.0894 0.0594  -0.1762 325 PHE A CB  
2494 C CG  . PHE A 325 ? 0.3557 0.4180 0.5201 -0.0854 0.0535  -0.1643 325 PHE A CG  
2495 C CD1 . PHE A 325 ? 0.3798 0.4292 0.5515 -0.0868 0.0555  -0.1638 325 PHE A CD1 
2496 C CD2 . PHE A 325 ? 0.3778 0.4482 0.5336 -0.0812 0.0469  -0.1540 325 PHE A CD2 
2497 C CE1 . PHE A 325 ? 0.3802 0.4257 0.5491 -0.0847 0.0513  -0.1539 325 PHE A CE1 
2498 C CE2 . PHE A 325 ? 0.4011 0.4674 0.5562 -0.0785 0.0430  -0.1448 325 PHE A CE2 
2499 C CZ  . PHE A 325 ? 0.3724 0.4266 0.5333 -0.0806 0.0455  -0.1451 325 PHE A CZ  
2500 N N   . TYR A 326 ? 0.3563 0.4648 0.4952 -0.0992 0.0474  -0.1753 326 TYR A N   
2501 C CA  . TYR A 326 ? 0.3404 0.4631 0.4729 -0.0998 0.0391  -0.1686 326 TYR A CA  
2502 C C   . TYR A 326 ? 0.3607 0.4984 0.4896 -0.1095 0.0374  -0.1776 326 TYR A C   
2503 O O   . TYR A 326 ? 0.3511 0.4984 0.4816 -0.1103 0.0313  -0.1737 326 TYR A O   
2504 C CB  . TYR A 326 ? 0.3564 0.4867 0.4800 -0.0949 0.0332  -0.1585 326 TYR A CB  
2505 C CG  . TYR A 326 ? 0.3923 0.5106 0.5205 -0.0853 0.0321  -0.1474 326 TYR A CG  
2506 C CD1 . TYR A 326 ? 0.4105 0.5286 0.5420 -0.0811 0.0274  -0.1387 326 TYR A CD1 
2507 C CD2 . TYR A 326 ? 0.4057 0.5134 0.5358 -0.0809 0.0361  -0.1465 326 TYR A CD2 
2508 C CE1 . TYR A 326 ? 0.4218 0.5290 0.5558 -0.0737 0.0267  -0.1296 326 TYR A CE1 
2509 C CE2 . TYR A 326 ? 0.4032 0.5007 0.5371 -0.0730 0.0344  -0.1366 326 TYR A CE2 
2510 C CZ  . TYR A 326 ? 0.5028 0.5998 0.6373 -0.0698 0.0297  -0.1283 326 TYR A CZ  
2511 O OH  . TYR A 326 ? 0.5516 0.6387 0.6881 -0.0632 0.0283  -0.1196 326 TYR A OH  
2512 N N   . SER A 327 ? 0.3012 0.4415 0.4265 -0.1173 0.0430  -0.1904 327 SER A N   
2513 C CA  . SER A 327 ? 0.3188 0.4734 0.4397 -0.1281 0.0418  -0.2007 327 SER A CA  
2514 C C   . SER A 327 ? 0.3964 0.5446 0.5300 -0.1310 0.0447  -0.2061 327 SER A C   
2515 O O   . SER A 327 ? 0.3840 0.5452 0.5182 -0.1358 0.0392  -0.2070 327 SER A O   
2516 C CB  . SER A 327 ? 0.3856 0.5431 0.4985 -0.1365 0.0487  -0.2142 327 SER A CB  
2517 O OG  . SER A 327 ? 0.5669 0.7356 0.6762 -0.1484 0.0494  -0.2271 327 SER A OG  
2518 N N   . ASN A 328 ? 0.3729 0.5012 0.5176 -0.1278 0.0527  -0.2084 328 ASN A N   
2519 C CA  . ASN A 328 ? 0.3832 0.5021 0.5395 -0.1306 0.0564  -0.2121 328 ASN A CA  
2520 C C   . ASN A 328 ? 0.4172 0.5378 0.5762 -0.1258 0.0502  -0.2002 328 ASN A C   
2521 O O   . ASN A 328 ? 0.4291 0.5551 0.5934 -0.1312 0.0497  -0.2037 328 ASN A O   
2522 C CB  . ASN A 328 ? 0.4610 0.5566 0.6282 -0.1277 0.0653  -0.2148 328 ASN A CB  
2523 C CG  . ASN A 328 ? 1.0626 1.1542 1.2332 -0.1333 0.0740  -0.2296 328 ASN A CG  
2524 O OD1 . ASN A 328 ? 1.0482 1.1242 1.2313 -0.1351 0.0815  -0.2363 328 ASN A OD1 
2525 N ND2 . ASN A 328 ? 1.0320 1.1361 1.1923 -0.1362 0.0740  -0.2350 328 ASN A ND2 
2526 N N   . GLN A 329 ? 0.3489 0.4659 0.5049 -0.1166 0.0462  -0.1874 329 GLN A N   
2527 C CA  . GLN A 329 ? 0.3473 0.4662 0.5059 -0.1121 0.0413  -0.1769 329 GLN A CA  
2528 C C   . GLN A 329 ? 0.4126 0.5538 0.5703 -0.1160 0.0340  -0.1776 329 GLN A C   
2529 O O   . GLN A 329 ? 0.4122 0.5572 0.5778 -0.1186 0.0336  -0.1781 329 GLN A O   
2530 C CB  . GLN A 329 ? 0.3545 0.4664 0.5093 -0.1022 0.0385  -0.1645 329 GLN A CB  
2531 C CG  . GLN A 329 ? 0.4863 0.5763 0.6444 -0.0976 0.0438  -0.1614 329 GLN A CG  
2532 C CD  . GLN A 329 ? 0.5855 0.6624 0.7489 -0.0977 0.0462  -0.1573 329 GLN A CD  
2533 O OE1 . GLN A 329 ? 0.4984 0.5612 0.6674 -0.1008 0.0516  -0.1613 329 GLN A OE1 
2534 N NE2 . GLN A 329 ? 0.4531 0.5333 0.6151 -0.0947 0.0427  -0.1492 329 GLN A NE2 
2535 N N   . LYS A 330 ? 0.3650 0.5210 0.5135 -0.1174 0.0285  -0.1780 330 LYS A N   
2536 C CA  . LYS A 330 ? 0.3541 0.5324 0.5012 -0.1214 0.0196  -0.1776 330 LYS A CA  
2537 C C   . LYS A 330 ? 0.4204 0.6069 0.5740 -0.1315 0.0210  -0.1892 330 LYS A C   
2538 O O   . LYS A 330 ? 0.4223 0.6213 0.5843 -0.1327 0.0155  -0.1875 330 LYS A O   
2539 C CB  . LYS A 330 ? 0.3779 0.5675 0.5107 -0.1234 0.0147  -0.1770 330 LYS A CB  
2540 C CG  . LYS A 330 ? 0.4055 0.6181 0.5358 -0.1270 0.0031  -0.1736 330 LYS A CG  
2541 C CD  . LYS A 330 ? 0.5046 0.7285 0.6176 -0.1336 -0.0007 -0.1763 330 LYS A CD  
2542 C CE  . LYS A 330 ? 0.5579 0.7913 0.6660 -0.1466 0.0010  -0.1912 330 LYS A CE  
2543 N NZ  . LYS A 330 ? 0.5548 0.7734 0.6597 -0.1505 0.0139  -0.2037 330 LYS A NZ  
2544 N N   . ASP A 331 ? 0.3891 0.5686 0.5409 -0.1386 0.0286  -0.2016 331 ASP A N   
2545 C CA  . ASP A 331 ? 0.4003 0.5858 0.5582 -0.1491 0.0312  -0.2143 331 ASP A CA  
2546 C C   . ASP A 331 ? 0.4456 0.6232 0.6179 -0.1480 0.0346  -0.2126 331 ASP A C   
2547 O O   . ASP A 331 ? 0.4341 0.6250 0.6142 -0.1541 0.0316  -0.2170 331 ASP A O   
2548 C CB  . ASP A 331 ? 0.4409 0.6160 0.5958 -0.1558 0.0409  -0.2280 331 ASP A CB  
2549 C CG  . ASP A 331 ? 0.5932 0.7775 0.7332 -0.1600 0.0397  -0.2332 331 ASP A CG  
2550 O OD1 . ASP A 331 ? 0.6214 0.8259 0.7520 -0.1632 0.0299  -0.2302 331 ASP A OD1 
2551 O OD2 . ASP A 331 ? 0.6529 0.8245 0.7913 -0.1609 0.0486  -0.2405 331 ASP A OD2 
2552 N N   . ALA A 332 ? 0.4059 0.5627 0.5811 -0.1406 0.0403  -0.2056 332 ALA A N   
2553 C CA  . ALA A 332 ? 0.4040 0.5496 0.5893 -0.1398 0.0447  -0.2025 332 ALA A CA  
2554 C C   . ALA A 332 ? 0.4450 0.6030 0.6361 -0.1362 0.0386  -0.1942 332 ALA A C   
2555 O O   . ALA A 332 ? 0.4489 0.6072 0.6500 -0.1401 0.0417  -0.1965 332 ALA A O   
2556 C CB  . ALA A 332 ? 0.4128 0.5333 0.5967 -0.1337 0.0509  -0.1964 332 ALA A CB  
2557 N N   . ILE A 333 ? 0.3831 0.5509 0.5693 -0.1292 0.0308  -0.1852 333 ILE A N   
2558 C CA  . ILE A 333 ? 0.3744 0.5553 0.5689 -0.1253 0.0247  -0.1780 333 ILE A CA  
2559 C C   . ILE A 333 ? 0.4220 0.6272 0.6245 -0.1320 0.0176  -0.1841 333 ILE A C   
2560 O O   . ILE A 333 ? 0.4274 0.6423 0.6441 -0.1328 0.0162  -0.1838 333 ILE A O   
2561 C CB  . ILE A 333 ? 0.4082 0.5890 0.5968 -0.1151 0.0192  -0.1657 333 ILE A CB  
2562 C CG1 . ILE A 333 ? 0.4027 0.5895 0.6029 -0.1100 0.0168  -0.1586 333 ILE A CG1 
2563 C CG2 . ILE A 333 ? 0.4179 0.6128 0.5974 -0.1148 0.0106  -0.1641 333 ILE A CG2 
2564 C CD1 . ILE A 333 ? 0.4890 0.6573 0.6880 -0.1050 0.0234  -0.1529 333 ILE A CD1 
2565 N N   . LEU A 334 ? 0.3463 0.5616 0.5399 -0.1376 0.0133  -0.1902 334 LEU A N   
2566 C CA  . LEU A 334 ? 0.3338 0.5728 0.5318 -0.1453 0.0051  -0.1960 334 LEU A CA  
2567 C C   . LEU A 334 ? 0.4063 0.6473 0.6164 -0.1546 0.0106  -0.2077 334 LEU A C   
2568 O O   . LEU A 334 ? 0.3943 0.6547 0.6172 -0.1585 0.0043  -0.2099 334 LEU A O   
2569 C CB  . LEU A 334 ? 0.3353 0.5818 0.5166 -0.1503 0.0007  -0.2000 334 LEU A CB  
2570 C CG  . LEU A 334 ? 0.3782 0.6414 0.5516 -0.1470 -0.0123 -0.1901 334 LEU A CG  
2571 C CD1 . LEU A 334 ? 0.3613 0.6288 0.5473 -0.1367 -0.0185 -0.1767 334 LEU A CD1 
2572 C CD2 . LEU A 334 ? 0.3869 0.6419 0.5407 -0.1457 -0.0105 -0.1883 334 LEU A CD2 
2573 N N   . ALA A 335 ? 0.3920 0.6129 0.5999 -0.1580 0.0222  -0.2148 335 ALA A N   
2574 C CA  . ALA A 335 ? 0.4119 0.6303 0.6307 -0.1673 0.0294  -0.2259 335 ALA A CA  
2575 C C   . ALA A 335 ? 0.4930 0.7104 0.7268 -0.1647 0.0320  -0.2210 335 ALA A C   
2576 O O   . ALA A 335 ? 0.5193 0.7518 0.7671 -0.1712 0.0304  -0.2270 335 ALA A O   
2577 C CB  . ALA A 335 ? 0.4275 0.6217 0.6409 -0.1702 0.0409  -0.2324 335 ALA A CB  
2578 N N   . ALA A 336 ? 0.4336 0.6348 0.6646 -0.1557 0.0357  -0.2105 336 ALA A N   
2579 C CA  . ALA A 336 ? 0.4337 0.6322 0.6760 -0.1533 0.0395  -0.2057 336 ALA A CA  
2580 C C   . ALA A 336 ? 0.4807 0.7045 0.7370 -0.1510 0.0303  -0.2029 336 ALA A C   
2581 O O   . ALA A 336 ? 0.4703 0.7018 0.7429 -0.1547 0.0332  -0.2064 336 ALA A O   
2582 C CB  . ALA A 336 ? 0.4400 0.6178 0.6731 -0.1445 0.0437  -0.1949 336 ALA A CB  
2583 N N   . ALA A 337 ? 0.4309 0.6678 0.6820 -0.1455 0.0192  -0.1970 337 ALA A N   
2584 C CA  . ALA A 337 ? 0.4183 0.6794 0.6835 -0.1426 0.0083  -0.1930 337 ALA A CA  
2585 C C   . ALA A 337 ? 0.4943 0.7766 0.7722 -0.1527 0.0036  -0.2033 337 ALA A C   
2586 O O   . ALA A 337 ? 0.4837 0.7823 0.7826 -0.1529 0.0002  -0.2036 337 ALA A O   
2587 C CB  . ALA A 337 ? 0.4206 0.6883 0.6744 -0.1359 -0.0025 -0.1838 337 ALA A CB  
2588 N N   . ASP A 338 ? 0.4689 0.7511 0.7354 -0.1615 0.0039  -0.2126 338 ASP A N   
2589 C CA  . ASP A 338 ? 0.4828 0.7848 0.7589 -0.1727 -0.0004 -0.2239 338 ASP A CA  
2590 C C   . ASP A 338 ? 0.5106 0.8107 0.8054 -0.1788 0.0091  -0.2319 338 ASP A C   
2591 O O   . ASP A 338 ? 0.5041 0.8255 0.8188 -0.1825 0.0037  -0.2353 338 ASP A O   
2592 C CB  . ASP A 338 ? 0.5357 0.8342 0.7940 -0.1815 0.0007  -0.2336 338 ASP A CB  
2593 C CG  . ASP A 338 ? 0.8419 1.1532 1.0839 -0.1811 -0.0112 -0.2297 338 ASP A CG  
2594 O OD1 . ASP A 338 ? 0.8693 1.1972 1.1162 -0.1754 -0.0236 -0.2195 338 ASP A OD1 
2595 O OD2 . ASP A 338 ? 0.9685 1.2735 1.1936 -0.1874 -0.0079 -0.2373 338 ASP A OD2 
2596 N N   . LYS A 339 ? 0.4461 0.7206 0.7349 -0.1798 0.0230  -0.2341 339 LYS A N   
2597 C CA  . LYS A 339 ? 0.4379 0.7040 0.7394 -0.1863 0.0345  -0.2407 339 LYS A CA  
2598 C C   . LYS A 339 ? 0.5040 0.7807 0.8263 -0.1833 0.0352  -0.2371 339 LYS A C   
2599 O O   . LYS A 339 ? 0.5225 0.8103 0.8627 -0.1914 0.0384  -0.2457 339 LYS A O   
2600 C CB  . LYS A 339 ? 0.4481 0.6819 0.7355 -0.1851 0.0471  -0.2386 339 LYS A CB  
2601 C CG  . LYS A 339 ? 0.3572 0.5773 0.6522 -0.1940 0.0600  -0.2458 339 LYS A CG  
2602 C CD  . LYS A 339 ? 0.3483 0.5368 0.6278 -0.1921 0.0692  -0.2419 339 LYS A CD  
2603 C CE  . LYS A 339 ? 0.4460 0.6168 0.7298 -0.2014 0.0817  -0.2475 339 LYS A CE  
2604 N NZ  . LYS A 339 ? 0.5398 0.6794 0.8095 -0.1977 0.0887  -0.2402 339 LYS A NZ  
2605 N N   . TRP A 340 ? 0.4431 0.7164 0.7642 -0.1721 0.0332  -0.2255 340 TRP A N   
2606 C CA  . TRP A 340 ? 0.4392 0.7189 0.7793 -0.1687 0.0364  -0.2225 340 TRP A CA  
2607 C C   . TRP A 340 ? 0.5093 0.8135 0.8666 -0.1614 0.0240  -0.2169 340 TRP A C   
2608 O O   . TRP A 340 ? 0.5211 0.8398 0.9031 -0.1627 0.0253  -0.2201 340 TRP A O   
2609 C CB  . TRP A 340 ? 0.4263 0.6803 0.7544 -0.1631 0.0469  -0.2149 340 TRP A CB  
2610 C CG  . TRP A 340 ? 0.4549 0.6827 0.7669 -0.1691 0.0582  -0.2178 340 TRP A CG  
2611 C CD1 . TRP A 340 ? 0.4961 0.7036 0.7865 -0.1660 0.0589  -0.2133 340 TRP A CD1 
2612 C CD2 . TRP A 340 ? 0.4638 0.6831 0.7820 -0.1796 0.0699  -0.2255 340 TRP A CD2 
2613 N NE1 . TRP A 340 ? 0.4992 0.6857 0.7831 -0.1732 0.0697  -0.2171 340 TRP A NE1 
2614 C CE2 . TRP A 340 ? 0.5255 0.7180 0.8249 -0.1819 0.0768  -0.2243 340 TRP A CE2 
2615 C CE3 . TRP A 340 ? 0.4831 0.7148 0.8222 -0.1874 0.0756  -0.2333 340 TRP A CE3 
2616 C CZ2 . TRP A 340 ? 0.5337 0.7103 0.8333 -0.1919 0.0886  -0.2296 340 TRP A CZ2 
2617 C CZ3 . TRP A 340 ? 0.5151 0.7316 0.8534 -0.1979 0.0882  -0.2395 340 TRP A CZ3 
2618 C CH2 . TRP A 340 ? 0.5344 0.7231 0.8525 -0.2002 0.0943  -0.2371 340 TRP A CH2 
2619 N N   . LEU A 341 ? 0.4638 0.7716 0.8094 -0.1536 0.0126  -0.2081 341 LEU A N   
2620 C CA  . LEU A 341 ? 0.4543 0.7818 0.8146 -0.1452 0.0001  -0.1999 341 LEU A CA  
2621 C C   . LEU A 341 ? 0.5077 0.8646 0.8825 -0.1494 -0.0148 -0.2027 341 LEU A C   
2622 O O   . LEU A 341 ? 0.4848 0.8600 0.8795 -0.1432 -0.0248 -0.1965 341 LEU A O   
2623 C CB  . LEU A 341 ? 0.4526 0.7689 0.7941 -0.1349 -0.0047 -0.1876 341 LEU A CB  
2624 C CG  . LEU A 341 ? 0.5087 0.8019 0.8425 -0.1278 0.0061  -0.1816 341 LEU A CG  
2625 C CD1 . LEU A 341 ? 0.5141 0.7821 0.8258 -0.1322 0.0172  -0.1850 341 LEU A CD1 
2626 C CD2 . LEU A 341 ? 0.5429 0.8333 0.8671 -0.1171 -0.0017 -0.1694 341 LEU A CD2 
2627 N N   . THR A 342 ? 0.4922 0.8539 0.8581 -0.1600 -0.0166 -0.2119 342 THR A N   
2628 C CA  . THR A 342 ? 0.5025 0.8927 0.8796 -0.1660 -0.0312 -0.2156 342 THR A CA  
2629 C C   . THR A 342 ? 0.5574 0.9681 0.9706 -0.1666 -0.0329 -0.2189 342 THR A C   
2630 O O   . THR A 342 ? 0.5478 0.9518 0.9730 -0.1713 -0.0194 -0.2273 342 THR A O   
2631 C CB  . THR A 342 ? 0.6444 1.0334 1.0052 -0.1788 -0.0296 -0.2274 342 THR A CB  
2632 O OG1 . THR A 342 ? 0.6969 1.0673 1.0272 -0.1768 -0.0276 -0.2239 342 THR A OG1 
2633 C CG2 . THR A 342 ? 0.6406 1.0598 1.0104 -0.1868 -0.0453 -0.2320 342 THR A CG2 
2634 N N   . GLY A 343 ? 0.5187 0.9530 0.9489 -0.1612 -0.0492 -0.2112 343 GLY A N   
2635 C CA  . GLY A 343 ? 0.5052 0.9625 0.9742 -0.1595 -0.0539 -0.2124 343 GLY A CA  
2636 C C   . GLY A 343 ? 0.5291 0.9811 1.0150 -0.1467 -0.0502 -0.2033 343 GLY A C   
2637 O O   . GLY A 343 ? 0.5210 0.9939 1.0399 -0.1419 -0.0583 -0.2005 343 GLY A O   
2638 N N   . LEU A 344 ? 0.4654 0.8894 0.9295 -0.1411 -0.0381 -0.1988 344 LEU A N   
2639 C CA  . LEU A 344 ? 0.4446 0.8589 0.9196 -0.1301 -0.0316 -0.1917 344 LEU A CA  
2640 C C   . LEU A 344 ? 0.4677 0.8744 0.9269 -0.1192 -0.0404 -0.1772 344 LEU A C   
2641 O O   . LEU A 344 ? 0.4438 0.8477 0.9170 -0.1094 -0.0388 -0.1705 344 LEU A O   
2642 C CB  . LEU A 344 ? 0.4402 0.8283 0.9034 -0.1331 -0.0104 -0.1978 344 LEU A CB  
2643 C CG  . LEU A 344 ? 0.4991 0.8876 0.9706 -0.1452 0.0016  -0.2117 344 LEU A CG  
2644 C CD1 . LEU A 344 ? 0.5006 0.8594 0.9516 -0.1482 0.0200  -0.2142 344 LEU A CD1 
2645 C CD2 . LEU A 344 ? 0.5227 0.9343 1.0352 -0.1465 0.0022  -0.2180 344 LEU A CD2 
2646 N N   . ALA A 345 ? 0.4276 0.8293 0.8570 -0.1214 -0.0481 -0.1733 345 ALA A N   
2647 C CA  . ALA A 345 ? 0.4187 0.8115 0.8291 -0.1128 -0.0553 -0.1602 345 ALA A CA  
2648 C C   . ALA A 345 ? 0.4714 0.8723 0.8594 -0.1174 -0.0690 -0.1567 345 ALA A C   
2649 O O   . ALA A 345 ? 0.4736 0.8823 0.8551 -0.1281 -0.0704 -0.1661 345 ALA A O   
2650 C CB  . ALA A 345 ? 0.4204 0.7835 0.8082 -0.1095 -0.0404 -0.1592 345 ALA A CB  
2651 N N   . GLU A 346 ? 0.4276 0.8256 0.8029 -0.1100 -0.0781 -0.1437 346 GLU A N   
2652 C CA  . GLU A 346 ? 0.4307 0.8345 0.7815 -0.1138 -0.0906 -0.1383 346 GLU A CA  
2653 C C   . GLU A 346 ? 0.4519 0.8330 0.7747 -0.1086 -0.0851 -0.1312 346 GLU A C   
2654 O O   . GLU A 346 ? 0.4243 0.7927 0.7527 -0.0989 -0.0797 -0.1244 346 GLU A O   
2655 C CB  . GLU A 346 ? 0.4569 0.8849 0.8242 -0.1105 -0.1110 -0.1269 346 GLU A CB  
2656 C CG  . GLU A 346 ? 0.6642 1.1181 1.0587 -0.1168 -0.1194 -0.1337 346 GLU A CG  
2657 C CD  . GLU A 346 ? 1.1100 1.5899 1.5117 -0.1182 -0.1425 -0.1241 346 GLU A CD  
2658 O OE1 . GLU A 346 ? 1.1363 1.6187 1.5449 -0.1087 -0.1533 -0.1087 346 GLU A OE1 
2659 O OE2 . GLU A 346 ? 1.0689 1.5670 1.4708 -0.1293 -0.1503 -0.1317 346 GLU A OE2 
2660 N N   . TRP A 347 ? 0.4179 0.7941 0.7114 -0.1158 -0.0856 -0.1341 347 TRP A N   
2661 C CA  . TRP A 347 ? 0.4169 0.7730 0.6841 -0.1122 -0.0800 -0.1289 347 TRP A CA  
2662 C C   . TRP A 347 ? 0.4731 0.8340 0.7128 -0.1200 -0.0873 -0.1287 347 TRP A C   
2663 O O   . TRP A 347 ? 0.4690 0.8444 0.7054 -0.1305 -0.0925 -0.1368 347 TRP A O   
2664 C CB  . TRP A 347 ? 0.3934 0.7253 0.6531 -0.1121 -0.0616 -0.1375 347 TRP A CB  
2665 C CG  . TRP A 347 ? 0.4100 0.7405 0.6644 -0.1232 -0.0541 -0.1523 347 TRP A CG  
2666 C CD1 . TRP A 347 ? 0.4545 0.7765 0.6858 -0.1304 -0.0495 -0.1594 347 TRP A CD1 
2667 C CD2 . TRP A 347 ? 0.4073 0.7442 0.6812 -0.1286 -0.0492 -0.1625 347 TRP A CD2 
2668 N NE1 . TRP A 347 ? 0.4492 0.7711 0.6848 -0.1396 -0.0423 -0.1732 347 TRP A NE1 
2669 C CE2 . TRP A 347 ? 0.4611 0.7920 0.7218 -0.1391 -0.0421 -0.1751 347 TRP A CE2 
2670 C CE3 . TRP A 347 ? 0.4150 0.7624 0.7177 -0.1261 -0.0493 -0.1630 347 TRP A CE3 
2671 C CZ2 . TRP A 347 ? 0.4548 0.7891 0.7290 -0.1472 -0.0357 -0.1871 347 TRP A CZ2 
2672 C CZ3 . TRP A 347 ? 0.4331 0.7847 0.7488 -0.1344 -0.0426 -0.1753 347 TRP A CZ3 
2673 C CH2 . TRP A 347 ? 0.4485 0.7933 0.7496 -0.1449 -0.0360 -0.1868 347 TRP A CH2 
2674 N N   . HIS A 348 ? 0.4478 0.7971 0.6678 -0.1157 -0.0872 -0.1200 348 HIS A N   
2675 C CA  . HIS A 348 ? 0.4647 0.8154 0.6559 -0.1233 -0.0912 -0.1201 348 HIS A CA  
2676 C C   . HIS A 348 ? 0.4938 0.8229 0.6672 -0.1254 -0.0751 -0.1295 348 HIS A C   
2677 O O   . HIS A 348 ? 0.4623 0.7734 0.6409 -0.1174 -0.0648 -0.1282 348 HIS A O   
2678 C CB  . HIS A 348 ? 0.4851 0.8383 0.6674 -0.1176 -0.1021 -0.1034 348 HIS A CB  
2679 C CG  . HIS A 348 ? 0.5405 0.9157 0.7388 -0.1163 -0.1202 -0.0928 348 HIS A CG  
2680 N ND1 . HIS A 348 ? 0.5803 0.9771 0.7803 -0.1265 -0.1311 -0.0978 348 HIS A ND1 
2681 C CD2 . HIS A 348 ? 0.5613 0.9397 0.7753 -0.1062 -0.1295 -0.0775 348 HIS A CD2 
2682 C CE1 . HIS A 348 ? 0.5760 0.9889 0.7939 -0.1217 -0.1472 -0.0847 348 HIS A CE1 
2683 N NE2 . HIS A 348 ? 0.5697 0.9718 0.7969 -0.1093 -0.1468 -0.0721 348 HIS A NE2 
2684 N N   . VAL A 349 ? 0.4624 0.7935 0.6159 -0.1366 -0.0729 -0.1396 349 VAL A N   
2685 C CA  . VAL A 349 ? 0.4511 0.7625 0.5901 -0.1388 -0.0580 -0.1490 349 VAL A CA  
2686 C C   . VAL A 349 ? 0.5041 0.8029 0.6291 -0.1315 -0.0563 -0.1385 349 VAL A C   
2687 O O   . VAL A 349 ? 0.5099 0.8182 0.6212 -0.1335 -0.0658 -0.1302 349 VAL A O   
2688 C CB  . VAL A 349 ? 0.5047 0.8219 0.6279 -0.1529 -0.0553 -0.1636 349 VAL A CB  
2689 C CG1 . VAL A 349 ? 0.5078 0.8039 0.6195 -0.1540 -0.0397 -0.1729 349 VAL A CG1 
2690 C CG2 . VAL A 349 ? 0.4955 0.8243 0.6338 -0.1604 -0.0564 -0.1745 349 VAL A CG2 
2691 N N   . PRO A 350 ? 0.4420 0.7201 0.5709 -0.1234 -0.0450 -0.1379 350 PRO A N   
2692 C CA  . PRO A 350 ? 0.4201 0.6868 0.5376 -0.1168 -0.0430 -0.1287 350 PRO A CA  
2693 C C   . PRO A 350 ? 0.4594 0.7239 0.5541 -0.1247 -0.0388 -0.1350 350 PRO A C   
2694 O O   . PRO A 350 ? 0.4557 0.7147 0.5468 -0.1314 -0.0296 -0.1488 350 PRO A O   
2695 C CB  . PRO A 350 ? 0.4256 0.6721 0.5533 -0.1085 -0.0319 -0.1294 350 PRO A CB  
2696 C CG  . PRO A 350 ? 0.4807 0.7291 0.6261 -0.1096 -0.0295 -0.1357 350 PRO A CG  
2697 C CD  . PRO A 350 ? 0.4477 0.7119 0.5903 -0.1208 -0.0337 -0.1452 350 PRO A CD  
2698 N N   . ALA A 351 ? 0.4207 0.6897 0.5004 -0.1247 -0.0451 -0.1253 351 ALA A N   
2699 C CA  . ALA A 351 ? 0.4344 0.7022 0.4911 -0.1329 -0.0406 -0.1307 351 ALA A CA  
2700 C C   . ALA A 351 ? 0.5066 0.7543 0.5616 -0.1272 -0.0275 -0.1329 351 ALA A C   
2701 O O   . ALA A 351 ? 0.5118 0.7549 0.5551 -0.1339 -0.0184 -0.1436 351 ALA A O   
2702 C CB  . ALA A 351 ? 0.4515 0.7316 0.4924 -0.1359 -0.0525 -0.1183 351 ALA A CB  
2703 N N   . ALA A 352 ? 0.4563 0.6927 0.5244 -0.1152 -0.0265 -0.1235 352 ALA A N   
2704 C CA  . ALA A 352 ? 0.4456 0.6640 0.5148 -0.1087 -0.0163 -0.1236 352 ALA A CA  
2705 C C   . ALA A 352 ? 0.4975 0.7050 0.5844 -0.0976 -0.0154 -0.1170 352 ALA A C   
2706 O O   . ALA A 352 ? 0.4965 0.7110 0.5948 -0.0943 -0.0224 -0.1113 352 ALA A O   
2707 C CB  . ALA A 352 ? 0.4590 0.6776 0.5134 -0.1085 -0.0178 -0.1154 352 ALA A CB  
2708 N N   . GLY A 353 ? 0.4393 0.6306 0.5289 -0.0924 -0.0066 -0.1183 353 GLY A N   
2709 C CA  . GLY A 353 ? 0.4275 0.6071 0.5300 -0.0830 -0.0050 -0.1122 353 GLY A CA  
2710 C C   . GLY A 353 ? 0.4856 0.6571 0.5998 -0.0827 0.0002  -0.1189 353 GLY A C   
2711 O O   . GLY A 353 ? 0.4671 0.6351 0.5805 -0.0882 0.0061  -0.1296 353 GLY A O   
2712 N N   . MET A 354 ? 0.4520 0.6198 0.5772 -0.0765 -0.0015 -0.1126 354 MET A N   
2713 C CA  . MET A 354 ? 0.4487 0.6075 0.5841 -0.0760 0.0036  -0.1166 354 MET A CA  
2714 C C   . MET A 354 ? 0.4448 0.6119 0.5924 -0.0751 -0.0003 -0.1142 354 MET A C   
2715 O O   . MET A 354 ? 0.4170 0.5759 0.5721 -0.0747 0.0046  -0.1164 354 MET A O   
2716 C CB  . MET A 354 ? 0.4884 0.6289 0.6241 -0.0703 0.0093  -0.1135 354 MET A CB  
2717 C CG  . MET A 354 ? 0.5586 0.6971 0.6932 -0.0632 0.0062  -0.1032 354 MET A CG  
2718 S SD  . MET A 354 ? 0.6387 0.7575 0.7728 -0.0575 0.0113  -0.0995 354 MET A SD  
2719 C CE  . MET A 354 ? 0.6001 0.7149 0.7275 -0.0598 0.0152  -0.1052 354 MET A CE  
2720 N N   . PHE A 355 ? 0.4109 0.5945 0.5613 -0.0754 -0.0088 -0.1101 355 PHE A N   
2721 C CA  . PHE A 355 ? 0.4062 0.5992 0.5723 -0.0741 -0.0124 -0.1083 355 PHE A CA  
2722 C C   . PHE A 355 ? 0.4433 0.6547 0.6153 -0.0807 -0.0186 -0.1132 355 PHE A C   
2723 O O   . PHE A 355 ? 0.4401 0.6621 0.6024 -0.0852 -0.0246 -0.1136 355 PHE A O   
2724 C CB  . PHE A 355 ? 0.4230 0.6180 0.5958 -0.0661 -0.0174 -0.0971 355 PHE A CB  
2725 C CG  . PHE A 355 ? 0.4339 0.6121 0.6020 -0.0600 -0.0120 -0.0924 355 PHE A CG  
2726 C CD1 . PHE A 355 ? 0.4640 0.6285 0.6352 -0.0589 -0.0039 -0.0955 355 PHE A CD1 
2727 C CD2 . PHE A 355 ? 0.4575 0.6337 0.6170 -0.0562 -0.0152 -0.0848 355 PHE A CD2 
2728 C CE1 . PHE A 355 ? 0.4658 0.6158 0.6319 -0.0541 0.0000  -0.0911 355 PHE A CE1 
2729 C CE2 . PHE A 355 ? 0.4818 0.6434 0.6378 -0.0512 -0.0105 -0.0811 355 PHE A CE2 
2730 C CZ  . PHE A 355 ? 0.4497 0.5988 0.6091 -0.0502 -0.0034 -0.0843 355 PHE A CZ  
2731 N N   . LEU A 356 ? 0.3934 0.6093 0.5812 -0.0818 -0.0171 -0.1170 356 LEU A N   
2732 C CA  . LEU A 356 ? 0.3978 0.6326 0.5967 -0.0874 -0.0232 -0.1215 356 LEU A CA  
2733 C C   . LEU A 356 ? 0.4423 0.6866 0.6614 -0.0813 -0.0284 -0.1147 356 LEU A C   
2734 O O   . LEU A 356 ? 0.4337 0.6689 0.6628 -0.0774 -0.0212 -0.1148 356 LEU A O   
2735 C CB  . LEU A 356 ? 0.4021 0.6336 0.6052 -0.0949 -0.0154 -0.1336 356 LEU A CB  
2736 C CG  . LEU A 356 ? 0.4649 0.7165 0.6793 -0.1023 -0.0212 -0.1402 356 LEU A CG  
2737 C CD1 . LEU A 356 ? 0.4717 0.7354 0.6725 -0.1089 -0.0290 -0.1426 356 LEU A CD1 
2738 C CD2 . LEU A 356 ? 0.4914 0.7371 0.7132 -0.1088 -0.0117 -0.1512 356 LEU A CD2 
2739 N N   . TRP A 357 ? 0.4090 0.6712 0.6339 -0.0805 -0.0408 -0.1084 357 TRP A N   
2740 C CA  . TRP A 357 ? 0.4136 0.6869 0.6606 -0.0740 -0.0478 -0.1008 357 TRP A CA  
2741 C C   . TRP A 357 ? 0.4718 0.7637 0.7392 -0.0789 -0.0520 -0.1073 357 TRP A C   
2742 O O   . TRP A 357 ? 0.4992 0.8073 0.7641 -0.0849 -0.0619 -0.1083 357 TRP A O   
2743 C CB  . TRP A 357 ? 0.4144 0.6947 0.6546 -0.0702 -0.0599 -0.0884 357 TRP A CB  
2744 C CG  . TRP A 357 ? 0.4338 0.7225 0.6960 -0.0620 -0.0680 -0.0779 357 TRP A CG  
2745 C CD1 . TRP A 357 ? 0.4775 0.7839 0.7481 -0.0613 -0.0832 -0.0691 357 TRP A CD1 
2746 C CD2 . TRP A 357 ? 0.4302 0.7081 0.7065 -0.0531 -0.0619 -0.0739 357 TRP A CD2 
2747 N NE1 . TRP A 357 ? 0.4702 0.7774 0.7623 -0.0518 -0.0867 -0.0598 357 TRP A NE1 
2748 C CE2 . TRP A 357 ? 0.4798 0.7698 0.7761 -0.0469 -0.0731 -0.0635 357 TRP A CE2 
2749 C CE3 . TRP A 357 ? 0.4436 0.7032 0.7182 -0.0503 -0.0481 -0.0784 357 TRP A CE3 
2750 C CZ2 . TRP A 357 ? 0.4630 0.7469 0.7788 -0.0379 -0.0698 -0.0587 357 TRP A CZ2 
2751 C CZ3 . TRP A 357 ? 0.4565 0.7108 0.7479 -0.0424 -0.0450 -0.0740 357 TRP A CZ3 
2752 C CH2 . TRP A 357 ? 0.4654 0.7315 0.7777 -0.0362 -0.0551 -0.0649 357 TRP A CH2 
2753 N N   . ILE A 358 ? 0.3991 0.6885 0.6856 -0.0775 -0.0436 -0.1126 358 ILE A N   
2754 C CA  . ILE A 358 ? 0.3857 0.6911 0.6947 -0.0823 -0.0444 -0.1204 358 ILE A CA  
2755 C C   . ILE A 358 ? 0.4166 0.7373 0.7561 -0.0756 -0.0516 -0.1146 358 ILE A C   
2756 O O   . ILE A 358 ? 0.4051 0.7168 0.7543 -0.0680 -0.0461 -0.1107 358 ILE A O   
2757 C CB  . ILE A 358 ? 0.4184 0.7099 0.7277 -0.0871 -0.0286 -0.1315 358 ILE A CB  
2758 C CG1 . ILE A 358 ? 0.4296 0.7077 0.7134 -0.0941 -0.0226 -0.1377 358 ILE A CG1 
2759 C CG2 . ILE A 358 ? 0.4096 0.7163 0.7446 -0.0919 -0.0269 -0.1399 358 ILE A CG2 
2760 C CD1 . ILE A 358 ? 0.5206 0.7754 0.7947 -0.0936 -0.0090 -0.1401 358 ILE A CD1 
2761 N N   . LYS A 359 ? 0.3872 0.7313 0.7436 -0.0786 -0.0637 -0.1149 359 LYS A N   
2762 C CA  . LYS A 359 ? 0.3815 0.7428 0.7724 -0.0725 -0.0715 -0.1102 359 LYS A CA  
2763 C C   . LYS A 359 ? 0.4375 0.8092 0.8523 -0.0780 -0.0649 -0.1226 359 LYS A C   
2764 O O   . LYS A 359 ? 0.4336 0.8182 0.8472 -0.0868 -0.0695 -0.1293 359 LYS A O   
2765 C CB  . LYS A 359 ? 0.4176 0.7997 0.8128 -0.0721 -0.0920 -0.1002 359 LYS A CB  
2766 C CG  . LYS A 359 ? 0.5709 0.9695 1.0050 -0.0640 -0.1011 -0.0935 359 LYS A CG  
2767 C CD  . LYS A 359 ? 0.7308 1.1502 1.1698 -0.0639 -0.1230 -0.0821 359 LYS A CD  
2768 C CE  . LYS A 359 ? 0.9101 1.3417 1.3887 -0.0536 -0.1318 -0.0730 359 LYS A CE  
2769 N NZ  . LYS A 359 ? 1.0540 1.5075 1.5406 -0.0537 -0.1552 -0.0606 359 LYS A NZ  
2770 N N   . VAL A 360 ? 0.3980 0.7649 0.8349 -0.0736 -0.0536 -0.1262 360 VAL A N   
2771 C CA  . VAL A 360 ? 0.4015 0.7788 0.8634 -0.0792 -0.0459 -0.1384 360 VAL A CA  
2772 C C   . VAL A 360 ? 0.4641 0.8701 0.9617 -0.0769 -0.0605 -0.1359 360 VAL A C   
2773 O O   . VAL A 360 ? 0.4521 0.8641 0.9707 -0.0672 -0.0675 -0.1268 360 VAL A O   
2774 C CB  . VAL A 360 ? 0.4400 0.8021 0.9103 -0.0779 -0.0270 -0.1449 360 VAL A CB  
2775 C CG1 . VAL A 360 ? 0.4285 0.7994 0.9181 -0.0865 -0.0174 -0.1585 360 VAL A CG1 
2776 C CG2 . VAL A 360 ? 0.4379 0.7719 0.8724 -0.0789 -0.0159 -0.1442 360 VAL A CG2 
2777 N N   . LYS A 361 ? 0.4448 0.8682 0.9488 -0.0861 -0.0660 -0.1435 361 LYS A N   
2778 C CA  . LYS A 361 ? 0.4568 0.9100 0.9926 -0.0864 -0.0819 -0.1421 361 LYS A CA  
2779 C C   . LYS A 361 ? 0.5414 1.0085 1.1237 -0.0783 -0.0822 -0.1414 361 LYS A C   
2780 O O   . LYS A 361 ? 0.5445 1.0267 1.1468 -0.0708 -0.0987 -0.1301 361 LYS A O   
2781 C CB  . LYS A 361 ? 0.4836 0.9506 1.0182 -0.0994 -0.0834 -0.1538 361 LYS A CB  
2782 C CG  . LYS A 361 ? 0.6248 1.0951 1.1276 -0.1059 -0.0964 -0.1501 361 LYS A CG  
2783 C CD  . LYS A 361 ? 0.6795 1.1776 1.1981 -0.1153 -0.1089 -0.1564 361 LYS A CD  
2784 C CE  . LYS A 361 ? 0.7552 1.2568 1.2406 -0.1245 -0.1196 -0.1559 361 LYS A CE  
2785 N NZ  . LYS A 361 ? 0.8187 1.3030 1.2775 -0.1349 -0.1041 -0.1694 361 LYS A NZ  
2786 N N   . GLY A 362 ? 0.5127 0.9746 1.1122 -0.0804 -0.0641 -0.1532 362 GLY A N   
2787 C CA  . GLY A 362 ? 0.5169 0.9925 1.1633 -0.0743 -0.0609 -0.1562 362 GLY A CA  
2788 C C   . GLY A 362 ? 0.5868 1.0495 1.2436 -0.0627 -0.0547 -0.1498 362 GLY A C   
2789 O O   . GLY A 362 ? 0.5778 1.0542 1.2666 -0.0533 -0.0659 -0.1418 362 GLY A O   
2790 N N   . ILE A 363 ? 0.5679 1.0042 1.1991 -0.0638 -0.0367 -0.1536 363 ILE A N   
2791 C CA  . ILE A 363 ? 0.5756 0.9959 1.2113 -0.0552 -0.0267 -0.1505 363 ILE A CA  
2792 C C   . ILE A 363 ? 0.6464 1.0641 1.2789 -0.0438 -0.0414 -0.1341 363 ILE A C   
2793 O O   . ILE A 363 ? 0.6543 1.0735 1.2634 -0.0442 -0.0563 -0.1243 363 ILE A O   
2794 C CB  . ILE A 363 ? 0.6149 1.0075 1.2190 -0.0607 -0.0056 -0.1579 363 ILE A CB  
2795 C CG1 . ILE A 363 ? 0.6228 1.0089 1.1990 -0.0734 0.0011  -0.1663 363 ILE A CG1 
2796 C CG2 . ILE A 363 ? 0.6255 1.0132 1.2538 -0.0589 0.0122  -0.1666 363 ILE A CG2 
2797 C CD1 . ILE A 363 ? 0.7145 1.1158 1.3148 -0.0838 0.0097  -0.1811 363 ILE A CD1 
2798 N N   . ASN A 364 ? 0.5968 1.0100 1.2534 -0.0345 -0.0361 -0.1317 364 ASN A N   
2799 C CA  . ASN A 364 ? 0.5931 1.0020 1.2523 -0.0233 -0.0474 -0.1168 364 ASN A CA  
2800 C C   . ASN A 364 ? 0.6379 1.0184 1.2645 -0.0214 -0.0356 -0.1147 364 ASN A C   
2801 O O   . ASN A 364 ? 0.6370 1.0088 1.2442 -0.0162 -0.0454 -0.1017 364 ASN A O   
2802 C CB  . ASN A 364 ? 0.6088 1.0324 1.3213 -0.0137 -0.0504 -0.1156 364 ASN A CB  
2803 C CG  . ASN A 364 ? 1.0823 1.5360 1.8324 -0.0140 -0.0648 -0.1158 364 ASN A CG  
2804 O OD1 . ASN A 364 ? 1.0731 1.5393 1.8112 -0.0170 -0.0829 -0.1078 364 ASN A OD1 
2805 N ND2 . ASN A 364 ? 1.0187 1.4855 1.8166 -0.0111 -0.0572 -0.1250 364 ASN A ND2 
2806 N N   . ASP A 365 ? 0.5791 0.9456 1.2000 -0.0262 -0.0146 -0.1273 365 ASP A N   
2807 C CA  . ASP A 365 ? 0.5691 0.9095 1.1600 -0.0260 -0.0022 -0.1272 365 ASP A CA  
2808 C C   . ASP A 365 ? 0.6007 0.9276 1.1587 -0.0373 0.0111  -0.1368 365 ASP A C   
2809 O O   . ASP A 365 ? 0.5922 0.9216 1.1622 -0.0440 0.0245  -0.1493 365 ASP A O   
2810 C CB  . ASP A 365 ? 0.5937 0.9284 1.2114 -0.0201 0.0101  -0.1318 365 ASP A CB  
2811 C CG  . ASP A 365 ? 0.7793 1.0881 1.3663 -0.0210 0.0229  -0.1327 365 ASP A CG  
2812 O OD1 . ASP A 365 ? 0.7972 1.0964 1.3783 -0.0280 0.0409  -0.1448 365 ASP A OD1 
2813 O OD2 . ASP A 365 ? 0.8594 1.1575 1.4267 -0.0157 0.0146  -0.1211 365 ASP A OD2 
2814 N N   . VAL A 366 ? 0.5464 0.8589 1.0641 -0.0397 0.0074  -0.1307 366 VAL A N   
2815 C CA  . VAL A 366 ? 0.5418 0.8401 1.0269 -0.0496 0.0173  -0.1372 366 VAL A CA  
2816 C C   . VAL A 366 ? 0.6109 0.8856 1.0757 -0.0511 0.0327  -0.1403 366 VAL A C   
2817 O O   . VAL A 366 ? 0.6023 0.8644 1.0441 -0.0596 0.0426  -0.1460 366 VAL A O   
2818 C CB  . VAL A 366 ? 0.5811 0.8787 1.0377 -0.0520 0.0050  -0.1305 366 VAL A CB  
2819 C CG1 . VAL A 366 ? 0.5736 0.8515 0.9983 -0.0485 0.0040  -0.1220 366 VAL A CG1 
2820 C CG2 . VAL A 366 ? 0.5797 0.8774 1.0238 -0.0629 0.0104  -0.1396 366 VAL A CG2 
2821 N N   . LYS A 367 ? 0.5840 0.8528 1.0578 -0.0434 0.0343  -0.1361 367 LYS A N   
2822 C CA  . LYS A 367 ? 0.5913 0.8394 1.0480 -0.0448 0.0480  -0.1391 367 LYS A CA  
2823 C C   . LYS A 367 ? 0.6755 0.9230 1.1434 -0.0529 0.0655  -0.1530 367 LYS A C   
2824 O O   . LYS A 367 ? 0.6746 0.9049 1.1176 -0.0599 0.0775  -0.1573 367 LYS A O   
2825 C CB  . LYS A 367 ? 0.6161 0.8607 1.0851 -0.0349 0.0453  -0.1326 367 LYS A CB  
2826 C CG  . LYS A 367 ? 0.7782 1.0006 1.2223 -0.0361 0.0553  -0.1330 367 LYS A CG  
2827 C CD  . LYS A 367 ? 0.9080 1.1251 1.3522 -0.0266 0.0471  -0.1224 367 LYS A CD  
2828 C CE  . LYS A 367 ? 1.0327 1.2334 1.4705 -0.0267 0.0591  -0.1262 367 LYS A CE  
2829 N NZ  . LYS A 367 ? 1.1261 1.3337 1.6009 -0.0237 0.0679  -0.1341 367 LYS A NZ  
2830 N N   . GLU A 368 ? 0.6591 0.9262 1.1641 -0.0527 0.0664  -0.1596 368 GLU A N   
2831 C CA  . GLU A 368 ? 0.6786 0.9493 1.1999 -0.0608 0.0829  -0.1736 368 GLU A CA  
2832 C C   . GLU A 368 ? 0.7703 1.0358 1.2677 -0.0728 0.0886  -0.1788 368 GLU A C   
2833 O O   . GLU A 368 ? 0.7887 1.0439 1.2764 -0.0821 0.1050  -0.1877 368 GLU A O   
2834 C CB  . GLU A 368 ? 0.6961 0.9914 1.2678 -0.0559 0.0800  -0.1783 368 GLU A CB  
2835 C CG  . GLU A 368 ? 0.8711 1.1827 1.4621 -0.0642 0.0845  -0.1886 368 GLU A CG  
2836 C CD  . GLU A 368 ? 1.1642 1.4921 1.7579 -0.0642 0.0675  -0.1833 368 GLU A CD  
2837 O OE1 . GLU A 368 ? 1.0323 1.3513 1.5931 -0.0642 0.0573  -0.1743 368 GLU A OE1 
2838 O OE2 . GLU A 368 ? 1.0745 1.4243 1.7034 -0.0652 0.0650  -0.1892 368 GLU A OE2 
2839 N N   . LEU A 369 ? 0.7276 0.9996 1.2149 -0.0733 0.0753  -0.1732 369 LEU A N   
2840 C CA  . LEU A 369 ? 0.7282 0.9969 1.1966 -0.0838 0.0781  -0.1774 369 LEU A CA  
2841 C C   . LEU A 369 ? 0.7857 1.0288 1.2121 -0.0898 0.0850  -0.1752 369 LEU A C   
2842 O O   . LEU A 369 ? 0.7946 1.0303 1.2106 -0.1003 0.0961  -0.1820 369 LEU A O   
2843 C CB  . LEU A 369 ? 0.7256 1.0093 1.1970 -0.0819 0.0611  -0.1723 369 LEU A CB  
2844 C CG  . LEU A 369 ? 0.7872 1.0865 1.2750 -0.0903 0.0624  -0.1813 369 LEU A CG  
2845 C CD1 . LEU A 369 ? 0.7807 1.1072 1.3041 -0.0845 0.0486  -0.1799 369 LEU A CD1 
2846 C CD2 . LEU A 369 ? 0.8215 1.1126 1.2798 -0.0973 0.0590  -0.1804 369 LEU A CD2 
2847 N N   . ILE A 370 ? 0.7343 0.9643 1.1376 -0.0836 0.0781  -0.1653 370 ILE A N   
2848 C CA  . ILE A 370 ? 0.7409 0.9473 1.1066 -0.0880 0.0826  -0.1618 370 ILE A CA  
2849 C C   . ILE A 370 ? 0.8123 1.0045 1.1693 -0.0956 0.0998  -0.1684 370 ILE A C   
2850 O O   . ILE A 370 ? 0.8226 1.0000 1.1558 -0.1045 0.1066  -0.1695 370 ILE A O   
2851 C CB  . ILE A 370 ? 0.7721 0.9699 1.1203 -0.0791 0.0718  -0.1505 370 ILE A CB  
2852 C CG1 . ILE A 370 ? 0.7669 0.9742 1.1121 -0.0760 0.0570  -0.1448 370 ILE A CG1 
2853 C CG2 . ILE A 370 ? 0.7834 0.9569 1.0981 -0.0823 0.0777  -0.1472 370 ILE A CG2 
2854 C CD1 . ILE A 370 ? 0.8130 1.0186 1.1499 -0.0668 0.0454  -0.1342 370 ILE A CD1 
2855 N N   . GLU A 371 ? 0.7572 0.9542 1.1345 -0.0926 0.1068  -0.1728 371 GLU A N   
2856 C CA  . GLU A 371 ? 0.9334 1.1196 1.3052 -0.1001 0.1237  -0.1805 371 GLU A CA  
2857 C C   . GLU A 371 ? 1.2301 1.4212 1.6101 -0.1118 0.1359  -0.1910 371 GLU A C   
2858 O O   . GLU A 371 ? 0.7517 0.9296 1.1059 -0.1211 0.1403  -0.1906 371 GLU A O   
2859 C CB  . GLU A 371 ? 0.9474 1.1409 1.3455 -0.0932 0.1275  -0.1840 371 GLU A CB  
2860 C CG  . GLU A 371 ? 1.1051 1.2857 1.4936 -0.1005 0.1447  -0.1918 371 GLU A CG  
2861 C CD  . GLU A 371 ? 1.4224 1.5843 1.7827 -0.0986 0.1439  -0.1854 371 GLU A CD  
2862 O OE1 . GLU A 371 ? 1.4915 1.6449 1.8287 -0.0947 0.1318  -0.1745 371 GLU A OE1 
2863 O OE2 . GLU A 371 ? 1.2959 1.4519 1.6574 -0.1018 0.1560  -0.1924 371 GLU A OE2 
2864 N N   . GLY A 378 ? 0.9056 1.0425 1.1523 -0.0975 0.0742  -0.1412 378 GLY A N   
2865 C CA  . GLY A 378 ? 0.9046 1.0291 1.1329 -0.0917 0.0687  -0.1328 378 GLY A CA  
2866 C C   . GLY A 378 ? 0.9675 1.0794 1.1772 -0.0939 0.0657  -0.1297 378 GLY A C   
2867 O O   . GLY A 378 ? 0.9899 1.1049 1.2025 -0.0990 0.0659  -0.1340 378 GLY A O   
2868 N N   . VAL A 379 ? 0.8986 0.9957 1.0905 -0.0905 0.0632  -0.1227 379 VAL A N   
2869 C CA  . VAL A 379 ? 0.8871 0.9703 1.0627 -0.0909 0.0599  -0.1185 379 VAL A CA  
2870 C C   . VAL A 379 ? 0.8587 0.9509 1.0370 -0.0839 0.0505  -0.1163 379 VAL A C   
2871 O O   . VAL A 379 ? 0.8465 0.9322 1.0159 -0.0785 0.0464  -0.1104 379 VAL A O   
2872 C CB  . VAL A 379 ? 0.9572 1.0310 1.1277 -0.0994 0.0645  -0.1218 379 VAL A CB  
2873 C CG1 . VAL A 379 ? 0.9568 1.0155 1.1140 -0.0980 0.0607  -0.1169 379 VAL A CG1 
2874 C CG2 . VAL A 379 ? 0.9707 1.0350 1.1363 -0.1078 0.0745  -0.1235 379 VAL A CG2 
2875 N N   . LEU A 380 ? 0.7570 0.8644 0.9471 -0.0850 0.0474  -0.1212 380 LEU A N   
2876 C CA  . LEU A 380 ? 0.7248 0.8428 0.9164 -0.0808 0.0389  -0.1202 380 LEU A CA  
2877 C C   . LEU A 380 ? 0.7037 0.8412 0.9104 -0.0766 0.0332  -0.1197 380 LEU A C   
2878 O O   . LEU A 380 ? 0.6879 0.8333 0.8935 -0.0723 0.0255  -0.1162 380 LEU A O   
2879 C CB  . LEU A 380 ? 0.7327 0.8519 0.9229 -0.0864 0.0387  -0.1261 380 LEU A CB  
2880 C CG  . LEU A 380 ? 0.7902 0.9176 0.9918 -0.0940 0.0426  -0.1342 380 LEU A CG  
2881 C CD1 . LEU A 380 ? 0.7832 0.9256 0.9901 -0.0966 0.0370  -0.1397 380 LEU A CD1 
2882 C CD2 . LEU A 380 ? 0.8264 0.9362 1.0211 -0.1009 0.0511  -0.1366 380 LEU A CD2 
2883 N N   . MET A 381 ? 0.6241 0.7689 0.8454 -0.0779 0.0372  -0.1226 381 MET A N   
2884 C CA  . MET A 381 ? 0.5995 0.7633 0.8403 -0.0738 0.0317  -0.1221 381 MET A CA  
2885 C C   . MET A 381 ? 0.6250 0.7872 0.8727 -0.0677 0.0333  -0.1179 381 MET A C   
2886 O O   . MET A 381 ? 0.6385 0.7868 0.8785 -0.0692 0.0413  -0.1183 381 MET A O   
2887 C CB  . MET A 381 ? 0.6261 0.8037 0.8851 -0.0796 0.0342  -0.1300 381 MET A CB  
2888 C CG  . MET A 381 ? 0.6677 0.8498 0.9226 -0.0859 0.0316  -0.1351 381 MET A CG  
2889 S SD  . MET A 381 ? 0.7133 0.9099 0.9891 -0.0942 0.0359  -0.1454 381 MET A SD  
2890 C CE  . MET A 381 ? 0.6817 0.8561 0.9450 -0.1019 0.0502  -0.1493 381 MET A CE  
2891 N N   . LEU A 382 ? 0.5513 0.7274 0.8132 -0.0613 0.0252  -0.1136 382 LEU A N   
2892 C CA  . LEU A 382 ? 0.5335 0.7107 0.8077 -0.0547 0.0256  -0.1098 382 LEU A CA  
2893 C C   . LEU A 382 ? 0.5676 0.7653 0.8670 -0.0499 0.0166  -0.1074 382 LEU A C   
2894 O O   . LEU A 382 ? 0.5592 0.7687 0.8588 -0.0509 0.0074  -0.1058 382 LEU A O   
2895 C CB  . LEU A 382 ? 0.5279 0.6908 0.7853 -0.0499 0.0247  -0.1028 382 LEU A CB  
2896 C CG  . LEU A 382 ? 0.5771 0.7460 0.8354 -0.0430 0.0143  -0.0941 382 LEU A CG  
2897 C CD1 . LEU A 382 ? 0.5730 0.7308 0.8275 -0.0379 0.0165  -0.0892 382 LEU A CD1 
2898 C CD2 . LEU A 382 ? 0.6153 0.7832 0.8557 -0.0449 0.0085  -0.0917 382 LEU A CD2 
2899 N N   . PRO A 383 ? 0.5104 0.7131 0.8322 -0.0451 0.0189  -0.1074 383 PRO A N   
2900 C CA  . PRO A 383 ? 0.4897 0.7123 0.8391 -0.0404 0.0095  -0.1045 383 PRO A CA  
2901 C C   . PRO A 383 ? 0.4683 0.6940 0.8163 -0.0330 -0.0028 -0.0927 383 PRO A C   
2902 O O   . PRO A 383 ? 0.4438 0.6560 0.7787 -0.0293 -0.0012 -0.0875 383 PRO A O   
2903 C CB  . PRO A 383 ? 0.5166 0.7419 0.8925 -0.0388 0.0188  -0.1105 383 PRO A CB  
2904 C CG  . PRO A 383 ? 0.5888 0.7946 0.9466 -0.0431 0.0328  -0.1158 383 PRO A CG  
2905 C CD  . PRO A 383 ? 0.5340 0.7252 0.8587 -0.0446 0.0303  -0.1107 383 PRO A CD  
2906 N N   . GLY A 384 ? 0.4067 0.6505 0.7686 -0.0315 -0.0152 -0.0884 384 GLY A N   
2907 C CA  . GLY A 384 ? 0.4023 0.6520 0.7633 -0.0260 -0.0289 -0.0760 384 GLY A CA  
2908 C C   . GLY A 384 ? 0.4403 0.6842 0.8136 -0.0172 -0.0300 -0.0679 384 GLY A C   
2909 O O   . GLY A 384 ? 0.4461 0.6876 0.8087 -0.0138 -0.0386 -0.0572 384 GLY A O   
2910 N N   . ASN A 385 ? 0.3817 0.6233 0.7780 -0.0142 -0.0206 -0.0735 385 ASN A N   
2911 C CA  . ASN A 385 ? 0.3703 0.6060 0.7838 -0.0062 -0.0189 -0.0687 385 ASN A CA  
2912 C C   . ASN A 385 ? 0.4178 0.6371 0.8072 -0.0036 -0.0195 -0.0606 385 ASN A C   
2913 O O   . ASN A 385 ? 0.4364 0.6564 0.8343 0.0027  -0.0278 -0.0499 385 ASN A O   
2914 C CB  . ASN A 385 ? 0.3540 0.5846 0.7851 -0.0070 -0.0033 -0.0804 385 ASN A CB  
2915 C CG  . ASN A 385 ? 0.7027 0.9492 1.1595 -0.0101 -0.0005 -0.0896 385 ASN A CG  
2916 O OD1 . ASN A 385 ? 0.6588 0.9052 1.1036 -0.0182 0.0060  -0.0983 385 ASN A OD1 
2917 N ND2 . ASN A 385 ? 0.6426 0.9032 1.1370 -0.0039 -0.0055 -0.0878 385 ASN A ND2 
2918 N N   . ALA A 386 ? 0.3467 0.5518 0.7069 -0.0089 -0.0116 -0.0651 386 ALA A N   
2919 C CA  . ALA A 386 ? 0.3413 0.5308 0.6777 -0.0077 -0.0106 -0.0597 386 ALA A CA  
2920 C C   . ALA A 386 ? 0.3588 0.5511 0.6828 -0.0056 -0.0231 -0.0476 386 ALA A C   
2921 O O   . ALA A 386 ? 0.3717 0.5528 0.6835 -0.0032 -0.0228 -0.0417 386 ALA A O   
2922 C CB  . ALA A 386 ? 0.3541 0.5316 0.6639 -0.0145 -0.0020 -0.0669 386 ALA A CB  
2923 N N   . PHE A 387 ? 0.2823 0.4894 0.6072 -0.0077 -0.0334 -0.0445 387 PHE A N   
2924 C CA  . PHE A 387 ? 0.2741 0.4849 0.5826 -0.0082 -0.0447 -0.0342 387 PHE A CA  
2925 C C   . PHE A 387 ? 0.3380 0.5589 0.6656 -0.0025 -0.0572 -0.0219 387 PHE A C   
2926 O O   . PHE A 387 ? 0.3482 0.5760 0.6641 -0.0041 -0.0686 -0.0126 387 PHE A O   
2927 C CB  . PHE A 387 ? 0.2896 0.5088 0.5814 -0.0161 -0.0478 -0.0392 387 PHE A CB  
2928 C CG  . PHE A 387 ? 0.2944 0.5028 0.5709 -0.0213 -0.0358 -0.0506 387 PHE A CG  
2929 C CD1 . PHE A 387 ? 0.3198 0.5312 0.6084 -0.0242 -0.0289 -0.0609 387 PHE A CD1 
2930 C CD2 . PHE A 387 ? 0.3154 0.5104 0.5667 -0.0235 -0.0316 -0.0507 387 PHE A CD2 
2931 C CE1 . PHE A 387 ? 0.3238 0.5238 0.5977 -0.0294 -0.0185 -0.0698 387 PHE A CE1 
2932 C CE2 . PHE A 387 ? 0.3439 0.5285 0.5829 -0.0279 -0.0219 -0.0599 387 PHE A CE2 
2933 C CZ  . PHE A 387 ? 0.3153 0.5020 0.5648 -0.0309 -0.0158 -0.0687 387 PHE A CZ  
2934 N N   . TYR A 388 ? 0.2929 0.5139 0.6496 0.0040  -0.0548 -0.0215 388 TYR A N   
2935 C CA  . TYR A 388 ? 0.2947 0.5240 0.6759 0.0108  -0.0662 -0.0095 388 TYR A CA  
2936 C C   . TYR A 388 ? 0.3762 0.5915 0.7693 0.0178  -0.0608 -0.0053 388 TYR A C   
2937 O O   . TYR A 388 ? 0.3899 0.5934 0.7837 0.0178  -0.0469 -0.0152 388 TYR A O   
2938 C CB  . TYR A 388 ? 0.2868 0.5336 0.7017 0.0126  -0.0698 -0.0139 388 TYR A CB  
2939 C CG  . TYR A 388 ? 0.2808 0.5443 0.6876 0.0060  -0.0791 -0.0151 388 TYR A CG  
2940 C CD1 . TYR A 388 ? 0.3087 0.5854 0.7153 0.0060  -0.0966 -0.0023 388 TYR A CD1 
2941 C CD2 . TYR A 388 ? 0.2767 0.5423 0.6745 -0.0011 -0.0705 -0.0290 388 TYR A CD2 
2942 C CE1 . TYR A 388 ? 0.3251 0.6175 0.7222 -0.0013 -0.1053 -0.0044 388 TYR A CE1 
2943 C CE2 . TYR A 388 ? 0.2860 0.5663 0.6760 -0.0079 -0.0784 -0.0312 388 TYR A CE2 
2944 C CZ  . TYR A 388 ? 0.3683 0.6628 0.7584 -0.0081 -0.0957 -0.0195 388 TYR A CZ  
2945 O OH  . TYR A 388 ? 0.3196 0.6296 0.7019 -0.0158 -0.1037 -0.0226 388 TYR A OH  
2946 N N   . VAL A 389 ? 0.3248 0.5412 0.7274 0.0232  -0.0720 0.0096  389 VAL A N   
2947 C CA  . VAL A 389 ? 0.3203 0.5239 0.7386 0.0302  -0.0683 0.0150  389 VAL A CA  
2948 C C   . VAL A 389 ? 0.4138 0.6204 0.8707 0.0352  -0.0600 0.0053  389 VAL A C   
2949 O O   . VAL A 389 ? 0.3944 0.5879 0.8564 0.0366  -0.0466 -0.0028 389 VAL A O   
2950 C CB  . VAL A 389 ? 0.3571 0.5621 0.7791 0.0345  -0.0833 0.0343  389 VAL A CB  
2951 C CG1 . VAL A 389 ? 0.3470 0.5386 0.7901 0.0420  -0.0790 0.0392  389 VAL A CG1 
2952 C CG2 . VAL A 389 ? 0.3579 0.5591 0.7403 0.0281  -0.0887 0.0420  389 VAL A CG2 
2953 N N   . ASP A 390 ? 0.4112 0.6359 0.8939 0.0367  -0.0672 0.0045  390 ASP A N   
2954 C CA  . ASP A 390 ? 0.4254 0.6561 0.9463 0.0404  -0.0591 -0.0061 390 ASP A CA  
2955 C C   . ASP A 390 ? 0.5017 0.7366 1.0111 0.0325  -0.0484 -0.0225 390 ASP A C   
2956 O O   . ASP A 390 ? 0.5114 0.7631 1.0290 0.0297  -0.0546 -0.0249 390 ASP A O   
2957 C CB  . ASP A 390 ? 0.4673 0.7161 1.0266 0.0469  -0.0739 0.0033  390 ASP A CB  
2958 C CG  . ASP A 390 ? 0.6488 0.9051 1.2553 0.0521  -0.0662 -0.0068 390 ASP A CG  
2959 O OD1 . ASP A 390 ? 0.6801 0.9487 1.3235 0.0593  -0.0781 0.0022  390 ASP A OD1 
2960 O OD2 . ASP A 390 ? 0.6964 0.9470 1.3034 0.0484  -0.0485 -0.0236 390 ASP A OD2 
2961 N N   . SER A 391 ? 0.4554 0.6747 0.9451 0.0283  -0.0327 -0.0332 391 SER A N   
2962 C CA  . SER A 391 ? 0.4436 0.6625 0.9184 0.0201  -0.0214 -0.0477 391 SER A CA  
2963 C C   . SER A 391 ? 0.4923 0.7192 0.9994 0.0199  -0.0112 -0.0605 391 SER A C   
2964 O O   . SER A 391 ? 0.4913 0.7200 0.9891 0.0126  -0.0026 -0.0718 391 SER A O   
2965 C CB  . SER A 391 ? 0.4808 0.6802 0.9226 0.0155  -0.0102 -0.0525 391 SER A CB  
2966 O OG  . SER A 391 ? 0.5912 0.7773 1.0364 0.0204  -0.0068 -0.0484 391 SER A OG  
2967 N N   . SER A 392 ? 0.4467 0.6781 0.9927 0.0277  -0.0115 -0.0590 392 SER A N   
2968 C CA  . SER A 392 ? 0.4425 0.6826 1.0256 0.0283  -0.0013 -0.0716 392 SER A CA  
2969 C C   . SER A 392 ? 0.4817 0.7451 1.0905 0.0291  -0.0121 -0.0704 392 SER A C   
2970 O O   . SER A 392 ? 0.4725 0.7456 1.1059 0.0267  -0.0030 -0.0830 392 SER A O   
2971 C CB  . SER A 392 ? 0.4966 0.7306 1.1126 0.0364  0.0043  -0.0717 392 SER A CB  
2972 O OG  . SER A 392 ? 0.6597 0.8954 1.2875 0.0450  -0.0118 -0.0545 392 SER A OG  
2973 N N   . ALA A 393 ? 0.4408 0.7137 1.0431 0.0314  -0.0313 -0.0558 393 ALA A N   
2974 C CA  . ALA A 393 ? 0.4391 0.7350 1.0613 0.0312  -0.0445 -0.0531 393 ALA A CA  
2975 C C   . ALA A 393 ? 0.4652 0.7663 1.0660 0.0204  -0.0382 -0.0650 393 ALA A C   
2976 O O   . ALA A 393 ? 0.4453 0.7324 1.0059 0.0141  -0.0321 -0.0675 393 ALA A O   
2977 C CB  . ALA A 393 ? 0.4567 0.7587 1.0678 0.0342  -0.0660 -0.0343 393 ALA A CB  
2978 N N   . PRO A 394 ? 0.4142 0.7346 1.0428 0.0182  -0.0390 -0.0728 394 PRO A N   
2979 C CA  . PRO A 394 ? 0.4038 0.7280 1.0124 0.0074  -0.0326 -0.0841 394 PRO A CA  
2980 C C   . PRO A 394 ? 0.4420 0.7703 1.0177 0.0023  -0.0467 -0.0760 394 PRO A C   
2981 O O   . PRO A 394 ? 0.4532 0.7917 1.0336 0.0066  -0.0646 -0.0626 394 PRO A O   
2982 C CB  . PRO A 394 ? 0.4204 0.7654 1.0726 0.0071  -0.0308 -0.0934 394 PRO A CB  
2983 C CG  . PRO A 394 ? 0.4829 0.8409 1.1735 0.0178  -0.0455 -0.0820 394 PRO A CG  
2984 C CD  . PRO A 394 ? 0.4305 0.7702 1.1112 0.0252  -0.0460 -0.0716 394 PRO A CD  
2985 N N   . SER A 395 ? 0.3661 0.6861 0.9083 -0.0071 -0.0384 -0.0840 395 SER A N   
2986 C CA  . SER A 395 ? 0.3473 0.6692 0.8569 -0.0130 -0.0485 -0.0792 395 SER A CA  
2987 C C   . SER A 395 ? 0.3569 0.6863 0.8604 -0.0232 -0.0434 -0.0914 395 SER A C   
2988 O O   . SER A 395 ? 0.3386 0.6566 0.8341 -0.0282 -0.0272 -0.1024 395 SER A O   
2989 C CB  . SER A 395 ? 0.3775 0.6773 0.8472 -0.0137 -0.0445 -0.0746 395 SER A CB  
2990 O OG  . SER A 395 ? 0.4253 0.7273 0.8661 -0.0187 -0.0544 -0.0696 395 SER A OG  
2991 N N   . PRO A 396 ? 0.3059 0.6534 0.8106 -0.0274 -0.0569 -0.0894 396 PRO A N   
2992 C CA  . PRO A 396 ? 0.2997 0.6535 0.7985 -0.0378 -0.0515 -0.1016 396 PRO A CA  
2993 C C   . PRO A 396 ? 0.3459 0.6845 0.8014 -0.0452 -0.0477 -0.1035 396 PRO A C   
2994 O O   . PRO A 396 ? 0.3499 0.6891 0.7972 -0.0541 -0.0414 -0.1138 396 PRO A O   
2995 C CB  . PRO A 396 ? 0.3233 0.7037 0.8437 -0.0389 -0.0687 -0.0984 396 PRO A CB  
2996 C CG  . PRO A 396 ? 0.3883 0.7703 0.9001 -0.0327 -0.0854 -0.0819 396 PRO A CG  
2997 C CD  . PRO A 396 ? 0.3304 0.6935 0.8412 -0.0238 -0.0778 -0.0760 396 PRO A CD  
2998 N N   . TYR A 397 ? 0.2824 0.6073 0.7124 -0.0415 -0.0511 -0.0939 397 TYR A N   
2999 C CA  . TYR A 397 ? 0.2797 0.5905 0.6714 -0.0470 -0.0485 -0.0944 397 TYR A CA  
3000 C C   . TYR A 397 ? 0.3473 0.6350 0.7219 -0.0480 -0.0321 -0.1000 397 TYR A C   
3001 O O   . TYR A 397 ? 0.3546 0.6330 0.7386 -0.0426 -0.0246 -0.0992 397 TYR A O   
3002 C CB  . TYR A 397 ? 0.2917 0.5999 0.6653 -0.0430 -0.0601 -0.0813 397 TYR A CB  
3003 C CG  . TYR A 397 ? 0.3014 0.6305 0.6827 -0.0434 -0.0784 -0.0732 397 TYR A CG  
3004 C CD1 . TYR A 397 ? 0.3258 0.6656 0.7330 -0.0353 -0.0893 -0.0626 397 TYR A CD1 
3005 C CD2 . TYR A 397 ? 0.3099 0.6475 0.6718 -0.0522 -0.0853 -0.0757 397 TYR A CD2 
3006 C CE1 . TYR A 397 ? 0.3550 0.7143 0.7688 -0.0361 -0.1079 -0.0535 397 TYR A CE1 
3007 C CE2 . TYR A 397 ? 0.3361 0.6933 0.7019 -0.0540 -0.1030 -0.0679 397 TYR A CE2 
3008 C CZ  . TYR A 397 ? 0.4730 0.8413 0.8646 -0.0459 -0.1150 -0.0562 397 TYR A CZ  
3009 O OH  . TYR A 397 ? 0.4981 0.8864 0.8933 -0.0483 -0.1341 -0.0473 397 TYR A OH  
3010 N N   . LEU A 398 ? 0.3054 0.5832 0.6536 -0.0550 -0.0274 -0.1050 398 LEU A N   
3011 C CA  . LEU A 398 ? 0.3155 0.5707 0.6436 -0.0563 -0.0146 -0.1081 398 LEU A CA  
3012 C C   . LEU A 398 ? 0.3659 0.6114 0.6637 -0.0593 -0.0169 -0.1060 398 LEU A C   
3013 O O   . LEU A 398 ? 0.3540 0.6100 0.6459 -0.0641 -0.0243 -0.1074 398 LEU A O   
3014 C CB  . LEU A 398 ? 0.3241 0.5735 0.6583 -0.0622 -0.0009 -0.1190 398 LEU A CB  
3015 C CG  . LEU A 398 ? 0.4055 0.6620 0.7397 -0.0717 0.0009  -0.1283 398 LEU A CG  
3016 C CD1 . LEU A 398 ? 0.4226 0.6614 0.7284 -0.0772 0.0066  -0.1310 398 LEU A CD1 
3017 C CD2 . LEU A 398 ? 0.4246 0.6844 0.7789 -0.0758 0.0113  -0.1373 398 LEU A CD2 
3018 N N   . ARG A 399 ? 0.3145 0.5410 0.5945 -0.0566 -0.0109 -0.1029 399 ARG A N   
3019 C CA  . ARG A 399 ? 0.3063 0.5227 0.5606 -0.0587 -0.0117 -0.1014 399 ARG A CA  
3020 C C   . ARG A 399 ? 0.3605 0.5610 0.6021 -0.0641 -0.0009 -0.1088 399 ARG A C   
3021 O O   . ARG A 399 ? 0.3585 0.5455 0.5987 -0.0627 0.0075  -0.1092 399 ARG A O   
3022 C CB  . ARG A 399 ? 0.2974 0.5053 0.5419 -0.0518 -0.0145 -0.0918 399 ARG A CB  
3023 C CG  . ARG A 399 ? 0.4199 0.6202 0.6407 -0.0540 -0.0158 -0.0904 399 ARG A CG  
3024 C CD  . ARG A 399 ? 0.3923 0.5797 0.6029 -0.0483 -0.0145 -0.0832 399 ARG A CD  
3025 N NE  . ARG A 399 ? 0.3594 0.5295 0.5646 -0.0478 -0.0047 -0.0861 399 ARG A NE  
3026 C CZ  . ARG A 399 ? 0.4801 0.6381 0.6782 -0.0434 -0.0023 -0.0812 399 ARG A CZ  
3027 N NH1 . ARG A 399 ? 0.2717 0.4322 0.4676 -0.0391 -0.0081 -0.0734 399 ARG A NH1 
3028 N NH2 . ARG A 399 ? 0.3009 0.4442 0.4936 -0.0440 0.0055  -0.0838 399 ARG A NH2 
3029 N N   . ALA A 400 ? 0.3166 0.5187 0.5488 -0.0707 -0.0013 -0.1145 400 ALA A N   
3030 C CA  . ALA A 400 ? 0.3101 0.4973 0.5314 -0.0762 0.0077  -0.1210 400 ALA A CA  
3031 C C   . ALA A 400 ? 0.3624 0.5389 0.5643 -0.0756 0.0071  -0.1190 400 ALA A C   
3032 O O   . ALA A 400 ? 0.3586 0.5443 0.5547 -0.0764 0.0004  -0.1182 400 ALA A O   
3033 C CB  . ALA A 400 ? 0.3215 0.5180 0.5498 -0.0845 0.0088  -0.1304 400 ALA A CB  
3034 N N   . SER A 401 ? 0.3199 0.4773 0.5121 -0.0746 0.0141  -0.1182 401 SER A N   
3035 C CA  . SER A 401 ? 0.3032 0.4498 0.4807 -0.0736 0.0144  -0.1169 401 SER A CA  
3036 C C   . SER A 401 ? 0.3346 0.4717 0.5075 -0.0797 0.0201  -0.1243 401 SER A C   
3037 O O   . SER A 401 ? 0.3349 0.4622 0.5104 -0.0827 0.0262  -0.1267 401 SER A O   
3038 C CB  . SER A 401 ? 0.3179 0.4507 0.4895 -0.0675 0.0165  -0.1097 401 SER A CB  
3039 O OG  . SER A 401 ? 0.4243 0.5485 0.5849 -0.0662 0.0165  -0.1087 401 SER A OG  
3040 N N   . PHE A 402 ? 0.2755 0.4151 0.4417 -0.0821 0.0185  -0.1282 402 PHE A N   
3041 C CA  . PHE A 402 ? 0.2722 0.4025 0.4357 -0.0878 0.0241  -0.1361 402 PHE A CA  
3042 C C   . PHE A 402 ? 0.3594 0.4741 0.5151 -0.0844 0.0271  -0.1342 402 PHE A C   
3043 O O   . PHE A 402 ? 0.3724 0.4812 0.5270 -0.0881 0.0309  -0.1411 402 PHE A O   
3044 C CB  . PHE A 402 ? 0.2821 0.4274 0.4463 -0.0949 0.0217  -0.1450 402 PHE A CB  
3045 C CG  . PHE A 402 ? 0.2813 0.4393 0.4375 -0.0946 0.0153  -0.1438 402 PHE A CG  
3046 C CD1 . PHE A 402 ? 0.3199 0.4719 0.4666 -0.0954 0.0180  -0.1469 402 PHE A CD1 
3047 C CD2 . PHE A 402 ? 0.2861 0.4626 0.4451 -0.0942 0.0067  -0.1398 402 PHE A CD2 
3048 C CE1 . PHE A 402 ? 0.3334 0.4972 0.4707 -0.0967 0.0130  -0.1461 402 PHE A CE1 
3049 C CE2 . PHE A 402 ? 0.3247 0.5124 0.4740 -0.0952 0.0002  -0.1376 402 PHE A CE2 
3050 C CZ  . PHE A 402 ? 0.3139 0.4951 0.4509 -0.0970 0.0039  -0.1410 402 PHE A CZ  
3051 N N   . SER A 403 ? 0.3172 0.4254 0.4694 -0.0775 0.0255  -0.1255 403 SER A N   
3052 C CA  . SER A 403 ? 0.3244 0.4198 0.4717 -0.0739 0.0275  -0.1234 403 SER A CA  
3053 C C   . SER A 403 ? 0.4092 0.4857 0.5583 -0.0742 0.0323  -0.1229 403 SER A C   
3054 O O   . SER A 403 ? 0.4160 0.4825 0.5650 -0.0726 0.0341  -0.1236 403 SER A O   
3055 C CB  . SER A 403 ? 0.3619 0.4583 0.5054 -0.0671 0.0236  -0.1146 403 SER A CB  
3056 O OG  . SER A 403 ? 0.5128 0.6047 0.6580 -0.0641 0.0232  -0.1084 403 SER A OG  
3057 N N   . SER A 404 ? 0.3802 0.4515 0.5314 -0.0766 0.0343  -0.1215 404 SER A N   
3058 C CA  . SER A 404 ? 0.3946 0.4469 0.5450 -0.0775 0.0380  -0.1189 404 SER A CA  
3059 C C   . SER A 404 ? 0.4578 0.5048 0.6117 -0.0847 0.0428  -0.1232 404 SER A C   
3060 O O   . SER A 404 ? 0.4860 0.5174 0.6407 -0.0868 0.0458  -0.1233 404 SER A O   
3061 C CB  . SER A 404 ? 0.4499 0.4944 0.5948 -0.0731 0.0361  -0.1094 404 SER A CB  
3062 O OG  . SER A 404 ? 0.6195 0.6749 0.7648 -0.0729 0.0352  -0.1080 404 SER A OG  
3063 N N   . ALA A 405 ? 0.3770 0.4363 0.5344 -0.0884 0.0434  -0.1265 405 ALA A N   
3064 C CA  . ALA A 405 ? 0.3748 0.4306 0.5365 -0.0960 0.0487  -0.1312 405 ALA A CA  
3065 C C   . ALA A 405 ? 0.4517 0.5034 0.6177 -0.1012 0.0519  -0.1395 405 ALA A C   
3066 O O   . ALA A 405 ? 0.4456 0.5063 0.6132 -0.1006 0.0498  -0.1451 405 ALA A O   
3067 C CB  . ALA A 405 ? 0.3758 0.4492 0.5442 -0.0986 0.0483  -0.1345 405 ALA A CB  
3068 N N   . SER A 406 ? 0.4278 0.4647 0.5952 -0.1067 0.0573  -0.1404 406 SER A N   
3069 C CA  . SER A 406 ? 0.4336 0.4642 0.6070 -0.1122 0.0615  -0.1486 406 SER A CA  
3070 C C   . SER A 406 ? 0.5113 0.5592 0.6917 -0.1193 0.0630  -0.1592 406 SER A C   
3071 O O   . SER A 406 ? 0.4965 0.5561 0.6785 -0.1207 0.0621  -0.1583 406 SER A O   
3072 C CB  . SER A 406 ? 0.4694 0.4769 0.6421 -0.1157 0.0663  -0.1442 406 SER A CB  
3073 O OG  . SER A 406 ? 0.5713 0.5781 0.7438 -0.1227 0.0707  -0.1445 406 SER A OG  
3074 N N   . PRO A 407 ? 0.4983 0.5488 0.6842 -0.1244 0.0654  -0.1699 407 PRO A N   
3075 C CA  . PRO A 407 ? 0.5013 0.5695 0.6939 -0.1322 0.0659  -0.1802 407 PRO A CA  
3076 C C   . PRO A 407 ? 0.5526 0.6199 0.7506 -0.1385 0.0703  -0.1807 407 PRO A C   
3077 O O   . PRO A 407 ? 0.5261 0.6124 0.7304 -0.1422 0.0684  -0.1855 407 PRO A O   
3078 C CB  . PRO A 407 ? 0.5350 0.5991 0.7313 -0.1374 0.0698  -0.1914 407 PRO A CB  
3079 C CG  . PRO A 407 ? 0.5845 0.6389 0.7762 -0.1301 0.0686  -0.1875 407 PRO A CG  
3080 C CD  . PRO A 407 ? 0.5245 0.5629 0.7123 -0.1238 0.0679  -0.1741 407 PRO A CD  
3081 N N   . GLU A 408 ? 0.5364 0.5819 0.7322 -0.1400 0.0758  -0.1751 408 GLU A N   
3082 C CA  . GLU A 408 ? 0.5488 0.5899 0.7472 -0.1468 0.0816  -0.1745 408 GLU A CA  
3083 C C   . GLU A 408 ? 0.5786 0.6236 0.7720 -0.1428 0.0800  -0.1658 408 GLU A C   
3084 O O   . GLU A 408 ? 0.5909 0.6425 0.7893 -0.1483 0.0841  -0.1680 408 GLU A O   
3085 C CB  . GLU A 408 ? 0.5900 0.6057 0.7877 -0.1525 0.0887  -0.1731 408 GLU A CB  
3086 C CG  . GLU A 408 ? 0.8008 0.7954 0.9922 -0.1461 0.0870  -0.1646 408 GLU A CG  
3087 C CD  . GLU A 408 ? 1.0970 1.0910 1.2938 -0.1430 0.0855  -0.1712 408 GLU A CD  
3088 O OE1 . GLU A 408 ? 1.0284 1.0304 1.2335 -0.1493 0.0886  -0.1837 408 GLU A OE1 
3089 O OE2 . GLU A 408 ? 0.9676 0.9529 1.1608 -0.1351 0.0818  -0.1645 408 GLU A OE2 
3090 N N   . GLN A 409 ? 0.5029 0.5454 0.6879 -0.1337 0.0747  -0.1571 409 GLN A N   
3091 C CA  . GLN A 409 ? 0.4902 0.5374 0.6709 -0.1295 0.0731  -0.1500 409 GLN A CA  
3092 C C   . GLN A 409 ? 0.5158 0.5893 0.7073 -0.1285 0.0694  -0.1555 409 GLN A C   
3093 O O   . GLN A 409 ? 0.4976 0.5790 0.6940 -0.1297 0.0717  -0.1552 409 GLN A O   
3094 C CB  . GLN A 409 ? 0.4969 0.5364 0.6675 -0.1203 0.0677  -0.1406 409 GLN A CB  
3095 C CG  . GLN A 409 ? 0.7272 0.7450 0.8864 -0.1207 0.0703  -0.1311 409 GLN A CG  
3096 C CD  . GLN A 409 ? 1.0963 1.1081 1.2474 -0.1120 0.0643  -0.1226 409 GLN A CD  
3097 O OE1 . GLN A 409 ? 1.0176 1.0398 1.1670 -0.1066 0.0607  -0.1200 409 GLN A OE1 
3098 N NE2 . GLN A 409 ? 1.0670 1.0613 1.2143 -0.1105 0.0630  -0.1180 409 GLN A NE2 
3099 N N   . MET A 410 ? 0.4632 0.5500 0.6586 -0.1269 0.0639  -0.1609 410 MET A N   
3100 C CA  . MET A 410 ? 0.4489 0.5609 0.6540 -0.1263 0.0579  -0.1654 410 MET A CA  
3101 C C   . MET A 410 ? 0.5205 0.6437 0.7390 -0.1350 0.0617  -0.1740 410 MET A C   
3102 O O   . MET A 410 ? 0.5132 0.6532 0.7426 -0.1343 0.0595  -0.1745 410 MET A O   
3103 C CB  . MET A 410 ? 0.4741 0.5939 0.6760 -0.1249 0.0520  -0.1692 410 MET A CB  
3104 C CG  . MET A 410 ? 0.5060 0.6224 0.6980 -0.1159 0.0469  -0.1611 410 MET A CG  
3105 S SD  . MET A 410 ? 0.5510 0.6678 0.7361 -0.1163 0.0445  -0.1667 410 MET A SD  
3106 C CE  . MET A 410 ? 0.4944 0.6074 0.6704 -0.1061 0.0399  -0.1562 410 MET A CE  
3107 N N   . ASP A 411 ? 0.4951 0.6087 0.7146 -0.1433 0.0679  -0.1808 411 ASP A N   
3108 C CA  . ASP A 411 ? 0.4974 0.6195 0.7297 -0.1530 0.0727  -0.1899 411 ASP A CA  
3109 C C   . ASP A 411 ? 0.5653 0.6850 0.8022 -0.1549 0.0791  -0.1868 411 ASP A C   
3110 O O   . ASP A 411 ? 0.5627 0.7016 0.8144 -0.1571 0.0785  -0.1913 411 ASP A O   
3111 C CB  . ASP A 411 ? 0.5358 0.6422 0.7664 -0.1610 0.0794  -0.1963 411 ASP A CB  
3112 C CG  . ASP A 411 ? 0.7413 0.8612 0.9857 -0.1715 0.0821  -0.2085 411 ASP A CG  
3113 O OD1 . ASP A 411 ? 0.7873 0.9072 1.0398 -0.1776 0.0887  -0.2103 411 ASP A OD1 
3114 O OD2 . ASP A 411 ? 0.7829 0.9133 1.0298 -0.1744 0.0781  -0.2168 411 ASP A OD2 
3115 N N   . VAL A 412 ? 0.5333 0.6304 0.7578 -0.1540 0.0848  -0.1790 412 VAL A N   
3116 C CA  . VAL A 412 ? 0.5316 0.6232 0.7557 -0.1570 0.0922  -0.1758 412 VAL A CA  
3117 C C   . VAL A 412 ? 0.5695 0.6795 0.8022 -0.1506 0.0884  -0.1741 412 VAL A C   
3118 O O   . VAL A 412 ? 0.5707 0.6917 0.8164 -0.1549 0.0935  -0.1788 412 VAL A O   
3119 C CB  . VAL A 412 ? 0.5863 0.6499 0.7916 -0.1570 0.0965  -0.1661 412 VAL A CB  
3120 C CG1 . VAL A 412 ? 0.5861 0.6454 0.7869 -0.1598 0.1034  -0.1622 412 VAL A CG1 
3121 C CG2 . VAL A 412 ? 0.5973 0.6420 0.7985 -0.1648 0.1018  -0.1676 412 VAL A CG2 
3122 N N   . ALA A 413 ? 0.5134 0.6268 0.7405 -0.1404 0.0798  -0.1678 413 ALA A N   
3123 C CA  . ALA A 413 ? 0.4961 0.6242 0.7309 -0.1331 0.0754  -0.1648 413 ALA A CA  
3124 C C   . ALA A 413 ? 0.5467 0.7019 0.8030 -0.1328 0.0698  -0.1711 413 ALA A C   
3125 O O   . ALA A 413 ? 0.5449 0.7119 0.8159 -0.1316 0.0717  -0.1723 413 ALA A O   
3126 C CB  . ALA A 413 ? 0.4963 0.6188 0.7188 -0.1233 0.0679  -0.1563 413 ALA A CB  
3127 N N   . PHE A 414 ? 0.4959 0.6614 0.7548 -0.1343 0.0630  -0.1755 414 PHE A N   
3128 C CA  . PHE A 414 ? 0.4906 0.6827 0.7686 -0.1350 0.0556  -0.1809 414 PHE A CA  
3129 C C   . PHE A 414 ? 0.5473 0.7489 0.8435 -0.1441 0.0625  -0.1901 414 PHE A C   
3130 O O   . PHE A 414 ? 0.5436 0.7682 0.8607 -0.1440 0.0574  -0.1937 414 PHE A O   
3131 C CB  . PHE A 414 ? 0.5189 0.7191 0.7911 -0.1354 0.0464  -0.1831 414 PHE A CB  
3132 C CG  . PHE A 414 ? 0.5352 0.7399 0.7989 -0.1262 0.0362  -0.1749 414 PHE A CG  
3133 C CD1 . PHE A 414 ? 0.5680 0.7745 0.8352 -0.1175 0.0337  -0.1666 414 PHE A CD1 
3134 C CD2 . PHE A 414 ? 0.5704 0.7782 0.8234 -0.1270 0.0297  -0.1763 414 PHE A CD2 
3135 C CE1 . PHE A 414 ? 0.5727 0.7825 0.8322 -0.1096 0.0246  -0.1587 414 PHE A CE1 
3136 C CE2 . PHE A 414 ? 0.5996 0.8115 0.8439 -0.1196 0.0211  -0.1687 414 PHE A CE2 
3137 C CZ  . PHE A 414 ? 0.5624 0.7750 0.8100 -0.1109 0.0183  -0.1595 414 PHE A CZ  
3138 N N   . GLN A 415 ? 0.5150 0.6988 0.8043 -0.1520 0.0739  -0.1933 415 GLN A N   
3139 C CA  . GLN A 415 ? 0.5285 0.7175 0.8329 -0.1619 0.0830  -0.2018 415 GLN A CA  
3140 C C   . GLN A 415 ? 0.5848 0.7779 0.9002 -0.1598 0.0891  -0.2003 415 GLN A C   
3141 O O   . GLN A 415 ? 0.5948 0.8059 0.9334 -0.1637 0.0918  -0.2075 415 GLN A O   
3142 C CB  . GLN A 415 ? 0.5640 0.7293 0.8546 -0.1708 0.0931  -0.2037 415 GLN A CB  
3143 C CG  . GLN A 415 ? 0.8182 0.9827 1.1197 -0.1822 0.1052  -0.2110 415 GLN A CG  
3144 C CD  . GLN A 415 ? 1.1385 1.2772 1.4244 -0.1902 0.1135  -0.2106 415 GLN A CD  
3145 O OE1 . GLN A 415 ? 1.0676 1.2073 1.3587 -0.1976 0.1148  -0.2182 415 GLN A OE1 
3146 N NE2 . GLN A 415 ? 1.1003 1.2150 1.3666 -0.1887 0.1184  -0.2013 415 GLN A NE2 
3147 N N   . VAL A 416 ? 0.5229 0.7002 0.8229 -0.1538 0.0914  -0.1917 416 VAL A N   
3148 C CA  . VAL A 416 ? 0.5090 0.6878 0.8163 -0.1516 0.0979  -0.1905 416 VAL A CA  
3149 C C   . VAL A 416 ? 0.5284 0.7323 0.8589 -0.1430 0.0885  -0.1907 416 VAL A C   
3150 O O   . VAL A 416 ? 0.5105 0.7279 0.8635 -0.1443 0.0935  -0.1960 416 VAL A O   
3151 C CB  . VAL A 416 ? 0.5533 0.7083 0.8355 -0.1482 0.1014  -0.1813 416 VAL A CB  
3152 C CG1 . VAL A 416 ? 0.5436 0.7013 0.8330 -0.1459 0.1078  -0.1811 416 VAL A CG1 
3153 C CG2 . VAL A 416 ? 0.5653 0.6958 0.8269 -0.1573 0.1101  -0.1800 416 VAL A CG2 
3154 N N   . LEU A 417 ? 0.4813 0.6915 0.8075 -0.1349 0.0750  -0.1850 417 LEU A N   
3155 C CA  . LEU A 417 ? 0.4736 0.7061 0.8193 -0.1265 0.0637  -0.1827 417 LEU A CA  
3156 C C   . LEU A 417 ? 0.5340 0.7911 0.9085 -0.1313 0.0614  -0.1913 417 LEU A C   
3157 O O   . LEU A 417 ? 0.5259 0.7987 0.9259 -0.1278 0.0611  -0.1929 417 LEU A O   
3158 C CB  . LEU A 417 ? 0.4689 0.7025 0.8007 -0.1200 0.0501  -0.1755 417 LEU A CB  
3159 C CG  . LEU A 417 ? 0.5073 0.7468 0.8416 -0.1084 0.0406  -0.1662 417 LEU A CG  
3160 C CD1 . LEU A 417 ? 0.5042 0.7554 0.8339 -0.1055 0.0261  -0.1623 417 LEU A CD1 
3161 C CD2 . LEU A 417 ? 0.5119 0.7671 0.8749 -0.1042 0.0409  -0.1671 417 LEU A CD2 
3162 N N   . ALA A 418 ? 0.5044 0.7643 0.8763 -0.1398 0.0606  -0.1977 418 ALA A N   
3163 C CA  . ALA A 418 ? 0.5056 0.7889 0.9030 -0.1462 0.0579  -0.2069 418 ALA A CA  
3164 C C   . ALA A 418 ? 0.5799 0.8698 1.0012 -0.1508 0.0698  -0.2142 418 ALA A C   
3165 O O   . ALA A 418 ? 0.5831 0.8974 1.0345 -0.1498 0.0646  -0.2183 418 ALA A O   
3166 C CB  . ALA A 418 ? 0.5223 0.8013 0.9085 -0.1560 0.0586  -0.2134 418 ALA A CB  
3167 N N   . GLN A 419 ? 0.5541 0.8226 0.9624 -0.1562 0.0854  -0.2157 419 GLN A N   
3168 C CA  . GLN A 419 ? 0.5646 0.8371 0.9922 -0.1623 0.0993  -0.2235 419 GLN A CA  
3169 C C   . GLN A 419 ? 0.5971 0.8799 1.0443 -0.1534 0.0994  -0.2214 419 GLN A C   
3170 O O   . GLN A 419 ? 0.5679 0.8695 1.0472 -0.1552 0.1036  -0.2291 419 GLN A O   
3171 C CB  . GLN A 419 ? 0.6013 0.8468 1.0051 -0.1716 0.1154  -0.2243 419 GLN A CB  
3172 C CG  . GLN A 419 ? 0.9906 1.2415 1.4128 -0.1828 0.1306  -0.2351 419 GLN A CG  
3173 C CD  . GLN A 419 ? 1.4509 1.6752 1.8490 -0.1907 0.1465  -0.2337 419 GLN A CD  
3174 O OE1 . GLN A 419 ? 1.4216 1.6290 1.8023 -0.2004 0.1530  -0.2343 419 GLN A OE1 
3175 N NE2 . GLN A 419 ? 1.4482 1.6678 1.8446 -0.1871 0.1531  -0.2315 419 GLN A NE2 
3176 N N   . LEU A 420 ? 0.5614 0.8320 0.9914 -0.1438 0.0951  -0.2115 420 LEU A N   
3177 C CA  . LEU A 420 ? 0.5570 0.8341 1.0033 -0.1347 0.0949  -0.2087 420 LEU A CA  
3178 C C   . LEU A 420 ? 0.6228 0.9282 1.1024 -0.1270 0.0808  -0.2082 420 LEU A C   
3179 O O   . LEU A 420 ? 0.6218 0.9411 1.1324 -0.1237 0.0843  -0.2123 420 LEU A O   
3180 C CB  . LEU A 420 ? 0.5520 0.8092 0.9707 -0.1270 0.0924  -0.1981 420 LEU A CB  
3181 C CG  . LEU A 420 ? 0.6171 0.8470 1.0057 -0.1336 0.1058  -0.1973 420 LEU A CG  
3182 C CD1 . LEU A 420 ? 0.6146 0.8277 0.9777 -0.1258 0.1002  -0.1866 420 LEU A CD1 
3183 C CD2 . LEU A 420 ? 0.6531 0.8814 1.0530 -0.1395 0.1224  -0.2051 420 LEU A CD2 
3184 N N   . ILE A 421 ? 0.5787 0.8927 1.0522 -0.1248 0.0651  -0.2036 421 ILE A N   
3185 C CA  . ILE A 421 ? 0.5765 0.9173 1.0769 -0.1189 0.0488  -0.2014 421 ILE A CA  
3186 C C   . ILE A 421 ? 0.6790 1.0421 1.2151 -0.1257 0.0525  -0.2128 421 ILE A C   
3187 O O   . ILE A 421 ? 0.6789 1.0619 1.2503 -0.1199 0.0481  -0.2135 421 ILE A O   
3188 C CB  . ILE A 421 ? 0.6085 0.9509 1.0877 -0.1184 0.0334  -0.1951 421 ILE A CB  
3189 C CG1 . ILE A 421 ? 0.6069 0.9336 1.0609 -0.1091 0.0277  -0.1830 421 ILE A CG1 
3190 C CG2 . ILE A 421 ? 0.6138 0.9860 1.1188 -0.1173 0.0169  -0.1952 421 ILE A CG2 
3191 C CD1 . ILE A 421 ? 0.6905 1.0109 1.1154 -0.1104 0.0182  -0.1783 421 ILE A CD1 
3192 N N   . LYS A 422 ? 0.6636 1.0219 1.1919 -0.1380 0.0618  -0.2219 422 LYS A N   
3193 C CA  . LYS A 422 ? 0.6743 1.0512 1.2330 -0.1468 0.0676  -0.2341 422 LYS A CA  
3194 C C   . LYS A 422 ? 0.7494 1.1303 1.3355 -0.1467 0.0821  -0.2407 422 LYS A C   
3195 O O   . LYS A 422 ? 0.7342 1.1389 1.3583 -0.1489 0.0822  -0.2489 422 LYS A O   
3196 C CB  . LYS A 422 ? 0.7189 1.0829 1.2574 -0.1604 0.0771  -0.2414 422 LYS A CB  
3197 C CG  . LYS A 422 ? 0.9042 1.2774 1.4347 -0.1640 0.0633  -0.2417 422 LYS A CG  
3198 C CD  . LYS A 422 ? 1.0012 1.3520 1.5026 -0.1747 0.0730  -0.2456 422 LYS A CD  
3199 C CE  . LYS A 422 ? 1.1134 1.4724 1.6066 -0.1789 0.0608  -0.2475 422 LYS A CE  
3200 N NZ  . LYS A 422 ? 1.2760 1.6093 1.7387 -0.1868 0.0693  -0.2493 422 LYS A NZ  
3201 N N   . GLU A 423 ? 0.7416 1.0999 1.3088 -0.1450 0.0949  -0.2381 423 GLU A N   
3202 C CA  . GLU A 423 ? 0.7570 1.1154 1.3444 -0.1459 0.1111  -0.2452 423 GLU A CA  
3203 C C   . GLU A 423 ? 0.8122 1.1903 1.4362 -0.1335 0.1026  -0.2428 423 GLU A C   
3204 O O   . GLU A 423 ? 0.8010 1.1964 1.4635 -0.1349 0.1101  -0.2523 423 GLU A O   
3205 C CB  . GLU A 423 ? 0.7890 1.1169 1.3407 -0.1479 0.1246  -0.2418 423 GLU A CB  
3206 C CG  . GLU A 423 ? 0.9966 1.3054 1.5225 -0.1624 0.1396  -0.2470 423 GLU A CG  
3207 C CD  . GLU A 423 ? 1.3273 1.6048 1.8094 -0.1635 0.1451  -0.2390 423 GLU A CD  
3208 O OE1 . GLU A 423 ? 1.1093 1.3774 1.5864 -0.1606 0.1530  -0.2378 423 GLU A OE1 
3209 O OE2 . GLU A 423 ? 1.3197 1.5822 1.7735 -0.1676 0.1416  -0.2344 423 GLU A OE2 
3210 N N   . SER A 424 ? 0.7815 1.1565 1.3947 -0.1215 0.0876  -0.2300 424 SER A N   
3211 C CA  . SER A 424 ? 0.7789 1.1692 1.4234 -0.1085 0.0773  -0.2246 424 SER A CA  
3212 C C   . SER A 424 ? 0.8442 1.2664 1.5293 -0.1062 0.0628  -0.2262 424 SER A C   
3213 O O   . SER A 424 ? 0.8382 1.2776 1.5648 -0.0989 0.0608  -0.2278 424 SER A O   
3214 C CB  . SER A 424 ? 0.8197 1.1977 1.4380 -0.0983 0.0639  -0.2097 424 SER A CB  
3215 O OG  . SER A 424 ? 0.9638 1.3159 1.5543 -0.0978 0.0761  -0.2078 424 SER A OG  
3216 N N   . LEU A 425 ? 0.8105 1.2409 1.4849 -0.1124 0.0522  -0.2260 425 LEU A N   
3217 C CA  . LEU A 425 ? 0.8126 1.2737 1.5210 -0.1119 0.0366  -0.2273 425 LEU A CA  
3218 C C   . LEU A 425 ? 0.8938 1.3732 1.6428 -0.1192 0.0483  -0.2422 425 LEU A C   
3219 O O   . LEU A 425 ? 0.8897 1.3975 1.6797 -0.1162 0.0365  -0.2436 425 LEU A O   
3220 C CB  . LEU A 425 ? 0.8143 1.2774 1.4957 -0.1179 0.0231  -0.2240 425 LEU A CB  
3221 C CG  . LEU A 425 ? 0.8661 1.3171 1.5125 -0.1111 0.0087  -0.2096 425 LEU A CG  
3222 C CD1 . LEU A 425 ? 0.8718 1.3185 1.4865 -0.1204 0.0033  -0.2109 425 LEU A CD1 
3223 C CD2 . LEU A 425 ? 0.8809 1.3511 1.5507 -0.0992 -0.0119 -0.1979 425 LEU A CD2 
3224 N N   . LEU A 426 ? 0.8771 1.3406 1.6155 -0.1290 0.0712  -0.2530 426 LEU A N   
3225 C CA  . LEU A 426 ? 0.8891 1.3672 1.6628 -0.1378 0.0860  -0.2683 426 LEU A CA  
3226 C C   . LEU A 426 ? 0.9731 1.4633 1.7907 -0.1300 0.0932  -0.2728 426 LEU A C   
3227 O O   . LEU A 426 ? 0.9617 1.4746 1.8234 -0.1334 0.0982  -0.2840 426 LEU A O   
3228 C CB  . LEU A 426 ? 0.8972 1.3521 1.6408 -0.1520 0.1083  -0.2771 426 LEU A CB  
3229 C CG  . LEU A 426 ? 0.9598 1.4128 1.6831 -0.1641 0.1064  -0.2806 426 LEU A CG  
3230 C CD1 . LEU A 426 ? 0.9723 1.3965 1.6603 -0.1761 0.1270  -0.2850 426 LEU A CD1 
3231 C CD2 . LEU A 426 ? 0.9930 1.4765 1.7589 -0.1708 0.1040  -0.2920 426 LEU A CD2 
3232 N N   . VAL A 427 ? 0.9633 1.4385 1.7706 -0.1199 0.0943  -0.2649 427 VAL A N   
3233 C CA  . VAL A 427 ? 0.9721 1.4554 1.8192 -0.1120 0.1021  -0.2693 427 VAL A CA  
3234 C C   . VAL A 427 ? 1.0470 1.5522 1.9308 -0.0967 0.0791  -0.2587 427 VAL A C   
3235 O O   . VAL A 427 ? 1.0467 1.5456 1.9058 -0.0893 0.0611  -0.2437 427 VAL A O   
3236 C CB  . VAL A 427 ? 1.0235 1.4777 1.8419 -0.1122 0.1205  -0.2700 427 VAL A CB  
3237 C CG1 . VAL A 427 ? 1.0139 1.4506 1.7999 -0.1015 0.1075  -0.2537 427 VAL A CG1 
3238 C CG2 . VAL A 427 ? 1.0229 1.4844 1.8824 -0.1105 0.1378  -0.2820 427 VAL A CG2 
3239 N N   . PRO A 428 ? 1.0145 1.5457 1.9576 -0.0921 0.0789  -0.2658 428 PRO A N   
3240 C CA  . PRO A 428 ? 1.0719 1.6232 2.0511 -0.0774 0.0557  -0.2540 428 PRO A CA  
3241 C C   . PRO A 428 ? 1.6290 2.1642 2.6040 -0.0644 0.0547  -0.2439 428 PRO A C   
3242 O O   . PRO A 428 ? 1.1784 1.7147 2.1476 -0.0541 0.0336  -0.2276 428 PRO A O   
3243 C CB  . PRO A 428 ? 1.0839 1.6655 2.1295 -0.0772 0.0593  -0.2664 428 PRO A CB  
3244 C CG  . PRO A 428 ? 1.1231 1.7023 2.1632 -0.0935 0.0827  -0.2846 428 PRO A CG  
3245 C CD  . PRO A 428 ? 1.0569 1.6005 2.0383 -0.1002 0.0994  -0.2845 428 PRO A CD  
3246 N N   . MET B 1   ? 0.3851 0.4787 0.7083 0.0472  0.0285  -0.1290 1   MET B N   
3247 C CA  . MET B 1   ? 0.3791 0.4629 0.7023 0.0515  0.0193  -0.1157 1   MET B CA  
3248 C C   . MET B 1   ? 0.4126 0.5045 0.7481 0.0582  0.0146  -0.1080 1   MET B C   
3249 O O   . MET B 1   ? 0.3960 0.4985 0.7258 0.0547  0.0145  -0.1048 1   MET B O   
3250 C CB  . MET B 1   ? 0.4054 0.4828 0.7068 0.0435  0.0155  -0.1074 1   MET B CB  
3251 C CG  . MET B 1   ? 0.4658 0.5278 0.7623 0.0426  0.0129  -0.1064 1   MET B CG  
3252 S SD  . MET B 1   ? 0.5203 0.5730 0.8031 0.0396  0.0047  -0.0918 1   MET B SD  
3253 C CE  . MET B 1   ? 0.4749 0.5294 0.7706 0.0484  -0.0011 -0.0815 1   MET B CE  
3254 N N   . ASN B 2   ? 0.3800 0.4667 0.7322 0.0676  0.0103  -0.1048 2   ASN B N   
3255 C CA  . ASN B 2   ? 0.3730 0.4673 0.7366 0.0739  0.0046  -0.0967 2   ASN B CA  
3256 C C   . ASN B 2   ? 0.4248 0.5127 0.7761 0.0721  -0.0032 -0.0828 2   ASN B C   
3257 O O   . ASN B 2   ? 0.4396 0.5146 0.7916 0.0752  -0.0080 -0.0763 2   ASN B O   
3258 C CB  . ASN B 2   ? 0.3547 0.4478 0.7424 0.0847  0.0028  -0.0984 2   ASN B CB  
3259 C CG  . ASN B 2   ? 0.8040 0.9129 1.2061 0.0898  0.0003  -0.0960 2   ASN B CG  
3260 O OD1 . ASN B 2   ? 0.7414 0.8531 1.1397 0.0903  -0.0067 -0.0850 2   ASN B OD1 
3261 N ND2 . ASN B 2   ? 0.7653 0.8862 1.1831 0.0926  0.0065  -0.1071 2   ASN B ND2 
3262 N N   . TYR B 3   ? 0.3468 0.4435 0.6870 0.0666  -0.0037 -0.0788 3   TYR B N   
3263 C CA  . TYR B 3   ? 0.3389 0.4310 0.6675 0.0643  -0.0099 -0.0671 3   TYR B CA  
3264 C C   . TYR B 3   ? 0.3837 0.4774 0.7230 0.0712  -0.0170 -0.0585 3   TYR B C   
3265 O O   . TYR B 3   ? 0.3826 0.4679 0.7146 0.0708  -0.0222 -0.0491 3   TYR B O   
3266 C CB  . TYR B 3   ? 0.3546 0.4545 0.6689 0.0562  -0.0080 -0.0660 3   TYR B CB  
3267 C CG  . TYR B 3   ? 0.3850 0.4803 0.6846 0.0484  -0.0033 -0.0706 3   TYR B CG  
3268 C CD1 . TYR B 3   ? 0.3992 0.5037 0.6953 0.0432  0.0031  -0.0787 3   TYR B CD1 
3269 C CD2 . TYR B 3   ? 0.4068 0.4889 0.6961 0.0459  -0.0054 -0.0669 3   TYR B CD2 
3270 C CE1 . TYR B 3   ? 0.3996 0.5000 0.6812 0.0356  0.0068  -0.0822 3   TYR B CE1 
3271 C CE2 . TYR B 3   ? 0.4212 0.4998 0.6974 0.0387  -0.0021 -0.0707 3   TYR B CE2 
3272 C CZ  . TYR B 3   ? 0.4709 0.5585 0.7427 0.0335  0.0037  -0.0780 3   TYR B CZ  
3273 O OH  . TYR B 3   ? 0.4374 0.5217 0.6949 0.0259  0.0062  -0.0809 3   TYR B OH  
3274 N N   . ALA B 4   ? 0.3305 0.4351 0.6874 0.0774  -0.0172 -0.0617 4   ALA B N   
3275 C CA  . ALA B 4   ? 0.3192 0.4276 0.6877 0.0841  -0.0247 -0.0535 4   ALA B CA  
3276 C C   . ALA B 4   ? 0.3547 0.4487 0.7285 0.0900  -0.0302 -0.0464 4   ALA B C   
3277 O O   . ALA B 4   ? 0.3627 0.4560 0.7356 0.0919  -0.0375 -0.0359 4   ALA B O   
3278 C CB  . ALA B 4   ? 0.3290 0.4531 0.7170 0.0895  -0.0236 -0.0593 4   ALA B CB  
3279 N N   . ARG B 5   ? 0.2899 0.3721 0.6679 0.0919  -0.0269 -0.0519 5   ARG B N   
3280 C CA  . ARG B 5   ? 0.2954 0.3624 0.6785 0.0969  -0.0319 -0.0450 5   ARG B CA  
3281 C C   . ARG B 5   ? 0.3536 0.4098 0.7188 0.0917  -0.0360 -0.0346 5   ARG B C   
3282 O O   . ARG B 5   ? 0.3479 0.3931 0.7156 0.0949  -0.0412 -0.0262 5   ARG B O   
3283 C CB  . ARG B 5   ? 0.2972 0.3538 0.6904 0.1001  -0.0270 -0.0544 5   ARG B CB  
3284 C CG  . ARG B 5   ? 0.3852 0.4337 0.7633 0.0922  -0.0209 -0.0613 5   ARG B CG  
3285 C CD  . ARG B 5   ? 0.4567 0.4939 0.8460 0.0958  -0.0171 -0.0700 5   ARG B CD  
3286 N NE  . ARG B 5   ? 0.4541 0.4763 0.8306 0.0901  -0.0161 -0.0701 5   ARG B NE  
3287 C CZ  . ARG B 5   ? 0.6433 0.6528 1.0150 0.0899  -0.0216 -0.0599 5   ARG B CZ  
3288 N NH1 . ARG B 5   ? 0.4309 0.4403 0.8071 0.0944  -0.0286 -0.0480 5   ARG B NH1 
3289 N NH2 . ARG B 5   ? 0.6409 0.6383 1.0025 0.0844  -0.0201 -0.0614 5   ARG B NH2 
3290 N N   . PHE B 6   ? 0.3061 0.3660 0.6542 0.0836  -0.0335 -0.0350 6   PHE B N   
3291 C CA  . PHE B 6   ? 0.3010 0.3530 0.6327 0.0780  -0.0359 -0.0269 6   PHE B CA  
3292 C C   . PHE B 6   ? 0.3373 0.3970 0.6626 0.0764  -0.0407 -0.0179 6   PHE B C   
3293 O O   . PHE B 6   ? 0.3273 0.3799 0.6434 0.0739  -0.0440 -0.0097 6   PHE B O   
3294 C CB  . PHE B 6   ? 0.3164 0.3667 0.6343 0.0702  -0.0305 -0.0327 6   PHE B CB  
3295 C CG  . PHE B 6   ? 0.3425 0.3846 0.6631 0.0699  -0.0259 -0.0414 6   PHE B CG  
3296 C CD1 . PHE B 6   ? 0.3843 0.4338 0.7091 0.0693  -0.0200 -0.0526 6   PHE B CD1 
3297 C CD2 . PHE B 6   ? 0.3727 0.4002 0.6911 0.0693  -0.0272 -0.0390 6   PHE B CD2 
3298 C CE1 . PHE B 6   ? 0.4009 0.4433 0.7268 0.0681  -0.0154 -0.0616 6   PHE B CE1 
3299 C CE2 . PHE B 6   ? 0.4199 0.4400 0.7402 0.0682  -0.0229 -0.0480 6   PHE B CE2 
3300 C CZ  . PHE B 6   ? 0.3974 0.4250 0.7211 0.0676  -0.0170 -0.0594 6   PHE B CZ  
3301 N N   . ILE B 7   ? 0.2820 0.3565 0.6118 0.0771  -0.0408 -0.0200 7   ILE B N   
3302 C CA  . ILE B 7   ? 0.2690 0.3516 0.5917 0.0745  -0.0449 -0.0129 7   ILE B CA  
3303 C C   . ILE B 7   ? 0.3179 0.4037 0.6491 0.0799  -0.0527 -0.0043 7   ILE B C   
3304 O O   . ILE B 7   ? 0.3420 0.4249 0.6878 0.0871  -0.0553 -0.0036 7   ILE B O   
3305 C CB  . ILE B 7   ? 0.2966 0.3924 0.6145 0.0694  -0.0408 -0.0188 7   ILE B CB  
3306 C CG1 . ILE B 7   ? 0.2891 0.3991 0.6226 0.0736  -0.0399 -0.0250 7   ILE B CG1 
3307 C CG2 . ILE B 7   ? 0.3075 0.3979 0.6144 0.0633  -0.0344 -0.0247 7   ILE B CG2 
3308 C CD1 . ILE B 7   ? 0.2783 0.4023 0.6075 0.0683  -0.0373 -0.0285 7   ILE B CD1 
3309 N N   . THR B 8   ? 0.2387 0.3293 0.5602 0.0763  -0.0566 0.0028  8   THR B N   
3310 C CA  . THR B 8   ? 0.2287 0.3239 0.5556 0.0801  -0.0646 0.0117  8   THR B CA  
3311 C C   . THR B 8   ? 0.2683 0.3818 0.6044 0.0815  -0.0660 0.0080  8   THR B C   
3312 O O   . THR B 8   ? 0.2577 0.3792 0.5921 0.0777  -0.0602 -0.0003 8   THR B O   
3313 C CB  . THR B 8   ? 0.2644 0.3560 0.5748 0.0744  -0.0678 0.0206  8   THR B CB  
3314 O OG1 . THR B 8   ? 0.2790 0.3781 0.5779 0.0674  -0.0641 0.0168  8   THR B OG1 
3315 C CG2 . THR B 8   ? 0.2394 0.3144 0.5416 0.0726  -0.0665 0.0245  8   THR B CG2 
3316 N N   . ALA B 9   ? 0.2169 0.3375 0.5626 0.0863  -0.0738 0.0148  9   ALA B N   
3317 C CA  . ALA B 9   ? 0.2066 0.3459 0.5629 0.0879  -0.0770 0.0129  9   ALA B CA  
3318 C C   . ALA B 9   ? 0.2775 0.4261 0.6185 0.0792  -0.0764 0.0129  9   ALA B C   
3319 O O   . ALA B 9   ? 0.2726 0.4355 0.6182 0.0772  -0.0742 0.0066  9   ALA B O   
3320 C CB  . ALA B 9   ? 0.2255 0.3679 0.5940 0.0949  -0.0870 0.0223  9   ALA B CB  
3321 N N   . ALA B 10  ? 0.2488 0.3890 0.5721 0.0737  -0.0775 0.0193  10  ALA B N   
3322 C CA  . ALA B 10  ? 0.2465 0.3930 0.5546 0.0652  -0.0764 0.0191  10  ALA B CA  
3323 C C   . ALA B 10  ? 0.3266 0.4732 0.6294 0.0601  -0.0674 0.0094  10  ALA B C   
3324 O O   . ALA B 10  ? 0.3138 0.4714 0.6138 0.0551  -0.0658 0.0053  10  ALA B O   
3325 C CB  . ALA B 10  ? 0.2577 0.3939 0.5496 0.0609  -0.0784 0.0271  10  ALA B CB  
3326 N N   . SER B 11  ? 0.2996 0.4338 0.6014 0.0611  -0.0620 0.0060  11  SER B N   
3327 C CA  . SER B 11  ? 0.2955 0.4278 0.5918 0.0564  -0.0541 -0.0020 11  SER B CA  
3328 C C   . SER B 11  ? 0.3144 0.4601 0.6214 0.0570  -0.0511 -0.0101 11  SER B C   
3329 O O   . SER B 11  ? 0.3051 0.4572 0.6061 0.0509  -0.0475 -0.0142 11  SER B O   
3330 C CB  . SER B 11  ? 0.3644 0.4821 0.6592 0.0580  -0.0504 -0.0035 11  SER B CB  
3331 O OG  . SER B 11  ? 0.5284 0.6429 0.8142 0.0523  -0.0439 -0.0089 11  SER B OG  
3332 N N   . ALA B 12  ? 0.2407 0.3911 0.5646 0.0642  -0.0527 -0.0122 12  ALA B N   
3333 C CA  . ALA B 12  ? 0.2238 0.3881 0.5612 0.0657  -0.0495 -0.0204 12  ALA B CA  
3334 C C   . ALA B 12  ? 0.2679 0.4489 0.6070 0.0623  -0.0522 -0.0204 12  ALA B C   
3335 O O   . ALA B 12  ? 0.2687 0.4591 0.6088 0.0579  -0.0470 -0.0275 12  ALA B O   
3336 C CB  . ALA B 12  ? 0.2347 0.4001 0.5914 0.0750  -0.0516 -0.0215 12  ALA B CB  
3337 N N   . ALA B 13  ? 0.2064 0.3909 0.5448 0.0635  -0.0603 -0.0123 13  ALA B N   
3338 C CA  . ALA B 13  ? 0.1879 0.3881 0.5272 0.0601  -0.0647 -0.0110 13  ALA B CA  
3339 C C   . ALA B 13  ? 0.2287 0.4321 0.5545 0.0502  -0.0596 -0.0153 13  ALA B C   
3340 O O   . ALA B 13  ? 0.2222 0.4408 0.5531 0.0471  -0.0600 -0.0190 13  ALA B O   
3341 C CB  . ALA B 13  ? 0.1991 0.3980 0.5340 0.0615  -0.0740 -0.0004 13  ALA B CB  
3342 N N   . ARG B 14  ? 0.1805 0.3697 0.4901 0.0455  -0.0552 -0.0148 14  ARG B N   
3343 C CA  . ARG B 14  ? 0.1674 0.3556 0.4637 0.0366  -0.0503 -0.0181 14  ARG B CA  
3344 C C   . ARG B 14  ? 0.2153 0.4132 0.5170 0.0329  -0.0444 -0.0265 14  ARG B C   
3345 O O   . ARG B 14  ? 0.2167 0.4144 0.5261 0.0357  -0.0402 -0.0312 14  ARG B O   
3346 C CB  . ARG B 14  ? 0.1583 0.3289 0.4409 0.0342  -0.0462 -0.0165 14  ARG B CB  
3347 C CG  . ARG B 14  ? 0.2243 0.3857 0.4995 0.0358  -0.0509 -0.0085 14  ARG B CG  
3348 C CD  . ARG B 14  ? 0.3346 0.4812 0.5968 0.0322  -0.0465 -0.0077 14  ARG B CD  
3349 N NE  . ARG B 14  ? 0.3683 0.5049 0.6264 0.0349  -0.0499 -0.0006 14  ARG B NE  
3350 C CZ  . ARG B 14  ? 0.5132 0.6501 0.7638 0.0328  -0.0538 0.0050  14  ARG B CZ  
3351 N NH1 . ARG B 14  ? 0.3891 0.5359 0.6353 0.0279  -0.0551 0.0041  14  ARG B NH1 
3352 N NH2 . ARG B 14  ? 0.3797 0.5072 0.6267 0.0349  -0.0562 0.0115  14  ARG B NH2 
3353 N N   . ASN B 15  ? 0.1778 0.3845 0.4753 0.0260  -0.0440 -0.0285 15  ASN B N   
3354 C CA  . ASN B 15  ? 0.1879 0.4042 0.4894 0.0209  -0.0385 -0.0360 15  ASN B CA  
3355 C C   . ASN B 15  ? 0.3110 0.5194 0.5976 0.0119  -0.0333 -0.0377 15  ASN B C   
3356 O O   . ASN B 15  ? 0.3302 0.5307 0.6055 0.0093  -0.0351 -0.0338 15  ASN B O   
3357 C CB  . ASN B 15  ? 0.1402 0.3763 0.4532 0.0203  -0.0429 -0.0376 15  ASN B CB  
3358 C CG  . ASN B 15  ? 0.2659 0.5118 0.5962 0.0293  -0.0488 -0.0356 15  ASN B CG  
3359 O OD1 . ASN B 15  ? 0.2743 0.5233 0.6173 0.0342  -0.0458 -0.0398 15  ASN B OD1 
3360 N ND2 . ASN B 15  ? 0.0675 0.3197 0.3993 0.0311  -0.0575 -0.0296 15  ASN B ND2 
3361 N N   . PRO B 16  ? 0.3013 0.5112 0.5875 0.0067  -0.0266 -0.0434 16  PRO B N   
3362 C CA  . PRO B 16  ? 0.3156 0.5172 0.5888 -0.0016 -0.0223 -0.0442 16  PRO B CA  
3363 C C   . PRO B 16  ? 0.4062 0.6175 0.6784 -0.0076 -0.0245 -0.0455 16  PRO B C   
3364 O O   . PRO B 16  ? 0.4193 0.6467 0.7020 -0.0067 -0.0279 -0.0473 16  PRO B O   
3365 C CB  . PRO B 16  ? 0.3376 0.5396 0.6119 -0.0053 -0.0153 -0.0492 16  PRO B CB  
3366 C CG  . PRO B 16  ? 0.3827 0.5924 0.6698 0.0014  -0.0152 -0.0518 16  PRO B CG  
3367 C CD  . PRO B 16  ? 0.3216 0.5410 0.6191 0.0077  -0.0224 -0.0493 16  PRO B CD  
3368 N N   . SER B 17  ? 0.3779 0.5800 0.6384 -0.0136 -0.0226 -0.0450 17  SER B N   
3369 C CA  . SER B 17  ? 0.3858 0.5955 0.6438 -0.0204 -0.0240 -0.0472 17  SER B CA  
3370 C C   . SER B 17  ? 0.4747 0.6991 0.7410 -0.0257 -0.0217 -0.0530 17  SER B C   
3371 O O   . SER B 17  ? 0.4707 0.6932 0.7386 -0.0281 -0.0160 -0.0559 17  SER B O   
3372 C CB  . SER B 17  ? 0.4180 0.6134 0.6632 -0.0262 -0.0204 -0.0471 17  SER B CB  
3373 O OG  . SER B 17  ? 0.5051 0.7070 0.7471 -0.0320 -0.0223 -0.0493 17  SER B OG  
3374 N N   . PRO B 18  ? 0.4531 0.6931 0.7246 -0.0284 -0.0262 -0.0548 18  PRO B N   
3375 C CA  . PRO B 18  ? 0.4606 0.7159 0.7412 -0.0342 -0.0240 -0.0607 18  PRO B CA  
3376 C C   . PRO B 18  ? 0.5495 0.7973 0.8217 -0.0444 -0.0174 -0.0647 18  PRO B C   
3377 O O   . PRO B 18  ? 0.5511 0.8072 0.8292 -0.0499 -0.0133 -0.0693 18  PRO B O   
3378 C CB  . PRO B 18  ? 0.4814 0.7539 0.7682 -0.0343 -0.0318 -0.0605 18  PRO B CB  
3379 C CG  . PRO B 18  ? 0.5343 0.7970 0.8089 -0.0336 -0.0359 -0.0559 18  PRO B CG  
3380 C CD  . PRO B 18  ? 0.4725 0.7175 0.7414 -0.0270 -0.0337 -0.0514 18  PRO B CD  
3381 N N   . ILE B 19  ? 0.5259 0.7579 0.7851 -0.0471 -0.0162 -0.0628 19  ILE B N   
3382 C CA  . ILE B 19  ? 0.5317 0.7530 0.7829 -0.0559 -0.0103 -0.0659 19  ILE B CA  
3383 C C   . ILE B 19  ? 0.5654 0.7712 0.8126 -0.0551 -0.0044 -0.0638 19  ILE B C   
3384 O O   . ILE B 19  ? 0.5434 0.7353 0.7845 -0.0502 -0.0046 -0.0595 19  ILE B O   
3385 C CB  . ILE B 19  ? 0.5781 0.7922 0.8195 -0.0597 -0.0117 -0.0662 19  ILE B CB  
3386 C CG1 . ILE B 19  ? 0.5849 0.7858 0.8191 -0.0528 -0.0135 -0.0608 19  ILE B CG1 
3387 C CG2 . ILE B 19  ? 0.5867 0.8189 0.8317 -0.0629 -0.0174 -0.0690 19  ILE B CG2 
3388 C CD1 . ILE B 19  ? 0.6627 0.8577 0.8874 -0.0558 -0.0146 -0.0613 19  ILE B CD1 
3389 N N   . ARG B 20  ? 0.5353 0.7450 0.7863 -0.0601 0.0005  -0.0668 20  ARG B N   
3390 C CA  . ARG B 20  ? 0.5442 0.7416 0.7908 -0.0607 0.0058  -0.0647 20  ARG B CA  
3391 C C   . ARG B 20  ? 0.6038 0.7822 0.8402 -0.0662 0.0095  -0.0630 20  ARG B C   
3392 O O   . ARG B 20  ? 0.5980 0.7755 0.8329 -0.0736 0.0111  -0.0661 20  ARG B O   
3393 C CB  . ARG B 20  ? 0.5553 0.7648 0.8091 -0.0645 0.0099  -0.0684 20  ARG B CB  
3394 C CG  . ARG B 20  ? 0.6701 0.8949 0.9352 -0.0570 0.0074  -0.0696 20  ARG B CG  
3395 C CD  . ARG B 20  ? 0.8183 1.0334 1.0806 -0.0486 0.0067  -0.0656 20  ARG B CD  
3396 N NE  . ARG B 20  ? 1.0613 1.2877 1.3342 -0.0396 0.0018  -0.0657 20  ARG B NE  
3397 C CZ  . ARG B 20  ? 1.3357 1.5542 1.6073 -0.0312 -0.0014 -0.0618 20  ARG B CZ  
3398 N NH1 . ARG B 20  ? 1.1823 1.3828 1.4424 -0.0306 -0.0004 -0.0576 20  ARG B NH1 
3399 N NH2 . ARG B 20  ? 1.2089 1.4374 1.4913 -0.0233 -0.0059 -0.0617 20  ARG B NH2 
3400 N N   . THR B 21  ? 0.5722 0.7353 0.8024 -0.0625 0.0105  -0.0581 21  THR B N   
3401 C CA  . THR B 21  ? 0.5832 0.7274 0.8054 -0.0660 0.0133  -0.0552 21  THR B CA  
3402 C C   . THR B 21  ? 0.6593 0.7945 0.8773 -0.0668 0.0163  -0.0513 21  THR B C   
3403 O O   . THR B 21  ? 0.6630 0.8072 0.8837 -0.0646 0.0166  -0.0517 21  THR B O   
3404 C CB  . THR B 21  ? 0.5954 0.7287 0.8139 -0.0606 0.0104  -0.0525 21  THR B CB  
3405 O OG1 . THR B 21  ? 0.5411 0.6725 0.7593 -0.0523 0.0076  -0.0484 21  THR B OG1 
3406 C CG2 . THR B 21  ? 0.5264 0.6673 0.7462 -0.0616 0.0079  -0.0563 21  THR B CG2 
3407 N N   . MET B 22  ? 0.6252 0.7433 0.8370 -0.0701 0.0184  -0.0475 22  MET B N   
3408 C CA  . MET B 22  ? 0.6360 0.7442 0.8420 -0.0718 0.0203  -0.0424 22  MET B CA  
3409 C C   . MET B 22  ? 0.7111 0.8008 0.9123 -0.0759 0.0218  -0.0381 22  MET B C   
3410 O O   . MET B 22  ? 0.7183 0.8045 0.9211 -0.0807 0.0234  -0.0408 22  MET B O   
3411 C CB  . MET B 22  ? 0.6712 0.7898 0.8775 -0.0782 0.0242  -0.0448 22  MET B CB  
3412 C CG  . MET B 22  ? 0.7251 0.8481 0.9339 -0.0874 0.0277  -0.0489 22  MET B CG  
3413 S SD  . MET B 22  ? 0.7913 0.9223 0.9984 -0.0965 0.0334  -0.0500 22  MET B SD  
3414 C CE  . MET B 22  ? 0.7551 0.8923 0.9673 -0.1065 0.0365  -0.0557 22  MET B CE  
3415 N N   . THR B 23  ? 0.6677 0.7460 0.8632 -0.0750 0.0212  -0.0315 23  THR B N   
3416 C CA  . THR B 23  ? 0.6742 0.7349 0.8663 -0.0789 0.0221  -0.0263 23  THR B CA  
3417 C C   . THR B 23  ? 0.7284 0.7884 0.9172 -0.0893 0.0263  -0.0260 23  THR B C   
3418 O O   . THR B 23  ? 0.7052 0.7733 0.8903 -0.0925 0.0280  -0.0256 23  THR B O   
3419 C CB  . THR B 23  ? 0.7451 0.7931 0.9339 -0.0735 0.0186  -0.0188 23  THR B CB  
3420 O OG1 . THR B 23  ? 0.7599 0.8070 0.9414 -0.0767 0.0187  -0.0140 23  THR B OG1 
3421 C CG2 . THR B 23  ? 0.6873 0.7390 0.8792 -0.0641 0.0150  -0.0197 23  THR B CG2 
3422 N N   . ASP B 24  ? 0.7076 0.7584 0.8983 -0.0949 0.0285  -0.0268 24  ASP B N   
3423 C CA  . ASP B 24  ? 0.7252 0.7734 0.9140 -0.1057 0.0329  -0.0270 24  ASP B CA  
3424 C C   . ASP B 24  ? 0.8129 0.8557 0.9934 -0.1118 0.0344  -0.0200 24  ASP B C   
3425 O O   . ASP B 24  ? 0.8334 0.8886 1.0120 -0.1177 0.0377  -0.0229 24  ASP B O   
3426 C CB  . ASP B 24  ? 0.7588 0.7941 0.9514 -0.1094 0.0345  -0.0287 24  ASP B CB  
3427 C CG  . ASP B 24  ? 0.9398 0.9792 1.1340 -0.1202 0.0392  -0.0337 24  ASP B CG  
3428 O OD1 . ASP B 24  ? 0.9718 1.0028 1.1699 -0.1234 0.0409  -0.0372 24  ASP B OD1 
3429 O OD2 . ASP B 24  ? 1.0160 1.0676 1.2080 -0.1257 0.0416  -0.0349 24  ASP B OD2 
3430 N N   . ILE B 25  ? 0.7689 0.7937 0.9448 -0.1114 0.0322  -0.0110 25  ILE B N   
3431 C CA  . ILE B 25  ? 0.7720 0.7898 0.9382 -0.1179 0.0327  -0.0027 25  ILE B CA  
3432 C C   . ILE B 25  ? 0.8198 0.8356 0.9830 -0.1306 0.0380  -0.0025 25  ILE B C   
3433 O O   . ILE B 25  ? 0.8309 0.8312 0.9881 -0.1360 0.0377  0.0062  25  ILE B O   
3434 C CB  . ILE B 25  ? 0.8041 0.8316 0.9633 -0.1145 0.0308  -0.0007 25  ILE B CB  
3435 C CG1 . ILE B 25  ? 0.8024 0.8225 0.9625 -0.1042 0.0248  0.0037  25  ILE B CG1 
3436 C CG2 . ILE B 25  ? 0.8244 0.8495 0.9717 -0.1236 0.0327  0.0058  25  ILE B CG2 
3437 C CD1 . ILE B 25  ? 0.9165 0.9507 1.0787 -0.0964 0.0232  -0.0014 25  ILE B CD1 
3438 N N   . LEU B 26  ? 0.7622 0.7931 0.9299 -0.1353 0.0424  -0.0117 26  LEU B N   
3439 C CA  . LEU B 26  ? 0.7687 0.8008 0.9352 -0.1477 0.0480  -0.0132 26  LEU B CA  
3440 C C   . LEU B 26  ? 0.8652 0.8814 1.0361 -0.1527 0.0493  -0.0130 26  LEU B C   
3441 O O   . LEU B 26  ? 0.8610 0.8749 1.0303 -0.1638 0.0538  -0.0131 26  LEU B O   
3442 C CB  . LEU B 26  ? 0.7524 0.8083 0.9246 -0.1504 0.0517  -0.0237 26  LEU B CB  
3443 C CG  . LEU B 26  ? 0.8031 0.8758 0.9711 -0.1517 0.0540  -0.0251 26  LEU B CG  
3444 C CD1 . LEU B 26  ? 0.7989 0.8925 0.9746 -0.1573 0.0588  -0.0348 26  LEU B CD1 
3445 C CD2 . LEU B 26  ? 0.8434 0.9069 0.9987 -0.1596 0.0561  -0.0165 26  LEU B CD2 
3446 N N   . SER B 27  ? 0.8655 0.8712 1.0424 -0.1450 0.0461  -0.0137 27  SER B N   
3447 C CA  . SER B 27  ? 0.8939 0.8846 1.0763 -0.1492 0.0480  -0.0153 27  SER B CA  
3448 C C   . SER B 27  ? 0.9959 0.9616 1.1780 -0.1470 0.0453  -0.0055 27  SER B C   
3449 O O   . SER B 27  ? 0.9820 0.9412 1.1576 -0.1444 0.0419  0.0043  27  SER B O   
3450 C CB  . SER B 27  ? 0.9279 0.9271 1.1192 -0.1446 0.0480  -0.0260 27  SER B CB  
3451 O OG  . SER B 27  ? 1.0510 1.0666 1.2450 -0.1522 0.0517  -0.0348 27  SER B OG  
3452 N N   . ARG B 28  ? 1.0047 0.9568 1.1943 -0.1489 0.0472  -0.0088 28  ARG B N   
3453 C CA  . ARG B 28  ? 1.0370 0.9648 1.2313 -0.1465 0.0458  -0.0027 28  ARG B CA  
3454 C C   . ARG B 28  ? 1.1195 1.0345 1.3090 -0.1421 0.0405  0.0112  28  ARG B C   
3455 O O   . ARG B 28  ? 1.1412 1.0432 1.3256 -0.1492 0.0405  0.0206  28  ARG B O   
3456 C CB  . ARG B 28  ? 1.0532 0.9791 1.2578 -0.1387 0.0457  -0.0114 28  ARG B CB  
3457 C CG  . ARG B 28  ? 1.2052 1.1467 1.4101 -0.1279 0.0422  -0.0147 28  ARG B CG  
3458 C CD  . ARG B 28  ? 1.3591 1.3069 1.5710 -0.1243 0.0439  -0.0262 28  ARG B CD  
3459 N NE  . ARG B 28  ? 1.4382 1.3999 1.6495 -0.1147 0.0403  -0.0280 28  ARG B NE  
3460 C CZ  . ARG B 28  ? 1.5566 1.5390 1.7645 -0.1143 0.0397  -0.0327 28  ARG B CZ  
3461 N NH1 . ARG B 28  ? 1.3959 1.3894 1.6013 -0.1228 0.0424  -0.0365 28  ARG B NH1 
3462 N NH2 . ARG B 28  ? 1.2956 1.2878 1.5034 -0.1054 0.0363  -0.0334 28  ARG B NH2 
3463 N N   . GLY B 29  ? 1.0590 0.9785 1.2499 -0.1310 0.0358  0.0125  29  GLY B N   
3464 C CA  . GLY B 29  ? 1.0586 0.9691 1.2463 -0.1253 0.0298  0.0244  29  GLY B CA  
3465 C C   . GLY B 29  ? 1.0814 1.0019 1.2720 -0.1138 0.0260  0.0217  29  GLY B C   
3466 O O   . GLY B 29  ? 1.0746 1.0067 1.2573 -0.1118 0.0233  0.0244  29  GLY B O   
3467 N N   . PRO B 30  ? 1.0141 0.9310 1.2158 -0.1063 0.0261  0.0159  30  PRO B N   
3468 C CA  . PRO B 30  ? 0.9790 0.9056 1.1832 -0.0959 0.0226  0.0138  30  PRO B CA  
3469 C C   . PRO B 30  ? 0.9636 0.9118 1.1641 -0.0956 0.0246  0.0044  30  PRO B C   
3470 O O   . PRO B 30  ? 0.9603 0.9147 1.1641 -0.0984 0.0286  -0.0051 30  PRO B O   
3471 C CB  . PRO B 30  ? 1.0030 0.9181 1.2200 -0.0896 0.0232  0.0105  30  PRO B CB  
3472 C CG  . PRO B 30  ? 1.0763 0.9827 1.2975 -0.0971 0.0287  0.0049  30  PRO B CG  
3473 C CD  . PRO B 30  ? 1.0402 0.9441 1.2526 -0.1074 0.0297  0.0105  30  PRO B CD  
3474 N N   . LYS B 31  ? 0.8657 0.8253 1.0592 -0.0926 0.0215  0.0073  31  LYS B N   
3475 C CA  . LYS B 31  ? 0.8284 0.8080 1.0196 -0.0914 0.0226  -0.0004 31  LYS B CA  
3476 C C   . LYS B 31  ? 0.8364 0.8217 1.0342 -0.0825 0.0213  -0.0062 31  LYS B C   
3477 O O   . LYS B 31  ? 0.8290 0.8070 1.0304 -0.0755 0.0181  -0.0024 31  LYS B O   
3478 C CB  . LYS B 31  ? 0.8476 0.8369 1.0294 -0.0927 0.0210  0.0037  31  LYS B CB  
3479 C CG  . LYS B 31  ? 0.9488 0.9488 1.1300 -0.0842 0.0176  0.0024  31  LYS B CG  
3480 C CD  . LYS B 31  ? 0.9700 0.9597 1.1504 -0.0784 0.0123  0.0109  31  LYS B CD  
3481 C CE  . LYS B 31  ? 0.9866 0.9858 1.1680 -0.0702 0.0093  0.0088  31  LYS B CE  
3482 N NZ  . LYS B 31  ? 1.0641 1.0756 1.2376 -0.0719 0.0094  0.0079  31  LYS B NZ  
3483 N N   . SER B 32  ? 0.7611 0.7598 0.9606 -0.0835 0.0238  -0.0154 32  SER B N   
3484 C CA  . SER B 32  ? 0.7294 0.7362 0.9333 -0.0771 0.0230  -0.0216 32  SER B CA  
3485 C C   . SER B 32  ? 0.7276 0.7538 0.9296 -0.0789 0.0237  -0.0279 32  SER B C   
3486 O O   . SER B 32  ? 0.7196 0.7514 0.9194 -0.0860 0.0261  -0.0294 32  SER B O   
3487 C CB  . SER B 32  ? 0.7813 0.7796 0.9913 -0.0784 0.0259  -0.0269 32  SER B CB  
3488 O OG  . SER B 32  ? 0.9479 0.9498 1.1577 -0.0870 0.0297  -0.0329 32  SER B OG  
3489 N N   . MET B 33  ? 0.6503 0.6868 0.8541 -0.0726 0.0215  -0.0314 33  MET B N   
3490 C CA  . MET B 33  ? 0.6269 0.6817 0.8307 -0.0733 0.0213  -0.0367 33  MET B CA  
3491 C C   . MET B 33  ? 0.6726 0.7342 0.8790 -0.0795 0.0238  -0.0444 33  MET B C   
3492 O O   . MET B 33  ? 0.6633 0.7168 0.8715 -0.0811 0.0254  -0.0474 33  MET B O   
3493 C CB  . MET B 33  ? 0.6381 0.7022 0.8423 -0.0648 0.0174  -0.0362 33  MET B CB  
3494 C CG  . MET B 33  ? 0.6737 0.7447 0.8805 -0.0620 0.0162  -0.0412 33  MET B CG  
3495 S SD  . MET B 33  ? 0.7039 0.7926 0.9120 -0.0558 0.0121  -0.0423 33  MET B SD  
3496 C CE  . MET B 33  ? 0.6601 0.7565 0.8694 -0.0573 0.0115  -0.0484 33  MET B CE  
3497 N N   . ILE B 34  ? 0.6302 0.7070 0.8374 -0.0835 0.0244  -0.0479 34  ILE B N   
3498 C CA  . ILE B 34  ? 0.6324 0.7193 0.8424 -0.0901 0.0261  -0.0552 34  ILE B CA  
3499 C C   . ILE B 34  ? 0.6979 0.8055 0.9111 -0.0866 0.0227  -0.0587 34  ILE B C   
3500 O O   . ILE B 34  ? 0.6797 0.7939 0.8935 -0.0812 0.0207  -0.0558 34  ILE B O   
3501 C CB  . ILE B 34  ? 0.6748 0.7601 0.8845 -0.1002 0.0303  -0.0559 34  ILE B CB  
3502 C CG1 . ILE B 34  ? 0.6669 0.7596 0.8750 -0.1006 0.0308  -0.0523 34  ILE B CG1 
3503 C CG2 . ILE B 34  ? 0.6914 0.7553 0.8993 -0.1044 0.0333  -0.0531 34  ILE B CG2 
3504 C CD1 . ILE B 34  ? 0.6874 0.7933 0.8983 -0.1090 0.0340  -0.0568 34  ILE B CD1 
3505 N N   . SER B 35  ? 0.6833 0.8009 0.8989 -0.0898 0.0220  -0.0650 35  SER B N   
3506 C CA  . SER B 35  ? 0.6869 0.8247 0.9067 -0.0870 0.0180  -0.0678 35  SER B CA  
3507 C C   . SER B 35  ? 0.7516 0.9039 0.9764 -0.0949 0.0197  -0.0726 35  SER B C   
3508 O O   . SER B 35  ? 0.7429 0.8922 0.9673 -0.1037 0.0228  -0.0769 35  SER B O   
3509 C CB  . SER B 35  ? 0.7399 0.8811 0.9583 -0.0850 0.0147  -0.0706 35  SER B CB  
3510 O OG  . SER B 35  ? 0.8981 1.0374 1.1154 -0.0936 0.0174  -0.0767 35  SER B OG  
3511 N N   . LEU B 36  ? 0.7138 0.8817 0.9443 -0.0919 0.0181  -0.0724 36  LEU B N   
3512 C CA  . LEU B 36  ? 0.7148 0.8993 0.9523 -0.0985 0.0198  -0.0771 36  LEU B CA  
3513 C C   . LEU B 36  ? 0.7569 0.9589 1.0002 -0.1011 0.0161  -0.0827 36  LEU B C   
3514 O O   . LEU B 36  ? 0.7612 0.9787 1.0119 -0.1070 0.0171  -0.0871 36  LEU B O   
3515 C CB  . LEU B 36  ? 0.7123 0.9062 0.9546 -0.0947 0.0207  -0.0754 36  LEU B CB  
3516 C CG  . LEU B 36  ? 0.7737 0.9544 1.0101 -0.0978 0.0261  -0.0716 36  LEU B CG  
3517 C CD1 . LEU B 36  ? 0.7677 0.9485 1.0036 -0.0894 0.0251  -0.0679 36  LEU B CD1 
3518 C CD2 . LEU B 36  ? 0.7980 0.9860 1.0371 -0.1083 0.0315  -0.0751 36  LEU B CD2 
3519 N N   . ALA B 37  ? 0.6925 0.8923 0.9321 -0.0978 0.0118  -0.0827 37  ALA B N   
3520 C CA  . ALA B 37  ? 0.6824 0.8978 0.9251 -0.1010 0.0074  -0.0876 37  ALA B CA  
3521 C C   . ALA B 37  ? 0.6968 0.9055 0.9345 -0.1114 0.0104  -0.0933 37  ALA B C   
3522 O O   . ALA B 37  ? 0.7086 0.9274 0.9511 -0.1199 0.0121  -0.0984 37  ALA B O   
3523 C CB  . ALA B 37  ? 0.6896 0.9106 0.9315 -0.0921 0.0005  -0.0844 37  ALA B CB  
3524 N N   . GLY B 38  ? 0.6133 0.8054 0.8425 -0.1114 0.0117  -0.0934 38  GLY B N   
3525 C CA  . GLY B 38  ? 0.5942 0.7732 0.8176 -0.1026 0.0106  -0.0881 38  GLY B CA  
3526 C C   . GLY B 38  ? 0.6183 0.7880 0.8344 -0.1051 0.0114  -0.0916 38  GLY B C   
3527 O O   . GLY B 38  ? 0.6210 0.7839 0.8355 -0.1137 0.0157  -0.0974 38  GLY B O   
3528 N N   . GLY B 39  ? 0.5319 0.7007 0.7439 -0.0979 0.0078  -0.0883 39  GLY B N   
3529 C CA  . GLY B 39  ? 0.5088 0.6716 0.7135 -0.1003 0.0086  -0.0921 39  GLY B CA  
3530 C C   . GLY B 39  ? 0.5030 0.6454 0.7042 -0.0962 0.0129  -0.0898 39  GLY B C   
3531 O O   . GLY B 39  ? 0.5098 0.6502 0.7057 -0.0933 0.0119  -0.0897 39  GLY B O   
3532 N N   . LEU B 40  ? 0.4016 0.5294 0.6058 -0.0964 0.0176  -0.0879 40  LEU B N   
3533 C CA  . LEU B 40  ? 0.3705 0.4790 0.5735 -0.0924 0.0213  -0.0854 40  LEU B CA  
3534 C C   . LEU B 40  ? 0.4177 0.5173 0.6183 -0.0989 0.0261  -0.0934 40  LEU B C   
3535 O O   . LEU B 40  ? 0.4127 0.5130 0.6143 -0.1077 0.0289  -0.0995 40  LEU B O   
3536 C CB  . LEU B 40  ? 0.3587 0.4544 0.5654 -0.0910 0.0239  -0.0801 40  LEU B CB  
3537 C CG  . LEU B 40  ? 0.3848 0.4865 0.5935 -0.0854 0.0206  -0.0731 40  LEU B CG  
3538 C CD1 . LEU B 40  ? 0.3708 0.4574 0.5806 -0.0849 0.0234  -0.0679 40  LEU B CD1 
3539 C CD2 . LEU B 40  ? 0.4013 0.5078 0.6086 -0.0762 0.0161  -0.0686 40  LEU B CD2 
3540 N N   . PRO B 41  ? 0.3636 0.4557 0.5614 -0.0953 0.0277  -0.0942 41  PRO B N   
3541 C CA  . PRO B 41  ? 0.3649 0.4486 0.5610 -0.1014 0.0333  -0.1030 41  PRO B CA  
3542 C C   . PRO B 41  ? 0.4044 0.4695 0.6067 -0.1039 0.0390  -0.1040 41  PRO B C   
3543 O O   . PRO B 41  ? 0.3870 0.4437 0.5936 -0.0988 0.0383  -0.0962 41  PRO B O   
3544 C CB  . PRO B 41  ? 0.3845 0.4647 0.5774 -0.0956 0.0338  -0.1022 41  PRO B CB  
3545 C CG  . PRO B 41  ? 0.4361 0.5141 0.6319 -0.0860 0.0303  -0.0920 41  PRO B CG  
3546 C CD  . PRO B 41  ? 0.3776 0.4680 0.5742 -0.0859 0.0251  -0.0876 41  PRO B CD  
3547 N N   . ASN B 42  ? 0.3630 0.4218 0.5657 -0.1121 0.0443  -0.1133 42  ASN B N   
3548 C CA  . ASN B 42  ? 0.3759 0.4156 0.5853 -0.1147 0.0496  -0.1141 42  ASN B CA  
3549 C C   . ASN B 42  ? 0.4436 0.4664 0.6583 -0.1066 0.0522  -0.1102 42  ASN B C   
3550 O O   . ASN B 42  ? 0.4479 0.4689 0.6618 -0.1049 0.0550  -0.1154 42  ASN B O   
3551 C CB  . ASN B 42  ? 0.3983 0.4349 0.6077 -0.1255 0.0547  -0.1254 42  ASN B CB  
3552 C CG  . ASN B 42  ? 0.7477 0.7673 0.9640 -0.1296 0.0587  -0.1245 42  ASN B CG  
3553 O OD1 . ASN B 42  ? 0.6785 0.6798 0.9012 -0.1250 0.0616  -0.1209 42  ASN B OD1 
3554 N ND2 . ASN B 42  ? 0.6801 0.7058 0.8958 -0.1384 0.0586  -0.1271 42  ASN B ND2 
3555 N N   . PRO B 43  ? 0.3813 0.3930 0.6014 -0.1018 0.0512  -0.1009 43  PRO B N   
3556 C CA  . PRO B 43  ? 0.3795 0.3762 0.6062 -0.0940 0.0527  -0.0966 43  PRO B CA  
3557 C C   . PRO B 43  ? 0.4336 0.4124 0.6683 -0.0968 0.0596  -0.1033 43  PRO B C   
3558 O O   . PRO B 43  ? 0.4111 0.3801 0.6524 -0.0906 0.0617  -0.1026 43  PRO B O   
3559 C CB  . PRO B 43  ? 0.3938 0.3862 0.6223 -0.0896 0.0485  -0.0846 43  PRO B CB  
3560 C CG  . PRO B 43  ? 0.4478 0.4442 0.6737 -0.0977 0.0483  -0.0851 43  PRO B CG  
3561 C CD  . PRO B 43  ? 0.3898 0.4023 0.6103 -0.1041 0.0487  -0.0943 43  PRO B CD  
3562 N N   . ASN B 44  ? 0.4222 0.3970 0.6572 -0.1062 0.0633  -0.1105 44  ASN B N   
3563 C CA  . ASN B 44  ? 0.4472 0.4044 0.6903 -0.1097 0.0704  -0.1183 44  ASN B CA  
3564 C C   . ASN B 44  ? 0.5158 0.4773 0.7571 -0.1111 0.0753  -0.1305 44  ASN B C   
3565 O O   . ASN B 44  ? 0.5312 0.4794 0.7795 -0.1139 0.0822  -0.1393 44  ASN B O   
3566 C CB  . ASN B 44  ? 0.4701 0.4206 0.7140 -0.1199 0.0730  -0.1219 44  ASN B CB  
3567 C CG  . ASN B 44  ? 0.8357 0.7801 1.0811 -0.1196 0.0694  -0.1100 44  ASN B CG  
3568 O OD1 . ASN B 44  ? 0.8022 0.7315 1.0545 -0.1136 0.0686  -0.1013 44  ASN B OD1 
3569 N ND2 . ASN B 44  ? 0.7210 0.6774 0.9600 -0.1266 0.0672  -0.1096 44  ASN B ND2 
3570 N N   . MET B 45  ? 0.4589 0.4382 0.6912 -0.1089 0.0719  -0.1308 45  MET B N   
3571 C CA  . MET B 45  ? 0.4572 0.4435 0.6848 -0.1105 0.0757  -0.1409 45  MET B CA  
3572 C C   . MET B 45  ? 0.4750 0.4593 0.7063 -0.1007 0.0760  -0.1367 45  MET B C   
3573 O O   . MET B 45  ? 0.4615 0.4472 0.6916 -0.1015 0.0810  -0.1452 45  MET B O   
3574 C CB  . MET B 45  ? 0.4863 0.4947 0.7004 -0.1158 0.0712  -0.1434 45  MET B CB  
3575 C CG  . MET B 45  ? 0.5474 0.5611 0.7579 -0.1265 0.0710  -0.1492 45  MET B CG  
3576 S SD  . MET B 45  ? 0.6263 0.6287 0.8390 -0.1370 0.0807  -0.1660 45  MET B SD  
3577 C CE  . MET B 45  ? 0.5978 0.5807 0.8220 -0.1394 0.0828  -0.1623 45  MET B CE  
3578 N N   . PHE B 46  ? 0.4193 0.4013 0.6547 -0.0921 0.0707  -0.1241 46  PHE B N   
3579 C CA  . PHE B 46  ? 0.3940 0.3749 0.6336 -0.0827 0.0699  -0.1186 46  PHE B CA  
3580 C C   . PHE B 46  ? 0.4356 0.3995 0.6893 -0.0793 0.0765  -0.1226 46  PHE B C   
3581 O O   . PHE B 46  ? 0.4367 0.3857 0.6995 -0.0802 0.0784  -0.1219 46  PHE B O   
3582 C CB  . PHE B 46  ? 0.3977 0.3815 0.6371 -0.0757 0.0620  -0.1046 46  PHE B CB  
3583 C CG  . PHE B 46  ? 0.3988 0.4001 0.6266 -0.0772 0.0556  -0.1006 46  PHE B CG  
3584 C CD1 . PHE B 46  ? 0.4257 0.4416 0.6434 -0.0819 0.0555  -0.1072 46  PHE B CD1 
3585 C CD2 . PHE B 46  ? 0.4128 0.4162 0.6399 -0.0739 0.0496  -0.0903 46  PHE B CD2 
3586 C CE1 . PHE B 46  ? 0.4237 0.4557 0.6330 -0.0826 0.0490  -0.1030 46  PHE B CE1 
3587 C CE2 . PHE B 46  ? 0.4324 0.4519 0.6510 -0.0746 0.0441  -0.0873 46  PHE B CE2 
3588 C CZ  . PHE B 46  ? 0.4075 0.4411 0.6182 -0.0786 0.0436  -0.0934 46  PHE B CZ  
3589 N N   . PRO B 47  ? 0.3861 0.3521 0.6424 -0.0758 0.0806  -0.1274 47  PRO B N   
3590 C CA  . PRO B 47  ? 0.3917 0.3425 0.6637 -0.0725 0.0879  -0.1329 47  PRO B CA  
3591 C C   . PRO B 47  ? 0.4497 0.3879 0.7369 -0.0630 0.0850  -0.1222 47  PRO B C   
3592 O O   . PRO B 47  ? 0.4532 0.3763 0.7554 -0.0610 0.0900  -0.1257 47  PRO B O   
3593 C CB  . PRO B 47  ? 0.4064 0.3663 0.6749 -0.0728 0.0933  -0.1416 47  PRO B CB  
3594 C CG  . PRO B 47  ? 0.4461 0.4226 0.7010 -0.0713 0.0862  -0.1340 47  PRO B CG  
3595 C CD  . PRO B 47  ? 0.3815 0.3635 0.6269 -0.0753 0.0794  -0.1285 47  PRO B CD  
3596 N N   . PHE B 48  ? 0.4020 0.3462 0.6859 -0.0573 0.0770  -0.1095 48  PHE B N   
3597 C CA  . PHE B 48  ? 0.4047 0.3385 0.7015 -0.0489 0.0731  -0.0987 48  PHE B CA  
3598 C C   . PHE B 48  ? 0.4420 0.3642 0.7407 -0.0511 0.0696  -0.0919 48  PHE B C   
3599 O O   . PHE B 48  ? 0.4329 0.3618 0.7194 -0.0564 0.0660  -0.0892 48  PHE B O   
3600 C CB  . PHE B 48  ? 0.4165 0.3612 0.7089 -0.0426 0.0665  -0.0891 48  PHE B CB  
3601 C CG  . PHE B 48  ? 0.4393 0.3966 0.7267 -0.0421 0.0696  -0.0952 48  PHE B CG  
3602 C CD1 . PHE B 48  ? 0.4920 0.4460 0.7913 -0.0387 0.0760  -0.1013 48  PHE B CD1 
3603 C CD2 . PHE B 48  ? 0.4662 0.4386 0.7374 -0.0454 0.0664  -0.0949 48  PHE B CD2 
3604 C CE1 . PHE B 48  ? 0.5038 0.4696 0.7971 -0.0394 0.0795  -0.1069 48  PHE B CE1 
3605 C CE2 . PHE B 48  ? 0.5032 0.4865 0.7685 -0.0457 0.0691  -0.0995 48  PHE B CE2 
3606 C CZ  . PHE B 48  ? 0.4853 0.4652 0.7610 -0.0431 0.0758  -0.1055 48  PHE B CZ  
3607 N N   . LYS B 49  ? 0.3840 0.2890 0.6986 -0.0475 0.0710  -0.0892 49  LYS B N   
3608 C CA  . LYS B 49  ? 0.3812 0.2728 0.6980 -0.0507 0.0686  -0.0831 49  LYS B CA  
3609 C C   . LYS B 49  ? 0.4320 0.3163 0.7535 -0.0450 0.0608  -0.0675 49  LYS B C   
3610 O O   . LYS B 49  ? 0.4281 0.3111 0.7412 -0.0493 0.0565  -0.0602 49  LYS B O   
3611 C CB  . LYS B 49  ? 0.4012 0.2770 0.7287 -0.0549 0.0764  -0.0928 49  LYS B CB  
3612 C CG  . LYS B 49  ? 0.3415 0.2248 0.6605 -0.0635 0.0836  -0.1085 49  LYS B CG  
3613 C CD  . LYS B 49  ? 0.3810 0.2736 0.6834 -0.0726 0.0809  -0.1085 49  LYS B CD  
3614 C CE  . LYS B 49  ? 0.4911 0.3925 0.7851 -0.0813 0.0870  -0.1235 49  LYS B CE  
3615 N NZ  . LYS B 49  ? 0.6441 0.5602 0.9221 -0.0885 0.0828  -0.1224 49  LYS B NZ  
3616 N N   . THR B 50  ? 0.3724 0.2523 0.7076 -0.0361 0.0591  -0.0626 50  THR B N   
3617 C CA  . THR B 50  ? 0.3665 0.2404 0.7070 -0.0303 0.0509  -0.0477 50  THR B CA  
3618 C C   . THR B 50  ? 0.4317 0.3133 0.7800 -0.0216 0.0486  -0.0452 50  THR B C   
3619 O O   . THR B 50  ? 0.4312 0.3172 0.7862 -0.0195 0.0548  -0.0551 50  THR B O   
3620 C CB  . THR B 50  ? 0.4218 0.2745 0.7778 -0.0288 0.0507  -0.0426 50  THR B CB  
3621 O OG1 . THR B 50  ? 0.4647 0.3102 0.8401 -0.0233 0.0564  -0.0500 50  THR B OG1 
3622 C CG2 . THR B 50  ? 0.3748 0.2172 0.7249 -0.0378 0.0530  -0.0442 50  THR B CG2 
3623 N N   . ALA B 51  ? 0.3954 0.2789 0.7430 -0.0171 0.0401  -0.0323 51  ALA B N   
3624 C CA  . ALA B 51  ? 0.3930 0.2841 0.7483 -0.0093 0.0374  -0.0294 51  ALA B CA  
3625 C C   . ALA B 51  ? 0.4386 0.3228 0.8025 -0.0038 0.0288  -0.0154 51  ALA B C   
3626 O O   . ALA B 51  ? 0.4412 0.3208 0.7967 -0.0068 0.0229  -0.0058 51  ALA B O   
3627 C CB  . ALA B 51  ? 0.3889 0.2979 0.7283 -0.0105 0.0358  -0.0306 51  ALA B CB  
3628 N N   . VAL B 52  ? 0.3811 0.2659 0.7621 0.0039  0.0281  -0.0144 52  VAL B N   
3629 C CA  . VAL B 52  ? 0.3797 0.2603 0.7711 0.0099  0.0193  -0.0014 52  VAL B CA  
3630 C C   . VAL B 52  ? 0.3961 0.2897 0.7939 0.0159  0.0177  -0.0017 52  VAL B C   
3631 O O   . VAL B 52  ? 0.3915 0.2878 0.8030 0.0194  0.0243  -0.0108 52  VAL B O   
3632 C CB  . VAL B 52  ? 0.4471 0.3092 0.8578 0.0132  0.0180  0.0038  52  VAL B CB  
3633 C CG1 . VAL B 52  ? 0.4594 0.3142 0.8863 0.0145  0.0284  -0.0094 52  VAL B CG1 
3634 C CG2 . VAL B 52  ? 0.4399 0.3007 0.8655 0.0210  0.0089  0.0160  52  VAL B CG2 
3635 N N   . ILE B 53  ? 0.3282 0.2303 0.7147 0.0160  0.0097  0.0072  53  ILE B N   
3636 C CA  . ILE B 53  ? 0.3230 0.2377 0.7126 0.0204  0.0068  0.0086  53  ILE B CA  
3637 C C   . ILE B 53  ? 0.4057 0.3172 0.8059 0.0254  -0.0034 0.0218  53  ILE B C   
3638 O O   . ILE B 53  ? 0.3925 0.2993 0.7826 0.0226  -0.0108 0.0320  53  ILE B O   
3639 C CB  . ILE B 53  ? 0.3443 0.2722 0.7118 0.0160  0.0060  0.0070  53  ILE B CB  
3640 C CG1 . ILE B 53  ? 0.3498 0.2814 0.7074 0.0111  0.0151  -0.0053 53  ILE B CG1 
3641 C CG2 . ILE B 53  ? 0.3126 0.2525 0.6824 0.0200  0.0024  0.0093  53  ILE B CG2 
3642 C CD1 . ILE B 53  ? 0.3624 0.3016 0.6982 0.0054  0.0138  -0.0053 53  ILE B CD1 
3643 N N   . THR B 54  ? 0.3861 0.3008 0.8067 0.0322  -0.0038 0.0214  54  THR B N   
3644 C CA  . THR B 54  ? 0.4023 0.3160 0.8356 0.0374  -0.0138 0.0334  54  THR B CA  
3645 C C   . THR B 54  ? 0.4750 0.4020 0.8964 0.0366  -0.0205 0.0385  54  THR B C   
3646 O O   . THR B 54  ? 0.4614 0.3995 0.8751 0.0353  -0.0159 0.0310  54  THR B O   
3647 C CB  . THR B 54  ? 0.4700 0.3814 0.9335 0.0454  -0.0114 0.0307  54  THR B CB  
3648 O OG1 . THR B 54  ? 0.3898 0.3139 0.8590 0.0472  -0.0045 0.0205  54  THR B OG1 
3649 C CG2 . THR B 54  ? 0.4698 0.3657 0.9463 0.0463  -0.0055 0.0264  54  THR B CG2 
3650 N N   . VAL B 55  ? 0.4594 0.3847 0.8782 0.0368  -0.0316 0.0515  55  VAL B N   
3651 C CA  . VAL B 55  ? 0.4576 0.3942 0.8655 0.0357  -0.0389 0.0570  55  VAL B CA  
3652 C C   . VAL B 55  ? 0.5540 0.4921 0.9787 0.0409  -0.0489 0.0673  55  VAL B C   
3653 O O   . VAL B 55  ? 0.5562 0.4843 0.9882 0.0422  -0.0555 0.0771  55  VAL B O   
3654 C CB  . VAL B 55  ? 0.4977 0.4344 0.8784 0.0283  -0.0423 0.0612  55  VAL B CB  
3655 C CG1 . VAL B 55  ? 0.4826 0.4297 0.8538 0.0271  -0.0503 0.0670  55  VAL B CG1 
3656 C CG2 . VAL B 55  ? 0.4929 0.4323 0.8587 0.0238  -0.0329 0.0503  55  VAL B CG2 
3657 N N   . GLU B 56  ? 0.5269 0.4779 0.9581 0.0435  -0.0502 0.0652  56  GLU B N   
3658 C CA  . GLU B 56  ? 0.5373 0.4942 0.9828 0.0476  -0.0601 0.0738  56  GLU B CA  
3659 C C   . GLU B 56  ? 0.6251 0.5846 1.0482 0.0419  -0.0697 0.0831  56  GLU B C   
3660 O O   . GLU B 56  ? 0.6297 0.5956 1.0330 0.0370  -0.0670 0.0784  56  GLU B O   
3661 C CB  . GLU B 56  ? 0.5424 0.5128 0.9997 0.0507  -0.0559 0.0661  56  GLU B CB  
3662 C CG  . GLU B 56  ? 0.7288 0.7072 1.2052 0.0553  -0.0649 0.0731  56  GLU B CG  
3663 C CD  . GLU B 56  ? 1.1577 1.1418 1.6628 0.0619  -0.0590 0.0662  56  GLU B CD  
3664 O OE1 . GLU B 56  ? 1.2260 1.2224 1.7334 0.0616  -0.0555 0.0601  56  GLU B OE1 
3665 O OE2 . GLU B 56  ? 1.0996 1.0759 1.6255 0.0672  -0.0575 0.0667  56  GLU B OE2 
3666 N N   . ASN B 57  ? 0.5931 0.5470 1.0186 0.0421  -0.0806 0.0960  57  ASN B N   
3667 C CA  . ASN B 57  ? 0.5912 0.5467 0.9951 0.0359  -0.0900 0.1054  57  ASN B CA  
3668 C C   . ASN B 57  ? 0.6278 0.5761 1.0060 0.0285  -0.0867 0.1050  57  ASN B C   
3669 O O   . ASN B 57  ? 0.6291 0.5822 0.9859 0.0224  -0.0901 0.1072  57  ASN B O   
3670 C CB  . ASN B 57  ? 0.5726 0.5426 0.9711 0.0345  -0.0947 0.1049  57  ASN B CB  
3671 C CG  . ASN B 57  ? 0.9044 0.8793 1.3187 0.0379  -0.1066 0.1151  57  ASN B CG  
3672 O OD1 . ASN B 57  ? 0.8770 0.8614 1.3099 0.0426  -0.1067 0.1118  57  ASN B OD1 
3673 N ND2 . ASN B 57  ? 0.7722 0.7415 1.1799 0.0353  -0.1172 0.1279  57  ASN B ND2 
3674 N N   . GLY B 58  ? 0.5657 0.5026 0.9474 0.0288  -0.0802 0.1023  58  GLY B N   
3675 C CA  . GLY B 58  ? 0.5575 0.4870 0.9186 0.0219  -0.0762 0.1015  58  GLY B CA  
3676 C C   . GLY B 58  ? 0.6037 0.5183 0.9754 0.0233  -0.0722 0.1021  58  GLY B C   
3677 O O   . GLY B 58  ? 0.6154 0.5257 1.0111 0.0301  -0.0712 0.1012  58  GLY B O   
3678 N N   . LYS B 59  ? 0.5390 0.4455 0.8939 0.0166  -0.0698 0.1033  59  LYS B N   
3679 C CA  . LYS B 59  ? 0.5376 0.4290 0.9009 0.0166  -0.0652 0.1030  59  LYS B CA  
3680 C C   . LYS B 59  ? 0.5691 0.4625 0.9386 0.0183  -0.0526 0.0872  59  LYS B C   
3681 O O   . LYS B 59  ? 0.5588 0.4644 0.9192 0.0173  -0.0482 0.0785  59  LYS B O   
3682 C CB  . LYS B 59  ? 0.5662 0.4496 0.9085 0.0077  -0.0664 0.1092  59  LYS B CB  
3683 C CG  . LYS B 59  ? 0.7238 0.5889 1.0760 0.0075  -0.0663 0.1151  59  LYS B CG  
3684 C CD  . LYS B 59  ? 0.8362 0.6939 1.1668 -0.0024 -0.0670 0.1213  59  LYS B CD  
3685 C CE  . LYS B 59  ? 0.9538 0.7945 1.2916 -0.0043 -0.0614 0.1203  59  LYS B CE  
3686 N NZ  . LYS B 59  ? 0.9764 0.8198 1.3116 -0.0064 -0.0490 0.1043  59  LYS B NZ  
3687 N N   . THR B 60  ? 0.5077 0.3891 0.8928 0.0209  -0.0472 0.0835  60  THR B N   
3688 C CA  . THR B 60  ? 0.4812 0.3639 0.8710 0.0214  -0.0352 0.0683  60  THR B CA  
3689 C C   . THR B 60  ? 0.4902 0.3738 0.8575 0.0130  -0.0294 0.0624  60  THR B C   
3690 O O   . THR B 60  ? 0.5103 0.3842 0.8683 0.0076  -0.0313 0.0686  60  THR B O   
3691 C CB  . THR B 60  ? 0.5874 0.4578 1.0022 0.0269  -0.0307 0.0649  60  THR B CB  
3692 O OG1 . THR B 60  ? 0.5526 0.4253 0.9689 0.0260  -0.0188 0.0495  60  THR B OG1 
3693 C CG2 . THR B 60  ? 0.6479 0.4998 1.0655 0.0247  -0.0339 0.0739  60  THR B CG2 
3694 N N   . ILE B 61  ? 0.3942 0.2900 0.7527 0.0116  -0.0229 0.0513  61  ILE B N   
3695 C CA  . ILE B 61  ? 0.3747 0.2744 0.7137 0.0043  -0.0176 0.0447  61  ILE B CA  
3696 C C   . ILE B 61  ? 0.4342 0.3245 0.7790 0.0021  -0.0088 0.0358  61  ILE B C   
3697 O O   . ILE B 61  ? 0.4352 0.3236 0.7963 0.0066  -0.0036 0.0284  61  ILE B O   
3698 C CB  . ILE B 61  ? 0.3862 0.3023 0.7158 0.0046  -0.0153 0.0375  61  ILE B CB  
3699 C CG1 . ILE B 61  ? 0.3828 0.3071 0.7008 0.0038  -0.0234 0.0456  61  ILE B CG1 
3700 C CG2 . ILE B 61  ? 0.3765 0.2974 0.6934 -0.0009 -0.0078 0.0273  61  ILE B CG2 
3701 C CD1 . ILE B 61  ? 0.3834 0.3210 0.7000 0.0067  -0.0232 0.0413  61  ILE B CD1 
3702 N N   . GLN B 62  ? 0.3921 0.2770 0.7244 -0.0053 -0.0069 0.0358  62  GLN B N   
3703 C CA  . GLN B 62  ? 0.4040 0.2799 0.7408 -0.0086 0.0012  0.0271  62  GLN B CA  
3704 C C   . GLN B 62  ? 0.4446 0.3271 0.7638 -0.0166 0.0060  0.0201  62  GLN B C   
3705 O O   . GLN B 62  ? 0.4559 0.3408 0.7603 -0.0219 0.0024  0.0261  62  GLN B O   
3706 C CB  . GLN B 62  ? 0.4457 0.3026 0.7920 -0.0094 -0.0009 0.0349  62  GLN B CB  
3707 C CG  . GLN B 62  ? 0.8444 0.6921 1.2150 -0.0009 -0.0023 0.0373  62  GLN B CG  
3708 C CD  . GLN B 62  ? 1.1377 0.9705 1.5151 0.0000  -0.0102 0.0520  62  GLN B CD  
3709 O OE1 . GLN B 62  ? 1.0605 0.8965 1.4316 0.0006  -0.0196 0.0643  62  GLN B OE1 
3710 N NE2 . GLN B 62  ? 1.0586 0.8742 1.4494 0.0000  -0.0068 0.0511  62  GLN B NE2 
3711 N N   . PHE B 63  ? 0.3786 0.2648 0.6997 -0.0178 0.0140  0.0072  63  PHE B N   
3712 C CA  . PHE B 63  ? 0.3623 0.2549 0.6689 -0.0255 0.0184  -0.0001 63  PHE B CA  
3713 C C   . PHE B 63  ? 0.4261 0.3051 0.7391 -0.0301 0.0244  -0.0057 63  PHE B C   
3714 O O   . PHE B 63  ? 0.4315 0.3064 0.7563 -0.0279 0.0303  -0.0147 63  PHE B O   
3715 C CB  . PHE B 63  ? 0.3650 0.2736 0.6658 -0.0249 0.0223  -0.0102 63  PHE B CB  
3716 C CG  . PHE B 63  ? 0.3701 0.2927 0.6628 -0.0216 0.0174  -0.0064 63  PHE B CG  
3717 C CD1 . PHE B 63  ? 0.4021 0.3239 0.6934 -0.0189 0.0098  0.0049  63  PHE B CD1 
3718 C CD2 . PHE B 63  ? 0.3877 0.3238 0.6746 -0.0213 0.0202  -0.0141 63  PHE B CD2 
3719 C CE1 . PHE B 63  ? 0.3963 0.3302 0.6809 -0.0161 0.0058  0.0074  63  PHE B CE1 
3720 C CE2 . PHE B 63  ? 0.4112 0.3586 0.6919 -0.0181 0.0158  -0.0106 63  PHE B CE2 
3721 C CZ  . PHE B 63  ? 0.3777 0.3237 0.6577 -0.0155 0.0089  -0.0004 63  PHE B CZ  
3722 N N   . GLY B 64  ? 0.3806 0.2521 0.6864 -0.0366 0.0229  -0.0002 64  GLY B N   
3723 C CA  . GLY B 64  ? 0.3912 0.2492 0.7013 -0.0425 0.0283  -0.0048 64  GLY B CA  
3724 C C   . GLY B 64  ? 0.4433 0.3108 0.7449 -0.0492 0.0351  -0.0180 64  GLY B C   
3725 O O   . GLY B 64  ? 0.4098 0.2941 0.7028 -0.0486 0.0352  -0.0228 64  GLY B O   
3726 N N   . GLU B 65  ? 0.4459 0.3026 0.7502 -0.0559 0.0403  -0.0235 65  GLU B N   
3727 C CA  . GLU B 65  ? 0.4580 0.3224 0.7554 -0.0634 0.0467  -0.0365 65  GLU B CA  
3728 C C   . GLU B 65  ? 0.5033 0.3873 0.7839 -0.0676 0.0444  -0.0368 65  GLU B C   
3729 O O   . GLU B 65  ? 0.4940 0.3923 0.7697 -0.0678 0.0466  -0.0458 65  GLU B O   
3730 C CB  . GLU B 65  ? 0.5007 0.3491 0.8019 -0.0714 0.0512  -0.0394 65  GLU B CB  
3731 C CG  . GLU B 65  ? 0.7301 0.5695 1.0432 -0.0718 0.0591  -0.0525 65  GLU B CG  
3732 C CD  . GLU B 65  ? 1.2287 1.0520 1.5611 -0.0634 0.0600  -0.0506 65  GLU B CD  
3733 O OE1 . GLU B 65  ? 1.2835 1.0995 1.6214 -0.0576 0.0536  -0.0373 65  GLU B OE1 
3734 O OE2 . GLU B 65  ? 1.1880 1.0061 1.5306 -0.0631 0.0673  -0.0629 65  GLU B OE2 
3735 N N   . GLU B 66  ? 0.4565 0.3412 0.7288 -0.0705 0.0397  -0.0267 66  GLU B N   
3736 C CA  . GLU B 66  ? 0.4365 0.3388 0.6947 -0.0744 0.0377  -0.0265 66  GLU B CA  
3737 C C   . GLU B 66  ? 0.4761 0.3925 0.7298 -0.0672 0.0330  -0.0233 66  GLU B C   
3738 O O   . GLU B 66  ? 0.4758 0.4086 0.7222 -0.0682 0.0333  -0.0288 66  GLU B O   
3739 C CB  . GLU B 66  ? 0.4572 0.3550 0.7082 -0.0819 0.0361  -0.0189 66  GLU B CB  
3740 C CG  . GLU B 66  ? 0.6025 0.4887 0.8565 -0.0908 0.0415  -0.0237 66  GLU B CG  
3741 C CD  . GLU B 66  ? 0.9014 0.7985 1.1529 -0.0971 0.0468  -0.0373 66  GLU B CD  
3742 O OE1 . GLU B 66  ? 0.8989 0.8149 1.1415 -0.0989 0.0457  -0.0401 66  GLU B OE1 
3743 O OE2 . GLU B 66  ? 0.7562 0.6428 1.0149 -0.1006 0.0519  -0.0451 66  GLU B OE2 
3744 N N   . MET B 67  ? 0.4057 0.3157 0.6648 -0.0599 0.0284  -0.0145 67  MET B N   
3745 C CA  . MET B 67  ? 0.3744 0.2957 0.6308 -0.0529 0.0239  -0.0111 67  MET B CA  
3746 C C   . MET B 67  ? 0.4014 0.3325 0.6606 -0.0492 0.0272  -0.0211 67  MET B C   
3747 O O   . MET B 67  ? 0.3856 0.3311 0.6378 -0.0472 0.0253  -0.0224 67  MET B O   
3748 C CB  . MET B 67  ? 0.4108 0.3220 0.6746 -0.0466 0.0187  -0.0006 67  MET B CB  
3749 C CG  . MET B 67  ? 0.4558 0.3780 0.7167 -0.0402 0.0136  0.0034  67  MET B CG  
3750 S SD  . MET B 67  ? 0.5101 0.4445 0.7541 -0.0440 0.0093  0.0088  67  MET B SD  
3751 C CE  . MET B 67  ? 0.4840 0.4058 0.7279 -0.0442 0.0029  0.0232  67  MET B CE  
3752 N N   . MET B 68  ? 0.3545 0.2773 0.6236 -0.0488 0.0324  -0.0284 68  MET B N   
3753 C CA  . MET B 68  ? 0.3322 0.2629 0.6034 -0.0468 0.0366  -0.0387 68  MET B CA  
3754 C C   . MET B 68  ? 0.3311 0.2760 0.5908 -0.0531 0.0386  -0.0464 68  MET B C   
3755 O O   . MET B 68  ? 0.3004 0.2583 0.5553 -0.0509 0.0380  -0.0497 68  MET B O   
3756 C CB  . MET B 68  ? 0.3738 0.2916 0.6583 -0.0461 0.0426  -0.0455 68  MET B CB  
3757 C CG  . MET B 68  ? 0.4237 0.3490 0.7111 -0.0435 0.0472  -0.0553 68  MET B CG  
3758 S SD  . MET B 68  ? 0.4792 0.4124 0.7700 -0.0340 0.0428  -0.0492 68  MET B SD  
3759 C CE  . MET B 68  ? 0.4513 0.3751 0.7600 -0.0295 0.0493  -0.0561 68  MET B CE  
3760 N N   . LYS B 69  ? 0.2722 0.2149 0.5277 -0.0610 0.0403  -0.0485 69  LYS B N   
3761 C CA  . LYS B 69  ? 0.2588 0.2158 0.5049 -0.0673 0.0415  -0.0554 69  LYS B CA  
3762 C C   . LYS B 69  ? 0.3014 0.2736 0.5389 -0.0648 0.0361  -0.0501 69  LYS B C   
3763 O O   . LYS B 69  ? 0.3189 0.3057 0.5510 -0.0652 0.0357  -0.0550 69  LYS B O   
3764 C CB  . LYS B 69  ? 0.2868 0.2382 0.5317 -0.0766 0.0443  -0.0580 69  LYS B CB  
3765 C CG  . LYS B 69  ? 0.3135 0.2548 0.5648 -0.0808 0.0508  -0.0679 69  LYS B CG  
3766 C CD  . LYS B 69  ? 0.3286 0.2661 0.5779 -0.0910 0.0536  -0.0714 69  LYS B CD  
3767 C CE  . LYS B 69  ? 0.4843 0.3996 0.7430 -0.0926 0.0565  -0.0690 69  LYS B CE  
3768 N NZ  . LYS B 69  ? 0.7251 0.6364 0.9816 -0.1034 0.0594  -0.0723 69  LYS B NZ  
3769 N N   . ARG B 70  ? 0.2210 0.1896 0.4576 -0.0621 0.0319  -0.0400 70  ARG B N   
3770 C CA  . ARG B 70  ? 0.2001 0.1815 0.4296 -0.0593 0.0272  -0.0353 70  ARG B CA  
3771 C C   . ARG B 70  ? 0.2352 0.2231 0.4659 -0.0517 0.0252  -0.0356 70  ARG B C   
3772 O O   . ARG B 70  ? 0.2088 0.2104 0.4342 -0.0507 0.0237  -0.0378 70  ARG B O   
3773 C CB  . ARG B 70  ? 0.1878 0.1627 0.4154 -0.0590 0.0237  -0.0251 70  ARG B CB  
3774 C CG  . ARG B 70  ? 0.2510 0.2392 0.4711 -0.0574 0.0199  -0.0218 70  ARG B CG  
3775 C CD  . ARG B 70  ? 0.3191 0.3016 0.5360 -0.0567 0.0163  -0.0121 70  ARG B CD  
3776 N NE  . ARG B 70  ? 0.3512 0.3464 0.5622 -0.0539 0.0132  -0.0106 70  ARG B NE  
3777 C CZ  . ARG B 70  ? 0.5068 0.5010 0.7131 -0.0531 0.0097  -0.0034 70  ARG B CZ  
3778 N NH1 . ARG B 70  ? 0.2438 0.2253 0.4499 -0.0550 0.0082  0.0040  70  ARG B NH1 
3779 N NH2 . ARG B 70  ? 0.4751 0.4806 0.6769 -0.0506 0.0077  -0.0037 70  ARG B NH2 
3780 N N   . ALA B 71  ? 0.2076 0.1855 0.4461 -0.0464 0.0254  -0.0333 71  ALA B N   
3781 C CA  . ALA B 71  ? 0.2186 0.2009 0.4596 -0.0397 0.0242  -0.0332 71  ALA B CA  
3782 C C   . ALA B 71  ? 0.3091 0.3011 0.5475 -0.0407 0.0273  -0.0420 71  ALA B C   
3783 O O   . ALA B 71  ? 0.3157 0.3165 0.5513 -0.0368 0.0252  -0.0412 71  ALA B O   
3784 C CB  . ALA B 71  ? 0.2390 0.2085 0.4913 -0.0350 0.0247  -0.0303 71  ALA B CB  
3785 N N   . LEU B 72  ? 0.2766 0.2667 0.5155 -0.0463 0.0322  -0.0501 72  LEU B N   
3786 C CA  . LEU B 72  ? 0.2584 0.2573 0.4935 -0.0488 0.0354  -0.0589 72  LEU B CA  
3787 C C   . LEU B 72  ? 0.2629 0.2765 0.4882 -0.0534 0.0332  -0.0614 72  LEU B C   
3788 O O   . LEU B 72  ? 0.2432 0.2656 0.4637 -0.0560 0.0346  -0.0678 72  LEU B O   
3789 C CB  . LEU B 72  ? 0.2698 0.2591 0.5106 -0.0529 0.0420  -0.0674 72  LEU B CB  
3790 C CG  . LEU B 72  ? 0.3314 0.3076 0.5844 -0.0481 0.0453  -0.0674 72  LEU B CG  
3791 C CD1 . LEU B 72  ? 0.3421 0.3098 0.6004 -0.0530 0.0527  -0.0778 72  LEU B CD1 
3792 C CD2 . LEU B 72  ? 0.3431 0.3252 0.5975 -0.0419 0.0447  -0.0663 72  LEU B CD2 
3793 N N   . GLN B 73  ? 0.1887 0.2056 0.4113 -0.0544 0.0296  -0.0562 73  GLN B N   
3794 C CA  . GLN B 73  ? 0.1733 0.2043 0.3894 -0.0583 0.0273  -0.0580 73  GLN B CA  
3795 C C   . GLN B 73  ? 0.2056 0.2469 0.4185 -0.0529 0.0219  -0.0520 73  GLN B C   
3796 O O   . GLN B 73  ? 0.1857 0.2217 0.4007 -0.0472 0.0199  -0.0457 73  GLN B O   
3797 C CB  . GLN B 73  ? 0.1913 0.2188 0.4079 -0.0650 0.0288  -0.0583 73  GLN B CB  
3798 C CG  . GLN B 73  ? 0.2038 0.2464 0.4162 -0.0701 0.0272  -0.0610 73  GLN B CG  
3799 C CD  . GLN B 73  ? 0.3928 0.4460 0.6023 -0.0743 0.0280  -0.0693 73  GLN B CD  
3800 O OE1 . GLN B 73  ? 0.3485 0.4119 0.5549 -0.0708 0.0251  -0.0695 73  GLN B OE1 
3801 N NE2 . GLN B 73  ? 0.3257 0.3771 0.5357 -0.0824 0.0316  -0.0760 73  GLN B NE2 
3802 N N   . TYR B 74  ? 0.1479 0.2042 0.3567 -0.0548 0.0195  -0.0542 74  TYR B N   
3803 C CA  . TYR B 74  ? 0.1357 0.2019 0.3428 -0.0499 0.0147  -0.0495 74  TYR B CA  
3804 C C   . TYR B 74  ? 0.2077 0.2693 0.4161 -0.0485 0.0137  -0.0438 74  TYR B C   
3805 O O   . TYR B 74  ? 0.1957 0.2497 0.4052 -0.0530 0.0162  -0.0436 74  TYR B O   
3806 C CB  . TYR B 74  ? 0.1388 0.2214 0.3437 -0.0529 0.0124  -0.0531 74  TYR B CB  
3807 C CG  . TYR B 74  ? 0.1549 0.2449 0.3564 -0.0542 0.0117  -0.0574 74  TYR B CG  
3808 C CD1 . TYR B 74  ? 0.1777 0.2692 0.3769 -0.0488 0.0093  -0.0545 74  TYR B CD1 
3809 C CD2 . TYR B 74  ? 0.1709 0.2677 0.3706 -0.0616 0.0130  -0.0641 74  TYR B CD2 
3810 C CE1 . TYR B 74  ? 0.1944 0.2929 0.3887 -0.0509 0.0086  -0.0578 74  TYR B CE1 
3811 C CE2 . TYR B 74  ? 0.1823 0.2871 0.3771 -0.0637 0.0118  -0.0679 74  TYR B CE2 
3812 C CZ  . TYR B 74  ? 0.2517 0.3573 0.4433 -0.0583 0.0096  -0.0645 74  TYR B CZ  
3813 O OH  . TYR B 74  ? 0.2077 0.3213 0.3929 -0.0610 0.0083  -0.0674 74  TYR B OH  
3814 N N   . SER B 75  ? 0.1691 0.2350 0.3770 -0.0428 0.0101  -0.0391 75  SER B N   
3815 C CA  . SER B 75  ? 0.1608 0.2241 0.3684 -0.0415 0.0090  -0.0341 75  SER B CA  
3816 C C   . SER B 75  ? 0.2498 0.3244 0.4569 -0.0371 0.0055  -0.0328 75  SER B C   
3817 O O   . SER B 75  ? 0.2546 0.3365 0.4621 -0.0340 0.0034  -0.0342 75  SER B O   
3818 C CB  . SER B 75  ? 0.1614 0.2107 0.3701 -0.0385 0.0088  -0.0289 75  SER B CB  
3819 O OG  . SER B 75  ? 0.1754 0.2229 0.3858 -0.0330 0.0076  -0.0280 75  SER B OG  
3820 N N   . PRO B 76  ? 0.2160 0.2924 0.4223 -0.0371 0.0050  -0.0304 76  PRO B N   
3821 C CA  . PRO B 76  ? 0.2080 0.2948 0.4154 -0.0328 0.0024  -0.0304 76  PRO B CA  
3822 C C   . PRO B 76  ? 0.2653 0.3508 0.4733 -0.0257 -0.0008 -0.0278 76  PRO B C   
3823 O O   . PRO B 76  ? 0.2519 0.3272 0.4589 -0.0235 -0.0012 -0.0245 76  PRO B O   
3824 C CB  . PRO B 76  ? 0.2284 0.3139 0.4336 -0.0347 0.0036  -0.0284 76  PRO B CB  
3825 C CG  . PRO B 76  ? 0.2794 0.3580 0.4823 -0.0416 0.0067  -0.0281 76  PRO B CG  
3826 C CD  . PRO B 76  ? 0.2297 0.2985 0.4336 -0.0413 0.0070  -0.0276 76  PRO B CD  
3827 N N   . SER B 77  ? 0.2359 0.3320 0.4466 -0.0222 -0.0033 -0.0291 77  SER B N   
3828 C CA  . SER B 77  ? 0.2361 0.3320 0.4478 -0.0158 -0.0065 -0.0266 77  SER B CA  
3829 C C   . SER B 77  ? 0.2908 0.3782 0.5013 -0.0124 -0.0073 -0.0229 77  SER B C   
3830 O O   . SER B 77  ? 0.2918 0.3735 0.5020 -0.0091 -0.0088 -0.0202 77  SER B O   
3831 C CB  . SER B 77  ? 0.2712 0.3797 0.4872 -0.0129 -0.0093 -0.0282 77  SER B CB  
3832 O OG  . SER B 77  ? 0.3330 0.4498 0.5497 -0.0154 -0.0101 -0.0307 77  SER B OG  
3833 N N   . ALA B 78  ? 0.2472 0.3346 0.4568 -0.0138 -0.0062 -0.0230 78  ALA B N   
3834 C CA  . ALA B 78  ? 0.2351 0.3159 0.4427 -0.0116 -0.0071 -0.0200 78  ALA B CA  
3835 C C   . ALA B 78  ? 0.3079 0.3770 0.5124 -0.0134 -0.0070 -0.0161 78  ALA B C   
3836 O O   . ALA B 78  ? 0.3077 0.3713 0.5111 -0.0113 -0.0088 -0.0131 78  ALA B O   
3837 C CB  . ALA B 78  ? 0.2422 0.3283 0.4488 -0.0136 -0.0056 -0.0222 78  ALA B CB  
3838 N N   . GLY B 79  ? 0.2811 0.3467 0.4852 -0.0173 -0.0050 -0.0163 79  GLY B N   
3839 C CA  . GLY B 79  ? 0.2685 0.3228 0.4719 -0.0189 -0.0047 -0.0126 79  GLY B CA  
3840 C C   . GLY B 79  ? 0.3138 0.3651 0.5146 -0.0250 -0.0024 -0.0122 79  GLY B C   
3841 O O   . GLY B 79  ? 0.3192 0.3777 0.5179 -0.0285 -0.0007 -0.0149 79  GLY B O   
3842 N N   . ILE B 80  ? 0.2625 0.3030 0.4642 -0.0265 -0.0022 -0.0088 80  ILE B N   
3843 C CA  . ILE B 80  ? 0.2668 0.3017 0.4661 -0.0325 -0.0003 -0.0071 80  ILE B CA  
3844 C C   . ILE B 80  ? 0.3089 0.3436 0.5016 -0.0350 -0.0018 -0.0031 80  ILE B C   
3845 O O   . ILE B 80  ? 0.2857 0.3191 0.4772 -0.0315 -0.0050 0.0000  80  ILE B O   
3846 C CB  . ILE B 80  ? 0.3201 0.3427 0.5240 -0.0329 0.0003  -0.0047 80  ILE B CB  
3847 C CG1 . ILE B 80  ? 0.3210 0.3361 0.5280 -0.0280 -0.0034 0.0010  80  ILE B CG1 
3848 C CG2 . ILE B 80  ? 0.3325 0.3569 0.5409 -0.0326 0.0032  -0.0107 80  ILE B CG2 
3849 C CD1 . ILE B 80  ? 0.2813 0.2835 0.4930 -0.0287 -0.0039 0.0057  80  ILE B CD1 
3850 N N   . PRO B 81  ? 0.2849 0.3224 0.4730 -0.0414 0.0008  -0.0039 81  PRO B N   
3851 C CA  . PRO B 81  ? 0.2840 0.3229 0.4643 -0.0446 0.0001  -0.0010 81  PRO B CA  
3852 C C   . PRO B 81  ? 0.3576 0.3863 0.5340 -0.0444 -0.0039 0.0069  81  PRO B C   
3853 O O   . PRO B 81  ? 0.3672 0.3989 0.5387 -0.0436 -0.0060 0.0080  81  PRO B O   
3854 C CB  . PRO B 81  ? 0.3096 0.3517 0.4863 -0.0526 0.0043  -0.0028 81  PRO B CB  
3855 C CG  . PRO B 81  ? 0.3716 0.4100 0.5541 -0.0539 0.0063  -0.0049 81  PRO B CG  
3856 C CD  . PRO B 81  ? 0.3081 0.3483 0.4973 -0.0468 0.0047  -0.0079 81  PRO B CD  
3857 N N   . GLU B 82  ? 0.3119 0.3290 0.4913 -0.0450 -0.0053 0.0120  82  GLU B N   
3858 C CA  . GLU B 82  ? 0.3178 0.3252 0.4954 -0.0445 -0.0100 0.0204  82  GLU B CA  
3859 C C   . GLU B 82  ? 0.3745 0.3829 0.5557 -0.0377 -0.0142 0.0215  82  GLU B C   
3860 O O   . GLU B 82  ? 0.3826 0.3891 0.5587 -0.0383 -0.0184 0.0268  82  GLU B O   
3861 C CB  . GLU B 82  ? 0.3476 0.3419 0.5298 -0.0463 -0.0105 0.0257  82  GLU B CB  
3862 C CG  . GLU B 82  ? 0.5067 0.4982 0.6994 -0.0431 -0.0075 0.0208  82  GLU B CG  
3863 C CD  . GLU B 82  ? 0.6440 0.6379 0.8362 -0.0484 -0.0021 0.0151  82  GLU B CD  
3864 O OE1 . GLU B 82  ? 0.3613 0.3672 0.5518 -0.0487 0.0005  0.0083  82  GLU B OE1 
3865 O OE2 . GLU B 82  ? 0.5933 0.5770 0.7876 -0.0523 -0.0006 0.0175  82  GLU B OE2 
3866 N N   . LEU B 83  ? 0.3201 0.3322 0.5092 -0.0320 -0.0131 0.0164  83  LEU B N   
3867 C CA  . LEU B 83  ? 0.2888 0.3025 0.4819 -0.0259 -0.0163 0.0166  83  LEU B CA  
3868 C C   . LEU B 83  ? 0.3124 0.3348 0.4992 -0.0257 -0.0169 0.0138  83  LEU B C   
3869 O O   . LEU B 83  ? 0.3152 0.3370 0.5005 -0.0240 -0.0207 0.0166  83  LEU B O   
3870 C CB  . LEU B 83  ? 0.2713 0.2860 0.4734 -0.0210 -0.0143 0.0122  83  LEU B CB  
3871 C CG  . LEU B 83  ? 0.3100 0.3262 0.5173 -0.0152 -0.0168 0.0123  83  LEU B CG  
3872 C CD1 . LEU B 83  ? 0.3167 0.3260 0.5277 -0.0137 -0.0212 0.0189  83  LEU B CD1 
3873 C CD2 . LEU B 83  ? 0.3234 0.3404 0.5377 -0.0121 -0.0138 0.0081  83  LEU B CD2 
3874 N N   . LEU B 84  ? 0.2467 0.2774 0.4308 -0.0274 -0.0131 0.0079  84  LEU B N   
3875 C CA  . LEU B 84  ? 0.2322 0.2713 0.4121 -0.0271 -0.0127 0.0040  84  LEU B CA  
3876 C C   . LEU B 84  ? 0.2952 0.3336 0.4656 -0.0319 -0.0141 0.0070  84  LEU B C   
3877 O O   . LEU B 84  ? 0.2834 0.3240 0.4512 -0.0304 -0.0160 0.0061  84  LEU B O   
3878 C CB  . LEU B 84  ? 0.2210 0.2698 0.4023 -0.0279 -0.0084 -0.0028 84  LEU B CB  
3879 C CG  . LEU B 84  ? 0.2616 0.3148 0.4507 -0.0225 -0.0080 -0.0066 84  LEU B CG  
3880 C CD1 . LEU B 84  ? 0.2453 0.3080 0.4363 -0.0242 -0.0047 -0.0120 84  LEU B CD1 
3881 C CD2 . LEU B 84  ? 0.2948 0.3500 0.4861 -0.0169 -0.0104 -0.0076 84  LEU B CD2 
3882 N N   . SER B 85  ? 0.2749 0.3096 0.4394 -0.0383 -0.0132 0.0106  85  SER B N   
3883 C CA  . SER B 85  ? 0.2961 0.3301 0.4493 -0.0443 -0.0145 0.0142  85  SER B CA  
3884 C C   . SER B 85  ? 0.3752 0.4023 0.5267 -0.0428 -0.0210 0.0212  85  SER B C   
3885 O O   . SER B 85  ? 0.4046 0.4343 0.5481 -0.0452 -0.0229 0.0213  85  SER B O   
3886 C CB  . SER B 85  ? 0.3538 0.3848 0.5006 -0.0520 -0.0120 0.0173  85  SER B CB  
3887 O OG  . SER B 85  ? 0.5436 0.5648 0.6963 -0.0513 -0.0135 0.0226  85  SER B OG  
3888 N N   . TRP B 86  ? 0.3006 0.3198 0.4605 -0.0390 -0.0242 0.0261  86  TRP B N   
3889 C CA  . TRP B 86  ? 0.2937 0.3073 0.4552 -0.0369 -0.0307 0.0329  86  TRP B CA  
3890 C C   . TRP B 86  ? 0.3066 0.3253 0.4705 -0.0324 -0.0326 0.0292  86  TRP B C   
3891 O O   . TRP B 86  ? 0.2834 0.3020 0.4424 -0.0338 -0.0373 0.0325  86  TRP B O   
3892 C CB  . TRP B 86  ? 0.2776 0.2828 0.4506 -0.0330 -0.0324 0.0373  86  TRP B CB  
3893 C CG  . TRP B 86  ? 0.2928 0.2914 0.4678 -0.0325 -0.0395 0.0464  86  TRP B CG  
3894 C CD1 . TRP B 86  ? 0.3431 0.3341 0.5142 -0.0368 -0.0431 0.0551  86  TRP B CD1 
3895 C CD2 . TRP B 86  ? 0.2842 0.2836 0.4663 -0.0276 -0.0444 0.0481  86  TRP B CD2 
3896 N NE1 . TRP B 86  ? 0.3451 0.3328 0.5208 -0.0344 -0.0505 0.0624  86  TRP B NE1 
3897 C CE2 . TRP B 86  ? 0.3494 0.3425 0.5326 -0.0288 -0.0512 0.0579  86  TRP B CE2 
3898 C CE3 . TRP B 86  ? 0.2844 0.2893 0.4725 -0.0225 -0.0438 0.0427  86  TRP B CE3 
3899 C CZ2 . TRP B 86  ? 0.3353 0.3287 0.5264 -0.0249 -0.0574 0.0618  86  TRP B CZ2 
3900 C CZ3 . TRP B 86  ? 0.3009 0.3055 0.4958 -0.0193 -0.0494 0.0464  86  TRP B CZ3 
3901 C CH2 . TRP B 86  ? 0.3210 0.3204 0.5180 -0.0204 -0.0561 0.0555  86  TRP B CH2 
3902 N N   . LEU B 87  ? 0.2527 0.2756 0.4239 -0.0274 -0.0292 0.0226  87  LEU B N   
3903 C CA  . LEU B 87  ? 0.2332 0.2600 0.4078 -0.0230 -0.0303 0.0189  87  LEU B CA  
3904 C C   . LEU B 87  ? 0.2790 0.3117 0.4446 -0.0260 -0.0294 0.0145  87  LEU B C   
3905 O O   . LEU B 87  ? 0.2575 0.2905 0.4217 -0.0253 -0.0326 0.0145  87  LEU B O   
3906 C CB  . LEU B 87  ? 0.2143 0.2434 0.3982 -0.0175 -0.0272 0.0142  87  LEU B CB  
3907 C CG  . LEU B 87  ? 0.2622 0.2859 0.4556 -0.0143 -0.0277 0.0172  87  LEU B CG  
3908 C CD1 . LEU B 87  ? 0.3011 0.3280 0.5003 -0.0108 -0.0238 0.0121  87  LEU B CD1 
3909 C CD2 . LEU B 87  ? 0.2556 0.2760 0.4545 -0.0114 -0.0325 0.0214  87  LEU B CD2 
3910 N N   . LYS B 88  ? 0.2477 0.2853 0.4074 -0.0298 -0.0247 0.0103  88  LYS B N   
3911 C CA  . LYS B 88  ? 0.2430 0.2868 0.3945 -0.0334 -0.0223 0.0050  88  LYS B CA  
3912 C C   . LYS B 88  ? 0.3152 0.3565 0.4558 -0.0388 -0.0265 0.0094  88  LYS B C   
3913 O O   . LYS B 88  ? 0.3152 0.3594 0.4519 -0.0395 -0.0272 0.0056  88  LYS B O   
3914 C CB  . LYS B 88  ? 0.2750 0.3240 0.4227 -0.0378 -0.0166 0.0014  88  LYS B CB  
3915 C CG  . LYS B 88  ? 0.5523 0.6087 0.7084 -0.0334 -0.0121 -0.0062 88  LYS B CG  
3916 C CD  . LYS B 88  ? 0.7399 0.8036 0.8924 -0.0387 -0.0064 -0.0106 88  LYS B CD  
3917 C CE  . LYS B 88  ? 0.8529 0.9242 1.0005 -0.0412 -0.0029 -0.0176 88  LYS B CE  
3918 N NZ  . LYS B 88  ? 0.9408 1.0184 1.0988 -0.0344 -0.0010 -0.0249 88  LYS B NZ  
3919 N N   . GLN B 89  ? 0.2975 0.3332 0.4336 -0.0429 -0.0296 0.0175  89  GLN B N   
3920 C CA  . GLN B 89  ? 0.3235 0.3565 0.4488 -0.0487 -0.0348 0.0239  89  GLN B CA  
3921 C C   . GLN B 89  ? 0.3904 0.4212 0.5203 -0.0450 -0.0414 0.0269  89  GLN B C   
3922 O O   . GLN B 89  ? 0.4092 0.4416 0.5298 -0.0493 -0.0450 0.0278  89  GLN B O   
3923 C CB  . GLN B 89  ? 0.3550 0.3813 0.4768 -0.0529 -0.0370 0.0331  89  GLN B CB  
3924 C CG  . GLN B 89  ? 0.5865 0.6155 0.7001 -0.0594 -0.0309 0.0309  89  GLN B CG  
3925 C CD  . GLN B 89  ? 0.9585 0.9843 1.0576 -0.0685 -0.0335 0.0386  89  GLN B CD  
3926 O OE1 . GLN B 89  ? 0.9324 0.9582 1.0223 -0.0720 -0.0387 0.0425  89  GLN B OE1 
3927 N NE2 . GLN B 89  ? 0.8880 0.9115 0.9841 -0.0732 -0.0297 0.0408  89  GLN B NE2 
3928 N N   . LEU B 90  ? 0.3344 0.3621 0.4781 -0.0378 -0.0427 0.0280  90  LEU B N   
3929 C CA  . LEU B 90  ? 0.3299 0.3564 0.4805 -0.0340 -0.0482 0.0302  90  LEU B CA  
3930 C C   . LEU B 90  ? 0.3702 0.4019 0.5190 -0.0332 -0.0467 0.0222  90  LEU B C   
3931 O O   . LEU B 90  ? 0.3827 0.4151 0.5274 -0.0355 -0.0513 0.0233  90  LEU B O   
3932 C CB  . LEU B 90  ? 0.3162 0.3391 0.4822 -0.0269 -0.0483 0.0319  90  LEU B CB  
3933 C CG  . LEU B 90  ? 0.3598 0.3817 0.5348 -0.0233 -0.0538 0.0351  90  LEU B CG  
3934 C CD1 . LEU B 90  ? 0.3633 0.3818 0.5380 -0.0257 -0.0611 0.0446  90  LEU B CD1 
3935 C CD2 . LEU B 90  ? 0.3937 0.4143 0.5827 -0.0168 -0.0512 0.0334  90  LEU B CD2 
3936 N N   . GLN B 91  ? 0.3027 0.3378 0.4543 -0.0304 -0.0403 0.0143  91  GLN B N   
3937 C CA  . GLN B 91  ? 0.2976 0.3365 0.4491 -0.0290 -0.0379 0.0062  91  GLN B CA  
3938 C C   . GLN B 91  ? 0.3520 0.3942 0.4903 -0.0359 -0.0378 0.0030  91  GLN B C   
3939 O O   . GLN B 91  ? 0.3386 0.3815 0.4755 -0.0363 -0.0392 -0.0009 91  GLN B O   
3940 C CB  . GLN B 91  ? 0.3078 0.3501 0.4654 -0.0248 -0.0316 -0.0004 91  GLN B CB  
3941 C CG  . GLN B 91  ? 0.4313 0.4714 0.6007 -0.0185 -0.0314 0.0016  91  GLN B CG  
3942 C CD  . GLN B 91  ? 0.6332 0.6705 0.8101 -0.0143 -0.0346 0.0027  91  GLN B CD  
3943 O OE1 . GLN B 91  ? 0.7114 0.7498 0.8920 -0.0113 -0.0332 -0.0020 91  GLN B OE1 
3944 N NE2 . GLN B 91  ? 0.4400 0.4736 0.6204 -0.0140 -0.0388 0.0091  91  GLN B NE2 
3945 N N   . ILE B 92  ? 0.3226 0.3662 0.4505 -0.0420 -0.0360 0.0047  92  ILE B N   
3946 C CA  . ILE B 92  ? 0.3411 0.3882 0.4541 -0.0501 -0.0355 0.0020  92  ILE B CA  
3947 C C   . ILE B 92  ? 0.4183 0.4629 0.5243 -0.0542 -0.0437 0.0086  92  ILE B C   
3948 O O   . ILE B 92  ? 0.4133 0.4606 0.5125 -0.0577 -0.0443 0.0036  92  ILE B O   
3949 C CB  . ILE B 92  ? 0.3819 0.4318 0.4854 -0.0563 -0.0307 0.0022  92  ILE B CB  
3950 C CG1 . ILE B 92  ? 0.3753 0.4307 0.4858 -0.0529 -0.0225 -0.0069 92  ILE B CG1 
3951 C CG2 . ILE B 92  ? 0.3998 0.4528 0.4855 -0.0663 -0.0308 0.0012  92  ILE B CG2 
3952 C CD1 . ILE B 92  ? 0.4524 0.5103 0.5598 -0.0568 -0.0177 -0.0062 92  ILE B CD1 
3953 N N   . LYS B 93  ? 0.3930 0.4327 0.5018 -0.0537 -0.0499 0.0192  93  LYS B N   
3954 C CA  . LYS B 93  ? 0.4146 0.4530 0.5185 -0.0572 -0.0588 0.0263  93  LYS B CA  
3955 C C   . LYS B 93  ? 0.4728 0.5118 0.5856 -0.0530 -0.0624 0.0238  93  LYS B C   
3956 O O   . LYS B 93  ? 0.4857 0.5265 0.5918 -0.0575 -0.0680 0.0250  93  LYS B O   
3957 C CB  . LYS B 93  ? 0.4460 0.4791 0.5519 -0.0575 -0.0649 0.0388  93  LYS B CB  
3958 C CG  . LYS B 93  ? 0.7619 0.7947 0.8514 -0.0665 -0.0650 0.0436  93  LYS B CG  
3959 C CD  . LYS B 93  ? 0.9552 0.9814 1.0466 -0.0671 -0.0713 0.0566  93  LYS B CD  
3960 C CE  . LYS B 93  ? 1.1580 1.1825 1.2347 -0.0753 -0.0691 0.0609  93  LYS B CE  
3961 N NZ  . LYS B 93  ? 1.3564 1.3803 1.4375 -0.0734 -0.0599 0.0554  93  LYS B NZ  
3962 N N   . LEU B 94  ? 0.4073 0.4449 0.5346 -0.0451 -0.0592 0.0203  94  LEU B N   
3963 C CA  . LEU B 94  ? 0.3927 0.4302 0.5300 -0.0409 -0.0619 0.0183  94  LEU B CA  
3964 C C   . LEU B 94  ? 0.4531 0.4930 0.5879 -0.0413 -0.0575 0.0076  94  LEU B C   
3965 O O   . LEU B 94  ? 0.4730 0.5135 0.6082 -0.0427 -0.0610 0.0056  94  LEU B O   
3966 C CB  . LEU B 94  ? 0.3706 0.4050 0.5244 -0.0327 -0.0608 0.0207  94  LEU B CB  
3967 C CG  . LEU B 94  ? 0.4177 0.4496 0.5808 -0.0305 -0.0672 0.0301  94  LEU B CG  
3968 C CD1 . LEU B 94  ? 0.4261 0.4563 0.5816 -0.0350 -0.0714 0.0384  94  LEU B CD1 
3969 C CD2 . LEU B 94  ? 0.4397 0.4690 0.6165 -0.0235 -0.0635 0.0305  94  LEU B CD2 
3970 N N   . HIS B 95  ? 0.3858 0.4271 0.5194 -0.0400 -0.0499 0.0006  95  HIS B N   
3971 C CA  . HIS B 95  ? 0.3735 0.4163 0.5080 -0.0389 -0.0453 -0.0097 95  HIS B CA  
3972 C C   . HIS B 95  ? 0.4143 0.4613 0.5371 -0.0445 -0.0399 -0.0177 95  HIS B C   
3973 O O   . HIS B 95  ? 0.4173 0.4651 0.5404 -0.0445 -0.0369 -0.0266 95  HIS B O   
3974 C CB  . HIS B 95  ? 0.3666 0.4076 0.5151 -0.0305 -0.0413 -0.0123 95  HIS B CB  
3975 C CG  . HIS B 95  ? 0.4038 0.4415 0.5632 -0.0256 -0.0451 -0.0051 95  HIS B CG  
3976 N ND1 . HIS B 95  ? 0.4224 0.4593 0.5872 -0.0221 -0.0435 -0.0008 95  HIS B ND1 
3977 C CD2 . HIS B 95  ? 0.4239 0.4596 0.5896 -0.0243 -0.0498 -0.0021 95  HIS B CD2 
3978 C CE1 . HIS B 95  ? 0.4085 0.4429 0.5827 -0.0186 -0.0468 0.0041  95  HIS B CE1 
3979 N NE2 . HIS B 95  ? 0.4143 0.4481 0.5898 -0.0197 -0.0507 0.0037  95  HIS B NE2 
3980 N N   . ASN B 96  ? 0.3388 0.3883 0.4518 -0.0494 -0.0382 -0.0151 96  ASN B N   
3981 C CA  . ASN B 96  ? 0.3347 0.3894 0.4365 -0.0554 -0.0320 -0.0227 96  ASN B CA  
3982 C C   . ASN B 96  ? 0.3956 0.4525 0.5055 -0.0508 -0.0251 -0.0345 96  ASN B C   
3983 O O   . ASN B 96  ? 0.4052 0.4631 0.5108 -0.0538 -0.0236 -0.0425 96  ASN B O   
3984 C CB  . ASN B 96  ? 0.3012 0.3578 0.3859 -0.0654 -0.0355 -0.0221 96  ASN B CB  
3985 C CG  . ASN B 96  ? 0.5079 0.5704 0.5785 -0.0734 -0.0289 -0.0290 96  ASN B CG  
3986 O OD1 . ASN B 96  ? 0.5546 0.6201 0.6258 -0.0733 -0.0227 -0.0307 96  ASN B OD1 
3987 N ND2 . ASN B 96  ? 0.2353 0.3002 0.2925 -0.0812 -0.0298 -0.0335 96  ASN B ND2 
3988 N N   . PRO B 97  ? 0.3405 0.3973 0.4636 -0.0431 -0.0217 -0.0355 97  PRO B N   
3989 C CA  . PRO B 97  ? 0.3307 0.3889 0.4636 -0.0378 -0.0164 -0.0454 97  PRO B CA  
3990 C C   . PRO B 97  ? 0.3688 0.4337 0.4958 -0.0422 -0.0090 -0.0555 97  PRO B C   
3991 O O   . PRO B 97  ? 0.3605 0.4302 0.4798 -0.0472 -0.0061 -0.0544 97  PRO B O   
3992 C CB  . PRO B 97  ? 0.3398 0.3976 0.4860 -0.0298 -0.0156 -0.0421 97  PRO B CB  
3993 C CG  . PRO B 97  ? 0.3961 0.4504 0.5407 -0.0303 -0.0210 -0.0311 97  PRO B CG  
3994 C CD  . PRO B 97  ? 0.3497 0.4052 0.4795 -0.0391 -0.0227 -0.0280 97  PRO B CD  
3995 N N   . PRO B 98  ? 0.3198 0.3850 0.4510 -0.0406 -0.0052 -0.0658 98  PRO B N   
3996 C CA  . PRO B 98  ? 0.3303 0.4025 0.4576 -0.0445 0.0029  -0.0770 98  PRO B CA  
3997 C C   . PRO B 98  ? 0.3980 0.4773 0.5340 -0.0409 0.0088  -0.0793 98  PRO B C   
3998 O O   . PRO B 98  ? 0.4033 0.4902 0.5330 -0.0464 0.0152  -0.0854 98  PRO B O   
3999 C CB  . PRO B 98  ? 0.3523 0.4214 0.4870 -0.0413 0.0051  -0.0870 98  PRO B CB  
4000 C CG  . PRO B 98  ? 0.4005 0.4609 0.5361 -0.0396 -0.0028 -0.0804 98  PRO B CG  
4001 C CD  . PRO B 98  ? 0.3307 0.3895 0.4709 -0.0355 -0.0078 -0.0682 98  PRO B CD  
4002 N N   . THR B 99  ? 0.3494 0.4267 0.4991 -0.0323 0.0065  -0.0743 99  THR B N   
4003 C CA  . THR B 99  ? 0.3390 0.4229 0.4997 -0.0276 0.0106  -0.0758 99  THR B CA  
4004 C C   . THR B 99  ? 0.4379 0.5273 0.5923 -0.0325 0.0119  -0.0707 99  THR B C   
4005 O O   . THR B 99  ? 0.4446 0.5409 0.6082 -0.0294 0.0156  -0.0733 99  THR B O   
4006 C CB  . THR B 99  ? 0.3601 0.4400 0.5365 -0.0175 0.0071  -0.0725 99  THR B CB  
4007 O OG1 . THR B 99  ? 0.3674 0.4410 0.5412 -0.0169 0.0006  -0.0616 99  THR B OG1 
4008 C CG2 . THR B 99  ? 0.3165 0.3914 0.5011 -0.0127 0.0072  -0.0786 99  THR B CG2 
4009 N N   . ILE B 100 ? 0.4241 0.5104 0.5638 -0.0399 0.0086  -0.0636 100 ILE B N   
4010 C CA  . ILE B 100 ? 0.4442 0.5333 0.5772 -0.0451 0.0093  -0.0576 100 ILE B CA  
4011 C C   . ILE B 100 ? 0.4921 0.5920 0.6260 -0.0486 0.0176  -0.0648 100 ILE B C   
4012 O O   . ILE B 100 ? 0.4731 0.5766 0.6145 -0.0463 0.0188  -0.0627 100 ILE B O   
4013 C CB  . ILE B 100 ? 0.5097 0.5933 0.6259 -0.0533 0.0044  -0.0490 100 ILE B CB  
4014 C CG1 . ILE B 100 ? 0.5117 0.5860 0.6303 -0.0492 -0.0041 -0.0410 100 ILE B CG1 
4015 C CG2 . ILE B 100 ? 0.5360 0.6209 0.6458 -0.0589 0.0053  -0.0423 100 ILE B CG2 
4016 C CD1 . ILE B 100 ? 0.6682 0.7385 0.7716 -0.0568 -0.0095 -0.0351 100 ILE B CD1 
4017 N N   . HIS B 101 ? 0.4561 0.5618 0.5827 -0.0544 0.0235  -0.0737 101 HIS B N   
4018 C CA  . HIS B 101 ? 0.4495 0.5666 0.5767 -0.0588 0.0322  -0.0813 101 HIS B CA  
4019 C C   . HIS B 101 ? 0.4712 0.5965 0.6149 -0.0522 0.0385  -0.0934 101 HIS B C   
4020 O O   . HIS B 101 ? 0.4802 0.6165 0.6257 -0.0560 0.0466  -0.1013 101 HIS B O   
4021 C CB  . HIS B 101 ? 0.4810 0.6007 0.5879 -0.0714 0.0358  -0.0825 101 HIS B CB  
4022 C CG  . HIS B 101 ? 0.5335 0.6464 0.6264 -0.0777 0.0298  -0.0694 101 HIS B CG  
4023 N ND1 . HIS B 101 ? 0.5656 0.6690 0.6485 -0.0793 0.0219  -0.0619 101 HIS B ND1 
4024 C CD2 . HIS B 101 ? 0.5592 0.6730 0.6487 -0.0820 0.0303  -0.0626 101 HIS B CD2 
4025 C CE1 . HIS B 101 ? 0.5636 0.6625 0.6378 -0.0841 0.0178  -0.0506 101 HIS B CE1 
4026 N NE2 . HIS B 101 ? 0.5655 0.6697 0.6430 -0.0860 0.0228  -0.0507 101 HIS B NE2 
4027 N N   . TYR B 102 ? 0.4006 0.5210 0.5578 -0.0423 0.0349  -0.0945 102 TYR B N   
4028 C CA  . TYR B 102 ? 0.3974 0.5235 0.5730 -0.0343 0.0392  -0.1044 102 TYR B CA  
4029 C C   . TYR B 102 ? 0.4532 0.5894 0.6424 -0.0306 0.0416  -0.1044 102 TYR B C   
4030 O O   . TYR B 102 ? 0.4492 0.5838 0.6356 -0.0316 0.0376  -0.0951 102 TYR B O   
4031 C CB  . TYR B 102 ? 0.4084 0.5247 0.5942 -0.0248 0.0328  -0.1015 102 TYR B CB  
4032 C CG  . TYR B 102 ? 0.4422 0.5504 0.6218 -0.0261 0.0318  -0.1055 102 TYR B CG  
4033 C CD1 . TYR B 102 ? 0.4627 0.5636 0.6542 -0.0178 0.0287  -0.1067 102 TYR B CD1 
4034 C CD2 . TYR B 102 ? 0.4583 0.5658 0.6194 -0.0364 0.0334  -0.1074 102 TYR B CD2 
4035 C CE1 . TYR B 102 ? 0.4752 0.5685 0.6615 -0.0196 0.0279  -0.1108 102 TYR B CE1 
4036 C CE2 . TYR B 102 ? 0.4709 0.5717 0.6260 -0.0383 0.0321  -0.1116 102 TYR B CE2 
4037 C CZ  . TYR B 102 ? 0.5363 0.6298 0.7043 -0.0300 0.0295  -0.1135 102 TYR B CZ  
4038 O OH  . TYR B 102 ? 0.5344 0.6210 0.6970 -0.0325 0.0283  -0.1181 102 TYR B OH  
4039 N N   . PRO B 103 ? 0.4301 0.5768 0.6351 -0.0262 0.0477  -0.1145 103 PRO B N   
4040 C CA  . PRO B 103 ? 0.4279 0.5849 0.6469 -0.0224 0.0486  -0.1138 103 PRO B CA  
4041 C C   . PRO B 103 ? 0.4799 0.6306 0.7083 -0.0137 0.0400  -0.1045 103 PRO B C   
4042 O O   . PRO B 103 ? 0.4601 0.6014 0.6921 -0.0075 0.0355  -0.1029 103 PRO B O   
4043 C CB  . PRO B 103 ? 0.4510 0.6193 0.6877 -0.0177 0.0558  -0.1267 103 PRO B CB  
4044 C CG  . PRO B 103 ? 0.5205 0.6854 0.7490 -0.0217 0.0606  -0.1353 103 PRO B CG  
4045 C CD  . PRO B 103 ? 0.4630 0.6127 0.6756 -0.0239 0.0538  -0.1273 103 PRO B CD  
4046 N N   . PRO B 104 ? 0.4596 0.6151 0.6911 -0.0138 0.0378  -0.0986 104 PRO B N   
4047 C CA  . PRO B 104 ? 0.4553 0.6050 0.6935 -0.0067 0.0299  -0.0901 104 PRO B CA  
4048 C C   . PRO B 104 ? 0.5151 0.6633 0.7694 0.0041  0.0268  -0.0919 104 PRO B C   
4049 O O   . PRO B 104 ? 0.5165 0.6538 0.7692 0.0082  0.0205  -0.0852 104 PRO B O   
4050 C CB  . PRO B 104 ? 0.4689 0.6283 0.7109 -0.0090 0.0304  -0.0877 104 PRO B CB  
4051 C CG  . PRO B 104 ? 0.5273 0.6905 0.7565 -0.0197 0.0363  -0.0898 104 PRO B CG  
4052 C CD  . PRO B 104 ? 0.4841 0.6497 0.7117 -0.0215 0.0424  -0.0993 104 PRO B CD  
4053 N N   . SER B 105 ? 0.4732 0.6316 0.7429 0.0084  0.0313  -0.1010 105 SER B N   
4054 C CA  . SER B 105 ? 0.4648 0.6218 0.7518 0.0189  0.0286  -0.1031 105 SER B CA  
4055 C C   . SER B 105 ? 0.5104 0.6546 0.7935 0.0206  0.0284  -0.1056 105 SER B C   
4056 O O   . SER B 105 ? 0.5132 0.6506 0.8064 0.0286  0.0239  -0.1033 105 SER B O   
4057 C CB  . SER B 105 ? 0.4960 0.6684 0.8025 0.0230  0.0337  -0.1124 105 SER B CB  
4058 O OG  . SER B 105 ? 0.5598 0.7406 0.8617 0.0156  0.0429  -0.1220 105 SER B OG  
4059 N N   . GLN B 106 ? 0.4560 0.5968 0.7239 0.0125  0.0328  -0.1097 106 GLN B N   
4060 C CA  . GLN B 106 ? 0.4554 0.5849 0.7176 0.0123  0.0328  -0.1128 106 GLN B CA  
4061 C C   . GLN B 106 ? 0.4802 0.5959 0.7298 0.0110  0.0254  -0.1023 106 GLN B C   
4062 O O   . GLN B 106 ? 0.4703 0.5766 0.7138 0.0096  0.0247  -0.1041 106 GLN B O   
4063 C CB  . GLN B 106 ? 0.4836 0.6170 0.7356 0.0040  0.0409  -0.1230 106 GLN B CB  
4064 C CG  . GLN B 106 ? 0.6866 0.8267 0.9547 0.0083  0.0481  -0.1365 106 GLN B CG  
4065 C CD  . GLN B 106 ? 1.0018 1.1464 1.2585 -0.0009 0.0569  -0.1475 106 GLN B CD  
4066 O OE1 . GLN B 106 ? 0.9317 1.0677 1.1723 -0.0070 0.0565  -0.1480 106 GLN B OE1 
4067 N NE2 . GLN B 106 ? 0.9678 1.1268 1.2331 -0.0023 0.0652  -0.1569 106 GLN B NE2 
4068 N N   . GLY B 107 ? 0.4118 0.5270 0.6588 0.0113  0.0203  -0.0923 107 GLY B N   
4069 C CA  . GLY B 107 ? 0.3869 0.4908 0.6247 0.0107  0.0136  -0.0822 107 GLY B CA  
4070 C C   . GLY B 107 ? 0.3901 0.4914 0.6103 0.0018  0.0129  -0.0773 107 GLY B C   
4071 O O   . GLY B 107 ? 0.3729 0.4646 0.5846 0.0000  0.0089  -0.0724 107 GLY B O   
4072 N N   . GLN B 108 ? 0.3250 0.4349 0.5405 -0.0037 0.0165  -0.0780 108 GLN B N   
4073 C CA  . GLN B 108 ? 0.3226 0.4301 0.5220 -0.0123 0.0159  -0.0725 108 GLN B CA  
4074 C C   . GLN B 108 ? 0.3445 0.4427 0.5407 -0.0107 0.0088  -0.0618 108 GLN B C   
4075 O O   . GLN B 108 ? 0.3106 0.4086 0.5162 -0.0047 0.0059  -0.0583 108 GLN B O   
4076 C CB  . GLN B 108 ? 0.3405 0.4584 0.5392 -0.0171 0.0204  -0.0739 108 GLN B CB  
4077 C CG  . GLN B 108 ? 0.4350 0.5502 0.6170 -0.0267 0.0205  -0.0685 108 GLN B CG  
4078 C CD  . GLN B 108 ? 0.5903 0.7154 0.7719 -0.0321 0.0256  -0.0704 108 GLN B CD  
4079 O OE1 . GLN B 108 ? 0.4863 0.6177 0.6790 -0.0285 0.0258  -0.0705 108 GLN B OE1 
4080 N NE2 . GLN B 108 ? 0.5229 0.6495 0.6908 -0.0416 0.0294  -0.0713 108 GLN B NE2 
4081 N N   . MET B 109 ? 0.3017 0.3925 0.4847 -0.0162 0.0061  -0.0568 109 MET B N   
4082 C CA  . MET B 109 ? 0.2877 0.3700 0.4685 -0.0150 0.0000  -0.0473 109 MET B CA  
4083 C C   . MET B 109 ? 0.3288 0.4132 0.5115 -0.0152 -0.0004 -0.0422 109 MET B C   
4084 O O   . MET B 109 ? 0.3131 0.4017 0.4899 -0.0211 0.0025  -0.0423 109 MET B O   
4085 C CB  . MET B 109 ? 0.3202 0.3961 0.4881 -0.0210 -0.0031 -0.0431 109 MET B CB  
4086 C CG  . MET B 109 ? 0.3626 0.4300 0.5313 -0.0186 -0.0094 -0.0343 109 MET B CG  
4087 S SD  . MET B 109 ? 0.4308 0.4926 0.5861 -0.0259 -0.0139 -0.0266 109 MET B SD  
4088 C CE  . MET B 109 ? 0.3904 0.4512 0.5465 -0.0269 -0.0141 -0.0196 109 MET B CE  
4089 N N   . ASP B 110 ? 0.2892 0.3708 0.4799 -0.0094 -0.0037 -0.0383 110 ASP B N   
4090 C CA  . ASP B 110 ? 0.2878 0.3707 0.4808 -0.0094 -0.0044 -0.0341 110 ASP B CA  
4091 C C   . ASP B 110 ? 0.3376 0.4121 0.5315 -0.0066 -0.0090 -0.0274 110 ASP B C   
4092 O O   . ASP B 110 ? 0.3255 0.3952 0.5215 -0.0031 -0.0116 -0.0266 110 ASP B O   
4093 C CB  . ASP B 110 ? 0.3112 0.4035 0.5145 -0.0056 -0.0022 -0.0384 110 ASP B CB  
4094 C CG  . ASP B 110 ? 0.5390 0.6356 0.7426 -0.0086 -0.0011 -0.0366 110 ASP B CG  
4095 O OD1 . ASP B 110 ? 0.5623 0.6542 0.7578 -0.0141 -0.0010 -0.0325 110 ASP B OD1 
4096 O OD2 . ASP B 110 ? 0.6381 0.7429 0.8504 -0.0057 -0.0005 -0.0391 110 ASP B OD2 
4097 N N   . LEU B 111 ? 0.3047 0.3775 0.4973 -0.0086 -0.0096 -0.0230 111 LEU B N   
4098 C CA  . LEU B 111 ? 0.3039 0.3694 0.4977 -0.0068 -0.0129 -0.0172 111 LEU B CA  
4099 C C   . LEU B 111 ? 0.3484 0.4160 0.5467 -0.0056 -0.0122 -0.0165 111 LEU B C   
4100 O O   . LEU B 111 ? 0.3721 0.4455 0.5704 -0.0085 -0.0095 -0.0188 111 LEU B O   
4101 C CB  . LEU B 111 ? 0.3162 0.3753 0.5027 -0.0118 -0.0142 -0.0123 111 LEU B CB  
4102 C CG  . LEU B 111 ? 0.3919 0.4441 0.5771 -0.0108 -0.0183 -0.0083 111 LEU B CG  
4103 C CD1 . LEU B 111 ? 0.4214 0.4728 0.5976 -0.0159 -0.0191 -0.0079 111 LEU B CD1 
4104 C CD2 . LEU B 111 ? 0.3906 0.4366 0.5783 -0.0105 -0.0204 -0.0025 111 LEU B CD2 
4105 N N   . CYS B 112 ? 0.2620 0.3252 0.4637 -0.0024 -0.0144 -0.0134 112 CYS B N   
4106 C CA  . CYS B 112 ? 0.2611 0.3254 0.4655 -0.0023 -0.0137 -0.0127 112 CYS B CA  
4107 C C   . CYS B 112 ? 0.2934 0.3504 0.4991 -0.0010 -0.0153 -0.0087 112 CYS B C   
4108 O O   . CYS B 112 ? 0.3072 0.3607 0.5144 0.0017  -0.0174 -0.0069 112 CYS B O   
4109 C CB  . CYS B 112 ? 0.2716 0.3441 0.4807 0.0005  -0.0134 -0.0159 112 CYS B CB  
4110 S SG  . CYS B 112 ? 0.3280 0.3993 0.5415 0.0068  -0.0164 -0.0147 112 CYS B SG  
4111 N N   . VAL B 113 ? 0.2221 0.2770 0.4280 -0.0034 -0.0138 -0.0079 113 VAL B N   
4112 C CA  . VAL B 113 ? 0.2229 0.2718 0.4316 -0.0024 -0.0141 -0.0054 113 VAL B CA  
4113 C C   . VAL B 113 ? 0.2817 0.3345 0.4927 0.0001  -0.0137 -0.0071 113 VAL B C   
4114 O O   . VAL B 113 ? 0.2887 0.3481 0.4993 -0.0008 -0.0127 -0.0100 113 VAL B O   
4115 C CB  . VAL B 113 ? 0.2803 0.3243 0.4891 -0.0060 -0.0122 -0.0045 113 VAL B CB  
4116 C CG1 . VAL B 113 ? 0.2829 0.3202 0.4966 -0.0044 -0.0124 -0.0021 113 VAL B CG1 
4117 C CG2 . VAL B 113 ? 0.2804 0.3217 0.4849 -0.0097 -0.0126 -0.0025 113 VAL B CG2 
4118 N N   . THR B 114 ? 0.2285 0.2781 0.4420 0.0028  -0.0148 -0.0050 114 THR B N   
4119 C CA  . THR B 114 ? 0.2096 0.2622 0.4240 0.0045  -0.0145 -0.0055 114 THR B CA  
4120 C C   . THR B 114 ? 0.2031 0.2516 0.4197 0.0037  -0.0123 -0.0051 114 THR B C   
4121 O O   . THR B 114 ? 0.1546 0.1975 0.3741 0.0032  -0.0118 -0.0038 114 THR B O   
4122 C CB  . THR B 114 ? 0.3348 0.3879 0.5500 0.0080  -0.0172 -0.0039 114 THR B CB  
4123 O OG1 . THR B 114 ? 0.3458 0.3931 0.5627 0.0088  -0.0184 -0.0016 114 THR B OG1 
4124 C CG2 . THR B 114 ? 0.2907 0.3489 0.5054 0.0093  -0.0185 -0.0057 114 THR B CG2 
4125 N N   . SER B 115 ? 0.1934 0.2450 0.4089 0.0034  -0.0110 -0.0063 115 SER B N   
4126 C CA  . SER B 115 ? 0.2107 0.2594 0.4283 0.0023  -0.0079 -0.0071 115 SER B CA  
4127 C C   . SER B 115 ? 0.2875 0.3334 0.5082 0.0046  -0.0087 -0.0041 115 SER B C   
4128 O O   . SER B 115 ? 0.2852 0.3331 0.5042 0.0045  -0.0079 -0.0036 115 SER B O   
4129 C CB  . SER B 115 ? 0.2656 0.3196 0.4791 -0.0004 -0.0057 -0.0102 115 SER B CB  
4130 O OG  . SER B 115 ? 0.4348 0.4908 0.6467 -0.0033 -0.0045 -0.0136 115 SER B OG  
4131 N N   . GLY B 116 ? 0.2578 0.2993 0.4824 0.0061  -0.0105 -0.0017 116 GLY B N   
4132 C CA  . GLY B 116 ? 0.2496 0.2888 0.4781 0.0080  -0.0122 0.0012  116 GLY B CA  
4133 C C   . GLY B 116 ? 0.3122 0.3522 0.5377 0.0096  -0.0158 0.0027  116 GLY B C   
4134 O O   . GLY B 116 ? 0.3098 0.3533 0.5311 0.0098  -0.0165 0.0014  116 GLY B O   
4135 N N   . SER B 117 ? 0.2795 0.3167 0.5079 0.0108  -0.0181 0.0049  117 SER B N   
4136 C CA  . SER B 117 ? 0.2769 0.3140 0.5031 0.0121  -0.0210 0.0054  117 SER B CA  
4137 C C   . SER B 117 ? 0.3471 0.3855 0.5717 0.0135  -0.0211 0.0061  117 SER B C   
4138 O O   . SER B 117 ? 0.3690 0.4079 0.5922 0.0151  -0.0231 0.0057  117 SER B O   
4139 C CB  . SER B 117 ? 0.3298 0.3635 0.5591 0.0122  -0.0235 0.0070  117 SER B CB  
4140 O OG  . SER B 117 ? 0.4637 0.4959 0.6973 0.0124  -0.0231 0.0088  117 SER B OG  
4141 N N   . GLN B 118 ? 0.2845 0.3236 0.5094 0.0126  -0.0189 0.0071  118 GLN B N   
4142 C CA  . GLN B 118 ? 0.2738 0.3140 0.4959 0.0129  -0.0192 0.0090  118 GLN B CA  
4143 C C   . GLN B 118 ? 0.3001 0.3450 0.5181 0.0137  -0.0204 0.0081  118 GLN B C   
4144 O O   . GLN B 118 ? 0.2850 0.3303 0.5019 0.0154  -0.0227 0.0103  118 GLN B O   
4145 C CB  . GLN B 118 ? 0.2865 0.3274 0.5085 0.0104  -0.0156 0.0096  118 GLN B CB  
4146 C CG  . GLN B 118 ? 0.2652 0.3064 0.4833 0.0097  -0.0159 0.0129  118 GLN B CG  
4147 C CD  . GLN B 118 ? 0.6394 0.6758 0.8598 0.0112  -0.0186 0.0162  118 GLN B CD  
4148 O OE1 . GLN B 118 ? 0.5832 0.6164 0.8086 0.0107  -0.0180 0.0164  118 GLN B OE1 
4149 N NE2 . GLN B 118 ? 0.6459 0.6815 0.8637 0.0131  -0.0218 0.0187  118 GLN B NE2 
4150 N N   . GLN B 119 ? 0.2641 0.3125 0.4807 0.0124  -0.0189 0.0051  119 GLN B N   
4151 C CA  . GLN B 119 ? 0.2660 0.3204 0.4798 0.0125  -0.0200 0.0036  119 GLN B CA  
4152 C C   . GLN B 119 ? 0.3487 0.4040 0.5647 0.0155  -0.0228 0.0031  119 GLN B C   
4153 O O   . GLN B 119 ? 0.3433 0.4025 0.5596 0.0175  -0.0252 0.0040  119 GLN B O   
4154 C CB  . GLN B 119 ? 0.2743 0.3317 0.4866 0.0095  -0.0173 0.0001  119 GLN B CB  
4155 C CG  . GLN B 119 ? 0.2763 0.3412 0.4851 0.0083  -0.0180 -0.0013 119 GLN B CG  
4156 C CD  . GLN B 119 ? 0.3648 0.4331 0.5731 0.0054  -0.0161 -0.0055 119 GLN B CD  
4157 O OE1 . GLN B 119 ? 0.2333 0.2983 0.4437 0.0049  -0.0147 -0.0069 119 GLN B OE1 
4158 N NE2 . GLN B 119 ? 0.2835 0.3585 0.4884 0.0031  -0.0162 -0.0071 119 GLN B NE2 
4159 N N   . GLY B 120 ? 0.3268 0.3788 0.5447 0.0157  -0.0226 0.0018  120 GLY B N   
4160 C CA  . GLY B 120 ? 0.3206 0.3732 0.5403 0.0178  -0.0241 0.0000  120 GLY B CA  
4161 C C   . GLY B 120 ? 0.3539 0.4036 0.5763 0.0210  -0.0265 0.0020  120 GLY B C   
4162 O O   . GLY B 120 ? 0.3477 0.4007 0.5727 0.0238  -0.0280 0.0011  120 GLY B O   
4163 N N   . LEU B 121 ? 0.3034 0.3472 0.5263 0.0207  -0.0267 0.0048  121 LEU B N   
4164 C CA  . LEU B 121 ? 0.3080 0.3471 0.5333 0.0229  -0.0287 0.0074  121 LEU B CA  
4165 C C   . LEU B 121 ? 0.3611 0.4030 0.5862 0.0249  -0.0305 0.0103  121 LEU B C   
4166 O O   . LEU B 121 ? 0.3805 0.4212 0.6093 0.0283  -0.0329 0.0108  121 LEU B O   
4167 C CB  . LEU B 121 ? 0.3090 0.3426 0.5345 0.0209  -0.0280 0.0101  121 LEU B CB  
4168 C CG  . LEU B 121 ? 0.3593 0.3898 0.5865 0.0194  -0.0278 0.0084  121 LEU B CG  
4169 C CD1 . LEU B 121 ? 0.3510 0.3795 0.5797 0.0170  -0.0266 0.0108  121 LEU B CD1 
4170 C CD2 . LEU B 121 ? 0.4098 0.4359 0.6393 0.0208  -0.0296 0.0068  121 LEU B CD2 
4171 N N   . CYS B 122 ? 0.3018 0.3476 0.5228 0.0226  -0.0296 0.0120  122 CYS B N   
4172 C CA  . CYS B 122 ? 0.3150 0.3647 0.5337 0.0232  -0.0318 0.0153  122 CYS B CA  
4173 C C   . CYS B 122 ? 0.3206 0.3766 0.5428 0.0264  -0.0344 0.0137  122 CYS B C   
4174 O O   . CYS B 122 ? 0.3059 0.3616 0.5311 0.0297  -0.0380 0.0171  122 CYS B O   
4175 C CB  . CYS B 122 ? 0.3369 0.3905 0.5495 0.0189  -0.0294 0.0155  122 CYS B CB  
4176 S SG  . CYS B 122 ? 0.4014 0.4622 0.6089 0.0181  -0.0325 0.0191  122 CYS B SG  
4177 N N   . LYS B 123 ? 0.2609 0.3226 0.4835 0.0254  -0.0327 0.0088  123 LYS B N   
4178 C CA  . LYS B 123 ? 0.2536 0.3232 0.4806 0.0277  -0.0343 0.0062  123 LYS B CA  
4179 C C   . LYS B 123 ? 0.3039 0.3709 0.5383 0.0323  -0.0356 0.0047  123 LYS B C   
4180 O O   . LYS B 123 ? 0.2941 0.3663 0.5347 0.0360  -0.0383 0.0048  123 LYS B O   
4181 C CB  . LYS B 123 ? 0.2683 0.3434 0.4936 0.0244  -0.0312 0.0011  123 LYS B CB  
4182 C CG  . LYS B 123 ? 0.3567 0.4338 0.5757 0.0196  -0.0292 0.0010  123 LYS B CG  
4183 C CD  . LYS B 123 ? 0.4211 0.5053 0.6376 0.0187  -0.0318 0.0032  123 LYS B CD  
4184 C CE  . LYS B 123 ? 0.3605 0.4412 0.5701 0.0154  -0.0305 0.0059  123 LYS B CE  
4185 N NZ  . LYS B 123 ? 0.4569 0.5445 0.6625 0.0141  -0.0338 0.0088  123 LYS B NZ  
4186 N N   . VAL B 124 ? 0.2493 0.3085 0.4838 0.0320  -0.0337 0.0032  124 VAL B N   
4187 C CA  . VAL B 124 ? 0.2398 0.2950 0.4803 0.0354  -0.0339 0.0005  124 VAL B CA  
4188 C C   . VAL B 124 ? 0.3093 0.3593 0.5544 0.0394  -0.0374 0.0052  124 VAL B C   
4189 O O   . VAL B 124 ? 0.3301 0.3811 0.5832 0.0439  -0.0389 0.0037  124 VAL B O   
4190 C CB  . VAL B 124 ? 0.2744 0.3233 0.5121 0.0327  -0.0314 -0.0022 124 VAL B CB  
4191 C CG1 . VAL B 124 ? 0.2792 0.3217 0.5219 0.0354  -0.0319 -0.0044 124 VAL B CG1 
4192 C CG2 . VAL B 124 ? 0.2597 0.3139 0.4944 0.0297  -0.0287 -0.0068 124 VAL B CG2 
4193 N N   . PHE B 125 ? 0.2451 0.2894 0.4856 0.0375  -0.0384 0.0109  125 PHE B N   
4194 C CA  . PHE B 125 ? 0.2429 0.2812 0.4863 0.0402  -0.0417 0.0167  125 PHE B CA  
4195 C C   . PHE B 125 ? 0.2922 0.3370 0.5389 0.0436  -0.0458 0.0202  125 PHE B C   
4196 O O   . PHE B 125 ? 0.2914 0.3330 0.5459 0.0484  -0.0489 0.0223  125 PHE B O   
4197 C CB  . PHE B 125 ? 0.2629 0.2956 0.4994 0.0362  -0.0412 0.0221  125 PHE B CB  
4198 C CG  . PHE B 125 ? 0.2744 0.3004 0.5096 0.0333  -0.0383 0.0201  125 PHE B CG  
4199 C CD1 . PHE B 125 ? 0.3072 0.3322 0.5370 0.0289  -0.0362 0.0225  125 PHE B CD1 
4200 C CD2 . PHE B 125 ? 0.2997 0.3210 0.5397 0.0347  -0.0376 0.0156  125 PHE B CD2 
4201 C CE1 . PHE B 125 ? 0.3154 0.3355 0.5458 0.0264  -0.0342 0.0210  125 PHE B CE1 
4202 C CE2 . PHE B 125 ? 0.3234 0.3395 0.5623 0.0316  -0.0358 0.0140  125 PHE B CE2 
4203 C CZ  . PHE B 125 ? 0.2961 0.3119 0.5308 0.0276  -0.0344 0.0170  125 PHE B CZ  
4204 N N   . GLU B 126 ? 0.2590 0.3132 0.5007 0.0410  -0.0460 0.0205  126 GLU B N   
4205 C CA  . GLU B 126 ? 0.2750 0.3379 0.5187 0.0430  -0.0504 0.0238  126 GLU B CA  
4206 C C   . GLU B 126 ? 0.3297 0.3995 0.5850 0.0482  -0.0517 0.0192  126 GLU B C   
4207 O O   . GLU B 126 ? 0.3264 0.4008 0.5885 0.0523  -0.0567 0.0229  126 GLU B O   
4208 C CB  . GLU B 126 ? 0.2910 0.3620 0.5255 0.0376  -0.0495 0.0239  126 GLU B CB  
4209 C CG  . GLU B 126 ? 0.4297 0.4955 0.6542 0.0331  -0.0489 0.0291  126 GLU B CG  
4210 C CD  . GLU B 126 ? 0.7424 0.8147 0.9572 0.0272  -0.0471 0.0286  126 GLU B CD  
4211 O OE1 . GLU B 126 ? 0.7781 0.8466 0.9852 0.0234  -0.0459 0.0323  126 GLU B OE1 
4212 O OE2 . GLU B 126 ? 0.6592 0.7403 0.8741 0.0259  -0.0464 0.0240  126 GLU B OE2 
4213 N N   . MET B 127 ? 0.2670 0.3379 0.5247 0.0477  -0.0471 0.0114  127 MET B N   
4214 C CA  . MET B 127 ? 0.2521 0.3298 0.5202 0.0514  -0.0463 0.0053  127 MET B CA  
4215 C C   . MET B 127 ? 0.3346 0.4056 0.6136 0.0576  -0.0479 0.0053  127 MET B C   
4216 O O   . MET B 127 ? 0.3508 0.4284 0.6415 0.0629  -0.0503 0.0042  127 MET B O   
4217 C CB  . MET B 127 ? 0.2671 0.3461 0.5313 0.0474  -0.0404 -0.0022 127 MET B CB  
4218 C CG  . MET B 127 ? 0.3101 0.3934 0.5836 0.0502  -0.0378 -0.0096 127 MET B CG  
4219 S SD  . MET B 127 ? 0.3619 0.4443 0.6275 0.0443  -0.0315 -0.0165 127 MET B SD  
4220 C CE  . MET B 127 ? 0.3184 0.3864 0.5812 0.0444  -0.0308 -0.0161 127 MET B CE  
4221 N N   . ILE B 128 ? 0.2759 0.3341 0.5521 0.0571  -0.0468 0.0066  128 ILE B N   
4222 C CA  . ILE B 128 ? 0.2812 0.3300 0.5666 0.0619  -0.0474 0.0057  128 ILE B CA  
4223 C C   . ILE B 128 ? 0.3459 0.3881 0.6363 0.0661  -0.0531 0.0145  128 ILE B C   
4224 O O   . ILE B 128 ? 0.3502 0.3921 0.6537 0.0725  -0.0556 0.0142  128 ILE B O   
4225 C CB  . ILE B 128 ? 0.3149 0.3536 0.5949 0.0582  -0.0432 0.0019  128 ILE B CB  
4226 C CG1 . ILE B 128 ? 0.3096 0.3543 0.5855 0.0545  -0.0383 -0.0063 128 ILE B CG1 
4227 C CG2 . ILE B 128 ? 0.3357 0.3632 0.6245 0.0623  -0.0435 0.0004  128 ILE B CG2 
4228 C CD1 . ILE B 128 ? 0.4613 0.4990 0.7282 0.0492  -0.0356 -0.0075 128 ILE B CD1 
4229 N N   . ILE B 129 ? 0.2953 0.3315 0.5758 0.0623  -0.0549 0.0222  129 ILE B N   
4230 C CA  . ILE B 129 ? 0.2971 0.3247 0.5791 0.0644  -0.0598 0.0316  129 ILE B CA  
4231 C C   . ILE B 129 ? 0.3434 0.3772 0.6301 0.0683  -0.0665 0.0389  129 ILE B C   
4232 O O   . ILE B 129 ? 0.3545 0.3981 0.6338 0.0653  -0.0683 0.0418  129 ILE B O   
4233 C CB  . ILE B 129 ? 0.3361 0.3550 0.6061 0.0583  -0.0585 0.0368  129 ILE B CB  
4234 C CG1 . ILE B 129 ? 0.3291 0.3400 0.5980 0.0556  -0.0534 0.0305  129 ILE B CG1 
4235 C CG2 . ILE B 129 ? 0.3602 0.3701 0.6304 0.0595  -0.0635 0.0475  129 ILE B CG2 
4236 C CD1 . ILE B 129 ? 0.3899 0.4023 0.6474 0.0489  -0.0500 0.0301  129 ILE B CD1 
4237 N N   . ASN B 130 ? 0.2944 0.3215 0.5935 0.0749  -0.0704 0.0423  130 ASN B N   
4238 C CA  . ASN B 130 ? 0.3042 0.3342 0.6099 0.0796  -0.0784 0.0514  130 ASN B CA  
4239 C C   . ASN B 130 ? 0.3915 0.4064 0.6927 0.0784  -0.0814 0.0616  130 ASN B C   
4240 O O   . ASN B 130 ? 0.3883 0.3905 0.6906 0.0777  -0.0776 0.0588  130 ASN B O   
4241 C CB  . ASN B 130 ? 0.2766 0.3089 0.6025 0.0887  -0.0803 0.0474  130 ASN B CB  
4242 C CG  . ASN B 130 ? 0.5567 0.6056 0.8888 0.0900  -0.0782 0.0387  130 ASN B CG  
4243 O OD1 . ASN B 130 ? 0.3392 0.4011 0.6668 0.0880  -0.0813 0.0415  130 ASN B OD1 
4244 N ND2 . ASN B 130 ? 0.5783 0.6270 0.9206 0.0930  -0.0726 0.0278  130 ASN B ND2 
4245 N N   . PRO B 131 ? 0.3561 0.3721 0.6518 0.0775  -0.0882 0.0735  131 PRO B N   
4246 C CA  . PRO B 131 ? 0.3602 0.3612 0.6505 0.0753  -0.0907 0.0838  131 PRO B CA  
4247 C C   . PRO B 131 ? 0.4097 0.3961 0.7156 0.0821  -0.0918 0.0841  131 PRO B C   
4248 O O   . PRO B 131 ? 0.3981 0.3868 0.7200 0.0903  -0.0963 0.0844  131 PRO B O   
4249 C CB  . PRO B 131 ? 0.3898 0.3971 0.6730 0.0740  -0.0987 0.0961  131 PRO B CB  
4250 C CG  . PRO B 131 ? 0.4323 0.4581 0.7115 0.0722  -0.0984 0.0908  131 PRO B CG  
4251 C CD  . PRO B 131 ? 0.3653 0.3962 0.6582 0.0773  -0.0940 0.0783  131 PRO B CD  
4252 N N   . GLY B 132 ? 0.3703 0.3427 0.6726 0.0785  -0.0872 0.0826  132 GLY B N   
4253 C CA  . GLY B 132 ? 0.3823 0.3385 0.6976 0.0832  -0.0870 0.0818  132 GLY B CA  
4254 C C   . GLY B 132 ? 0.4184 0.3722 0.7417 0.0847  -0.0799 0.0674  132 GLY B C   
4255 O O   . GLY B 132 ? 0.4044 0.3453 0.7395 0.0887  -0.0791 0.0648  132 GLY B O   
4256 N N   . ASP B 133 ? 0.3782 0.3439 0.6947 0.0811  -0.0746 0.0579  133 ASP B N   
4257 C CA  . ASP B 133 ? 0.3678 0.3332 0.6886 0.0811  -0.0678 0.0444  133 ASP B CA  
4258 C C   . ASP B 133 ? 0.4440 0.3978 0.7571 0.0746  -0.0636 0.0427  133 ASP B C   
4259 O O   . ASP B 133 ? 0.4444 0.3967 0.7451 0.0684  -0.0638 0.0493  133 ASP B O   
4260 C CB  . ASP B 133 ? 0.3709 0.3531 0.6864 0.0790  -0.0644 0.0366  133 ASP B CB  
4261 C CG  . ASP B 133 ? 0.5461 0.5413 0.8725 0.0853  -0.0666 0.0338  133 ASP B CG  
4262 O OD1 . ASP B 133 ? 0.5807 0.5724 0.9223 0.0928  -0.0705 0.0359  133 ASP B OD1 
4263 O OD2 . ASP B 133 ? 0.5803 0.5892 0.9016 0.0828  -0.0644 0.0290  133 ASP B OD2 
4264 N N   . ASN B 134 ? 0.4062 0.3525 0.7267 0.0757  -0.0595 0.0332  134 ASN B N   
4265 C CA  . ASN B 134 ? 0.4039 0.3401 0.7183 0.0694  -0.0558 0.0304  134 ASN B CA  
4266 C C   . ASN B 134 ? 0.4431 0.3893 0.7481 0.0639  -0.0510 0.0221  134 ASN B C   
4267 O O   . ASN B 134 ? 0.4222 0.3774 0.7303 0.0662  -0.0486 0.0135  134 ASN B O   
4268 C CB  . ASN B 134 ? 0.4213 0.3436 0.7480 0.0725  -0.0542 0.0244  134 ASN B CB  
4269 C CG  . ASN B 134 ? 0.6829 0.5913 1.0186 0.0767  -0.0589 0.0338  134 ASN B CG  
4270 O OD1 . ASN B 134 ? 0.6145 0.5177 0.9429 0.0735  -0.0623 0.0455  134 ASN B OD1 
4271 N ND2 . ASN B 134 ? 0.5545 0.4558 0.9062 0.0837  -0.0589 0.0287  134 ASN B ND2 
4272 N N   . VAL B 135 ? 0.3999 0.3449 0.6936 0.0567  -0.0496 0.0250  135 VAL B N   
4273 C CA  . VAL B 135 ? 0.3813 0.3346 0.6665 0.0513  -0.0458 0.0186  135 VAL B CA  
4274 C C   . VAL B 135 ? 0.4359 0.3807 0.7180 0.0453  -0.0437 0.0167  135 VAL B C   
4275 O O   . VAL B 135 ? 0.4628 0.3984 0.7444 0.0430  -0.0450 0.0236  135 VAL B O   
4276 C CB  . VAL B 135 ? 0.4140 0.3802 0.6896 0.0489  -0.0460 0.0221  135 VAL B CB  
4277 C CG1 . VAL B 135 ? 0.4087 0.3850 0.6878 0.0540  -0.0477 0.0217  135 VAL B CG1 
4278 C CG2 . VAL B 135 ? 0.4154 0.3791 0.6839 0.0450  -0.0476 0.0321  135 VAL B CG2 
4279 N N   . LEU B 136 ? 0.3546 0.3026 0.6346 0.0424  -0.0406 0.0076  136 LEU B N   
4280 C CA  . LEU B 136 ? 0.3422 0.2843 0.6199 0.0364  -0.0390 0.0047  136 LEU B CA  
4281 C C   . LEU B 136 ? 0.3816 0.3319 0.6506 0.0309  -0.0383 0.0066  136 LEU B C   
4282 O O   . LEU B 136 ? 0.3628 0.3237 0.6273 0.0309  -0.0375 0.0040  136 LEU B O   
4283 C CB  . LEU B 136 ? 0.3458 0.2855 0.6270 0.0361  -0.0367 -0.0066 136 LEU B CB  
4284 C CG  . LEU B 136 ? 0.4088 0.3384 0.7008 0.0412  -0.0364 -0.0105 136 LEU B CG  
4285 C CD1 . LEU B 136 ? 0.4149 0.3473 0.7089 0.0415  -0.0331 -0.0229 136 LEU B CD1 
4286 C CD2 . LEU B 136 ? 0.4309 0.3454 0.7269 0.0388  -0.0372 -0.0074 136 LEU B CD2 
4287 N N   . LEU B 137 ? 0.3562 0.3014 0.6236 0.0260  -0.0384 0.0109  137 LEU B N   
4288 C CA  . LEU B 137 ? 0.3410 0.2934 0.6026 0.0209  -0.0376 0.0134  137 LEU B CA  
4289 C C   . LEU B 137 ? 0.4195 0.3652 0.6829 0.0152  -0.0372 0.0138  137 LEU B C   
4290 O O   . LEU B 137 ? 0.4231 0.3576 0.6911 0.0150  -0.0376 0.0146  137 LEU B O   
4291 C CB  . LEU B 137 ? 0.3350 0.2912 0.5931 0.0220  -0.0381 0.0219  137 LEU B CB  
4292 C CG  . LEU B 137 ? 0.3884 0.3527 0.6412 0.0180  -0.0366 0.0247  137 LEU B CG  
4293 C CD1 . LEU B 137 ? 0.3894 0.3629 0.6378 0.0207  -0.0365 0.0263  137 LEU B CD1 
4294 C CD2 . LEU B 137 ? 0.4240 0.3834 0.6763 0.0140  -0.0359 0.0315  137 LEU B CD2 
4295 N N   . ASP B 138 ? 0.3944 0.3470 0.6553 0.0105  -0.0365 0.0134  138 ASP B N   
4296 C CA  . ASP B 138 ? 0.4075 0.3566 0.6710 0.0045  -0.0362 0.0138  138 ASP B CA  
4297 C C   . ASP B 138 ? 0.4580 0.4114 0.7204 0.0013  -0.0347 0.0208  138 ASP B C   
4298 O O   . ASP B 138 ? 0.4546 0.4180 0.7144 0.0016  -0.0339 0.0215  138 ASP B O   
4299 C CB  . ASP B 138 ? 0.4398 0.3936 0.7036 0.0010  -0.0370 0.0067  138 ASP B CB  
4300 C CG  . ASP B 138 ? 0.7057 0.6714 0.9655 0.0018  -0.0373 0.0053  138 ASP B CG  
4301 O OD1 . ASP B 138 ? 0.7456 0.7143 1.0021 0.0063  -0.0371 0.0038  138 ASP B OD1 
4302 O OD2 . ASP B 138 ? 0.8051 0.7770 1.0658 -0.0020 -0.0380 0.0055  138 ASP B OD2 
4303 N N   . GLU B 139 ? 0.4280 0.3735 0.6924 -0.0018 -0.0340 0.0258  139 GLU B N   
4304 C CA  . GLU B 139 ? 0.4291 0.3783 0.6926 -0.0060 -0.0317 0.0319  139 GLU B CA  
4305 C C   . GLU B 139 ? 0.4996 0.4519 0.7684 -0.0120 -0.0310 0.0290  139 GLU B C   
4306 O O   . GLU B 139 ? 0.5014 0.4468 0.7742 -0.0144 -0.0323 0.0254  139 GLU B O   
4307 C CB  . GLU B 139 ? 0.4609 0.4000 0.7232 -0.0072 -0.0313 0.0394  139 GLU B CB  
4308 C CG  . GLU B 139 ? 0.6237 0.5622 0.8805 -0.0023 -0.0324 0.0448  139 GLU B CG  
4309 C CD  . GLU B 139 ? 0.9639 0.8922 1.2189 -0.0041 -0.0329 0.0536  139 GLU B CD  
4310 O OE1 . GLU B 139 ? 0.8415 0.7738 1.0901 -0.0063 -0.0315 0.0601  139 GLU B OE1 
4311 O OE2 . GLU B 139 ? 0.9717 0.8873 1.2313 -0.0037 -0.0345 0.0540  139 GLU B OE2 
4312 N N   . PRO B 140 ? 0.4437 0.4065 0.7137 -0.0147 -0.0289 0.0299  140 PRO B N   
4313 C CA  . PRO B 140 ? 0.4227 0.3940 0.6886 -0.0128 -0.0266 0.0329  140 PRO B CA  
4314 C C   . PRO B 140 ? 0.4192 0.3972 0.6824 -0.0078 -0.0280 0.0290  140 PRO B C   
4315 O O   . PRO B 140 ? 0.3760 0.3564 0.6415 -0.0072 -0.0303 0.0240  140 PRO B O   
4316 C CB  . PRO B 140 ? 0.4489 0.4276 0.7202 -0.0182 -0.0234 0.0337  140 PRO B CB  
4317 C CG  . PRO B 140 ? 0.5028 0.4819 0.7817 -0.0212 -0.0257 0.0293  140 PRO B CG  
4318 C CD  . PRO B 140 ? 0.4560 0.4235 0.7332 -0.0202 -0.0287 0.0274  140 PRO B CD  
4319 N N   . ALA B 141 ? 0.3915 0.3723 0.6489 -0.0047 -0.0269 0.0317  141 ALA B N   
4320 C CA  . ALA B 141 ? 0.3879 0.3745 0.6420 -0.0003 -0.0278 0.0288  141 ALA B CA  
4321 C C   . ALA B 141 ? 0.4653 0.4604 0.7169 -0.0005 -0.0247 0.0301  141 ALA B C   
4322 O O   . ALA B 141 ? 0.4527 0.4489 0.7037 -0.0038 -0.0216 0.0336  141 ALA B O   
4323 C CB  . ALA B 141 ? 0.3975 0.3788 0.6475 0.0042  -0.0299 0.0295  141 ALA B CB  
4324 N N   . TYR B 142 ? 0.4462 0.4471 0.6963 0.0024  -0.0252 0.0269  142 TYR B N   
4325 C CA  . TYR B 142 ? 0.4513 0.4595 0.6994 0.0025  -0.0222 0.0270  142 TYR B CA  
4326 C C   . TYR B 142 ? 0.5005 0.5078 0.7415 0.0024  -0.0207 0.0309  142 TYR B C   
4327 O O   . TYR B 142 ? 0.5187 0.5226 0.7557 0.0053  -0.0234 0.0322  142 TYR B O   
4328 C CB  . TYR B 142 ? 0.4650 0.4774 0.7123 0.0056  -0.0235 0.0231  142 TYR B CB  
4329 C CG  . TYR B 142 ? 0.4984 0.5167 0.7428 0.0061  -0.0207 0.0226  142 TYR B CG  
4330 C CD1 . TYR B 142 ? 0.5250 0.5448 0.7642 0.0088  -0.0216 0.0212  142 TYR B CD1 
4331 C CD2 . TYR B 142 ? 0.5087 0.5314 0.7566 0.0036  -0.0166 0.0226  142 TYR B CD2 
4332 C CE1 . TYR B 142 ? 0.5295 0.5543 0.7661 0.0086  -0.0190 0.0200  142 TYR B CE1 
4333 C CE2 . TYR B 142 ? 0.5126 0.5399 0.7580 0.0037  -0.0134 0.0209  142 TYR B CE2 
4334 C CZ  . TYR B 142 ? 0.5920 0.6202 0.8315 0.0061  -0.0148 0.0197  142 TYR B CZ  
4335 O OH  . TYR B 142 ? 0.5984 0.6308 0.8354 0.0056  -0.0117 0.0176  142 TYR B OH  
4336 N N   . SER B 143 ? 0.4286 0.4394 0.6686 -0.0013 -0.0165 0.0329  143 SER B N   
4337 C CA  . SER B 143 ? 0.4211 0.4321 0.6527 -0.0030 -0.0149 0.0371  143 SER B CA  
4338 C C   . SER B 143 ? 0.4224 0.4369 0.6475 0.0001  -0.0163 0.0363  143 SER B C   
4339 O O   . SER B 143 ? 0.4146 0.4273 0.6330 0.0003  -0.0182 0.0406  143 SER B O   
4340 C CB  . SER B 143 ? 0.4733 0.4892 0.7048 -0.0082 -0.0091 0.0374  143 SER B CB  
4341 O OG  . SER B 143 ? 0.6259 0.6491 0.8614 -0.0077 -0.0059 0.0322  143 SER B OG  
4342 N N   . GLY B 144 ? 0.3402 0.3594 0.5676 0.0022  -0.0159 0.0313  144 GLY B N   
4343 C CA  . GLY B 144 ? 0.3320 0.3552 0.5545 0.0047  -0.0170 0.0296  144 GLY B CA  
4344 C C   . GLY B 144 ? 0.3816 0.4013 0.6026 0.0086  -0.0220 0.0311  144 GLY B C   
4345 O O   . GLY B 144 ? 0.3781 0.4005 0.5939 0.0097  -0.0235 0.0326  144 GLY B O   
4346 N N   . THR B 145 ? 0.3299 0.3441 0.5562 0.0106  -0.0244 0.0304  145 THR B N   
4347 C CA  . THR B 145 ? 0.3288 0.3394 0.5556 0.0147  -0.0284 0.0308  145 THR B CA  
4348 C C   . THR B 145 ? 0.3910 0.3962 0.6158 0.0147  -0.0304 0.0370  145 THR B C   
4349 O O   . THR B 145 ? 0.3869 0.3923 0.6105 0.0180  -0.0335 0.0390  145 THR B O   
4350 C CB  . THR B 145 ? 0.3764 0.3845 0.6084 0.0168  -0.0299 0.0261  145 THR B CB  
4351 O OG1 . THR B 145 ? 0.4018 0.4021 0.6370 0.0186  -0.0322 0.0273  145 THR B OG1 
4352 C CG2 . THR B 145 ? 0.3215 0.3306 0.5566 0.0142  -0.0282 0.0234  145 THR B CG2 
4353 N N   . LEU B 146 ? 0.3434 0.3441 0.5682 0.0109  -0.0287 0.0405  146 LEU B N   
4354 C CA  . LEU B 146 ? 0.3347 0.3289 0.5569 0.0098  -0.0305 0.0477  146 LEU B CA  
4355 C C   . LEU B 146 ? 0.3650 0.3644 0.5786 0.0086  -0.0309 0.0522  146 LEU B C   
4356 O O   . LEU B 146 ? 0.3451 0.3416 0.5568 0.0109  -0.0351 0.0575  146 LEU B O   
4357 C CB  . LEU B 146 ? 0.3314 0.3208 0.5552 0.0047  -0.0278 0.0501  146 LEU B CB  
4358 C CG  . LEU B 146 ? 0.3637 0.3486 0.5956 0.0046  -0.0277 0.0458  146 LEU B CG  
4359 C CD1 . LEU B 146 ? 0.3664 0.3507 0.6002 -0.0014 -0.0241 0.0473  146 LEU B CD1 
4360 C CD2 . LEU B 146 ? 0.3597 0.3344 0.5957 0.0079  -0.0315 0.0466  146 LEU B CD2 
4361 N N   . GLN B 147 ? 0.3379 0.3455 0.5471 0.0053  -0.0269 0.0496  147 GLN B N   
4362 C CA  . GLN B 147 ? 0.3557 0.3696 0.5556 0.0030  -0.0266 0.0523  147 GLN B CA  
4363 C C   . GLN B 147 ? 0.4021 0.4207 0.6012 0.0075  -0.0308 0.0510  147 GLN B C   
4364 O O   . GLN B 147 ? 0.3831 0.4051 0.5751 0.0066  -0.0333 0.0554  147 GLN B O   
4365 C CB  . GLN B 147 ? 0.3761 0.3967 0.5729 -0.0020 -0.0203 0.0483  147 GLN B CB  
4366 C CG  . GLN B 147 ? 0.6533 0.6714 0.8488 -0.0078 -0.0159 0.0512  147 GLN B CG  
4367 C CD  . GLN B 147 ? 0.9745 0.9893 1.1609 -0.0114 -0.0177 0.0598  147 GLN B CD  
4368 O OE1 . GLN B 147 ? 0.8889 0.8953 1.0772 -0.0120 -0.0194 0.0652  147 GLN B OE1 
4369 N NE2 . GLN B 147 ? 0.9395 0.9601 1.1153 -0.0140 -0.0179 0.0619  147 GLN B NE2 
4370 N N   . SER B 148 ? 0.3655 0.3846 0.5718 0.0120  -0.0316 0.0453  148 SER B N   
4371 C CA  . SER B 148 ? 0.3540 0.3779 0.5618 0.0163  -0.0350 0.0431  148 SER B CA  
4372 C C   . SER B 148 ? 0.4082 0.4270 0.6201 0.0209  -0.0404 0.0476  148 SER B C   
4373 O O   . SER B 148 ? 0.4186 0.4421 0.6291 0.0231  -0.0442 0.0502  148 SER B O   
4374 C CB  . SER B 148 ? 0.3787 0.4043 0.5922 0.0184  -0.0332 0.0356  148 SER B CB  
4375 O OG  . SER B 148 ? 0.4797 0.5119 0.6902 0.0156  -0.0296 0.0314  148 SER B OG  
4376 N N   . LEU B 149 ? 0.3445 0.3538 0.5624 0.0225  -0.0409 0.0483  149 LEU B N   
4377 C CA  . LEU B 149 ? 0.3451 0.3477 0.5692 0.0274  -0.0454 0.0517  149 LEU B CA  
4378 C C   . LEU B 149 ? 0.4538 0.4522 0.6741 0.0267  -0.0493 0.0616  149 LEU B C   
4379 O O   . LEU B 149 ? 0.4541 0.4514 0.6788 0.0316  -0.0543 0.0651  149 LEU B O   
4380 C CB  . LEU B 149 ? 0.3349 0.3284 0.5669 0.0289  -0.0444 0.0480  149 LEU B CB  
4381 C CG  . LEU B 149 ? 0.3573 0.3541 0.5929 0.0298  -0.0417 0.0387  149 LEU B CG  
4382 C CD1 . LEU B 149 ? 0.3486 0.3365 0.5901 0.0299  -0.0410 0.0356  149 LEU B CD1 
4383 C CD2 . LEU B 149 ? 0.3485 0.3521 0.5874 0.0344  -0.0432 0.0345  149 LEU B CD2 
4384 N N   . HIS B 150 ? 0.4590 0.4550 0.6716 0.0206  -0.0469 0.0663  150 HIS B N   
4385 C CA  . HIS B 150 ? 0.4870 0.4783 0.6934 0.0181  -0.0500 0.0767  150 HIS B CA  
4386 C C   . HIS B 150 ? 0.4951 0.4931 0.6972 0.0201  -0.0557 0.0823  150 HIS B C   
4387 O O   . HIS B 150 ? 0.4994 0.4911 0.7045 0.0233  -0.0614 0.0899  150 HIS B O   
4388 C CB  . HIS B 150 ? 0.5260 0.5169 0.7237 0.0099  -0.0449 0.0792  150 HIS B CB  
4389 C CG  . HIS B 150 ? 0.6054 0.5933 0.7936 0.0057  -0.0475 0.0900  150 HIS B CG  
4390 N ND1 . HIS B 150 ? 0.6407 0.6376 0.8164 0.0003  -0.0463 0.0923  150 HIS B ND1 
4391 C CD2 . HIS B 150 ? 0.6509 0.6276 0.8400 0.0059  -0.0513 0.0991  150 HIS B CD2 
4392 C CE1 . HIS B 150 ? 0.6556 0.6471 0.8238 -0.0030 -0.0495 0.1031  150 HIS B CE1 
4393 N NE2 . HIS B 150 ? 0.6660 0.6449 0.8423 0.0004  -0.0529 0.1080  150 HIS B NE2 
4394 N N   . PRO B 151 ? 0.4176 0.4279 0.6138 0.0186  -0.0549 0.0787  151 PRO B N   
4395 C CA  . PRO B 151 ? 0.4195 0.4370 0.6121 0.0201  -0.0612 0.0840  151 PRO B CA  
4396 C C   . PRO B 151 ? 0.4419 0.4606 0.6470 0.0287  -0.0667 0.0829  151 PRO B C   
4397 O O   . PRO B 151 ? 0.4141 0.4377 0.6191 0.0311  -0.0733 0.0888  151 PRO B O   
4398 C CB  . PRO B 151 ? 0.4318 0.4616 0.6158 0.0155  -0.0575 0.0782  151 PRO B CB  
4399 C CG  . PRO B 151 ? 0.4713 0.4988 0.6534 0.0110  -0.0495 0.0724  151 PRO B CG  
4400 C CD  . PRO B 151 ? 0.4102 0.4283 0.6032 0.0152  -0.0487 0.0701  151 PRO B CD  
4401 N N   . LEU B 152 ? 0.3958 0.4111 0.6118 0.0331  -0.0640 0.0750  152 LEU B N   
4402 C CA  . LEU B 152 ? 0.3812 0.3981 0.6102 0.0410  -0.0673 0.0715  152 LEU B CA  
4403 C C   . LEU B 152 ? 0.4213 0.4274 0.6599 0.0465  -0.0723 0.0779  152 LEU B C   
4404 O O   . LEU B 152 ? 0.4291 0.4371 0.6800 0.0535  -0.0754 0.0755  152 LEU B O   
4405 C CB  . LEU B 152 ? 0.3629 0.3813 0.5981 0.0424  -0.0619 0.0601  152 LEU B CB  
4406 C CG  . LEU B 152 ? 0.3994 0.4287 0.6284 0.0387  -0.0578 0.0533  152 LEU B CG  
4407 C CD1 . LEU B 152 ? 0.4304 0.4571 0.6624 0.0381  -0.0523 0.0448  152 LEU B CD1 
4408 C CD2 . LEU B 152 ? 0.3843 0.4256 0.6167 0.0416  -0.0609 0.0512  152 LEU B CD2 
4409 N N   . GLY B 153 ? 0.3489 0.3441 0.5826 0.0433  -0.0730 0.0859  153 GLY B N   
4410 C CA  . GLY B 153 ? 0.3583 0.3411 0.6003 0.0477  -0.0779 0.0934  153 GLY B CA  
4411 C C   . GLY B 153 ? 0.4157 0.3904 0.6728 0.0539  -0.0764 0.0862  153 GLY B C   
4412 O O   . GLY B 153 ? 0.4457 0.4169 0.7152 0.0611  -0.0811 0.0884  153 GLY B O   
4413 N N   . CYS B 154 ? 0.3544 0.3268 0.6112 0.0512  -0.0698 0.0773  154 CYS B N   
4414 C CA  . CYS B 154 ? 0.3615 0.3266 0.6302 0.0553  -0.0673 0.0691  154 CYS B CA  
4415 C C   . CYS B 154 ? 0.4629 0.4129 0.7311 0.0517  -0.0654 0.0715  154 CYS B C   
4416 O O   . CYS B 154 ? 0.4790 0.4273 0.7366 0.0449  -0.0639 0.0768  154 CYS B O   
4417 C CB  . CYS B 154 ? 0.3532 0.3275 0.6213 0.0544  -0.0621 0.0572  154 CYS B CB  
4418 S SG  . CYS B 154 ? 0.3950 0.3724 0.6498 0.0453  -0.0563 0.0547  154 CYS B SG  
4419 N N   . ASN B 155 ? 0.4296 0.3690 0.7094 0.0557  -0.0648 0.0669  155 ASN B N   
4420 C CA  . ASN B 155 ? 0.4274 0.3520 0.7081 0.0520  -0.0628 0.0680  155 ASN B CA  
4421 C C   . ASN B 155 ? 0.4623 0.3890 0.7409 0.0477  -0.0569 0.0573  155 ASN B C   
4422 O O   . ASN B 155 ? 0.4492 0.3785 0.7344 0.0510  -0.0549 0.0473  155 ASN B O   
4423 C CB  . ASN B 155 ? 0.4318 0.3422 0.7264 0.0581  -0.0656 0.0691  155 ASN B CB  
4424 C CG  . ASN B 155 ? 0.8213 0.7288 1.1196 0.0629  -0.0727 0.0810  155 ASN B CG  
4425 O OD1 . ASN B 155 ? 0.8093 0.7131 1.0988 0.0587  -0.0755 0.0926  155 ASN B OD1 
4426 N ND2 . ASN B 155 ? 0.7119 0.6215 1.0236 0.0717  -0.0757 0.0784  155 ASN B ND2 
4427 N N   . ILE B 156 ? 0.4205 0.3473 0.6899 0.0401  -0.0541 0.0594  156 ILE B N   
4428 C CA  . ILE B 156 ? 0.4089 0.3378 0.6766 0.0355  -0.0494 0.0508  156 ILE B CA  
4429 C C   . ILE B 156 ? 0.4581 0.3726 0.7318 0.0334  -0.0484 0.0492  156 ILE B C   
4430 O O   . ILE B 156 ? 0.4392 0.3448 0.7110 0.0295  -0.0490 0.0568  156 ILE B O   
4431 C CB  . ILE B 156 ? 0.4391 0.3774 0.6965 0.0290  -0.0466 0.0523  156 ILE B CB  
4432 C CG1 . ILE B 156 ? 0.4246 0.3770 0.6766 0.0308  -0.0469 0.0516  156 ILE B CG1 
4433 C CG2 . ILE B 156 ? 0.4483 0.3873 0.7062 0.0245  -0.0429 0.0448  156 ILE B CG2 
4434 C CD1 . ILE B 156 ? 0.4227 0.3827 0.6650 0.0252  -0.0447 0.0552  156 ILE B CD1 
4435 N N   . ILE B 157 ? 0.4355 0.3476 0.7159 0.0354  -0.0468 0.0390  157 ILE B N   
4436 C CA  . ILE B 157 ? 0.4405 0.3398 0.7269 0.0331  -0.0455 0.0347  157 ILE B CA  
4437 C C   . ILE B 157 ? 0.4953 0.4000 0.7766 0.0261  -0.0423 0.0287  157 ILE B C   
4438 O O   . ILE B 157 ? 0.4798 0.3942 0.7591 0.0265  -0.0409 0.0209  157 ILE B O   
4439 C CB  . ILE B 157 ? 0.4826 0.3763 0.7796 0.0394  -0.0455 0.0264  157 ILE B CB  
4440 C CG1 . ILE B 157 ? 0.4984 0.3905 0.8023 0.0476  -0.0492 0.0323  157 ILE B CG1 
4441 C CG2 . ILE B 157 ? 0.4933 0.3718 0.7967 0.0366  -0.0440 0.0220  157 ILE B CG2 
4442 C CD1 . ILE B 157 ? 0.5840 0.4767 0.8992 0.0551  -0.0486 0.0230  157 ILE B CD1 
4443 N N   . ASN B 158 ? 0.4749 0.3740 0.7543 0.0196  -0.0415 0.0328  158 ASN B N   
4444 C CA  . ASN B 158 ? 0.4762 0.3811 0.7526 0.0129  -0.0392 0.0280  158 ASN B CA  
4445 C C   . ASN B 158 ? 0.5349 0.4347 0.8162 0.0110  -0.0383 0.0179  158 ASN B C   
4446 O O   . ASN B 158 ? 0.5534 0.4398 0.8407 0.0110  -0.0385 0.0167  158 ASN B O   
4447 C CB  . ASN B 158 ? 0.4905 0.3939 0.7640 0.0062  -0.0381 0.0356  158 ASN B CB  
4448 C CG  . ASN B 158 ? 0.7849 0.6925 1.0589 -0.0007 -0.0363 0.0309  158 ASN B CG  
4449 O OD1 . ASN B 158 ? 0.7657 0.6852 1.0374 -0.0014 -0.0357 0.0264  158 ASN B OD1 
4450 N ND2 . ASN B 158 ? 0.7069 0.6046 0.9848 -0.0059 -0.0357 0.0318  158 ASN B ND2 
4451 N N   . VAL B 159 ? 0.4797 0.3899 0.7579 0.0092  -0.0375 0.0106  159 VAL B N   
4452 C CA  . VAL B 159 ? 0.4906 0.3988 0.7707 0.0061  -0.0368 0.0005  159 VAL B CA  
4453 C C   . VAL B 159 ? 0.5473 0.4589 0.8261 -0.0018 -0.0368 0.0008  159 VAL B C   
4454 O O   . VAL B 159 ? 0.5457 0.4680 0.8208 -0.0035 -0.0369 0.0047  159 VAL B O   
4455 C CB  . VAL B 159 ? 0.5462 0.4642 0.8230 0.0091  -0.0364 -0.0073 159 VAL B CB  
4456 C CG1 . VAL B 159 ? 0.5501 0.4662 0.8273 0.0051  -0.0358 -0.0180 159 VAL B CG1 
4457 C CG2 . VAL B 159 ? 0.5491 0.4664 0.8287 0.0171  -0.0363 -0.0073 159 VAL B CG2 
4458 N N   . ALA B 160 ? 0.5051 0.4079 0.7879 -0.0068 -0.0367 -0.0036 160 ALA B N   
4459 C CA  . ALA B 160 ? 0.4971 0.4036 0.7805 -0.0148 -0.0370 -0.0039 160 ALA B CA  
4460 C C   . ALA B 160 ? 0.5423 0.4630 0.8215 -0.0169 -0.0384 -0.0088 160 ALA B C   
4461 O O   . ALA B 160 ? 0.5311 0.4548 0.8070 -0.0147 -0.0388 -0.0155 160 ALA B O   
4462 C CB  . ALA B 160 ? 0.5199 0.4139 0.8085 -0.0199 -0.0368 -0.0087 160 ALA B CB  
4463 N N   . SER B 161 ? 0.4991 0.4288 0.7790 -0.0213 -0.0390 -0.0049 161 SER B N   
4464 C CA  . SER B 161 ? 0.4814 0.4244 0.7590 -0.0235 -0.0411 -0.0075 161 SER B CA  
4465 C C   . SER B 161 ? 0.5140 0.4617 0.7968 -0.0310 -0.0426 -0.0073 161 SER B C   
4466 O O   . SER B 161 ? 0.5173 0.4598 0.8053 -0.0345 -0.0411 -0.0036 161 SER B O   
4467 C CB  . SER B 161 ? 0.5141 0.4670 0.7884 -0.0188 -0.0406 -0.0024 161 SER B CB  
4468 O OG  . SER B 161 ? 0.6534 0.6074 0.9306 -0.0194 -0.0387 0.0051  161 SER B OG  
4469 N N   . ASP B 162 ? 0.4388 0.3969 0.7205 -0.0338 -0.0459 -0.0110 162 ASP B N   
4470 C CA  . ASP B 162 ? 0.4221 0.3877 0.7098 -0.0406 -0.0485 -0.0111 162 ASP B CA  
4471 C C   . ASP B 162 ? 0.4409 0.4212 0.7281 -0.0396 -0.0517 -0.0094 162 ASP B C   
4472 O O   . ASP B 162 ? 0.4362 0.4197 0.7193 -0.0338 -0.0506 -0.0067 162 ASP B O   
4473 C CB  . ASP B 162 ? 0.4535 0.4135 0.7416 -0.0470 -0.0505 -0.0187 162 ASP B CB  
4474 C CG  . ASP B 162 ? 0.5502 0.5118 0.8301 -0.0471 -0.0530 -0.0264 162 ASP B CG  
4475 O OD1 . ASP B 162 ? 0.5325 0.4969 0.8061 -0.0415 -0.0525 -0.0260 162 ASP B OD1 
4476 O OD2 . ASP B 162 ? 0.6317 0.5918 0.9112 -0.0536 -0.0553 -0.0331 162 ASP B OD2 
4477 N N   . GLU B 163 ? 0.3912 0.3803 0.6833 -0.0452 -0.0558 -0.0107 163 GLU B N   
4478 C CA  . GLU B 163 ? 0.3934 0.3961 0.6870 -0.0447 -0.0600 -0.0085 163 GLU B CA  
4479 C C   . GLU B 163 ? 0.4566 0.4609 0.7394 -0.0414 -0.0622 -0.0108 163 GLU B C   
4480 O O   . GLU B 163 ? 0.4677 0.4807 0.7505 -0.0388 -0.0643 -0.0072 163 GLU B O   
4481 C CB  . GLU B 163 ? 0.4188 0.4302 0.7197 -0.0519 -0.0654 -0.0100 163 GLU B CB  
4482 C CG  . GLU B 163 ? 0.5998 0.6065 0.9081 -0.0584 -0.0642 -0.0120 163 GLU B CG  
4483 C CD  . GLU B 163 ? 0.9115 0.9076 1.2138 -0.0630 -0.0646 -0.0195 163 GLU B CD  
4484 O OE1 . GLU B 163 ? 0.6674 0.6513 0.9708 -0.0636 -0.0601 -0.0203 163 GLU B OE1 
4485 O OE2 . GLU B 163 ? 0.9589 0.9586 1.2552 -0.0664 -0.0694 -0.0247 163 GLU B OE2 
4486 N N   . SER B 164 ? 0.3908 0.3867 0.6650 -0.0420 -0.0613 -0.0171 164 SER B N   
4487 C CA  . SER B 164 ? 0.3718 0.3689 0.6352 -0.0400 -0.0623 -0.0204 164 SER B CA  
4488 C C   . SER B 164 ? 0.3892 0.3794 0.6483 -0.0330 -0.0572 -0.0202 164 SER B C   
4489 O O   . SER B 164 ? 0.3787 0.3669 0.6295 -0.0317 -0.0563 -0.0251 164 SER B O   
4490 C CB  . SER B 164 ? 0.4261 0.4209 0.6831 -0.0462 -0.0648 -0.0288 164 SER B CB  
4491 O OG  . SER B 164 ? 0.5289 0.5303 0.7909 -0.0531 -0.0699 -0.0287 164 SER B OG  
4492 N N   . GLY B 165 ? 0.3249 0.3127 0.5896 -0.0289 -0.0539 -0.0146 165 GLY B N   
4493 C CA  . GLY B 165 ? 0.3176 0.3000 0.5798 -0.0225 -0.0497 -0.0130 165 GLY B CA  
4494 C C   . GLY B 165 ? 0.3962 0.3664 0.6581 -0.0215 -0.0470 -0.0172 165 GLY B C   
4495 O O   . GLY B 165 ? 0.4099 0.3736 0.6761 -0.0257 -0.0471 -0.0192 165 GLY B O   
4496 N N   . ILE B 166 ? 0.3521 0.3191 0.6102 -0.0159 -0.0446 -0.0185 166 ILE B N   
4497 C CA  . ILE B 166 ? 0.3539 0.3098 0.6133 -0.0132 -0.0421 -0.0223 166 ILE B CA  
4498 C C   . ILE B 166 ? 0.4319 0.3823 0.6912 -0.0184 -0.0427 -0.0309 166 ILE B C   
4499 O O   . ILE B 166 ? 0.4193 0.3762 0.6730 -0.0223 -0.0446 -0.0360 166 ILE B O   
4500 C CB  . ILE B 166 ? 0.3877 0.3454 0.6434 -0.0067 -0.0402 -0.0237 166 ILE B CB  
4501 C CG1 . ILE B 166 ? 0.3793 0.3381 0.6369 -0.0015 -0.0391 -0.0155 166 ILE B CG1 
4502 C CG2 . ILE B 166 ? 0.4136 0.3625 0.6708 -0.0045 -0.0379 -0.0315 166 ILE B CG2 
4503 C CD1 . ILE B 166 ? 0.4109 0.3751 0.6648 0.0039  -0.0379 -0.0158 166 ILE B CD1 
4504 N N   . VAL B 167 ? 0.4111 0.3494 0.6761 -0.0190 -0.0412 -0.0323 167 VAL B N   
4505 C CA  . VAL B 167 ? 0.4234 0.3543 0.6893 -0.0240 -0.0410 -0.0414 167 VAL B CA  
4506 C C   . VAL B 167 ? 0.5226 0.4468 0.7881 -0.0190 -0.0378 -0.0486 167 VAL B C   
4507 O O   . VAL B 167 ? 0.5522 0.4681 0.8234 -0.0131 -0.0358 -0.0453 167 VAL B O   
4508 C CB  . VAL B 167 ? 0.4605 0.3811 0.7338 -0.0282 -0.0409 -0.0392 167 VAL B CB  
4509 C CG1 . VAL B 167 ? 0.4653 0.3776 0.7397 -0.0339 -0.0405 -0.0496 167 VAL B CG1 
4510 C CG2 . VAL B 167 ? 0.4459 0.3748 0.7212 -0.0327 -0.0434 -0.0322 167 VAL B CG2 
4511 N N   . PRO B 168 ? 0.4704 0.3988 0.7296 -0.0214 -0.0372 -0.0581 168 PRO B N   
4512 C CA  . PRO B 168 ? 0.4730 0.3967 0.7332 -0.0166 -0.0332 -0.0660 168 PRO B CA  
4513 C C   . PRO B 168 ? 0.5368 0.4446 0.8064 -0.0147 -0.0304 -0.0707 168 PRO B C   
4514 O O   . PRO B 168 ? 0.5361 0.4391 0.8112 -0.0075 -0.0276 -0.0724 168 PRO B O   
4515 C CB  . PRO B 168 ? 0.5012 0.4329 0.7515 -0.0220 -0.0330 -0.0756 168 PRO B CB  
4516 C CG  . PRO B 168 ? 0.5509 0.4941 0.7945 -0.0270 -0.0378 -0.0693 168 PRO B CG  
4517 C CD  . PRO B 168 ? 0.4894 0.4282 0.7402 -0.0286 -0.0402 -0.0618 168 PRO B CD  
4518 N N   . ASP B 169 ? 0.5073 0.4068 0.7799 -0.0210 -0.0314 -0.0725 169 ASP B N   
4519 C CA  . ASP B 169 ? 0.5219 0.4043 0.8042 -0.0199 -0.0289 -0.0765 169 ASP B CA  
4520 C C   . ASP B 169 ? 0.5449 0.4186 0.8358 -0.0129 -0.0290 -0.0655 169 ASP B C   
4521 O O   . ASP B 169 ? 0.5429 0.4040 0.8425 -0.0078 -0.0267 -0.0679 169 ASP B O   
4522 C CB  . ASP B 169 ? 0.5627 0.4389 0.8455 -0.0295 -0.0298 -0.0818 169 ASP B CB  
4523 C CG  . ASP B 169 ? 0.8044 0.6828 1.0812 -0.0355 -0.0281 -0.0964 169 ASP B CG  
4524 O OD1 . ASP B 169 ? 0.8412 0.7096 1.1226 -0.0331 -0.0238 -0.1063 169 ASP B OD1 
4525 O OD2 . ASP B 169 ? 0.9138 0.8042 1.1813 -0.0425 -0.0312 -0.0980 169 ASP B OD2 
4526 N N   . SER B 170 ? 0.4815 0.3621 0.7701 -0.0125 -0.0317 -0.0536 170 SER B N   
4527 C CA  . SER B 170 ? 0.4759 0.3505 0.7698 -0.0068 -0.0322 -0.0421 170 SER B CA  
4528 C C   . SER B 170 ? 0.4952 0.3719 0.7910 0.0027  -0.0312 -0.0417 170 SER B C   
4529 O O   . SER B 170 ? 0.4899 0.3558 0.7937 0.0084  -0.0308 -0.0384 170 SER B O   
4530 C CB  . SER B 170 ? 0.5180 0.4024 0.8074 -0.0093 -0.0345 -0.0315 170 SER B CB  
4531 O OG  . SER B 170 ? 0.6392 0.5188 0.9317 -0.0048 -0.0349 -0.0206 170 SER B OG  
4532 N N   . LEU B 171 ? 0.4393 0.3300 0.7283 0.0040  -0.0309 -0.0451 171 LEU B N   
4533 C CA  . LEU B 171 ? 0.4221 0.3184 0.7122 0.0118  -0.0296 -0.0463 171 LEU B CA  
4534 C C   . LEU B 171 ? 0.5094 0.3962 0.8079 0.0155  -0.0264 -0.0564 171 LEU B C   
4535 O O   . LEU B 171 ? 0.5147 0.3987 0.8211 0.0235  -0.0259 -0.0544 171 LEU B O   
4536 C CB  . LEU B 171 ? 0.4013 0.3137 0.6815 0.0098  -0.0296 -0.0490 171 LEU B CB  
4537 C CG  . LEU B 171 ? 0.4538 0.3746 0.7338 0.0162  -0.0279 -0.0512 171 LEU B CG  
4538 C CD1 . LEU B 171 ? 0.4409 0.3640 0.7238 0.0225  -0.0297 -0.0403 171 LEU B CD1 
4539 C CD2 . LEU B 171 ? 0.4860 0.4204 0.7553 0.0122  -0.0276 -0.0548 171 LEU B CD2 
4540 N N   . ARG B 172 ? 0.4867 0.3686 0.7844 0.0096  -0.0243 -0.0674 172 ARG B N   
4541 C CA  . ARG B 172 ? 0.5064 0.3785 0.8125 0.0121  -0.0203 -0.0791 172 ARG B CA  
4542 C C   . ARG B 172 ? 0.5976 0.4522 0.9171 0.0171  -0.0208 -0.0740 172 ARG B C   
4543 O O   . ARG B 172 ? 0.5916 0.4412 0.9217 0.0251  -0.0190 -0.0763 172 ARG B O   
4544 C CB  . ARG B 172 ? 0.5171 0.3878 0.8175 0.0028  -0.0184 -0.0914 172 ARG B CB  
4545 C CG  . ARG B 172 ? 0.6537 0.5212 0.9582 0.0040  -0.0129 -0.1069 172 ARG B CG  
4546 C CD  . ARG B 172 ? 0.8464 0.7177 1.1403 -0.0064 -0.0113 -0.1190 172 ARG B CD  
4547 N NE  . ARG B 172 ? 0.9474 0.8365 1.2269 -0.0103 -0.0128 -0.1184 172 ARG B NE  
4548 C CZ  . ARG B 172 ? 1.0398 0.9364 1.3083 -0.0189 -0.0167 -0.1157 172 ARG B CZ  
4549 N NH1 . ARG B 172 ? 0.9033 0.7923 1.1733 -0.0250 -0.0194 -0.1143 172 ARG B NH1 
4550 N NH2 . ARG B 172 ? 0.6959 0.6075 0.9523 -0.0217 -0.0183 -0.1145 172 ARG B NH2 
4551 N N   . ASP B 173 ? 0.5964 0.4426 0.9158 0.0123  -0.0234 -0.0663 173 ASP B N   
4552 C CA  . ASP B 173 ? 0.6208 0.4495 0.9507 0.0151  -0.0244 -0.0594 173 ASP B CA  
4553 C C   . ASP B 173 ? 0.6660 0.4955 1.0008 0.0244  -0.0269 -0.0476 173 ASP B C   
4554 O O   . ASP B 173 ? 0.6889 0.5060 1.0358 0.0310  -0.0270 -0.0462 173 ASP B O   
4555 C CB  . ASP B 173 ? 0.6618 0.4853 0.9879 0.0063  -0.0265 -0.0529 173 ASP B CB  
4556 C CG  . ASP B 173 ? 0.9729 0.7769 1.3087 0.0072  -0.0273 -0.0458 173 ASP B CG  
4557 O OD1 . ASP B 173 ? 1.0310 0.8209 1.3729 0.0035  -0.0252 -0.0539 173 ASP B OD1 
4558 O OD2 . ASP B 173 ? 1.0727 0.8752 1.4093 0.0110  -0.0301 -0.0322 173 ASP B OD2 
4559 N N   . ILE B 174 ? 0.5924 0.4367 0.9185 0.0249  -0.0292 -0.0394 174 ILE B N   
4560 C CA  . ILE B 174 ? 0.5849 0.4327 0.9133 0.0326  -0.0320 -0.0284 174 ILE B CA  
4561 C C   . ILE B 174 ? 0.6302 0.4809 0.9675 0.0415  -0.0305 -0.0349 174 ILE B C   
4562 O O   . ILE B 174 ? 0.6391 0.4804 0.9878 0.0487  -0.0321 -0.0304 174 ILE B O   
4563 C CB  . ILE B 174 ? 0.6043 0.4678 0.9208 0.0300  -0.0340 -0.0202 174 ILE B CB  
4564 C CG1 . ILE B 174 ? 0.6118 0.4710 0.9233 0.0228  -0.0355 -0.0115 174 ILE B CG1 
4565 C CG2 . ILE B 174 ? 0.6007 0.4714 0.9184 0.0377  -0.0363 -0.0122 174 ILE B CG2 
4566 C CD1 . ILE B 174 ? 0.7145 0.5891 1.0150 0.0175  -0.0359 -0.0089 174 ILE B CD1 
4567 N N   . LEU B 175 ? 0.5557 0.4188 0.8884 0.0407  -0.0273 -0.0457 175 LEU B N   
4568 C CA  . LEU B 175 ? 0.5413 0.4103 0.8816 0.0478  -0.0247 -0.0537 175 LEU B CA  
4569 C C   . LEU B 175 ? 0.6231 0.4779 0.9793 0.0530  -0.0221 -0.0616 175 LEU B C   
4570 O O   . LEU B 175 ? 0.6271 0.4848 0.9942 0.0614  -0.0212 -0.0641 175 LEU B O   
4571 C CB  . LEU B 175 ? 0.5252 0.4088 0.8554 0.0434  -0.0211 -0.0644 175 LEU B CB  
4572 C CG  . LEU B 175 ? 0.5548 0.4550 0.8731 0.0417  -0.0231 -0.0578 175 LEU B CG  
4573 C CD1 . LEU B 175 ? 0.5430 0.4537 0.8499 0.0350  -0.0204 -0.0670 175 LEU B CD1 
4574 C CD2 . LEU B 175 ? 0.5723 0.4810 0.8965 0.0500  -0.0241 -0.0535 175 LEU B CD2 
4575 N N   . SER B 176 ? 0.5950 0.4344 0.9537 0.0482  -0.0209 -0.0655 176 SER B N   
4576 C CA  . SER B 176 ? 0.6092 0.4325 0.9835 0.0523  -0.0180 -0.0738 176 SER B CA  
4577 C C   . SER B 176 ? 0.6489 0.4618 1.0391 0.0624  -0.0216 -0.0637 176 SER B C   
4578 O O   . SER B 176 ? 0.6641 0.4658 1.0704 0.0684  -0.0191 -0.0709 176 SER B O   
4579 C CB  . SER B 176 ? 0.6770 0.4864 1.0492 0.0435  -0.0164 -0.0794 176 SER B CB  
4580 O OG  . SER B 176 ? 0.8392 0.6330 1.2157 0.0430  -0.0201 -0.0675 176 SER B OG  
4581 N N   . ARG B 177 ? 0.5729 0.3898 0.9587 0.0645  -0.0274 -0.0473 177 ARG B N   
4582 C CA  . ARG B 177 ? 0.5731 0.3813 0.9718 0.0735  -0.0321 -0.0358 177 ARG B CA  
4583 C C   . ARG B 177 ? 0.6240 0.4414 1.0359 0.0841  -0.0317 -0.0399 177 ARG B C   
4584 O O   . ARG B 177 ? 0.6377 0.4466 1.0650 0.0928  -0.0352 -0.0334 177 ARG B O   
4585 C CB  . ARG B 177 ? 0.5547 0.3633 0.9438 0.0711  -0.0382 -0.0175 177 ARG B CB  
4586 C CG  . ARG B 177 ? 0.6818 0.5101 1.0615 0.0727  -0.0409 -0.0108 177 ARG B CG  
4587 C CD  . ARG B 177 ? 0.9267 0.7542 1.2971 0.0698  -0.0462 0.0062  177 ARG B CD  
4588 N NE  . ARG B 177 ? 1.0753 0.9039 1.4312 0.0592  -0.0446 0.0074  177 ARG B NE  
4589 C CZ  . ARG B 177 ? 1.2505 1.0832 1.5952 0.0547  -0.0473 0.0194  177 ARG B CZ  
4590 N NH1 . ARG B 177 ? 1.0865 0.9225 1.4308 0.0592  -0.0520 0.0313  177 ARG B NH1 
4591 N NH2 . ARG B 177 ? 1.0574 0.8918 1.3916 0.0455  -0.0454 0.0191  177 ARG B NH2 
4592 N N   . TRP B 178 ? 0.5575 0.3920 0.9639 0.0831  -0.0274 -0.0508 178 TRP B N   
4593 C CA  . TRP B 178 ? 0.5479 0.3941 0.9657 0.0913  -0.0253 -0.0580 178 TRP B CA  
4594 C C   . TRP B 178 ? 0.5987 0.4460 1.0189 0.0886  -0.0169 -0.0778 178 TRP B C   
4595 O O   . TRP B 178 ? 0.5942 0.4360 1.0042 0.0797  -0.0138 -0.0846 178 TRP B O   
4596 C CB  . TRP B 178 ? 0.5142 0.3818 0.9204 0.0906  -0.0271 -0.0530 178 TRP B CB  
4597 C CG  . TRP B 178 ? 0.5234 0.3931 0.9232 0.0913  -0.0345 -0.0352 178 TRP B CG  
4598 C CD1 . TRP B 178 ? 0.5644 0.4358 0.9744 0.0996  -0.0402 -0.0247 178 TRP B CD1 
4599 C CD2 . TRP B 178 ? 0.5128 0.3856 0.8940 0.0830  -0.0368 -0.0265 178 TRP B CD2 
4600 N NE1 . TRP B 178 ? 0.5544 0.4288 0.9518 0.0962  -0.0457 -0.0101 178 TRP B NE1 
4601 C CE2 . TRP B 178 ? 0.5612 0.4365 0.9414 0.0862  -0.0432 -0.0113 178 TRP B CE2 
4602 C CE3 . TRP B 178 ? 0.5223 0.3962 0.8883 0.0730  -0.0341 -0.0302 178 TRP B CE3 
4603 C CZ2 . TRP B 178 ? 0.5451 0.4235 0.9096 0.0797  -0.0461 -0.0007 178 TRP B CZ2 
4604 C CZ3 . TRP B 178 ? 0.5337 0.4108 0.8862 0.0674  -0.0373 -0.0192 178 TRP B CZ3 
4605 C CH2 . TRP B 178 ? 0.5413 0.4204 0.8930 0.0707  -0.0427 -0.0052 178 TRP B CH2 
4606 N N   . LYS B 179 ? 0.5502 0.4062 0.9837 0.0958  -0.0131 -0.0873 179 LYS B N   
4607 C CA  . LYS B 179 ? 0.5518 0.4120 0.9878 0.0937  -0.0043 -0.1068 179 LYS B CA  
4608 C C   . LYS B 179 ? 0.6005 0.4838 1.0256 0.0914  -0.0020 -0.1103 179 LYS B C   
4609 O O   . LYS B 179 ? 0.5894 0.4835 1.0168 0.0966  -0.0064 -0.1004 179 LYS B O   
4610 C CB  . LYS B 179 ? 0.5953 0.4478 1.0576 0.1041  -0.0008 -0.1158 179 LYS B CB  
4611 C CG  . LYS B 179 ? 0.7600 0.5880 1.2364 0.1076  -0.0030 -0.1123 179 LYS B CG  
4612 C CD  . LYS B 179 ? 0.9197 0.7341 1.3918 0.0994  0.0032  -0.1262 179 LYS B CD  
4613 C CE  . LYS B 179 ? 1.1343 0.9234 1.6188 0.1018  0.0005  -0.1210 179 LYS B CE  
4614 N NZ  . LYS B 179 ? 1.2720 1.0486 1.7465 0.0908  0.0045  -0.1303 179 LYS B NZ  
4615 N N   . PRO B 180 ? 0.5652 0.4566 0.9783 0.0834  0.0046  -0.1239 180 PRO B N   
4616 C CA  . PRO B 180 ? 0.5511 0.4636 0.9538 0.0810  0.0068  -0.1263 180 PRO B CA  
4617 C C   . PRO B 180 ? 0.6122 0.5365 1.0316 0.0909  0.0076  -0.1269 180 PRO B C   
4618 O O   . PRO B 180 ? 0.5941 0.5339 1.0068 0.0908  0.0054  -0.1207 180 PRO B O   
4619 C CB  . PRO B 180 ? 0.5766 0.4922 0.9690 0.0721  0.0147  -0.1430 180 PRO B CB  
4620 C CG  . PRO B 180 ? 0.6425 0.5408 1.0307 0.0665  0.0139  -0.1445 180 PRO B CG  
4621 C CD  . PRO B 180 ? 0.5942 0.4761 1.0016 0.0755  0.0102  -0.1373 180 PRO B CD  
4622 N N   . GLU B 181 ? 0.5922 0.5091 1.0346 0.0996  0.0104  -0.1341 181 GLU B N   
4623 C CA  . GLU B 181 ? 0.5979 0.5251 1.0609 0.1102  0.0110  -0.1354 181 GLU B CA  
4624 C C   . GLU B 181 ? 0.6377 0.5681 1.1053 0.1169  0.0010  -0.1166 181 GLU B C   
4625 O O   . GLU B 181 ? 0.6205 0.5662 1.0976 0.1227  0.0002  -0.1153 181 GLU B O   
4626 C CB  . GLU B 181 ? 0.6386 0.5551 1.1272 0.1183  0.0161  -0.1474 181 GLU B CB  
4627 C CG  . GLU B 181 ? 0.8421 0.7345 1.3398 0.1215  0.0119  -0.1414 181 GLU B CG  
4628 C CD  . GLU B 181 ? 1.2601 1.1424 1.7886 0.1335  0.0134  -0.1468 181 GLU B CD  
4629 O OE1 . GLU B 181 ? 1.2712 1.1486 1.8139 0.1427  0.0052  -0.1326 181 GLU B OE1 
4630 O OE2 . GLU B 181 ? 1.2120 1.0908 1.7506 0.1336  0.0226  -0.1650 181 GLU B OE2 
4631 N N   . ASP B 182 ? 0.5916 0.5085 1.0519 0.1154  -0.0063 -0.1025 182 ASP B N   
4632 C CA  . ASP B 182 ? 0.5820 0.5003 1.0437 0.1201  -0.0159 -0.0842 182 ASP B CA  
4633 C C   . ASP B 182 ? 0.6379 0.5757 1.0851 0.1166  -0.0183 -0.0777 182 ASP B C   
4634 O O   . ASP B 182 ? 0.6490 0.5935 1.1027 0.1225  -0.0247 -0.0668 182 ASP B O   
4635 C CB  . ASP B 182 ? 0.6051 0.5049 1.0593 0.1171  -0.0217 -0.0717 182 ASP B CB  
4636 C CG  . ASP B 182 ? 0.7401 0.6185 1.2104 0.1214  -0.0210 -0.0746 182 ASP B CG  
4637 O OD1 . ASP B 182 ? 0.7814 0.6584 1.2701 0.1274  -0.0157 -0.0874 182 ASP B OD1 
4638 O OD2 . ASP B 182 ? 0.7684 0.6313 1.2335 0.1186  -0.0255 -0.0644 182 ASP B OD2 
4639 N N   . ALA B 183 ? 0.5711 0.5177 0.9990 0.1070  -0.0137 -0.0841 183 ALA B N   
4640 C CA  . ALA B 183 ? 0.5442 0.5081 0.9580 0.1030  -0.0152 -0.0791 183 ALA B CA  
4641 C C   . ALA B 183 ? 0.5926 0.5732 1.0203 0.1097  -0.0143 -0.0821 183 ALA B C   
4642 O O   . ALA B 183 ? 0.5621 0.5540 0.9858 0.1103  -0.0190 -0.0730 183 ALA B O   
4643 C CB  . ALA B 183 ? 0.5440 0.5128 0.9382 0.0923  -0.0097 -0.0871 183 ALA B CB  
4644 N N   . LYS B 184 ? 0.5879 0.5698 1.0331 0.1147  -0.0082 -0.0953 184 LYS B N   
4645 C CA  . LYS B 184 ? 0.5987 0.5966 1.0617 0.1217  -0.0061 -0.1008 184 LYS B CA  
4646 C C   . LYS B 184 ? 0.6776 0.6740 1.1612 0.1330  -0.0145 -0.0896 184 LYS B C   
4647 O O   . LYS B 184 ? 0.6750 0.6873 1.1710 0.1384  -0.0157 -0.0895 184 LYS B O   
4648 C CB  . LYS B 184 ? 0.6401 0.6388 1.1154 0.1229  0.0042  -0.1198 184 LYS B CB  
4649 C CG  . LYS B 184 ? 0.7734 0.7749 1.2281 0.1112  0.0122  -0.1311 184 LYS B CG  
4650 C CD  . LYS B 184 ? 0.8902 0.8896 1.3560 0.1117  0.0224  -0.1501 184 LYS B CD  
4651 C CE  . LYS B 184 ? 1.0580 1.0571 1.5016 0.0994  0.0293  -0.1603 184 LYS B CE  
4652 N NZ  . LYS B 184 ? 1.2569 1.2369 1.6895 0.0946  0.0266  -0.1574 184 LYS B NZ  
4653 N N   . ASN B 185 ? 0.6442 0.6218 1.1313 0.1362  -0.0204 -0.0801 185 ASN B N   
4654 C CA  . ASN B 185 ? 0.6475 0.6210 1.1519 0.1461  -0.0294 -0.0674 185 ASN B CA  
4655 C C   . ASN B 185 ? 0.6938 0.6689 1.1812 0.1424  -0.0386 -0.0495 185 ASN B C   
4656 O O   . ASN B 185 ? 0.6848 0.6464 1.1565 0.1364  -0.0406 -0.0425 185 ASN B O   
4657 C CB  . ASN B 185 ? 0.6707 0.6221 1.1904 0.1518  -0.0301 -0.0678 185 ASN B CB  
4658 C CG  . ASN B 185 ? 0.9405 0.8857 1.4802 0.1627  -0.0396 -0.0548 185 ASN B CG  
4659 O OD1 . ASN B 185 ? 0.8507 0.8093 1.3948 0.1669  -0.0466 -0.0451 185 ASN B OD1 
4660 N ND2 . ASN B 185 ? 0.8567 0.7811 1.4092 0.1672  -0.0404 -0.0541 185 ASN B ND2 
4661 N N   . PRO B 186 ? 0.6460 0.6379 1.1364 0.1454  -0.0439 -0.0425 186 PRO B N   
4662 C CA  . PRO B 186 ? 0.6363 0.6310 1.1092 0.1409  -0.0517 -0.0270 186 PRO B CA  
4663 C C   . PRO B 186 ? 0.6990 0.6762 1.1694 0.1421  -0.0597 -0.0119 186 PRO B C   
4664 O O   . PRO B 186 ? 0.6978 0.6702 1.1471 0.1342  -0.0615 -0.0040 186 PRO B