data_4GFX
# 
_entry.id   4GFX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GFX         
RCSB  RCSB074132   
WWPDB D_1000074132 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4GFX 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hwang, J.' 1 
'Kim, M.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
'The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein.' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            5 
_citation.page_first                2958 
_citation.page_last                 2958 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24389582 
_citation.pdbx_database_id_DOI      10.1038/ncomms3958 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hwang, J.'    1  
primary 'Suh, H.W.'    2  
primary 'Jeon, Y.H.'   3  
primary 'Hwang, E.'    4  
primary 'Nguyen, L.T.' 5  
primary 'Yeom, J.'     6  
primary 'Lee, S.G.'    7  
primary 'Lee, C.'      8  
primary 'Kim, K.J.'    9  
primary 'Kang, B.S.'   10 
primary 'Jeong, J.O.'  11 
primary 'Oh, T.K.'     12 
primary 'Choi, I.'     13 
primary 'Lee, J.O.'    14 
primary 'Kim, M.H.'    15 
# 
_cell.entry_id           4GFX 
_cell.length_a           37.431 
_cell.length_b           56.621 
_cell.length_c           67.660 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4GFX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thioredoxin-interacting protein' 17057.500 1   ? F4V,K5A,K6A 'N-terminal domain (UNP residues 4-154)' ? 
2 non-polymer syn GLYCEROL                          92.094    1   ? ?           ?                                        ? 
3 water       nat water                             18.015    100 ? ?           ?                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TXNIP, Thioredoxin-binding protein 2, TBP-2, Vitamin D3 up-regulated protein 1, VDUP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VAAIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPT
GENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VAAIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPT
GENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ALA n 
1 3   ALA n 
1 4   ILE n 
1 5   LYS n 
1 6   SER n 
1 7   PHE n 
1 8   GLU n 
1 9   VAL n 
1 10  VAL n 
1 11  PHE n 
1 12  ASN n 
1 13  ASP n 
1 14  PRO n 
1 15  GLU n 
1 16  LYS n 
1 17  VAL n 
1 18  TYR n 
1 19  GLY n 
1 20  SER n 
1 21  GLY n 
1 22  GLU n 
1 23  LYS n 
1 24  VAL n 
1 25  ALA n 
1 26  GLY n 
1 27  ARG n 
1 28  VAL n 
1 29  ILE n 
1 30  VAL n 
1 31  GLU n 
1 32  VAL n 
1 33  CYS n 
1 34  GLU n 
1 35  VAL n 
1 36  THR n 
1 37  ARG n 
1 38  VAL n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ARG n 
1 43  ILE n 
1 44  LEU n 
1 45  ALA n 
1 46  CYS n 
1 47  GLY n 
1 48  VAL n 
1 49  ALA n 
1 50  LYS n 
1 51  VAL n 
1 52  LEU n 
1 53  TRP n 
1 54  MET n 
1 55  GLN n 
1 56  GLY n 
1 57  SER n 
1 58  GLN n 
1 59  GLN n 
1 60  CYS n 
1 61  LYS n 
1 62  GLN n 
1 63  THR n 
1 64  SER n 
1 65  GLU n 
1 66  TYR n 
1 67  LEU n 
1 68  ARG n 
1 69  TYR n 
1 70  GLU n 
1 71  ASP n 
1 72  THR n 
1 73  LEU n 
1 74  LEU n 
1 75  LEU n 
1 76  GLU n 
1 77  ASP n 
1 78  GLN n 
1 79  PRO n 
1 80  THR n 
1 81  GLY n 
1 82  GLU n 
1 83  ASN n 
1 84  GLU n 
1 85  MET n 
1 86  VAL n 
1 87  ILE n 
1 88  MET n 
1 89  ARG n 
1 90  PRO n 
1 91  GLY n 
1 92  ASN n 
1 93  LYS n 
1 94  TYR n 
1 95  GLU n 
1 96  TYR n 
1 97  LYS n 
1 98  PHE n 
1 99  GLY n 
1 100 PHE n 
1 101 GLU n 
1 102 LEU n 
1 103 PRO n 
1 104 GLN n 
1 105 GLY n 
1 106 PRO n 
1 107 LEU n 
1 108 GLY n 
1 109 THR n 
1 110 SER n 
1 111 PHE n 
1 112 LYS n 
1 113 GLY n 
1 114 LYS n 
1 115 TYR n 
1 116 GLY n 
1 117 CYS n 
1 118 VAL n 
1 119 ASP n 
1 120 TYR n 
1 121 TRP n 
1 122 VAL n 
1 123 LYS n 
1 124 ALA n 
1 125 PHE n 
1 126 LEU n 
1 127 ASP n 
1 128 ARG n 
1 129 PRO n 
1 130 SER n 
1 131 GLN n 
1 132 PRO n 
1 133 THR n 
1 134 GLN n 
1 135 GLU n 
1 136 THR n 
1 137 LYS n 
1 138 LYS n 
1 139 ASN n 
1 140 PHE n 
1 141 GLU n 
1 142 VAL n 
1 143 VAL n 
1 144 ASP n 
1 145 LEU n 
1 146 VAL n 
1 147 ASP n 
1 148 VAL n 
1 149 ASN n 
1 150 THR n 
1 151 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TXNIP, VDUP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TXNIP_HUMAN 
_struct_ref.pdbx_db_accession          Q9H3M7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPT
GENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTP
;
_struct_ref.pdbx_align_begin           4 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4GFX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9H3M7 
_struct_ref_seq.db_align_beg                  4 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  154 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       154 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GFX VAL A 1 ? UNP Q9H3M7 PHE 4 'ENGINEERED MUTATION' 4 1 
1 4GFX ALA A 2 ? UNP Q9H3M7 LYS 5 'ENGINEERED MUTATION' 5 2 
1 4GFX ALA A 3 ? UNP Q9H3M7 LYS 6 'ENGINEERED MUTATION' 6 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4GFX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   10 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   41.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'0.75 M sodium/potassium phosphate, 0.1 M HEPES sodium, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 4A' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     4GFX 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   18976 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.6 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   90.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4GFX 
_refine.ls_number_reflns_obs                     17968 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.78 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    97.02 
_refine.ls_R_factor_obs                          0.17423 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17136 
_refine.ls_R_factor_R_free                       0.22711 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  972 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               25.152 
_refine.aniso_B[1][1]                            -0.52 
_refine.aniso_B[2][2]                            1.57 
_refine.aniso_B[3][3]                            -1.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PARTIALLY REFINED STRUCTURE OF MSE-LABELED TXNIP N-TERMINAL DOMAIN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.130 
_refine.pdbx_overall_ESU_R_Free                  0.101 
_refine.overall_SU_ML                            0.062 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.815 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1189 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             100 
_refine_hist.number_atoms_total               1295 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        18.78 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d         0.008  0.022  ? 1236 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg      1.129  1.973  ? 1673 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg   6.455  5.000  ? 154  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg   30.061 25.000 ? 56   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg   11.963 15.000 ? 216  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg   14.421 15.000 ? 6    ? 'X-RAY DIFFRACTION' 
r_chiral_restr           0.075  0.200  ? 180  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined     0.004  0.020  ? 939  ? 'X-RAY DIFFRACTION' 
r_nbd_refined            0.189  0.200  ? 470  ? 'X-RAY DIFFRACTION' 
r_nbtor_refined          0.304  0.200  ? 844  ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined    0.103  0.200  ? 80   ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined   0.244  0.200  ? 55   ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined 0.127  0.200  ? 10   ? 'X-RAY DIFFRACTION' 
r_mcbond_it              2.624  3.000  ? 789  ? 'X-RAY DIFFRACTION' 
r_mcangle_it             3.504  5.000  ? 1233 ? 'X-RAY DIFFRACTION' 
r_scbond_it              5.721  8.000  ? 520  ? 'X-RAY DIFFRACTION' 
r_scangle_it             7.977  11.000 ? 440  ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.644 
_refine_ls_shell.number_reflns_R_work             1164 
_refine_ls_shell.R_factor_R_work                  0.175 
_refine_ls_shell.percent_reflns_obs               86.99 
_refine_ls_shell.R_factor_R_free                  0.278 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             66 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4GFX 
_struct.title                     'Crystal structure of the N-terminal domain of TXNIP' 
_struct.pdbx_descriptor           'Thioredoxin-interacting protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GFX 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Arrestin-like fold, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            60 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            117 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             63 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             120 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.031 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 4   ? PHE A 11  ? ILE A 7   PHE A 14  
A 2 LYS A 23  ? VAL A 32  ? LYS A 26  VAL A 35  
A 3 TYR A 94  ? GLU A 101 ? TYR A 97  GLU A 104 
B 1 THR A 36  ? VAL A 38  ? THR A 39  VAL A 41  
B 2 VAL A 86  ? MET A 88  ? VAL A 89  MET A 91  
C 1 LEU A 67  ? THR A 72  ? LEU A 70  THR A 75  
C 2 ALA A 40  ? ALA A 49  ? ALA A 43  ALA A 52  
C 3 VAL A 118 ? ARG A 128 ? VAL A 121 ARG A 131 
C 4 GLN A 131 ? PHE A 140 ? GLN A 134 PHE A 143 
D 1 VAL A 51  ? MET A 54  ? VAL A 54  MET A 57  
D 2 SER A 57  ? LYS A 61  ? SER A 60  LYS A 64  
E 1 TYR A 115 ? GLY A 116 ? TYR A 118 GLY A 119 
E 2 GLY A 108 ? PHE A 111 ? GLY A 111 PHE A 114 
E 3 LEU A 145 ? ASP A 147 ? LEU A 148 ASP A 150 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 10  ? N VAL A 13  O ARG A 27  ? O ARG A 30  
A 2 3 N VAL A 24  ? N VAL A 27  O PHE A 100 ? O PHE A 103 
B 1 2 N VAL A 38  ? N VAL A 41  O VAL A 86  ? O VAL A 89  
C 1 2 O ASP A 71  ? O ASP A 74  N ILE A 43  ? N ILE A 46  
C 2 3 N VAL A 48  ? N VAL A 51  O ASP A 119 ? O ASP A 122 
C 3 4 N VAL A 122 ? N VAL A 125 O LYS A 138 ? O LYS A 141 
D 1 2 N LEU A 52  ? N LEU A 55  O GLN A 59  ? O GLN A 62  
E 1 2 O TYR A 115 ? O TYR A 118 N PHE A 111 ? N PHE A 114 
E 2 3 N GLY A 108 ? N GLY A 111 O VAL A 146 ? O VAL A 149 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 THR A 36  ? THR A 39  . ? 1_555 ? 
2 AC1 6 ARG A 37  ? ARG A 40  . ? 1_555 ? 
3 AC1 6 GLN A 104 ? GLN A 107 . ? 2_554 ? 
4 AC1 6 GLN A 131 ? GLN A 134 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 923 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 955 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4GFX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4GFX 
_atom_sites.fract_transf_matrix[1][1]   0.026716 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017661 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014780 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1   ? 6.588  -4.946  -16.753 1.00 32.49 ? 4    VAL A N   1 
ATOM   2    C CA  . VAL A 1 1   ? 6.134  -6.149  -16.022 1.00 31.87 ? 4    VAL A CA  1 
ATOM   3    C C   . VAL A 1 1   ? 4.865  -5.845  -15.239 1.00 30.08 ? 4    VAL A C   1 
ATOM   4    O O   . VAL A 1 1   ? 4.907  -5.176  -14.198 1.00 27.32 ? 4    VAL A O   1 
ATOM   5    C CB  . VAL A 1 1   ? 7.210  -6.722  -15.069 1.00 32.41 ? 4    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 1   ? 7.622  -5.706  -14.039 1.00 35.34 ? 4    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 1   ? 6.691  -7.985  -14.381 1.00 34.48 ? 4    VAL A CG2 1 
ATOM   8    N N   . ALA A 1 2   ? 3.737  -6.341  -15.750 1.00 29.02 ? 5    ALA A N   1 
ATOM   9    C CA  . ALA A 1 2   ? 2.432  -6.086  -15.149 1.00 28.65 ? 5    ALA A CA  1 
ATOM   10   C C   . ALA A 1 2   ? 2.274  -4.588  -14.858 1.00 27.43 ? 5    ALA A C   1 
ATOM   11   O O   . ALA A 1 2   ? 1.969  -4.183  -13.729 1.00 28.15 ? 5    ALA A O   1 
ATOM   12   C CB  . ALA A 1 2   ? 2.239  -6.931  -13.873 1.00 28.88 ? 5    ALA A CB  1 
ATOM   13   N N   . ALA A 1 3   ? 2.528  -3.783  -15.892 1.00 23.33 ? 6    ALA A N   1 
ATOM   14   C CA  . ALA A 1 3   ? 2.424  -2.321  -15.834 1.00 22.79 ? 6    ALA A CA  1 
ATOM   15   C C   . ALA A 1 3   ? 3.676  -1.631  -15.330 1.00 20.74 ? 6    ALA A C   1 
ATOM   16   O O   . ALA A 1 3   ? 3.832  -0.431  -15.538 1.00 20.05 ? 6    ALA A O   1 
ATOM   17   C CB  . ALA A 1 3   ? 1.225  -1.881  -15.007 1.00 23.29 ? 6    ALA A CB  1 
ATOM   18   N N   . ILE A 1 4   ? 4.549  -2.365  -14.641 1.00 19.41 ? 7    ILE A N   1 
ATOM   19   C CA  . ILE A 1 4   ? 5.692  -1.733  -13.981 1.00 17.30 ? 7    ILE A CA  1 
ATOM   20   C C   . ILE A 1 4   ? 6.908  -1.639  -14.905 1.00 17.78 ? 7    ILE A C   1 
ATOM   21   O O   . ILE A 1 4   ? 7.391  -2.639  -15.425 1.00 21.43 ? 7    ILE A O   1 
ATOM   22   C CB  . ILE A 1 4   ? 6.048  -2.400  -12.633 1.00 16.07 ? 7    ILE A CB  1 
ATOM   23   C CG1 . ILE A 1 4   ? 4.789  -2.569  -11.754 1.00 16.35 ? 7    ILE A CG1 1 
ATOM   24   C CG2 . ILE A 1 4   ? 7.149  -1.615  -11.916 1.00 15.68 ? 7    ILE A CG2 1 
ATOM   25   C CD1 . ILE A 1 4   ? 4.031  -1.269  -11.449 1.00 17.42 ? 7    ILE A CD1 1 
ATOM   26   N N   . LYS A 1 5   ? 7.373  -0.408  -15.093 1.00 16.91 ? 8    LYS A N   1 
ATOM   27   C CA  . LYS A 1 5   ? 8.517  -0.098  -15.946 1.00 17.18 ? 8    LYS A CA  1 
ATOM   28   C C   . LYS A 1 5   ? 9.852  -0.178  -15.203 1.00 16.34 ? 8    LYS A C   1 
ATOM   29   O O   . LYS A 1 5   ? 10.866 -0.605  -15.764 1.00 18.18 ? 8    LYS A O   1 
ATOM   30   C CB  . LYS A 1 5   ? 8.326  1.306   -16.534 1.00 19.14 ? 8    LYS A CB  1 
ATOM   31   C CG  . LYS A 1 5   ? 9.415  1.804   -17.456 1.00 22.55 ? 8    LYS A CG  1 
ATOM   32   C CD  . LYS A 1 5   ? 9.080  3.212   -17.917 1.00 25.27 ? 8    LYS A CD  1 
ATOM   33   C CE  . LYS A 1 5   ? 10.194 3.815   -18.760 1.00 28.39 ? 8    LYS A CE  1 
ATOM   34   N NZ  . LYS A 1 5   ? 11.406 4.090   -17.945 1.00 37.63 ? 8    LYS A NZ  1 
ATOM   35   N N   A SER A 1 6   ? 9.837  0.244   -13.944 0.50 14.34 ? 9    SER A N   1 
ATOM   36   N N   B SER A 1 6   ? 9.862  0.267   -13.947 0.50 14.82 ? 9    SER A N   1 
ATOM   37   C CA  A SER A 1 6   ? 11.025 0.264   -13.120 0.50 13.92 ? 9    SER A CA  1 
ATOM   38   C CA  B SER A 1 6   ? 11.072 0.251   -13.132 0.50 14.95 ? 9    SER A CA  1 
ATOM   39   C C   A SER A 1 6   ? 10.602 0.254   -11.664 0.50 12.92 ? 9    SER A C   1 
ATOM   40   C C   B SER A 1 6   ? 10.720 0.402   -11.661 0.50 13.66 ? 9    SER A C   1 
ATOM   41   O O   A SER A 1 6   ? 9.519  0.735   -11.318 0.50 12.43 ? 9    SER A O   1 
ATOM   42   O O   B SER A 1 6   ? 9.810  1.153   -11.304 0.50 13.98 ? 9    SER A O   1 
ATOM   43   C CB  A SER A 1 6   ? 11.864 1.503   -13.423 0.50 14.63 ? 9    SER A CB  1 
ATOM   44   C CB  B SER A 1 6   ? 12.050 1.350   -13.567 0.50 15.54 ? 9    SER A CB  1 
ATOM   45   O OG  A SER A 1 6   ? 13.063 1.502   -12.674 0.50 14.78 ? 9    SER A OG  1 
ATOM   46   O OG  B SER A 1 6   ? 11.567 2.638   -13.229 0.50 19.95 ? 9    SER A OG  1 
ATOM   47   N N   . PHE A 1 7   ? 11.455 -0.322  -10.823 1.00 13.57 ? 10   PHE A N   1 
ATOM   48   C CA  . PHE A 1 7   ? 11.222 -0.367  -9.386  1.00 12.90 ? 10   PHE A CA  1 
ATOM   49   C C   . PHE A 1 7   ? 12.601 -0.514  -8.773  1.00 14.48 ? 10   PHE A C   1 
ATOM   50   O O   . PHE A 1 7   ? 13.280 -1.523  -9.006  1.00 14.39 ? 10   PHE A O   1 
ATOM   51   C CB  . PHE A 1 7   ? 10.333 -1.572  -9.034  1.00 13.74 ? 10   PHE A CB  1 
ATOM   52   C CG  . PHE A 1 7   ? 9.907  -1.619  -7.586  1.00 13.93 ? 10   PHE A CG  1 
ATOM   53   C CD1 . PHE A 1 7   ? 9.568  -0.457  -6.903  1.00 14.02 ? 10   PHE A CD1 1 
ATOM   54   C CD2 . PHE A 1 7   ? 9.805  -2.837  -6.916  1.00 15.39 ? 10   PHE A CD2 1 
ATOM   55   C CE1 . PHE A 1 7   ? 9.162  -0.503  -5.563  1.00 16.72 ? 10   PHE A CE1 1 
ATOM   56   C CE2 . PHE A 1 7   ? 9.413  -2.887  -5.583  1.00 16.25 ? 10   PHE A CE2 1 
ATOM   57   C CZ  . PHE A 1 7   ? 9.085  -1.722  -4.907  1.00 14.49 ? 10   PHE A CZ  1 
ATOM   58   N N   . GLU A 1 8   ? 13.045 0.503   -8.038  1.00 12.99 ? 11   GLU A N   1 
ATOM   59   C CA  . GLU A 1 8   ? 14.418 0.489   -7.527  1.00 15.14 ? 11   GLU A CA  1 
ATOM   60   C C   . GLU A 1 8   ? 14.585 1.238   -6.219  1.00 14.75 ? 11   GLU A C   1 
ATOM   61   O O   . GLU A 1 8   ? 13.833 2.158   -5.941  1.00 13.74 ? 11   GLU A O   1 
ATOM   62   C CB  . GLU A 1 8   ? 15.387 1.053   -8.567  1.00 17.78 ? 11   GLU A CB  1 
ATOM   63   C CG  . GLU A 1 8   ? 15.252 2.542   -8.843  1.00 21.55 ? 11   GLU A CG  1 
ATOM   64   C CD  . GLU A 1 8   ? 16.203 3.044   -9.929  1.00 30.13 ? 11   GLU A CD  1 
ATOM   65   O OE1 . GLU A 1 8   ? 17.220 2.372   -10.219 1.00 33.09 ? 11   GLU A OE1 1 
ATOM   66   O OE2 . GLU A 1 8   ? 15.927 4.132   -10.487 1.00 39.30 ? 11   GLU A OE2 1 
ATOM   67   N N   . VAL A 1 9   ? 15.581 0.820   -5.438  1.00 13.52 ? 12   VAL A N   1 
ATOM   68   C CA  . VAL A 1 9   ? 16.050 1.549   -4.265  1.00 14.45 ? 12   VAL A CA  1 
ATOM   69   C C   . VAL A 1 9   ? 17.249 2.408   -4.697  1.00 14.98 ? 12   VAL A C   1 
ATOM   70   O O   . VAL A 1 9   ? 18.189 1.905   -5.290  1.00 15.54 ? 12   VAL A O   1 
ATOM   71   C CB  . VAL A 1 9   ? 16.468 0.574   -3.122  1.00 14.14 ? 12   VAL A CB  1 
ATOM   72   C CG1 . VAL A 1 9   ? 17.154 1.317   -1.974  1.00 14.70 ? 12   VAL A CG1 1 
ATOM   73   C CG2 . VAL A 1 9   ? 15.263 -0.195  -2.609  1.00 15.84 ? 12   VAL A CG2 1 
ATOM   74   N N   . VAL A 1 10  ? 17.197 3.705   -4.420  1.00 15.10 ? 13   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 18.279 4.615   -4.793  1.00 16.01 ? 13   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 18.745 5.349   -3.538  1.00 15.69 ? 13   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 17.966 6.075   -2.927  1.00 17.64 ? 13   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 17.807 5.655   -5.872  1.00 17.13 ? 13   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 18.910 6.668   -6.190  1.00 23.67 ? 13   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 17.354 4.955   -7.140  1.00 19.50 ? 13   VAL A CG2 1 
ATOM   81   N N   . PHE A 1 11  ? 19.998 5.147   -3.141  1.00 15.15 ? 14   PHE A N   1 
ATOM   82   C CA  . PHE A 1 11  ? 20.545 5.875   -1.992  1.00 15.41 ? 14   PHE A CA  1 
ATOM   83   C C   . PHE A 1 11  ? 20.915 7.286   -2.436  1.00 17.35 ? 14   PHE A C   1 
ATOM   84   O O   . PHE A 1 11  ? 21.386 7.485   -3.567  1.00 19.14 ? 14   PHE A O   1 
ATOM   85   C CB  . PHE A 1 11  ? 21.745 5.151   -1.374  1.00 15.63 ? 14   PHE A CB  1 
ATOM   86   C CG  . PHE A 1 11  ? 21.410 3.787   -0.828  1.00 15.36 ? 14   PHE A CG  1 
ATOM   87   C CD1 . PHE A 1 11  ? 20.620 3.644   0.322   1.00 14.03 ? 14   PHE A CD1 1 
ATOM   88   C CD2 . PHE A 1 11  ? 21.861 2.647   -1.473  1.00 17.44 ? 14   PHE A CD2 1 
ATOM   89   C CE1 . PHE A 1 11  ? 20.295 2.368   0.815   1.00 17.03 ? 14   PHE A CE1 1 
ATOM   90   C CE2 . PHE A 1 11  ? 21.536 1.376   -0.997  1.00 15.44 ? 14   PHE A CE2 1 
ATOM   91   C CZ  . PHE A 1 11  ? 20.756 1.233   0.148   1.00 16.73 ? 14   PHE A CZ  1 
ATOM   92   N N   . ASN A 1 12  ? 20.689 8.259   -1.555  1.00 16.86 ? 15   ASN A N   1 
ATOM   93   C CA  . ASN A 1 12  ? 20.919 9.665   -1.897  1.00 18.89 ? 15   ASN A CA  1 
ATOM   94   C C   . ASN A 1 12  ? 22.360 9.938   -2.292  1.00 20.97 ? 15   ASN A C   1 
ATOM   95   O O   . ASN A 1 12  ? 22.628 10.713  -3.219  1.00 22.32 ? 15   ASN A O   1 
ATOM   96   C CB  . ASN A 1 12  ? 20.483 10.563  -0.742  1.00 19.39 ? 15   ASN A CB  1 
ATOM   97   C CG  . ASN A 1 12  ? 18.974 10.595  -0.571  1.00 20.87 ? 15   ASN A CG  1 
ATOM   98   O OD1 . ASN A 1 12  ? 18.230 10.178  -1.458  1.00 24.30 ? 15   ASN A OD1 1 
ATOM   99   N ND2 . ASN A 1 12  ? 18.518 11.115  0.558   1.00 22.68 ? 15   ASN A ND2 1 
ATOM   100  N N   . ASP A 1 13  ? 23.281 9.298   -1.573  1.00 20.29 ? 16   ASP A N   1 
ATOM   101  C CA  . ASP A 1 13  ? 24.679 9.239   -1.979  1.00 21.87 ? 16   ASP A CA  1 
ATOM   102  C C   . ASP A 1 13  ? 25.011 7.787   -2.285  1.00 21.78 ? 16   ASP A C   1 
ATOM   103  O O   . ASP A 1 13  ? 25.268 7.003   -1.368  1.00 20.90 ? 16   ASP A O   1 
ATOM   104  C CB  . ASP A 1 13  ? 25.604 9.780   -0.888  1.00 21.90 ? 16   ASP A CB  1 
ATOM   105  C CG  . ASP A 1 13  ? 27.059 9.855   -1.339  1.00 25.94 ? 16   ASP A CG  1 
ATOM   106  O OD1 . ASP A 1 13  ? 27.396 9.317   -2.422  1.00 27.05 ? 16   ASP A OD1 1 
ATOM   107  O OD2 . ASP A 1 13  ? 27.870 10.454  -0.599  1.00 28.91 ? 16   ASP A OD2 1 
ATOM   108  N N   . PRO A 1 14  ? 24.994 7.423   -3.576  1.00 22.88 ? 17   PRO A N   1 
ATOM   109  C CA  . PRO A 1 14  ? 25.234 6.046   -4.003  1.00 24.02 ? 17   PRO A CA  1 
ATOM   110  C C   . PRO A 1 14  ? 26.630 5.531   -3.661  1.00 22.75 ? 17   PRO A C   1 
ATOM   111  O O   . PRO A 1 14  ? 26.843 4.320   -3.631  1.00 23.57 ? 17   PRO A O   1 
ATOM   112  C CB  . PRO A 1 14  ? 25.038 6.105   -5.523  1.00 24.92 ? 17   PRO A CB  1 
ATOM   113  C CG  . PRO A 1 14  ? 25.210 7.521   -5.877  1.00 27.39 ? 17   PRO A CG  1 
ATOM   114  C CD  . PRO A 1 14  ? 24.699 8.303   -4.722  1.00 25.88 ? 17   PRO A CD  1 
ATOM   115  N N   . GLU A 1 15  ? 27.562 6.430   -3.372  1.00 21.14 ? 18   GLU A N   1 
ATOM   116  C CA  . GLU A 1 15  ? 28.923 6.016   -3.035  1.00 19.85 ? 18   GLU A CA  1 
ATOM   117  C C   . GLU A 1 15  ? 29.178 5.930   -1.529  1.00 18.27 ? 18   GLU A C   1 
ATOM   118  O O   . GLU A 1 15  ? 30.242 5.486   -1.104  1.00 18.46 ? 18   GLU A O   1 
ATOM   119  C CB  . GLU A 1 15  ? 29.964 6.934   -3.702  1.00 21.11 ? 18   GLU A CB  1 
ATOM   120  C CG  . GLU A 1 15  ? 29.778 7.168   -5.223  1.00 27.34 ? 18   GLU A CG  1 
ATOM   121  C CD  . GLU A 1 15  ? 29.338 5.926   -5.993  1.00 34.89 ? 18   GLU A CD  1 
ATOM   122  O OE1 . GLU A 1 15  ? 28.459 6.062   -6.870  1.00 36.47 ? 18   GLU A OE1 1 
ATOM   123  O OE2 . GLU A 1 15  ? 29.855 4.821   -5.719  1.00 39.98 ? 18   GLU A OE2 1 
ATOM   124  N N   . LYS A 1 16  ? 28.214 6.359   -0.716  1.00 17.05 ? 19   LYS A N   1 
ATOM   125  C CA  . LYS A 1 16  ? 28.458 6.397   0.725   1.00 15.43 ? 19   LYS A CA  1 
ATOM   126  C C   . LYS A 1 16  ? 28.567 4.992   1.320   1.00 15.16 ? 19   LYS A C   1 
ATOM   127  O O   . LYS A 1 16  ? 27.782 4.099   0.975   1.00 17.57 ? 19   LYS A O   1 
ATOM   128  C CB  . LYS A 1 16  ? 27.375 7.192   1.448   1.00 16.61 ? 19   LYS A CB  1 
ATOM   129  C CG  . LYS A 1 16  ? 27.651 7.408   2.928   1.00 18.66 ? 19   LYS A CG  1 
ATOM   130  C CD  . LYS A 1 16  ? 26.716 8.469   3.476   1.00 25.64 ? 19   LYS A CD  1 
ATOM   131  C CE  . LYS A 1 16  ? 26.783 8.547   4.987   1.00 31.48 ? 19   LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 16  ? 27.995 9.272   5.443   1.00 36.83 ? 19   LYS A NZ  1 
ATOM   133  N N   . VAL A 1 17  ? 29.571 4.818   2.179   1.00 14.82 ? 20   VAL A N   1 
ATOM   134  C CA  . VAL A 1 17  ? 29.740 3.623   3.005   1.00 15.67 ? 20   VAL A CA  1 
ATOM   135  C C   . VAL A 1 17  ? 29.453 4.077   4.444   1.00 16.95 ? 20   VAL A C   1 
ATOM   136  O O   . VAL A 1 17  ? 30.007 5.081   4.904   1.00 18.76 ? 20   VAL A O   1 
ATOM   137  C CB  . VAL A 1 17  ? 31.183 3.075   2.887   1.00 16.55 ? 20   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 17  ? 31.391 1.885   3.786   1.00 16.32 ? 20   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 17  ? 31.483 2.698   1.450   1.00 21.13 ? 20   VAL A CG2 1 
ATOM   140  N N   . TYR A 1 18  ? 28.594 3.341   5.142   1.00 15.63 ? 21   TYR A N   1 
ATOM   141  C CA  . TYR A 1 18  ? 27.983 3.853   6.384   1.00 16.55 ? 21   TYR A CA  1 
ATOM   142  C C   . TYR A 1 18  ? 28.655 3.316   7.638   1.00 17.24 ? 21   TYR A C   1 
ATOM   143  O O   . TYR A 1 18  ? 29.032 2.158   7.689   1.00 18.73 ? 21   TYR A O   1 
ATOM   144  C CB  . TYR A 1 18  ? 26.481 3.516   6.411   1.00 16.74 ? 21   TYR A CB  1 
ATOM   145  C CG  . TYR A 1 18  ? 25.753 4.019   5.188   1.00 16.82 ? 21   TYR A CG  1 
ATOM   146  C CD1 . TYR A 1 18  ? 25.669 3.235   4.031   1.00 15.29 ? 21   TYR A CD1 1 
ATOM   147  C CD2 . TYR A 1 18  ? 25.180 5.296   5.166   1.00 16.77 ? 21   TYR A CD2 1 
ATOM   148  C CE1 . TYR A 1 18  ? 25.009 3.698   2.884   1.00 15.54 ? 21   TYR A CE1 1 
ATOM   149  C CE2 . TYR A 1 18  ? 24.529 5.770   4.027   1.00 16.70 ? 21   TYR A CE2 1 
ATOM   150  C CZ  . TYR A 1 18  ? 24.452 4.971   2.894   1.00 17.01 ? 21   TYR A CZ  1 
ATOM   151  O OH  . TYR A 1 18  ? 23.810 5.443   1.782   1.00 18.34 ? 21   TYR A OH  1 
ATOM   152  N N   . GLY A 1 19  ? 28.780 4.169   8.651   1.00 18.17 ? 22   GLY A N   1 
ATOM   153  C CA  . GLY A 1 19  ? 29.347 3.783   9.934   1.00 18.63 ? 22   GLY A CA  1 
ATOM   154  C C   . GLY A 1 19  ? 28.332 3.851   11.058  1.00 18.97 ? 22   GLY A C   1 
ATOM   155  O O   . GLY A 1 19  ? 27.162 4.200   10.843  1.00 18.50 ? 22   GLY A O   1 
ATOM   156  N N   . SER A 1 20  ? 28.786 3.515   12.259  1.00 19.56 ? 23   SER A N   1 
ATOM   157  C CA  . SER A 1 20  ? 27.923 3.492   13.430  1.00 20.71 ? 23   SER A CA  1 
ATOM   158  C C   . SER A 1 20  ? 27.166 4.797   13.610  1.00 20.80 ? 23   SER A C   1 
ATOM   159  O O   . SER A 1 20  ? 27.746 5.883   13.514  1.00 20.33 ? 23   SER A O   1 
ATOM   160  C CB  . SER A 1 20  ? 28.740 3.183   14.691  1.00 20.84 ? 23   SER A CB  1 
ATOM   161  O OG  . SER A 1 20  ? 29.391 1.932   14.568  1.00 25.56 ? 23   SER A OG  1 
ATOM   162  N N   . GLY A 1 21  ? 25.865 4.669   13.855  1.00 20.34 ? 24   GLY A N   1 
ATOM   163  C CA  . GLY A 1 21  ? 25.008 5.798   14.192  1.00 21.49 ? 24   GLY A CA  1 
ATOM   164  C C   . GLY A 1 21  ? 24.622 6.688   13.034  1.00 22.79 ? 24   GLY A C   1 
ATOM   165  O O   . GLY A 1 21  ? 23.904 7.673   13.229  1.00 24.17 ? 24   GLY A O   1 
ATOM   166  N N   . GLU A 1 22  ? 25.086 6.346   11.833  1.00 20.69 ? 25   GLU A N   1 
ATOM   167  C CA  . GLU A 1 22  ? 24.860 7.191   10.667  1.00 19.39 ? 25   GLU A CA  1 
ATOM   168  C C   . GLU A 1 22  ? 23.513 6.922   10.018  1.00 19.25 ? 25   GLU A C   1 
ATOM   169  O O   . GLU A 1 22  ? 22.993 5.806   10.072  1.00 20.29 ? 25   GLU A O   1 
ATOM   170  C CB  . GLU A 1 22  ? 26.003 7.048   9.658   1.00 19.75 ? 25   GLU A CB  1 
ATOM   171  C CG  . GLU A 1 22  ? 27.318 7.601   10.181  1.00 22.49 ? 25   GLU A CG  1 
ATOM   172  C CD  . GLU A 1 22  ? 28.452 7.561   9.168   1.00 25.38 ? 25   GLU A CD  1 
ATOM   173  O OE1 . GLU A 1 22  ? 28.364 6.817   8.175   1.00 27.73 ? 25   GLU A OE1 1 
ATOM   174  O OE2 . GLU A 1 22  ? 29.450 8.285   9.384   1.00 38.20 ? 25   GLU A OE2 1 
ATOM   175  N N   . LYS A 1 23  ? 22.951 7.970   9.422   1.00 20.46 ? 26   LYS A N   1 
ATOM   176  C CA  . LYS A 1 23  ? 21.688 7.886   8.694   1.00 20.50 ? 26   LYS A CA  1 
ATOM   177  C C   . LYS A 1 23  ? 21.889 7.315   7.291   1.00 19.81 ? 26   LYS A C   1 
ATOM   178  O O   . LYS A 1 23  ? 22.774 7.748   6.554   1.00 19.96 ? 26   LYS A O   1 
ATOM   179  C CB  . LYS A 1 23  ? 21.022 9.262   8.597   1.00 22.73 ? 26   LYS A CB  1 
ATOM   180  C CG  . LYS A 1 23  ? 19.572 9.211   8.116   1.00 25.36 ? 26   LYS A CG  1 
ATOM   181  C CD  . LYS A 1 23  ? 18.906 10.590  8.145   1.00 31.75 ? 26   LYS A CD  1 
ATOM   182  C CE  . LYS A 1 23  ? 19.462 11.514  7.070   1.00 39.38 ? 26   LYS A CE  1 
ATOM   183  N NZ  . LYS A 1 23  ? 18.856 12.876  7.140   1.00 45.68 ? 26   LYS A NZ  1 
ATOM   184  N N   . VAL A 1 24  ? 21.062 6.334   6.945   1.00 17.26 ? 27   VAL A N   1 
ATOM   185  C CA  . VAL A 1 24  ? 21.003 5.806   5.578   1.00 16.15 ? 27   VAL A CA  1 
ATOM   186  C C   . VAL A 1 24  ? 19.741 6.400   4.998   1.00 18.14 ? 27   VAL A C   1 
ATOM   187  O O   . VAL A 1 24  ? 18.655 6.146   5.518   1.00 18.55 ? 27   VAL A O   1 
ATOM   188  C CB  . VAL A 1 24  ? 20.875 4.277   5.558   1.00 15.51 ? 27   VAL A CB  1 
ATOM   189  C CG1 . VAL A 1 24  ? 20.752 3.784   4.122   1.00 14.92 ? 27   VAL A CG1 1 
ATOM   190  C CG2 . VAL A 1 24  ? 22.054 3.618   6.280   1.00 15.97 ? 27   VAL A CG2 1 
ATOM   191  N N   . ALA A 1 25  ? 19.895 7.242   3.971   1.00 17.60 ? 28   ALA A N   1 
ATOM   192  C CA  . ALA A 1 25  ? 18.772 7.950   3.366   1.00 18.03 ? 28   ALA A CA  1 
ATOM   193  C C   . ALA A 1 25  ? 18.701 7.665   1.878   1.00 16.11 ? 28   ALA A C   1 
ATOM   194  O O   . ALA A 1 25  ? 19.723 7.548   1.202   1.00 16.68 ? 28   ALA A O   1 
ATOM   195  C CB  . ALA A 1 25  ? 18.868 9.457   3.608   1.00 20.96 ? 28   ALA A CB  1 
ATOM   196  N N   . GLY A 1 26  ? 17.484 7.576   1.366   1.00 14.36 ? 29   GLY A N   1 
ATOM   197  C CA  . GLY A 1 26  ? 17.305 7.280   -0.039  1.00 13.80 ? 29   GLY A CA  1 
ATOM   198  C C   . GLY A 1 26  ? 15.873 7.430   -0.465  1.00 14.37 ? 29   GLY A C   1 
ATOM   199  O O   . GLY A 1 26  ? 15.046 7.995   0.253   1.00 15.17 ? 29   GLY A O   1 
ATOM   200  N N   . ARG A 1 27  ? 15.592 6.914   -1.657  1.00 13.36 ? 30   ARG A N   1 
ATOM   201  C CA  . ARG A 1 27  ? 14.239 6.881   -2.195  1.00 12.14 ? 30   ARG A CA  1 
ATOM   202  C C   . ARG A 1 27  ? 13.958 5.537   -2.841  1.00 12.39 ? 30   ARG A C   1 
ATOM   203  O O   . ARG A 1 27  ? 14.861 4.919   -3.435  1.00 13.49 ? 30   ARG A O   1 
ATOM   204  C CB  . ARG A 1 27  ? 14.044 7.987   -3.234  1.00 14.21 ? 30   ARG A CB  1 
ATOM   205  C CG  . ARG A 1 27  ? 14.092 9.402   -2.688  1.00 17.51 ? 30   ARG A CG  1 
ATOM   206  C CD  . ARG A 1 27  ? 14.314 10.388  -3.820  1.00 24.84 ? 30   ARG A CD  1 
ATOM   207  N NE  . ARG A 1 27  ? 15.592 10.172  -4.503  1.00 22.60 ? 30   ARG A NE  1 
ATOM   208  C CZ  . ARG A 1 27  ? 15.935 10.748  -5.650  1.00 30.94 ? 30   ARG A CZ  1 
ATOM   209  N NH1 . ARG A 1 27  ? 15.096 11.584  -6.256  1.00 29.63 ? 30   ARG A NH1 1 
ATOM   210  N NH2 . ARG A 1 27  ? 17.117 10.492  -6.194  1.00 31.03 ? 30   ARG A NH2 1 
ATOM   211  N N   . VAL A 1 28  ? 12.707 5.086   -2.738  1.00 11.59 ? 31   VAL A N   1 
ATOM   212  C CA  . VAL A 1 28  ? 12.228 3.991   -3.580  1.00 12.02 ? 31   VAL A CA  1 
ATOM   213  C C   . VAL A 1 28  ? 11.518 4.668   -4.757  1.00 12.39 ? 31   VAL A C   1 
ATOM   214  O O   . VAL A 1 28  ? 10.668 5.530   -4.557  1.00 13.55 ? 31   VAL A O   1 
ATOM   215  C CB  . VAL A 1 28  ? 11.262 3.037   -2.827  1.00 11.50 ? 31   VAL A CB  1 
ATOM   216  C CG1 . VAL A 1 28  ? 10.746 1.950   -3.763  1.00 12.61 ? 31   VAL A CG1 1 
ATOM   217  C CG2 . VAL A 1 28  ? 11.945 2.414   -1.598  1.00 13.19 ? 31   VAL A CG2 1 
ATOM   218  N N   . ILE A 1 29  ? 11.891 4.309   -5.980  1.00 11.21 ? 32   ILE A N   1 
ATOM   219  C CA  . ILE A 1 29  ? 11.331 4.971   -7.155  1.00 14.31 ? 32   ILE A CA  1 
ATOM   220  C C   . ILE A 1 29  ? 10.598 3.951   -8.019  1.00 14.68 ? 32   ILE A C   1 
ATOM   221  O O   . ILE A 1 29  ? 11.124 2.870   -8.322  1.00 14.11 ? 32   ILE A O   1 
ATOM   222  C CB  . ILE A 1 29  ? 12.439 5.711   -7.957  1.00 16.08 ? 32   ILE A CB  1 
ATOM   223  C CG1 . ILE A 1 29  ? 13.125 6.750   -7.054  1.00 19.72 ? 32   ILE A CG1 1 
ATOM   224  C CG2 . ILE A 1 29  ? 11.877 6.365   -9.220  1.00 15.53 ? 32   ILE A CG2 1 
ATOM   225  C CD1 . ILE A 1 29  ? 14.373 7.370   -7.629  1.00 21.80 ? 32   ILE A CD1 1 
ATOM   226  N N   . VAL A 1 30  ? 9.372  4.300   -8.382  1.00 13.68 ? 33   VAL A N   1 
ATOM   227  C CA  . VAL A 1 30  ? 8.534  3.483   -9.259  1.00 12.83 ? 33   VAL A CA  1 
ATOM   228  C C   . VAL A 1 30  ? 8.175  4.275   -10.530 1.00 13.85 ? 33   VAL A C   1 
ATOM   229  O O   . VAL A 1 30  ? 7.858  5.472   -10.474 1.00 14.97 ? 33   VAL A O   1 
ATOM   230  C CB  . VAL A 1 30  ? 7.229  3.007   -8.528  1.00 14.16 ? 33   VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 30  ? 6.529  1.919   -9.310  1.00 16.20 ? 33   VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 30  ? 7.524  2.526   -7.103  1.00 14.25 ? 33   VAL A CG2 1 
ATOM   233  N N   . GLU A 1 31  ? 8.259  3.602   -11.674 1.00 13.50 ? 34   GLU A N   1 
ATOM   234  C CA  . GLU A 1 31  ? 7.754  4.125   -12.941 1.00 15.44 ? 34   GLU A CA  1 
ATOM   235  C C   . GLU A 1 31  ? 6.866  3.059   -13.545 1.00 15.07 ? 34   GLU A C   1 
ATOM   236  O O   . GLU A 1 31  ? 7.128  1.867   -13.398 1.00 15.56 ? 34   GLU A O   1 
ATOM   237  C CB  . GLU A 1 31  ? 8.888  4.463   -13.919 1.00 15.98 ? 34   GLU A CB  1 
ATOM   238  C CG  . GLU A 1 31  ? 9.868  5.497   -13.404 1.00 21.82 ? 34   GLU A CG  1 
ATOM   239  C CD  . GLU A 1 31  ? 11.003 5.766   -14.369 1.00 27.54 ? 34   GLU A CD  1 
ATOM   240  O OE1 . GLU A 1 31  ? 11.362 4.866   -15.157 1.00 36.78 ? 34   GLU A OE1 1 
ATOM   241  O OE2 . GLU A 1 31  ? 11.549 6.887   -14.335 1.00 36.57 ? 34   GLU A OE2 1 
ATOM   242  N N   . VAL A 1 32  ? 5.806  3.491   -14.221 1.00 15.29 ? 35   VAL A N   1 
ATOM   243  C CA  . VAL A 1 32  ? 4.871  2.565   -14.849 1.00 15.32 ? 35   VAL A CA  1 
ATOM   244  C C   . VAL A 1 32  ? 4.677  2.850   -16.342 1.00 16.79 ? 35   VAL A C   1 
ATOM   245  O O   . VAL A 1 32  ? 4.874  3.975   -16.795 1.00 18.44 ? 35   VAL A O   1 
ATOM   246  C CB  . VAL A 1 32  ? 3.492  2.586   -14.145 1.00 14.95 ? 35   VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 32  ? 3.653  2.244   -12.681 1.00 16.79 ? 35   VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 32  ? 2.809  3.951   -14.304 1.00 15.26 ? 35   VAL A CG2 1 
ATOM   249  N N   . CYS A 1 33  ? 4.265  1.834   -17.090 1.00 18.97 ? 36   CYS A N   1 
ATOM   250  C CA  . CYS A 1 33  ? 3.977  1.989   -18.524 1.00 20.27 ? 36   CYS A CA  1 
ATOM   251  C C   . CYS A 1 33  ? 2.503  2.214   -18.804 1.00 20.81 ? 36   CYS A C   1 
ATOM   252  O O   . CYS A 1 33  ? 2.127  2.566   -19.919 1.00 22.36 ? 36   CYS A O   1 
ATOM   253  C CB  . CYS A 1 33  ? 4.425  0.761   -19.299 1.00 21.39 ? 36   CYS A CB  1 
ATOM   254  S SG  . CYS A 1 33  ? 6.173  0.604   -19.445 1.00 31.26 ? 36   CYS A SG  1 
ATOM   255  N N   . GLU A 1 34  ? 1.669  1.966   -17.802 1.00 20.88 ? 37   GLU A N   1 
ATOM   256  C CA  . GLU A 1 34  ? 0.240  2.195   -17.912 1.00 21.55 ? 37   GLU A CA  1 
ATOM   257  C C   . GLU A 1 34  ? -0.366 2.430   -16.538 1.00 20.31 ? 37   GLU A C   1 
ATOM   258  O O   . GLU A 1 34  ? 0.238  2.079   -15.504 1.00 20.08 ? 37   GLU A O   1 
ATOM   259  C CB  . GLU A 1 34  ? -0.451 1.023   -18.592 1.00 23.34 ? 37   GLU A CB  1 
ATOM   260  C CG  . GLU A 1 34  ? -0.246 -0.296  -17.888 1.00 24.03 ? 37   GLU A CG  1 
ATOM   261  C CD  . GLU A 1 34  ? -0.582 -1.474  -18.768 1.00 29.01 ? 37   GLU A CD  1 
ATOM   262  O OE1 . GLU A 1 34  ? -0.715 -1.272  -19.989 1.00 29.26 ? 37   GLU A OE1 1 
ATOM   263  O OE2 . GLU A 1 34  ? -0.703 -2.601  -18.243 1.00 37.10 ? 37   GLU A OE2 1 
ATOM   264  N N   . VAL A 1 35  ? -1.553 3.033   -16.534 1.00 19.82 ? 38   VAL A N   1 
ATOM   265  C CA  . VAL A 1 35  ? -2.265 3.346   -15.288 1.00 20.63 ? 38   VAL A CA  1 
ATOM   266  C C   . VAL A 1 35  ? -2.437 2.102   -14.421 1.00 20.70 ? 38   VAL A C   1 
ATOM   267  O O   . VAL A 1 35  ? -2.915 1.067   -14.891 1.00 21.47 ? 38   VAL A O   1 
ATOM   268  C CB  . VAL A 1 35  ? -3.651 3.969   -15.545 1.00 22.32 ? 38   VAL A CB  1 
ATOM   269  C CG1 . VAL A 1 35  ? -4.324 4.324   -14.223 1.00 22.86 ? 38   VAL A CG1 1 
ATOM   270  C CG2 . VAL A 1 35  ? -3.534 5.196   -16.419 1.00 25.81 ? 38   VAL A CG2 1 
ATOM   271  N N   . THR A 1 36  ? -2.030 2.211   -13.157 1.00 18.40 ? 39   THR A N   1 
ATOM   272  C CA  . THR A 1 36  ? -2.146 1.100   -12.216 1.00 20.28 ? 39   THR A CA  1 
ATOM   273  C C   . THR A 1 36  ? -2.348 1.625   -10.795 1.00 20.28 ? 39   THR A C   1 
ATOM   274  O O   . THR A 1 36  ? -1.807 2.672   -10.429 1.00 19.73 ? 39   THR A O   1 
ATOM   275  C CB  . THR A 1 36  ? -0.927 0.127   -12.321 1.00 20.75 ? 39   THR A CB  1 
ATOM   276  O OG1 . THR A 1 36  ? -1.137 -1.020  -11.489 1.00 21.77 ? 39   THR A OG1 1 
ATOM   277  C CG2 . THR A 1 36  ? 0.362  0.811   -11.933 1.00 20.26 ? 39   THR A CG2 1 
ATOM   278  N N   . ARG A 1 37  ? -3.156 0.900   -10.024 1.00 20.84 ? 40   ARG A N   1 
ATOM   279  C CA  . ARG A 1 37  ? -3.516 1.274   -8.659  1.00 21.54 ? 40   ARG A CA  1 
ATOM   280  C C   . ARG A 1 37  ? -2.573 0.593   -7.679  1.00 20.39 ? 40   ARG A C   1 
ATOM   281  O O   . ARG A 1 37  ? -2.427 -0.635  -7.693  1.00 21.55 ? 40   ARG A O   1 
ATOM   282  C CB  . ARG A 1 37  ? -4.959 0.840   -8.396  1.00 23.54 ? 40   ARG A CB  1 
ATOM   283  C CG  . ARG A 1 37  ? -5.602 1.384   -7.145  1.00 29.94 ? 40   ARG A CG  1 
ATOM   284  C CD  . ARG A 1 37  ? -7.116 1.297   -7.328  1.00 37.27 ? 40   ARG A CD  1 
ATOM   285  N NE  . ARG A 1 37  ? -7.859 2.071   -6.339  1.00 45.67 ? 40   ARG A NE  1 
ATOM   286  C CZ  . ARG A 1 37  ? -8.565 1.538   -5.350  1.00 47.84 ? 40   ARG A CZ  1 
ATOM   287  N NH1 . ARG A 1 37  ? -8.630 0.218   -5.204  1.00 48.90 ? 40   ARG A NH1 1 
ATOM   288  N NH2 . ARG A 1 37  ? -9.209 2.327   -4.501  1.00 49.03 ? 40   ARG A NH2 1 
ATOM   289  N N   . VAL A 1 38  ? -1.937 1.398   -6.831  1.00 17.85 ? 41   VAL A N   1 
ATOM   290  C CA  . VAL A 1 38  ? -0.955 0.901   -5.862  1.00 18.60 ? 41   VAL A CA  1 
ATOM   291  C C   . VAL A 1 38  ? -1.470 1.072   -4.430  1.00 18.11 ? 41   VAL A C   1 
ATOM   292  O O   . VAL A 1 38  ? -1.847 2.183   -4.020  1.00 19.82 ? 41   VAL A O   1 
ATOM   293  C CB  . VAL A 1 38  ? 0.416  1.590   -6.042  1.00 17.64 ? 41   VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 38  ? 1.385  1.162   -4.927  1.00 17.64 ? 41   VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 38  ? 0.998  1.236   -7.408  1.00 19.23 ? 41   VAL A CG2 1 
ATOM   296  N N   . LYS A 1 39  ? -1.489 -0.034  -3.685  1.00 17.92 ? 42   LYS A N   1 
ATOM   297  C CA  . LYS A 1 39  ? -1.914 -0.044  -2.279  1.00 20.08 ? 42   LYS A CA  1 
ATOM   298  C C   . LYS A 1 39  ? -0.866 0.539   -1.335  1.00 19.59 ? 42   LYS A C   1 
ATOM   299  O O   . LYS A 1 39  ? -1.191 1.367   -0.470  1.00 20.27 ? 42   LYS A O   1 
ATOM   300  C CB  . LYS A 1 39  ? -2.276 -1.470  -1.859  1.00 20.84 ? 42   LYS A CB  1 
ATOM   301  C CG  . LYS A 1 39  ? -2.638 -1.669  -0.386  1.00 27.16 ? 42   LYS A CG  1 
ATOM   302  C CD  . LYS A 1 39  ? -3.487 -2.923  -0.199  1.00 37.50 ? 42   LYS A CD  1 
ATOM   303  C CE  . LYS A 1 39  ? -2.856 -4.169  -0.827  1.00 35.12 ? 42   LYS A CE  1 
ATOM   304  N NZ  . LYS A 1 39  ? -3.770 -5.353  -0.712  1.00 41.45 ? 42   LYS A NZ  1 
ATOM   305  N N   . ALA A 1 40  ? 0.382  0.095   -1.495  1.00 16.37 ? 43   ALA A N   1 
ATOM   306  C CA  . ALA A 1 40  ? 1.459  0.478   -0.592  1.00 16.89 ? 43   ALA A CA  1 
ATOM   307  C C   . ALA A 1 40  ? 2.819  0.267   -1.231  1.00 15.23 ? 43   ALA A C   1 
ATOM   308  O O   . ALA A 1 40  ? 2.976  -0.582  -2.116  1.00 15.69 ? 43   ALA A O   1 
ATOM   309  C CB  . ALA A 1 40  ? 1.371  -0.320  0.723   1.00 17.19 ? 43   ALA A CB  1 
ATOM   310  N N   . VAL A 1 41  ? 3.783  1.074   -0.796  1.00 14.55 ? 44   VAL A N   1 
ATOM   311  C CA  . VAL A 1 41  ? 5.196  0.780   -1.010  1.00 13.74 ? 44   VAL A CA  1 
ATOM   312  C C   . VAL A 1 41  ? 5.807  0.643   0.385   1.00 15.82 ? 44   VAL A C   1 
ATOM   313  O O   . VAL A 1 41  ? 5.711  1.551   1.216   1.00 16.63 ? 44   VAL A O   1 
ATOM   314  C CB  . VAL A 1 41  ? 5.924  1.860   -1.849  1.00 15.01 ? 44   VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 41  ? 7.426  1.583   -1.885  1.00 14.01 ? 44   VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 41  ? 5.380  1.887   -3.276  1.00 16.11 ? 44   VAL A CG2 1 
ATOM   317  N N   . ARG A 1 42  ? 6.382  -0.522  0.654   1.00 14.09 ? 45   ARG A N   1 
ATOM   318  C CA  . ARG A 1 42  ? 6.952  -0.798  1.967   1.00 17.12 ? 45   ARG A CA  1 
ATOM   319  C C   . ARG A 1 42  ? 8.447  -1.024  1.856   1.00 16.66 ? 45   ARG A C   1 
ATOM   320  O O   . ARG A 1 42  ? 8.946  -1.441  0.794   1.00 15.96 ? 45   ARG A O   1 
ATOM   321  C CB  . ARG A 1 42  ? 6.310  -2.044  2.572   1.00 17.95 ? 45   ARG A CB  1 
ATOM   322  C CG  . ARG A 1 42  ? 4.830  -1.900  2.895   1.00 20.65 ? 45   ARG A CG  1 
ATOM   323  C CD  . ARG A 1 42  ? 4.261  -3.212  3.450   1.00 23.91 ? 45   ARG A CD  1 
ATOM   324  N NE  . ARG A 1 42  ? 4.127  -4.234  2.409   1.00 27.68 ? 45   ARG A NE  1 
ATOM   325  C CZ  . ARG A 1 42  ? 4.865  -5.340  2.313   1.00 31.32 ? 45   ARG A CZ  1 
ATOM   326  N NH1 . ARG A 1 42  ? 5.801  -5.611  3.215   1.00 31.25 ? 45   ARG A NH1 1 
ATOM   327  N NH2 . ARG A 1 42  ? 4.651  -6.188  1.311   1.00 29.35 ? 45   ARG A NH2 1 
ATOM   328  N N   . ILE A 1 43  ? 9.166  -0.757  2.947   1.00 15.77 ? 46   ILE A N   1 
ATOM   329  C CA  . ILE A 1 43  ? 10.564 -1.193  3.023   1.00 16.67 ? 46   ILE A CA  1 
ATOM   330  C C   . ILE A 1 43  ? 10.888 -2.110  4.189   1.00 15.64 ? 46   ILE A C   1 
ATOM   331  O O   . ILE A 1 43  ? 10.218 -2.106  5.239   1.00 15.32 ? 46   ILE A O   1 
ATOM   332  C CB  . ILE A 1 43  ? 11.602 -0.038  2.977   1.00 18.95 ? 46   ILE A CB  1 
ATOM   333  C CG1 . ILE A 1 43  ? 11.422 0.930   4.145   1.00 20.55 ? 46   ILE A CG1 1 
ATOM   334  C CG2 . ILE A 1 43  ? 11.606 0.659   1.595   1.00 20.98 ? 46   ILE A CG2 1 
ATOM   335  C CD1 . ILE A 1 43  ? 12.707 1.674   4.476   1.00 23.82 ? 46   ILE A CD1 1 
ATOM   336  N N   . LEU A 1 44  ? 11.927 -2.906  3.975   1.00 14.03 ? 47   LEU A N   1 
ATOM   337  C CA  . LEU A 1 44  ? 12.535 -3.715  5.027   1.00 14.39 ? 47   LEU A CA  1 
ATOM   338  C C   . LEU A 1 44  ? 14.036 -3.532  4.893   1.00 13.22 ? 47   LEU A C   1 
ATOM   339  O O   . LEU A 1 44  ? 14.611 -3.869  3.856   1.00 14.18 ? 47   LEU A O   1 
ATOM   340  C CB  . LEU A 1 44  ? 12.152 -5.190  4.871   1.00 16.84 ? 47   LEU A CB  1 
ATOM   341  C CG  . LEU A 1 44  ? 12.837 -6.208  5.795   1.00 20.80 ? 47   LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 44  ? 12.486 -5.970  7.271   1.00 20.60 ? 47   LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 44  ? 12.505 -7.642  5.383   1.00 22.84 ? 47   LEU A CD2 1 
ATOM   344  N N   . ALA A 1 45  ? 14.656 -2.956  5.917   1.00 12.50 ? 48   ALA A N   1 
ATOM   345  C CA  . ALA A 1 45  ? 16.104 -2.740  5.919   1.00 13.71 ? 48   ALA A CA  1 
ATOM   346  C C   . ALA A 1 45  ? 16.705 -3.614  6.997   1.00 15.67 ? 48   ALA A C   1 
ATOM   347  O O   . ALA A 1 45  ? 16.264 -3.576  8.141   1.00 17.60 ? 48   ALA A O   1 
ATOM   348  C CB  . ALA A 1 45  ? 16.431 -1.278  6.178   1.00 15.24 ? 48   ALA A CB  1 
ATOM   349  N N   . CYS A 1 46  ? 17.691 -4.424  6.632   1.00 15.97 ? 49   CYS A N   1 
ATOM   350  C CA  . CYS A 1 46  ? 18.227 -5.403  7.563   1.00 15.94 ? 49   CYS A CA  1 
ATOM   351  C C   . CYS A 1 46  ? 19.732 -5.445  7.566   1.00 15.70 ? 49   CYS A C   1 
ATOM   352  O O   . CYS A 1 46  ? 20.371 -5.164  6.552   1.00 15.85 ? 49   CYS A O   1 
ATOM   353  C CB  . CYS A 1 46  ? 17.725 -6.797  7.222   1.00 19.04 ? 49   CYS A CB  1 
ATOM   354  S SG  . CYS A 1 46  ? 15.994 -7.048  7.610   1.00 25.28 ? 49   CYS A SG  1 
ATOM   355  N N   . GLY A 1 47  ? 20.285 -5.781  8.727   1.00 16.80 ? 50   GLY A N   1 
ATOM   356  C CA  . GLY A 1 47  ? 21.690 -6.146  8.831   1.00 15.88 ? 50   GLY A CA  1 
ATOM   357  C C   . GLY A 1 47  ? 21.697 -7.552  9.383   1.00 18.14 ? 50   GLY A C   1 
ATOM   358  O O   . GLY A 1 47  ? 21.348 -7.751  10.548  1.00 19.43 ? 50   GLY A O   1 
ATOM   359  N N   . VAL A 1 48  ? 22.053 -8.519  8.535   1.00 19.29 ? 51   VAL A N   1 
ATOM   360  C CA  . VAL A 1 48  ? 21.939 -9.949  8.857   1.00 21.80 ? 51   VAL A CA  1 
ATOM   361  C C   . VAL A 1 48  ? 23.316 -10.550 9.103   1.00 21.95 ? 51   VAL A C   1 
ATOM   362  O O   . VAL A 1 48  ? 24.227 -10.375 8.308   1.00 21.83 ? 51   VAL A O   1 
ATOM   363  C CB  . VAL A 1 48  ? 21.202 -10.753 7.732   1.00 20.79 ? 51   VAL A CB  1 
ATOM   364  C CG1 . VAL A 1 48  ? 21.109 -12.246 8.083   1.00 29.15 ? 51   VAL A CG1 1 
ATOM   365  C CG2 . VAL A 1 48  ? 19.811 -10.166 7.468   1.00 26.42 ? 51   VAL A CG2 1 
ATOM   366  N N   . ALA A 1 49  ? 23.458 -11.268 10.212  1.00 23.66 ? 52   ALA A N   1 
ATOM   367  C CA  . ALA A 1 49  ? 24.714 -11.946 10.520  1.00 24.66 ? 52   ALA A CA  1 
ATOM   368  C C   . ALA A 1 49  ? 24.896 -13.160 9.622   1.00 25.64 ? 52   ALA A C   1 
ATOM   369  O O   . ALA A 1 49  ? 23.997 -13.992 9.518   1.00 25.92 ? 52   ALA A O   1 
ATOM   370  C CB  . ALA A 1 49  ? 24.745 -12.362 11.976  1.00 26.49 ? 52   ALA A CB  1 
ATOM   371  N N   . LYS A 1 50  ? 26.057 -13.240 8.971   1.00 25.49 ? 53   LYS A N   1 
ATOM   372  C CA  . LYS A 1 50  ? 26.426 -14.384 8.137   1.00 25.85 ? 53   LYS A CA  1 
ATOM   373  C C   . LYS A 1 50  ? 27.105 -15.426 9.015   1.00 25.56 ? 53   LYS A C   1 
ATOM   374  O O   . LYS A 1 50  ? 27.773 -15.070 9.986   1.00 26.10 ? 53   LYS A O   1 
ATOM   375  C CB  . LYS A 1 50  ? 27.401 -13.960 7.037   1.00 25.00 ? 53   LYS A CB  1 
ATOM   376  C CG  . LYS A 1 50  ? 26.905 -12.862 6.099   1.00 28.93 ? 53   LYS A CG  1 
ATOM   377  C CD  . LYS A 1 50  ? 28.036 -12.357 5.205   1.00 31.42 ? 53   LYS A CD  1 
ATOM   378  C CE  . LYS A 1 50  ? 28.367 -13.342 4.088   1.00 35.41 ? 53   LYS A CE  1 
ATOM   379  N NZ  . LYS A 1 50  ? 27.382 -13.277 2.967   1.00 37.83 ? 53   LYS A NZ  1 
ATOM   380  N N   . VAL A 1 51  ? 26.944 -16.703 8.672   1.00 23.02 ? 54   VAL A N   1 
ATOM   381  C CA  . VAL A 1 51  ? 27.588 -17.788 9.400   1.00 22.34 ? 54   VAL A CA  1 
ATOM   382  C C   . VAL A 1 51  ? 28.680 -18.395 8.520   1.00 19.88 ? 54   VAL A C   1 
ATOM   383  O O   . VAL A 1 51  ? 28.421 -18.795 7.382   1.00 21.11 ? 54   VAL A O   1 
ATOM   384  C CB  . VAL A 1 51  ? 26.573 -18.875 9.810   1.00 23.14 ? 54   VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 51  ? 27.267 -20.009 10.557  1.00 25.35 ? 54   VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 51  ? 25.445 -18.269 10.655  1.00 25.01 ? 54   VAL A CG2 1 
ATOM   387  N N   . LEU A 1 52  ? 29.899 -18.455 9.052   1.00 18.54 ? 55   LEU A N   1 
ATOM   388  C CA  . LEU A 1 52  ? 31.041 -18.981 8.315   1.00 18.48 ? 55   LEU A CA  1 
ATOM   389  C C   . LEU A 1 52  ? 31.867 -19.904 9.200   1.00 19.35 ? 55   LEU A C   1 
ATOM   390  O O   . LEU A 1 52  ? 32.351 -19.500 10.263  1.00 20.37 ? 55   LEU A O   1 
ATOM   391  C CB  . LEU A 1 52  ? 31.920 -17.846 7.761   1.00 18.51 ? 55   LEU A CB  1 
ATOM   392  C CG  . LEU A 1 52  ? 33.195 -18.261 7.001   1.00 21.44 ? 55   LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 52  ? 32.888 -18.969 5.675   1.00 21.75 ? 55   LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 52  ? 34.125 -17.073 6.777   1.00 24.76 ? 55   LEU A CD2 1 
ATOM   395  N N   . TRP A 1 53  ? 32.018 -21.146 8.752   1.00 19.09 ? 56   TRP A N   1 
ATOM   396  C CA  . TRP A 1 53  ? 32.852 -22.109 9.447   1.00 19.36 ? 56   TRP A CA  1 
ATOM   397  C C   . TRP A 1 53  ? 34.173 -22.248 8.709   1.00 21.49 ? 56   TRP A C   1 
ATOM   398  O O   . TRP A 1 53  ? 34.187 -22.589 7.531   1.00 21.01 ? 56   TRP A O   1 
ATOM   399  C CB  . TRP A 1 53  ? 32.171 -23.469 9.497   1.00 17.43 ? 56   TRP A CB  1 
ATOM   400  C CG  . TRP A 1 53  ? 30.845 -23.490 10.167  1.00 17.29 ? 56   TRP A CG  1 
ATOM   401  C CD1 . TRP A 1 53  ? 29.650 -23.078 9.647   1.00 16.71 ? 56   TRP A CD1 1 
ATOM   402  C CD2 . TRP A 1 53  ? 30.560 -24.013 11.470  1.00 19.10 ? 56   TRP A CD2 1 
ATOM   403  N NE1 . TRP A 1 53  ? 28.636 -23.308 10.555  1.00 16.80 ? 56   TRP A NE1 1 
ATOM   404  C CE2 . TRP A 1 53  ? 29.172 -23.863 11.688  1.00 19.13 ? 56   TRP A CE2 1 
ATOM   405  C CE3 . TRP A 1 53  ? 31.351 -24.576 12.484  1.00 18.21 ? 56   TRP A CE3 1 
ATOM   406  C CZ2 . TRP A 1 53  ? 28.551 -24.275 12.873  1.00 17.63 ? 56   TRP A CZ2 1 
ATOM   407  C CZ3 . TRP A 1 53  ? 30.737 -24.980 13.666  1.00 16.23 ? 56   TRP A CZ3 1 
ATOM   408  C CH2 . TRP A 1 53  ? 29.347 -24.826 13.849  1.00 19.04 ? 56   TRP A CH2 1 
ATOM   409  N N   . MET A 1 54  ? 35.275 -21.964 9.399   1.00 24.92 ? 57   MET A N   1 
ATOM   410  C CA  . MET A 1 54  ? 36.618 -22.114 8.829   1.00 28.83 ? 57   MET A CA  1 
ATOM   411  C C   . MET A 1 54  ? 37.612 -22.471 9.921   1.00 31.83 ? 57   MET A C   1 
ATOM   412  O O   . MET A 1 54  ? 37.387 -22.161 11.090  1.00 31.33 ? 57   MET A O   1 
ATOM   413  C CB  . MET A 1 54  ? 37.075 -20.834 8.122   1.00 29.26 ? 57   MET A CB  1 
ATOM   414  C CG  . MET A 1 54  ? 36.524 -20.651 6.720   1.00 26.41 ? 57   MET A CG  1 
ATOM   415  S SD  . MET A 1 54  ? 37.293 -19.266 5.856   1.00 32.76 ? 57   MET A SD  1 
ATOM   416  C CE  . MET A 1 54  ? 38.858 -19.989 5.372   1.00 32.03 ? 57   MET A CE  1 
ATOM   417  N N   . GLN A 1 55  ? 38.704 -23.127 9.527   1.00 34.26 ? 58   GLN A N   1 
ATOM   418  C CA  . GLN A 1 55  ? 39.762 -23.550 10.461  1.00 37.53 ? 58   GLN A CA  1 
ATOM   419  C C   . GLN A 1 55  ? 39.247 -24.509 11.541  1.00 38.72 ? 58   GLN A C   1 
ATOM   420  O O   . GLN A 1 55  ? 39.809 -24.587 12.640  1.00 39.91 ? 58   GLN A O   1 
ATOM   421  C CB  . GLN A 1 55  ? 40.447 -22.335 11.102  1.00 38.18 ? 58   GLN A CB  1 
ATOM   422  C CG  . GLN A 1 55  ? 41.120 -21.396 10.117  1.00 40.46 ? 58   GLN A CG  1 
ATOM   423  C CD  . GLN A 1 55  ? 41.775 -20.207 10.801  1.00 43.85 ? 58   GLN A CD  1 
ATOM   424  O OE1 . GLN A 1 55  ? 41.704 -20.058 12.024  1.00 48.96 ? 58   GLN A OE1 1 
ATOM   425  N NE2 . GLN A 1 55  ? 42.418 -19.354 10.010  1.00 45.42 ? 58   GLN A NE2 1 
ATOM   426  N N   . GLY A 1 56  ? 38.179 -25.236 11.223  1.00 39.44 ? 59   GLY A N   1 
ATOM   427  C CA  . GLY A 1 56  ? 37.613 -26.223 12.141  1.00 40.38 ? 59   GLY A CA  1 
ATOM   428  C C   . GLY A 1 56  ? 36.680 -25.676 13.205  1.00 40.55 ? 59   GLY A C   1 
ATOM   429  O O   . GLY A 1 56  ? 36.314 -26.400 14.132  1.00 41.74 ? 59   GLY A O   1 
ATOM   430  N N   . SER A 1 57  ? 36.292 -24.406 13.083  1.00 38.81 ? 60   SER A N   1 
ATOM   431  C CA  . SER A 1 57  ? 35.325 -23.804 14.004  1.00 38.17 ? 60   SER A CA  1 
ATOM   432  C C   . SER A 1 57  ? 34.484 -22.709 13.344  1.00 36.44 ? 60   SER A C   1 
ATOM   433  O O   . SER A 1 57  ? 34.775 -22.263 12.230  1.00 33.82 ? 60   SER A O   1 
ATOM   434  C CB  . SER A 1 57  ? 36.028 -23.267 15.262  1.00 39.28 ? 60   SER A CB  1 
ATOM   435  O OG  . SER A 1 57  ? 36.491 -21.939 15.077  1.00 42.67 ? 60   SER A OG  1 
ATOM   436  N N   . GLN A 1 58  ? 33.436 -22.284 14.038  1.00 35.40 ? 61   GLN A N   1 
ATOM   437  C CA  . GLN A 1 58  ? 32.588 -21.214 13.549  1.00 35.71 ? 61   GLN A CA  1 
ATOM   438  C C   . GLN A 1 58  ? 33.263 -19.865 13.789  1.00 35.79 ? 61   GLN A C   1 
ATOM   439  O O   . GLN A 1 58  ? 33.561 -19.505 14.930  1.00 36.83 ? 61   GLN A O   1 
ATOM   440  C CB  . GLN A 1 58  ? 31.236 -21.266 14.245  1.00 36.51 ? 61   GLN A CB  1 
ATOM   441  C CG  . GLN A 1 58  ? 30.135 -20.659 13.432  1.00 40.44 ? 61   GLN A CG  1 
ATOM   442  C CD  . GLN A 1 58  ? 28.968 -20.225 14.277  1.00 48.35 ? 61   GLN A CD  1 
ATOM   443  O OE1 . GLN A 1 58  ? 28.891 -20.523 15.469  1.00 52.99 ? 61   GLN A OE1 1 
ATOM   444  N NE2 . GLN A 1 58  ? 28.044 -19.509 13.660  1.00 53.19 ? 61   GLN A NE2 1 
ATOM   445  N N   . GLN A 1 59  ? 33.499 -19.129 12.710  1.00 34.86 ? 62   GLN A N   1 
ATOM   446  C CA  . GLN A 1 59  ? 34.238 -17.868 12.774  1.00 34.71 ? 62   GLN A CA  1 
ATOM   447  C C   . GLN A 1 59  ? 33.292 -16.674 12.789  1.00 35.62 ? 62   GLN A C   1 
ATOM   448  O O   . GLN A 1 59  ? 33.219 -15.955 13.791  1.00 35.97 ? 62   GLN A O   1 
ATOM   449  C CB  . GLN A 1 59  ? 35.246 -17.776 11.627  1.00 33.60 ? 62   GLN A CB  1 
ATOM   450  C CG  . GLN A 1 59  ? 36.234 -18.940 11.575  1.00 33.97 ? 62   GLN A CG  1 
ATOM   451  C CD  . GLN A 1 59  ? 37.137 -19.030 12.802  1.00 33.64 ? 62   GLN A CD  1 
ATOM   452  O OE1 . GLN A 1 59  ? 37.253 -18.083 13.585  1.00 36.58 ? 62   GLN A OE1 1 
ATOM   453  N NE2 . GLN A 1 59  ? 37.787 -20.176 12.969  1.00 38.09 ? 62   GLN A NE2 1 
ATOM   454  N N   . CYS A 1 60  ? 32.585 -16.457 11.679  1.00 36.04 ? 63   CYS A N   1 
ATOM   455  C CA  . CYS A 1 60  ? 31.386 -15.628 11.704  1.00 36.00 ? 63   CYS A CA  1 
ATOM   456  C C   . CYS A 1 60  ? 30.370 -16.486 12.437  1.00 36.95 ? 63   CYS A C   1 
ATOM   457  O O   . CYS A 1 60  ? 29.974 -17.566 11.959  1.00 32.30 ? 63   CYS A O   1 
ATOM   458  C CB  . CYS A 1 60  ? 30.900 -15.269 10.296  1.00 33.72 ? 63   CYS A CB  1 
ATOM   459  S SG  . CYS A 1 60  ? 32.056 -14.281 9.312   1.00 36.28 ? 63   CYS A SG  1 
ATOM   460  N N   . LYS A 1 61  ? 29.991 -16.023 13.622  1.00 39.37 ? 64   LYS A N   1 
ATOM   461  C CA  . LYS A 1 61  ? 29.180 -16.817 14.530  1.00 42.44 ? 64   LYS A CA  1 
ATOM   462  C C   . LYS A 1 61  ? 27.687 -16.650 14.280  1.00 43.45 ? 64   LYS A C   1 
ATOM   463  O O   . LYS A 1 61  ? 26.870 -17.370 14.857  1.00 45.88 ? 64   LYS A O   1 
ATOM   464  C CB  . LYS A 1 61  ? 29.545 -16.520 15.985  1.00 43.65 ? 64   LYS A CB  1 
ATOM   465  C CG  . LYS A 1 61  ? 30.862 -17.152 16.405  1.00 44.11 ? 64   LYS A CG  1 
ATOM   466  C CD  . LYS A 1 61  ? 31.253 -16.754 17.814  1.00 49.60 ? 64   LYS A CD  1 
ATOM   467  C CE  . LYS A 1 61  ? 32.618 -17.323 18.182  1.00 50.94 ? 64   LYS A CE  1 
ATOM   468  N NZ  . LYS A 1 61  ? 33.680 -16.893 17.226  1.00 49.23 ? 64   LYS A NZ  1 
ATOM   469  N N   . GLN A 1 62  ? 27.341 -15.717 13.398  1.00 43.45 ? 65   GLN A N   1 
ATOM   470  C CA  . GLN A 1 62  ? 25.954 -15.457 13.046  1.00 42.78 ? 65   GLN A CA  1 
ATOM   471  C C   . GLN A 1 62  ? 25.154 -14.981 14.239  1.00 43.41 ? 65   GLN A C   1 
ATOM   472  O O   . GLN A 1 62  ? 25.566 -14.071 14.966  1.00 44.96 ? 65   GLN A O   1 
ATOM   473  N N   . THR A 1 63  ? 24.015 -15.624 14.452  1.00 42.92 ? 66   THR A N   1 
ATOM   474  C CA  . THR A 1 63  ? 23.102 -15.209 15.489  1.00 41.54 ? 66   THR A CA  1 
ATOM   475  C C   . THR A 1 63  ? 22.163 -14.150 14.956  1.00 39.51 ? 66   THR A C   1 
ATOM   476  O O   . THR A 1 63  ? 21.705 -14.227 13.815  1.00 40.36 ? 66   THR A O   1 
ATOM   477  N N   . SER A 1 64  ? 21.900 -13.149 15.787  1.00 37.41 ? 67   SER A N   1 
ATOM   478  C CA  . SER A 1 64  ? 20.776 -12.252 15.574  1.00 34.09 ? 67   SER A CA  1 
ATOM   479  C C   . SER A 1 64  ? 21.112 -11.084 14.665  1.00 30.63 ? 67   SER A C   1 
ATOM   480  O O   . SER A 1 64  ? 22.283 -10.786 14.424  1.00 31.41 ? 67   SER A O   1 
ATOM   481  C CB  . SER A 1 64  ? 20.242 -11.744 16.916  1.00 35.01 ? 67   SER A CB  1 
ATOM   482  O OG  . SER A 1 64  ? 19.696 -12.808 17.672  1.00 39.48 ? 67   SER A OG  1 
ATOM   483  N N   A GLU A 1 65  ? 20.061 -10.436 14.169  0.50 29.14 ? 68   GLU A N   1 
ATOM   484  N N   B GLU A 1 65  ? 20.074 -10.427 14.162  0.50 29.24 ? 68   GLU A N   1 
ATOM   485  C CA  A GLU A 1 65  ? 20.176 -9.245  13.337  0.50 26.36 ? 68   GLU A CA  1 
ATOM   486  C CA  B GLU A 1 65  ? 20.244 -9.285  13.275  0.50 26.57 ? 68   GLU A CA  1 
ATOM   487  C C   A GLU A 1 65  ? 20.786 -8.080  14.106  0.50 24.30 ? 68   GLU A C   1 
ATOM   488  C C   B GLU A 1 65  ? 20.656 -8.031  14.037  0.50 24.45 ? 68   GLU A C   1 
ATOM   489  O O   A GLU A 1 65  ? 20.689 -8.009  15.337  0.50 24.85 ? 68   GLU A O   1 
ATOM   490  O O   B GLU A 1 65  ? 20.303 -7.857  15.206  0.50 25.45 ? 68   GLU A O   1 
ATOM   491  C CB  A GLU A 1 65  ? 18.797 -8.826  12.813  0.50 26.79 ? 68   GLU A CB  1 
ATOM   492  C CB  B GLU A 1 65  ? 18.970 -9.043  12.460  0.50 26.83 ? 68   GLU A CB  1 
ATOM   493  C CG  A GLU A 1 65  ? 18.135 -9.816  11.860  0.50 27.80 ? 68   GLU A CG  1 
ATOM   494  C CG  B GLU A 1 65  ? 18.662 -10.177 11.484  0.50 28.00 ? 68   GLU A CG  1 
ATOM   495  C CD  A GLU A 1 65  ? 16.635 -9.605  11.762  0.50 27.50 ? 68   GLU A CD  1 
ATOM   496  C CD  B GLU A 1 65  ? 17.345 -10.010 10.755  0.50 28.16 ? 68   GLU A CD  1 
ATOM   497  O OE1 A GLU A 1 65  ? 15.965 -9.563  12.816  0.50 30.52 ? 68   GLU A OE1 1 
ATOM   498  O OE1 B GLU A 1 65  ? 16.811 -8.878  10.704  0.50 31.11 ? 68   GLU A OE1 1 
ATOM   499  O OE2 A GLU A 1 65  ? 16.125 -9.485  10.630  0.50 29.18 ? 68   GLU A OE2 1 
ATOM   500  O OE2 B GLU A 1 65  ? 16.845 -11.023 10.221  0.50 27.72 ? 68   GLU A OE2 1 
ATOM   501  N N   . TYR A 1 66  ? 21.426 -7.179  13.365  1.00 19.98 ? 69   TYR A N   1 
ATOM   502  C CA  . TYR A 1 66  ? 21.886 -5.901  13.905  1.00 19.08 ? 69   TYR A CA  1 
ATOM   503  C C   . TYR A 1 66  ? 20.833 -4.830  13.669  1.00 17.26 ? 69   TYR A C   1 
ATOM   504  O O   . TYR A 1 66  ? 20.781 -3.826  14.376  1.00 19.05 ? 69   TYR A O   1 
ATOM   505  C CB  . TYR A 1 66  ? 23.174 -5.471  13.192  1.00 18.87 ? 69   TYR A CB  1 
ATOM   506  C CG  . TYR A 1 66  ? 24.415 -6.143  13.729  1.00 21.57 ? 69   TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 66  ? 24.770 -7.424  13.318  1.00 25.05 ? 69   TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 66  ? 25.223 -5.498  14.659  1.00 22.30 ? 69   TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 66  ? 25.913 -8.053  13.826  1.00 26.72 ? 69   TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 66  ? 26.364 -6.110  15.165  1.00 27.21 ? 69   TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 66  ? 26.701 -7.382  14.750  1.00 26.47 ? 69   TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 66  ? 27.832 -7.973  15.264  1.00 26.89 ? 69   TYR A OH  1 
ATOM   513  N N   . LEU A 1 67  ? 20.017 -5.042  12.642  1.00 15.97 ? 70   LEU A N   1 
ATOM   514  C CA  . LEU A 1 67  ? 19.083 -4.036  12.151  1.00 16.35 ? 70   LEU A CA  1 
ATOM   515  C C   . LEU A 1 67  ? 17.914 -4.754  11.502  1.00 17.21 ? 70   LEU A C   1 
ATOM   516  O O   . LEU A 1 67  ? 18.105 -5.700  10.727  1.00 17.06 ? 70   LEU A O   1 
ATOM   517  C CB  . LEU A 1 67  ? 19.775 -3.119  11.114  1.00 15.03 ? 70   LEU A CB  1 
ATOM   518  C CG  . LEU A 1 67  ? 18.914 -2.174  10.247  1.00 13.73 ? 70   LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 67  ? 18.398 -0.978  11.040  1.00 18.76 ? 70   LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 67  ? 19.671 -1.680  9.021   1.00 15.83 ? 70   LEU A CD2 1 
ATOM   521  N N   . ARG A 1 68  ? 16.704 -4.330  11.855  1.00 17.46 ? 71   ARG A N   1 
ATOM   522  C CA  . ARG A 1 68  ? 15.510 -4.752  11.141  1.00 19.08 ? 71   ARG A CA  1 
ATOM   523  C C   . ARG A 1 68  ? 14.463 -3.664  11.250  1.00 19.76 ? 71   ARG A C   1 
ATOM   524  O O   . ARG A 1 68  ? 13.762 -3.553  12.260  1.00 21.63 ? 71   ARG A O   1 
ATOM   525  C CB  . ARG A 1 68  ? 14.963 -6.080  11.669  1.00 19.32 ? 71   ARG A CB  1 
ATOM   526  C CG  . ARG A 1 68  ? 13.768 -6.582  10.877  1.00 21.01 ? 71   ARG A CG  1 
ATOM   527  C CD  . ARG A 1 68  ? 13.191 -7.858  11.454  1.00 25.89 ? 71   ARG A CD  1 
ATOM   528  N NE  . ARG A 1 68  ? 12.212 -8.444  10.540  1.00 33.65 ? 71   ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 68  ? 12.497 -9.318  9.576   1.00 36.44 ? 71   ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 68  ? 13.747 -9.727  9.373   1.00 36.36 ? 71   ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 68  ? 11.523 -9.782  8.800   1.00 35.64 ? 71   ARG A NH2 1 
ATOM   532  N N   . TYR A 1 69  ? 14.379 -2.860  10.197  1.00 19.18 ? 72   TYR A N   1 
ATOM   533  C CA  . TYR A 1 69  ? 13.509 -1.705  10.164  1.00 18.22 ? 72   TYR A CA  1 
ATOM   534  C C   . TYR A 1 69  ? 12.476 -1.916  9.072   1.00 18.95 ? 72   TYR A C   1 
ATOM   535  O O   . TYR A 1 69  ? 12.824 -2.111  7.904   1.00 17.30 ? 72   TYR A O   1 
ATOM   536  C CB  . TYR A 1 69  ? 14.337 -0.446  9.911   1.00 18.56 ? 72   TYR A CB  1 
ATOM   537  C CG  . TYR A 1 69  ? 13.532 0.787   9.570   1.00 20.17 ? 72   TYR A CG  1 
ATOM   538  C CD1 . TYR A 1 69  ? 12.674 1.368   10.503  1.00 26.07 ? 72   TYR A CD1 1 
ATOM   539  C CD2 . TYR A 1 69  ? 13.622 1.371   8.310   1.00 19.75 ? 72   TYR A CD2 1 
ATOM   540  C CE1 . TYR A 1 69  ? 11.924 2.505   10.187  1.00 29.88 ? 72   TYR A CE1 1 
ATOM   541  C CE2 . TYR A 1 69  ? 12.878 2.511   7.983   1.00 24.35 ? 72   TYR A CE2 1 
ATOM   542  C CZ  . TYR A 1 69  ? 12.031 3.069   8.923   1.00 25.69 ? 72   TYR A CZ  1 
ATOM   543  O OH  . TYR A 1 69  ? 11.297 4.197   8.606   1.00 27.75 ? 72   TYR A OH  1 
ATOM   544  N N   . GLU A 1 70  ? 11.208 -1.895  9.469   1.00 19.95 ? 73   GLU A N   1 
ATOM   545  C CA  . GLU A 1 70  ? 10.092 -2.071  8.544   1.00 23.18 ? 73   GLU A CA  1 
ATOM   546  C C   . GLU A 1 70  ? 9.229  -0.825  8.575   1.00 22.22 ? 73   GLU A C   1 
ATOM   547  O O   . GLU A 1 70  ? 8.947  -0.286  9.654   1.00 23.60 ? 73   GLU A O   1 
ATOM   548  C CB  . GLU A 1 70  ? 9.235  -3.276  8.952   1.00 26.10 ? 73   GLU A CB  1 
ATOM   549  C CG  . GLU A 1 70  ? 9.760  -4.621  8.513   1.00 32.38 ? 73   GLU A CG  1 
ATOM   550  C CD  . GLU A 1 70  ? 8.913  -5.786  9.013   1.00 36.59 ? 73   GLU A CD  1 
ATOM   551  O OE1 . GLU A 1 70  ? 8.726  -5.909  10.243  1.00 43.24 ? 73   GLU A OE1 1 
ATOM   552  O OE2 . GLU A 1 70  ? 8.453  -6.590  8.171   1.00 44.28 ? 73   GLU A OE2 1 
ATOM   553  N N   . ASP A 1 71  ? 8.796  -0.366  7.403   1.00 21.01 ? 74   ASP A N   1 
ATOM   554  C CA  . ASP A 1 71  ? 7.900  0.782   7.346   1.00 21.37 ? 74   ASP A CA  1 
ATOM   555  C C   . ASP A 1 71  ? 7.119  0.818   6.048   1.00 19.95 ? 74   ASP A C   1 
ATOM   556  O O   . ASP A 1 71  ? 7.528  0.223   5.052   1.00 20.93 ? 74   ASP A O   1 
ATOM   557  C CB  . ASP A 1 71  ? 8.685  2.090   7.477   1.00 21.24 ? 74   ASP A CB  1 
ATOM   558  C CG  . ASP A 1 71  ? 7.920  3.158   8.244   1.00 28.94 ? 74   ASP A CG  1 
ATOM   559  O OD1 . ASP A 1 71  ? 6.684  3.039   8.404   1.00 31.06 ? 74   ASP A OD1 1 
ATOM   560  O OD2 . ASP A 1 71  ? 8.566  4.119   8.708   1.00 34.38 ? 74   ASP A OD2 1 
ATOM   561  N N   . THR A 1 72  ? 5.987  1.514   6.082   1.00 19.23 ? 75   THR A N   1 
ATOM   562  C CA  . THR A 1 72  ? 5.242  1.851   4.885   1.00 18.41 ? 75   THR A CA  1 
ATOM   563  C C   . THR A 1 72  ? 5.585  3.299   4.551   1.00 19.02 ? 75   THR A C   1 
ATOM   564  O O   . THR A 1 72  ? 5.485  4.191   5.402   1.00 21.26 ? 75   THR A O   1 
ATOM   565  C CB  . THR A 1 72  ? 3.728  1.649   5.099   1.00 19.43 ? 75   THR A CB  1 
ATOM   566  O OG1 . THR A 1 72  ? 3.485  0.271   5.423   1.00 23.03 ? 75   THR A OG1 1 
ATOM   567  C CG2 . THR A 1 72  ? 2.942  2.000   3.850   1.00 22.26 ? 75   THR A CG2 1 
ATOM   568  N N   . LEU A 1 73  ? 6.004  3.517   3.311   1.00 17.27 ? 76   LEU A N   1 
ATOM   569  C CA  . LEU A 1 73  ? 6.506  4.823   2.890   1.00 16.90 ? 76   LEU A CA  1 
ATOM   570  C C   . LEU A 1 73  ? 5.425  5.729   2.321   1.00 18.00 ? 76   LEU A C   1 
ATOM   571  O O   . LEU A 1 73  ? 4.400  5.258   1.838   1.00 19.44 ? 76   LEU A O   1 
ATOM   572  C CB  . LEU A 1 73  ? 7.636  4.658   1.865   1.00 17.11 ? 76   LEU A CB  1 
ATOM   573  C CG  . LEU A 1 73  ? 8.823  3.796   2.294   1.00 14.29 ? 76   LEU A CG  1 
ATOM   574  C CD1 . LEU A 1 73  ? 9.882  3.887   1.236   1.00 13.66 ? 76   LEU A CD1 1 
ATOM   575  C CD2 . LEU A 1 73  ? 9.379  4.279   3.608   1.00 16.93 ? 76   LEU A CD2 1 
ATOM   576  N N   . LEU A 1 74  ? 5.695  7.031   2.362   1.00 18.43 ? 77   LEU A N   1 
ATOM   577  C CA  . LEU A 1 74  ? 4.780  8.041   1.858   1.00 18.34 ? 77   LEU A CA  1 
ATOM   578  C C   . LEU A 1 74  ? 5.296  8.596   0.530   1.00 17.89 ? 77   LEU A C   1 
ATOM   579  O O   . LEU A 1 74  ? 6.460  8.984   0.404   1.00 17.89 ? 77   LEU A O   1 
ATOM   580  C CB  . LEU A 1 74  ? 4.627  9.155   2.896   1.00 19.96 ? 77   LEU A CB  1 
ATOM   581  C CG  . LEU A 1 74  ? 3.775  10.387  2.585   1.00 21.93 ? 77   LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 74  ? 2.299  10.029  2.492   1.00 25.02 ? 77   LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 74  ? 4.013  11.426  3.675   1.00 24.59 ? 77   LEU A CD2 1 
ATOM   584  N N   . LEU A 1 75  ? 4.425  8.612   -0.470  1.00 17.90 ? 78   LEU A N   1 
ATOM   585  C CA  . LEU A 1 75  ? 4.738  9.238   -1.742  1.00 18.33 ? 78   LEU A CA  1 
ATOM   586  C C   . LEU A 1 75  ? 5.103  10.709  -1.523  1.00 19.81 ? 78   LEU A C   1 
ATOM   587  O O   . LEU A 1 75  ? 4.448  11.412  -0.745  1.00 19.90 ? 78   LEU A O   1 
ATOM   588  C CB  . LEU A 1 75  ? 3.544  9.100   -2.689  1.00 19.34 ? 78   LEU A CB  1 
ATOM   589  C CG  . LEU A 1 75  ? 3.729  9.627   -4.106  1.00 18.92 ? 78   LEU A CG  1 
ATOM   590  C CD1 . LEU A 1 75  ? 4.865  8.901   -4.836  1.00 23.11 ? 78   LEU A CD1 1 
ATOM   591  C CD2 . LEU A 1 75  ? 2.427  9.535   -4.874  1.00 18.75 ? 78   LEU A CD2 1 
ATOM   592  N N   . GLU A 1 76  ? 6.162  11.160  -2.189  1.00 22.69 ? 79   GLU A N   1 
ATOM   593  C CA  . GLU A 1 76  ? 6.624  12.543  -2.061  1.00 25.27 ? 79   GLU A CA  1 
ATOM   594  C C   . GLU A 1 76  ? 5.483  13.489  -2.369  1.00 26.88 ? 79   GLU A C   1 
ATOM   595  O O   . GLU A 1 76  ? 4.725  13.263  -3.314  1.00 27.90 ? 79   GLU A O   1 
ATOM   596  C CB  . GLU A 1 76  ? 7.800  12.819  -3.004  1.00 26.88 ? 79   GLU A CB  1 
ATOM   597  C CG  . GLU A 1 76  ? 9.170  12.388  -2.467  1.00 28.17 ? 79   GLU A CG  1 
ATOM   598  C CD  . GLU A 1 76  ? 10.317 12.825  -3.378  1.00 30.44 ? 79   GLU A CD  1 
ATOM   599  O OE1 . GLU A 1 76  ? 11.449 12.328  -3.205  1.00 32.69 ? 79   GLU A OE1 1 
ATOM   600  O OE2 . GLU A 1 76  ? 10.085 13.662  -4.278  1.00 31.84 ? 79   GLU A OE2 1 
ATOM   601  N N   . ASP A 1 77  ? 5.348  14.523  -1.544  1.00 28.62 ? 80   ASP A N   1 
ATOM   602  C CA  . ASP A 1 77  ? 4.355  15.581  -1.757  1.00 29.53 ? 80   ASP A CA  1 
ATOM   603  C C   . ASP A 1 77  ? 2.890  15.153  -1.529  1.00 28.85 ? 80   ASP A C   1 
ATOM   604  O O   . ASP A 1 77  ? 1.957  15.856  -1.930  1.00 29.97 ? 80   ASP A O   1 
ATOM   605  C CB  . ASP A 1 77  ? 4.554  16.235  -3.135  1.00 31.58 ? 80   ASP A CB  1 
ATOM   606  C CG  . ASP A 1 77  ? 5.963  16.774  -3.322  1.00 37.49 ? 80   ASP A CG  1 
ATOM   607  O OD1 . ASP A 1 77  ? 6.431  17.520  -2.438  1.00 44.26 ? 80   ASP A OD1 1 
ATOM   608  O OD2 . ASP A 1 77  ? 6.608  16.446  -4.343  1.00 45.72 ? 80   ASP A OD2 1 
ATOM   609  N N   . GLN A 1 78  ? 2.697  14.004  -0.886  1.00 25.62 ? 81   GLN A N   1 
ATOM   610  C CA  . GLN A 1 78  ? 1.384  13.631  -0.335  1.00 27.06 ? 81   GLN A CA  1 
ATOM   611  C C   . GLN A 1 78  ? 1.320  14.051  1.148   1.00 25.07 ? 81   GLN A C   1 
ATOM   612  O O   . GLN A 1 78  ? 2.363  14.180  1.786   1.00 22.08 ? 81   GLN A O   1 
ATOM   613  C CB  . GLN A 1 78  ? 1.156  12.128  -0.485  1.00 27.52 ? 81   GLN A CB  1 
ATOM   614  C CG  . GLN A 1 78  ? 0.987  11.671  -1.927  1.00 31.37 ? 81   GLN A CG  1 
ATOM   615  C CD  . GLN A 1 78  ? -0.366 12.034  -2.507  1.00 40.19 ? 81   GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 78  ? -1.387 11.421  -2.174  1.00 44.77 ? 81   GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 78  ? -0.381 13.029  -3.387  1.00 42.45 ? 81   GLN A NE2 1 
ATOM   618  N N   . PRO A 1 79  ? 0.099  14.268  1.705   1.00 25.75 ? 82   PRO A N   1 
ATOM   619  C CA  . PRO A 1 79  ? -0.007 14.694  3.112   1.00 26.99 ? 82   PRO A CA  1 
ATOM   620  C C   . PRO A 1 79  ? 0.511  13.641  4.099   1.00 28.47 ? 82   PRO A C   1 
ATOM   621  O O   . PRO A 1 79  ? 0.189  12.458  3.970   1.00 26.18 ? 82   PRO A O   1 
ATOM   622  C CB  . PRO A 1 79  ? -1.517 14.902  3.319   1.00 26.55 ? 82   PRO A CB  1 
ATOM   623  C CG  . PRO A 1 79  ? -2.122 14.928  1.957   1.00 28.22 ? 82   PRO A CG  1 
ATOM   624  C CD  . PRO A 1 79  ? -1.226 14.126  1.074   1.00 26.91 ? 82   PRO A CD  1 
ATOM   625  N N   . THR A 1 80  ? 1.312  14.087  5.066   1.00 28.91 ? 83   THR A N   1 
ATOM   626  C CA  . THR A 1 80  ? 1.863  13.227  6.122   1.00 31.70 ? 83   THR A CA  1 
ATOM   627  C C   . THR A 1 80  ? 0.759  12.506  6.895   1.00 32.33 ? 83   THR A C   1 
ATOM   628  O O   . THR A 1 80  ? -0.283 13.092  7.196   1.00 31.77 ? 83   THR A O   1 
ATOM   629  C CB  . THR A 1 80  ? 2.742  14.041  7.104   1.00 32.44 ? 83   THR A CB  1 
ATOM   630  O OG1 . THR A 1 80  ? 3.869  14.572  6.397   1.00 35.36 ? 83   THR A OG1 1 
ATOM   631  C CG2 . THR A 1 80  ? 3.247  13.174  8.253   1.00 34.43 ? 83   THR A CG2 1 
ATOM   632  N N   . GLY A 1 81  ? 1.001  11.229  7.194   1.00 33.10 ? 84   GLY A N   1 
ATOM   633  C CA  . GLY A 1 81  ? 0.073  10.410  7.969   1.00 34.43 ? 84   GLY A CA  1 
ATOM   634  C C   . GLY A 1 81  ? -1.143 9.932   7.199   1.00 35.36 ? 84   GLY A C   1 
ATOM   635  O O   . GLY A 1 81  ? -1.963 9.182   7.731   1.00 36.81 ? 84   GLY A O   1 
ATOM   636  N N   . GLU A 1 82  ? -1.261 10.354  5.942   1.00 35.04 ? 85   GLU A N   1 
ATOM   637  C CA  . GLU A 1 82  ? -2.431 10.016  5.140   1.00 34.60 ? 85   GLU A CA  1 
ATOM   638  C C   . GLU A 1 82  ? -2.334 8.584   4.634   1.00 32.26 ? 85   GLU A C   1 
ATOM   639  O O   . GLU A 1 82  ? -1.240 8.088   4.332   1.00 32.87 ? 85   GLU A O   1 
ATOM   640  C CB  . GLU A 1 82  ? -2.597 10.984  3.966   1.00 35.43 ? 85   GLU A CB  1 
ATOM   641  C CG  . GLU A 1 82  ? -4.032 11.462  3.758   1.00 38.71 ? 85   GLU A CG  1 
ATOM   642  C CD  . GLU A 1 82  ? -4.378 12.733  4.544   1.00 41.24 ? 85   GLU A CD  1 
ATOM   643  O OE1 . GLU A 1 82  ? -5.192 13.538  4.038   1.00 41.42 ? 85   GLU A OE1 1 
ATOM   644  O OE2 . GLU A 1 82  ? -3.848 12.932  5.659   1.00 45.75 ? 85   GLU A OE2 1 
ATOM   645  N N   . ASN A 1 83  ? -3.482 7.918   4.572   1.00 29.04 ? 86   ASN A N   1 
ATOM   646  C CA  . ASN A 1 83  ? -3.552 6.570   4.042   1.00 26.42 ? 86   ASN A CA  1 
ATOM   647  C C   . ASN A 1 83  ? -4.396 6.588   2.782   1.00 24.52 ? 86   ASN A C   1 
ATOM   648  O O   . ASN A 1 83  ? -5.617 6.740   2.817   1.00 24.10 ? 86   ASN A O   1 
ATOM   649  C CB  . ASN A 1 83  ? -4.110 5.601   5.087   1.00 26.28 ? 86   ASN A CB  1 
ATOM   650  C CG  . ASN A 1 83  ? -3.316 5.627   6.378   1.00 28.69 ? 86   ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 83  ? -2.161 5.216   6.416   1.00 33.68 ? 86   ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 83  ? -3.939 6.117   7.443   1.00 32.99 ? 86   ASN A ND2 1 
ATOM   653  N N   . GLU A 1 84  ? -3.725 6.453   1.654   1.00 24.12 ? 87   GLU A N   1 
ATOM   654  C CA  . GLU A 1 84  ? -4.356 6.698   0.389   1.00 25.09 ? 87   GLU A CA  1 
ATOM   655  C C   . GLU A 1 84  ? -3.646 5.844   -0.621  1.00 25.01 ? 87   GLU A C   1 
ATOM   656  O O   . GLU A 1 84  ? -2.415 5.757   -0.625  1.00 26.89 ? 87   GLU A O   1 
ATOM   657  C CB  . GLU A 1 84  ? -4.212 8.180   0.019   1.00 26.01 ? 87   GLU A CB  1 
ATOM   658  C CG  . GLU A 1 84  ? -5.060 8.647   -1.153  1.00 32.43 ? 87   GLU A CG  1 
ATOM   659  C CD  . GLU A 1 84  ? -6.422 9.208   -0.741  1.00 35.21 ? 87   GLU A CD  1 
ATOM   660  O OE1 . GLU A 1 84  ? -7.130 9.727   -1.625  1.00 40.23 ? 87   GLU A OE1 1 
ATOM   661  O OE2 . GLU A 1 84  ? -6.787 9.144   0.453   1.00 38.26 ? 87   GLU A OE2 1 
ATOM   662  N N   . MET A 1 85  ? -4.427 5.196   -1.468  1.00 22.55 ? 88   MET A N   1 
ATOM   663  C CA  . MET A 1 85  ? -3.857 4.465   -2.578  1.00 22.85 ? 88   MET A CA  1 
ATOM   664  C C   . MET A 1 85  ? -3.433 5.446   -3.645  1.00 20.70 ? 88   MET A C   1 
ATOM   665  O O   . MET A 1 85  ? -3.957 6.557   -3.727  1.00 23.43 ? 88   MET A O   1 
ATOM   666  C CB  . MET A 1 85  ? -4.861 3.466   -3.102  1.00 22.70 ? 88   MET A CB  1 
ATOM   667  C CG  . MET A 1 85  ? -5.286 2.537   -1.997  1.00 28.14 ? 88   MET A CG  1 
ATOM   668  S SD  . MET A 1 85  ? -5.718 0.950   -2.619  1.00 32.35 ? 88   MET A SD  1 
ATOM   669  C CE  . MET A 1 85  ? -5.713 0.027   -1.111  1.00 35.94 ? 88   MET A CE  1 
ATOM   670  N N   . VAL A 1 86  ? -2.456 5.036   -4.439  1.00 19.43 ? 89   VAL A N   1 
ATOM   671  C CA  . VAL A 1 86  ? -1.871 5.907   -5.444  1.00 19.75 ? 89   VAL A CA  1 
ATOM   672  C C   . VAL A 1 86  ? -2.235 5.362   -6.813  1.00 18.70 ? 89   VAL A C   1 
ATOM   673  O O   . VAL A 1 86  ? -2.071 4.167   -7.074  1.00 18.58 ? 89   VAL A O   1 
ATOM   674  C CB  . VAL A 1 86  ? -0.328 5.958   -5.251  1.00 19.88 ? 89   VAL A CB  1 
ATOM   675  C CG1 . VAL A 1 86  ? 0.348  6.720   -6.370  1.00 24.75 ? 89   VAL A CG1 1 
ATOM   676  C CG2 . VAL A 1 86  ? 0.007  6.587   -3.890  1.00 20.68 ? 89   VAL A CG2 1 
ATOM   677  N N   . ILE A 1 87  ? -2.751 6.230   -7.680  1.00 19.11 ? 90   ILE A N   1 
ATOM   678  C CA  . ILE A 1 87  ? -2.946 5.867   -9.075  1.00 19.26 ? 90   ILE A CA  1 
ATOM   679  C C   . ILE A 1 87  ? -1.696 6.318   -9.832  1.00 18.33 ? 90   ILE A C   1 
ATOM   680  O O   . ILE A 1 87  ? -1.485 7.518   -10.084 1.00 21.16 ? 90   ILE A O   1 
ATOM   681  C CB  . ILE A 1 87  ? -4.240 6.477   -9.677  1.00 20.34 ? 90   ILE A CB  1 
ATOM   682  C CG1 . ILE A 1 87  ? -5.483 6.076   -8.858  1.00 19.03 ? 90   ILE A CG1 1 
ATOM   683  C CG2 . ILE A 1 87  ? -4.385 6.097   -11.149 1.00 23.08 ? 90   ILE A CG2 1 
ATOM   684  C CD1 . ILE A 1 87  ? -5.760 4.580   -8.810  1.00 25.11 ? 90   ILE A CD1 1 
ATOM   685  N N   . MET A 1 88  ? -0.845 5.359   -10.164 1.00 17.48 ? 91   MET A N   1 
ATOM   686  C CA  . MET A 1 88  ? 0.363  5.694   -10.899 1.00 16.52 ? 91   MET A CA  1 
ATOM   687  C C   . MET A 1 88  ? 0.092  5.742   -12.391 1.00 17.90 ? 91   MET A C   1 
ATOM   688  O O   . MET A 1 88  ? -0.564 4.859   -12.939 1.00 17.85 ? 91   MET A O   1 
ATOM   689  C CB  . MET A 1 88  ? 1.474  4.705   -10.575 1.00 14.54 ? 91   MET A CB  1 
ATOM   690  C CG  . MET A 1 88  ? 1.945  4.767   -9.133  1.00 14.75 ? 91   MET A CG  1 
ATOM   691  S SD  . MET A 1 88  ? 3.383  3.704   -8.920  1.00 17.86 ? 91   MET A SD  1 
ATOM   692  C CE  . MET A 1 88  ? 3.743  4.005   -7.179  1.00 17.65 ? 91   MET A CE  1 
ATOM   693  N N   . ARG A 1 89  ? 0.596  6.792   -13.033 1.00 18.21 ? 92   ARG A N   1 
ATOM   694  C CA  . ARG A 1 89  ? 0.387  7.016   -14.455 1.00 19.80 ? 92   ARG A CA  1 
ATOM   695  C C   . ARG A 1 89  ? 1.732  7.119   -15.172 1.00 19.61 ? 92   ARG A C   1 
ATOM   696  O O   . ARG A 1 89  ? 2.710  7.581   -14.587 1.00 19.14 ? 92   ARG A O   1 
ATOM   697  C CB  . ARG A 1 89  ? -0.439 8.291   -14.655 1.00 21.38 ? 92   ARG A CB  1 
ATOM   698  C CG  . ARG A 1 89  ? -1.821 8.226   -14.005 1.00 24.97 ? 92   ARG A CG  1 
ATOM   699  C CD  . ARG A 1 89  ? -2.622 9.501   -14.200 1.00 30.61 ? 92   ARG A CD  1 
ATOM   700  N NE  . ARG A 1 89  ? -3.995 9.342   -13.705 1.00 36.77 ? 92   ARG A NE  1 
ATOM   701  C CZ  . ARG A 1 89  ? -4.374 9.513   -12.440 1.00 40.74 ? 92   ARG A CZ  1 
ATOM   702  N NH1 . ARG A 1 89  ? -3.493 9.855   -11.504 1.00 42.88 ? 92   ARG A NH1 1 
ATOM   703  N NH2 . ARG A 1 89  ? -5.647 9.335   -12.109 1.00 37.52 ? 92   ARG A NH2 1 
ATOM   704  N N   . PRO A 1 90  ? 1.795  6.681   -16.444 1.00 21.00 ? 93   PRO A N   1 
ATOM   705  C CA  . PRO A 1 90  ? 3.062  6.777   -17.174 1.00 21.01 ? 93   PRO A CA  1 
ATOM   706  C C   . PRO A 1 90  ? 3.555  8.221   -17.314 1.00 22.72 ? 93   PRO A C   1 
ATOM   707  O O   . PRO A 1 90  ? 2.753  9.164   -17.270 1.00 22.99 ? 93   PRO A O   1 
ATOM   708  C CB  . PRO A 1 90  ? 2.739  6.179   -18.557 1.00 22.06 ? 93   PRO A CB  1 
ATOM   709  C CG  . PRO A 1 90  ? 1.261  6.145   -18.644 1.00 23.21 ? 93   PRO A CG  1 
ATOM   710  C CD  . PRO A 1 90  ? 0.724  6.072   -17.250 1.00 20.87 ? 93   PRO A CD  1 
ATOM   711  N N   . GLY A 1 91  ? 4.869  8.384   -17.453 1.00 23.57 ? 94   GLY A N   1 
ATOM   712  C CA  . GLY A 1 91  ? 5.476  9.701   -17.654 1.00 25.16 ? 94   GLY A CA  1 
ATOM   713  C C   . GLY A 1 91  ? 5.834  10.403  -16.360 1.00 27.01 ? 94   GLY A C   1 
ATOM   714  O O   . GLY A 1 91  ? 6.253  11.564  -16.368 1.00 30.27 ? 94   GLY A O   1 
ATOM   715  N N   . ASN A 1 92  ? 5.668  9.695   -15.245 1.00 25.23 ? 95   ASN A N   1 
ATOM   716  C CA  . ASN A 1 92  ? 5.942  10.234  -13.921 1.00 24.92 ? 95   ASN A CA  1 
ATOM   717  C C   . ASN A 1 92  ? 6.877  9.310   -13.148 1.00 23.96 ? 95   ASN A C   1 
ATOM   718  O O   . ASN A 1 92  ? 6.837  8.092   -13.326 1.00 25.63 ? 95   ASN A O   1 
ATOM   719  C CB  . ASN A 1 92  ? 4.636  10.401  -13.136 1.00 25.15 ? 95   ASN A CB  1 
ATOM   720  C CG  . ASN A 1 92  ? 3.600  11.223  -13.883 1.00 27.91 ? 95   ASN A CG  1 
ATOM   721  O OD1 . ASN A 1 92  ? 3.768  12.427  -14.080 1.00 33.36 ? 95   ASN A OD1 1 
ATOM   722  N ND2 . ASN A 1 92  ? 2.515  10.577  -14.291 1.00 28.10 ? 95   ASN A ND2 1 
ATOM   723  N N   . LYS A 1 93  ? 7.722  9.894   -12.302 1.00 22.92 ? 96   LYS A N   1 
ATOM   724  C CA  . LYS A 1 93  ? 8.485  9.128   -11.324 1.00 22.56 ? 96   LYS A CA  1 
ATOM   725  C C   . LYS A 1 93  ? 7.794  9.246   -9.974  1.00 21.48 ? 96   LYS A C   1 
ATOM   726  O O   . LYS A 1 93  ? 7.544  10.354  -9.496  1.00 23.38 ? 96   LYS A O   1 
ATOM   727  C CB  . LYS A 1 93  ? 9.921  9.640   -11.194 1.00 23.95 ? 96   LYS A CB  1 
ATOM   728  C CG  . LYS A 1 93  ? 10.827 9.343   -12.380 1.00 28.94 ? 96   LYS A CG  1 
ATOM   729  C CD  . LYS A 1 93  ? 12.271 9.686   -12.028 1.00 31.52 ? 96   LYS A CD  1 
ATOM   730  C CE  . LYS A 1 93  ? 13.178 9.691   -13.248 1.00 36.99 ? 96   LYS A CE  1 
ATOM   731  N NZ  . LYS A 1 93  ? 12.947 10.865  -14.142 1.00 46.39 ? 96   LYS A NZ  1 
ATOM   732  N N   . TYR A 1 94  ? 7.477  8.105   -9.370  1.00 17.37 ? 97   TYR A N   1 
ATOM   733  C CA  . TYR A 1 94  ? 6.841  8.089   -8.061  1.00 16.68 ? 97   TYR A CA  1 
ATOM   734  C C   . TYR A 1 94  ? 7.901  7.750   -7.040  1.00 17.79 ? 97   TYR A C   1 
ATOM   735  O O   . TYR A 1 94  ? 8.402  6.619   -6.991  1.00 17.90 ? 97   TYR A O   1 
ATOM   736  C CB  . TYR A 1 94  ? 5.676  7.100   -8.030  1.00 17.00 ? 97   TYR A CB  1 
ATOM   737  C CG  . TYR A 1 94  ? 4.578  7.545   -8.955  1.00 16.58 ? 97   TYR A CG  1 
ATOM   738  C CD1 . TYR A 1 94  ? 3.585  8.405   -8.502  1.00 16.91 ? 97   TYR A CD1 1 
ATOM   739  C CD2 . TYR A 1 94  ? 4.564  7.155   -10.299 1.00 14.01 ? 97   TYR A CD2 1 
ATOM   740  C CE1 . TYR A 1 94  ? 2.584  8.845   -9.339  1.00 17.34 ? 97   TYR A CE1 1 
ATOM   741  C CE2 . TYR A 1 94  ? 3.558  7.595   -11.159 1.00 17.18 ? 97   TYR A CE2 1 
ATOM   742  C CZ  . TYR A 1 94  ? 2.580  8.452   -10.674 1.00 14.76 ? 97   TYR A CZ  1 
ATOM   743  O OH  . TYR A 1 94  ? 1.573  8.881   -11.502 1.00 19.87 ? 97   TYR A OH  1 
ATOM   744  N N   . GLU A 1 95  ? 8.250  8.749   -6.237  1.00 17.47 ? 98   GLU A N   1 
ATOM   745  C CA  . GLU A 1 95  ? 9.398  8.648   -5.354  1.00 16.68 ? 98   GLU A CA  1 
ATOM   746  C C   . GLU A 1 95  ? 8.961  8.660   -3.897  1.00 18.05 ? 98   GLU A C   1 
ATOM   747  O O   . GLU A 1 95  ? 8.144  9.493   -3.479  1.00 18.60 ? 98   GLU A O   1 
ATOM   748  C CB  . GLU A 1 95  ? 10.393 9.770   -5.641  1.00 19.50 ? 98   GLU A CB  1 
ATOM   749  C CG  . GLU A 1 95  ? 10.929 9.732   -7.064  1.00 18.52 ? 98   GLU A CG  1 
ATOM   750  C CD  . GLU A 1 95  ? 11.809 10.899  -7.434  1.00 29.43 ? 98   GLU A CD  1 
ATOM   751  O OE1 . GLU A 1 95  ? 11.958 11.833  -6.621  1.00 35.46 ? 98   GLU A OE1 1 
ATOM   752  O OE2 . GLU A 1 95  ? 12.352 10.870  -8.562  1.00 32.61 ? 98   GLU A OE2 1 
ATOM   753  N N   . TYR A 1 96  ? 9.512  7.722   -3.141  1.00 15.38 ? 99   TYR A N   1 
ATOM   754  C CA  . TYR A 1 96  ? 9.173  7.532   -1.737  1.00 15.71 ? 99   TYR A CA  1 
ATOM   755  C C   . TYR A 1 96  ? 10.447 7.638   -0.930  1.00 16.54 ? 99   TYR A C   1 
ATOM   756  O O   . TYR A 1 96  ? 11.303 6.754   -1.023  1.00 16.93 ? 99   TYR A O   1 
ATOM   757  C CB  . TYR A 1 96  ? 8.596  6.129   -1.509  1.00 14.33 ? 99   TYR A CB  1 
ATOM   758  C CG  . TYR A 1 96  ? 7.272  5.852   -2.179  1.00 13.93 ? 99   TYR A CG  1 
ATOM   759  C CD1 . TYR A 1 96  ? 6.089  5.824   -1.433  1.00 14.41 ? 99   TYR A CD1 1 
ATOM   760  C CD2 . TYR A 1 96  ? 7.194  5.618   -3.558  1.00 12.92 ? 99   TYR A CD2 1 
ATOM   761  C CE1 . TYR A 1 96  ? 4.864  5.559   -2.036  1.00 14.93 ? 99   TYR A CE1 1 
ATOM   762  C CE2 . TYR A 1 96  ? 5.967  5.376   -4.173  1.00 14.75 ? 99   TYR A CE2 1 
ATOM   763  C CZ  . TYR A 1 96  ? 4.808  5.343   -3.404  1.00 14.21 ? 99   TYR A CZ  1 
ATOM   764  O OH  . TYR A 1 96  ? 3.597  5.075   -4.011  1.00 17.57 ? 99   TYR A OH  1 
ATOM   765  N N   . LYS A 1 97  ? 10.568 8.701   -0.133  1.00 17.03 ? 100  LYS A N   1 
ATOM   766  C CA  . LYS A 1 97  ? 11.750 8.889   0.707   1.00 15.79 ? 100  LYS A CA  1 
ATOM   767  C C   . LYS A 1 97  ? 11.768 7.918   1.878   1.00 16.90 ? 100  LYS A C   1 
ATOM   768  O O   . LYS A 1 97  ? 10.715 7.572   2.428   1.00 16.97 ? 100  LYS A O   1 
ATOM   769  C CB  . LYS A 1 97  ? 11.828 10.332  1.220   1.00 16.78 ? 100  LYS A CB  1 
ATOM   770  C CG  . LYS A 1 97  ? 12.203 11.307  0.118   1.00 17.29 ? 100  LYS A CG  1 
ATOM   771  C CD  . LYS A 1 97  ? 12.165 12.774  0.542   1.00 22.28 ? 100  LYS A CD  1 
ATOM   772  C CE  . LYS A 1 97  ? 12.569 13.657  -0.622  1.00 31.55 ? 100  LYS A CE  1 
ATOM   773  N NZ  . LYS A 1 97  ? 12.300 15.101  -0.402  1.00 34.50 ? 100  LYS A NZ  1 
ATOM   774  N N   . PHE A 1 98  ? 12.964 7.459   2.238   1.00 16.47 ? 101  PHE A N   1 
ATOM   775  C CA  . PHE A 1 98  ? 13.143 6.686   3.459   1.00 16.24 ? 101  PHE A CA  1 
ATOM   776  C C   . PHE A 1 98  ? 14.414 7.131   4.160   1.00 16.87 ? 101  PHE A C   1 
ATOM   777  O O   . PHE A 1 98  ? 15.322 7.713   3.544   1.00 16.54 ? 101  PHE A O   1 
ATOM   778  C CB  . PHE A 1 98  ? 13.199 5.169   3.186   1.00 15.68 ? 101  PHE A CB  1 
ATOM   779  C CG  . PHE A 1 98  ? 14.400 4.732   2.370   1.00 15.04 ? 101  PHE A CG  1 
ATOM   780  C CD1 . PHE A 1 98  ? 15.647 4.523   2.977   1.00 14.71 ? 101  PHE A CD1 1 
ATOM   781  C CD2 . PHE A 1 98  ? 14.283 4.515   1.001   1.00 14.07 ? 101  PHE A CD2 1 
ATOM   782  C CE1 . PHE A 1 98  ? 16.758 4.122   2.222   1.00 13.56 ? 101  PHE A CE1 1 
ATOM   783  C CE2 . PHE A 1 98  ? 15.391 4.096   0.232   1.00 13.22 ? 101  PHE A CE2 1 
ATOM   784  C CZ  . PHE A 1 98  ? 16.628 3.910   0.844   1.00 13.38 ? 101  PHE A CZ  1 
ATOM   785  N N   . GLY A 1 99  ? 14.494 6.820   5.445   1.00 16.94 ? 102  GLY A N   1 
ATOM   786  C CA  . GLY A 1 99  ? 15.667 7.169   6.223   1.00 17.72 ? 102  GLY A CA  1 
ATOM   787  C C   . GLY A 1 99  ? 15.610 6.437   7.533   1.00 17.63 ? 102  GLY A C   1 
ATOM   788  O O   . GLY A 1 99  ? 14.548 6.331   8.142   1.00 19.80 ? 102  GLY A O   1 
ATOM   789  N N   . PHE A 1 100 ? 16.737 5.877   7.932   1.00 17.58 ? 103  PHE A N   1 
ATOM   790  C CA  . PHE A 1 100 ? 16.890 5.187   9.186   1.00 18.92 ? 103  PHE A CA  1 
ATOM   791  C C   . PHE A 1 100 ? 18.312 5.375   9.685   1.00 19.74 ? 103  PHE A C   1 
ATOM   792  O O   . PHE A 1 100 ? 19.176 5.672   8.938   1.00 20.07 ? 103  PHE A O   1 
ATOM   793  C CB  . PHE A 1 100 ? 16.550 3.707   9.110   1.00 18.68 ? 103  PHE A CB  1 
ATOM   794  C CG  . PHE A 1 100 ? 17.253 2.961   8.042   1.00 19.41 ? 103  PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 100 ? 18.396 2.269   8.311   1.00 17.41 ? 103  PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 100 ? 16.721 2.877   6.794   1.00 16.53 ? 103  PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 100 ? 19.006 1.591   7.332   1.00 19.78 ? 103  PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 100 ? 17.342 2.189   5.839   1.00 20.60 ? 103  PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 100 ? 18.493 1.562   6.107   1.00 18.51 ? 103  PHE A CZ  1 
ATOM   800  N N   . GLU A 1 101 ? 18.505 5.262   10.992  1.00 21.94 ? 104  GLU A N   1 
ATOM   801  C CA  . GLU A 1 101 ? 19.831 5.378   11.538  1.00 23.02 ? 104  GLU A CA  1 
ATOM   802  C C   . GLU A 1 101 ? 20.390 4.036   11.902  1.00 23.12 ? 104  GLU A C   1 
ATOM   803  O O   . GLU A 1 101 ? 19.693 3.182   12.267  1.00 24.06 ? 104  GLU A O   1 
ATOM   804  C CB  . GLU A 1 101 ? 19.882 6.423   12.651  1.00 20.96 ? 104  GLU A CB  1 
ATOM   805  C CG  . GLU A 1 101 ? 19.537 7.760   12.018  1.00 21.09 ? 104  GLU A CG  1 
ATOM   806  C CD  . GLU A 1 101 ? 19.609 9.000   12.860  1.00 21.63 ? 104  GLU A CD  1 
ATOM   807  O OE1 . GLU A 1 101 ? 20.236 9.001   13.937  1.00 21.96 ? 104  GLU A OE1 1 
ATOM   808  O OE2 . GLU A 1 101 ? 19.051 10.013  12.382  1.00 21.75 ? 104  GLU A OE2 1 
ATOM   809  N N   . LEU A 1 102 ? 21.673 3.866   11.682  1.00 19.45 ? 105  LEU A N   1 
ATOM   810  C CA  . LEU A 1 102 ? 22.328 2.614   12.033  1.00 18.82 ? 105  LEU A CA  1 
ATOM   811  C C   . LEU A 1 102 ? 22.636 2.568   13.540  1.00 19.16 ? 105  LEU A C   1 
ATOM   812  O O   . LEU A 1 102 ? 22.722 3.616   14.187  1.00 20.74 ? 105  LEU A O   1 
ATOM   813  C CB  . LEU A 1 102 ? 23.613 2.458   11.215  1.00 16.38 ? 105  LEU A CB  1 
ATOM   814  C CG  . LEU A 1 102 ? 23.368 2.240   9.715   1.00 16.08 ? 105  LEU A CG  1 
ATOM   815  C CD1 . LEU A 1 102 ? 24.686 2.260   8.954   1.00 15.79 ? 105  LEU A CD1 1 
ATOM   816  C CD2 . LEU A 1 102 ? 22.619 0.933   9.471   1.00 19.84 ? 105  LEU A CD2 1 
ATOM   817  N N   . PRO A 1 103 ? 22.785 1.356   14.105  1.00 19.87 ? 106  PRO A N   1 
ATOM   818  C CA  . PRO A 1 103 ? 23.080 1.243   15.543  1.00 21.30 ? 106  PRO A CA  1 
ATOM   819  C C   . PRO A 1 103 ? 24.397 1.911   15.960  1.00 22.74 ? 106  PRO A C   1 
ATOM   820  O O   . PRO A 1 103 ? 25.307 2.084   15.131  1.00 20.42 ? 106  PRO A O   1 
ATOM   821  C CB  . PRO A 1 103 ? 23.124 -0.269  15.797  1.00 23.06 ? 106  PRO A CB  1 
ATOM   822  C CG  . PRO A 1 103 ? 23.117 -0.920  14.482  1.00 21.30 ? 106  PRO A CG  1 
ATOM   823  C CD  . PRO A 1 103 ? 22.639 0.043   13.449  1.00 19.60 ? 106  PRO A CD  1 
ATOM   824  N N   . GLN A 1 104 ? 24.465 2.300   17.233  1.00 24.40 ? 107  GLN A N   1 
ATOM   825  C CA  . GLN A 1 104 ? 25.615 3.004   17.799  1.00 27.94 ? 107  GLN A CA  1 
ATOM   826  C C   . GLN A 1 104 ? 26.845 2.121   17.985  1.00 28.68 ? 107  GLN A C   1 
ATOM   827  O O   . GLN A 1 104 ? 27.979 2.607   17.941  1.00 30.56 ? 107  GLN A O   1 
ATOM   828  C CB  . GLN A 1 104 ? 25.243 3.638   19.144  1.00 30.16 ? 107  GLN A CB  1 
ATOM   829  C CG  . GLN A 1 104 ? 24.231 4.774   19.045  1.00 37.77 ? 107  GLN A CG  1 
ATOM   830  C CD  . GLN A 1 104 ? 24.730 5.947   18.213  1.00 42.00 ? 107  GLN A CD  1 
ATOM   831  O OE1 . GLN A 1 104 ? 25.887 6.358   18.317  1.00 49.29 ? 107  GLN A OE1 1 
ATOM   832  N NE2 . GLN A 1 104 ? 23.851 6.497   17.388  1.00 46.32 ? 107  GLN A NE2 1 
ATOM   833  N N   . GLY A 1 105 ? 26.627 0.831   18.206  1.00 27.31 ? 108  GLY A N   1 
ATOM   834  C CA  . GLY A 1 105 ? 27.746 -0.077  18.457  1.00 29.40 ? 108  GLY A CA  1 
ATOM   835  C C   . GLY A 1 105 ? 28.441 -0.504  17.173  1.00 27.68 ? 108  GLY A C   1 
ATOM   836  O O   . GLY A 1 105 ? 28.165 0.053   16.098  1.00 28.67 ? 108  GLY A O   1 
ATOM   837  N N   . PRO A 1 106 ? 29.353 -1.490  17.270  1.00 26.83 ? 109  PRO A N   1 
ATOM   838  C CA  . PRO A 1 106 ? 29.916 -2.110  16.070  1.00 24.63 ? 109  PRO A CA  1 
ATOM   839  C C   . PRO A 1 106 ? 28.796 -2.575  15.130  1.00 22.07 ? 109  PRO A C   1 
ATOM   840  O O   . PRO A 1 106 ? 27.734 -2.999  15.593  1.00 23.00 ? 109  PRO A O   1 
ATOM   841  C CB  . PRO A 1 106 ? 30.682 -3.313  16.628  1.00 25.25 ? 109  PRO A CB  1 
ATOM   842  C CG  . PRO A 1 106 ? 31.019 -2.935  18.025  1.00 28.27 ? 109  PRO A CG  1 
ATOM   843  C CD  . PRO A 1 106 ? 29.906 -2.067  18.510  1.00 27.15 ? 109  PRO A CD  1 
ATOM   844  N N   . LEU A 1 107 ? 29.024 -2.471  13.825  1.00 19.90 ? 110  LEU A N   1 
ATOM   845  C CA  . LEU A 1 107 ? 28.003 -2.850  12.841  1.00 17.33 ? 110  LEU A CA  1 
ATOM   846  C C   . LEU A 1 107 ? 28.102 -4.309  12.398  1.00 18.09 ? 110  LEU A C   1 
ATOM   847  O O   . LEU A 1 107 ? 27.283 -4.795  11.613  1.00 17.74 ? 110  LEU A O   1 
ATOM   848  C CB  . LEU A 1 107 ? 28.068 -1.923  11.626  1.00 17.44 ? 110  LEU A CB  1 
ATOM   849  C CG  . LEU A 1 107 ? 27.710 -0.474  11.960  1.00 19.52 ? 110  LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 107 ? 27.724 0.370   10.702  1.00 18.51 ? 110  LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 107 ? 26.350 -0.421  12.682  1.00 18.44 ? 110  LEU A CD2 1 
ATOM   852  N N   . GLY A 1 108 ? 29.112 -5.003  12.896  1.00 20.89 ? 111  GLY A N   1 
ATOM   853  C CA  . GLY A 1 108 ? 29.279 -6.408  12.586  1.00 20.77 ? 111  GLY A CA  1 
ATOM   854  C C   . GLY A 1 108 ? 30.677 -6.860  12.923  1.00 22.26 ? 111  GLY A C   1 
ATOM   855  O O   . GLY A 1 108 ? 31.461 -6.113  13.527  1.00 21.40 ? 111  GLY A O   1 
ATOM   856  N N   . THR A 1 109 ? 30.985 -8.090  12.531  1.00 23.58 ? 112  THR A N   1 
ATOM   857  C CA  . THR A 1 109 ? 32.319 -8.630  12.737  1.00 24.53 ? 112  THR A CA  1 
ATOM   858  C C   . THR A 1 109 ? 32.971 -8.966  11.404  1.00 25.02 ? 112  THR A C   1 
ATOM   859  O O   . THR A 1 109 ? 32.314 -8.959  10.353  1.00 23.91 ? 112  THR A O   1 
ATOM   860  C CB  . THR A 1 109 ? 32.315 -9.862  13.685  1.00 24.33 ? 112  THR A CB  1 
ATOM   861  O OG1 . THR A 1 109 ? 31.425 -10.868 13.192  1.00 29.42 ? 112  THR A OG1 1 
ATOM   862  C CG2 . THR A 1 109 ? 31.872 -9.465  15.080  1.00 26.35 ? 112  THR A CG2 1 
ATOM   863  N N   . SER A 1 110 ? 34.274 -9.222  11.453  1.00 26.50 ? 113  SER A N   1 
ATOM   864  C CA  . SER A 1 110 ? 35.017 -9.675  10.287  1.00 27.90 ? 113  SER A CA  1 
ATOM   865  C C   . SER A 1 110 ? 36.030 -10.735 10.704  1.00 28.35 ? 113  SER A C   1 
ATOM   866  O O   . SER A 1 110 ? 36.548 -10.702 11.818  1.00 26.81 ? 113  SER A O   1 
ATOM   867  C CB  . SER A 1 110 ? 35.714 -8.500  9.598   1.00 29.26 ? 113  SER A CB  1 
ATOM   868  O OG  . SER A 1 110 ? 36.674 -7.902  10.455  1.00 33.63 ? 113  SER A OG  1 
ATOM   869  N N   . PHE A 1 111 ? 36.288 -11.682 9.807   1.00 29.97 ? 114  PHE A N   1 
ATOM   870  C CA  . PHE A 1 111 ? 37.235 -12.761 10.065  1.00 30.88 ? 114  PHE A CA  1 
ATOM   871  C C   . PHE A 1 111 ? 38.497 -12.526 9.246   1.00 32.98 ? 114  PHE A C   1 
ATOM   872  O O   . PHE A 1 111 ? 38.433 -12.359 8.024   1.00 33.06 ? 114  PHE A O   1 
ATOM   873  C CB  . PHE A 1 111 ? 36.601 -14.120 9.729   1.00 30.63 ? 114  PHE A CB  1 
ATOM   874  C CG  . PHE A 1 111 ? 37.540 -15.295 9.865   1.00 29.22 ? 114  PHE A CG  1 
ATOM   875  C CD1 . PHE A 1 111 ? 38.157 -15.585 11.077  1.00 28.78 ? 114  PHE A CD1 1 
ATOM   876  C CD2 . PHE A 1 111 ? 37.771 -16.133 8.783   1.00 29.02 ? 114  PHE A CD2 1 
ATOM   877  C CE1 . PHE A 1 111 ? 39.022 -16.673 11.204  1.00 27.15 ? 114  PHE A CE1 1 
ATOM   878  C CE2 . PHE A 1 111 ? 38.629 -17.230 8.897   1.00 26.78 ? 114  PHE A CE2 1 
ATOM   879  C CZ  . PHE A 1 111 ? 39.255 -17.502 10.112  1.00 28.25 ? 114  PHE A CZ  1 
ATOM   880  N N   . LYS A 1 112 ? 39.637 -12.499 9.942   1.00 36.23 ? 115  LYS A N   1 
ATOM   881  C CA  . LYS A 1 112 ? 40.962 -12.243 9.347   1.00 39.29 ? 115  LYS A CA  1 
ATOM   882  C C   . LYS A 1 112 ? 41.001 -11.015 8.430   1.00 40.18 ? 115  LYS A C   1 
ATOM   883  O O   . LYS A 1 112 ? 41.734 -11.002 7.436   1.00 42.29 ? 115  LYS A O   1 
ATOM   884  C CB  . LYS A 1 112 ? 41.500 -13.483 8.615   1.00 39.97 ? 115  LYS A CB  1 
ATOM   885  C CG  . LYS A 1 112 ? 41.652 -14.724 9.494   1.00 42.17 ? 115  LYS A CG  1 
ATOM   886  C CD  . LYS A 1 112 ? 42.605 -15.754 8.896   1.00 44.83 ? 115  LYS A CD  1 
ATOM   887  C CE  . LYS A 1 112 ? 42.035 -16.445 7.665   1.00 47.11 ? 115  LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 112 ? 42.245 -15.647 6.423   1.00 52.92 ? 115  LYS A NZ  1 
ATOM   889  N N   . GLY A 1 113 ? 40.212 -9.996  8.771   1.00 41.02 ? 116  GLY A N   1 
ATOM   890  C CA  . GLY A 1 113 ? 40.135 -8.747  8.000   1.00 41.75 ? 116  GLY A CA  1 
ATOM   891  C C   . GLY A 1 113 ? 39.952 -8.968  6.511   1.00 41.97 ? 116  GLY A C   1 
ATOM   892  O O   . GLY A 1 113 ? 40.610 -8.320  5.696   1.00 43.05 ? 116  GLY A O   1 
ATOM   893  N N   . LYS A 1 114 ? 39.055 -9.887  6.159   1.00 41.58 ? 117  LYS A N   1 
ATOM   894  C CA  . LYS A 1 114 ? 38.894 -10.341 4.780   1.00 41.03 ? 117  LYS A CA  1 
ATOM   895  C C   . LYS A 1 114 ? 37.463 -10.811 4.529   1.00 39.51 ? 117  LYS A C   1 
ATOM   896  O O   . LYS A 1 114 ? 36.879 -10.509 3.487   1.00 40.34 ? 117  LYS A O   1 
ATOM   897  C CB  . LYS A 1 114 ? 39.888 -11.476 4.495   1.00 41.76 ? 117  LYS A CB  1 
ATOM   898  C CG  . LYS A 1 114 ? 39.938 -11.971 3.056   1.00 43.68 ? 117  LYS A CG  1 
ATOM   899  C CD  . LYS A 1 114 ? 40.841 -13.196 2.951   1.00 45.10 ? 117  LYS A CD  1 
ATOM   900  C CE  . LYS A 1 114 ? 41.033 -13.645 1.514   1.00 51.12 ? 117  LYS A CE  1 
ATOM   901  N NZ  . LYS A 1 114 ? 39.803 -14.260 0.935   1.00 52.33 ? 117  LYS A NZ  1 
ATOM   902  N N   . TYR A 1 115 ? 36.905 -11.546 5.489   1.00 36.68 ? 118  TYR A N   1 
ATOM   903  C CA  . TYR A 1 115 ? 35.548 -12.070 5.385   1.00 34.97 ? 118  TYR A CA  1 
ATOM   904  C C   . TYR A 1 115 ? 34.628 -11.278 6.305   1.00 34.20 ? 118  TYR A C   1 
ATOM   905  O O   . TYR A 1 115 ? 34.696 -11.424 7.528   1.00 34.64 ? 118  TYR A O   1 
ATOM   906  C CB  . TYR A 1 115 ? 35.507 -13.553 5.779   1.00 34.43 ? 118  TYR A CB  1 
ATOM   907  C CG  . TYR A 1 115 ? 36.444 -14.452 4.998   1.00 34.15 ? 118  TYR A CG  1 
ATOM   908  C CD1 . TYR A 1 115 ? 36.087 -14.941 3.738   1.00 34.12 ? 118  TYR A CD1 1 
ATOM   909  C CD2 . TYR A 1 115 ? 37.679 -14.830 5.523   1.00 31.31 ? 118  TYR A CD2 1 
ATOM   910  C CE1 . TYR A 1 115 ? 36.940 -15.773 3.020   1.00 32.66 ? 118  TYR A CE1 1 
ATOM   911  C CE2 . TYR A 1 115 ? 38.542 -15.662 4.812   1.00 31.94 ? 118  TYR A CE2 1 
ATOM   912  C CZ  . TYR A 1 115 ? 38.165 -16.129 3.561   1.00 33.92 ? 118  TYR A CZ  1 
ATOM   913  O OH  . TYR A 1 115 ? 39.012 -16.954 2.851   1.00 37.83 ? 118  TYR A OH  1 
ATOM   914  N N   . GLY A 1 116 ? 33.789 -10.428 5.721   1.00 33.08 ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 116 ? 32.771 -9.700  6.485   1.00 31.86 ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 116 ? 31.666 -10.641 6.931   1.00 31.26 ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 116 ? 31.179 -11.451 6.139   1.00 33.35 ? 119  GLY A O   1 
ATOM   918  N N   . CYS A 1 117 ? 31.279 -10.540 8.200   1.00 27.91 ? 120  CYS A N   1 
ATOM   919  C CA  . CYS A 1 117 ? 30.325 -11.479 8.806   1.00 27.80 ? 120  CYS A CA  1 
ATOM   920  C C   . CYS A 1 117 ? 28.905 -10.954 8.813   1.00 25.26 ? 120  CYS A C   1 
ATOM   921  O O   . CYS A 1 117 ? 28.052 -11.474 9.533   1.00 24.91 ? 120  CYS A O   1 
ATOM   922  C CB  . CYS A 1 117 ? 30.723 -11.778 10.252  1.00 28.82 ? 120  CYS A CB  1 
ATOM   923  S SG  . CYS A 1 117 ? 32.293 -12.608 10.439  1.00 33.12 ? 120  CYS A SG  1 
ATOM   924  N N   . VAL A 1 118 ? 28.651 -9.911  8.032   1.00 24.46 ? 121  VAL A N   1 
ATOM   925  C CA  . VAL A 1 118 ? 27.342 -9.276  8.042   1.00 23.10 ? 121  VAL A CA  1 
ATOM   926  C C   . VAL A 1 118 ? 26.937 -8.827  6.632   1.00 21.70 ? 121  VAL A C   1 
ATOM   927  O O   . VAL A 1 118 ? 27.792 -8.468  5.808   1.00 22.78 ? 121  VAL A O   1 
ATOM   928  C CB  . VAL A 1 118 ? 27.307 -8.110  9.087   1.00 23.95 ? 121  VAL A CB  1 
ATOM   929  C CG1 . VAL A 1 118 ? 28.159 -6.915  8.636   1.00 25.86 ? 121  VAL A CG1 1 
ATOM   930  C CG2 . VAL A 1 118 ? 25.886 -7.705  9.433   1.00 26.49 ? 121  VAL A CG2 1 
ATOM   931  N N   . ASP A 1 119 ? 25.635 -8.891  6.358   1.00 19.08 ? 122  ASP A N   1 
ATOM   932  C CA  . ASP A 1 119 ? 25.061 -8.367  5.115   1.00 18.63 ? 122  ASP A CA  1 
ATOM   933  C C   . ASP A 1 119 ? 24.005 -7.314  5.422   1.00 15.86 ? 122  ASP A C   1 
ATOM   934  O O   . ASP A 1 119 ? 23.055 -7.591  6.159   1.00 18.30 ? 122  ASP A O   1 
ATOM   935  C CB  . ASP A 1 119 ? 24.420 -9.487  4.301   1.00 18.92 ? 122  ASP A CB  1 
ATOM   936  C CG  . ASP A 1 119 ? 25.442 -10.339 3.564   1.00 27.60 ? 122  ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 119 ? 26.423 -9.783  3.010   1.00 35.84 ? 122  ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 119 ? 25.253 -11.572 3.524   1.00 35.31 ? 122  ASP A OD2 1 
ATOM   939  N N   . TYR A 1 120 ? 24.185 -6.109  4.874   1.00 12.94 ? 123  TYR A N   1 
ATOM   940  C CA  . TYR A 1 120 ? 23.205 -5.035  4.994   1.00 12.39 ? 123  TYR A CA  1 
ATOM   941  C C   . TYR A 1 120 ? 22.524 -4.745  3.658   1.00 13.00 ? 123  TYR A C   1 
ATOM   942  O O   . TYR A 1 120 ? 23.171 -4.681  2.604   1.00 12.65 ? 123  TYR A O   1 
ATOM   943  C CB  . TYR A 1 120 ? 23.869 -3.759  5.505   1.00 13.03 ? 123  TYR A CB  1 
ATOM   944  C CG  . TYR A 1 120 ? 24.159 -3.754  6.987   1.00 13.59 ? 123  TYR A CG  1 
ATOM   945  C CD1 . TYR A 1 120 ? 25.319 -4.339  7.493   1.00 17.75 ? 123  TYR A CD1 1 
ATOM   946  C CD2 . TYR A 1 120 ? 23.281 -3.137  7.884   1.00 11.68 ? 123  TYR A CD2 1 
ATOM   947  C CE1 . TYR A 1 120 ? 25.595 -4.315  8.860   1.00 14.98 ? 123  TYR A CE1 1 
ATOM   948  C CE2 . TYR A 1 120 ? 23.546 -3.110  9.249   1.00 16.43 ? 123  TYR A CE2 1 
ATOM   949  C CZ  . TYR A 1 120 ? 24.697 -3.708  9.731   1.00 13.73 ? 123  TYR A CZ  1 
ATOM   950  O OH  . TYR A 1 120 ? 24.949 -3.683  11.076  1.00 16.89 ? 123  TYR A OH  1 
ATOM   951  N N   . TRP A 1 121 ? 21.216 -4.540  3.718   1.00 11.37 ? 124  TRP A N   1 
ATOM   952  C CA  . TRP A 1 121 ? 20.440 -4.295  2.510   1.00 11.56 ? 124  TRP A CA  1 
ATOM   953  C C   . TRP A 1 121 ? 19.125 -3.617  2.807   1.00 12.26 ? 124  TRP A C   1 
ATOM   954  O O   . TRP A 1 121 ? 18.673 -3.579  3.962   1.00 12.08 ? 124  TRP A O   1 
ATOM   955  C CB  . TRP A 1 121 ? 20.224 -5.589  1.712   1.00 12.88 ? 124  TRP A CB  1 
ATOM   956  C CG  . TRP A 1 121 ? 19.828 -6.824  2.500   1.00 13.33 ? 124  TRP A CG  1 
ATOM   957  C CD1 . TRP A 1 121 ? 20.619 -7.908  2.760   1.00 15.81 ? 124  TRP A CD1 1 
ATOM   958  C CD2 . TRP A 1 121 ? 18.539 -7.125  3.061   1.00 16.74 ? 124  TRP A CD2 1 
ATOM   959  N NE1 . TRP A 1 121 ? 19.914 -8.856  3.466   1.00 17.07 ? 124  TRP A NE1 1 
ATOM   960  C CE2 . TRP A 1 121 ? 18.635 -8.402  3.664   1.00 17.54 ? 124  TRP A CE2 1 
ATOM   961  C CE3 . TRP A 1 121 ? 17.322 -6.435  3.132   1.00 14.75 ? 124  TRP A CE3 1 
ATOM   962  C CZ2 . TRP A 1 121 ? 17.555 -9.003  4.334   1.00 17.24 ? 124  TRP A CZ2 1 
ATOM   963  C CZ3 . TRP A 1 121 ? 16.250 -7.031  3.802   1.00 15.44 ? 124  TRP A CZ3 1 
ATOM   964  C CH2 . TRP A 1 121 ? 16.370 -8.310  4.376   1.00 18.85 ? 124  TRP A CH2 1 
ATOM   965  N N   . VAL A 1 122 ? 18.540 -3.056  1.752   1.00 11.91 ? 125  VAL A N   1 
ATOM   966  C CA  . VAL A 1 122 ? 17.182 -2.539  1.781   1.00 10.71 ? 125  VAL A CA  1 
ATOM   967  C C   . VAL A 1 122 ? 16.377 -3.275  0.725   1.00 12.42 ? 125  VAL A C   1 
ATOM   968  O O   . VAL A 1 122 ? 16.791 -3.358  -0.432  1.00 13.66 ? 125  VAL A O   1 
ATOM   969  C CB  . VAL A 1 122 ? 17.146 -1.022  1.488   1.00 9.25  ? 125  VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 122 ? 15.706 -0.513  1.444   1.00 14.24 ? 125  VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 122 ? 17.950 -0.262  2.538   1.00 13.57 ? 125  VAL A CG2 1 
ATOM   972  N N   . LYS A 1 123 ? 15.256 -3.845  1.148   1.00 12.64 ? 126  LYS A N   1 
ATOM   973  C CA  . LYS A 1 123 ? 14.258 -4.378  0.233   1.00 12.33 ? 126  LYS A CA  1 
ATOM   974  C C   . LYS A 1 123 ? 13.069 -3.435  0.197   1.00 12.87 ? 126  LYS A C   1 
ATOM   975  O O   . LYS A 1 123 ? 12.720 -2.832  1.210   1.00 13.54 ? 126  LYS A O   1 
ATOM   976  C CB  . LYS A 1 123 ? 13.782 -5.754  0.701   1.00 11.84 ? 126  LYS A CB  1 
ATOM   977  C CG  . LYS A 1 123 ? 14.795 -6.875  0.554   1.00 15.71 ? 126  LYS A CG  1 
ATOM   978  C CD  . LYS A 1 123 ? 14.282 -8.167  1.163   1.00 17.48 ? 126  LYS A CD  1 
ATOM   979  C CE  . LYS A 1 123 ? 15.301 -9.285  1.006   1.00 18.43 ? 126  LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 123 ? 14.900 -10.558 1.686   1.00 26.13 ? 126  LYS A NZ  1 
ATOM   981  N N   . ALA A 1 124 ? 12.449 -3.297  -0.965  1.00 12.72 ? 127  ALA A N   1 
ATOM   982  C CA  . ALA A 1 124 ? 11.186 -2.589  -1.039  1.00 14.13 ? 127  ALA A CA  1 
ATOM   983  C C   . ALA A 1 124 ? 10.162 -3.486  -1.707  1.00 14.15 ? 127  ALA A C   1 
ATOM   984  O O   . ALA A 1 124 ? 10.519 -4.376  -2.487  1.00 14.10 ? 127  ALA A O   1 
ATOM   985  C CB  . ALA A 1 124 ? 11.335 -1.271  -1.778  1.00 13.83 ? 127  ALA A CB  1 
ATOM   986  N N   . PHE A 1 125 ? 8.895  -3.246  -1.375  1.00 14.70 ? 128  PHE A N   1 
ATOM   987  C CA  . PHE A 1 125 ? 7.784  -4.079  -1.799  1.00 14.62 ? 128  PHE A CA  1 
ATOM   988  C C   . PHE A 1 125 ? 6.696  -3.194  -2.364  1.00 15.06 ? 128  PHE A C   1 
ATOM   989  O O   . PHE A 1 125 ? 6.332  -2.196  -1.745  1.00 16.23 ? 128  PHE A O   1 
ATOM   990  C CB  . PHE A 1 125 ? 7.252  -4.866  -0.598  1.00 15.43 ? 128  PHE A CB  1 
ATOM   991  C CG  . PHE A 1 125 ? 8.287  -5.755  0.031   1.00 17.61 ? 128  PHE A CG  1 
ATOM   992  C CD1 . PHE A 1 125 ? 8.534  -7.022  -0.484  1.00 20.31 ? 128  PHE A CD1 1 
ATOM   993  C CD2 . PHE A 1 125 ? 9.046  -5.307  1.111   1.00 18.45 ? 128  PHE A CD2 1 
ATOM   994  C CE1 . PHE A 1 125 ? 9.512  -7.841  0.079   1.00 21.80 ? 128  PHE A CE1 1 
ATOM   995  C CE2 . PHE A 1 125 ? 10.025 -6.121  1.683   1.00 19.33 ? 128  PHE A CE2 1 
ATOM   996  C CZ  . PHE A 1 125 ? 10.257 -7.388  1.161   1.00 18.43 ? 128  PHE A CZ  1 
ATOM   997  N N   . LEU A 1 126 ? 6.204  -3.565  -3.544  1.00 14.75 ? 129  LEU A N   1 
ATOM   998  C CA  . LEU A 1 126 ? 5.145  -2.832  -4.229  1.00 14.63 ? 129  LEU A CA  1 
ATOM   999  C C   . LEU A 1 126 ? 3.868  -3.649  -4.137  1.00 15.39 ? 129  LEU A C   1 
ATOM   1000 O O   . LEU A 1 126 ? 3.734  -4.663  -4.824  1.00 16.29 ? 129  LEU A O   1 
ATOM   1001 C CB  . LEU A 1 126 ? 5.522  -2.618  -5.703  1.00 13.75 ? 129  LEU A CB  1 
ATOM   1002 C CG  . LEU A 1 126 ? 4.580  -1.804  -6.593  1.00 19.23 ? 129  LEU A CG  1 
ATOM   1003 C CD1 . LEU A 1 126 ? 4.537  -0.344  -6.196  1.00 20.62 ? 129  LEU A CD1 1 
ATOM   1004 C CD2 . LEU A 1 126 ? 5.008  -1.932  -8.054  1.00 21.89 ? 129  LEU A CD2 1 
ATOM   1005 N N   . ASP A 1 127 ? 2.946  -3.203  -3.289  1.00 16.25 ? 130  ASP A N   1 
ATOM   1006 C CA  . ASP A 1 127 ? 1.690  -3.905  -3.041  1.00 18.40 ? 130  ASP A CA  1 
ATOM   1007 C C   . ASP A 1 127 ? 0.589  -3.334  -3.921  1.00 18.50 ? 130  ASP A C   1 
ATOM   1008 O O   . ASP A 1 127 ? 0.412  -2.119  -4.001  1.00 17.91 ? 130  ASP A O   1 
ATOM   1009 C CB  . ASP A 1 127 ? 1.274  -3.769  -1.567  1.00 18.32 ? 130  ASP A CB  1 
ATOM   1010 C CG  . ASP A 1 127 ? 2.230  -4.467  -0.614  1.00 23.83 ? 130  ASP A CG  1 
ATOM   1011 O OD1 . ASP A 1 127 ? 2.922  -5.418  -1.030  1.00 25.53 ? 130  ASP A OD1 1 
ATOM   1012 O OD2 . ASP A 1 127 ? 2.281  -4.067  0.566   1.00 31.21 ? 130  ASP A OD2 1 
ATOM   1013 N N   . ARG A 1 128 ? -0.140 -4.221  -4.583  1.00 19.24 ? 131  ARG A N   1 
ATOM   1014 C CA  . ARG A 1 128 ? -1.235 -3.826  -5.452  1.00 22.82 ? 131  ARG A CA  1 
ATOM   1015 C C   . ARG A 1 128 ? -2.386 -4.803  -5.260  1.00 26.15 ? 131  ARG A C   1 
ATOM   1016 O O   . ARG A 1 128 ? -2.154 -6.009  -5.142  1.00 27.17 ? 131  ARG A O   1 
ATOM   1017 C CB  . ARG A 1 128 ? -0.775 -3.797  -6.919  1.00 21.56 ? 131  ARG A CB  1 
ATOM   1018 C CG  . ARG A 1 128 ? 0.224  -2.678  -7.236  1.00 20.07 ? 131  ARG A CG  1 
ATOM   1019 C CD  . ARG A 1 128 ? 0.522  -2.584  -8.721  1.00 22.03 ? 131  ARG A CD  1 
ATOM   1020 N NE  . ARG A 1 128 ? 1.133  -3.803  -9.236  1.00 22.36 ? 131  ARG A NE  1 
ATOM   1021 C CZ  . ARG A 1 128 ? 1.175  -4.133  -10.522 1.00 24.26 ? 131  ARG A CZ  1 
ATOM   1022 N NH1 . ARG A 1 128 ? 0.627  -3.345  -11.442 1.00 26.71 ? 131  ARG A NH1 1 
ATOM   1023 N NH2 . ARG A 1 128 ? 1.748  -5.271  -10.887 1.00 25.46 ? 131  ARG A NH2 1 
ATOM   1024 N N   . PRO A 1 129 ? -3.630 -4.286  -5.202  1.00 30.69 ? 132  PRO A N   1 
ATOM   1025 C CA  . PRO A 1 129 ? -4.815 -5.127  -4.984  1.00 34.57 ? 132  PRO A CA  1 
ATOM   1026 C C   . PRO A 1 129 ? -4.959 -6.236  -6.027  1.00 37.74 ? 132  PRO A C   1 
ATOM   1027 O O   . PRO A 1 129 ? -4.792 -5.982  -7.226  1.00 38.92 ? 132  PRO A O   1 
ATOM   1028 C CB  . PRO A 1 129 ? -5.977 -4.131  -5.102  1.00 34.75 ? 132  PRO A CB  1 
ATOM   1029 C CG  . PRO A 1 129 ? -5.385 -2.808  -4.790  1.00 34.96 ? 132  PRO A CG  1 
ATOM   1030 C CD  . PRO A 1 129 ? -3.990 -2.861  -5.341  1.00 28.92 ? 132  PRO A CD  1 
ATOM   1031 N N   . SER A 1 130 ? -5.262 -7.449  -5.557  1.00 41.02 ? 133  SER A N   1 
ATOM   1032 C CA  . SER A 1 130 ? -5.409 -8.654  -6.398  1.00 43.53 ? 133  SER A CA  1 
ATOM   1033 C C   . SER A 1 130 ? -4.293 -8.821  -7.436  1.00 42.97 ? 133  SER A C   1 
ATOM   1034 O O   . SER A 1 130 ? -4.542 -9.118  -8.606  1.00 44.85 ? 133  SER A O   1 
ATOM   1035 C CB  . SER A 1 130 ? -6.802 -8.707  -7.057  1.00 44.85 ? 133  SER A CB  1 
ATOM   1036 O OG  . SER A 1 130 ? -6.938 -7.735  -8.084  1.00 49.30 ? 133  SER A OG  1 
ATOM   1037 N N   . GLN A 1 131 ? -3.057 -8.626  -6.988  1.00 41.64 ? 134  GLN A N   1 
ATOM   1038 C CA  . GLN A 1 131 ? -1.886 -8.692  -7.854  1.00 39.52 ? 134  GLN A CA  1 
ATOM   1039 C C   . GLN A 1 131 ? -0.678 -9.088  -7.009  1.00 36.72 ? 134  GLN A C   1 
ATOM   1040 O O   . GLN A 1 131 ? -0.592 -8.692  -5.848  1.00 36.44 ? 134  GLN A O   1 
ATOM   1041 C CB  . GLN A 1 131 ? -1.658 -7.335  -8.524  1.00 38.94 ? 134  GLN A CB  1 
ATOM   1042 C CG  . GLN A 1 131 ? -1.023 -7.413  -9.902  1.00 43.42 ? 134  GLN A CG  1 
ATOM   1043 C CD  . GLN A 1 131 ? -1.757 -6.567  -10.930 1.00 46.29 ? 134  GLN A CD  1 
ATOM   1044 O OE1 . GLN A 1 131 ? -2.140 -5.426  -10.658 1.00 47.98 ? 134  GLN A OE1 1 
ATOM   1045 N NE2 . GLN A 1 131 ? -1.956 -7.125  -12.120 1.00 45.50 ? 134  GLN A NE2 1 
ATOM   1046 N N   . PRO A 1 132 ? 0.239  -9.904  -7.571  1.00 34.71 ? 135  PRO A N   1 
ATOM   1047 C CA  . PRO A 1 132 ? 1.428  -10.288 -6.808  1.00 32.11 ? 135  PRO A CA  1 
ATOM   1048 C C   . PRO A 1 132 ? 2.287  -9.076  -6.436  1.00 28.81 ? 135  PRO A C   1 
ATOM   1049 O O   . PRO A 1 132 ? 2.511  -8.186  -7.259  1.00 26.79 ? 135  PRO A O   1 
ATOM   1050 C CB  . PRO A 1 132 ? 2.183  -11.209 -7.771  1.00 33.47 ? 135  PRO A CB  1 
ATOM   1051 C CG  . PRO A 1 132 ? 1.153  -11.679 -8.743  1.00 35.63 ? 135  PRO A CG  1 
ATOM   1052 C CD  . PRO A 1 132 ? 0.226  -10.529 -8.908  1.00 35.11 ? 135  PRO A CD  1 
ATOM   1053 N N   . THR A 1 133 ? 2.733  -9.042  -5.188  1.00 25.84 ? 136  THR A N   1 
ATOM   1054 C CA  . THR A 1 133 ? 3.658  -8.010  -4.717  1.00 23.33 ? 136  THR A CA  1 
ATOM   1055 C C   . THR A 1 133 ? 4.970  -8.144  -5.476  1.00 22.58 ? 136  THR A C   1 
ATOM   1056 O O   . THR A 1 133 ? 5.439  -9.258  -5.707  1.00 24.58 ? 136  THR A O   1 
ATOM   1057 C CB  . THR A 1 133 ? 3.875  -8.135  -3.188  1.00 23.10 ? 136  THR A CB  1 
ATOM   1058 O OG1 . THR A 1 133 ? 2.640  -7.849  -2.515  1.00 26.28 ? 136  THR A OG1 1 
ATOM   1059 C CG2 . THR A 1 133 ? 4.961  -7.177  -2.674  1.00 21.17 ? 136  THR A CG2 1 
ATOM   1060 N N   . GLN A 1 134 ? 5.546  -7.013  -5.878  1.00 18.35 ? 137  GLN A N   1 
ATOM   1061 C CA  . GLN A 1 134 ? 6.844  -7.004  -6.546  1.00 17.69 ? 137  GLN A CA  1 
ATOM   1062 C C   . GLN A 1 134 ? 7.902  -6.614  -5.528  1.00 16.27 ? 137  GLN A C   1 
ATOM   1063 O O   . GLN A 1 134 ? 7.632  -5.820  -4.629  1.00 16.62 ? 137  GLN A O   1 
ATOM   1064 C CB  . GLN A 1 134 ? 6.842  -6.028  -7.724  1.00 15.67 ? 137  GLN A CB  1 
ATOM   1065 C CG  . GLN A 1 134 ? 5.764  -6.351  -8.768  1.00 16.99 ? 137  GLN A CG  1 
ATOM   1066 C CD  . GLN A 1 134 ? 6.043  -5.804  -10.155 1.00 17.94 ? 137  GLN A CD  1 
ATOM   1067 O OE1 . GLN A 1 134 ? 7.015  -5.079  -10.377 1.00 17.13 ? 137  GLN A OE1 1 
ATOM   1068 N NE2 . GLN A 1 134 ? 5.177  -6.158  -11.107 1.00 18.74 ? 137  GLN A NE2 1 
ATOM   1069 N N   . GLU A 1 135 ? 9.100  -7.171  -5.666  1.00 15.78 ? 138  GLU A N   1 
ATOM   1070 C CA  . GLU A 1 135 ? 10.188 -6.849  -4.743  1.00 15.59 ? 138  GLU A CA  1 
ATOM   1071 C C   . GLU A 1 135 ? 11.390 -6.245  -5.469  1.00 15.40 ? 138  GLU A C   1 
ATOM   1072 O O   . GLU A 1 135 ? 11.664 -6.583  -6.614  1.00 14.67 ? 138  GLU A O   1 
ATOM   1073 C CB  . GLU A 1 135 ? 10.633 -8.108  -3.987  1.00 16.95 ? 138  GLU A CB  1 
ATOM   1074 C CG  . GLU A 1 135 ? 11.790 -7.875  -3.019  1.00 19.80 ? 138  GLU A CG  1 
ATOM   1075 C CD  . GLU A 1 135 ? 12.323 -9.152  -2.386  1.00 26.17 ? 138  GLU A CD  1 
ATOM   1076 O OE1 . GLU A 1 135 ? 11.552 -10.124 -2.226  1.00 32.76 ? 138  GLU A OE1 1 
ATOM   1077 O OE2 . GLU A 1 135 ? 13.524 -9.171  -2.035  1.00 26.52 ? 138  GLU A OE2 1 
ATOM   1078 N N   . THR A 1 136 ? 12.101 -5.349  -4.789  1.00 14.35 ? 139  THR A N   1 
ATOM   1079 C CA  . THR A 1 136 ? 13.428 -4.929  -5.219  1.00 13.48 ? 139  THR A CA  1 
ATOM   1080 C C   . THR A 1 136 ? 14.376 -5.022  -4.015  1.00 14.40 ? 139  THR A C   1 
ATOM   1081 O O   . THR A 1 136 ? 13.943 -4.928  -2.873  1.00 15.71 ? 139  THR A O   1 
ATOM   1082 C CB  . THR A 1 136 ? 13.415 -3.518  -5.888  1.00 14.79 ? 139  THR A CB  1 
ATOM   1083 O OG1 . THR A 1 136 ? 14.709 -3.210  -6.419  1.00 16.20 ? 139  THR A OG1 1 
ATOM   1084 C CG2 . THR A 1 136 ? 12.988 -2.427  -4.912  1.00 15.33 ? 139  THR A CG2 1 
ATOM   1085 N N   . LYS A 1 137 ? 15.654 -5.253  -4.274  1.00 13.10 ? 140  LYS A N   1 
ATOM   1086 C CA  . LYS A 1 137 ? 16.635 -5.351  -3.195  1.00 13.58 ? 140  LYS A CA  1 
ATOM   1087 C C   . LYS A 1 137 ? 17.915 -4.646  -3.603  1.00 14.38 ? 140  LYS A C   1 
ATOM   1088 O O   . LYS A 1 137 ? 18.376 -4.815  -4.731  1.00 15.92 ? 140  LYS A O   1 
ATOM   1089 C CB  . LYS A 1 137 ? 16.921 -6.821  -2.870  1.00 14.79 ? 140  LYS A CB  1 
ATOM   1090 C CG  . LYS A 1 137 ? 17.912 -7.063  -1.734  1.00 15.28 ? 140  LYS A CG  1 
ATOM   1091 C CD  . LYS A 1 137 ? 18.314 -8.544  -1.653  1.00 16.37 ? 140  LYS A CD  1 
ATOM   1092 C CE  . LYS A 1 137 ? 19.366 -8.752  -0.559  1.00 18.12 ? 140  LYS A CE  1 
ATOM   1093 N NZ  . LYS A 1 137 ? 19.639 -10.192 -0.261  1.00 22.57 ? 140  LYS A NZ  1 
ATOM   1094 N N   . LYS A 1 138 ? 18.493 -3.876  -2.682  1.00 13.67 ? 141  LYS A N   1 
ATOM   1095 C CA  . LYS A 1 138 ? 19.793 -3.273  -2.927  1.00 14.96 ? 141  LYS A CA  1 
ATOM   1096 C C   . LYS A 1 138 ? 20.654 -3.389  -1.673  1.00 14.05 ? 141  LYS A C   1 
ATOM   1097 O O   . LYS A 1 138 ? 20.224 -3.026  -0.573  1.00 14.35 ? 141  LYS A O   1 
ATOM   1098 C CB  . LYS A 1 138 ? 19.660 -1.801  -3.350  1.00 16.46 ? 141  LYS A CB  1 
ATOM   1099 C CG  . LYS A 1 138 ? 20.969 -1.196  -3.914  1.00 15.49 ? 141  LYS A CG  1 
ATOM   1100 C CD  . LYS A 1 138 ? 20.759 0.138   -4.625  1.00 22.03 ? 141  LYS A CD  1 
ATOM   1101 C CE  . LYS A 1 138 ? 20.497 -0.039  -6.124  1.00 25.54 ? 141  LYS A CE  1 
ATOM   1102 N NZ  . LYS A 1 138 ? 20.320 1.262   -6.852  1.00 24.01 ? 141  LYS A NZ  1 
ATOM   1103 N N   . ASN A 1 139 ? 21.875 -3.886  -1.847  1.00 13.21 ? 142  ASN A N   1 
ATOM   1104 C CA  . ASN A 1 139 ? 22.827 -3.942  -0.743  1.00 14.45 ? 142  ASN A CA  1 
ATOM   1105 C C   . ASN A 1 139 ? 23.390 -2.562  -0.433  1.00 14.49 ? 142  ASN A C   1 
ATOM   1106 O O   . ASN A 1 139 ? 23.441 -1.697  -1.303  1.00 14.43 ? 142  ASN A O   1 
ATOM   1107 C CB  . ASN A 1 139 ? 23.991 -4.882  -1.085  1.00 16.18 ? 142  ASN A CB  1 
ATOM   1108 C CG  . ASN A 1 139 ? 23.546 -6.296  -1.409  1.00 23.25 ? 142  ASN A CG  1 
ATOM   1109 O OD1 . ASN A 1 139 ? 22.664 -6.844  -0.773  1.00 25.80 ? 142  ASN A OD1 1 
ATOM   1110 N ND2 . ASN A 1 139 ? 24.188 -6.899  -2.402  1.00 34.69 ? 142  ASN A ND2 1 
ATOM   1111 N N   . PHE A 1 140 ? 23.822 -2.363  0.810   1.00 14.33 ? 143  PHE A N   1 
ATOM   1112 C CA  . PHE A 1 140 ? 24.676 -1.220  1.140   1.00 15.17 ? 143  PHE A CA  1 
ATOM   1113 C C   . PHE A 1 140 ? 25.873 -1.662  1.968   1.00 15.77 ? 143  PHE A C   1 
ATOM   1114 O O   . PHE A 1 140 ? 25.840 -2.733  2.577   1.00 15.91 ? 143  PHE A O   1 
ATOM   1115 C CB  . PHE A 1 140 ? 23.896 -0.028  1.737   1.00 16.04 ? 143  PHE A CB  1 
ATOM   1116 C CG  . PHE A 1 140 ? 23.238 -0.295  3.075   1.00 13.48 ? 143  PHE A CG  1 
ATOM   1117 C CD1 . PHE A 1 140 ? 23.919 -0.033  4.265   1.00 12.43 ? 143  PHE A CD1 1 
ATOM   1118 C CD2 . PHE A 1 140 ? 21.914 -0.759  3.138   1.00 12.47 ? 143  PHE A CD2 1 
ATOM   1119 C CE1 . PHE A 1 140 ? 23.306 -0.246  5.508   1.00 14.18 ? 143  PHE A CE1 1 
ATOM   1120 C CE2 . PHE A 1 140 ? 21.284 -0.983  4.379   1.00 13.05 ? 143  PHE A CE2 1 
ATOM   1121 C CZ  . PHE A 1 140 ? 21.982 -0.723  5.564   1.00 14.09 ? 143  PHE A CZ  1 
ATOM   1122 N N   . GLU A 1 141 ? 26.938 -0.862  1.936   1.00 15.50 ? 144  GLU A N   1 
ATOM   1123 C CA  . GLU A 1 141 ? 28.198 -1.218  2.568   1.00 16.79 ? 144  GLU A CA  1 
ATOM   1124 C C   . GLU A 1 141 ? 28.361 -0.483  3.886   1.00 16.22 ? 144  GLU A C   1 
ATOM   1125 O O   . GLU A 1 141 ? 27.920 0.662   4.037   1.00 14.53 ? 144  GLU A O   1 
ATOM   1126 C CB  . GLU A 1 141 ? 29.377 -0.859  1.662   1.00 17.59 ? 144  GLU A CB  1 
ATOM   1127 C CG  . GLU A 1 141 ? 29.338 -1.484  0.283   1.00 22.50 ? 144  GLU A CG  1 
ATOM   1128 C CD  . GLU A 1 141 ? 30.050 -2.822  0.203   1.00 30.77 ? 144  GLU A CD  1 
ATOM   1129 O OE1 . GLU A 1 141 ? 30.216 -3.320  -0.933  1.00 34.79 ? 144  GLU A OE1 1 
ATOM   1130 O OE2 . GLU A 1 141 ? 30.448 -3.375  1.253   1.00 35.38 ? 144  GLU A OE2 1 
ATOM   1131 N N   . VAL A 1 142 ? 28.988 -1.157  4.845   1.00 17.37 ? 145  VAL A N   1 
ATOM   1132 C CA  . VAL A 1 142 ? 29.270 -0.558  6.136   1.00 17.42 ? 145  VAL A CA  1 
ATOM   1133 C C   . VAL A 1 142 ? 30.743 -0.688  6.527   1.00 17.77 ? 145  VAL A C   1 
ATOM   1134 O O   . VAL A 1 142 ? 31.464 -1.571  6.042   1.00 19.13 ? 145  VAL A O   1 
ATOM   1135 C CB  . VAL A 1 142 ? 28.383 -1.143  7.287   1.00 17.07 ? 145  VAL A CB  1 
ATOM   1136 C CG1 . VAL A 1 142 ? 26.898 -0.907  7.026   1.00 17.27 ? 145  VAL A CG1 1 
ATOM   1137 C CG2 . VAL A 1 142 ? 28.663 -2.639  7.521   1.00 20.41 ? 145  VAL A CG2 1 
ATOM   1138 N N   . VAL A 1 143 ? 31.164 0.207   7.411   1.00 18.13 ? 146  VAL A N   1 
ATOM   1139 C CA  . VAL A 1 143 ? 32.415 0.053   8.146   1.00 20.29 ? 146  VAL A CA  1 
ATOM   1140 C C   . VAL A 1 143 ? 32.105 -0.221  9.623   1.00 21.15 ? 146  VAL A C   1 
ATOM   1141 O O   . VAL A 1 143 ? 30.994 -0.646  9.958   1.00 21.60 ? 146  VAL A O   1 
ATOM   1142 C CB  . VAL A 1 143 ? 33.372 1.266   7.947   1.00 21.48 ? 146  VAL A CB  1 
ATOM   1143 C CG1 . VAL A 1 143 ? 33.951 1.236   6.540   1.00 24.63 ? 146  VAL A CG1 1 
ATOM   1144 C CG2 . VAL A 1 143 ? 32.666 2.607   8.239   1.00 23.03 ? 146  VAL A CG2 1 
ATOM   1145 N N   . ASP A 1 144 ? 33.087 -0.006  10.497  1.00 22.23 ? 147  ASP A N   1 
ATOM   1146 C CA  . ASP A 1 144 ? 32.919 -0.244  11.937  1.00 23.94 ? 147  ASP A CA  1 
ATOM   1147 C C   . ASP A 1 144 ? 32.620 -1.708  12.257  1.00 23.58 ? 147  ASP A C   1 
ATOM   1148 O O   . ASP A 1 144 ? 31.813 -2.030  13.148  1.00 22.64 ? 147  ASP A O   1 
ATOM   1149 C CB  . ASP A 1 144 ? 31.879 0.712   12.534  1.00 24.21 ? 147  ASP A CB  1 
ATOM   1150 C CG  . ASP A 1 144 ? 32.341 2.170   12.496  1.00 29.21 ? 147  ASP A CG  1 
ATOM   1151 O OD1 . ASP A 1 144 ? 33.540 2.426   12.755  1.00 34.33 ? 147  ASP A OD1 1 
ATOM   1152 O OD2 . ASP A 1 144 ? 31.518 3.060   12.206  1.00 28.74 ? 147  ASP A OD2 1 
ATOM   1153 N N   . LEU A 1 145 ? 33.282 -2.589  11.513  1.00 24.69 ? 148  LEU A N   1 
ATOM   1154 C CA  . LEU A 1 145 ? 33.304 -4.006  11.826  1.00 25.04 ? 148  LEU A CA  1 
ATOM   1155 C C   . LEU A 1 145 ? 34.487 -4.262  12.744  1.00 25.98 ? 148  LEU A C   1 
ATOM   1156 O O   . LEU A 1 145 ? 35.542 -3.653  12.586  1.00 27.87 ? 148  LEU A O   1 
ATOM   1157 C CB  . LEU A 1 145 ? 33.463 -4.840  10.557  1.00 24.63 ? 148  LEU A CB  1 
ATOM   1158 C CG  . LEU A 1 145 ? 32.507 -4.649  9.373   1.00 25.66 ? 148  LEU A CG  1 
ATOM   1159 C CD1 . LEU A 1 145 ? 32.792 -5.708  8.310   1.00 27.87 ? 148  LEU A CD1 1 
ATOM   1160 C CD2 . LEU A 1 145 ? 31.053 -4.702  9.797   1.00 25.03 ? 148  LEU A CD2 1 
ATOM   1161 N N   . VAL A 1 146 ? 34.309 -5.165  13.696  1.00 26.05 ? 149  VAL A N   1 
ATOM   1162 C CA  . VAL A 1 146 ? 35.383 -5.519  14.623  1.00 27.02 ? 149  VAL A CA  1 
ATOM   1163 C C   . VAL A 1 146 ? 35.796 -6.970  14.376  1.00 27.59 ? 149  VAL A C   1 
ATOM   1164 O O   . VAL A 1 146 ? 35.006 -7.752  13.858  1.00 26.43 ? 149  VAL A O   1 
ATOM   1165 C CB  . VAL A 1 146 ? 34.967 -5.282  16.103  1.00 27.95 ? 149  VAL A CB  1 
ATOM   1166 C CG1 . VAL A 1 146 ? 34.751 -3.783  16.361  1.00 30.33 ? 149  VAL A CG1 1 
ATOM   1167 C CG2 . VAL A 1 146 ? 33.720 -6.079  16.459  1.00 27.05 ? 149  VAL A CG2 1 
ATOM   1168 N N   . ASP A 1 147 ? 37.032 -7.325  14.721  1.00 28.28 ? 150  ASP A N   1 
ATOM   1169 C CA  . ASP A 1 147 ? 37.494 -8.708  14.560  1.00 29.84 ? 150  ASP A CA  1 
ATOM   1170 C C   . ASP A 1 147 ? 36.617 -9.672  15.362  1.00 31.71 ? 150  ASP A C   1 
ATOM   1171 O O   . ASP A 1 147 ? 36.070 -9.296  16.407  1.00 31.70 ? 150  ASP A O   1 
ATOM   1172 C CB  . ASP A 1 147 ? 38.954 -8.851  14.990  1.00 31.10 ? 150  ASP A CB  1 
ATOM   1173 C CG  . ASP A 1 147 ? 39.498 -10.242 14.725  1.00 33.13 ? 150  ASP A CG  1 
ATOM   1174 O OD1 . ASP A 1 147 ? 39.749 -10.985 15.702  1.00 37.42 ? 150  ASP A OD1 1 
ATOM   1175 O OD2 . ASP A 1 147 ? 39.646 -10.605 13.541  1.00 36.95 ? 150  ASP A OD2 1 
ATOM   1176 N N   . VAL A 1 148 ? 36.487 -10.905 14.869  1.00 32.74 ? 151  VAL A N   1 
ATOM   1177 C CA  . VAL A 1 148 ? 35.629 -11.907 15.508  1.00 34.76 ? 151  VAL A CA  1 
ATOM   1178 C C   . VAL A 1 148 ? 36.038 -12.221 16.951  1.00 36.97 ? 151  VAL A C   1 
ATOM   1179 O O   . VAL A 1 148 ? 35.181 -12.525 17.788  1.00 37.10 ? 151  VAL A O   1 
ATOM   1180 C CB  . VAL A 1 148 ? 35.521 -13.218 14.679  1.00 35.15 ? 151  VAL A CB  1 
ATOM   1181 C CG1 . VAL A 1 148 ? 34.672 -12.992 13.442  1.00 33.19 ? 151  VAL A CG1 1 
ATOM   1182 C CG2 . VAL A 1 148 ? 36.905 -13.772 14.310  1.00 36.08 ? 151  VAL A CG2 1 
ATOM   1183 N N   . ASN A 1 149 ? 37.338 -12.128 17.228  1.00 38.52 ? 152  ASN A N   1 
ATOM   1184 C CA  . ASN A 1 149 ? 37.888 -12.424 18.555  1.00 41.25 ? 152  ASN A CA  1 
ATOM   1185 C C   . ASN A 1 149 ? 38.197 -11.176 19.388  1.00 43.00 ? 152  ASN A C   1 
ATOM   1186 O O   . ASN A 1 149 ? 39.061 -11.207 20.273  1.00 44.17 ? 152  ASN A O   1 
ATOM   1187 C CB  . ASN A 1 149 ? 39.136 -13.311 18.436  1.00 41.39 ? 152  ASN A CB  1 
ATOM   1188 C CG  . ASN A 1 149 ? 38.850 -14.637 17.749  1.00 43.11 ? 152  ASN A CG  1 
ATOM   1189 O OD1 . ASN A 1 149 ? 39.647 -15.113 16.938  1.00 46.22 ? 152  ASN A OD1 1 
ATOM   1190 N ND2 . ASN A 1 149 ? 37.705 -15.235 18.066  1.00 45.53 ? 152  ASN A ND2 1 
ATOM   1191 N N   . THR A 1 150 ? 37.491 -10.083 19.104  1.00 44.04 ? 153  THR A N   1 
ATOM   1192 C CA  . THR A 1 150 ? 37.646 -8.850  19.875  1.00 45.86 ? 153  THR A CA  1 
ATOM   1193 C C   . THR A 1 150 ? 37.042 -9.016  21.282  1.00 47.06 ? 153  THR A C   1 
ATOM   1194 O O   . THR A 1 150 ? 35.944 -9.566  21.424  1.00 47.52 ? 153  THR A O   1 
ATOM   1195 C CB  . THR A 1 150 ? 37.055 -7.619  19.133  1.00 46.24 ? 153  THR A CB  1 
ATOM   1196 O OG1 . THR A 1 150 ? 37.553 -6.409  19.721  1.00 49.27 ? 153  THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 150 ? 35.526 -7.618  19.175  1.00 47.28 ? 153  THR A CG2 1 
ATOM   1198 N N   . PRO A 1 151 ? 37.776 -8.580  22.324  1.00 47.90 ? 154  PRO A N   1 
ATOM   1199 C CA  . PRO A 1 151 ? 37.306 -8.697  23.708  1.00 48.84 ? 154  PRO A CA  1 
ATOM   1200 C C   . PRO A 1 151 ? 36.227 -7.672  24.059  1.00 49.62 ? 154  PRO A C   1 
ATOM   1201 O O   . PRO A 1 151 ? 36.003 -6.723  23.306  1.00 50.12 ? 154  PRO A O   1 
ATOM   1202 C CB  . PRO A 1 151 ? 38.571 -8.438  24.539  1.00 48.93 ? 154  PRO A CB  1 
ATOM   1203 C CG  . PRO A 1 151 ? 39.718 -8.410  23.546  1.00 49.02 ? 154  PRO A CG  1 
ATOM   1204 C CD  . PRO A 1 151 ? 39.113 -7.968  22.263  1.00 48.60 ? 154  PRO A CD  1 
HETATM 1205 C C1  . GOL B 2 .   ? -4.534 -3.278  -10.233 1.00 38.42 ? 801  GOL A C1  1 
HETATM 1206 O O1  . GOL B 2 .   ? -3.628 -2.665  -9.338  1.00 39.09 ? 801  GOL A O1  1 
HETATM 1207 C C2  . GOL B 2 .   ? -4.757 -2.391  -11.453 1.00 41.03 ? 801  GOL A C2  1 
HETATM 1208 O O2  . GOL B 2 .   ? -5.084 -1.082  -11.035 1.00 35.83 ? 801  GOL A O2  1 
HETATM 1209 C C3  . GOL B 2 .   ? -3.492 -2.313  -12.299 1.00 36.94 ? 801  GOL A C3  1 
HETATM 1210 O O3  . GOL B 2 .   ? -3.025 -3.577  -12.710 1.00 44.54 ? 801  GOL A O3  1 
HETATM 1211 O O   . HOH C 3 .   ? 5.282  6.266   -14.269 1.00 19.89 ? 901  HOH A O   1 
HETATM 1212 O O   . HOH C 3 .   ? 2.523  -5.418  -7.260  1.00 20.15 ? 902  HOH A O   1 
HETATM 1213 O O   . HOH C 3 .   ? 2.770  3.452   0.548   1.00 18.28 ? 903  HOH A O   1 
HETATM 1214 O O   . HOH C 3 .   ? 21.737 3.884   -5.163  1.00 21.87 ? 904  HOH A O   1 
HETATM 1215 O O   . HOH C 3 .   ? 27.077 1.545   0.429   1.00 19.29 ? 905  HOH A O   1 
HETATM 1216 O O   . HOH C 3 .   ? 25.178 4.461   -0.427  1.00 19.60 ? 906  HOH A O   1 
HETATM 1217 O O   . HOH C 3 .   ? 16.833 -1.660  -6.116  1.00 22.34 ? 907  HOH A O   1 
HETATM 1218 O O   . HOH C 3 .   ? 8.395  10.707  0.394   1.00 23.36 ? 908  HOH A O   1 
HETATM 1219 O O   . HOH C 3 .   ? 0.444  -6.981  -3.997  1.00 25.13 ? 909  HOH A O   1 
HETATM 1220 O O   . HOH C 3 .   ? 22.825 -4.487  -4.522  1.00 24.47 ? 910  HOH A O   1 
HETATM 1221 O O   . HOH C 3 .   ? 22.558 7.831   1.186   1.00 26.19 ? 911  HOH A O   1 
HETATM 1222 O O   . HOH C 3 .   ? 26.523 -5.306  3.262   1.00 29.11 ? 912  HOH A O   1 
HETATM 1223 O O   . HOH C 3 .   ? 2.867  -7.737  -9.924  1.00 25.94 ? 913  HOH A O   1 
HETATM 1224 O O   . HOH C 3 .   ? 29.339 -4.145  4.033   1.00 32.73 ? 914  HOH A O   1 
HETATM 1225 O O   . HOH C 3 .   ? 11.835 5.796   6.506   1.00 27.41 ? 915  HOH A O   1 
HETATM 1226 O O   . HOH C 3 .   ? 17.832 8.912   -3.663  1.00 30.12 ? 916  HOH A O   1 
HETATM 1227 O O   . HOH C 3 .   ? 8.221  8.158   3.157   1.00 26.88 ? 917  HOH A O   1 
HETATM 1228 O O   . HOH C 3 .   ? 6.492  5.890   -17.768 1.00 27.52 ? 918  HOH A O   1 
HETATM 1229 O O   . HOH C 3 .   ? 1.834  4.347   -1.858  1.00 28.73 ? 919  HOH A O   1 
HETATM 1230 O O   . HOH C 3 .   ? 21.764 5.427   16.137  1.00 36.04 ? 920  HOH A O   1 
HETATM 1231 O O   . HOH C 3 .   ? 12.563 3.322   -10.834 1.00 23.21 ? 921  HOH A O   1 
HETATM 1232 O O   . HOH C 3 .   ? 39.315 -9.182  11.298  1.00 32.44 ? 922  HOH A O   1 
HETATM 1233 O O   . HOH C 3 .   ? -3.332 -1.561  -15.069 1.00 29.23 ? 923  HOH A O   1 
HETATM 1234 O O   . HOH C 3 .   ? 1.684  7.198   -0.265  1.00 29.24 ? 924  HOH A O   1 
HETATM 1235 O O   . HOH C 3 .   ? 22.140 8.922   3.746   1.00 35.91 ? 925  HOH A O   1 
HETATM 1236 O O   . HOH C 3 .   ? 35.301 -2.123  9.091   1.00 38.80 ? 926  HOH A O   1 
HETATM 1237 O O   . HOH C 3 .   ? -5.897 10.697  -3.872  1.00 37.08 ? 927  HOH A O   1 
HETATM 1238 O O   . HOH C 3 .   ? 15.726 -2.204  -9.921  1.00 37.83 ? 928  HOH A O   1 
HETATM 1239 O O   . HOH C 3 .   ? 14.252 -0.798  -12.142 1.00 34.25 ? 929  HOH A O   1 
HETATM 1240 O O   . HOH C 3 .   ? 26.165 -2.913  17.815  1.00 31.54 ? 930  HOH A O   1 
HETATM 1241 O O   . HOH C 3 .   ? 13.649 -10.827 4.194   1.00 49.90 ? 931  HOH A O   1 
HETATM 1242 O O   . HOH C 3 .   ? 23.051 -8.578  16.864  1.00 47.91 ? 932  HOH A O   1 
HETATM 1243 O O   . HOH C 3 .   ? 14.980 -11.527 -1.540  1.00 49.85 ? 933  HOH A O   1 
HETATM 1244 O O   . HOH C 3 .   ? 20.845 11.511  -5.172  1.00 33.12 ? 934  HOH A O   1 
HETATM 1245 O O   . HOH C 3 .   ? 24.148 2.661   -4.424  1.00 35.43 ? 935  HOH A O   1 
HETATM 1246 O O   . HOH C 3 .   ? 7.432  11.531  -6.963  1.00 26.53 ? 936  HOH A O   1 
HETATM 1247 O O   . HOH C 3 .   ? -3.496 8.931   -7.061  1.00 38.42 ? 937  HOH A O   1 
HETATM 1248 O O   . HOH C 3 .   ? -0.085 10.654  -10.537 1.00 34.65 ? 938  HOH A O   1 
HETATM 1249 O O   . HOH C 3 .   ? 31.580 1.604   16.076  1.00 36.23 ? 939  HOH A O   1 
HETATM 1250 O O   . HOH C 3 .   ? 30.657 6.889   6.765   1.00 36.33 ? 940  HOH A O   1 
HETATM 1251 O O   . HOH C 3 .   ? 30.346 6.928   12.790  1.00 35.49 ? 941  HOH A O   1 
HETATM 1252 O O   . HOH C 3 .   ? -0.565 3.943   -1.545  1.00 35.31 ? 942  HOH A O   1 
HETATM 1253 O O   . HOH C 3 .   ? 40.272 -12.895 12.525  1.00 33.00 ? 943  HOH A O   1 
HETATM 1254 O O   . HOH C 3 .   ? 17.610 -11.912 1.026   1.00 53.03 ? 944  HOH A O   1 
HETATM 1255 O O   . HOH C 3 .   ? 5.872  5.087   9.876   1.00 52.85 ? 945  HOH A O   1 
HETATM 1256 O O   . HOH C 3 .   ? 6.775  6.757   6.106   1.00 49.76 ? 946  HOH A O   1 
HETATM 1257 O O   . HOH C 3 .   ? 18.369 12.430  -7.988  1.00 35.91 ? 947  HOH A O   1 
HETATM 1258 O O   . HOH C 3 .   ? 0.329  -3.236  2.246   1.00 61.26 ? 948  HOH A O   1 
HETATM 1259 O O   . HOH C 3 .   ? 15.688 10.724  0.987   1.00 30.14 ? 949  HOH A O   1 
HETATM 1260 O O   . HOH C 3 .   ? 24.325 10.633  9.374   1.00 40.54 ? 950  HOH A O   1 
HETATM 1261 O O   . HOH C 3 .   ? 2.395  13.693  -4.515  1.00 42.84 ? 951  HOH A O   1 
HETATM 1262 O O   . HOH C 3 .   ? 24.486 -0.589  19.373  1.00 40.89 ? 952  HOH A O   1 
HETATM 1263 O O   . HOH C 3 .   ? 12.206 -11.616 0.135   1.00 46.85 ? 953  HOH A O   1 
HETATM 1264 O O   . HOH C 3 .   ? 7.770  12.767  -12.059 1.00 39.57 ? 954  HOH A O   1 
HETATM 1265 O O   . HOH C 3 .   ? -1.050 -5.024  -13.767 1.00 50.16 ? 955  HOH A O   1 
HETATM 1266 O O   . HOH C 3 .   ? 40.951 -9.621  17.868  1.00 48.00 ? 956  HOH A O   1 
HETATM 1267 O O   . HOH C 3 .   ? 24.501 -7.006  1.575   1.00 45.24 ? 957  HOH A O   1 
HETATM 1268 O O   . HOH C 3 .   ? 27.096 -6.859  1.290   1.00 52.29 ? 958  HOH A O   1 
HETATM 1269 O O   . HOH C 3 .   ? 24.463 -2.147  -3.943  1.00 40.07 ? 959  HOH A O   1 
HETATM 1270 O O   . HOH C 3 .   ? 37.429 -5.299  10.536  1.00 43.55 ? 960  HOH A O   1 
HETATM 1271 O O   . HOH C 3 .   ? 2.222  -11.298 -3.480  1.00 44.19 ? 961  HOH A O   1 
HETATM 1272 O O   . HOH C 3 .   ? 32.269 -23.427 16.709  1.00 39.35 ? 962  HOH A O   1 
HETATM 1273 O O   . HOH C 3 .   ? -0.603 6.363   1.839   1.00 47.07 ? 963  HOH A O   1 
HETATM 1274 O O   . HOH C 3 .   ? 7.926  -3.723  5.420   1.00 42.42 ? 964  HOH A O   1 
HETATM 1275 O O   . HOH C 3 .   ? 21.089 -11.488 3.748   1.00 45.92 ? 965  HOH A O   1 
HETATM 1276 O O   . HOH C 3 .   ? 5.190  12.749  -6.013  1.00 37.20 ? 966  HOH A O   1 
HETATM 1277 O O   . HOH C 3 .   ? 19.987 -4.154  -6.672  1.00 36.45 ? 967  HOH A O   1 
HETATM 1278 O O   . HOH C 3 .   ? 6.430  -11.548 -6.103  1.00 43.48 ? 968  HOH A O   1 
HETATM 1279 O O   . HOH C 3 .   ? 0.218  3.349   1.713   1.00 34.90 ? 969  HOH A O   1 
HETATM 1280 O O   . HOH C 3 .   ? 28.714 -10.578 12.494  1.00 33.16 ? 970  HOH A O   1 
HETATM 1281 O O   . HOH C 3 .   ? 16.138 5.966   12.660  1.00 45.25 ? 971  HOH A O   1 
HETATM 1282 O O   . HOH C 3 .   ? 5.488  14.792  2.429   1.00 51.47 ? 972  HOH A O   1 
HETATM 1283 O O   . HOH C 3 .   ? 22.654 -9.761  0.607   1.00 48.15 ? 973  HOH A O   1 
HETATM 1284 O O   . HOH C 3 .   ? 10.375 -1.648  12.257  1.00 37.88 ? 974  HOH A O   1 
HETATM 1285 O O   . HOH C 3 .   ? 11.886 -4.984  13.504  1.00 45.51 ? 975  HOH A O   1 
HETATM 1286 O O   . HOH C 3 .   ? 7.476  14.681  0.873   1.00 43.55 ? 976  HOH A O   1 
HETATM 1287 O O   . HOH C 3 .   ? 30.904 -13.371 14.461  1.00 34.99 ? 977  HOH A O   1 
HETATM 1288 O O   . HOH C 3 .   ? 23.128 -10.164 -2.983  1.00 47.13 ? 978  HOH A O   1 
HETATM 1289 O O   . HOH C 3 .   ? 23.260 -14.586 6.223   1.00 40.31 ? 979  HOH A O   1 
HETATM 1290 O O   . HOH C 3 .   ? -6.243 -6.150  -1.383  1.00 53.35 ? 980  HOH A O   1 
HETATM 1291 O O   . HOH C 3 .   ? 28.184 -13.579 12.071  1.00 34.94 ? 981  HOH A O   1 
HETATM 1292 O O   . HOH C 3 .   ? 38.811 -5.248  15.485  1.00 45.36 ? 982  HOH A O   1 
HETATM 1293 O O   . HOH C 3 .   ? 35.880 0.717   10.389  1.00 39.27 ? 983  HOH A O   1 
HETATM 1294 O O   . HOH C 3 .   ? 15.307 2.892   -14.282 1.00 46.45 ? 984  HOH A O   1 
HETATM 1295 O O   . HOH C 3 .   ? -1.301 15.504  -4.876  1.00 44.97 ? 985  HOH A O   1 
HETATM 1296 O O   . HOH C 3 .   ? 33.212 -0.582  15.860  1.00 43.94 ? 986  HOH A O   1 
HETATM 1297 O O   . HOH C 3 .   ? 30.855 -10.555 3.360   1.00 61.57 ? 987  HOH A O   1 
HETATM 1298 O O   . HOH C 3 .   ? 26.757 7.112   -8.957  1.00 59.41 ? 988  HOH A O   1 
HETATM 1299 O O   . HOH C 3 .   ? 9.305  13.270  -7.820  1.00 58.22 ? 989  HOH A O   1 
HETATM 1300 O O   . HOH C 3 .   ? -3.975 8.983   -4.457  1.00 37.79 ? 990  HOH A O   1 
HETATM 1301 O O   . HOH C 3 .   ? 1.412  -1.103  4.568   1.00 46.52 ? 991  HOH A O   1 
HETATM 1302 O O   . HOH C 3 .   ? 28.009 -2.786  -3.028  1.00 55.39 ? 992  HOH A O   1 
HETATM 1303 O O   . HOH C 3 .   ? -0.446 8.851   -0.647  1.00 42.40 ? 993  HOH A O   1 
HETATM 1304 O O   . HOH C 3 .   ? 29.160 -6.863  17.337  1.00 64.08 ? 994  HOH A O   1 
HETATM 1305 O O   . HOH C 3 .   ? 10.935 -2.057  -18.154 1.00 46.21 ? 995  HOH A O   1 
HETATM 1306 O O   . HOH C 3 .   ? 33.934 -27.065 14.429  1.00 51.48 ? 996  HOH A O   1 
HETATM 1307 O O   . HOH C 3 .   ? -5.997 7.578   -15.180 1.00 56.75 ? 997  HOH A O   1 
HETATM 1308 O O   . HOH C 3 .   ? 27.670 -17.229 5.174   1.00 42.70 ? 998  HOH A O   1 
HETATM 1309 O O   . HOH C 3 .   ? 13.263 5.696   -19.606 1.00 57.99 ? 999  HOH A O   1 
HETATM 1310 O O   . HOH C 3 .   ? -0.403 -5.370  -17.536 1.00 45.51 ? 1000 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 1   ? 0.4054 0.4600 0.3690 0.0269  -0.0313 -0.0344 4   VAL A N   
2    C CA  . VAL A 1   ? 0.3965 0.4455 0.3688 0.0228  -0.0358 -0.0369 4   VAL A CA  
3    C C   . VAL A 1   ? 0.3720 0.4204 0.3504 0.0180  -0.0356 -0.0335 4   VAL A C   
4    O O   . VAL A 1   ? 0.3374 0.3844 0.3164 0.0143  -0.0312 -0.0280 4   VAL A O   
5    C CB  . VAL A 1   ? 0.4044 0.4481 0.3789 0.0200  -0.0345 -0.0355 4   VAL A CB  
6    C CG1 . VAL A 1   ? 0.4423 0.4852 0.4154 0.0166  -0.0283 -0.0287 4   VAL A CG1 
7    C CG2 . VAL A 1   ? 0.4292 0.4674 0.4133 0.0160  -0.0394 -0.0373 4   VAL A CG2 
8    N N   . ALA A 2   ? 0.3566 0.4065 0.3395 0.0183  -0.0407 -0.0372 5   ALA A N   
9    C CA  . ALA A 2   ? 0.3495 0.4005 0.3387 0.0143  -0.0408 -0.0341 5   ALA A CA  
10   C C   . ALA A 2   ? 0.3348 0.3889 0.3184 0.0144  -0.0347 -0.0286 5   ALA A C   
11   O O   . ALA A 2   ? 0.3433 0.3963 0.3298 0.0104  -0.0316 -0.0237 5   ALA A O   
12   C CB  . ALA A 2   ? 0.3506 0.3970 0.3496 0.0083  -0.0419 -0.0314 5   ALA A CB  
13   N N   . ALA A 3   ? 0.2844 0.3424 0.2597 0.0194  -0.0331 -0.0294 6   ALA A N   
14   C CA  . ALA A 3   ? 0.2784 0.3390 0.2484 0.0202  -0.0280 -0.0246 6   ALA A CA  
15   C C   . ALA A 3   ? 0.2546 0.3129 0.2204 0.0198  -0.0228 -0.0205 6   ALA A C   
16   O O   . ALA A 3   ? 0.2469 0.3070 0.2079 0.0214  -0.0192 -0.0170 6   ALA A O   
17   C CB  . ALA A 3   ? 0.2829 0.3442 0.2577 0.0167  -0.0272 -0.0213 6   ALA A CB  
18   N N   . ILE A 4   ? 0.2385 0.2924 0.2066 0.0174  -0.0228 -0.0208 7   ILE A N   
19   C CA  . ILE A 4   ? 0.2133 0.2649 0.1789 0.0163  -0.0183 -0.0169 7   ILE A CA  
20   C C   . ILE A 4   ? 0.2207 0.2743 0.1806 0.0204  -0.0171 -0.0177 7   ILE A C   
21   O O   . ILE A 4   ? 0.2668 0.3207 0.2265 0.0225  -0.0199 -0.0219 7   ILE A O   
22   C CB  . ILE A 4   ? 0.1977 0.2443 0.1684 0.0118  -0.0182 -0.0158 7   ILE A CB  
23   C CG1 . ILE A 4   ? 0.1993 0.2457 0.1761 0.0083  -0.0193 -0.0143 7   ILE A CG1 
24   C CG2 . ILE A 4   ? 0.1943 0.2388 0.1625 0.0108  -0.0139 -0.0121 7   ILE A CG2 
25   C CD1 . ILE A 4   ? 0.2128 0.2616 0.1877 0.0083  -0.0165 -0.0108 7   ILE A CD1 
26   N N   . LYS A 5   ? 0.2104 0.2659 0.1664 0.0216  -0.0130 -0.0134 8   LYS A N   
27   C CA  . LYS A 5   ? 0.2141 0.2733 0.1654 0.0254  -0.0108 -0.0122 8   LYS A CA  
28   C C   . LYS A 5   ? 0.2041 0.2602 0.1567 0.0233  -0.0084 -0.0102 8   LYS A C   
29   O O   . LYS A 5   ? 0.2273 0.2860 0.1776 0.0260  -0.0082 -0.0113 8   LYS A O   
30   C CB  . LYS A 5   ? 0.2387 0.3017 0.1867 0.0276  -0.0076 -0.0075 8   LYS A CB  
31   C CG  . LYS A 5   ? 0.2815 0.3498 0.2254 0.0315  -0.0047 -0.0043 8   LYS A CG  
32   C CD  . LYS A 5   ? 0.3156 0.3868 0.2577 0.0330  -0.0019 0.0013  8   LYS A CD  
33   C CE  . LYS A 5   ? 0.3540 0.4311 0.2935 0.0364  0.0016  0.0063  8   LYS A CE  
34   N NZ  . LYS A 5   ? 0.4709 0.5445 0.4142 0.0328  0.0042  0.0098  8   LYS A NZ  
35   N N   A SER A 6   ? 0.1792 0.2304 0.1351 0.0188  -0.0069 -0.0076 9   SER A N   
36   N N   B SER A 6   ? 0.1853 0.2365 0.1411 0.0188  -0.0068 -0.0075 9   SER A N   
37   C CA  A SER A 6   ? 0.1745 0.2227 0.1320 0.0165  -0.0050 -0.0057 9   SER A CA  
38   C CA  B SER A 6   ? 0.1874 0.2357 0.1449 0.0166  -0.0049 -0.0057 9   SER A CA  
39   C C   A SER A 6   ? 0.1621 0.2052 0.1236 0.0122  -0.0052 -0.0051 9   SER A C   
40   C C   B SER A 6   ? 0.1715 0.2146 0.1328 0.0122  -0.0047 -0.0046 9   SER A C   
41   O O   A SER A 6   ? 0.1558 0.1984 0.1182 0.0111  -0.0054 -0.0042 9   SER A O   
42   O O   B SER A 6   ? 0.1756 0.2182 0.1375 0.0112  -0.0043 -0.0029 9   SER A O   
43   C CB  A SER A 6   ? 0.1831 0.2335 0.1392 0.0175  -0.0013 -0.0008 9   SER A CB  
44   C CB  B SER A 6   ? 0.1946 0.2456 0.1503 0.0180  -0.0014 -0.0011 9   SER A CB  
45   O OG  A SER A 6   ? 0.1851 0.2330 0.1434 0.0154  0.0002  0.0007  9   SER A OG  
46   O OG  B SER A 6   ? 0.2506 0.3002 0.2072 0.0166  0.0004  0.0027  9   SER A OG  
47   N N   . PHE A 7   ? 0.1707 0.2107 0.1343 0.0102  -0.0051 -0.0054 10  PHE A N   
48   C CA  . PHE A 7   ? 0.1624 0.1985 0.1292 0.0068  -0.0050 -0.0045 10  PHE A CA  
49   C C   . PHE A 7   ? 0.1828 0.2169 0.1502 0.0059  -0.0038 -0.0038 10  PHE A C   
50   O O   . PHE A 7   ? 0.1818 0.2158 0.1494 0.0065  -0.0049 -0.0060 10  PHE A O   
51   C CB  . PHE A 7   ? 0.1723 0.2074 0.1423 0.0053  -0.0080 -0.0068 10  PHE A CB  
52   C CG  . PHE A 7   ? 0.1743 0.2074 0.1476 0.0025  -0.0076 -0.0049 10  PHE A CG  
53   C CD1 . PHE A 7   ? 0.1756 0.2090 0.1481 0.0021  -0.0056 -0.0024 10  PHE A CD1 
54   C CD2 . PHE A 7   ? 0.1920 0.2234 0.1694 0.0005  -0.0094 -0.0056 10  PHE A CD2 
55   C CE1 . PHE A 7   ? 0.2092 0.2421 0.1840 0.0005  -0.0052 -0.0008 10  PHE A CE1 
56   C CE2 . PHE A 7   ? 0.2021 0.2331 0.1823 -0.0015 -0.0087 -0.0030 10  PHE A CE2 
57   C CZ  . PHE A 7   ? 0.1800 0.2123 0.1584 -0.0012 -0.0065 -0.0008 10  PHE A CZ  
58   N N   . GLU A 8   ? 0.1643 0.1970 0.1323 0.0047  -0.0018 -0.0012 11  GLU A N   
59   C CA  . GLU A 8   ? 0.1916 0.2230 0.1607 0.0040  -0.0008 -0.0006 11  GLU A CA  
60   C C   . GLU A 8   ? 0.1871 0.2155 0.1580 0.0022  -0.0002 0.0008  11  GLU A C   
61   O O   . GLU A 8   ? 0.1744 0.2023 0.1452 0.0022  0.0000  0.0019  11  GLU A O   
62   C CB  . GLU A 8   ? 0.2244 0.2589 0.1924 0.0058  0.0009  0.0012  11  GLU A CB  
63   C CG  . GLU A 8   ? 0.2718 0.3068 0.2402 0.0059  0.0025  0.0048  11  GLU A CG  
64   C CD  . GLU A 8   ? 0.3790 0.4185 0.3474 0.0077  0.0045  0.0079  11  GLU A CD  
65   O OE1 . GLU A 8   ? 0.4156 0.4577 0.3839 0.0086  0.0050  0.0074  11  GLU A OE1 
66   O OE2 . GLU A 8   ? 0.4946 0.5355 0.4632 0.0084  0.0057  0.0113  11  GLU A OE2 
67   N N   . VAL A 9   ? 0.1715 0.1984 0.1438 0.0013  -0.0002 0.0003  12  VAL A N   
68   C CA  . VAL A 9   ? 0.1834 0.2081 0.1574 0.0003  -0.0001 0.0010  12  VAL A CA  
69   C C   . VAL A 9   ? 0.1895 0.2146 0.1653 0.0003  0.0010  0.0027  12  VAL A C   
70   O O   . VAL A 9   ? 0.1958 0.2229 0.1719 0.0007  0.0016  0.0029  12  VAL A O   
71   C CB  . VAL A 9   ? 0.1797 0.2031 0.1545 -0.0004 -0.0009 -0.0003 12  VAL A CB  
72   C CG1 . VAL A 9   ? 0.1868 0.2086 0.1630 -0.0006 -0.0011 -0.0003 12  VAL A CG1 
73   C CG2 . VAL A 9   ? 0.2012 0.2248 0.1757 -0.0007 -0.0017 -0.0006 12  VAL A CG2 
74   N N   . VAL A 10  ? 0.1908 0.2143 0.1685 0.0000  0.0009  0.0041  13  VAL A N   
75   C CA  . VAL A 10  ? 0.2010 0.2248 0.1824 -0.0006 0.0015  0.0066  13  VAL A CA  
76   C C   . VAL A 10  ? 0.1971 0.2173 0.1819 -0.0015 -0.0002 0.0057  13  VAL A C   
77   O O   . VAL A 10  ? 0.2227 0.2403 0.2073 -0.0009 -0.0016 0.0047  13  VAL A O   
78   C CB  . VAL A 10  ? 0.2147 0.2397 0.1966 0.0001  0.0025  0.0099  13  VAL A CB  
79   C CG1 . VAL A 10  ? 0.2956 0.3209 0.2831 -0.0009 0.0030  0.0137  13  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.2445 0.2739 0.2225 0.0019  0.0038  0.0103  13  VAL A CG2 
81   N N   . PHE A 11  ? 0.1891 0.2095 0.1769 -0.0024 -0.0005 0.0055  14  PHE A N   
82   C CA  . PHE A 11  ? 0.1922 0.2094 0.1839 -0.0029 -0.0028 0.0040  14  PHE A CA  
83   C C   . PHE A 11  ? 0.2153 0.2310 0.2129 -0.0039 -0.0035 0.0069  14  PHE A C   
84   O O   . PHE A 11  ? 0.2361 0.2547 0.2363 -0.0047 -0.0016 0.0109  14  PHE A O   
85   C CB  . PHE A 11  ? 0.1941 0.2123 0.1874 -0.0035 -0.0032 0.0026  14  PHE A CB  
86   C CG  . PHE A 11  ? 0.1921 0.2111 0.1805 -0.0025 -0.0028 0.0003  14  PHE A CG  
87   C CD1 . PHE A 11  ? 0.1767 0.1942 0.1623 -0.0013 -0.0041 -0.0020 14  PHE A CD1 
88   C CD2 . PHE A 11  ? 0.2181 0.2397 0.2049 -0.0025 -0.0013 0.0007  14  PHE A CD2 
89   C CE1 . PHE A 11  ? 0.2154 0.2340 0.1977 -0.0006 -0.0037 -0.0029 14  PHE A CE1 
90   C CE2 . PHE A 11  ? 0.1939 0.2155 0.1774 -0.0018 -0.0015 -0.0010 14  PHE A CE2 
91   C CZ  . PHE A 11  ? 0.2114 0.2314 0.1930 -0.0012 -0.0026 -0.0024 14  PHE A CZ  
92   N N   . ASN A 12  ? 0.2096 0.2211 0.2098 -0.0036 -0.0064 0.0050  15  ASN A N   
93   C CA  . ASN A 12  ? 0.2341 0.2427 0.2410 -0.0046 -0.0080 0.0075  15  ASN A CA  
94   C C   . ASN A 12  ? 0.2573 0.2675 0.2722 -0.0070 -0.0078 0.0109  15  ASN A C   
95   O O   . ASN A 12  ? 0.2722 0.2832 0.2926 -0.0083 -0.0070 0.0159  15  ASN A O   
96   C CB  . ASN A 12  ? 0.2417 0.2451 0.2499 -0.0031 -0.0121 0.0035  15  ASN A CB  
97   C CG  . ASN A 12  ? 0.2629 0.2656 0.2644 -0.0005 -0.0120 0.0017  15  ASN A CG  
98   O OD1 . ASN A 12  ? 0.3067 0.3122 0.3043 -0.0004 -0.0092 0.0039  15  ASN A OD1 
99   N ND2 . ASN A 12  ? 0.2871 0.2870 0.2878 0.0019  -0.0154 -0.0027 15  ASN A ND2 
100  N N   . ASP A 13  ? 0.2479 0.2591 0.2638 -0.0075 -0.0086 0.0085  16  ASP A N   
101  C CA  . ASP A 13  ? 0.2646 0.2792 0.2872 -0.0096 -0.0078 0.0116  16  ASP A CA  
102  C C   . ASP A 13  ? 0.2637 0.2835 0.2806 -0.0087 -0.0047 0.0112  16  ASP A C   
103  O O   . ASP A 13  ? 0.2536 0.2729 0.2676 -0.0080 -0.0058 0.0073  16  ASP A O   
104  C CB  . ASP A 13  ? 0.2636 0.2752 0.2935 -0.0106 -0.0119 0.0090  16  ASP A CB  
105  C CG  . ASP A 13  ? 0.3104 0.3262 0.3491 -0.0132 -0.0112 0.0130  16  ASP A CG  
106  O OD1 . ASP A 13  ? 0.3227 0.3445 0.3604 -0.0135 -0.0071 0.0175  16  ASP A OD1 
107  O OD2 . ASP A 13  ? 0.3461 0.3596 0.3929 -0.0145 -0.0150 0.0115  16  ASP A OD2 
108  N N   . PRO A 14  ? 0.2765 0.3013 0.2916 -0.0084 -0.0013 0.0152  17  PRO A N   
109  C CA  . PRO A 14  ? 0.2913 0.3207 0.3008 -0.0069 0.0011  0.0143  17  PRO A CA  
110  C C   . PRO A 14  ? 0.2729 0.3054 0.2861 -0.0076 0.0010  0.0140  17  PRO A C   
111  O O   . PRO A 14  ? 0.2842 0.3187 0.2926 -0.0061 0.0019  0.0117  17  PRO A O   
112  C CB  . PRO A 14  ? 0.3013 0.3360 0.3094 -0.0058 0.0042  0.0189  17  PRO A CB  
113  C CG  . PRO A 14  ? 0.3303 0.3646 0.3460 -0.0076 0.0040  0.0238  17  PRO A CG  
114  C CD  . PRO A 14  ? 0.3130 0.3395 0.3309 -0.0087 0.0004  0.0206  17  PRO A CD  
115  N N   . GLU A 15  ? 0.2495 0.2819 0.2716 -0.0097 -0.0004 0.0161  18  GLU A N   
116  C CA  . GLU A 15  ? 0.2306 0.2665 0.2572 -0.0104 -0.0007 0.0160  18  GLU A CA  
117  C C   . GLU A 15  ? 0.2119 0.2432 0.2392 -0.0106 -0.0043 0.0107  18  GLU A C   
118  O O   . GLU A 15  ? 0.2125 0.2463 0.2427 -0.0108 -0.0049 0.0097  18  GLU A O   
119  C CB  . GLU A 15  ? 0.2414 0.2820 0.2788 -0.0126 0.0001  0.0223  18  GLU A CB  
120  C CG  . GLU A 15  ? 0.3182 0.3650 0.3555 -0.0119 0.0040  0.0287  18  GLU A CG  
121  C CD  . GLU A 15  ? 0.4160 0.4670 0.4428 -0.0083 0.0070  0.0273  18  GLU A CD  
122  O OE1 . GLU A 15  ? 0.4370 0.4892 0.4595 -0.0068 0.0087  0.0292  18  GLU A OE1 
123  O OE2 . GLU A 15  ? 0.4809 0.5340 0.5041 -0.0068 0.0072  0.0240  18  GLU A OE2 
124  N N   . LYS A 16  ? 0.1994 0.2246 0.2240 -0.0100 -0.0069 0.0072  19  LYS A N   
125  C CA  . LYS A 16  ? 0.1797 0.2015 0.2050 -0.0094 -0.0106 0.0022  19  LYS A CA  
126  C C   . LYS A 16  ? 0.1780 0.2015 0.1963 -0.0074 -0.0097 -0.0009 19  LYS A C   
127  O O   . LYS A 16  ? 0.2109 0.2349 0.2219 -0.0061 -0.0075 -0.0010 19  LYS A O   
128  C CB  . LYS A 16  ? 0.1972 0.2133 0.2206 -0.0083 -0.0134 -0.0008 19  LYS A CB  
129  C CG  . LYS A 16  ? 0.2237 0.2372 0.2481 -0.0067 -0.0178 -0.0062 19  LYS A CG  
130  C CD  . LYS A 16  ? 0.3139 0.3223 0.3381 -0.0053 -0.0211 -0.0089 19  LYS A CD  
131  C CE  . LYS A 16  ? 0.3889 0.3957 0.4114 -0.0021 -0.0253 -0.0150 19  LYS A CE  
132  N NZ  . LYS A 16  ? 0.4538 0.4593 0.4861 -0.0033 -0.0298 -0.0169 19  LYS A NZ  
133  N N   . VAL A 17  ? 0.1725 0.1967 0.1940 -0.0073 -0.0119 -0.0032 20  VAL A N   
134  C CA  . VAL A 17  ? 0.1848 0.2098 0.2006 -0.0052 -0.0119 -0.0063 20  VAL A CA  
135  C C   . VAL A 17  ? 0.2024 0.2242 0.2173 -0.0033 -0.0158 -0.0108 20  VAL A C   
136  O O   . VAL A 17  ? 0.2236 0.2440 0.2453 -0.0040 -0.0193 -0.0124 20  VAL A O   
137  C CB  . VAL A 17  ? 0.1931 0.2226 0.2130 -0.0057 -0.0115 -0.0056 20  VAL A CB  
138  C CG1 . VAL A 17  ? 0.1919 0.2218 0.2063 -0.0033 -0.0119 -0.0086 20  VAL A CG1 
139  C CG2 . VAL A 17  ? 0.2495 0.2835 0.2700 -0.0065 -0.0078 -0.0013 20  VAL A CG2 
140  N N   . TYR A 18  ? 0.1885 0.2096 0.1956 -0.0008 -0.0154 -0.0128 21  TYR A N   
141  C CA  . TYR A 18  ? 0.2017 0.2208 0.2064 0.0020  -0.0185 -0.0165 21  TYR A CA  
142  C C   . TYR A 18  ? 0.2103 0.2313 0.2135 0.0046  -0.0206 -0.0198 21  TYR A C   
143  O O   . TYR A 18  ? 0.2294 0.2527 0.2297 0.0050  -0.0187 -0.0187 21  TYR A O   
144  C CB  . TYR A 18  ? 0.2067 0.2252 0.2042 0.0035  -0.0166 -0.0158 21  TYR A CB  
145  C CG  . TYR A 18  ? 0.2080 0.2249 0.2063 0.0014  -0.0147 -0.0129 21  TYR A CG  
146  C CD1 . TYR A 18  ? 0.1886 0.2070 0.1855 -0.0004 -0.0112 -0.0096 21  TYR A CD1 
147  C CD2 . TYR A 18  ? 0.2076 0.2216 0.2082 0.0015  -0.0167 -0.0137 21  TYR A CD2 
148  C CE1 . TYR A 18  ? 0.1918 0.2095 0.1891 -0.0017 -0.0095 -0.0070 21  TYR A CE1 
149  C CE2 . TYR A 18  ? 0.2067 0.2196 0.2080 -0.0002 -0.0149 -0.0107 21  TYR A CE2 
150  C CZ  . TYR A 18  ? 0.2105 0.2257 0.2101 -0.0018 -0.0112 -0.0072 21  TYR A CZ  
151  O OH  . TYR A 18  ? 0.2274 0.2421 0.2272 -0.0029 -0.0096 -0.0044 21  TYR A OH  
152  N N   . GLY A 19  ? 0.2218 0.2417 0.2268 0.0069  -0.0249 -0.0239 22  GLY A N   
153  C CA  . GLY A 19  ? 0.2275 0.2498 0.2305 0.0104  -0.0274 -0.0275 22  GLY A CA  
154  C C   . GLY A 19  ? 0.2338 0.2571 0.2298 0.0154  -0.0287 -0.0302 22  GLY A C   
155  O O   . GLY A 19  ? 0.2294 0.2514 0.2222 0.0159  -0.0277 -0.0293 22  GLY A O   
156  N N   . SER A 20  ? 0.2411 0.2675 0.2344 0.0194  -0.0310 -0.0334 23  SER A N   
157  C CA  . SER A 20  ? 0.2572 0.2866 0.2432 0.0252  -0.0320 -0.0356 23  SER A CA  
158  C C   . SER A 20  ? 0.2589 0.2859 0.2455 0.0273  -0.0353 -0.0391 23  SER A C   
159  O O   . SER A 20  ? 0.2519 0.2753 0.2454 0.0263  -0.0397 -0.0427 23  SER A O   
160  C CB  . SER A 20  ? 0.2581 0.2915 0.2424 0.0298  -0.0350 -0.0392 23  SER A CB  
161  O OG  . SER A 20  ? 0.3174 0.3530 0.3008 0.0284  -0.0320 -0.0359 23  SER A OG  
162  N N   . GLY A 21  ? 0.2545 0.2837 0.2346 0.0301  -0.0332 -0.0377 24  GLY A N   
163  C CA  . GLY A 21  ? 0.2699 0.2981 0.2487 0.0336  -0.0362 -0.0412 24  GLY A CA  
164  C C   . GLY A 21  ? 0.2866 0.3087 0.2704 0.0292  -0.0361 -0.0401 24  GLY A C   
165  O O   . GLY A 21  ? 0.3048 0.3253 0.2881 0.0320  -0.0388 -0.0431 24  GLY A O   
166  N N   . GLU A 22  ? 0.2594 0.2789 0.2480 0.0230  -0.0332 -0.0357 25  GLU A N   
167  C CA  . GLU A 22  ? 0.2427 0.2572 0.2367 0.0189  -0.0330 -0.0339 25  GLU A CA  
168  C C   . GLU A 22  ? 0.2425 0.2576 0.2315 0.0184  -0.0289 -0.0301 25  GLU A C   
169  O O   . GLU A 22  ? 0.2562 0.2751 0.2397 0.0187  -0.0251 -0.0271 25  GLU A O   
170  C CB  . GLU A 22  ? 0.2454 0.2582 0.2469 0.0133  -0.0318 -0.0308 25  GLU A CB  
171  C CG  . GLU A 22  ? 0.2779 0.2896 0.2868 0.0132  -0.0366 -0.0345 25  GLU A CG  
172  C CD  . GLU A 22  ? 0.3120 0.3231 0.3293 0.0078  -0.0354 -0.0308 25  GLU A CD  
173  O OE1 . GLU A 22  ? 0.3416 0.3545 0.3574 0.0050  -0.0304 -0.0258 25  GLU A OE1 
174  O OE2 . GLU A 22  ? 0.4719 0.4816 0.4981 0.0067  -0.0397 -0.0331 25  GLU A OE2 
175  N N   . LYS A 23  ? 0.2581 0.2693 0.2499 0.0175  -0.0301 -0.0302 26  LYS A N   
176  C CA  . LYS A 23  ? 0.2597 0.2712 0.2479 0.0168  -0.0267 -0.0268 26  LYS A CA  
177  C C   . LYS A 23  ? 0.2504 0.2613 0.2409 0.0115  -0.0225 -0.0215 26  LYS A C   
178  O O   . LYS A 23  ? 0.2510 0.2593 0.2480 0.0081  -0.0231 -0.0202 26  LYS A O   
179  C CB  . LYS A 23  ? 0.2886 0.2962 0.2788 0.0184  -0.0298 -0.0290 26  LYS A CB  
180  C CG  . LYS A 23  ? 0.3231 0.3321 0.3083 0.0191  -0.0268 -0.0265 26  LYS A CG  
181  C CD  . LYS A 23  ? 0.4048 0.4100 0.3915 0.0216  -0.0304 -0.0293 26  LYS A CD  
182  C CE  . LYS A 23  ? 0.5008 0.4996 0.4959 0.0173  -0.0318 -0.0274 26  LYS A CE  
183  N NZ  . LYS A 23  ? 0.5814 0.5755 0.5788 0.0199  -0.0359 -0.0302 26  LYS A NZ  
184  N N   . VAL A 24  ? 0.2189 0.2327 0.2042 0.0111  -0.0186 -0.0184 27  VAL A N   
185  C CA  . VAL A 24  ? 0.2046 0.2182 0.1909 0.0072  -0.0151 -0.0141 27  VAL A CA  
186  C C   . VAL A 24  ? 0.2306 0.2434 0.2153 0.0076  -0.0143 -0.0129 27  VAL A C   
187  O O   . VAL A 24  ? 0.2366 0.2518 0.2165 0.0101  -0.0137 -0.0132 27  VAL A O   
188  C CB  . VAL A 24  ? 0.1966 0.2135 0.1791 0.0067  -0.0121 -0.0120 27  VAL A CB  
189  C CG1 . VAL A 24  ? 0.1890 0.2058 0.1722 0.0037  -0.0093 -0.0087 27  VAL A CG1 
190  C CG2 . VAL A 24  ? 0.2017 0.2199 0.1850 0.0072  -0.0129 -0.0133 27  VAL A CG2 
191  N N   . ALA A 25  ? 0.2233 0.2331 0.2122 0.0053  -0.0145 -0.0113 28  ALA A N   
192  C CA  . ALA A 25  ? 0.2296 0.2382 0.2174 0.0058  -0.0141 -0.0101 28  ALA A CA  
193  C C   . ALA A 25  ? 0.2047 0.2140 0.1933 0.0029  -0.0110 -0.0059 28  ALA A C   
194  O O   . ALA A 25  ? 0.2106 0.2200 0.2030 0.0006  -0.0101 -0.0039 28  ALA A O   
195  C CB  . ALA A 25  ? 0.2667 0.2708 0.2590 0.0069  -0.0180 -0.0122 28  ALA A CB  
196  N N   . GLY A 26  ? 0.1833 0.1939 0.1684 0.0036  -0.0094 -0.0047 29  GLY A N   
197  C CA  . GLY A 26  ? 0.1759 0.1878 0.1607 0.0018  -0.0068 -0.0013 29  GLY A CA  
198  C C   . GLY A 26  ? 0.1838 0.1968 0.1652 0.0030  -0.0060 -0.0006 29  GLY A C   
199  O O   . GLY A 26  ? 0.1948 0.2071 0.1746 0.0052  -0.0075 -0.0024 29  GLY A O   
200  N N   . ARG A 27  ? 0.1707 0.1859 0.1509 0.0020  -0.0039 0.0017  30  ARG A N   
201  C CA  . ARG A 27  ? 0.1557 0.1727 0.1328 0.0031  -0.0031 0.0023  30  ARG A CA  
202  C C   . ARG A 27  ? 0.1586 0.1789 0.1335 0.0023  -0.0016 0.0027  30  ARG A C   
203  O O   . ARG A 27  ? 0.1720 0.1930 0.1476 0.0013  -0.0007 0.0033  30  ARG A O   
204  C CB  . ARG A 27  ? 0.1819 0.1977 0.1604 0.0033  -0.0029 0.0048  30  ARG A CB  
205  C CG  . ARG A 27  ? 0.2240 0.2357 0.2056 0.0042  -0.0052 0.0043  30  ARG A CG  
206  C CD  . ARG A 27  ? 0.3162 0.3265 0.3010 0.0037  -0.0047 0.0081  30  ARG A CD  
207  N NE  . ARG A 27  ? 0.2862 0.2979 0.2746 0.0016  -0.0033 0.0111  30  ARG A NE  
208  C CZ  . ARG A 27  ? 0.3905 0.4034 0.3818 0.0011  -0.0019 0.0157  30  ARG A CZ  
209  N NH1 . ARG A 27  ? 0.3743 0.3865 0.3652 0.0024  -0.0020 0.0179  30  ARG A NH1 
210  N NH2 . ARG A 27  ? 0.3896 0.4052 0.3842 -0.0004 -0.0004 0.0187  30  ARG A NH2 
211  N N   . VAL A 28  ? 0.1484 0.1708 0.1210 0.0030  -0.0015 0.0022  31  VAL A N   
212  C CA  . VAL A 28  ? 0.1534 0.1784 0.1250 0.0025  -0.0010 0.0024  31  VAL A CA  
213  C C   . VAL A 28  ? 0.1581 0.1843 0.1285 0.0035  -0.0006 0.0035  31  VAL A C   
214  O O   . VAL A 28  ? 0.1730 0.1990 0.1428 0.0047  -0.0009 0.0039  31  VAL A O   
215  C CB  . VAL A 28  ? 0.1461 0.1732 0.1175 0.0023  -0.0014 0.0018  31  VAL A CB  
216  C CG1 . VAL A 28  ? 0.1594 0.1885 0.1312 0.0015  -0.0018 0.0016  31  VAL A CG1 
217  C CG2 . VAL A 28  ? 0.1675 0.1940 0.1398 0.0018  -0.0016 0.0013  31  VAL A CG2 
218  N N   . ILE A 29  ? 0.1428 0.1706 0.1125 0.0037  0.0001  0.0041  32  ILE A N   
219  C CA  . ILE A 29  ? 0.1819 0.2116 0.1502 0.0052  0.0005  0.0056  32  ILE A CA  
220  C C   . ILE A 29  ? 0.1860 0.2191 0.1525 0.0060  -0.0001 0.0040  32  ILE A C   
221  O O   . ILE A 29  ? 0.1786 0.2125 0.1450 0.0058  -0.0006 0.0024  32  ILE A O   
222  C CB  . ILE A 29  ? 0.2039 0.2339 0.1732 0.0056  0.0019  0.0084  32  ILE A CB  
223  C CG1 . ILE A 29  ? 0.2502 0.2761 0.2229 0.0045  0.0016  0.0096  32  ILE A CG1 
224  C CG2 . ILE A 29  ? 0.1966 0.2293 0.1641 0.0077  0.0027  0.0107  32  ILE A CG2 
225  C CD1 . ILE A 29  ? 0.2755 0.3016 0.2513 0.0040  0.0028  0.0130  32  ILE A CD1 
226  N N   . VAL A 30  ? 0.1731 0.2080 0.1385 0.0072  -0.0006 0.0041  33  VAL A N   
227  C CA  . VAL A 30  ? 0.1616 0.1998 0.1260 0.0082  -0.0020 0.0023  33  VAL A CA  
228  C C   . VAL A 30  ? 0.1745 0.2156 0.1361 0.0110  -0.0014 0.0037  33  VAL A C   
229  O O   . VAL A 30  ? 0.1890 0.2294 0.1503 0.0117  -0.0005 0.0060  33  VAL A O   
230  C CB  . VAL A 30  ? 0.1776 0.2167 0.1439 0.0071  -0.0034 0.0011  33  VAL A CB  
231  C CG1 . VAL A 30  ? 0.2021 0.2440 0.1693 0.0074  -0.0057 -0.0013 33  VAL A CG1 
232  C CG2 . VAL A 30  ? 0.1785 0.2155 0.1474 0.0049  -0.0034 0.0012  33  VAL A CG2 
233  N N   . GLU A 31  ? 0.1696 0.2142 0.1293 0.0130  -0.0021 0.0021  34  GLU A N   
234  C CA  . GLU A 31  ? 0.1938 0.2427 0.1504 0.0163  -0.0020 0.0030  34  GLU A CA  
235  C C   . GLU A 31  ? 0.1882 0.2401 0.1443 0.0176  -0.0050 -0.0012 34  GLU A C   
236  O O   . GLU A 31  ? 0.1941 0.2452 0.1518 0.0167  -0.0069 -0.0044 34  GLU A O   
237  C CB  . GLU A 31  ? 0.2004 0.2522 0.1547 0.0188  0.0000  0.0055  34  GLU A CB  
238  C CG  . GLU A 31  ? 0.2745 0.3235 0.2310 0.0172  0.0025  0.0100  34  GLU A CG  
239  C CD  . GLU A 31  ? 0.3458 0.3991 0.3013 0.0194  0.0047  0.0135  34  GLU A CD  
240  O OE1 . GLU A 31  ? 0.4623 0.5201 0.4150 0.0220  0.0043  0.0113  34  GLU A OE1 
241  O OE2 . GLU A 31  ? 0.4598 0.5121 0.4176 0.0188  0.0067  0.0185  34  GLU A OE2 
242  N N   . VAL A 32  ? 0.1904 0.2456 0.1449 0.0198  -0.0057 -0.0012 35  VAL A N   
243  C CA  . VAL A 32  ? 0.1896 0.2480 0.1444 0.0212  -0.0092 -0.0055 35  VAL A CA  
244  C C   . VAL A 32  ? 0.2080 0.2721 0.1579 0.0264  -0.0097 -0.0060 35  VAL A C   
245  O O   . VAL A 32  ? 0.2292 0.2952 0.1762 0.0285  -0.0070 -0.0019 35  VAL A O   
246  C CB  . VAL A 32  ? 0.1838 0.2419 0.1423 0.0190  -0.0107 -0.0059 35  VAL A CB  
247  C CG1 . VAL A 32  ? 0.2072 0.2610 0.1699 0.0148  -0.0102 -0.0050 35  VAL A CG1 
248  C CG2 . VAL A 32  ? 0.1881 0.2477 0.1443 0.0207  -0.0089 -0.0027 35  VAL A CG2 
249  N N   . CYS A 33  ? 0.2346 0.3018 0.1843 0.0286  -0.0134 -0.0110 36  CYS A N   
250  C CA  . CYS A 33  ? 0.2506 0.3244 0.1953 0.0344  -0.0145 -0.0125 36  CYS A CA  
251  C C   . CYS A 33  ? 0.2562 0.3327 0.2017 0.0353  -0.0169 -0.0138 36  CYS A C   
252  O O   . CYS A 33  ? 0.2754 0.3576 0.2165 0.0403  -0.0175 -0.0143 36  CYS A O   
253  C CB  . CYS A 33  ? 0.2644 0.3407 0.2077 0.0377  -0.0181 -0.0182 36  CYS A CB  
254  S SG  . CYS A 33  ? 0.3903 0.4670 0.3306 0.0393  -0.0152 -0.0166 36  CYS A SG  
255  N N   . GLU A 34  ? 0.2563 0.3295 0.2076 0.0308  -0.0182 -0.0143 37  GLU A N   
256  C CA  . GLU A 34  ? 0.2632 0.3392 0.2164 0.0310  -0.0202 -0.0151 37  GLU A CA  
257  C C   . GLU A 34  ? 0.2468 0.3196 0.2054 0.0261  -0.0191 -0.0126 37  GLU A C   
258  O O   . GLU A 34  ? 0.2443 0.3125 0.2059 0.0223  -0.0179 -0.0114 37  GLU A O   
259  C CB  . GLU A 34  ? 0.2838 0.3629 0.2399 0.0325  -0.0259 -0.0214 37  GLU A CB  
260  C CG  . GLU A 34  ? 0.2918 0.3666 0.2547 0.0284  -0.0290 -0.0245 37  GLU A CG  
261  C CD  . GLU A 34  ? 0.3533 0.4302 0.3186 0.0308  -0.0353 -0.0314 37  GLU A CD  
262  O OE1 . GLU A 34  ? 0.3566 0.4386 0.3164 0.0366  -0.0369 -0.0343 37  GLU A OE1 
263  O OE2 . GLU A 34  ? 0.4545 0.5278 0.4273 0.0272  -0.0390 -0.0341 37  GLU A OE2 
264  N N   . VAL A 35  ? 0.2393 0.3151 0.1988 0.0266  -0.0194 -0.0116 38  VAL A N   
265  C CA  . VAL A 35  ? 0.2485 0.3231 0.2124 0.0231  -0.0182 -0.0090 38  VAL A CA  
266  C C   . VAL A 35  ? 0.2473 0.3205 0.2187 0.0187  -0.0204 -0.0105 38  VAL A C   
267  O O   . VAL A 35  ? 0.2549 0.3301 0.2307 0.0183  -0.0246 -0.0141 38  VAL A O   
268  C CB  . VAL A 35  ? 0.2681 0.3476 0.2324 0.0250  -0.0191 -0.0086 38  VAL A CB  
269  C CG1 . VAL A 35  ? 0.2736 0.3530 0.2420 0.0222  -0.0176 -0.0058 38  VAL A CG1 
270  C CG2 . VAL A 35  ? 0.3141 0.3950 0.2714 0.0295  -0.0171 -0.0065 38  VAL A CG2 
271  N N   . THR A 36  ? 0.2186 0.2885 0.1920 0.0156  -0.0179 -0.0076 39  THR A N   
272  C CA  . THR A 36  ? 0.2403 0.3092 0.2210 0.0114  -0.0193 -0.0076 39  THR A CA  
273  C C   . THR A 36  ? 0.2399 0.3087 0.2221 0.0095  -0.0163 -0.0035 39  THR A C   
274  O O   . THR A 36  ? 0.2354 0.3019 0.2126 0.0109  -0.0132 -0.0016 39  THR A O   
275  C CB  . THR A 36  ? 0.2477 0.3120 0.2286 0.0103  -0.0204 -0.0097 39  THR A CB  
276  O OG1 . THR A 36  ? 0.2584 0.3217 0.2472 0.0063  -0.0223 -0.0094 39  THR A OG1 
277  C CG2 . THR A 36  ? 0.2447 0.3049 0.2202 0.0108  -0.0166 -0.0077 39  THR A CG2 
278  N N   . ARG A 37  ? 0.2435 0.3154 0.2331 0.0067  -0.0175 -0.0021 40  ARG A N   
279  C CA  . ARG A 37  ? 0.2509 0.3250 0.2424 0.0056  -0.0148 0.0019  40  ARG A CA  
280  C C   . ARG A 37  ? 0.2370 0.3074 0.2304 0.0030  -0.0137 0.0033  40  ARG A C   
281  O O   . ARG A 37  ? 0.2500 0.3194 0.2493 0.0002  -0.0161 0.0027  40  ARG A O   
282  C CB  . ARG A 37  ? 0.2713 0.3527 0.2705 0.0042  -0.0164 0.0036  40  ARG A CB  
283  C CG  . ARG A 37  ? 0.3501 0.4368 0.3506 0.0046  -0.0136 0.0078  40  ARG A CG  
284  C CD  . ARG A 37  ? 0.4382 0.5332 0.4447 0.0045  -0.0151 0.0091  40  ARG A CD  
285  N NE  . ARG A 37  ? 0.5426 0.6442 0.5485 0.0066  -0.0123 0.0126  40  ARG A NE  
286  C CZ  . ARG A 37  ? 0.5652 0.6742 0.5785 0.0048  -0.0115 0.0171  40  ARG A CZ  
287  N NH1 . ARG A 37  ? 0.5750 0.6850 0.5978 0.0004  -0.0135 0.0190  40  ARG A NH1 
288  N NH2 . ARG A 37  ? 0.5786 0.6944 0.5901 0.0079  -0.0089 0.0199  40  ARG A NH2 
289  N N   . VAL A 38  ? 0.2070 0.2754 0.1958 0.0042  -0.0106 0.0049  41  VAL A N   
290  C CA  . VAL A 38  ? 0.2174 0.2825 0.2069 0.0024  -0.0094 0.0062  41  VAL A CA  
291  C C   . VAL A 38  ? 0.2090 0.2787 0.2005 0.0025  -0.0074 0.0099  41  VAL A C   
292  O O   . VAL A 38  ? 0.2312 0.3032 0.2188 0.0055  -0.0057 0.0106  41  VAL A O   
293  C CB  . VAL A 38  ? 0.2095 0.2683 0.1923 0.0039  -0.0079 0.0046  41  VAL A CB  
294  C CG1 . VAL A 38  ? 0.2103 0.2663 0.1937 0.0025  -0.0067 0.0058  41  VAL A CG1 
295  C CG2 . VAL A 38  ? 0.2312 0.2870 0.2123 0.0042  -0.0096 0.0016  41  VAL A CG2 
296  N N   . LYS A 39  ? 0.2039 0.2755 0.2016 -0.0002 -0.0077 0.0125  42  LYS A N   
297  C CA  . LYS A 39  ? 0.2286 0.3060 0.2285 0.0002  -0.0055 0.0169  42  LYS A CA  
298  C C   . LYS A 39  ? 0.2253 0.2998 0.2193 0.0023  -0.0033 0.0167  42  LYS A C   
299  O O   . LYS A 39  ? 0.2335 0.3121 0.2244 0.0055  -0.0015 0.0179  42  LYS A O   
300  C CB  . LYS A 39  ? 0.2338 0.3145 0.2434 -0.0036 -0.0067 0.0206  42  LYS A CB  
301  C CG  . LYS A 39  ? 0.3104 0.3984 0.3231 -0.0032 -0.0042 0.0264  42  LYS A CG  
302  C CD  . LYS A 39  ? 0.4356 0.5292 0.4602 -0.0071 -0.0056 0.0314  42  LYS A CD  
303  C CE  . LYS A 39  ? 0.4060 0.4923 0.4363 -0.0112 -0.0090 0.0298  42  LYS A CE  
304  N NZ  . LYS A 39  ? 0.4801 0.5712 0.5238 -0.0153 -0.0112 0.0347  42  LYS A NZ  
305  N N   . ALA A 40  ? 0.1873 0.2548 0.1798 0.0008  -0.0038 0.0149  43  ALA A N   
306  C CA  . ALA A 40  ? 0.1964 0.2609 0.1845 0.0024  -0.0022 0.0146  43  ALA A CA  
307  C C   . ALA A 40  ? 0.1788 0.2354 0.1646 0.0011  -0.0030 0.0115  43  ALA A C   
308  O O   . ALA A 40  ? 0.1845 0.2386 0.1732 -0.0011 -0.0048 0.0103  43  ALA A O   
309  C CB  . ALA A 40  ? 0.1973 0.2667 0.1893 0.0018  -0.0011 0.0188  43  ALA A CB  
310  N N   . VAL A 41  ? 0.1729 0.2261 0.1538 0.0030  -0.0020 0.0100  44  VAL A N   
311  C CA  . VAL A 41  ? 0.1651 0.2123 0.1446 0.0019  -0.0023 0.0082  44  VAL A CA  
312  C C   . VAL A 41  ? 0.1914 0.2393 0.1704 0.0027  -0.0013 0.0094  44  VAL A C   
313  O O   . VAL A 41  ? 0.2020 0.2517 0.1781 0.0056  -0.0006 0.0093  44  VAL A O   
314  C CB  . VAL A 41  ? 0.1842 0.2267 0.1595 0.0032  -0.0023 0.0056  44  VAL A CB  
315  C CG1 . VAL A 41  ? 0.1733 0.2111 0.1478 0.0022  -0.0022 0.0044  44  VAL A CG1 
316  C CG2 . VAL A 41  ? 0.1980 0.2407 0.1734 0.0029  -0.0032 0.0047  44  VAL A CG2 
317  N N   . ARG A 42  ? 0.1689 0.2156 0.1508 0.0007  -0.0016 0.0105  45  ARG A N   
318  C CA  . ARG A 42  ? 0.2071 0.2550 0.1886 0.0016  -0.0008 0.0120  45  ARG A CA  
319  C C   . ARG A 42  ? 0.2035 0.2457 0.1836 0.0009  -0.0012 0.0098  45  ARG A C   
320  O O   . ARG A 42  ? 0.1958 0.2340 0.1766 -0.0009 -0.0022 0.0080  45  ARG A O   
321  C CB  . ARG A 42  ? 0.2142 0.2667 0.2013 -0.0001 -0.0006 0.0165  45  ARG A CB  
322  C CG  . ARG A 42  ? 0.2448 0.3051 0.2346 0.0007  0.0002  0.0199  45  ARG A CG  
323  C CD  . ARG A 42  ? 0.2821 0.3470 0.2793 -0.0016 0.0003  0.0254  45  ARG A CD  
324  N NE  . ARG A 42  ? 0.3292 0.3901 0.3325 -0.0056 -0.0022 0.0250  45  ARG A NE  
325  C CZ  . ARG A 42  ? 0.3756 0.4318 0.3825 -0.0080 -0.0037 0.0251  45  ARG A CZ  
326  N NH1 . ARG A 42  ? 0.3758 0.4309 0.3808 -0.0071 -0.0027 0.0264  45  ARG A NH1 
327  N NH2 . ARG A 42  ? 0.3501 0.4027 0.3625 -0.0109 -0.0067 0.0238  45  ARG A NH2 
328  N N   . ILE A 43  ? 0.1930 0.2355 0.1708 0.0028  -0.0006 0.0097  46  ILE A N   
329  C CA  . ILE A 43  ? 0.2060 0.2442 0.1834 0.0020  -0.0010 0.0082  46  ILE A CA  
330  C C   . ILE A 43  ? 0.1917 0.2322 0.1705 0.0024  -0.0006 0.0108  46  ILE A C   
331  O O   . ILE A 43  ? 0.1857 0.2319 0.1643 0.0044  0.0003  0.0136  46  ILE A O   
332  C CB  . ILE A 43  ? 0.2371 0.2717 0.2113 0.0035  -0.0014 0.0049  46  ILE A CB  
333  C CG1 . ILE A 43  ? 0.2574 0.2947 0.2289 0.0070  -0.0014 0.0042  46  ILE A CG1 
334  C CG2 . ILE A 43  ? 0.2640 0.2955 0.2377 0.0025  -0.0017 0.0032  46  ILE A CG2 
335  C CD1 . ILE A 43  ? 0.3004 0.3340 0.2706 0.0082  -0.0026 0.0011  46  ILE A CD1 
336  N N   . LEU A 44  ? 0.1722 0.2089 0.1522 0.0009  -0.0013 0.0100  47  LEU A N   
337  C CA  . LEU A 44  ? 0.1761 0.2139 0.1569 0.0014  -0.0011 0.0120  47  LEU A CA  
338  C C   . LEU A 44  ? 0.1634 0.1967 0.1421 0.0017  -0.0017 0.0086  47  LEU A C   
339  O O   . LEU A 44  ? 0.1767 0.2058 0.1563 -0.0001 -0.0025 0.0067  47  LEU A O   
340  C CB  . LEU A 44  ? 0.2053 0.2429 0.1915 -0.0011 -0.0017 0.0154  47  LEU A CB  
341  C CG  . LEU A 44  ? 0.2549 0.2926 0.2428 -0.0009 -0.0017 0.0180  47  LEU A CG  
342  C CD1 . LEU A 44  ? 0.2505 0.2953 0.2368 0.0022  0.0001  0.0218  47  LEU A CD1 
343  C CD2 . LEU A 44  ? 0.2792 0.3148 0.2739 -0.0039 -0.0032 0.0208  47  LEU A CD2 
344  N N   . ALA A 45  ? 0.1548 0.1895 0.1307 0.0044  -0.0016 0.0076  48  ALA A N   
345  C CA  . ALA A 45  ? 0.1716 0.2029 0.1464 0.0046  -0.0024 0.0046  48  ALA A CA  
346  C C   . ALA A 45  ? 0.1959 0.2289 0.1708 0.0059  -0.0024 0.0062  48  ALA A C   
347  O O   . ALA A 45  ? 0.2191 0.2569 0.1925 0.0086  -0.0018 0.0082  48  ALA A O   
348  C CB  . ALA A 45  ? 0.1919 0.2229 0.1643 0.0067  -0.0031 0.0014  48  ALA A CB  
349  N N   . CYS A 46  ? 0.2002 0.2299 0.1766 0.0045  -0.0029 0.0056  49  CYS A N   
350  C CA  . CYS A 46  ? 0.1993 0.2302 0.1762 0.0056  -0.0030 0.0077  49  CYS A CA  
351  C C   . CYS A 46  ? 0.1973 0.2257 0.1736 0.0060  -0.0039 0.0047  49  CYS A C   
352  O O   . CYS A 46  ? 0.2000 0.2252 0.1770 0.0045  -0.0043 0.0020  49  CYS A O   
353  C CB  . CYS A 46  ? 0.2376 0.2674 0.2186 0.0033  -0.0031 0.0112  49  CYS A CB  
354  S SG  . CYS A 46  ? 0.3141 0.3487 0.2976 0.0029  -0.0020 0.0165  49  CYS A SG  
355  N N   . GLY A 47  ? 0.2108 0.2416 0.1860 0.0084  -0.0041 0.0056  50  GLY A N   
356  C CA  . GLY A 47  ? 0.1997 0.2286 0.1750 0.0089  -0.0050 0.0036  50  GLY A CA  
357  C C   . GLY A 47  ? 0.2277 0.2571 0.2044 0.0092  -0.0048 0.0075  50  GLY A C   
358  O O   . GLY A 47  ? 0.2430 0.2768 0.2185 0.0117  -0.0042 0.0106  50  GLY A O   
359  N N   . VAL A 48  ? 0.2427 0.2678 0.2222 0.0071  -0.0055 0.0075  51  VAL A N   
360  C CA  . VAL A 48  ? 0.2740 0.2980 0.2564 0.0069  -0.0059 0.0114  51  VAL A CA  
361  C C   . VAL A 48  ? 0.2765 0.2988 0.2586 0.0083  -0.0069 0.0099  51  VAL A C   
362  O O   . VAL A 48  ? 0.2759 0.2958 0.2577 0.0079  -0.0076 0.0059  51  VAL A O   
363  C CB  . VAL A 48  ? 0.2611 0.2809 0.2478 0.0038  -0.0069 0.0123  51  VAL A CB  
364  C CG1 . VAL A 48  ? 0.3662 0.3838 0.3574 0.0034  -0.0081 0.0164  51  VAL A CG1 
365  C CG2 . VAL A 48  ? 0.3315 0.3534 0.3189 0.0024  -0.0060 0.0138  51  VAL A CG2 
366  N N   . ALA A 49  ? 0.2974 0.3219 0.2797 0.0103  -0.0068 0.0136  52  ALA A N   
367  C CA  . ALA A 49  ? 0.3106 0.3337 0.2927 0.0119  -0.0078 0.0126  52  ALA A CA  
368  C C   . ALA A 49  ? 0.3237 0.3408 0.3098 0.0101  -0.0095 0.0127  52  ALA A C   
369  O O   . ALA A 49  ? 0.3265 0.3415 0.3167 0.0085  -0.0100 0.0166  52  ALA A O   
370  C CB  . ALA A 49  ? 0.3327 0.3603 0.3137 0.0150  -0.0072 0.0171  52  ALA A CB  
371  N N   . LYS A 50  ? 0.3228 0.3375 0.3082 0.0107  -0.0106 0.0082  53  LYS A N   
372  C CA  . LYS A 50  ? 0.3282 0.3375 0.3165 0.0102  -0.0127 0.0070  53  LYS A CA  
373  C C   . LYS A 50  ? 0.3245 0.3329 0.3139 0.0124  -0.0137 0.0095  53  LYS A C   
374  O O   . LYS A 50  ? 0.3309 0.3434 0.3175 0.0147  -0.0128 0.0100  53  LYS A O   
375  C CB  . LYS A 50  ? 0.3181 0.3269 0.3047 0.0107  -0.0131 0.0013  53  LYS A CB  
376  C CG  . LYS A 50  ? 0.3679 0.3780 0.3533 0.0089  -0.0119 -0.0010 53  LYS A CG  
377  C CD  . LYS A 50  ? 0.3993 0.4110 0.3834 0.0098  -0.0117 -0.0052 53  LYS A CD  
378  C CE  . LYS A 50  ? 0.4505 0.4592 0.4357 0.0109  -0.0136 -0.0078 53  LYS A CE  
379  N NZ  . LYS A 50  ? 0.4816 0.4887 0.4672 0.0096  -0.0141 -0.0088 53  LYS A NZ  
380  N N   . VAL A 51  ? 0.2926 0.2957 0.2863 0.0119  -0.0160 0.0110  54  VAL A N   
381  C CA  . VAL A 51  ? 0.2841 0.2853 0.2795 0.0140  -0.0173 0.0136  54  VAL A CA  
382  C C   . VAL A 51  ? 0.2543 0.2513 0.2497 0.0157  -0.0197 0.0084  54  VAL A C   
383  O O   . VAL A 51  ? 0.2706 0.2632 0.2682 0.0147  -0.0219 0.0053  54  VAL A O   
384  C CB  . VAL A 51  ? 0.2932 0.2911 0.2948 0.0125  -0.0186 0.0203  54  VAL A CB  
385  C CG1 . VAL A 51  ? 0.3212 0.3169 0.3251 0.0148  -0.0201 0.0236  54  VAL A CG1 
386  C CG2 . VAL A 51  ? 0.3149 0.3187 0.3166 0.0114  -0.0158 0.0260  54  VAL A CG2 
387  N N   . LEU A 52  ? 0.2374 0.2366 0.2303 0.0186  -0.0196 0.0071  55  LEU A N   
388  C CA  . LEU A 52  ? 0.2377 0.2345 0.2301 0.0209  -0.0216 0.0022  55  LEU A CA  
389  C C   . LEU A 52  ? 0.2488 0.2446 0.2419 0.0238  -0.0228 0.0043  55  LEU A C   
390  O O   . LEU A 52  ? 0.2609 0.2617 0.2514 0.0254  -0.0212 0.0062  55  LEU A O   
391  C CB  . LEU A 52  ? 0.2376 0.2397 0.2262 0.0215  -0.0199 -0.0028 55  LEU A CB  
392  C CG  . LEU A 52  ? 0.2749 0.2770 0.2628 0.0244  -0.0213 -0.0076 55  LEU A CG  
393  C CD1 . LEU A 52  ? 0.2798 0.2772 0.2693 0.0249  -0.0238 -0.0108 55  LEU A CD1 
394  C CD2 . LEU A 52  ? 0.3154 0.3245 0.3008 0.0248  -0.0192 -0.0105 55  LEU A CD2 
395  N N   . TRP A 53  ? 0.2465 0.2358 0.2430 0.0250  -0.0261 0.0038  56  TRP A N   
396  C CA  . TRP A 53  ? 0.2502 0.2376 0.2476 0.0281  -0.0278 0.0054  56  TRP A CA  
397  C C   . TRP A 53  ? 0.2778 0.2658 0.2729 0.0315  -0.0291 -0.0011 56  TRP A C   
398  O O   . TRP A 53  ? 0.2726 0.2571 0.2687 0.0320  -0.0313 -0.0056 56  TRP A O   
399  C CB  . TRP A 53  ? 0.2263 0.2056 0.2304 0.0275  -0.0312 0.0094  56  TRP A CB  
400  C CG  . TRP A 53  ? 0.2232 0.2024 0.2312 0.0242  -0.0300 0.0168  56  TRP A CG  
401  C CD1 . TRP A 53  ? 0.2153 0.1940 0.2256 0.0205  -0.0296 0.0175  56  TRP A CD1 
402  C CD2 . TRP A 53  ? 0.2449 0.2254 0.2556 0.0246  -0.0292 0.0253  56  TRP A CD2 
403  N NE1 . TRP A 53  ? 0.2147 0.1946 0.2292 0.0185  -0.0284 0.0259  56  TRP A NE1 
404  C CE2 . TRP A 53  ? 0.2436 0.2250 0.2583 0.0210  -0.0280 0.0310  56  TRP A CE2 
405  C CE3 . TRP A 53  ? 0.2334 0.2151 0.2433 0.0280  -0.0292 0.0288  56  TRP A CE3 
406  C CZ2 . TRP A 53  ? 0.2224 0.2065 0.2408 0.0207  -0.0266 0.0407  56  TRP A CZ2 
407  C CZ3 . TRP A 53  ? 0.2065 0.1906 0.2195 0.0279  -0.0279 0.0383  56  TRP A CZ3 
408  C CH2 . TRP A 53  ? 0.2401 0.2258 0.2575 0.0243  -0.0264 0.0444  56  TRP A CH2 
409  N N   . MET A 54  ? 0.3206 0.3138 0.3126 0.0341  -0.0279 -0.0016 57  MET A N   
410  C CA  . MET A 54  ? 0.3700 0.3652 0.3602 0.0376  -0.0289 -0.0070 57  MET A CA  
411  C C   . MET A 54  ? 0.4075 0.4053 0.3965 0.0409  -0.0290 -0.0054 57  MET A C   
412  O O   . MET A 54  ? 0.4004 0.4012 0.3886 0.0405  -0.0274 -0.0010 57  MET A O   
413  C CB  . MET A 54  ? 0.3740 0.3763 0.3614 0.0368  -0.0264 -0.0112 57  MET A CB  
414  C CG  . MET A 54  ? 0.3384 0.3390 0.3262 0.0354  -0.0268 -0.0146 57  MET A CG  
415  S SD  . MET A 54  ? 0.4165 0.4263 0.4019 0.0352  -0.0238 -0.0184 57  MET A SD  
416  C CE  . MET A 54  ? 0.4065 0.4193 0.3913 0.0407  -0.0254 -0.0226 57  MET A CE  
417  N N   . GLN A 55  ? 0.4385 0.4358 0.4274 0.0447  -0.0310 -0.0090 58  GLN A N   
418  C CA  . GLN A 55  ? 0.4795 0.4793 0.4673 0.0485  -0.0316 -0.0080 58  GLN A CA  
419  C C   . GLN A 55  ? 0.4955 0.4902 0.4856 0.0491  -0.0329 -0.0015 58  GLN A C   
420  O O   . GLN A 55  ? 0.5099 0.5082 0.4984 0.0515  -0.0323 0.0012  58  GLN A O   
421  C CB  . GLN A 55  ? 0.4854 0.4949 0.4704 0.0484  -0.0288 -0.0088 58  GLN A CB  
422  C CG  . GLN A 55  ? 0.5125 0.5280 0.4968 0.0479  -0.0275 -0.0141 58  GLN A CG  
423  C CD  . GLN A 55  ? 0.5529 0.5771 0.5362 0.0474  -0.0255 -0.0147 58  GLN A CD  
424  O OE1 . GLN A 55  ? 0.6174 0.6433 0.5996 0.0479  -0.0254 -0.0119 58  GLN A OE1 
425  N NE2 . GLN A 55  ? 0.5705 0.6006 0.5547 0.0466  -0.0244 -0.0182 58  GLN A NE2 
426  N N   . GLY A 56  ? 0.5060 0.4927 0.5001 0.0470  -0.0347 0.0012  59  GLY A N   
427  C CA  . GLY A 56  ? 0.5182 0.4997 0.5162 0.0471  -0.0361 0.0086  59  GLY A CA  
428  C C   . GLY A 56  ? 0.5190 0.5047 0.5168 0.0446  -0.0330 0.0157  59  GLY A C   
429  O O   . GLY A 56  ? 0.5338 0.5177 0.5345 0.0452  -0.0334 0.0230  59  GLY A O   
430  N N   . SER A 57  ? 0.4961 0.4877 0.4907 0.0421  -0.0300 0.0139  60  SER A N   
431  C CA  . SER A 57  ? 0.4867 0.4829 0.4807 0.0401  -0.0271 0.0199  60  SER A CA  
432  C C   . SER A 57  ? 0.4645 0.4626 0.4574 0.0362  -0.0252 0.0174  60  SER A C   
433  O O   . SER A 57  ? 0.4319 0.4292 0.4240 0.0352  -0.0257 0.0111  60  SER A O   
434  C CB  . SER A 57  ? 0.4996 0.5043 0.4886 0.0436  -0.0252 0.0213  60  SER A CB  
435  O OG  . SER A 57  ? 0.5419 0.5530 0.5266 0.0433  -0.0236 0.0154  60  SER A OG  
436  N N   . GLN A 58  ? 0.4502 0.4517 0.4433 0.0345  -0.0230 0.0229  61  GLN A N   
437  C CA  . GLN A 58  ? 0.4537 0.4575 0.4457 0.0312  -0.0212 0.0211  61  GLN A CA  
438  C C   . GLN A 58  ? 0.4542 0.4653 0.4405 0.0324  -0.0193 0.0163  61  GLN A C   
439  O O   . GLN A 58  ? 0.4664 0.4836 0.4495 0.0352  -0.0182 0.0182  61  GLN A O   
440  C CB  . GLN A 58  ? 0.4625 0.4680 0.4569 0.0294  -0.0195 0.0288  61  GLN A CB  
441  C CG  . GLN A 58  ? 0.5121 0.5164 0.5079 0.0254  -0.0188 0.0276  61  GLN A CG  
442  C CD  . GLN A 58  ? 0.6104 0.6204 0.6064 0.0246  -0.0162 0.0341  61  GLN A CD  
443  O OE1 . GLN A 58  ? 0.6678 0.6825 0.6633 0.0271  -0.0150 0.0404  61  GLN A OE1 
444  N NE2 . GLN A 58  ? 0.6714 0.6818 0.6678 0.0215  -0.0153 0.0327  61  GLN A NE2 
445  N N   . GLN A 59  ? 0.4428 0.4535 0.4283 0.0306  -0.0193 0.0103  62  GLN A N   
446  C CA  . GLN A 59  ? 0.4400 0.4567 0.4220 0.0312  -0.0181 0.0056  62  GLN A CA  
447  C C   . GLN A 59  ? 0.4510 0.4707 0.4318 0.0288  -0.0163 0.0057  62  GLN A C   
448  O O   . GLN A 59  ? 0.4545 0.4796 0.4326 0.0304  -0.0154 0.0066  62  GLN A O   
449  C CB  . GLN A 59  ? 0.4261 0.4420 0.4086 0.0312  -0.0191 -0.0002 62  GLN A CB  
450  C CG  . GLN A 59  ? 0.4313 0.4447 0.4148 0.0343  -0.0211 -0.0010 62  GLN A CG  
451  C CD  . GLN A 59  ? 0.4262 0.4441 0.4078 0.0379  -0.0214 0.0000  62  GLN A CD  
452  O OE1 . GLN A 59  ? 0.4622 0.4859 0.4416 0.0384  -0.0203 -0.0002 62  GLN A OE1 
453  N NE2 . GLN A 59  ? 0.4832 0.4983 0.4657 0.0409  -0.0232 0.0008  62  GLN A NE2 
454  N N   . CYS A 60  ? 0.4569 0.4733 0.4393 0.0256  -0.0160 0.0044  63  CYS A N   
455  C CA  . CYS A 60  ? 0.4561 0.4739 0.4379 0.0232  -0.0145 0.0060  63  CYS A CA  
456  C C   . CYS A 60  ? 0.4679 0.4846 0.4516 0.0232  -0.0142 0.0127  63  CYS A C   
457  O O   . CYS A 60  ? 0.4095 0.4206 0.3972 0.0219  -0.0156 0.0150  63  CYS A O   
458  C CB  . CYS A 60  ? 0.4277 0.4424 0.4110 0.0201  -0.0144 0.0032  63  CYS A CB  
459  S SG  . CYS A 60  ? 0.4596 0.4768 0.4420 0.0199  -0.0142 -0.0031 63  CYS A SG  
460  N N   . LYS A 61  ? 0.4974 0.5197 0.4786 0.0251  -0.0128 0.0160  64  LYS A N   
461  C CA  . LYS A 61  ? 0.5352 0.5590 0.5182 0.0260  -0.0121 0.0236  64  LYS A CA  
462  C C   . LYS A 61  ? 0.5472 0.5710 0.5327 0.0230  -0.0108 0.0273  64  LYS A C   
463  O O   . LYS A 61  ? 0.5765 0.6015 0.5653 0.0229  -0.0102 0.0346  64  LYS A O   
464  C CB  . LYS A 61  ? 0.5495 0.5809 0.5282 0.0306  -0.0111 0.0258  64  LYS A CB  
465  C CG  . LYS A 61  ? 0.5557 0.5869 0.5335 0.0339  -0.0126 0.0246  64  LYS A CG  
466  C CD  . LYS A 61  ? 0.6241 0.6636 0.5969 0.0390  -0.0120 0.0258  64  LYS A CD  
467  C CE  . LYS A 61  ? 0.6414 0.6809 0.6133 0.0423  -0.0137 0.0240  64  LYS A CE  
468  N NZ  . LYS A 61  ? 0.6206 0.6569 0.5930 0.0407  -0.0153 0.0161  64  LYS A NZ  
469  N N   . GLN A 62  ? 0.5479 0.5708 0.5325 0.0206  -0.0105 0.0228  65  GLN A N   
470  C CA  . GLN A 62  ? 0.5385 0.5616 0.5253 0.0177  -0.0095 0.0254  65  GLN A CA  
471  C C   . GLN A 62  ? 0.5446 0.5756 0.5292 0.0199  -0.0073 0.0304  65  GLN A C   
472  O O   . GLN A 62  ? 0.5642 0.6007 0.5435 0.0232  -0.0066 0.0279  65  GLN A O   
473  N N   . THR A 63  ? 0.5365 0.5685 0.5256 0.0185  -0.0065 0.0374  66  THR A N   
474  C CA  . THR A 63  ? 0.5167 0.5574 0.5041 0.0207  -0.0040 0.0429  66  THR A CA  
475  C C   . THR A 63  ? 0.4908 0.5332 0.4770 0.0190  -0.0031 0.0403  66  THR A C   
476  O O   . THR A 63  ? 0.5023 0.5390 0.4922 0.0148  -0.0040 0.0384  66  THR A O   
477  N N   . SER A 64  ? 0.4634 0.5137 0.4442 0.0227  -0.0015 0.0399  67  SER A N   
478  C CA  . SER A 64  ? 0.4205 0.4743 0.4006 0.0220  -0.0003 0.0396  67  SER A CA  
479  C C   . SER A 64  ? 0.3790 0.4285 0.3561 0.0206  -0.0015 0.0310  67  SER A C   
480  O O   . SER A 64  ? 0.3909 0.4368 0.3658 0.0211  -0.0030 0.0253  67  SER A O   
481  C CB  . SER A 64  ? 0.4299 0.4949 0.4055 0.0275  0.0017  0.0433  67  SER A CB  
482  O OG  . SER A 64  ? 0.4835 0.5537 0.4630 0.0284  0.0035  0.0531  67  SER A OG  
483  N N   A GLU A 65  ? 0.3597 0.4101 0.3373 0.0189  -0.0007 0.0308  68  GLU A N   
484  N N   B GLU A 65  ? 0.3610 0.4114 0.3386 0.0189  -0.0007 0.0307  68  GLU A N   
485  C CA  A GLU A 65  ? 0.3264 0.3736 0.3016 0.0177  -0.0016 0.0239  68  GLU A CA  
486  C CA  B GLU A 65  ? 0.3292 0.3759 0.3046 0.0175  -0.0017 0.0237  68  GLU A CA  
487  C C   A GLU A 65  ? 0.3009 0.3519 0.2704 0.0222  -0.0023 0.0191  68  GLU A C   
488  C C   B GLU A 65  ? 0.3028 0.3537 0.2724 0.0219  -0.0022 0.0192  68  GLU A C   
489  O O   A GLU A 65  ? 0.3067 0.3648 0.2729 0.0269  -0.0017 0.0213  68  GLU A O   
490  O O   B GLU A 65  ? 0.3139 0.3725 0.2805 0.0265  -0.0013 0.0217  68  GLU A O   
491  C CB  A GLU A 65  ? 0.3308 0.3794 0.3077 0.0158  -0.0005 0.0255  68  GLU A CB  
492  C CB  B GLU A 65  ? 0.3318 0.3778 0.3099 0.0144  -0.0010 0.0250  68  GLU A CB  
493  C CG  A GLU A 65  ? 0.3428 0.3870 0.3262 0.0110  -0.0008 0.0288  68  GLU A CG  
494  C CG  B GLU A 65  ? 0.3464 0.3868 0.3308 0.0099  -0.0017 0.0274  68  GLU A CG  
495  C CD  A GLU A 65  ? 0.3369 0.3854 0.3227 0.0099  0.0005  0.0326  68  GLU A CD  
496  C CD  B GLU A 65  ? 0.3473 0.3878 0.3349 0.0071  -0.0013 0.0289  68  GLU A CD  
497  O OE1 A GLU A 65  ? 0.3725 0.4293 0.3576 0.0128  0.0023  0.0377  68  GLU A OE1 
498  O OE1 B GLU A 65  ? 0.3848 0.4283 0.3691 0.0082  -0.0005 0.0267  68  GLU A OE1 
499  O OE2 A GLU A 65  ? 0.3587 0.4030 0.3470 0.0066  -0.0003 0.0306  68  GLU A OE2 
500  O OE2 B GLU A 65  ? 0.3406 0.3782 0.3344 0.0039  -0.0022 0.0320  68  GLU A OE2 
501  N N   . TYR A 66  ? 0.2480 0.2943 0.2167 0.0208  -0.0038 0.0127  69  TYR A N   
502  C CA  . TYR A 66  ? 0.2372 0.2857 0.2021 0.0243  -0.0053 0.0074  69  TYR A CA  
503  C C   . TYR A 66  ? 0.2141 0.2640 0.1778 0.0245  -0.0050 0.0061  69  TYR A C   
504  O O   . TYR A 66  ? 0.2367 0.2900 0.1971 0.0286  -0.0063 0.0028  69  TYR A O   
505  C CB  . TYR A 66  ? 0.2359 0.2788 0.2023 0.0222  -0.0072 0.0019  69  TYR A CB  
506  C CG  . TYR A 66  ? 0.2700 0.3132 0.2364 0.0238  -0.0082 0.0014  69  TYR A CG  
507  C CD1 . TYR A 66  ? 0.3142 0.3544 0.2830 0.0216  -0.0074 0.0044  69  TYR A CD1 
508  C CD2 . TYR A 66  ? 0.2790 0.3252 0.2430 0.0278  -0.0103 -0.0025 69  TYR A CD2 
509  C CE1 . TYR A 66  ? 0.3353 0.3760 0.3040 0.0234  -0.0084 0.0039  69  TYR A CE1 
510  C CE2 . TYR A 66  ? 0.3410 0.3880 0.3050 0.0294  -0.0113 -0.0031 69  TYR A CE2 
511  C CZ  . TYR A 66  ? 0.3318 0.3761 0.2979 0.0272  -0.0101 0.0003  69  TYR A CZ  
512  O OH  . TYR A 66  ? 0.3370 0.3821 0.3029 0.0292  -0.0112 -0.0003 69  TYR A OH  
513  N N   . LEU A 67  ? 0.1978 0.2447 0.1644 0.0205  -0.0038 0.0082  70  LEU A N   
514  C CA  . LEU A 67  ? 0.2027 0.2497 0.1688 0.0200  -0.0037 0.0067  70  LEU A CA  
515  C C   . LEU A 67  ? 0.2126 0.2597 0.1817 0.0168  -0.0019 0.0115  70  LEU A C   
516  O O   . LEU A 67  ? 0.2109 0.2538 0.1837 0.0132  -0.0018 0.0131  70  LEU A O   
517  C CB  . LEU A 67  ? 0.1877 0.2284 0.1549 0.0175  -0.0053 0.0014  70  LEU A CB  
518  C CG  . LEU A 67  ? 0.1717 0.2106 0.1393 0.0159  -0.0052 0.0002  70  LEU A CG  
519  C CD1 . LEU A 67  ? 0.2353 0.2777 0.1998 0.0202  -0.0063 -0.0023 70  LEU A CD1 
520  C CD2 . LEU A 67  ? 0.1995 0.2324 0.1696 0.0126  -0.0060 -0.0028 70  LEU A CD2 
521  N N   . ARG A 68  ? 0.2143 0.2668 0.1824 0.0187  -0.0008 0.0137  71  ARG A N   
522  C CA  . ARG A 68  ? 0.2335 0.2863 0.2051 0.0155  0.0005  0.0175  71  ARG A CA  
523  C C   . ARG A 68  ? 0.2416 0.2986 0.2108 0.0178  0.0009  0.0166  71  ARG A C   
524  O O   . ARG A 68  ? 0.2631 0.3283 0.2304 0.0218  0.0021  0.0196  71  ARG A O   
525  C CB  . ARG A 68  ? 0.2338 0.2908 0.2093 0.0148  0.0019  0.0247  71  ARG A CB  
526  C CG  . ARG A 68  ? 0.2535 0.3104 0.2344 0.0110  0.0025  0.0285  71  ARG A CG  
527  C CD  . ARG A 68  ? 0.3119 0.3733 0.2985 0.0101  0.0036  0.0365  71  ARG A CD  
528  N NE  . ARG A 68  ? 0.4085 0.4680 0.4020 0.0056  0.0032  0.0392  71  ARG A NE  
529  C CZ  . ARG A 68  ? 0.4448 0.4966 0.4432 0.0014  0.0011  0.0382  71  ARG A CZ  
530  N NH1 . ARG A 68  ? 0.4463 0.4918 0.4435 0.0012  -0.0003 0.0349  71  ARG A NH1 
531  N NH2 . ARG A 68  ? 0.4328 0.4836 0.4377 -0.0021 0.0001  0.0402  71  ARG A NH2 
532  N N   . TYR A 69  ? 0.2358 0.2877 0.2051 0.0157  0.0000  0.0127  72  TYR A N   
533  C CA  . TYR A 69  ? 0.2236 0.2780 0.1906 0.0179  -0.0001 0.0110  72  TYR A CA  
534  C C   . TYR A 69  ? 0.2321 0.2854 0.2025 0.0142  0.0007  0.0131  72  TYR A C   
535  O O   . TYR A 69  ? 0.2126 0.2597 0.1852 0.0104  0.0001  0.0115  72  TYR A O   
536  C CB  . TYR A 69  ? 0.2304 0.2797 0.1951 0.0189  -0.0023 0.0047  72  TYR A CB  
537  C CG  . TYR A 69  ? 0.2513 0.3006 0.2146 0.0204  -0.0030 0.0023  72  TYR A CG  
538  C CD1 . TYR A 69  ? 0.3248 0.3809 0.2849 0.0255  -0.0030 0.0024  72  TYR A CD1 
539  C CD2 . TYR A 69  ? 0.2474 0.2906 0.2125 0.0172  -0.0036 0.0003  72  TYR A CD2 
540  C CE1 . TYR A 69  ? 0.3736 0.4293 0.3323 0.0272  -0.0039 0.0000  72  TYR A CE1 
541  C CE2 . TYR A 69  ? 0.3061 0.3489 0.2701 0.0186  -0.0044 -0.0015 72  TYR A CE2 
542  C CZ  . TYR A 69  ? 0.3222 0.3708 0.2831 0.0236  -0.0046 -0.0019 72  TYR A CZ  
543  O OH  . TYR A 69  ? 0.3488 0.3968 0.3086 0.0254  -0.0057 -0.0040 72  TYR A OH  
544  N N   . GLU A 70  ? 0.2424 0.3027 0.2131 0.0158  0.0021  0.0166  73  GLU A N   
545  C CA  . GLU A 70  ? 0.2819 0.3425 0.2562 0.0128  0.0026  0.0187  73  GLU A CA  
546  C C   . GLU A 70  ? 0.2697 0.3337 0.2409 0.0159  0.0026  0.0168  73  GLU A C   
547  O O   . GLU A 70  ? 0.2862 0.3566 0.2539 0.0210  0.0031  0.0169  73  GLU A O   
548  C CB  . GLU A 70  ? 0.3151 0.3819 0.2946 0.0114  0.0041  0.0258  73  GLU A CB  
549  C CG  . GLU A 70  ? 0.3945 0.4565 0.3793 0.0071  0.0034  0.0279  73  GLU A CG  
550  C CD  . GLU A 70  ? 0.4435 0.5116 0.4350 0.0057  0.0045  0.0356  73  GLU A CD  
551  O OE1 . GLU A 70  ? 0.5254 0.6014 0.5160 0.0090  0.0063  0.0402  73  GLU A OE1 
552  O OE2 . GLU A 70  ? 0.5397 0.6048 0.5379 0.0013  0.0033  0.0373  73  GLU A OE2 
553  N N   . ASP A 71  ? 0.2553 0.3153 0.2275 0.0136  0.0020  0.0149  74  ASP A N   
554  C CA  . ASP A 71  ? 0.2598 0.3227 0.2295 0.0165  0.0019  0.0134  74  ASP A CA  
555  C C   . ASP A 71  ? 0.2417 0.3024 0.2140 0.0132  0.0018  0.0136  74  ASP A C   
556  O O   . ASP A 71  ? 0.2550 0.3104 0.2300 0.0092  0.0012  0.0132  74  ASP A O   
557  C CB  . ASP A 71  ? 0.2612 0.3193 0.2265 0.0194  0.0001  0.0077  74  ASP A CB  
558  C CG  . ASP A 71  ? 0.3581 0.4216 0.3197 0.0251  -0.0004 0.0062  74  ASP A CG  
559  O OD1 . ASP A 71  ? 0.3825 0.4532 0.3445 0.0265  0.0011  0.0093  74  ASP A OD1 
560  O OD2 . ASP A 71  ? 0.4290 0.4897 0.3875 0.0285  -0.0026 0.0015  74  ASP A OD2 
561  N N   . THR A 72  ? 0.2312 0.2968 0.2026 0.0156  0.0022  0.0140  75  THR A N   
562  C CA  . THR A 72  ? 0.2210 0.2848 0.1938 0.0137  0.0018  0.0134  75  THR A CA  
563  C C   . THR A 72  ? 0.2319 0.2907 0.2003 0.0162  0.0004  0.0087  75  THR A C   
564  O O   . THR A 72  ? 0.2605 0.3216 0.2255 0.0208  -0.0001 0.0069  75  THR A O   
565  C CB  . THR A 72  ? 0.2301 0.3029 0.2054 0.0146  0.0030  0.0173  75  THR A CB  
566  O OG1 . THR A 72  ? 0.2723 0.3493 0.2533 0.0118  0.0039  0.0224  75  THR A OG1 
567  C CG2 . THR A 72  ? 0.2659 0.3372 0.2426 0.0130  0.0022  0.0163  75  THR A CG2 
568  N N   . LEU A 73  ? 0.2117 0.2639 0.1807 0.0134  -0.0004 0.0069  76  LEU A N   
569  C CA  . LEU A 73  ? 0.2096 0.2562 0.1762 0.0149  -0.0017 0.0035  76  LEU A CA  
570  C C   . LEU A 73  ? 0.2235 0.2714 0.1890 0.0167  -0.0020 0.0031  76  LEU A C   
571  O O   . LEU A 73  ? 0.2399 0.2919 0.2070 0.0156  -0.0012 0.0053  76  LEU A O   
572  C CB  . LEU A 73  ? 0.2142 0.2540 0.1820 0.0115  -0.0021 0.0025  76  LEU A CB  
573  C CG  . LEU A 73  ? 0.1787 0.2166 0.1475 0.0098  -0.0020 0.0024  76  LEU A CG  
574  C CD1 . LEU A 73  ? 0.1724 0.2047 0.1421 0.0074  -0.0023 0.0014  76  LEU A CD1 
575  C CD2 . LEU A 73  ? 0.2127 0.2510 0.1797 0.0128  -0.0028 0.0008  76  LEU A CD2 
576  N N   . LEU A 74  ? 0.2310 0.2749 0.1945 0.0193  -0.0036 0.0004  77  LEU A N   
577  C CA  . LEU A 74  ? 0.2301 0.2742 0.1925 0.0216  -0.0042 -0.0002 77  LEU A CA  
578  C C   . LEU A 74  ? 0.2263 0.2637 0.1897 0.0193  -0.0048 -0.0004 77  LEU A C   
579  O O   . LEU A 74  ? 0.2279 0.2595 0.1923 0.0182  -0.0057 -0.0015 77  LEU A O   
580  C CB  . LEU A 74  ? 0.2514 0.2958 0.2112 0.0269  -0.0061 -0.0032 77  LEU A CB  
581  C CG  . LEU A 74  ? 0.2771 0.3207 0.2355 0.0304  -0.0076 -0.0046 77  LEU A CG  
582  C CD1 . LEU A 74  ? 0.3135 0.3656 0.2713 0.0317  -0.0059 -0.0023 77  LEU A CD1 
583  C CD2 . LEU A 74  ? 0.3120 0.3540 0.2683 0.0358  -0.0105 -0.0087 77  LEU A CD2 
584  N N   . LEU A 75  ? 0.2258 0.2649 0.1893 0.0187  -0.0041 0.0010  78  LEU A N   
585  C CA  . LEU A 75  ? 0.2326 0.2671 0.1965 0.0176  -0.0044 0.0015  78  LEU A CA  
586  C C   . LEU A 75  ? 0.2532 0.2823 0.2170 0.0202  -0.0064 0.0000  78  LEU A C   
587  O O   . LEU A 75  ? 0.2545 0.2847 0.2169 0.0239  -0.0077 -0.0017 78  LEU A O   
588  C CB  . LEU A 75  ? 0.2443 0.2828 0.2077 0.0178  -0.0038 0.0029  78  LEU A CB  
589  C CG  . LEU A 75  ? 0.2400 0.2755 0.2033 0.0172  -0.0038 0.0040  78  LEU A CG  
590  C CD1 . LEU A 75  ? 0.2934 0.3268 0.2577 0.0142  -0.0030 0.0048  78  LEU A CD1 
591  C CD2 . LEU A 75  ? 0.2366 0.2769 0.1991 0.0183  -0.0036 0.0048  78  LEU A CD2 
592  N N   . GLU A 76  ? 0.2909 0.3144 0.2568 0.0183  -0.0068 0.0008  79  GLU A N   
593  C CA  . GLU A 76  ? 0.3251 0.3424 0.2928 0.0200  -0.0091 0.0000  79  GLU A CA  
594  C C   . GLU A 76  ? 0.3458 0.3632 0.3122 0.0232  -0.0101 0.0000  79  GLU A C   
595  O O   . GLU A 76  ? 0.3581 0.3788 0.3232 0.0229  -0.0085 0.0021  79  GLU A O   
596  C CB  . GLU A 76  ? 0.3458 0.3585 0.3171 0.0170  -0.0088 0.0026  79  GLU A CB  
597  C CG  . GLU A 76  ? 0.3619 0.3726 0.3359 0.0146  -0.0091 0.0019  79  GLU A CG  
598  C CD  . GLU A 76  ? 0.3903 0.3975 0.3688 0.0120  -0.0087 0.0051  79  GLU A CD  
599  O OE1 . GLU A 76  ? 0.4182 0.4249 0.3989 0.0098  -0.0083 0.0053  79  GLU A OE1 
600  O OE2 . GLU A 76  ? 0.4080 0.4136 0.3881 0.0124  -0.0087 0.0081  79  GLU A OE2 
601  N N   . ASP A 77  ? 0.3689 0.3831 0.3356 0.0267  -0.0131 -0.0028 80  ASP A N   
602  C CA  . ASP A 77  ? 0.3810 0.3942 0.3467 0.0304  -0.0147 -0.0032 80  ASP A CA  
603  C C   . ASP A 77  ? 0.3711 0.3924 0.3327 0.0333  -0.0133 -0.0037 80  ASP A C   
604  O O   . ASP A 77  ? 0.3855 0.4074 0.3459 0.0361  -0.0140 -0.0035 80  ASP A O   
605  C CB  . ASP A 77  ? 0.4075 0.4165 0.3758 0.0287  -0.0143 0.0007  80  ASP A CB  
606  C CG  . ASP A 77  ? 0.4829 0.4848 0.4567 0.0261  -0.0157 0.0021  80  ASP A CG  
607  O OD1 . ASP A 77  ? 0.5695 0.5661 0.5461 0.0277  -0.0193 -0.0010 80  ASP A OD1 
608  O OD2 . ASP A 77  ? 0.5865 0.5886 0.5622 0.0227  -0.0135 0.0062  80  ASP A OD2 
609  N N   . GLN A 78  ? 0.3286 0.3564 0.2886 0.0325  -0.0115 -0.0040 81  GLN A N   
610  C CA  . GLN A 78  ? 0.3447 0.3812 0.3021 0.0355  -0.0105 -0.0043 81  GLN A CA  
611  C C   . GLN A 78  ? 0.3196 0.3580 0.2750 0.0405  -0.0125 -0.0079 81  GLN A C   
612  O O   . GLN A 78  ? 0.2830 0.3169 0.2391 0.0404  -0.0141 -0.0100 81  GLN A O   
613  C CB  . GLN A 78  ? 0.3482 0.3913 0.3062 0.0318  -0.0077 -0.0017 81  GLN A CB  
614  C CG  . GLN A 78  ? 0.3966 0.4396 0.3559 0.0282  -0.0063 0.0008  81  GLN A CG  
615  C CD  . GLN A 78  ? 0.5071 0.5546 0.4654 0.0305  -0.0063 0.0016  81  GLN A CD  
616  O OE1 . GLN A 78  ? 0.5623 0.6178 0.5210 0.0311  -0.0053 0.0024  81  GLN A OE1 
617  N NE2 . GLN A 78  ? 0.5375 0.5803 0.4953 0.0317  -0.0072 0.0019  81  GLN A NE2 
618  N N   . PRO A 79  ? 0.3267 0.3724 0.2794 0.0453  -0.0125 -0.0087 82  PRO A N   
619  C CA  . PRO A 79  ? 0.3422 0.3911 0.2922 0.0514  -0.0144 -0.0124 82  PRO A CA  
620  C C   . PRO A 79  ? 0.3594 0.4135 0.3089 0.0506  -0.0128 -0.0118 82  PRO A C   
621  O O   . PRO A 79  ? 0.3278 0.3883 0.2786 0.0471  -0.0095 -0.0078 82  PRO A O   
622  C CB  . PRO A 79  ? 0.3343 0.3925 0.2818 0.0563  -0.0137 -0.0119 82  PRO A CB  
623  C CG  . PRO A 79  ? 0.3554 0.4124 0.3046 0.0531  -0.0125 -0.0090 82  PRO A CG  
624  C CD  . PRO A 79  ? 0.3393 0.3916 0.2916 0.0459  -0.0108 -0.0063 82  PRO A CD  
625  N N   . THR A 80  ? 0.3665 0.4174 0.3148 0.0538  -0.0155 -0.0158 83  THR A N   
626  C CA  . THR A 80  ? 0.4005 0.4563 0.3477 0.0542  -0.0145 -0.0158 83  THR A CA  
627  C C   . THR A 80  ? 0.4047 0.4742 0.3495 0.0576  -0.0116 -0.0129 83  THR A C   
628  O O   . THR A 80  ? 0.3965 0.4721 0.3387 0.0632  -0.0120 -0.0139 83  THR A O   
629  C CB  . THR A 80  ? 0.4120 0.4630 0.3577 0.0589  -0.0188 -0.0217 83  THR A CB  
630  O OG1 . THR A 80  ? 0.4516 0.4905 0.4014 0.0547  -0.0213 -0.0231 83  THR A OG1 
631  C CG2 . THR A 80  ? 0.4357 0.4930 0.3795 0.0603  -0.0177 -0.0216 83  THR A CG2 
632  N N   . GLY A 81  ? 0.4122 0.4869 0.3584 0.0542  -0.0086 -0.0089 84  GLY A N   
633  C CA  . GLY A 81  ? 0.4247 0.5131 0.3703 0.0566  -0.0055 -0.0047 84  GLY A CA  
634  C C   . GLY A 81  ? 0.4335 0.5279 0.3822 0.0538  -0.0029 0.0001  84  GLY A C   
635  O O   . GLY A 81  ? 0.4474 0.5537 0.3975 0.0547  -0.0002 0.0048  84  GLY A O   
636  N N   . GLU A 82  ? 0.4313 0.5183 0.3817 0.0503  -0.0038 -0.0007 85  GLU A N   
637  C CA  . GLU A 82  ? 0.4229 0.5153 0.3762 0.0482  -0.0020 0.0029  85  GLU A CA  
638  C C   . GLU A 82  ? 0.3910 0.4848 0.3497 0.0411  0.0002  0.0077  85  GLU A C   
639  O O   . GLU A 82  ? 0.4008 0.4872 0.3607 0.0368  -0.0001 0.0072  85  GLU A O   
640  C CB  . GLU A 82  ? 0.4363 0.5207 0.3891 0.0477  -0.0039 0.0005  85  GLU A CB  
641  C CG  . GLU A 82  ? 0.4755 0.5675 0.4278 0.0513  -0.0036 0.0013  85  GLU A CG  
642  C CD  . GLU A 82  ? 0.5088 0.6021 0.4562 0.0596  -0.0059 -0.0029 85  GLU A CD  
643  O OE1 . GLU A 82  ? 0.5112 0.6048 0.4576 0.0624  -0.0069 -0.0040 85  GLU A OE1 
644  O OE2 . GLU A 82  ? 0.5664 0.6607 0.5110 0.0637  -0.0069 -0.0055 85  GLU A OE2 
645  N N   . ASN A 83  ? 0.3458 0.4495 0.3082 0.0402  0.0020  0.0121  86  ASN A N   
646  C CA  . ASN A 83  ? 0.3100 0.4150 0.2789 0.0337  0.0033  0.0164  86  ASN A CA  
647  C C   . ASN A 83  ? 0.2850 0.3898 0.2569 0.0311  0.0027  0.0168  86  ASN A C   
648  O O   . ASN A 83  ? 0.2762 0.3898 0.2498 0.0332  0.0033  0.0188  86  ASN A O   
649  C CB  . ASN A 83  ? 0.3028 0.4199 0.2756 0.0341  0.0057  0.0222  86  ASN A CB  
650  C CG  . ASN A 83  ? 0.3342 0.4528 0.3031 0.0378  0.0063  0.0218  86  ASN A CG  
651  O OD1 . ASN A 83  ? 0.4000 0.5111 0.3685 0.0351  0.0057  0.0205  86  ASN A OD1 
652  N ND2 . ASN A 83  ? 0.3863 0.5152 0.3519 0.0446  0.0073  0.0226  86  ASN A ND2 
653  N N   . GLU A 84  ? 0.2829 0.3782 0.2553 0.0270  0.0014  0.0148  87  GLU A N   
654  C CA  . GLU A 84  ? 0.2953 0.3891 0.2688 0.0257  0.0004  0.0140  87  GLU A CA  
655  C C   . GLU A 84  ? 0.2956 0.3828 0.2718 0.0203  -0.0005 0.0136  87  GLU A C   
656  O O   . GLU A 84  ? 0.3225 0.4023 0.2969 0.0189  -0.0007 0.0120  87  GLU A O   
657  C CB  . GLU A 84  ? 0.3108 0.3988 0.2785 0.0297  -0.0009 0.0102  87  GLU A CB  
658  C CG  . GLU A 84  ? 0.3920 0.4804 0.3599 0.0300  -0.0017 0.0097  87  GLU A CG  
659  C CD  . GLU A 84  ? 0.4243 0.5219 0.3918 0.0346  -0.0014 0.0106  87  GLU A CD  
660  O OE1 . GLU A 84  ? 0.4878 0.5858 0.4549 0.0356  -0.0023 0.0100  87  GLU A OE1 
661  O OE2 . GLU A 84  ? 0.4604 0.5655 0.4279 0.0375  -0.0003 0.0120  87  GLU A OE2 
662  N N   . MET A 85  ? 0.2618 0.3523 0.2428 0.0176  -0.0013 0.0148  88  MET A N   
663  C CA  . MET A 85  ? 0.2670 0.3515 0.2499 0.0136  -0.0027 0.0134  88  MET A CA  
664  C C   . MET A 85  ? 0.2436 0.3216 0.2212 0.0153  -0.0035 0.0102  88  MET A C   
665  O O   . MET A 85  ? 0.2791 0.3581 0.2532 0.0189  -0.0034 0.0096  88  MET A O   
666  C CB  . MET A 85  ? 0.2606 0.3510 0.2509 0.0107  -0.0041 0.0151  88  MET A CB  
667  C CG  . MET A 85  ? 0.3249 0.4224 0.3218 0.0090  -0.0031 0.0196  88  MET A CG  
668  S SD  . MET A 85  ? 0.3742 0.4732 0.3817 0.0034  -0.0058 0.0213  88  MET A SD  
669  C CE  . MET A 85  ? 0.4155 0.5205 0.4294 0.0016  -0.0039 0.0275  88  MET A CE  
670  N N   . VAL A 86  ? 0.2300 0.3016 0.2069 0.0130  -0.0043 0.0086  89  VAL A N   
671  C CA  . VAL A 86  ? 0.2375 0.3034 0.2097 0.0145  -0.0046 0.0067  89  VAL A CA  
672  C C   . VAL A 86  ? 0.2233 0.2903 0.1968 0.0135  -0.0062 0.0056  89  VAL A C   
673  O O   . VAL A 86  ? 0.2205 0.2878 0.1978 0.0107  -0.0074 0.0050  89  VAL A O   
674  C CB  . VAL A 86  ? 0.2421 0.3010 0.2122 0.0135  -0.0039 0.0059  89  VAL A CB  
675  C CG1 . VAL A 86  ? 0.3065 0.3605 0.2732 0.0146  -0.0040 0.0051  89  VAL A CG1 
676  C CG2 . VAL A 86  ? 0.2531 0.3110 0.2217 0.0152  -0.0030 0.0062  89  VAL A CG2 
677  N N   . ILE A 87  ? 0.2293 0.2970 0.1999 0.0162  -0.0065 0.0051  90  ILE A N   
678  C CA  . ILE A 87  ? 0.2309 0.2996 0.2013 0.0164  -0.0082 0.0036  90  ILE A CA  
679  C C   . ILE A 87  ? 0.2225 0.2855 0.1884 0.0173  -0.0074 0.0032  90  ILE A C   
680  O O   . ILE A 87  ? 0.2603 0.3210 0.2225 0.0197  -0.0063 0.0044  90  ILE A O   
681  C CB  . ILE A 87  ? 0.2431 0.3169 0.2129 0.0191  -0.0090 0.0036  90  ILE A CB  
682  C CG1 . ILE A 87  ? 0.2224 0.3032 0.1975 0.0183  -0.0095 0.0047  90  ILE A CG1 
683  C CG2 . ILE A 87  ? 0.2775 0.3528 0.2465 0.0200  -0.0111 0.0016  90  ILE A CG2 
684  C CD1 . ILE A 87  ? 0.2960 0.3798 0.2782 0.0145  -0.0114 0.0044  90  ILE A CD1 
685  N N   . MET A 88  ? 0.2121 0.2732 0.1788 0.0153  -0.0080 0.0019  91  MET A N   
686  C CA  . MET A 88  ? 0.2024 0.2598 0.1655 0.0163  -0.0070 0.0021  91  MET A CA  
687  C C   . MET A 88  ? 0.2197 0.2802 0.1800 0.0191  -0.0081 0.0011  91  MET A C   
688  O O   . MET A 88  ? 0.2173 0.2815 0.1795 0.0192  -0.0106 -0.0014 91  MET A O   
689  C CB  . MET A 88  ? 0.1778 0.2322 0.1424 0.0138  -0.0070 0.0011  91  MET A CB  
690  C CG  . MET A 88  ? 0.1808 0.2323 0.1472 0.0118  -0.0058 0.0023  91  MET A CG  
691  S SD  . MET A 88  ? 0.2211 0.2689 0.1886 0.0094  -0.0057 0.0013  91  MET A SD  
692  C CE  . MET A 88  ? 0.2188 0.2642 0.1877 0.0080  -0.0043 0.0028  91  MET A CE  
693  N N   . ARG A 89  ? 0.2254 0.2847 0.1818 0.0216  -0.0064 0.0034  92  ARG A N   
694  C CA  . ARG A 89  ? 0.2454 0.3085 0.1983 0.0252  -0.0069 0.0034  92  ARG A CA  
695  C C   . ARG A 89  ? 0.2443 0.3065 0.1944 0.0264  -0.0053 0.0050  92  ARG A C   
696  O O   . ARG A 89  ? 0.2394 0.2973 0.1904 0.0248  -0.0033 0.0075  92  ARG A O   
697  C CB  . ARG A 89  ? 0.2657 0.3299 0.2168 0.0279  -0.0063 0.0058  92  ARG A CB  
698  C CG  . ARG A 89  ? 0.3095 0.3761 0.2631 0.0273  -0.0077 0.0044  92  ARG A CG  
699  C CD  . ARG A 89  ? 0.3813 0.4489 0.3329 0.0305  -0.0073 0.0065  92  ARG A CD  
700  N NE  . ARG A 89  ? 0.4570 0.5289 0.4111 0.0305  -0.0087 0.0051  92  ARG A NE  
701  C CZ  . ARG A 89  ? 0.5068 0.5779 0.4634 0.0291  -0.0083 0.0053  92  ARG A CZ  
702  N NH1 . ARG A 89  ? 0.5356 0.6013 0.4923 0.0278  -0.0069 0.0064  92  ARG A NH1 
703  N NH2 . ARG A 89  ? 0.4633 0.5400 0.4225 0.0295  -0.0094 0.0046  92  ARG A NH2 
704  N N   . PRO A 90  ? 0.2613 0.3284 0.2084 0.0297  -0.0062 0.0037  93  PRO A N   
705  C CA  . PRO A 90  ? 0.2619 0.3301 0.2062 0.0316  -0.0043 0.0058  93  PRO A CA  
706  C C   . PRO A 90  ? 0.2843 0.3511 0.2277 0.0326  -0.0011 0.0121  93  PRO A C   
707  O O   . PRO A 90  ? 0.2880 0.3542 0.2313 0.0335  -0.0010 0.0142  93  PRO A O   
708  C CB  . PRO A 90  ? 0.2742 0.3494 0.2146 0.0363  -0.0062 0.0030  93  PRO A CB  
709  C CG  . PRO A 90  ? 0.2878 0.3652 0.2289 0.0370  -0.0089 0.0004  93  PRO A CG  
710  C CD  . PRO A 90  ? 0.2581 0.3306 0.2043 0.0321  -0.0093 -0.0001 93  PRO A CD  
711  N N   . GLY A 91  ? 0.2953 0.3614 0.2389 0.0323  0.0011  0.0152  94  GLY A N   
712  C CA  . GLY A 91  ? 0.3155 0.3805 0.2600 0.0329  0.0038  0.0220  94  GLY A CA  
713  C C   . GLY A 91  ? 0.3400 0.3970 0.2894 0.0288  0.0042  0.0236  94  GLY A C   
714  O O   . GLY A 91  ? 0.3813 0.4358 0.3331 0.0287  0.0056  0.0288  94  GLY A O   
715  N N   . ASN A 92  ? 0.3181 0.3714 0.2692 0.0256  0.0027  0.0191  95  ASN A N   
716  C CA  . ASN A 92  ? 0.3151 0.3616 0.2701 0.0225  0.0025  0.0194  95  ASN A CA  
717  C C   . ASN A 92  ? 0.3029 0.3474 0.2599 0.0195  0.0025  0.0170  95  ASN A C   
718  O O   . ASN A 92  ? 0.3237 0.3709 0.2793 0.0193  0.0017  0.0136  95  ASN A O   
719  C CB  . ASN A 92  ? 0.3185 0.3636 0.2737 0.0223  0.0008  0.0167  95  ASN A CB  
720  C CG  . ASN A 92  ? 0.3534 0.4008 0.3064 0.0256  0.0006  0.0184  95  ASN A CG  
721  O OD1 . ASN A 92  ? 0.4228 0.4678 0.3768 0.0268  0.0012  0.0224  95  ASN A OD1 
722  N ND2 . ASN A 92  ? 0.3548 0.4071 0.3057 0.0270  -0.0007 0.0155  95  ASN A ND2 
723  N N   . LYS A 93  ? 0.2903 0.3298 0.2508 0.0173  0.0029  0.0186  96  LYS A N   
724  C CA  . LYS A 93  ? 0.2860 0.3229 0.2484 0.0145  0.0026  0.0161  96  LYS A CA  
725  C C   . LYS A 93  ? 0.2730 0.3064 0.2365 0.0134  0.0010  0.0134  96  LYS A C   
726  O O   . LYS A 93  ? 0.2978 0.3278 0.2628 0.0139  0.0004  0.0145  96  LYS A O   
727  C CB  . LYS A 93  ? 0.3031 0.3376 0.2691 0.0130  0.0037  0.0192  96  LYS A CB  
728  C CG  . LYS A 93  ? 0.3650 0.4045 0.3303 0.0142  0.0057  0.0222  96  LYS A CG  
729  C CD  . LYS A 93  ? 0.3967 0.4343 0.3668 0.0121  0.0066  0.0250  96  LYS A CD  
730  C CE  . LYS A 93  ? 0.4638 0.5077 0.4341 0.0137  0.0091  0.0297  96  LYS A CE  
731  N NZ  . LYS A 93  ? 0.5817 0.6276 0.5531 0.0156  0.0104  0.0358  96  LYS A NZ  
732  N N   . TYR A 94  ? 0.2208 0.2553 0.1838 0.0122  0.0003  0.0101  97  TYR A N   
733  C CA  . TYR A 94  ? 0.2122 0.2453 0.1762 0.0115  -0.0008 0.0082  97  TYR A CA  
734  C C   . TYR A 94  ? 0.2267 0.2568 0.1926 0.0096  -0.0008 0.0073  97  TYR A C   
735  O O   . TYR A 94  ? 0.2276 0.2587 0.1938 0.0081  -0.0006 0.0062  97  TYR A O   
736  C CB  . TYR A 94  ? 0.2151 0.2524 0.1785 0.0115  -0.0016 0.0062  97  TYR A CB  
737  C CG  . TYR A 94  ? 0.2092 0.2496 0.1709 0.0137  -0.0019 0.0068  97  TYR A CG  
738  C CD1 . TYR A 94  ? 0.2134 0.2542 0.1748 0.0154  -0.0023 0.0071  97  TYR A CD1 
739  C CD2 . TYR A 94  ? 0.1763 0.2198 0.1363 0.0148  -0.0019 0.0068  97  TYR A CD2 
740  C CE1 . TYR A 94  ? 0.2185 0.2623 0.1782 0.0176  -0.0027 0.0076  97  TYR A CE1 
741  C CE2 . TYR A 94  ? 0.2159 0.2627 0.1740 0.0173  -0.0024 0.0072  97  TYR A CE2 
742  C CZ  . TYR A 94  ? 0.1853 0.2320 0.1434 0.0185  -0.0027 0.0078  97  TYR A CZ  
743  O OH  . TYR A 94  ? 0.2494 0.2997 0.2059 0.0211  -0.0032 0.0082  97  TYR A OH  
744  N N   . GLU A 95  ? 0.2234 0.2496 0.1908 0.0099  -0.0014 0.0075  98  GLU A N   
745  C CA  . GLU A 95  ? 0.2137 0.2369 0.1832 0.0085  -0.0017 0.0067  98  GLU A CA  
746  C C   . GLU A 95  ? 0.2312 0.2540 0.2004 0.0094  -0.0029 0.0043  98  GLU A C   
747  O O   . GLU A 95  ? 0.2386 0.2611 0.2071 0.0117  -0.0040 0.0036  98  GLU A O   
748  C CB  . GLU A 95  ? 0.2496 0.2689 0.2223 0.0082  -0.0020 0.0089  98  GLU A CB  
749  C CG  . GLU A 95  ? 0.2363 0.2578 0.2094 0.0078  -0.0002 0.0123  98  GLU A CG  
750  C CD  . GLU A 95  ? 0.3740 0.3926 0.3515 0.0073  -0.0002 0.0160  98  GLU A CD  
751  O OE1 . GLU A 95  ? 0.4509 0.4647 0.4318 0.0072  -0.0023 0.0153  98  GLU A OE1 
752  O OE2 . GLU A 95  ? 0.4130 0.4347 0.3912 0.0073  0.0016  0.0196  98  GLU A OE2 
753  N N   . TYR A 96  ? 0.1971 0.2205 0.1667 0.0082  -0.0028 0.0031  99  TYR A N   
754  C CA  . TYR A 96  ? 0.2012 0.2258 0.1700 0.0094  -0.0036 0.0014  99  TYR A CA  
755  C C   . TYR A 96  ? 0.2122 0.2338 0.1826 0.0090  -0.0045 0.0001  99  TYR A C   
756  O O   . TYR A 96  ? 0.2168 0.2384 0.1881 0.0069  -0.0037 0.0004  99  TYR A O   
757  C CB  . TYR A 96  ? 0.1822 0.2114 0.1507 0.0084  -0.0026 0.0018  99  TYR A CB  
758  C CG  . TYR A 96  ? 0.1761 0.2092 0.1441 0.0086  -0.0022 0.0028  99  TYR A CG  
759  C CD1 . TYR A 96  ? 0.1807 0.2183 0.1483 0.0103  -0.0022 0.0031  99  TYR A CD1 
760  C CD2 . TYR A 96  ? 0.1633 0.1964 0.1313 0.0075  -0.0019 0.0034  99  TYR A CD2 
761  C CE1 . TYR A 96  ? 0.1857 0.2275 0.1539 0.0103  -0.0021 0.0041  99  TYR A CE1 
762  C CE2 . TYR A 96  ? 0.1852 0.2221 0.1531 0.0079  -0.0021 0.0038  99  TYR A CE2 
763  C CZ  . TYR A 96  ? 0.1768 0.2178 0.1452 0.0090  -0.0022 0.0042  99  TYR A CZ  
764  O OH  . TYR A 96  ? 0.2177 0.2629 0.1869 0.0092  -0.0026 0.0047  99  TYR A OH  
765  N N   . LYS A 97  ? 0.2190 0.2380 0.1899 0.0112  -0.0065 -0.0018 100 LYS A N   
766  C CA  . LYS A 97  ? 0.2037 0.2198 0.1766 0.0112  -0.0081 -0.0037 100 LYS A CA  
767  C C   . LYS A 97  ? 0.2172 0.2369 0.1880 0.0121  -0.0078 -0.0049 100 LYS A C   
768  O O   . LYS A 97  ? 0.2174 0.2417 0.1855 0.0142  -0.0071 -0.0048 100 LYS A O   
769  C CB  . LYS A 97  ? 0.2171 0.2290 0.1917 0.0137  -0.0113 -0.0060 100 LYS A CB  
770  C CG  . LYS A 97  ? 0.2236 0.2310 0.2022 0.0121  -0.0118 -0.0038 100 LYS A CG  
771  C CD  . LYS A 97  ? 0.2877 0.2898 0.2692 0.0146  -0.0157 -0.0060 100 LYS A CD  
772  C CE  . LYS A 97  ? 0.4047 0.4026 0.3913 0.0124  -0.0159 -0.0023 100 LYS A CE  
773  N NZ  . LYS A 97  ? 0.4428 0.4351 0.4328 0.0148  -0.0198 -0.0038 100 LYS A NZ  
774  N N   . PHE A 98  ? 0.2117 0.2301 0.1841 0.0108  -0.0081 -0.0056 101 PHE A N   
775  C CA  . PHE A 98  ? 0.2083 0.2299 0.1790 0.0122  -0.0081 -0.0067 101 PHE A CA  
776  C C   . PHE A 98  ? 0.2166 0.2351 0.1893 0.0128  -0.0105 -0.0094 101 PHE A C   
777  O O   . PHE A 98  ? 0.2126 0.2268 0.1892 0.0108  -0.0115 -0.0094 101 PHE A O   
778  C CB  . PHE A 98  ? 0.2003 0.2247 0.1708 0.0097  -0.0058 -0.0042 101 PHE A CB  
779  C CG  . PHE A 98  ? 0.1924 0.2138 0.1653 0.0066  -0.0053 -0.0036 101 PHE A CG  
780  C CD1 . PHE A 98  ? 0.1881 0.2083 0.1624 0.0063  -0.0061 -0.0049 101 PHE A CD1 
781  C CD2 . PHE A 98  ? 0.1801 0.2009 0.1537 0.0044  -0.0040 -0.0019 101 PHE A CD2 
782  C CE1 . PHE A 98  ? 0.1733 0.1919 0.1500 0.0038  -0.0055 -0.0042 101 PHE A CE1 
783  C CE2 . PHE A 98  ? 0.1690 0.1886 0.1445 0.0024  -0.0033 -0.0013 101 PHE A CE2 
784  C CZ  . PHE A 98  ? 0.1709 0.1895 0.1480 0.0020  -0.0040 -0.0023 101 PHE A CZ  
785  N N   . GLY A 99  ? 0.2172 0.2387 0.1877 0.0157  -0.0114 -0.0112 102 GLY A N   
786  C CA  . GLY A 99  ? 0.2272 0.2465 0.1995 0.0169  -0.0141 -0.0144 102 GLY A CA  
787  C C   . GLY A 99  ? 0.2256 0.2502 0.1942 0.0202  -0.0140 -0.0153 102 GLY A C   
788  O O   . GLY A 99  ? 0.2526 0.2823 0.2175 0.0236  -0.0133 -0.0148 102 GLY A O   
789  N N   . PHE A 100 ? 0.2246 0.2489 0.1944 0.0194  -0.0145 -0.0159 103 PHE A N   
790  C CA  . PHE A 100 ? 0.2409 0.2703 0.2076 0.0227  -0.0145 -0.0165 103 PHE A CA  
791  C C   . PHE A 100 ? 0.2514 0.2783 0.2204 0.0230  -0.0173 -0.0198 103 PHE A C   
792  O O   . PHE A 100 ? 0.2556 0.2779 0.2292 0.0195  -0.0181 -0.0201 103 PHE A O   
793  C CB  . PHE A 100 ? 0.2371 0.2703 0.2024 0.0209  -0.0109 -0.0117 103 PHE A CB  
794  C CG  . PHE A 100 ? 0.2464 0.2761 0.2150 0.0158  -0.0094 -0.0097 103 PHE A CG  
795  C CD1 . PHE A 100 ? 0.2209 0.2500 0.1905 0.0149  -0.0096 -0.0099 103 PHE A CD1 
796  C CD2 . PHE A 100 ? 0.2102 0.2379 0.1802 0.0125  -0.0078 -0.0075 103 PHE A CD2 
797  C CE1 . PHE A 100 ? 0.2509 0.2774 0.2231 0.0111  -0.0083 -0.0083 103 PHE A CE1 
798  C CE2 . PHE A 100 ? 0.2617 0.2871 0.2340 0.0089  -0.0066 -0.0061 103 PHE A CE2 
799  C CZ  . PHE A 100 ? 0.2351 0.2598 0.2084 0.0083  -0.0069 -0.0066 103 PHE A CZ  
800  N N   . GLU A 101 ? 0.2789 0.3099 0.2448 0.0278  -0.0190 -0.0222 104 GLU A N   
801  C CA  . GLU A 101 ? 0.2924 0.3219 0.2605 0.0285  -0.0219 -0.0256 104 GLU A CA  
802  C C   . GLU A 101 ? 0.2930 0.3259 0.2597 0.0278  -0.0196 -0.0229 104 GLU A C   
803  O O   . GLU A 101 ? 0.3044 0.3422 0.2675 0.0292  -0.0169 -0.0194 104 GLU A O   
804  C CB  . GLU A 101 ? 0.2665 0.2969 0.2332 0.0346  -0.0268 -0.0317 104 GLU A CB  
805  C CG  . GLU A 101 ? 0.2688 0.2934 0.2390 0.0338  -0.0295 -0.0342 104 GLU A CG  
806  C CD  . GLU A 101 ? 0.2760 0.2991 0.2467 0.0393  -0.0355 -0.0411 104 GLU A CD  
807  O OE1 . GLU A 101 ? 0.2799 0.3055 0.2492 0.0436  -0.0388 -0.0454 104 GLU A OE1 
808  O OE2 . GLU A 101 ? 0.2783 0.2971 0.2511 0.0393  -0.0374 -0.0424 104 GLU A OE2 
809  N N   . LEU A 102 ? 0.2461 0.2761 0.2167 0.0253  -0.0207 -0.0239 105 LEU A N   
810  C CA  . LEU A 102 ? 0.2376 0.2703 0.2071 0.0249  -0.0190 -0.0217 105 LEU A CA  
811  C C   . LEU A 102 ? 0.2414 0.2792 0.2073 0.0309  -0.0213 -0.0246 105 LEU A C   
812  O O   . LEU A 102 ? 0.2616 0.2994 0.2271 0.0348  -0.0253 -0.0298 105 LEU A O   
813  C CB  . LEU A 102 ? 0.2062 0.2349 0.1812 0.0204  -0.0192 -0.0218 105 LEU A CB  
814  C CG  . LEU A 102 ? 0.2027 0.2282 0.1803 0.0153  -0.0164 -0.0183 105 LEU A CG  
815  C CD1 . LEU A 102 ? 0.1980 0.2210 0.1811 0.0118  -0.0168 -0.0184 105 LEU A CD1 
816  C CD2 . LEU A 102 ? 0.2506 0.2782 0.2250 0.0144  -0.0128 -0.0139 105 LEU A CD2 
817  N N   . PRO A 103 ? 0.2499 0.2920 0.2129 0.0322  -0.0192 -0.0214 106 PRO A N   
818  C CA  . PRO A 103 ? 0.2674 0.3155 0.2264 0.0385  -0.0211 -0.0236 106 PRO A CA  
819  C C   . PRO A 103 ? 0.2854 0.3314 0.2471 0.0399  -0.0258 -0.0298 106 PRO A C   
820  O O   . PRO A 103 ? 0.2559 0.2965 0.2235 0.0351  -0.0266 -0.0307 106 PRO A O   
821  C CB  . PRO A 103 ? 0.2891 0.3408 0.2463 0.0381  -0.0176 -0.0178 106 PRO A CB  
822  C CG  . PRO A 103 ? 0.2672 0.3136 0.2284 0.0314  -0.0149 -0.0141 106 PRO A CG  
823  C CD  . PRO A 103 ? 0.2465 0.2882 0.2102 0.0282  -0.0152 -0.0157 106 PRO A CD  
824  N N   . GLN A 104 ? 0.3061 0.3572 0.2638 0.0469  -0.0289 -0.0339 107 GLN A N   
825  C CA  . GLN A 104 ? 0.3504 0.4003 0.3108 0.0493  -0.0345 -0.0407 107 GLN A CA  
826  C C   . GLN A 104 ? 0.3589 0.4097 0.3210 0.0481  -0.0343 -0.0399 107 GLN A C   
827  O O   . GLN A 104 ? 0.3819 0.4297 0.3494 0.0469  -0.0381 -0.0443 107 GLN A O   
828  C CB  . GLN A 104 ? 0.3784 0.4344 0.3331 0.0584  -0.0383 -0.0460 107 GLN A CB  
829  C CG  . GLN A 104 ? 0.4755 0.5300 0.4294 0.0606  -0.0403 -0.0491 107 GLN A CG  
830  C CD  . GLN A 104 ? 0.5295 0.5746 0.4917 0.0561  -0.0444 -0.0535 107 GLN A CD  
831  O OE1 . GLN A 104 ? 0.6210 0.6629 0.5889 0.0552  -0.0489 -0.0580 107 GLN A OE1 
832  N NE2 . GLN A 104 ? 0.5851 0.6262 0.5487 0.0533  -0.0431 -0.0518 107 GLN A NE2 
833  N N   . GLY A 105 ? 0.3415 0.3965 0.2996 0.0485  -0.0300 -0.0341 108 GLY A N   
834  C CA  . GLY A 105 ? 0.3673 0.4234 0.3263 0.0482  -0.0298 -0.0331 108 GLY A CA  
835  C C   . GLY A 105 ? 0.3455 0.3955 0.3108 0.0407  -0.0280 -0.0308 108 GLY A C   
836  O O   . GLY A 105 ? 0.3584 0.4033 0.3276 0.0359  -0.0274 -0.0305 108 GLY A O   
837  N N   . PRO A 106 ? 0.3342 0.3852 0.3001 0.0401  -0.0271 -0.0290 109 PRO A N   
838  C CA  . PRO A 106 ? 0.3063 0.3527 0.2768 0.0340  -0.0248 -0.0262 109 PRO A CA  
839  C C   . PRO A 106 ? 0.2750 0.3189 0.2448 0.0304  -0.0207 -0.0211 109 PRO A C   
840  O O   . PRO A 106 ? 0.2873 0.3340 0.2527 0.0326  -0.0188 -0.0178 109 PRO A O   
841  C CB  . PRO A 106 ? 0.3137 0.3631 0.2825 0.0360  -0.0241 -0.0243 109 PRO A CB  
842  C CG  . PRO A 106 ? 0.3513 0.4061 0.3168 0.0425  -0.0275 -0.0282 109 PRO A CG  
843  C CD  . PRO A 106 ? 0.3376 0.3945 0.2996 0.0457  -0.0284 -0.0297 109 PRO A CD  
844  N N   . LEU A 107 ? 0.2475 0.2867 0.2218 0.0252  -0.0196 -0.0205 110 LEU A N   
845  C CA  . LEU A 107 ? 0.2159 0.2526 0.1899 0.0219  -0.0164 -0.0165 110 LEU A CA  
846  C C   . LEU A 107 ? 0.2259 0.2617 0.1997 0.0202  -0.0139 -0.0125 110 LEU A C   
847  O O   . LEU A 107 ? 0.2222 0.2558 0.1960 0.0177  -0.0118 -0.0094 110 LEU A O   
848  C CB  . LEU A 107 ? 0.2172 0.2500 0.1956 0.0178  -0.0166 -0.0178 110 LEU A CB  
849  C CG  . LEU A 107 ? 0.2433 0.2757 0.2226 0.0191  -0.0193 -0.0213 110 LEU A CG  
850  C CD1 . LEU A 107 ? 0.2302 0.2588 0.2144 0.0149  -0.0191 -0.0212 110 LEU A CD1 
851  C CD2 . LEU A 107 ? 0.2307 0.2656 0.2045 0.0225  -0.0186 -0.0203 110 LEU A CD2 
852  N N   . GLY A 108 ? 0.2609 0.2981 0.2347 0.0218  -0.0147 -0.0128 111 GLY A N   
853  C CA  . GLY A 108 ? 0.2599 0.2957 0.2337 0.0209  -0.0130 -0.0094 111 GLY A CA  
854  C C   . GLY A 108 ? 0.2779 0.3150 0.2529 0.0224  -0.0144 -0.0111 111 GLY A C   
855  O O   . GLY A 108 ? 0.2660 0.3055 0.2416 0.0243  -0.0167 -0.0148 111 GLY A O   
856  N N   . THR A 109 ? 0.2950 0.3302 0.2705 0.0217  -0.0134 -0.0088 112 THR A N   
857  C CA  . THR A 109 ? 0.3064 0.3426 0.2830 0.0232  -0.0146 -0.0102 112 THR A CA  
858  C C   . THR A 109 ? 0.3124 0.3460 0.2922 0.0205  -0.0140 -0.0111 112 THR A C   
859  O O   . THR A 109 ? 0.2990 0.3298 0.2797 0.0178  -0.0127 -0.0102 112 THR A O   
860  C CB  . THR A 109 ? 0.3043 0.3417 0.2784 0.0264  -0.0144 -0.0068 112 THR A CB  
861  O OG1 . THR A 109 ? 0.3700 0.4036 0.3444 0.0247  -0.0129 -0.0025 112 THR A OG1 
862  C CG2 . THR A 109 ? 0.3295 0.3717 0.2999 0.0303  -0.0149 -0.0061 112 THR A CG2 
863  N N   . SER A 110 ? 0.3299 0.3653 0.3115 0.0217  -0.0151 -0.0130 113 SER A N   
864  C CA  . SER A 110 ? 0.3470 0.3816 0.3312 0.0203  -0.0146 -0.0136 113 SER A CA  
865  C C   . SER A 110 ? 0.3525 0.3881 0.3364 0.0231  -0.0155 -0.0138 113 SER A C   
866  O O   . SER A 110 ? 0.3324 0.3708 0.3155 0.0257  -0.0168 -0.0145 113 SER A O   
867  C CB  . SER A 110 ? 0.3620 0.3993 0.3504 0.0182  -0.0147 -0.0160 113 SER A CB  
868  O OG  . SER A 110 ? 0.4154 0.4565 0.4061 0.0196  -0.0168 -0.0183 113 SER A OG  
869  N N   . PHE A 111 ? 0.3736 0.4070 0.3580 0.0232  -0.0150 -0.0135 114 PHE A N   
870  C CA  . PHE A 111 ? 0.3851 0.4189 0.3694 0.0261  -0.0161 -0.0138 114 PHE A CA  
871  C C   . PHE A 111 ? 0.4094 0.4472 0.3966 0.0263  -0.0161 -0.0164 114 PHE A C   
872  O O   . PHE A 111 ? 0.4099 0.4478 0.3984 0.0248  -0.0150 -0.0170 114 PHE A O   
873  C CB  . PHE A 111 ? 0.3842 0.4123 0.3672 0.0268  -0.0163 -0.0116 114 PHE A CB  
874  C CG  . PHE A 111 ? 0.3666 0.3939 0.3497 0.0300  -0.0177 -0.0121 114 PHE A CG  
875  C CD1 . PHE A 111 ? 0.3605 0.3901 0.3427 0.0328  -0.0186 -0.0112 114 PHE A CD1 
876  C CD2 . PHE A 111 ? 0.3647 0.3892 0.3486 0.0308  -0.0184 -0.0135 114 PHE A CD2 
877  C CE1 . PHE A 111 ? 0.3402 0.3690 0.3225 0.0360  -0.0200 -0.0115 114 PHE A CE1 
878  C CE2 . PHE A 111 ? 0.3367 0.3602 0.3207 0.0343  -0.0200 -0.0143 114 PHE A CE2 
879  C CZ  . PHE A 111 ? 0.3549 0.3803 0.3382 0.0367  -0.0208 -0.0130 114 PHE A CZ  
880  N N   . LYS A 112 ? 0.4487 0.4907 0.4372 0.0284  -0.0173 -0.0178 115 LYS A N   
881  C CA  . LYS A 112 ? 0.4843 0.5319 0.4767 0.0289  -0.0174 -0.0199 115 LYS A CA  
882  C C   . LYS A 112 ? 0.4930 0.5439 0.4896 0.0255  -0.0161 -0.0201 115 LYS A C   
883  O O   . LYS A 112 ? 0.5175 0.5725 0.5169 0.0255  -0.0151 -0.0204 115 LYS A O   
884  C CB  . LYS A 112 ? 0.4935 0.5404 0.4850 0.0315  -0.0173 -0.0203 115 LYS A CB  
885  C CG  . LYS A 112 ? 0.5233 0.5670 0.5119 0.0350  -0.0189 -0.0197 115 LYS A CG  
886  C CD  . LYS A 112 ? 0.5565 0.6013 0.5454 0.0384  -0.0196 -0.0212 115 LYS A CD  
887  C CE  . LYS A 112 ? 0.5873 0.6277 0.5750 0.0387  -0.0194 -0.0216 115 LYS A CE  
888  N NZ  . LYS A 112 ? 0.6585 0.7040 0.6481 0.0372  -0.0175 -0.0228 115 LYS A NZ  
889  N N   . GLY A 113 ? 0.5041 0.5535 0.5011 0.0230  -0.0162 -0.0198 116 GLY A N   
890  C CA  . GLY A 113 ? 0.5111 0.5627 0.5125 0.0196  -0.0152 -0.0194 116 GLY A CA  
891  C C   . GLY A 113 ? 0.5136 0.5658 0.5151 0.0187  -0.0129 -0.0181 116 GLY A C   
892  O O   . GLY A 113 ? 0.5240 0.5814 0.5303 0.0174  -0.0118 -0.0173 116 GLY A O   
893  N N   . LYS A 114 ? 0.5121 0.5592 0.5085 0.0197  -0.0123 -0.0176 117 LYS A N   
894  C CA  . LYS A 114 ? 0.5053 0.5528 0.5008 0.0202  -0.0107 -0.0173 117 LYS A CA  
895  C C   . LYS A 114 ? 0.4896 0.5304 0.4809 0.0196  -0.0107 -0.0167 117 LYS A C   
896  O O   . LYS A 114 ? 0.5003 0.5411 0.4912 0.0186  -0.0094 -0.0163 117 LYS A O   
897  C CB  . LYS A 114 ? 0.5141 0.5639 0.5088 0.0240  -0.0113 -0.0187 117 LYS A CB  
898  C CG  . LYS A 114 ? 0.5382 0.5900 0.5316 0.0260  -0.0102 -0.0193 117 LYS A CG  
899  C CD  . LYS A 114 ? 0.5561 0.6092 0.5482 0.0306  -0.0115 -0.0214 117 LYS A CD  
900  C CE  . LYS A 114 ? 0.6317 0.6884 0.6223 0.0338  -0.0107 -0.0227 117 LYS A CE  
901  N NZ  . LYS A 114 ? 0.6506 0.7002 0.6374 0.0342  -0.0118 -0.0240 117 LYS A NZ  
902  N N   . TYR A 115 ? 0.4564 0.4922 0.4452 0.0204  -0.0120 -0.0164 118 TYR A N   
903  C CA  . TYR A 115 ? 0.4376 0.4673 0.4238 0.0196  -0.0122 -0.0152 118 TYR A CA  
904  C C   . TYR A 115 ? 0.4285 0.4570 0.4141 0.0175  -0.0119 -0.0135 118 TYR A C   
905  O O   . TYR A 115 ? 0.4343 0.4627 0.4191 0.0185  -0.0127 -0.0127 118 TYR A O   
906  C CB  . TYR A 115 ? 0.4327 0.4580 0.4176 0.0220  -0.0140 -0.0150 118 TYR A CB  
907  C CG  . TYR A 115 ? 0.4288 0.4549 0.4138 0.0251  -0.0150 -0.0174 118 TYR A CG  
908  C CD1 . TYR A 115 ? 0.4293 0.4536 0.4136 0.0260  -0.0155 -0.0191 118 TYR A CD1 
909  C CD2 . TYR A 115 ? 0.3917 0.4207 0.3773 0.0277  -0.0157 -0.0183 118 TYR A CD2 
910  C CE1 . TYR A 115 ? 0.4105 0.4361 0.3945 0.0298  -0.0167 -0.0218 118 TYR A CE1 
911  C CE2 . TYR A 115 ? 0.3992 0.4296 0.3847 0.0312  -0.0167 -0.0207 118 TYR A CE2 
912  C CZ  . TYR A 115 ? 0.4252 0.4538 0.4097 0.0324  -0.0172 -0.0225 118 TYR A CZ  
913  O OH  . TYR A 115 ? 0.4744 0.5048 0.4583 0.0368  -0.0185 -0.0255 118 TYR A OH  
914  N N   . GLY A 116 ? 0.4143 0.4424 0.4001 0.0150  -0.0108 -0.0130 119 GLY A N   
915  C CA  . GLY A 116 ? 0.3996 0.4265 0.3844 0.0136  -0.0106 -0.0116 119 GLY A CA  
916  C C   . GLY A 116 ? 0.3940 0.4169 0.3769 0.0138  -0.0109 -0.0094 119 GLY A C   
917  O O   . GLY A 116 ? 0.4215 0.4412 0.4045 0.0135  -0.0112 -0.0091 119 GLY A O   
918  N N   . CYS A 117 ? 0.3518 0.3753 0.3334 0.0147  -0.0111 -0.0077 120 CYS A N   
919  C CA  . CYS A 117 ? 0.3514 0.3725 0.3322 0.0151  -0.0113 -0.0042 120 CYS A CA  
920  C C   . CYS A 117 ? 0.3195 0.3403 0.2998 0.0133  -0.0103 -0.0021 120 CYS A C   
921  O O   . CYS A 117 ? 0.3152 0.3360 0.2953 0.0137  -0.0100 0.0016  120 CYS A O   
922  C CB  . CYS A 117 ? 0.3640 0.3876 0.3434 0.0179  -0.0118 -0.0025 120 CYS A CB  
923  S SG  . CYS A 117 ? 0.4182 0.4422 0.3981 0.0205  -0.0131 -0.0042 120 CYS A SG  
924  N N   . VAL A 118 ? 0.3092 0.3305 0.2897 0.0115  -0.0096 -0.0041 121 VAL A N   
925  C CA  . VAL A 118 ? 0.2922 0.3137 0.2719 0.0102  -0.0087 -0.0026 121 VAL A CA  
926  C C   . VAL A 118 ? 0.2746 0.2944 0.2553 0.0079  -0.0082 -0.0040 121 VAL A C   
927  O O   . VAL A 118 ? 0.2879 0.3082 0.2694 0.0076  -0.0081 -0.0063 121 VAL A O   
928  C CB  . VAL A 118 ? 0.3023 0.3274 0.2802 0.0117  -0.0087 -0.0033 121 VAL A CB  
929  C CG1 . VAL A 118 ? 0.3258 0.3518 0.3050 0.0110  -0.0092 -0.0070 121 VAL A CG1 
930  C CG2 . VAL A 118 ? 0.3346 0.3609 0.3112 0.0115  -0.0078 -0.0010 121 VAL A CG2 
931  N N   . ASP A 119 ? 0.2419 0.2605 0.2226 0.0065  -0.0077 -0.0021 122 ASP A N   
932  C CA  . ASP A 119 ? 0.2364 0.2540 0.2174 0.0048  -0.0072 -0.0032 122 ASP A CA  
933  C C   . ASP A 119 ? 0.2010 0.2203 0.1811 0.0041  -0.0064 -0.0022 122 ASP A C   
934  O O   . ASP A 119 ? 0.2318 0.2519 0.2117 0.0044  -0.0061 0.0005  122 ASP A O   
935  C CB  . ASP A 119 ? 0.2405 0.2551 0.2231 0.0040  -0.0082 -0.0027 122 ASP A CB  
936  C CG  . ASP A 119 ? 0.3508 0.3637 0.3340 0.0051  -0.0094 -0.0050 122 ASP A CG  
937  O OD1 . ASP A 119 ? 0.4548 0.4698 0.4372 0.0059  -0.0088 -0.0073 122 ASP A OD1 
938  O OD2 . ASP A 119 ? 0.4490 0.4586 0.4340 0.0054  -0.0112 -0.0045 122 ASP A OD2 
939  N N   . TYR A 120 ? 0.1640 0.1841 0.1438 0.0036  -0.0059 -0.0039 123 TYR A N   
940  C CA  . TYR A 120 ? 0.1569 0.1779 0.1358 0.0032  -0.0054 -0.0035 123 TYR A CA  
941  C C   . TYR A 120 ? 0.1649 0.1849 0.1442 0.0016  -0.0048 -0.0036 123 TYR A C   
942  O O   . TYR A 120 ? 0.1604 0.1801 0.1403 0.0012  -0.0045 -0.0047 123 TYR A O   
943  C CB  . TYR A 120 ? 0.1645 0.1868 0.1436 0.0040  -0.0059 -0.0054 123 TYR A CB  
944  C CG  . TYR A 120 ? 0.1714 0.1956 0.1493 0.0065  -0.0069 -0.0058 123 TYR A CG  
945  C CD1 . TYR A 120 ? 0.2238 0.2486 0.2021 0.0076  -0.0077 -0.0066 123 TYR A CD1 
946  C CD2 . TYR A 120 ? 0.1473 0.1734 0.1230 0.0084  -0.0072 -0.0056 123 TYR A CD2 
947  C CE1 . TYR A 120 ? 0.1884 0.2156 0.1651 0.0104  -0.0087 -0.0072 123 TYR A CE1 
948  C CE2 . TYR A 120 ? 0.2071 0.2362 0.1810 0.0116  -0.0082 -0.0062 123 TYR A CE2 
949  C CZ  . TYR A 120 ? 0.1726 0.2022 0.1469 0.0126  -0.0090 -0.0070 123 TYR A CZ  
950  O OH  . TYR A 120 ? 0.2122 0.2453 0.1842 0.0164  -0.0102 -0.0077 123 TYR A OH  
951  N N   . TRP A 121 ? 0.1443 0.1646 0.1229 0.0012  -0.0044 -0.0022 124 TRP A N   
952  C CA  . TRP A 121 ? 0.1469 0.1666 0.1256 0.0001  -0.0040 -0.0022 124 TRP A CA  
953  C C   . TRP A 121 ? 0.1556 0.1766 0.1335 0.0001  -0.0036 -0.0010 124 TRP A C   
954  O O   . TRP A 121 ? 0.1529 0.1758 0.1302 0.0011  -0.0035 0.0004  124 TRP A O   
955  C CB  . TRP A 121 ? 0.1638 0.1820 0.1437 -0.0005 -0.0048 -0.0023 124 TRP A CB  
956  C CG  . TRP A 121 ? 0.1692 0.1865 0.1508 -0.0007 -0.0058 -0.0003 124 TRP A CG  
957  C CD1 . TRP A 121 ? 0.2007 0.2163 0.1836 -0.0002 -0.0068 -0.0005 124 TRP A CD1 
958  C CD2 . TRP A 121 ? 0.2114 0.2299 0.1947 -0.0015 -0.0058 0.0027  124 TRP A CD2 
959  N NE1 . TRP A 121 ? 0.2160 0.2311 0.2015 -0.0008 -0.0075 0.0026  124 TRP A NE1 
960  C CE2 . TRP A 121 ? 0.2210 0.2383 0.2071 -0.0017 -0.0068 0.0048  124 TRP A CE2 
961  C CE3 . TRP A 121 ? 0.1856 0.2064 0.1686 -0.0019 -0.0050 0.0041  124 TRP A CE3 
962  C CZ2 . TRP A 121 ? 0.2157 0.2346 0.2050 -0.0025 -0.0068 0.0091  124 TRP A CZ2 
963  C CZ3 . TRP A 121 ? 0.1926 0.2155 0.1784 -0.0025 -0.0050 0.0079  124 TRP A CZ3 
964  C CH2 . TRP A 121 ? 0.2350 0.2571 0.2242 -0.0030 -0.0058 0.0107  124 TRP A CH2 
965  N N   . VAL A 122 ? 0.1514 0.1722 0.1290 -0.0006 -0.0033 -0.0013 125 VAL A N   
966  C CA  . VAL A 122 ? 0.1359 0.1581 0.1130 -0.0006 -0.0030 -0.0002 125 VAL A CA  
967  C C   . VAL A 122 ? 0.1572 0.1792 0.1354 -0.0017 -0.0034 0.0002  125 VAL A C   
968  O O   . VAL A 122 ? 0.1733 0.1944 0.1513 -0.0019 -0.0036 -0.0013 125 VAL A O   
969  C CB  . VAL A 122 ? 0.1177 0.1398 0.0938 -0.0001 -0.0026 -0.0010 125 VAL A CB  
970  C CG1 . VAL A 122 ? 0.1807 0.2045 0.1560 0.0003  -0.0024 0.0000  125 VAL A CG1 
971  C CG2 . VAL A 122 ? 0.1725 0.1945 0.1485 0.0012  -0.0032 -0.0021 125 VAL A CG2 
972  N N   . LYS A 123 ? 0.1591 0.1825 0.1388 -0.0023 -0.0037 0.0021  126 LYS A N   
973  C CA  . LYS A 123 ? 0.1544 0.1779 0.1361 -0.0034 -0.0047 0.0023  126 LYS A CA  
974  C C   . LYS A 123 ? 0.1607 0.1869 0.1415 -0.0030 -0.0039 0.0032  126 LYS A C   
975  O O   . LYS A 123 ? 0.1687 0.1973 0.1485 -0.0020 -0.0029 0.0047  126 LYS A O   
976  C CB  . LYS A 123 ? 0.1468 0.1702 0.1328 -0.0047 -0.0060 0.0044  126 LYS A CB  
977  C CG  . LYS A 123 ? 0.1964 0.2164 0.1840 -0.0049 -0.0074 0.0032  126 LYS A CG  
978  C CD  . LYS A 123 ? 0.2173 0.2367 0.2103 -0.0063 -0.0089 0.0062  126 LYS A CD  
979  C CE  . LYS A 123 ? 0.2301 0.2455 0.2247 -0.0062 -0.0108 0.0046  126 LYS A CE  
980  N NZ  . LYS A 123 ? 0.3259 0.3400 0.3268 -0.0076 -0.0125 0.0083  126 LYS A NZ  
981  N N   . ALA A 124 ? 0.1587 0.1850 0.1396 -0.0033 -0.0045 0.0022  127 ALA A N   
982  C CA  . ALA A 124 ? 0.1756 0.2048 0.1563 -0.0030 -0.0041 0.0032  127 ALA A CA  
983  C C   . ALA A 124 ? 0.1744 0.2046 0.1588 -0.0043 -0.0059 0.0035  127 ALA A C   
984  O O   . ALA A 124 ? 0.1740 0.2019 0.1600 -0.0049 -0.0078 0.0015  127 ALA A O   
985  C CB  . ALA A 124 ? 0.1732 0.2019 0.1504 -0.0017 -0.0033 0.0019  127 ALA A CB  
986  N N   . PHE A 125 ? 0.1795 0.2134 0.1656 -0.0045 -0.0056 0.0056  128 PHE A N   
987  C CA  . PHE A 125 ? 0.1761 0.2119 0.1675 -0.0061 -0.0076 0.0065  128 PHE A CA  
988  C C   . PHE A 125 ? 0.1810 0.2200 0.1712 -0.0052 -0.0073 0.0063  128 PHE A C   
989  O O   . PHE A 125 ? 0.1958 0.2375 0.1833 -0.0037 -0.0054 0.0077  128 PHE A O   
990  C CB  . PHE A 125 ? 0.1836 0.2224 0.1803 -0.0076 -0.0074 0.0109  128 PHE A CB  
991  C CG  . PHE A 125 ? 0.2117 0.2474 0.2098 -0.0083 -0.0076 0.0117  128 PHE A CG  
992  C CD1 . PHE A 125 ? 0.2457 0.2776 0.2485 -0.0101 -0.0105 0.0107  128 PHE A CD1 
993  C CD2 . PHE A 125 ? 0.2235 0.2598 0.2178 -0.0067 -0.0054 0.0128  128 PHE A CD2 
994  C CE1 . PHE A 125 ? 0.2652 0.2940 0.2692 -0.0104 -0.0109 0.0113  128 PHE A CE1 
995  C CE2 . PHE A 125 ? 0.2351 0.2689 0.2305 -0.0071 -0.0057 0.0134  128 PHE A CE2 
996  C CZ  . PHE A 125 ? 0.2234 0.2534 0.2235 -0.0090 -0.0083 0.0129  128 PHE A CZ  
997  N N   . LEU A 126 ? 0.1767 0.2154 0.1685 -0.0056 -0.0096 0.0041  129 LEU A N   
998  C CA  . LEU A 126 ? 0.1743 0.2163 0.1652 -0.0045 -0.0098 0.0036  129 LEU A CA  
999  C C   . LEU A 126 ? 0.1803 0.2259 0.1785 -0.0066 -0.0118 0.0054  129 LEU A C   
1000 O O   . LEU A 126 ? 0.1907 0.2347 0.1935 -0.0079 -0.0151 0.0035  129 LEU A O   
1001 C CB  . LEU A 126 ? 0.1650 0.2051 0.1523 -0.0029 -0.0110 -0.0002 129 LEU A CB  
1002 C CG  . LEU A 126 ? 0.2341 0.2772 0.2193 -0.0011 -0.0112 -0.0010 129 LEU A CG  
1003 C CD1 . LEU A 126 ? 0.2529 0.2970 0.2336 0.0006  -0.0083 0.0007  129 LEU A CD1 
1004 C CD2 . LEU A 126 ? 0.2691 0.3114 0.2514 0.0009  -0.0129 -0.0047 129 LEU A CD2 
1005 N N   . ASP A 127 ? 0.1889 0.2397 0.1888 -0.0065 -0.0101 0.0091  130 ASP A N   
1006 C CA  . ASP A 127 ? 0.2117 0.2676 0.2198 -0.0086 -0.0116 0.0122  130 ASP A CA  
1007 C C   . ASP A 127 ? 0.2118 0.2713 0.2199 -0.0077 -0.0126 0.0108  130 ASP A C   
1008 O O   . ASP A 127 ? 0.2059 0.2669 0.2079 -0.0049 -0.0106 0.0102  130 ASP A O   
1009 C CB  . ASP A 127 ? 0.2081 0.2698 0.2180 -0.0085 -0.0088 0.0177  130 ASP A CB  
1010 C CG  . ASP A 127 ? 0.2784 0.3377 0.2893 -0.0094 -0.0079 0.0198  130 ASP A CG  
1011 O OD1 . ASP A 127 ? 0.3009 0.3547 0.3145 -0.0113 -0.0102 0.0181  130 ASP A OD1 
1012 O OD2 . ASP A 127 ? 0.3713 0.4346 0.3801 -0.0077 -0.0051 0.0230  130 ASP A OD2 
1013 N N   . ARG A 128 ? 0.2183 0.2788 0.2337 -0.0097 -0.0162 0.0100  131 ARG A N   
1014 C CA  . ARG A 128 ? 0.2621 0.3264 0.2785 -0.0088 -0.0179 0.0084  131 ARG A CA  
1015 C C   . ARG A 128 ? 0.2988 0.3679 0.3270 -0.0121 -0.0206 0.0114  131 ARG A C   
1016 O O   . ARG A 128 ? 0.3101 0.3763 0.3458 -0.0151 -0.0234 0.0120  131 ARG A O   
1017 C CB  . ARG A 128 ? 0.2490 0.3091 0.2610 -0.0070 -0.0205 0.0024  131 ARG A CB  
1018 C CG  . ARG A 128 ? 0.2347 0.2917 0.2360 -0.0037 -0.0175 0.0006  131 ARG A CG  
1019 C CD  . ARG A 128 ? 0.2616 0.3168 0.2586 -0.0011 -0.0197 -0.0042 131 ARG A CD  
1020 N NE  . ARG A 128 ? 0.2660 0.3175 0.2659 -0.0019 -0.0232 -0.0076 131 ARG A NE  
1021 C CZ  . ARG A 128 ? 0.2907 0.3420 0.2891 0.0005  -0.0266 -0.0124 131 ARG A CZ  
1022 N NH1 . ARG A 128 ? 0.3220 0.3768 0.3161 0.0035  -0.0266 -0.0139 131 ARG A NH1 
1023 N NH2 . ARG A 128 ? 0.3062 0.3539 0.3074 0.0003  -0.0302 -0.0159 131 ARG A NH2 
1024 N N   . PRO A 129 ? 0.3530 0.4294 0.3837 -0.0117 -0.0201 0.0136  132 PRO A N   
1025 C CA  . PRO A 129 ? 0.3959 0.4784 0.4393 -0.0150 -0.0225 0.0174  132 PRO A CA  
1026 C C   . PRO A 129 ? 0.4348 0.5134 0.4860 -0.0174 -0.0287 0.0133  132 PRO A C   
1027 O O   . PRO A 129 ? 0.4525 0.5279 0.4985 -0.0151 -0.0312 0.0071  132 PRO A O   
1028 C CB  . PRO A 129 ? 0.3961 0.4865 0.4379 -0.0128 -0.0211 0.0184  132 PRO A CB  
1029 C CG  . PRO A 129 ? 0.4033 0.4924 0.4326 -0.0086 -0.0167 0.0175  132 PRO A CG  
1030 C CD  . PRO A 129 ? 0.3322 0.4119 0.3547 -0.0079 -0.0173 0.0129  132 PRO A CD  
1031 N N   . SER A 130 ? 0.4719 0.5510 0.5358 -0.0217 -0.0314 0.0170  133 SER A N   
1032 C CA  . SER A 130 ? 0.5018 0.5765 0.5755 -0.0243 -0.0384 0.0132  133 SER A CA  
1033 C C   . SER A 130 ? 0.5004 0.5662 0.5662 -0.0216 -0.0412 0.0050  133 SER A C   
1034 O O   . SER A 130 ? 0.5244 0.5883 0.5915 -0.0204 -0.0464 -0.0012 133 SER A O   
1035 C CB  . SER A 130 ? 0.5137 0.5946 0.5959 -0.0253 -0.0422 0.0125  133 SER A CB  
1036 O OG  . SER A 130 ? 0.5733 0.6548 0.6452 -0.0209 -0.0422 0.0066  133 SER A OG  
1037 N N   . GLN A 131 ? 0.4879 0.5489 0.5453 -0.0202 -0.0377 0.0050  134 GLN A N   
1038 C CA  . GLN A 131 ? 0.4662 0.5200 0.5153 -0.0172 -0.0392 -0.0017 134 GLN A CA  
1039 C C   . GLN A 131 ? 0.4331 0.4819 0.4801 -0.0180 -0.0369 0.0004  134 GLN A C   
1040 O O   . GLN A 131 ? 0.4291 0.4806 0.4750 -0.0189 -0.0322 0.0062  134 GLN A O   
1041 C CB  . GLN A 131 ? 0.4626 0.5181 0.4987 -0.0127 -0.0359 -0.0047 134 GLN A CB  
1042 C CG  . GLN A 131 ? 0.5227 0.5745 0.5526 -0.0089 -0.0391 -0.0122 134 GLN A CG  
1043 C CD  . GLN A 131 ? 0.5591 0.6155 0.5843 -0.0056 -0.0396 -0.0151 134 GLN A CD  
1044 O OE1 . GLN A 131 ? 0.5808 0.6413 0.6010 -0.0045 -0.0354 -0.0120 134 GLN A OE1 
1045 N NE2 . GLN A 131 ? 0.5488 0.6047 0.5753 -0.0035 -0.0452 -0.0213 134 GLN A NE2 
1046 N N   . PRO A 132 ? 0.4100 0.4519 0.4567 -0.0173 -0.0405 -0.0045 135 PRO A N   
1047 C CA  . PRO A 132 ? 0.3794 0.4166 0.4240 -0.0177 -0.0384 -0.0027 135 PRO A CA  
1048 C C   . PRO A 132 ? 0.3414 0.3795 0.3737 -0.0149 -0.0322 -0.0018 135 PRO A C   
1049 O O   . PRO A 132 ? 0.3185 0.3574 0.3421 -0.0116 -0.0310 -0.0055 135 PRO A O   
1050 C CB  . PRO A 132 ? 0.3987 0.4293 0.4436 -0.0160 -0.0438 -0.0097 135 PRO A CB  
1051 C CG  . PRO A 132 ? 0.4234 0.4550 0.4754 -0.0162 -0.0500 -0.0138 135 PRO A CG  
1052 C CD  . PRO A 132 ? 0.4157 0.4544 0.4639 -0.0153 -0.0469 -0.0121 135 PRO A CD  
1053 N N   . THR A 133 ? 0.3038 0.3421 0.3359 -0.0163 -0.0286 0.0033  136 THR A N   
1054 C CA  . THR A 133 ? 0.2754 0.3136 0.2974 -0.0139 -0.0235 0.0038  136 THR A CA  
1055 C C   . THR A 133 ? 0.2697 0.3025 0.2856 -0.0116 -0.0245 -0.0014 136 THR A C   
1056 O O   . THR A 133 ? 0.2953 0.3236 0.3152 -0.0122 -0.0280 -0.0036 136 THR A O   
1057 C CB  . THR A 133 ? 0.2713 0.3112 0.2953 -0.0154 -0.0203 0.0099  136 THR A CB  
1058 O OG1 . THR A 133 ? 0.3076 0.3546 0.3362 -0.0166 -0.0188 0.0151  136 THR A OG1 
1059 C CG2 . THR A 133 ? 0.2504 0.2893 0.2647 -0.0129 -0.0162 0.0096  136 THR A CG2 
1060 N N   . GLN A 134 ? 0.2191 0.2525 0.2258 -0.0087 -0.0215 -0.0032 137 GLN A N   
1061 C CA  . GLN A 134 ? 0.2139 0.2437 0.2146 -0.0062 -0.0215 -0.0071 137 GLN A CA  
1062 C C   . GLN A 134 ? 0.1974 0.2260 0.1947 -0.0063 -0.0178 -0.0045 137 GLN A C   
1063 O O   . GLN A 134 ? 0.2015 0.2324 0.1975 -0.0068 -0.0148 -0.0010 137 GLN A O   
1064 C CB  . GLN A 134 ? 0.1897 0.2219 0.1837 -0.0029 -0.0207 -0.0099 137 GLN A CB  
1065 C CG  . GLN A 134 ? 0.2048 0.2391 0.2016 -0.0021 -0.0246 -0.0130 137 GLN A CG  
1066 C CD  . GLN A 134 ? 0.2185 0.2546 0.2084 0.0021  -0.0249 -0.0168 137 GLN A CD  
1067 O OE1 . GLN A 134 ? 0.2104 0.2467 0.1938 0.0043  -0.0218 -0.0164 137 GLN A OE1 
1068 N NE2 . GLN A 134 ? 0.2274 0.2655 0.2193 0.0035  -0.0289 -0.0203 137 GLN A NE2 
1069 N N   . GLU A 135 ? 0.1930 0.2180 0.1887 -0.0054 -0.0185 -0.0067 138 GLU A N   
1070 C CA  . GLU A 135 ? 0.1920 0.2158 0.1848 -0.0054 -0.0155 -0.0047 138 GLU A CA  
1071 C C   . GLU A 135 ? 0.1918 0.2152 0.1783 -0.0028 -0.0140 -0.0073 138 GLU A C   
1072 O O   . GLU A 135 ? 0.1831 0.2063 0.1680 -0.0007 -0.0159 -0.0109 138 GLU A O   
1073 C CB  . GLU A 135 ? 0.2086 0.2292 0.2063 -0.0070 -0.0172 -0.0037 138 GLU A CB  
1074 C CG  . GLU A 135 ? 0.2460 0.2655 0.2407 -0.0066 -0.0145 -0.0021 138 GLU A CG  
1075 C CD  . GLU A 135 ? 0.3264 0.3426 0.3255 -0.0077 -0.0163 -0.0012 138 GLU A CD  
1076 O OE1 . GLU A 135 ? 0.4078 0.4230 0.4139 -0.0096 -0.0189 0.0004  138 GLU A OE1 
1077 O OE2 . GLU A 135 ? 0.3322 0.3470 0.3284 -0.0065 -0.0151 -0.0018 138 GLU A OE2 
1078 N N   . THR A 136 ? 0.1794 0.2031 0.1627 -0.0026 -0.0108 -0.0054 139 THR A N   
1079 C CA  . THR A 136 ? 0.1697 0.1932 0.1491 -0.0008 -0.0094 -0.0067 139 THR A CA  
1080 C C   . THR A 136 ? 0.1818 0.2036 0.1617 -0.0017 -0.0081 -0.0051 139 THR A C   
1081 O O   . THR A 136 ? 0.1978 0.2197 0.1793 -0.0030 -0.0074 -0.0027 139 THR A O   
1082 C CB  . THR A 136 ? 0.1869 0.2129 0.1624 0.0006  -0.0072 -0.0060 139 THR A CB  
1083 O OG1 . THR A 136 ? 0.2052 0.2319 0.1783 0.0022  -0.0059 -0.0065 139 THR A OG1 
1084 C CG2 . THR A 136 ? 0.1936 0.2199 0.1691 -0.0004 -0.0053 -0.0033 139 THR A CG2 
1085 N N   . LYS A 137 ? 0.1660 0.1870 0.1445 -0.0005 -0.0079 -0.0066 140 LYS A N   
1086 C CA  . LYS A 137 ? 0.1724 0.1921 0.1513 -0.0010 -0.0069 -0.0055 140 LYS A CA  
1087 C C   . LYS A 137 ? 0.1829 0.2040 0.1596 0.0003  -0.0053 -0.0060 140 LYS A C   
1088 O O   . LYS A 137 ? 0.2023 0.2250 0.1776 0.0021  -0.0055 -0.0076 140 LYS A O   
1089 C CB  . LYS A 137 ? 0.1877 0.2048 0.1694 -0.0013 -0.0092 -0.0064 140 LYS A CB  
1090 C CG  . LYS A 137 ? 0.1941 0.2102 0.1762 -0.0014 -0.0084 -0.0053 140 LYS A CG  
1091 C CD  . LYS A 137 ? 0.2080 0.2211 0.1927 -0.0012 -0.0109 -0.0063 140 LYS A CD  
1092 C CE  . LYS A 137 ? 0.2305 0.2429 0.2151 -0.0009 -0.0100 -0.0052 140 LYS A CE  
1093 N NZ  . LYS A 137 ? 0.2869 0.2961 0.2747 -0.0008 -0.0125 -0.0053 140 LYS A NZ  
1094 N N   . LYS A 138 ? 0.1738 0.1949 0.1506 -0.0003 -0.0039 -0.0045 141 LYS A N   
1095 C CA  . LYS A 138 ? 0.1898 0.2123 0.1663 0.0003  -0.0026 -0.0045 141 LYS A CA  
1096 C C   . LYS A 138 ? 0.1782 0.1996 0.1560 -0.0001 -0.0027 -0.0043 141 LYS A C   
1097 O O   . LYS A 138 ? 0.1823 0.2028 0.1603 -0.0007 -0.0028 -0.0035 141 LYS A O   
1098 C CB  . LYS A 138 ? 0.2084 0.2324 0.1848 0.0002  -0.0012 -0.0029 141 LYS A CB  
1099 C CG  . LYS A 138 ? 0.1948 0.2213 0.1724 0.0007  0.0001  -0.0018 141 LYS A CG  
1100 C CD  . LYS A 138 ? 0.2769 0.3051 0.2552 0.0006  0.0014  0.0007  141 LYS A CD  
1101 C CE  . LYS A 138 ? 0.3209 0.3528 0.2969 0.0026  0.0023  0.0012  141 LYS A CE  
1102 N NZ  . LYS A 138 ? 0.3005 0.3345 0.2774 0.0027  0.0038  0.0045  141 LYS A NZ  
1103 N N   . ASN A 139 ? 0.1672 0.1893 0.1455 0.0007  -0.0027 -0.0052 142 ASN A N   
1104 C CA  . ASN A 139 ? 0.1826 0.2043 0.1622 0.0006  -0.0029 -0.0053 142 ASN A CA  
1105 C C   . ASN A 139 ? 0.1821 0.2049 0.1634 -0.0001 -0.0022 -0.0044 142 ASN A C   
1106 O O   . ASN A 139 ? 0.1806 0.2050 0.1627 -0.0004 -0.0012 -0.0033 142 ASN A O   
1107 C CB  . ASN A 139 ? 0.2041 0.2267 0.1840 0.0019  -0.0033 -0.0066 142 ASN A CB  
1108 C CG  . ASN A 139 ? 0.2947 0.3151 0.2737 0.0028  -0.0049 -0.0080 142 ASN A CG  
1109 O OD1 . ASN A 139 ? 0.3276 0.3455 0.3072 0.0019  -0.0060 -0.0074 142 ASN A OD1 
1110 N ND2 . ASN A 139 ? 0.4393 0.4613 0.4177 0.0048  -0.0053 -0.0098 142 ASN A ND2 
1111 N N   . PHE A 140 ? 0.1800 0.2021 0.1622 -0.0001 -0.0030 -0.0048 143 PHE A N   
1112 C CA  . PHE A 140 ? 0.1894 0.2122 0.1747 -0.0006 -0.0033 -0.0048 143 PHE A CA  
1113 C C   . PHE A 140 ? 0.1963 0.2199 0.1831 0.0001  -0.0042 -0.0060 143 PHE A C   
1114 O O   . PHE A 140 ? 0.1990 0.2219 0.1837 0.0011  -0.0046 -0.0067 143 PHE A O   
1115 C CB  . PHE A 140 ? 0.2009 0.2222 0.1864 -0.0008 -0.0041 -0.0049 143 PHE A CB  
1116 C CG  . PHE A 140 ? 0.1696 0.1901 0.1526 0.0006  -0.0052 -0.0060 143 PHE A CG  
1117 C CD1 . PHE A 140 ? 0.1558 0.1767 0.1397 0.0019  -0.0069 -0.0078 143 PHE A CD1 
1118 C CD2 . PHE A 140 ? 0.1578 0.1783 0.1379 0.0010  -0.0046 -0.0051 143 PHE A CD2 
1119 C CE1 . PHE A 140 ? 0.1787 0.2003 0.1597 0.0041  -0.0077 -0.0084 143 PHE A CE1 
1120 C CE2 . PHE A 140 ? 0.1654 0.1869 0.1435 0.0027  -0.0052 -0.0051 143 PHE A CE2 
1121 C CZ  . PHE A 140 ? 0.1783 0.2007 0.1564 0.0045  -0.0066 -0.0067 143 PHE A CZ  
1122 N N   . GLU A 141 ? 0.1909 0.2160 0.1819 -0.0006 -0.0046 -0.0060 144 GLU A N   
1123 C CA  . GLU A 141 ? 0.2061 0.2327 0.1992 0.0000  -0.0056 -0.0071 144 GLU A CA  
1124 C C   . GLU A 141 ? 0.1987 0.2242 0.1934 0.0004  -0.0080 -0.0090 144 GLU A C   
1125 O O   . GLU A 141 ? 0.1771 0.2011 0.1737 -0.0001 -0.0091 -0.0093 144 GLU A O   
1126 C CB  . GLU A 141 ? 0.2134 0.2437 0.2114 -0.0010 -0.0047 -0.0056 144 GLU A CB  
1127 C CG  . GLU A 141 ? 0.2752 0.3082 0.2714 -0.0004 -0.0024 -0.0040 144 GLU A CG  
1128 C CD  . GLU A 141 ? 0.3801 0.4148 0.3743 0.0016  -0.0022 -0.0053 144 GLU A CD  
1129 O OE1 . GLU A 141 ? 0.4305 0.4682 0.4234 0.0029  -0.0008 -0.0046 144 GLU A OE1 
1130 O OE2 . GLU A 141 ? 0.4391 0.4724 0.4328 0.0023  -0.0036 -0.0070 144 GLU A OE2 
1131 N N   . VAL A 142 ? 0.2132 0.2395 0.2071 0.0020  -0.0091 -0.0106 145 VAL A N   
1132 C CA  . VAL A 142 ? 0.2136 0.2397 0.2085 0.0034  -0.0119 -0.0132 145 VAL A CA  
1133 C C   . VAL A 142 ? 0.2159 0.2445 0.2148 0.0037  -0.0133 -0.0145 145 VAL A C   
1134 O O   . VAL A 142 ? 0.2324 0.2628 0.2315 0.0036  -0.0120 -0.0135 145 VAL A O   
1135 C CB  . VAL A 142 ? 0.2112 0.2370 0.2003 0.0062  -0.0123 -0.0139 145 VAL A CB  
1136 C CG1 . VAL A 142 ? 0.2152 0.2395 0.2013 0.0060  -0.0111 -0.0125 145 VAL A CG1 
1137 C CG2 . VAL A 142 ? 0.2541 0.2808 0.2404 0.0073  -0.0112 -0.0128 145 VAL A CG2 
1138 N N   . VAL A 143 ? 0.2195 0.2480 0.2216 0.0045  -0.0165 -0.0172 146 VAL A N   
1139 C CA  . VAL A 143 ? 0.2449 0.2759 0.2500 0.0056  -0.0188 -0.0194 146 VAL A CA  
1140 C C   . VAL A 143 ? 0.2573 0.2887 0.2574 0.0096  -0.0209 -0.0223 146 VAL A C   
1141 O O   . VAL A 143 ? 0.2654 0.2959 0.2593 0.0113  -0.0196 -0.0214 146 VAL A O   
1142 C CB  . VAL A 143 ? 0.2566 0.2883 0.2713 0.0034  -0.0215 -0.0203 146 VAL A CB  
1143 C CG1 . VAL A 143 ? 0.2941 0.3281 0.3137 0.0002  -0.0186 -0.0163 146 VAL A CG1 
1144 C CG2 . VAL A 143 ? 0.2766 0.3048 0.2936 0.0032  -0.0243 -0.0221 146 VAL A CG2 
1145 N N   . ASP A 144 ? 0.2695 0.3028 0.2724 0.0113  -0.0241 -0.0255 147 ASP A N   
1146 C CA  . ASP A 144 ? 0.2923 0.3273 0.2902 0.0161  -0.0263 -0.0284 147 ASP A CA  
1147 C C   . ASP A 144 ? 0.2894 0.3260 0.2805 0.0181  -0.0235 -0.0257 147 ASP A C   
1148 O O   . ASP A 144 ? 0.2790 0.3169 0.2642 0.0216  -0.0233 -0.0254 147 ASP A O   
1149 C CB  . ASP A 144 ? 0.2969 0.3305 0.2924 0.0183  -0.0284 -0.0307 147 ASP A CB  
1150 C CG  . ASP A 144 ? 0.3584 0.3899 0.3616 0.0171  -0.0328 -0.0344 147 ASP A CG  
1151 O OD1 . ASP A 144 ? 0.4208 0.4537 0.4301 0.0167  -0.0359 -0.0369 147 ASP A OD1 
1152 O OD2 . ASP A 144 ? 0.3532 0.3818 0.3571 0.0164  -0.0335 -0.0347 147 ASP A OD2 
1153 N N   . LEU A 145 ? 0.3029 0.3397 0.2955 0.0162  -0.0213 -0.0234 148 LEU A N   
1154 C CA  . LEU A 145 ? 0.3085 0.3463 0.2966 0.0181  -0.0196 -0.0212 148 LEU A CA  
1155 C C   . LEU A 145 ? 0.3190 0.3601 0.3079 0.0210  -0.0220 -0.0236 148 LEU A C   
1156 O O   . LEU A 145 ? 0.3406 0.3832 0.3353 0.0199  -0.0240 -0.0260 148 LEU A O   
1157 C CB  . LEU A 145 ? 0.3035 0.3397 0.2927 0.0155  -0.0168 -0.0185 148 LEU A CB  
1158 C CG  . LEU A 145 ? 0.3174 0.3508 0.3065 0.0125  -0.0146 -0.0163 148 LEU A CG  
1159 C CD1 . LEU A 145 ? 0.3457 0.3784 0.3348 0.0115  -0.0126 -0.0146 148 LEU A CD1 
1160 C CD2 . LEU A 145 ? 0.3116 0.3433 0.2962 0.0133  -0.0138 -0.0148 148 LEU A CD2 
1161 N N   . VAL A 146 ? 0.3210 0.3639 0.3049 0.0247  -0.0218 -0.0225 149 VAL A N   
1162 C CA  . VAL A 146 ? 0.3321 0.3786 0.3158 0.0281  -0.0240 -0.0245 149 VAL A CA  
1163 C C   . VAL A 146 ? 0.3400 0.3861 0.3223 0.0284  -0.0220 -0.0214 149 VAL A C   
1164 O O   . VAL A 146 ? 0.3269 0.3700 0.3071 0.0271  -0.0194 -0.0177 149 VAL A O   
1165 C CB  . VAL A 146 ? 0.3445 0.3944 0.3232 0.0334  -0.0260 -0.0261 149 VAL A CB  
1166 C CG1 . VAL A 146 ? 0.3738 0.4239 0.3548 0.0337  -0.0292 -0.0307 149 VAL A CG1 
1167 C CG2 . VAL A 146 ? 0.3349 0.3850 0.3077 0.0351  -0.0231 -0.0213 149 VAL A CG2 
1168 N N   . ASP A 147 ? 0.3473 0.3961 0.3313 0.0302  -0.0235 -0.0231 150 ASP A N   
1169 C CA  . ASP A 147 ? 0.3676 0.4159 0.3503 0.0312  -0.0221 -0.0206 150 ASP A CA  
1170 C C   . ASP A 147 ? 0.3934 0.4411 0.3705 0.0341  -0.0209 -0.0166 150 ASP A C   
1171 O O   . ASP A 147 ? 0.3935 0.4439 0.3672 0.0371  -0.0217 -0.0165 150 ASP A O   
1172 C CB  . ASP A 147 ? 0.3815 0.4337 0.3666 0.0334  -0.0244 -0.0233 150 ASP A CB  
1173 C CG  . ASP A 147 ? 0.4078 0.4592 0.3920 0.0346  -0.0232 -0.0210 150 ASP A CG  
1174 O OD1 . ASP A 147 ? 0.4625 0.5157 0.4435 0.0386  -0.0240 -0.0201 150 ASP A OD1 
1175 O OD2 . ASP A 147 ? 0.4561 0.5053 0.4425 0.0321  -0.0216 -0.0202 150 ASP A OD2 
1176 N N   . VAL A 148 ? 0.4077 0.4521 0.3843 0.0335  -0.0193 -0.0132 151 VAL A N   
1177 C CA  . VAL A 148 ? 0.4347 0.4780 0.4078 0.0355  -0.0181 -0.0081 151 VAL A CA  
1178 C C   . VAL A 148 ? 0.4622 0.5105 0.4321 0.0408  -0.0193 -0.0072 151 VAL A C   
1179 O O   . VAL A 148 ? 0.4643 0.5145 0.4309 0.0431  -0.0183 -0.0030 151 VAL A O   
1180 C CB  . VAL A 148 ? 0.4410 0.4790 0.4157 0.0339  -0.0171 -0.0051 151 VAL A CB  
1181 C CG1 . VAL A 148 ? 0.4169 0.4506 0.3934 0.0296  -0.0158 -0.0050 151 VAL A CG1 
1182 C CG2 . VAL A 148 ? 0.4522 0.4902 0.4287 0.0350  -0.0183 -0.0076 151 VAL A CG2 
1183 N N   . ASN A 149 ? 0.4805 0.5317 0.4514 0.0428  -0.0213 -0.0108 152 ASN A N   
1184 C CA  . ASN A 149 ? 0.5144 0.5707 0.4821 0.0483  -0.0228 -0.0107 152 ASN A CA  
1185 C C   . ASN A 149 ? 0.5350 0.5970 0.5017 0.0510  -0.0255 -0.0157 152 ASN A C   
1186 O O   . ASN A 149 ? 0.5487 0.6155 0.5141 0.0554  -0.0278 -0.0180 152 ASN A O   
1187 C CB  . ASN A 149 ? 0.5156 0.5718 0.4850 0.0497  -0.0238 -0.0112 152 ASN A CB  
1188 C CG  . ASN A 149 ? 0.5391 0.5894 0.5094 0.0481  -0.0220 -0.0067 152 ASN A CG  
1189 O OD1 . ASN A 149 ? 0.5784 0.6263 0.5514 0.0470  -0.0224 -0.0084 152 ASN A OD1 
1190 N ND2 . ASN A 149 ? 0.5711 0.6193 0.5395 0.0483  -0.0204 -0.0010 152 ASN A ND2 
1191 N N   . THR A 150 ? 0.5483 0.6095 0.5157 0.0488  -0.0256 -0.0178 153 THR A N   
1192 C CA  . THR A 150 ? 0.5699 0.6355 0.5368 0.0516  -0.0288 -0.0232 153 THR A CA  
1193 C C   . THR A 150 ? 0.5855 0.6570 0.5455 0.0582  -0.0291 -0.0214 153 THR A C   
1194 O O   . THR A 150 ? 0.5926 0.6640 0.5491 0.0587  -0.0261 -0.0156 153 THR A O   
1195 C CB  . THR A 150 ? 0.5747 0.6372 0.5448 0.0474  -0.0292 -0.0259 153 THR A CB  
1196 O OG1 . THR A 150 ? 0.6115 0.6771 0.5835 0.0496  -0.0336 -0.0323 153 THR A OG1 
1197 C CG2 . THR A 150 ? 0.5897 0.6512 0.5557 0.0474  -0.0266 -0.0220 153 THR A CG2 
1198 N N   . PRO A 151 ? 0.5948 0.6721 0.5530 0.0636  -0.0328 -0.0260 154 PRO A N   
1199 C CA  . PRO A 151 ? 0.6066 0.6913 0.5576 0.0712  -0.0333 -0.0247 154 PRO A CA  
1200 C C   . PRO A 151 ? 0.6168 0.7037 0.5648 0.0732  -0.0340 -0.0267 154 PRO A C   
1201 O O   . PRO A 151 ? 0.6233 0.7056 0.5754 0.0688  -0.0350 -0.0303 154 PRO A O   
1202 C CB  . PRO A 151 ? 0.6061 0.6960 0.5572 0.0761  -0.0379 -0.0307 154 PRO A CB  
1203 C CG  . PRO A 151 ? 0.6062 0.6913 0.5651 0.0705  -0.0391 -0.0336 154 PRO A CG  
1204 C CD  . PRO A 151 ? 0.6017 0.6799 0.5651 0.0632  -0.0369 -0.0327 154 PRO A CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   4   4   VAL VAL A . n 
A 1 2   ALA 2   5   5   ALA ALA A . n 
A 1 3   ALA 3   6   6   ALA ALA A . n 
A 1 4   ILE 4   7   7   ILE ILE A . n 
A 1 5   LYS 5   8   8   LYS LYS A . n 
A 1 6   SER 6   9   9   SER SER A . n 
A 1 7   PHE 7   10  10  PHE PHE A . n 
A 1 8   GLU 8   11  11  GLU GLU A . n 
A 1 9   VAL 9   12  12  VAL VAL A . n 
A 1 10  VAL 10  13  13  VAL VAL A . n 
A 1 11  PHE 11  14  14  PHE PHE A . n 
A 1 12  ASN 12  15  15  ASN ASN A . n 
A 1 13  ASP 13  16  16  ASP ASP A . n 
A 1 14  PRO 14  17  17  PRO PRO A . n 
A 1 15  GLU 15  18  18  GLU GLU A . n 
A 1 16  LYS 16  19  19  LYS LYS A . n 
A 1 17  VAL 17  20  20  VAL VAL A . n 
A 1 18  TYR 18  21  21  TYR TYR A . n 
A 1 19  GLY 19  22  22  GLY GLY A . n 
A 1 20  SER 20  23  23  SER SER A . n 
A 1 21  GLY 21  24  24  GLY GLY A . n 
A 1 22  GLU 22  25  25  GLU GLU A . n 
A 1 23  LYS 23  26  26  LYS LYS A . n 
A 1 24  VAL 24  27  27  VAL VAL A . n 
A 1 25  ALA 25  28  28  ALA ALA A . n 
A 1 26  GLY 26  29  29  GLY GLY A . n 
A 1 27  ARG 27  30  30  ARG ARG A . n 
A 1 28  VAL 28  31  31  VAL VAL A . n 
A 1 29  ILE 29  32  32  ILE ILE A . n 
A 1 30  VAL 30  33  33  VAL VAL A . n 
A 1 31  GLU 31  34  34  GLU GLU A . n 
A 1 32  VAL 32  35  35  VAL VAL A . n 
A 1 33  CYS 33  36  36  CYS CYS A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  VAL 35  38  38  VAL VAL A . n 
A 1 36  THR 36  39  39  THR THR A . n 
A 1 37  ARG 37  40  40  ARG ARG A . n 
A 1 38  VAL 38  41  41  VAL VAL A . n 
A 1 39  LYS 39  42  42  LYS LYS A . n 
A 1 40  ALA 40  43  43  ALA ALA A . n 
A 1 41  VAL 41  44  44  VAL VAL A . n 
A 1 42  ARG 42  45  45  ARG ARG A . n 
A 1 43  ILE 43  46  46  ILE ILE A . n 
A 1 44  LEU 44  47  47  LEU LEU A . n 
A 1 45  ALA 45  48  48  ALA ALA A . n 
A 1 46  CYS 46  49  49  CYS CYS A . n 
A 1 47  GLY 47  50  50  GLY GLY A . n 
A 1 48  VAL 48  51  51  VAL VAL A . n 
A 1 49  ALA 49  52  52  ALA ALA A . n 
A 1 50  LYS 50  53  53  LYS LYS A . n 
A 1 51  VAL 51  54  54  VAL VAL A . n 
A 1 52  LEU 52  55  55  LEU LEU A . n 
A 1 53  TRP 53  56  56  TRP TRP A . n 
A 1 54  MET 54  57  57  MET MET A . n 
A 1 55  GLN 55  58  58  GLN GLN A . n 
A 1 56  GLY 56  59  59  GLY GLY A . n 
A 1 57  SER 57  60  60  SER SER A . n 
A 1 58  GLN 58  61  61  GLN GLN A . n 
A 1 59  GLN 59  62  62  GLN GLN A . n 
A 1 60  CYS 60  63  63  CYS CYS A . n 
A 1 61  LYS 61  64  64  LYS LYS A . n 
A 1 62  GLN 62  65  65  GLN GLY A . n 
A 1 63  THR 63  66  66  THR GLY A . n 
A 1 64  SER 64  67  67  SER SER A . n 
A 1 65  GLU 65  68  68  GLU GLU A . n 
A 1 66  TYR 66  69  69  TYR TYR A . n 
A 1 67  LEU 67  70  70  LEU LEU A . n 
A 1 68  ARG 68  71  71  ARG ARG A . n 
A 1 69  TYR 69  72  72  TYR TYR A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  ASP 71  74  74  ASP ASP A . n 
A 1 72  THR 72  75  75  THR THR A . n 
A 1 73  LEU 73  76  76  LEU LEU A . n 
A 1 74  LEU 74  77  77  LEU LEU A . n 
A 1 75  LEU 75  78  78  LEU LEU A . n 
A 1 76  GLU 76  79  79  GLU GLU A . n 
A 1 77  ASP 77  80  80  ASP ASP A . n 
A 1 78  GLN 78  81  81  GLN GLN A . n 
A 1 79  PRO 79  82  82  PRO PRO A . n 
A 1 80  THR 80  83  83  THR THR A . n 
A 1 81  GLY 81  84  84  GLY GLY A . n 
A 1 82  GLU 82  85  85  GLU GLU A . n 
A 1 83  ASN 83  86  86  ASN ASN A . n 
A 1 84  GLU 84  87  87  GLU GLU A . n 
A 1 85  MET 85  88  88  MET MET A . n 
A 1 86  VAL 86  89  89  VAL VAL A . n 
A 1 87  ILE 87  90  90  ILE ILE A . n 
A 1 88  MET 88  91  91  MET MET A . n 
A 1 89  ARG 89  92  92  ARG ARG A . n 
A 1 90  PRO 90  93  93  PRO PRO A . n 
A 1 91  GLY 91  94  94  GLY GLY A . n 
A 1 92  ASN 92  95  95  ASN ASN A . n 
A 1 93  LYS 93  96  96  LYS LYS A . n 
A 1 94  TYR 94  97  97  TYR TYR A . n 
A 1 95  GLU 95  98  98  GLU GLU A . n 
A 1 96  TYR 96  99  99  TYR TYR A . n 
A 1 97  LYS 97  100 100 LYS LYS A . n 
A 1 98  PHE 98  101 101 PHE PHE A . n 
A 1 99  GLY 99  102 102 GLY GLY A . n 
A 1 100 PHE 100 103 103 PHE PHE A . n 
A 1 101 GLU 101 104 104 GLU GLU A . n 
A 1 102 LEU 102 105 105 LEU LEU A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 GLN 104 107 107 GLN GLN A . n 
A 1 105 GLY 105 108 108 GLY GLY A . n 
A 1 106 PRO 106 109 109 PRO PRO A . n 
A 1 107 LEU 107 110 110 LEU LEU A . n 
A 1 108 GLY 108 111 111 GLY GLY A . n 
A 1 109 THR 109 112 112 THR THR A . n 
A 1 110 SER 110 113 113 SER SER A . n 
A 1 111 PHE 111 114 114 PHE PHE A . n 
A 1 112 LYS 112 115 115 LYS LYS A . n 
A 1 113 GLY 113 116 116 GLY GLY A . n 
A 1 114 LYS 114 117 117 LYS LYS A . n 
A 1 115 TYR 115 118 118 TYR TYR A . n 
A 1 116 GLY 116 119 119 GLY GLY A . n 
A 1 117 CYS 117 120 120 CYS CYS A . n 
A 1 118 VAL 118 121 121 VAL VAL A . n 
A 1 119 ASP 119 122 122 ASP ASP A . n 
A 1 120 TYR 120 123 123 TYR TYR A . n 
A 1 121 TRP 121 124 124 TRP TRP A . n 
A 1 122 VAL 122 125 125 VAL VAL A . n 
A 1 123 LYS 123 126 126 LYS LYS A . n 
A 1 124 ALA 124 127 127 ALA ALA A . n 
A 1 125 PHE 125 128 128 PHE PHE A . n 
A 1 126 LEU 126 129 129 LEU LEU A . n 
A 1 127 ASP 127 130 130 ASP ASP A . n 
A 1 128 ARG 128 131 131 ARG ARG A . n 
A 1 129 PRO 129 132 132 PRO PRO A . n 
A 1 130 SER 130 133 133 SER SER A . n 
A 1 131 GLN 131 134 134 GLN GLN A . n 
A 1 132 PRO 132 135 135 PRO PRO A . n 
A 1 133 THR 133 136 136 THR THR A . n 
A 1 134 GLN 134 137 137 GLN GLN A . n 
A 1 135 GLU 135 138 138 GLU GLU A . n 
A 1 136 THR 136 139 139 THR THR A . n 
A 1 137 LYS 137 140 140 LYS LYS A . n 
A 1 138 LYS 138 141 141 LYS LYS A . n 
A 1 139 ASN 139 142 142 ASN ASN A . n 
A 1 140 PHE 140 143 143 PHE PHE A . n 
A 1 141 GLU 141 144 144 GLU GLU A . n 
A 1 142 VAL 142 145 145 VAL VAL A . n 
A 1 143 VAL 143 146 146 VAL VAL A . n 
A 1 144 ASP 144 147 147 ASP ASP A . n 
A 1 145 LEU 145 148 148 LEU LEU A . n 
A 1 146 VAL 146 149 149 VAL VAL A . n 
A 1 147 ASP 147 150 150 ASP ASP A . n 
A 1 148 VAL 148 151 151 VAL VAL A . n 
A 1 149 ASN 149 152 152 ASN ASN A . n 
A 1 150 THR 150 153 153 THR THR A . n 
A 1 151 PRO 151 154 154 PRO PRO A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         16.6030 
_pdbx_refine_tls.origin_y         -1.6540 
_pdbx_refine_tls.origin_z         1.9700 
_pdbx_refine_tls.T[1][1]          -0.0181 
_pdbx_refine_tls.T[2][2]          0.0051 
_pdbx_refine_tls.T[3][3]          -0.0419 
_pdbx_refine_tls.T[1][2]          0.0000 
_pdbx_refine_tls.T[1][3]          -0.0027 
_pdbx_refine_tls.T[2][3]          0.0000 
_pdbx_refine_tls.L[1][1]          0.9770 
_pdbx_refine_tls.L[2][2]          0.3478 
_pdbx_refine_tls.L[3][3]          0.4541 
_pdbx_refine_tls.L[1][2]          -0.4797 
_pdbx_refine_tls.L[1][3]          0.3257 
_pdbx_refine_tls.L[2][3]          -0.1286 
_pdbx_refine_tls.S[1][1]          -0.0141 
_pdbx_refine_tls.S[1][2]          -0.0378 
_pdbx_refine_tls.S[1][3]          -0.0250 
_pdbx_refine_tls.S[2][1]          0.0094 
_pdbx_refine_tls.S[2][2]          0.0361 
_pdbx_refine_tls.S[2][3]          -0.0045 
_pdbx_refine_tls.S[3][1]          0.0003 
_pdbx_refine_tls.S[3][2]          -0.0356 
_pdbx_refine_tls.S[3][3]          -0.0220 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     4 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     154 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 6   ? ? 85.97   -19.34  
2 1 GLN A 62  ? ? -98.99  -66.93  
3 1 GLN A 65  ? ? 62.55   -129.64 
4 1 THR A 66  ? ? 87.14   -139.54 
5 1 LYS A 117 ? ? -152.10 -42.26  
6 1 VAL A 146 ? ? -110.55 -161.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 65 ? CB  ? A GLN 62 CB  
2 1 Y 1 A GLN 65 ? CG  ? A GLN 62 CG  
3 1 Y 1 A GLN 65 ? CD  ? A GLN 62 CD  
4 1 Y 1 A GLN 65 ? OE1 ? A GLN 62 OE1 
5 1 Y 1 A GLN 65 ? NE2 ? A GLN 62 NE2 
6 1 Y 1 A THR 66 ? CB  ? A THR 63 CB  
7 1 Y 1 A THR 66 ? OG1 ? A THR 63 OG1 
8 1 Y 1 A THR 66 ? CG2 ? A THR 63 CG2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   801  801 GOL GOL A . 
C 3 HOH 1   901  1   HOH HOH A . 
C 3 HOH 2   902  2   HOH HOH A . 
C 3 HOH 3   903  3   HOH HOH A . 
C 3 HOH 4   904  4   HOH HOH A . 
C 3 HOH 5   905  5   HOH HOH A . 
C 3 HOH 6   906  6   HOH HOH A . 
C 3 HOH 7   907  7   HOH HOH A . 
C 3 HOH 8   908  8   HOH HOH A . 
C 3 HOH 9   909  9   HOH HOH A . 
C 3 HOH 10  910  10  HOH HOH A . 
C 3 HOH 11  911  11  HOH HOH A . 
C 3 HOH 12  912  12  HOH HOH A . 
C 3 HOH 13  913  13  HOH HOH A . 
C 3 HOH 14  914  14  HOH HOH A . 
C 3 HOH 15  915  15  HOH HOH A . 
C 3 HOH 16  916  16  HOH HOH A . 
C 3 HOH 17  917  17  HOH HOH A . 
C 3 HOH 18  918  18  HOH HOH A . 
C 3 HOH 19  919  19  HOH HOH A . 
C 3 HOH 20  920  20  HOH HOH A . 
C 3 HOH 21  921  21  HOH HOH A . 
C 3 HOH 22  922  22  HOH HOH A . 
C 3 HOH 23  923  23  HOH HOH A . 
C 3 HOH 24  924  24  HOH HOH A . 
C 3 HOH 25  925  25  HOH HOH A . 
C 3 HOH 26  926  26  HOH HOH A . 
C 3 HOH 27  927  27  HOH HOH A . 
C 3 HOH 28  928  28  HOH HOH A . 
C 3 HOH 29  929  29  HOH HOH A . 
C 3 HOH 30  930  30  HOH HOH A . 
C 3 HOH 31  931  31  HOH HOH A . 
C 3 HOH 32  932  32  HOH HOH A . 
C 3 HOH 33  933  33  HOH HOH A . 
C 3 HOH 34  934  34  HOH HOH A . 
C 3 HOH 35  935  35  HOH HOH A . 
C 3 HOH 36  936  36  HOH HOH A . 
C 3 HOH 37  937  37  HOH HOH A . 
C 3 HOH 38  938  38  HOH HOH A . 
C 3 HOH 39  939  39  HOH HOH A . 
C 3 HOH 40  940  40  HOH HOH A . 
C 3 HOH 41  941  41  HOH HOH A . 
C 3 HOH 42  942  42  HOH HOH A . 
C 3 HOH 43  943  43  HOH HOH A . 
C 3 HOH 44  944  44  HOH HOH A . 
C 3 HOH 45  945  45  HOH HOH A . 
C 3 HOH 46  946  46  HOH HOH A . 
C 3 HOH 47  947  47  HOH HOH A . 
C 3 HOH 48  948  48  HOH HOH A . 
C 3 HOH 49  949  49  HOH HOH A . 
C 3 HOH 50  950  50  HOH HOH A . 
C 3 HOH 51  951  51  HOH HOH A . 
C 3 HOH 52  952  52  HOH HOH A . 
C 3 HOH 53  953  53  HOH HOH A . 
C 3 HOH 54  954  54  HOH HOH A . 
C 3 HOH 55  955  55  HOH HOH A . 
C 3 HOH 56  956  56  HOH HOH A . 
C 3 HOH 57  957  57  HOH HOH A . 
C 3 HOH 58  958  58  HOH HOH A . 
C 3 HOH 59  959  59  HOH HOH A . 
C 3 HOH 60  960  60  HOH HOH A . 
C 3 HOH 61  961  61  HOH HOH A . 
C 3 HOH 62  962  62  HOH HOH A . 
C 3 HOH 63  963  63  HOH HOH A . 
C 3 HOH 64  964  64  HOH HOH A . 
C 3 HOH 65  965  65  HOH HOH A . 
C 3 HOH 66  966  66  HOH HOH A . 
C 3 HOH 67  967  67  HOH HOH A . 
C 3 HOH 68  968  68  HOH HOH A . 
C 3 HOH 69  969  69  HOH HOH A . 
C 3 HOH 70  970  70  HOH HOH A . 
C 3 HOH 71  971  71  HOH HOH A . 
C 3 HOH 72  972  72  HOH HOH A . 
C 3 HOH 73  973  73  HOH HOH A . 
C 3 HOH 74  974  74  HOH HOH A . 
C 3 HOH 75  975  75  HOH HOH A . 
C 3 HOH 76  976  76  HOH HOH A . 
C 3 HOH 77  977  77  HOH HOH A . 
C 3 HOH 78  978  78  HOH HOH A . 
C 3 HOH 79  979  79  HOH HOH A . 
C 3 HOH 80  980  80  HOH HOH A . 
C 3 HOH 81  981  81  HOH HOH A . 
C 3 HOH 82  982  82  HOH HOH A . 
C 3 HOH 83  983  83  HOH HOH A . 
C 3 HOH 84  984  84  HOH HOH A . 
C 3 HOH 85  985  85  HOH HOH A . 
C 3 HOH 86  986  86  HOH HOH A . 
C 3 HOH 87  987  87  HOH HOH A . 
C 3 HOH 88  988  88  HOH HOH A . 
C 3 HOH 89  989  89  HOH HOH A . 
C 3 HOH 90  990  90  HOH HOH A . 
C 3 HOH 91  991  91  HOH HOH A . 
C 3 HOH 92  992  92  HOH HOH A . 
C 3 HOH 93  993  93  HOH HOH A . 
C 3 HOH 94  994  94  HOH HOH A . 
C 3 HOH 95  995  95  HOH HOH A . 
C 3 HOH 96  996  96  HOH HOH A . 
C 3 HOH 97  997  97  HOH HOH A . 
C 3 HOH 98  998  98  HOH HOH A . 
C 3 HOH 99  999  99  HOH HOH A . 
C 3 HOH 100 1000 100 HOH HOH A . 
#