data_4GGF
# 
_entry.id   4GGF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GGF         
RCSB  RCSB074150   
WWPDB D_1000074150 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4GGF 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Damo, S.M.' 1 
'Fritz, G.'  2 
# 
_citation.id                        primary 
_citation.title                     
;Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                3841 
_citation.page_last                 3846 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23431180 
_citation.pdbx_database_id_DOI      10.1073/pnas.1220341110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Damo, S.M.'     1  
primary 'Kehl-Fie, T.E.' 2  
primary 'Sugitani, N.'   3  
primary 'Holt, M.E.'     4  
primary 'Rathi, S.'      5  
primary 'Murphy, W.J.'   6  
primary 'Zhang, Y.'      7  
primary 'Betz, C.'       8  
primary 'Hench, L.'      9  
primary 'Fritz, G.'      10 
primary 'Skaar, E.P.'    11 
primary 'Chazin, W.J.'   12 
# 
_cell.entry_id           4GGF 
_cell.length_a           82.027 
_cell.length_b           217.002 
_cell.length_c           53.022 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4GGF 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-A8'    10837.463 4   ? ? ? ? 
2 polymer     man 'Protein S100-A9'    13247.955 4   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'        40.078    12  ? ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION' 54.938    7   ? ? ? ? 
5 non-polymer syn GLYCEROL             92.094    6   ? ? ? ? 
6 non-polymer syn 'SULFATE ION'        96.063    3   ? ? ? ? 
7 water       nat water                18.015    488 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, MRP-8, p8, S100 calcium-binding protein A8, Urinary stone protein band A
;
2 
;Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, MRP-14, p14, S100 calcium-binding protein A9
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
A,K,S,U ? 
2 'polypeptide(L)' no no 
;MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFI
MLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
;MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFI
MLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
C,L,T,V ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   THR n 
1 4   GLU n 
1 5   LEU n 
1 6   GLU n 
1 7   LYS n 
1 8   ALA n 
1 9   LEU n 
1 10  ASN n 
1 11  SER n 
1 12  ILE n 
1 13  ILE n 
1 14  ASP n 
1 15  VAL n 
1 16  TYR n 
1 17  HIS n 
1 18  LYS n 
1 19  TYR n 
1 20  SER n 
1 21  LEU n 
1 22  ILE n 
1 23  LYS n 
1 24  GLY n 
1 25  ASN n 
1 26  PHE n 
1 27  HIS n 
1 28  ALA n 
1 29  VAL n 
1 30  TYR n 
1 31  ARG n 
1 32  ASP n 
1 33  ASP n 
1 34  LEU n 
1 35  LYS n 
1 36  LYS n 
1 37  LEU n 
1 38  LEU n 
1 39  GLU n 
1 40  THR n 
1 41  GLU n 
1 42  SER n 
1 43  PRO n 
1 44  GLN n 
1 45  TYR n 
1 46  ILE n 
1 47  ARG n 
1 48  LYS n 
1 49  LYS n 
1 50  GLY n 
1 51  ALA n 
1 52  ASP n 
1 53  VAL n 
1 54  TRP n 
1 55  PHE n 
1 56  LYS n 
1 57  GLU n 
1 58  LEU n 
1 59  ASP n 
1 60  ILE n 
1 61  ASN n 
1 62  THR n 
1 63  ASP n 
1 64  GLY n 
1 65  ALA n 
1 66  VAL n 
1 67  ASN n 
1 68  PHE n 
1 69  GLN n 
1 70  GLU n 
1 71  PHE n 
1 72  LEU n 
1 73  ILE n 
1 74  LEU n 
1 75  VAL n 
1 76  ILE n 
1 77  LYS n 
1 78  MET n 
1 79  GLY n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  HIS n 
1 84  LYS n 
1 85  LYS n 
1 86  SER n 
1 87  HIS n 
1 88  GLU n 
1 89  GLU n 
1 90  SER n 
1 91  HIS n 
1 92  LYS n 
1 93  GLU n 
2 1   MET n 
2 2   THR n 
2 3   SER n 
2 4   LYS n 
2 5   MET n 
2 6   SER n 
2 7   GLN n 
2 8   LEU n 
2 9   GLU n 
2 10  ARG n 
2 11  ASN n 
2 12  ILE n 
2 13  GLU n 
2 14  THR n 
2 15  ILE n 
2 16  ILE n 
2 17  ASN n 
2 18  THR n 
2 19  PHE n 
2 20  HIS n 
2 21  GLN n 
2 22  TYR n 
2 23  SER n 
2 24  VAL n 
2 25  LYS n 
2 26  LEU n 
2 27  GLY n 
2 28  HIS n 
2 29  PRO n 
2 30  ASP n 
2 31  THR n 
2 32  LEU n 
2 33  ASN n 
2 34  GLN n 
2 35  GLY n 
2 36  GLU n 
2 37  PHE n 
2 38  LYS n 
2 39  GLU n 
2 40  LEU n 
2 41  VAL n 
2 42  ARG n 
2 43  LYS n 
2 44  ASP n 
2 45  LEU n 
2 46  GLN n 
2 47  ASN n 
2 48  PHE n 
2 49  LEU n 
2 50  LYS n 
2 51  LYS n 
2 52  GLU n 
2 53  ASN n 
2 54  LYS n 
2 55  ASN n 
2 56  GLU n 
2 57  LYS n 
2 58  VAL n 
2 59  ILE n 
2 60  GLU n 
2 61  HIS n 
2 62  ILE n 
2 63  MET n 
2 64  GLU n 
2 65  ASP n 
2 66  LEU n 
2 67  ASP n 
2 68  THR n 
2 69  ASN n 
2 70  ALA n 
2 71  ASP n 
2 72  LYS n 
2 73  GLN n 
2 74  LEU n 
2 75  SER n 
2 76  PHE n 
2 77  GLU n 
2 78  GLU n 
2 79  PHE n 
2 80  ILE n 
2 81  MET n 
2 82  LEU n 
2 83  MET n 
2 84  ALA n 
2 85  ARG n 
2 86  LEU n 
2 87  THR n 
2 88  TRP n 
2 89  ALA n 
2 90  SER n 
2 91  HIS n 
2 92  GLU n 
2 93  LYS n 
2 94  MET n 
2 95  HIS n 
2 96  GLU n 
2 97  GLY n 
2 98  ASP n 
2 99  GLU n 
2 100 GLY n 
2 101 PRO n 
2 102 GLY n 
2 103 HIS n 
2 104 HIS n 
2 105 HIS n 
2 106 LYS n 
2 107 PRO n 
2 108 GLY n 
2 109 LEU n 
2 110 GLY n 
2 111 GLU n 
2 112 GLY n 
2 113 THR n 
2 114 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'S100A8, CAGA, CFAG, MRP8'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? 
? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET1120 ? ? 
2 1 sample ? ? ? human ? 'S100A9, CAGB, CFAG, MRP14' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562    ? ? 
? ? ? ? ?           ? ? ? ? ? ? ? ?       ? ? ? ?       ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP S10A8_HUMAN P05109 1 
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
1 ? 
2 UNP S10A9_HUMAN P06702 2 
;MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFI
MLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GGF A 1 ? 93  ? P05109 1 ? 93  ? 1 93  
2 2 4GGF C 1 ? 114 ? P06702 1 ? 114 ? 1 114 
3 1 4GGF K 1 ? 93  ? P05109 1 ? 93  ? 1 93  
4 2 4GGF L 1 ? 114 ? P06702 1 ? 114 ? 1 114 
5 1 4GGF S 1 ? 93  ? P05109 1 ? 93  ? 1 93  
6 2 4GGF T 1 ? 114 ? P06702 1 ? 114 ? 1 114 
7 1 4GGF U 1 ? 93  ? P05109 1 ? 93  ? 1 93  
8 2 4GGF V 1 ? 114 ? P06702 1 ? 114 ? 1 114 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GGF SER A 42 ? UNP P05109 CYS 42 CONFLICT 42 1 
2 4GGF SER C 3  ? UNP P06702 CYS 3  CONFLICT 3  2 
3 4GGF SER K 42 ? UNP P05109 CYS 42 CONFLICT 42 3 
4 4GGF SER L 3  ? UNP P06702 CYS 3  CONFLICT 3  4 
5 4GGF SER S 42 ? UNP P05109 CYS 42 CONFLICT 42 5 
6 4GGF SER T 3  ? UNP P06702 CYS 3  CONFLICT 3  6 
7 4GGF SER U 42 ? UNP P05109 CYS 42 CONFLICT 42 7 
8 4GGF SER V 3  ? UNP P06702 CYS 3  CONFLICT 3  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ?                               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'        ?                               'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE             ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE            ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ?                               'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                               'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4GGF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, lithium sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-11-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
# 
_reflns.entry_id                     4GGF 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   124149 
_reflns.number_all                   126186 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_netI_over_sigmaI        16.81 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.6  1.7  90.6 ? ? ? ? ? ? ? ? ? ? 1 1 
1.7  1.8  99.8 ? ? ? ? ? ? ? ? ? ? 2 1 
1.8  1.96 99.9 ? ? ? ? ? ? ? ? ? ? 3 1 
1.96 2.14 99.9 ? ? ? ? ? ? ? ? ? ? 4 1 
2.14 2.4  100  ? ? ? ? ? ? ? ? ? ? 5 1 
2.40 2.8  100  ? ? ? ? ? ? ? ? ? ? 6 1 
# 
_refine.entry_id                                 4GGF 
_refine.ls_number_reflns_obs                     117923 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.64 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    98.36 
_refine.ls_R_factor_obs                          0.17796 
_refine.ls_R_factor_R_work                       0.17671 
_refine.ls_R_factor_R_free                       0.20182 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6217 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               24.050 
_refine.aniso_B[1][1]                            0.05 
_refine.aniso_B[2][2]                            -1.36 
_refine.aniso_B[3][3]                            1.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1xk4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.083 
_refine.pdbx_overall_ESU_R_Free                  0.082 
_refine.overall_SU_ML                            0.059 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.492 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6450 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         70 
_refine_hist.number_atoms_solvent             488 
_refine_hist.number_atoms_total               7008 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        47.64 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.016  0.020  ? 6944  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 4765  ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.684  1.952  ? 9361  ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            1.047  3.000  ? 11729 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.507  5.000  ? 851   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.073 25.496 ? 353   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.878 15.000 ? 1357  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       13.634 15.000 ? 22    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.122  0.200  ? 999   ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.008  0.020  ? 7723  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.001  0.020  ? 1340  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            13.516 5.000  ? 4     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          17.696 5.000  ? 48    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.640 
_refine_ls_shell.number_reflns_R_work             7071 
_refine_ls_shell.R_factor_R_work                  0.289 
_refine_ls_shell.percent_reflns_obs               84.75 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             401 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4GGF 
_struct.title                     'Crystal structure of Mn2+ bound calprotectin' 
_struct.pdbx_descriptor           'Protein S100-A8, Protein S100-A9' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GGF 
_struct_keywords.pdbx_keywords   'ANTIMICROBIAL PROTEIN' 
_struct_keywords.text            'S100, EF-hand, ANTIMICROBIAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 5 ? 
O  N N 6 ? 
P  N N 3 ? 
Q  N N 5 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 6 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 3 ? 
GA N N 4 ? 
HA N N 6 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
PA N N 7 ? 
QA N N 7 ? 
RA N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 3  ? LEU A 21 ? THR A 3  LEU A 21 1 ? 19 
HELX_P HELX_P2  2  TYR A 30 ? SER A 42 ? TYR A 30 SER A 42 1 ? 13 
HELX_P HELX_P3  3  PRO A 43 ? LYS A 48 ? PRO A 43 LYS A 48 1 ? 6  
HELX_P HELX_P4  4  GLY A 50 ? ASP A 59 ? GLY A 50 ASP A 59 1 ? 10 
HELX_P HELX_P5  5  ASN A 67 ? HIS A 87 ? ASN A 67 HIS A 87 1 ? 21 
HELX_P HELX_P6  6  SER B 6  ? VAL B 24 ? SER C 6  VAL C 24 1 ? 19 
HELX_P HELX_P7  7  ASN B 33 ? LEU B 45 ? ASN C 33 LEU C 45 1 ? 13 
HELX_P HELX_P8  8  LEU B 49 ? LYS B 54 ? LEU C 49 LYS C 54 1 ? 6  
HELX_P HELX_P9  9  ASN B 55 ? ASP B 67 ? ASN C 55 ASP C 67 1 ? 13 
HELX_P HELX_P10 10 SER B 75 ? HIS B 95 ? SER C 75 HIS C 95 1 ? 21 
HELX_P HELX_P11 11 THR C 3  ? LEU C 21 ? THR K 3  LEU K 21 1 ? 19 
HELX_P HELX_P12 12 TYR C 30 ? SER C 42 ? TYR K 30 SER K 42 1 ? 13 
HELX_P HELX_P13 13 PRO C 43 ? LYS C 48 ? PRO K 43 LYS K 48 1 ? 6  
HELX_P HELX_P14 14 GLY C 50 ? ASP C 59 ? GLY K 50 ASP K 59 1 ? 10 
HELX_P HELX_P15 15 ASN C 67 ? HIS C 87 ? ASN K 67 HIS K 87 1 ? 21 
HELX_P HELX_P16 16 SER D 6  ? VAL D 24 ? SER L 6  VAL L 24 1 ? 19 
HELX_P HELX_P17 17 ASN D 33 ? LEU D 45 ? ASN L 33 LEU L 45 1 ? 13 
HELX_P HELX_P18 18 LEU D 49 ? LYS D 54 ? LEU L 49 LYS L 54 1 ? 6  
HELX_P HELX_P19 19 ASN D 55 ? ASP D 67 ? ASN L 55 ASP L 67 1 ? 13 
HELX_P HELX_P20 20 SER D 75 ? HIS D 95 ? SER L 75 HIS L 95 1 ? 21 
HELX_P HELX_P21 21 THR E 3  ? LEU E 21 ? THR S 3  LEU S 21 1 ? 19 
HELX_P HELX_P22 22 ARG E 31 ? SER E 42 ? ARG S 31 SER S 42 1 ? 12 
HELX_P HELX_P23 23 PRO E 43 ? LYS E 48 ? PRO S 43 LYS S 48 1 ? 6  
HELX_P HELX_P24 24 GLY E 50 ? ASP E 59 ? GLY S 50 ASP S 59 1 ? 10 
HELX_P HELX_P25 25 ASN E 67 ? HIS E 87 ? ASN S 67 HIS S 87 1 ? 21 
HELX_P HELX_P26 26 SER F 6  ? VAL F 24 ? SER T 6  VAL T 24 1 ? 19 
HELX_P HELX_P27 27 ASN F 33 ? LEU F 45 ? ASN T 33 LEU T 45 1 ? 13 
HELX_P HELX_P28 28 LEU F 49 ? LYS F 54 ? LEU T 49 LYS T 54 1 ? 6  
HELX_P HELX_P29 29 ASN F 55 ? ASP F 67 ? ASN T 55 ASP T 67 1 ? 13 
HELX_P HELX_P30 30 SER F 75 ? HIS F 95 ? SER T 75 HIS T 95 1 ? 21 
HELX_P HELX_P31 31 THR G 3  ? LEU G 21 ? THR U 3  LEU U 21 1 ? 19 
HELX_P HELX_P32 32 TYR G 30 ? SER G 42 ? TYR U 30 SER U 42 1 ? 13 
HELX_P HELX_P33 33 PRO G 43 ? LYS G 48 ? PRO U 43 LYS U 48 1 ? 6  
HELX_P HELX_P34 34 GLY G 50 ? ASP G 59 ? GLY U 50 ASP U 59 1 ? 10 
HELX_P HELX_P35 35 ASN G 67 ? SER G 86 ? ASN U 67 SER U 86 1 ? 20 
HELX_P HELX_P36 36 SER H 6  ? VAL H 24 ? SER V 6  VAL V 24 1 ? 19 
HELX_P HELX_P37 37 ASN H 33 ? LEU H 45 ? ASN V 33 LEU V 45 1 ? 13 
HELX_P HELX_P38 38 LEU H 49 ? LYS H 54 ? LEU V 49 LYS V 54 1 ? 6  
HELX_P HELX_P39 39 ASN H 55 ? ASP H 67 ? ASN V 55 ASP V 67 1 ? 13 
HELX_P HELX_P40 40 SER H 75 ? HIS H 95 ? SER V 75 HIS V 95 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? B  ASP 30  OD1 A ? ? 1_555 K  MN  . MN ? ? C ASP 30  C MN  202 1_555 ? ? ? ? ? ? ? 1.709 ? 
metalc2   metalc ? ? F  ASP 30  OD1 B ? ? 1_555 AA MN  . MN ? ? T ASP 30  T MN  202 1_555 ? ? ? ? ? ? ? 1.751 ? 
metalc3   metalc ? ? F  ASP 30  OD1 A ? ? 1_555 AA MN  . MN ? ? T ASP 30  T MN  202 1_555 ? ? ? ? ? ? ? 1.773 ? 
metalc4   metalc ? ? A  HIS 87  NE2 ? ? ? 1_555 K  MN  . MN ? ? A HIS 87  C MN  202 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc5   metalc ? ? C  HIS 87  NE2 ? ? ? 1_555 R  MN  . MN ? ? K HIS 87  L MN  201 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc6   metalc ? ? E  HIS 87  NE2 ? ? ? 1_555 AA MN  . MN ? ? S HIS 87  T MN  202 1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc7   metalc ? ? E  HIS 83  NE2 ? ? ? 1_555 AA MN  . MN ? ? S HIS 83  T MN  202 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc8   metalc ? ? C  HIS 83  NE2 ? ? ? 1_555 R  MN  . MN ? ? K HIS 83  L MN  201 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc9   metalc ? ? D  ASP 30  OD1 B ? ? 1_555 R  MN  . MN ? ? L ASP 30  L MN  201 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc10  metalc ? ? A  HIS 83  NE2 ? ? ? 1_555 K  MN  . MN ? ? A HIS 83  C MN  202 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc11  metalc ? ? B  GLN 73  O   A ? ? 1_555 L  CA  . CA ? ? C GLN 73  C CA  203 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc12  metalc ? ? D  HIS 91  NE2 ? ? ? 1_555 S  MN  . MN ? ? L HIS 91  L MN  202 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc13  metalc ? ? B  HIS 103 NE2 ? ? ? 1_555 J  MN  . MN ? ? C HIS 103 C MN  201 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc14  metalc ? ? D  ASP 30  OD2 B ? ? 1_555 R  MN  . MN ? ? L ASP 30  L MN  201 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc15  metalc ? ? B  HIS 20  NE2 ? ? ? 1_555 K  MN  . MN ? ? C HIS 20  C MN  202 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc16  metalc ? ? H  HIS 28  O   ? ? ? 1_555 JA CA  . CA ? ? V HIS 28  V CA  204 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc17  metalc ? ? G  ASP 59  OD1 ? ? ? 1_555 FA CA  . CA ? ? U ASP 59  U CA  101 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc18  metalc ? ? H  HIS 103 NE2 ? ? ? 1_555 GA MN  . MN ? ? V HIS 103 V MN  201 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc19  metalc ? ? F  ASN 69  OD1 ? ? ? 1_555 CA CA  . CA ? ? T ASN 69  T CA  204 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc20  metalc ? ? B  HIS 95  NE2 ? ? ? 1_555 J  MN  . MN ? ? C HIS 95  C MN  201 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc21  metalc ? ? E  HIS 27  NE2 ? ? ? 1_555 Z  MN  . MN ? ? S HIS 27  T MN  201 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc22  metalc ? ? B  ASP 67  OD1 ? ? ? 1_555 L  CA  . CA ? ? C ASP 67  C CA  203 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc23  metalc ? ? F  HIS 20  NE2 ? ? ? 1_555 AA MN  . MN ? ? T HIS 20  T MN  202 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc24  metalc ? ? F  HIS 95  NE2 ? ? ? 1_555 Z  MN  . MN ? ? T HIS 95  T MN  201 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc25  metalc ? ? F  HIS 91  NE2 ? ? ? 1_555 Z  MN  . MN ? ? T HIS 91  T MN  201 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc26  metalc ? ? C  HIS 27  NE2 ? ? ? 1_555 S  MN  . MN ? ? K HIS 27  L MN  202 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc27  metalc ? ? FA CA  .   CA  ? ? ? 1_555 QA HOH . O  ? ? U CA  101 U HOH 216 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc28  metalc ? ? C  HIS 17  NE2 ? ? ? 1_555 S  MN  . MN ? ? K HIS 17  L MN  202 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc29  metalc ? ? F  HIS 105 NE2 ? ? ? 1_555 Z  MN  . MN ? ? T HIS 105 T MN  201 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc30  metalc ? ? H  ASP 67  OD1 ? ? ? 1_555 IA CA  . CA ? ? V ASP 67  V CA  203 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc31  metalc ? ? D  HIS 20  NE2 ? ? ? 1_555 R  MN  . MN ? ? L HIS 20  L MN  201 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc32  metalc ? ? W  CA  .   CA  ? ? ? 1_555 OA HOH . O  ? ? S CA  101 S HOH 235 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc33  metalc ? ? G  HIS 27  NE2 ? ? ? 1_555 GA MN  . MN ? ? U HIS 27  V MN  201 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc34  metalc ? ? D  HIS 103 NE2 ? ? ? 1_555 S  MN  . MN ? ? L HIS 103 L MN  202 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc35  metalc ? ? P  CA  .   CA  ? ? ? 1_555 MA HOH . O  ? ? K CA  102 K HOH 240 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc36  metalc ? ? D  GLU 78  OE1 ? ? ? 1_555 U  CA  . CA ? ? L GLU 78  L CA  204 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc37  metalc ? ? D  HIS 95  NE2 ? ? ? 1_555 S  MN  . MN ? ? L HIS 95  L MN  202 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc38  metalc ? ? G  ALA 65  O   ? ? ? 1_555 FA CA  . CA ? ? U ALA 65  U CA  101 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc39  metalc ? ? B  GLN 73  O   B ? ? 1_555 L  CA  . CA ? ? C GLN 73  C CA  203 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc40  metalc ? ? H  HIS 91  NE2 ? ? ? 1_555 GA MN  . MN ? ? V HIS 91  V MN  201 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc41  metalc ? ? E  ASP 59  OD1 ? ? ? 1_555 W  CA  . CA ? ? S ASP 59  S CA  101 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc42  metalc ? ? C  ASN 61  OD1 ? ? ? 1_555 P  CA  . CA ? ? K ASN 61  K CA  102 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc43  metalc ? ? G  ASN 61  OD1 ? ? ? 1_555 FA CA  . CA ? ? U ASN 61  U CA  101 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc44  metalc ? ? B  ASN 69  OD1 ? ? ? 1_555 L  CA  . CA ? ? C ASN 69  C CA  203 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc45  metalc ? ? D  ASP 67  OD1 ? ? ? 1_555 U  CA  . CA ? ? L ASP 67  L CA  204 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc46  metalc ? ? A  HIS 17  NE2 ? ? ? 1_555 J  MN  . MN ? ? A HIS 17  C MN  201 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc47  metalc ? ? F  ASP 67  OD1 ? ? ? 1_555 CA CA  . CA ? ? T ASP 67  T CA  204 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc48  metalc ? ? B  HIS 91  NE2 ? ? ? 1_555 J  MN  . MN ? ? C HIS 91  C MN  201 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc49  metalc ? ? A  ALA 65  O   ? ? ? 1_555 I  CA  . CA ? ? A ALA 65  A CA  101 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc50  metalc ? ? D  HIS 28  O   ? ? ? 1_555 V  CA  . CA ? ? L HIS 28  L CA  205 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc51  metalc ? ? F  HIS 103 NE2 ? ? ? 1_555 Z  MN  . MN ? ? T HIS 103 T MN  201 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc52  metalc ? ? F  GLN 73  O   B ? ? 1_555 CA CA  . CA ? ? T GLN 73  T CA  204 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc53  metalc ? ? F  LEU 26  O   ? ? ? 1_555 BA CA  . CA ? ? T LEU 26  T CA  203 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc54  metalc ? ? A  ASN 61  OD1 ? ? ? 1_555 I  CA  . CA ? ? A ASN 61  A CA  101 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc55  metalc ? ? U  CA  .   CA  ? ? ? 1_555 NA HOH . O  ? ? L CA  204 L HOH 354 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc56  metalc ? ? B  GLU 78  OE1 ? ? ? 1_555 L  CA  . CA ? ? C GLU 78  C CA  203 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc57  metalc ? ? D  ASN 69  OD1 ? ? ? 1_555 U  CA  . CA ? ? L ASN 69  L CA  204 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc58  metalc ? ? E  HIS 17  NE2 ? ? ? 1_555 Z  MN  . MN ? ? S HIS 17  T MN  201 1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc59  metalc ? ? H  HIS 95  NE2 ? ? ? 1_555 GA MN  . MN ? ? V HIS 95  V MN  201 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc60  metalc ? ? H  SER 23  O   ? ? ? 1_555 JA CA  . CA ? ? V SER 23  V CA  204 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc61  metalc ? ? D  GLN 73  O   ? ? ? 1_555 U  CA  . CA ? ? L GLN 73  L CA  204 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc62  metalc ? ? D  SER 23  O   ? ? ? 1_555 V  CA  . CA ? ? L SER 23  L CA  205 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc63  metalc ? ? B  HIS 105 NE2 ? ? ? 1_555 J  MN  . MN ? ? C HIS 105 C MN  201 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc64  metalc ? ? D  HIS 105 NE2 ? ? ? 1_555 S  MN  . MN ? ? L HIS 105 L MN  202 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc65  metalc ? ? A  ASP 59  OD1 ? ? ? 1_555 I  CA  . CA ? ? A ASP 59  A CA  101 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc66  metalc ? ? H  HIS 105 NE2 ? ? ? 1_555 GA MN  . MN ? ? V HIS 105 V MN  201 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc67  metalc ? ? E  ALA 65  O   ? ? ? 1_555 W  CA  . CA ? ? S ALA 65  S CA  101 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc68  metalc ? ? A  HIS 27  NE2 ? ? ? 1_555 J  MN  . MN ? ? A HIS 27  C MN  201 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc69  metalc ? ? D  ASP 71  OD1 ? ? ? 1_555 U  CA  . CA ? ? L ASP 71  L CA  204 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc70  metalc ? ? C  ALA 65  O   ? ? ? 1_555 P  CA  . CA ? ? K ALA 65  K CA  102 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc71  metalc ? ? G  HIS 17  NE2 ? ? ? 1_555 GA MN  . MN ? ? U HIS 17  V MN  201 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc72  metalc ? ? B  ASP 71  OD1 ? ? ? 1_555 L  CA  . CA ? ? C ASP 71  C CA  203 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc73  metalc ? ? L  CA  .   CA  ? ? ? 1_555 LA HOH . O  ? ? C CA  203 C HOH 305 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc74  metalc ? ? F  SER 23  O   ? ? ? 1_555 BA CA  . CA ? ? T SER 23  T CA  203 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc75  metalc ? ? H  ASN 69  OD1 ? ? ? 1_555 IA CA  . CA ? ? V ASN 69  V CA  203 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc76  metalc ? ? E  ASN 61  OD1 ? ? ? 1_555 W  CA  . CA ? ? S ASN 61  S CA  101 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc77  metalc ? ? C  ASP 59  OD1 ? ? ? 1_555 P  CA  . CA ? ? K ASP 59  K CA  102 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc78  metalc ? ? F  ASP 30  OD2 B ? ? 1_555 AA MN  . MN ? ? T ASP 30  T MN  202 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc79  metalc ? ? H  LEU 26  O   ? ? ? 1_555 JA CA  . CA ? ? V LEU 26  V CA  204 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc80  metalc ? ? C  GLU 70  OE2 ? ? ? 1_555 P  CA  . CA ? ? K GLU 70  K CA  102 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc81  metalc ? ? D  GLU 36  OE1 ? ? ? 1_555 V  CA  . CA ? ? L GLU 36  L CA  205 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc82  metalc ? ? H  GLU 78  OE1 ? ? ? 1_555 IA CA  . CA ? ? V GLU 78  V CA  203 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc83  metalc ? ? B  LEU 26  O   ? ? ? 1_555 M  CA  . CA ? ? C LEU 26  C CA  204 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc84  metalc ? ? D  THR 31  O   ? ? ? 1_555 V  CA  . CA ? ? L THR 31  L CA  205 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc85  metalc ? ? B  SER 23  O   ? ? ? 1_555 M  CA  . CA ? ? C SER 23  C CA  204 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc86  metalc ? ? B  HIS 28  O   ? ? ? 1_555 M  CA  . CA ? ? C HIS 28  C CA  204 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc87  metalc ? ? H  GLN 73  O   ? ? ? 1_555 IA CA  . CA ? ? V GLN 73  V CA  203 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc88  metalc ? ? H  THR 31  O   ? ? ? 1_555 JA CA  . CA ? ? V THR 31  V CA  204 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc89  metalc ? ? B  GLU 36  OE1 ? ? ? 1_555 M  CA  . CA ? ? C GLU 36  C CA  204 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc90  metalc ? ? E  ASP 63  OD1 ? ? ? 1_555 W  CA  . CA ? ? S ASP 63  S CA  101 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc91  metalc ? ? F  THR 31  O   ? ? ? 1_555 BA CA  . CA ? ? T THR 31  T CA  203 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc92  metalc ? ? B  ASP 30  OD2 B ? ? 1_555 K  MN  . MN ? ? C ASP 30  C MN  202 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc93  metalc ? ? G  ASP 63  OD1 ? ? ? 1_555 FA CA  . CA ? ? U ASP 63  U CA  101 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc94  metalc ? ? IA CA  .   CA  ? ? ? 1_555 RA HOH . O  ? ? V CA  203 V HOH 327 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc95  metalc ? ? F  GLU 36  OE1 ? ? ? 1_555 BA CA  . CA ? ? T GLU 36  T CA  203 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc96  metalc ? ? F  HIS 28  O   ? ? ? 1_555 BA CA  . CA ? ? T HIS 28  T CA  203 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc97  metalc ? ? B  THR 31  O   ? ? ? 1_555 M  CA  . CA ? ? C THR 31  C CA  204 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc98  metalc ? ? F  GLN 73  O   A ? ? 1_555 CA CA  . CA ? ? T GLN 73  T CA  204 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc99  metalc ? ? I  CA  .   CA  ? ? ? 1_555 KA HOH . O  ? ? A CA  101 A HOH 203 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc100 metalc ? ? F  ASP 71  OD1 ? ? ? 1_555 CA CA  . CA ? ? T ASP 71  T CA  204 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc101 metalc ? ? BA CA  .   CA  ? ? ? 1_555 PA HOH . O  ? ? T CA  203 T HOH 317 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc102 metalc ? ? G  GLU 70  OE1 ? ? ? 1_555 FA CA  . CA ? ? U GLU 70  U CA  101 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc103 metalc ? ? M  CA  .   CA  ? ? ? 1_555 LA HOH . O  ? ? C CA  204 C HOH 327 1_555 ? ? ? ? ? ? ? 2.450 ? 
metalc104 metalc ? ? E  GLU 70  OE1 ? ? ? 1_555 W  CA  . CA ? ? S GLU 70  S CA  101 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc105 metalc ? ? JA CA  .   CA  ? ? ? 1_555 RA HOH . O  ? ? V CA  204 V HOH 316 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc106 metalc ? ? V  CA  .   CA  ? ? ? 1_555 NA HOH . O  ? ? L CA  205 L HOH 317 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc107 metalc ? ? C  ASP 63  OD1 ? ? ? 1_555 P  CA  . CA ? ? K ASP 63  K CA  102 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc108 metalc ? ? CA CA  .   CA  ? ? ? 1_555 PA HOH . O  ? ? T CA  204 T HOH 343 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc109 metalc ? ? D  LEU 26  O   ? ? ? 1_555 V  CA  . CA ? ? L LEU 26  L CA  205 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc110 metalc ? ? C  GLU 70  OE1 ? ? ? 1_555 P  CA  . CA ? ? K GLU 70  K CA  102 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc111 metalc ? ? A  GLU 70  OE2 ? ? ? 1_555 I  CA  . CA ? ? A GLU 70  A CA  101 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc112 metalc ? ? H  GLU 36  OE1 ? ? ? 1_555 JA CA  . CA ? ? V GLU 36  V CA  204 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc113 metalc ? ? A  ASP 63  OD1 ? ? ? 1_555 I  CA  . CA ? ? A ASP 63  A CA  101 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc114 metalc ? ? D  GLU 36  OE2 ? ? ? 1_555 V  CA  . CA ? ? L GLU 36  L CA  205 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc115 metalc ? ? A  GLU 70  OE1 ? ? ? 1_555 I  CA  . CA ? ? A GLU 70  A CA  101 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc116 metalc ? ? H  ASP 71  OD1 ? ? ? 1_555 IA CA  . CA ? ? V ASP 71  V CA  203 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc117 metalc ? ? F  GLU 36  OE2 ? ? ? 1_555 BA CA  . CA ? ? T GLU 36  T CA  203 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc118 metalc ? ? F  GLU 78  OE1 ? ? ? 1_555 CA CA  . CA ? ? T GLU 78  T CA  204 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc119 metalc ? ? G  GLU 70  OE2 ? ? ? 1_555 FA CA  . CA ? ? U GLU 70  U CA  101 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc120 metalc ? ? E  GLU 70  OE2 ? ? ? 1_555 W  CA  . CA ? ? S GLU 70  S CA  101 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc121 metalc ? ? F  GLU 78  OE2 ? ? ? 1_555 CA CA  . CA ? ? T GLU 78  T CA  204 1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc122 metalc ? ? H  GLU 36  OE2 ? ? ? 1_555 JA CA  . CA ? ? V GLU 36  V CA  204 1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc123 metalc ? ? D  GLU 78  OE2 ? ? ? 1_555 U  CA  . CA ? ? L GLU 78  L CA  204 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc124 metalc ? ? D  ASP 30  OD2 A ? ? 1_555 R  MN  . MN ? ? L ASP 30  L MN  201 1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc125 metalc ? ? H  GLU 78  OE2 ? ? ? 1_555 IA CA  . CA ? ? V GLU 78  V CA  203 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc126 metalc ? ? B  GLU 78  OE2 ? ? ? 1_555 L  CA  . CA ? ? C GLU 78  C CA  203 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc127 metalc ? ? B  GLU 36  OE2 ? ? ? 1_555 M  CA  . CA ? ? C GLU 36  C CA  204 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc128 metalc ? ? R  MN  .   MN  ? ? ? 1_555 NA HOH . O  ? ? L MN  201 L HOH 357 1_555 ? ? ? ? ? ? ? 2.734 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 88  A . ? GLU 88  A GLU 89  A ? GLU 89  A 1 -1.64 
2 GLY 100 B . ? GLY 100 C PRO 101 B ? PRO 101 C 1 -2.35 
3 GLY 100 D . ? GLY 100 L PRO 101 D ? PRO 101 L 1 4.34  
4 GLU 88  E . ? GLU 88  S GLU 89  E ? GLU 89  S 1 20.86 
5 GLY 100 F . ? GLY 100 T PRO 101 F ? PRO 101 T 1 -1.01 
6 GLY 100 H . ? GLY 100 V PRO 101 H ? PRO 101 V 1 -1.01 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 29 ? TYR E 30 ? VAL S 29 TYR S 30 
A 2 ALA E 65 ? VAL E 66 ? ALA S 65 VAL S 66 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   E 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    29 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    S 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     29 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   E 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    66 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    S 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     66 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 101'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 201'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN C 202'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 203'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 204'  
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL C 205' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 K 101' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA K 102'  
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL K 103' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN L 201'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN L 202'  
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 L 203' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA L 204'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA L 205'  
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA S 101'  
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL S 102' 
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL S 103' 
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN T 201'  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN T 202'  
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA T 203'  
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA T 204'  
CC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE GOL T 205' 
CC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL T 206' 
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA U 101'  
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN V 201'  
CC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 V 202' 
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA V 203'  
DC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA V 204'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP A  59  ? ASP A 59  . ? 1_555 ? 
2   AC1 6  ASN A  61  ? ASN A 61  . ? 1_555 ? 
3   AC1 6  ASP A  63  ? ASP A 63  . ? 1_555 ? 
4   AC1 6  ALA A  65  ? ALA A 65  . ? 1_555 ? 
5   AC1 6  GLU A  70  ? GLU A 70  . ? 1_555 ? 
6   AC1 6  HOH KA .   ? HOH A 203 . ? 1_555 ? 
7   AC2 6  HIS A  17  ? HIS A 17  . ? 1_555 ? 
8   AC2 6  HIS A  27  ? HIS A 27  . ? 1_555 ? 
9   AC2 6  HIS B  91  ? HIS C 91  . ? 1_555 ? 
10  AC2 6  HIS B  95  ? HIS C 95  . ? 1_555 ? 
11  AC2 6  HIS B  103 ? HIS C 103 . ? 1_555 ? 
12  AC2 6  HIS B  105 ? HIS C 105 . ? 1_555 ? 
13  AC3 5  HIS A  83  ? HIS A 83  . ? 1_555 ? 
14  AC3 5  HIS A  87  ? HIS A 87  . ? 1_555 ? 
15  AC3 5  HIS B  20  ? HIS C 20  . ? 1_555 ? 
16  AC3 5  ASP B  30  ? ASP C 30  . ? 1_555 ? 
17  AC3 5  HOH LA .   ? HOH C 380 . ? 1_555 ? 
18  AC4 6  ASP B  67  ? ASP C 67  . ? 1_555 ? 
19  AC4 6  ASN B  69  ? ASN C 69  . ? 1_555 ? 
20  AC4 6  ASP B  71  ? ASP C 71  . ? 1_555 ? 
21  AC4 6  GLN B  73  ? GLN C 73  . ? 1_555 ? 
22  AC4 6  GLU B  78  ? GLU C 78  . ? 1_555 ? 
23  AC4 6  HOH LA .   ? HOH C 305 . ? 1_555 ? 
24  AC5 6  SER B  23  ? SER C 23  . ? 1_555 ? 
25  AC5 6  LEU B  26  ? LEU C 26  . ? 1_555 ? 
26  AC5 6  HIS B  28  ? HIS C 28  . ? 1_555 ? 
27  AC5 6  THR B  31  ? THR C 31  . ? 1_555 ? 
28  AC5 6  GLU B  36  ? GLU C 36  . ? 1_555 ? 
29  AC5 6  HOH LA .   ? HOH C 327 . ? 1_555 ? 
30  AC6 8  HIS B  91  ? HIS C 91  . ? 1_555 ? 
31  AC6 8  GLU B  92  ? GLU C 92  . ? 1_555 ? 
32  AC6 8  HIS B  95  ? HIS C 95  . ? 1_555 ? 
33  AC6 8  HOH LA .   ? HOH C 308 . ? 1_555 ? 
34  AC6 8  HOH LA .   ? HOH C 349 . ? 1_555 ? 
35  AC6 8  HOH LA .   ? HOH C 353 . ? 1_555 ? 
36  AC6 8  ASP D  65  ? ASP L 65  . ? 1_555 ? 
37  AC6 8  ARG D  85  ? ARG L 85  . ? 1_555 ? 
38  AC7 5  LYS C  35  ? LYS K 35  . ? 1_555 ? 
39  AC7 5  GLY C  50  ? GLY K 50  . ? 1_555 ? 
40  AC7 5  ALA C  51  ? ALA K 51  . ? 1_555 ? 
41  AC7 5  ASP C  52  ? ASP K 52  . ? 1_555 ? 
42  AC7 5  HOH MA .   ? HOH K 245 . ? 1_555 ? 
43  AC8 6  ASP C  59  ? ASP K 59  . ? 1_555 ? 
44  AC8 6  ASN C  61  ? ASN K 61  . ? 1_555 ? 
45  AC8 6  ASP C  63  ? ASP K 63  . ? 1_555 ? 
46  AC8 6  ALA C  65  ? ALA K 65  . ? 1_555 ? 
47  AC8 6  GLU C  70  ? GLU K 70  . ? 1_555 ? 
48  AC8 6  HOH MA .   ? HOH K 240 . ? 1_555 ? 
49  AC9 8  GLU A  57  ? GLU A 57  . ? 1_555 ? 
50  AC9 8  ILE A  73  ? ILE A 73  . ? 1_555 ? 
51  AC9 8  HOH KA .   ? HOH A 207 . ? 1_555 ? 
52  AC9 8  GLU C  57  ? GLU K 57  . ? 1_555 ? 
53  AC9 8  ILE C  60  ? ILE K 60  . ? 1_555 ? 
54  AC9 8  ILE C  73  ? ILE K 73  . ? 1_555 ? 
55  AC9 8  LYS C  77  ? LYS K 77  . ? 1_555 ? 
56  AC9 8  HOH MA .   ? HOH K 255 . ? 1_555 ? 
57  BC1 5  HIS C  83  ? HIS K 83  . ? 1_555 ? 
58  BC1 5  HIS C  87  ? HIS K 87  . ? 1_555 ? 
59  BC1 5  HIS D  20  ? HIS L 20  . ? 1_555 ? 
60  BC1 5  ASP D  30  ? ASP L 30  . ? 1_555 ? 
61  BC1 5  HOH NA .   ? HOH L 357 . ? 1_555 ? 
62  BC2 6  HIS C  17  ? HIS K 17  . ? 1_555 ? 
63  BC2 6  HIS C  27  ? HIS K 27  . ? 1_555 ? 
64  BC2 6  HIS D  91  ? HIS L 91  . ? 1_555 ? 
65  BC2 6  HIS D  95  ? HIS L 95  . ? 1_555 ? 
66  BC2 6  HIS D  103 ? HIS L 103 . ? 1_555 ? 
67  BC2 6  HIS D  105 ? HIS L 105 . ? 1_555 ? 
68  BC3 5  GLY D  27  ? GLY L 27  . ? 1_555 ? 
69  BC3 5  HIS D  28  ? HIS L 28  . ? 1_555 ? 
70  BC3 5  ASN D  33  ? ASN L 33  . ? 1_555 ? 
71  BC3 5  GLN D  73  ? GLN L 73  . ? 1_555 ? 
72  BC3 5  HOH NA .   ? HOH L 317 . ? 1_555 ? 
73  BC4 6  ASP D  67  ? ASP L 67  . ? 1_555 ? 
74  BC4 6  ASN D  69  ? ASN L 69  . ? 1_555 ? 
75  BC4 6  ASP D  71  ? ASP L 71  . ? 1_555 ? 
76  BC4 6  GLN D  73  ? GLN L 73  . ? 1_555 ? 
77  BC4 6  GLU D  78  ? GLU L 78  . ? 1_555 ? 
78  BC4 6  HOH NA .   ? HOH L 354 . ? 1_555 ? 
79  BC5 6  SER D  23  ? SER L 23  . ? 1_555 ? 
80  BC5 6  LEU D  26  ? LEU L 26  . ? 1_555 ? 
81  BC5 6  HIS D  28  ? HIS L 28  . ? 1_555 ? 
82  BC5 6  THR D  31  ? THR L 31  . ? 1_555 ? 
83  BC5 6  GLU D  36  ? GLU L 36  . ? 1_555 ? 
84  BC5 6  HOH NA .   ? HOH L 317 . ? 1_555 ? 
85  BC6 6  ASP E  59  ? ASP S 59  . ? 1_555 ? 
86  BC6 6  ASN E  61  ? ASN S 61  . ? 1_555 ? 
87  BC6 6  ASP E  63  ? ASP S 63  . ? 1_555 ? 
88  BC6 6  ALA E  65  ? ALA S 65  . ? 1_555 ? 
89  BC6 6  GLU E  70  ? GLU S 70  . ? 1_555 ? 
90  BC6 6  HOH OA .   ? HOH S 235 . ? 1_555 ? 
91  BC7 5  LYS E  35  ? LYS S 35  . ? 1_555 ? 
92  BC7 5  GLY E  50  ? GLY S 50  . ? 1_555 ? 
93  BC7 5  ALA E  51  ? ALA S 51  . ? 1_555 ? 
94  BC7 5  ASP E  52  ? ASP S 52  . ? 1_555 ? 
95  BC7 5  HOH OA .   ? HOH S 239 . ? 1_555 ? 
96  BC8 6  ASP C  32  ? ASP K 32  . ? 1_555 ? 
97  BC8 6  HOH MA .   ? HOH K 211 . ? 1_555 ? 
98  BC8 6  ARG E  31  ? ARG S 31  . ? 1_555 ? 
99  BC8 6  GLY E  64  ? GLY S 64  . ? 1_555 ? 
100 BC8 6  HOH OA .   ? HOH S 201 . ? 1_555 ? 
101 BC8 6  HOH OA .   ? HOH S 233 . ? 1_555 ? 
102 BC9 6  HIS E  17  ? HIS S 17  . ? 1_555 ? 
103 BC9 6  HIS E  27  ? HIS S 27  . ? 1_555 ? 
104 BC9 6  HIS F  91  ? HIS T 91  . ? 1_555 ? 
105 BC9 6  HIS F  95  ? HIS T 95  . ? 1_555 ? 
106 BC9 6  HIS F  103 ? HIS T 103 . ? 1_555 ? 
107 BC9 6  HIS F  105 ? HIS T 105 . ? 1_555 ? 
108 CC1 5  HIS E  83  ? HIS S 83  . ? 1_555 ? 
109 CC1 5  HIS E  87  ? HIS S 87  . ? 1_555 ? 
110 CC1 5  HIS F  20  ? HIS T 20  . ? 1_555 ? 
111 CC1 5  ASP F  30  ? ASP T 30  . ? 1_555 ? 
112 CC1 5  HOH PA .   ? HOH T 370 . ? 1_555 ? 
113 CC2 6  SER F  23  ? SER T 23  . ? 1_555 ? 
114 CC2 6  LEU F  26  ? LEU T 26  . ? 1_555 ? 
115 CC2 6  HIS F  28  ? HIS T 28  . ? 1_555 ? 
116 CC2 6  THR F  31  ? THR T 31  . ? 1_555 ? 
117 CC2 6  GLU F  36  ? GLU T 36  . ? 1_555 ? 
118 CC2 6  HOH PA .   ? HOH T 317 . ? 1_555 ? 
119 CC3 6  ASP F  67  ? ASP T 67  . ? 1_555 ? 
120 CC3 6  ASN F  69  ? ASN T 69  . ? 1_555 ? 
121 CC3 6  ASP F  71  ? ASP T 71  . ? 1_555 ? 
122 CC3 6  GLN F  73  ? GLN T 73  . ? 1_555 ? 
123 CC3 6  GLU F  78  ? GLU T 78  . ? 1_555 ? 
124 CC3 6  HOH PA .   ? HOH T 343 . ? 1_555 ? 
125 CC4 13 HIS E  27  ? HIS S 27  . ? 1_555 ? 
126 CC4 13 PHE E  68  ? PHE S 68  . ? 1_555 ? 
127 CC4 13 GLN E  69  ? GLN S 69  . ? 1_555 ? 
128 CC4 13 HOH OA .   ? HOH S 255 . ? 1_555 ? 
129 CC4 13 TRP F  88  ? TRP T 88  . ? 1_555 ? 
130 CC4 13 HIS F  91  ? HIS T 91  . ? 1_555 ? 
131 CC4 13 GLU F  92  ? GLU T 92  . ? 1_555 ? 
132 CC4 13 HIS F  95  ? HIS T 95  . ? 1_555 ? 
133 CC4 13 HOH PA .   ? HOH T 326 . ? 1_555 ? 
134 CC4 13 HOH PA .   ? HOH T 375 . ? 1_555 ? 
135 CC4 13 ASP H  65  ? ASP V 65  . ? 1_555 ? 
136 CC4 13 ARG H  85  ? ARG V 85  . ? 1_555 ? 
137 CC4 13 HOH RA .   ? HOH V 331 . ? 1_555 ? 
138 CC5 4  GLY F  27  ? GLY T 27  . ? 1_555 ? 
139 CC5 4  HIS F  28  ? HIS T 28  . ? 1_555 ? 
140 CC5 4  ASN F  33  ? ASN T 33  . ? 1_555 ? 
141 CC5 4  GLN F  73  ? GLN T 73  . ? 1_555 ? 
142 CC6 6  ASP G  59  ? ASP U 59  . ? 1_555 ? 
143 CC6 6  ASN G  61  ? ASN U 61  . ? 1_555 ? 
144 CC6 6  ASP G  63  ? ASP U 63  . ? 1_555 ? 
145 CC6 6  ALA G  65  ? ALA U 65  . ? 1_555 ? 
146 CC6 6  GLU G  70  ? GLU U 70  . ? 1_555 ? 
147 CC6 6  HOH QA .   ? HOH U 216 . ? 1_555 ? 
148 CC7 6  HIS G  17  ? HIS U 17  . ? 1_555 ? 
149 CC7 6  HIS G  27  ? HIS U 27  . ? 1_555 ? 
150 CC7 6  HIS H  91  ? HIS V 91  . ? 1_555 ? 
151 CC7 6  HIS H  95  ? HIS V 95  . ? 1_555 ? 
152 CC7 6  HIS H  103 ? HIS V 103 . ? 1_555 ? 
153 CC7 6  HIS H  105 ? HIS V 105 . ? 1_555 ? 
154 CC8 5  GLY H  27  ? GLY V 27  . ? 1_555 ? 
155 CC8 5  HIS H  28  ? HIS V 28  . ? 1_555 ? 
156 CC8 5  ASN H  33  ? ASN V 33  . ? 1_555 ? 
157 CC8 5  GLN H  73  ? GLN V 73  . ? 1_555 ? 
158 CC8 5  HOH RA .   ? HOH V 316 . ? 1_555 ? 
159 CC9 6  ASP H  67  ? ASP V 67  . ? 1_555 ? 
160 CC9 6  ASN H  69  ? ASN V 69  . ? 1_555 ? 
161 CC9 6  ASP H  71  ? ASP V 71  . ? 1_555 ? 
162 CC9 6  GLN H  73  ? GLN V 73  . ? 1_555 ? 
163 CC9 6  GLU H  78  ? GLU V 78  . ? 1_555 ? 
164 CC9 6  HOH RA .   ? HOH V 327 . ? 1_555 ? 
165 DC1 6  SER H  23  ? SER V 23  . ? 1_555 ? 
166 DC1 6  LEU H  26  ? LEU V 26  . ? 1_555 ? 
167 DC1 6  HIS H  28  ? HIS V 28  . ? 1_555 ? 
168 DC1 6  THR H  31  ? THR V 31  . ? 1_555 ? 
169 DC1 6  GLU H  36  ? GLU V 36  . ? 1_555 ? 
170 DC1 6  HOH RA .   ? HOH V 316 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4GGF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4GGF 
_atom_sites.fract_transf_matrix[1][1]   0.012191 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004608 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018860 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A  1 1   ? 12.338  49.000 -14.658 1.00 36.18  ? 1   MET A N   1 
ATOM   2    C  CA  . MET A  1 1   ? 11.365  49.007 -13.567 1.00 34.62  ? 1   MET A CA  1 
ATOM   3    C  C   . MET A  1 1   ? 10.079  48.325 -14.046 1.00 30.49  ? 1   MET A C   1 
ATOM   4    O  O   . MET A  1 1   ? 9.631   48.510 -15.179 1.00 30.75  ? 1   MET A O   1 
ATOM   5    C  CB  . MET A  1 1   ? 11.089  50.445 -13.100 1.00 35.64  ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A  1 1   ? 10.041  50.529 -12.011 1.00 37.11  ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A  1 1   ? 9.787   52.174 -11.351 1.00 57.16  ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A  1 1   ? 11.155  52.301 -10.204 1.00 42.70  ? 1   MET A CE  1 
ATOM   9    N  N   . LEU A  1 2   ? 9.490   47.516 -13.180 1.00 26.81  ? 2   LEU A N   1 
ATOM   10   C  CA  . LEU A  1 2   ? 8.192   46.902 -13.481 1.00 24.92  ? 2   LEU A CA  1 
ATOM   11   C  C   . LEU A  1 2   ? 7.092   47.963 -13.547 1.00 22.71  ? 2   LEU A C   1 
ATOM   12   O  O   . LEU A  1 2   ? 7.194   49.051 -12.959 1.00 22.37  ? 2   LEU A O   1 
ATOM   13   C  CB  . LEU A  1 2   ? 7.908   45.896 -12.399 1.00 24.51  ? 2   LEU A CB  1 
ATOM   14   C  CG  . LEU A  1 2   ? 8.197   44.406 -12.576 1.00 25.86  ? 2   LEU A CG  1 
ATOM   15   C  CD1 . LEU A  1 2   ? 9.042   43.877 -13.711 1.00 25.29  ? 2   LEU A CD1 1 
ATOM   16   C  CD2 . LEU A  1 2   ? 8.401   43.743 -11.231 1.00 25.16  ? 2   LEU A CD2 1 
ATOM   17   N  N   . THR A  1 3   ? 6.027   47.678 -14.288 1.00 20.95  ? 3   THR A N   1 
ATOM   18   C  CA  . THR A  1 3   ? 4.880   48.583 -14.363 1.00 20.38  ? 3   THR A CA  1 
ATOM   19   C  C   . THR A  1 3   ? 4.099   48.556 -13.051 1.00 20.06  ? 3   THR A C   1 
ATOM   20   O  O   . THR A  1 3   ? 4.258   47.661 -12.252 1.00 19.47  ? 3   THR A O   1 
ATOM   21   C  CB  . THR A  1 3   ? 3.957   48.202 -15.541 1.00 19.82  ? 3   THR A CB  1 
ATOM   22   O  OG1 . THR A  1 3   ? 3.253   46.982 -15.210 1.00 18.91  ? 3   THR A OG1 1 
ATOM   23   C  CG2 . THR A  1 3   ? 4.797   47.945 -16.820 1.00 20.04  ? 3   THR A CG2 1 
ATOM   24   N  N   . GLU A  1 4   ? 3.220   49.519 -12.855 1.00 20.33  ? 4   GLU A N   1 
ATOM   25   C  CA  . GLU A  1 4   ? 2.374   49.529 -11.656 1.00 20.47  ? 4   GLU A CA  1 
ATOM   26   C  C   . GLU A  1 4   ? 1.473   48.282 -11.590 1.00 18.61  ? 4   GLU A C   1 
ATOM   27   O  O   . GLU A  1 4   ? 1.291   47.733 -10.546 1.00 17.94  ? 4   GLU A O   1 
ATOM   28   C  CB  . GLU A  1 4   ? 1.552   50.797 -11.612 1.00 23.14  ? 4   GLU A CB  1 
ATOM   29   C  CG  . GLU A  1 4   ? 2.368   52.068 -11.438 1.00 26.64  ? 4   GLU A CG  1 
ATOM   30   C  CD  . GLU A  1 4   ? 3.325   52.056 -10.214 1.00 31.13  ? 4   GLU A CD  1 
ATOM   31   O  OE1 . GLU A  1 4   ? 4.544   52.354 -10.365 1.00 38.00  ? 4   GLU A OE1 1 
ATOM   32   O  OE2 . GLU A  1 4   ? 2.869   51.751 -9.110  1.00 34.48  ? 4   GLU A OE2 1 
ATOM   33   N  N   . LEU A  1 5   ? 1.006   47.805 -12.749 1.00 17.48  ? 5   LEU A N   1 
ATOM   34   C  CA  . LEU A  1 5   ? 0.208   46.586 -12.753 1.00 16.12  ? 5   LEU A CA  1 
ATOM   35   C  C   . LEU A  1 5   ? 1.012   45.392 -12.372 1.00 16.01  ? 5   LEU A C   1 
ATOM   36   O  O   . LEU A  1 5   ? 0.587   44.582 -11.488 1.00 15.68  ? 5   LEU A O   1 
ATOM   37   C  CB  . LEU A  1 5   ? -0.409  46.313 -14.116 1.00 16.13  ? 5   LEU A CB  1 
ATOM   38   C  CG  . LEU A  1 5   ? -1.315  45.051 -14.163 1.00 15.40  ? 5   LEU A CG  1 
ATOM   39   C  CD1 . LEU A  1 5   ? -2.504  45.092 -13.172 1.00 15.35  ? 5   LEU A CD1 1 
ATOM   40   C  CD2 . LEU A  1 5   ? -1.796  44.858 -15.608 1.00 15.26  ? 5   LEU A CD2 1 
ATOM   41   N  N   . GLU A  1 6   ? 2.180   45.265 -12.976 1.00 16.36  ? 6   GLU A N   1 
ATOM   42   C  CA  . GLU A  1 6   ? 3.116   44.200 -12.576 1.00 16.88  ? 6   GLU A CA  1 
ATOM   43   C  C   . GLU A  1 6   ? 3.471   44.234 -11.081 1.00 17.20  ? 6   GLU A C   1 
ATOM   44   O  O   . GLU A  1 6   ? 3.488   43.198 -10.418 1.00 16.97  ? 6   GLU A O   1 
ATOM   45   C  CB  . GLU A  1 6   ? 4.350   44.203 -13.480 1.00 17.56  ? 6   GLU A CB  1 
ATOM   46   C  CG  . GLU A  1 6   ? 4.021   43.858 -14.914 1.00 17.70  ? 6   GLU A CG  1 
ATOM   47   C  CD  . GLU A  1 6   ? 5.102   44.251 -15.891 1.00 18.74  ? 6   GLU A CD  1 
ATOM   48   O  OE1 . GLU A  1 6   ? 5.040   43.721 -17.029 1.00 18.07  ? 6   GLU A OE1 1 
ATOM   49   O  OE2 . GLU A  1 6   ? 5.979   45.126 -15.605 1.00 19.52  ? 6   GLU A OE2 1 
ATOM   50   N  N   . LYS A  1 7   ? 3.768   45.420 -10.549 1.00 17.46  ? 7   LYS A N   1 
ATOM   51   C  CA  . LYS A  1 7   ? 4.090   45.538 -9.136  1.00 18.13  ? 7   LYS A CA  1 
ATOM   52   C  C   . LYS A  1 7   ? 2.891   45.121 -8.295  1.00 17.56  ? 7   LYS A C   1 
ATOM   53   O  O   . LYS A  1 7   ? 3.074   44.546 -7.240  1.00 17.17  ? 7   LYS A O   1 
ATOM   54   C  CB  . LYS A  1 7   ? 4.488   46.980 -8.787  1.00 19.73  ? 7   LYS A CB  1 
ATOM   55   C  CG  . LYS A  1 7   ? 5.832   47.393 -9.323  1.00 21.49  ? 7   LYS A CG  1 
ATOM   56   C  CD  . LYS A  1 7   ? 6.054   48.890 -9.088  1.00 23.40  ? 7   LYS A CD  1 
ATOM   57   C  CE  . LYS A  1 7   ? 7.409   49.290 -9.595  1.00 25.60  ? 7   LYS A CE  1 
ATOM   58   N  NZ  . LYS A  1 7   ? 7.681   50.729 -9.302  1.00 27.96  ? 7   LYS A NZ  1 
ATOM   59   N  N   . ALA A  1 8   ? 1.688   45.433 -8.749  1.00 16.52  ? 8   ALA A N   1 
ATOM   60   C  CA  . ALA A  1 8   ? 0.496   45.016 -8.012  1.00 16.39  ? 8   ALA A CA  1 
ATOM   61   C  C   . ALA A  1 8   ? 0.379   43.502 -7.861  1.00 15.74  ? 8   ALA A C   1 
ATOM   62   O  O   . ALA A  1 8   ? 0.002   42.985 -6.825  1.00 16.27  ? 8   ALA A O   1 
ATOM   63   C  CB  . ALA A  1 8   ? -0.769  45.586 -8.639  1.00 15.64  ? 8   ALA A CB  1 
ATOM   64   N  N   . LEU A  1 9   ? 0.677   42.805 -8.942  1.00 16.22  ? 9   LEU A N   1 
ATOM   65   C  CA  . LEU A  1 9   ? 0.596   41.364 -8.955  1.00 15.72  ? 9   LEU A CA  1 
ATOM   66   C  C   . LEU A  1 9   ? 1.695   40.790 -8.057  1.00 15.92  ? 9   LEU A C   1 
ATOM   67   O  O   . LEU A  1 9   ? 1.444   39.892 -7.247  1.00 16.46  ? 9   LEU A O   1 
ATOM   68   C  CB  . LEU A  1 9   ? 0.733   40.850 -10.371 1.00 15.70  ? 9   LEU A CB  1 
ATOM   69   C  CG  . LEU A  1 9   ? -0.283  41.302 -11.422 1.00 15.63  ? 9   LEU A CG  1 
ATOM   70   C  CD1 . LEU A  1 9   ? -0.143  40.491 -12.707 1.00 15.64  ? 9   LEU A CD1 1 
ATOM   71   C  CD2 . LEU A  1 9   ? -1.722  41.165 -10.942 1.00 15.78  ? 9   LEU A CD2 1 
ATOM   72   N  N   . ASN A  1 10  ? 2.900   41.374 -8.093  1.00 16.59  ? 10  ASN A N   1 
ATOM   73   C  CA  . ASN A  1 10  ? 3.897   40.893 -7.177  1.00 16.87  ? 10  ASN A CA  1 
ATOM   74   C  C   . ASN A  1 10  ? 3.556   41.229 -5.739  1.00 17.17  ? 10  ASN A C   1 
ATOM   75   O  O   . ASN A  1 10  ? 3.928   40.490 -4.850  1.00 17.43  ? 10  ASN A O   1 
ATOM   76   C  CB  . ASN A  1 10  ? 5.283   41.414 -7.531  1.00 17.67  ? 10  ASN A CB  1 
ATOM   77   C  CG  . ASN A  1 10  ? 5.900   40.665 -8.700  1.00 18.00  ? 10  ASN A CG  1 
ATOM   78   O  OD1 . ASN A  1 10  ? 5.513   39.525 -9.004  1.00 18.53  ? 10  ASN A OD1 1 
ATOM   79   N  ND2 . ASN A  1 10  ? 6.944   41.261 -9.301  1.00 19.24  ? 10  ASN A ND2 1 
ATOM   80   N  N   . SER A  1 11  ? 2.902   42.364 -5.520  1.00 16.82  ? 11  SER A N   1 
ATOM   81   C  CA  . SER A  1 11  ? 2.419   42.706 -4.169  1.00 16.93  ? 11  SER A CA  1 
ATOM   82   C  C   . SER A  1 11  ? 1.403   41.717 -3.634  1.00 16.29  ? 11  SER A C   1 
ATOM   83   O  O   . SER A  1 11  ? 1.395   41.435 -2.427  1.00 16.01  ? 11  SER A O   1 
ATOM   84   C  CB  . SER A  1 11  ? 1.850   44.139 -4.105  1.00 16.91  ? 11  SER A CB  1 
ATOM   85   O  OG  . SER A  1 11  ? 1.385   44.439 -2.787  1.00 17.74  ? 11  SER A OG  1 
ATOM   86   N  N   . ILE A  1 12  ? 0.570   41.149 -4.499  1.00 15.98  ? 12  ILE A N   1 
ATOM   87   C  CA  . ILE A  1 12  ? -0.370  40.118 -4.087  1.00 15.60  ? 12  ILE A CA  1 
ATOM   88   C  C   . ILE A  1 12  ? 0.458   38.925 -3.515  1.00 16.37  ? 12  ILE A C   1 
ATOM   89   O  O   . ILE A  1 12  ? 0.041   38.323 -2.538  1.00 15.27  ? 12  ILE A O   1 
ATOM   90   C  CB  . ILE A  1 12  ? -1.379  39.732 -5.182  1.00 15.85  ? 12  ILE A CB  1 
ATOM   91   C  CG1 . ILE A  1 12  ? -2.355  40.910 -5.451  1.00 15.68  ? 12  ILE A CG1 1 
ATOM   92   C  CG2 . ILE A  1 12  ? -2.100  38.410 -4.790  1.00 15.24  ? 12  ILE A CG2 1 
ATOM   93   C  CD1 . ILE A  1 12  ? -3.123  40.818 -6.793  1.00 15.56  ? 12  ILE A CD1 1 
ATOM   94   N  N   . ILE A  1 13  ? 1.560   38.561 -4.177  1.00 16.35  ? 13  ILE A N   1 
ATOM   95   C  CA  . ILE A  1 13  ? 2.415   37.478 -3.655  1.00 16.74  ? 13  ILE A CA  1 
ATOM   96   C  C   . ILE A  1 13  ? 2.897   37.852 -2.271  1.00 17.47  ? 13  ILE A C   1 
ATOM   97   O  O   . ILE A  1 13  ? 2.846   37.052 -1.347  1.00 17.64  ? 13  ILE A O   1 
ATOM   98   C  CB  . ILE A  1 13  ? 3.602   37.194 -4.607  1.00 17.25  ? 13  ILE A CB  1 
ATOM   99   C  CG1 . ILE A  1 13  ? 3.093   36.756 -5.989  1.00 17.17  ? 13  ILE A CG1 1 
ATOM   100  C  CG2 . ILE A  1 13  ? 4.577   36.266 -3.906  1.00 17.75  ? 13  ILE A CG2 1 
ATOM   101  C  CD1 . ILE A  1 13  ? 4.175   36.702 -7.081  1.00 17.08  ? 13  ILE A CD1 1 
ATOM   102  N  N   A ASP A  1 14  ? 3.348   39.090 -2.130  0.54 18.19  ? 14  ASP A N   1 
ATOM   103  N  N   B ASP A  1 14  ? 3.344   39.100 -2.143  0.46 17.84  ? 14  ASP A N   1 
ATOM   104  C  CA  A ASP A  1 14  ? 3.848   39.580 -0.847  0.54 19.05  ? 14  ASP A CA  1 
ATOM   105  C  CA  B ASP A  1 14  ? 3.840   39.657 -0.878  0.46 18.43  ? 14  ASP A CA  1 
ATOM   106  C  C   A ASP A  1 14  ? 2.792   39.502 0.239   0.54 18.60  ? 14  ASP A C   1 
ATOM   107  C  C   B ASP A  1 14  ? 2.809   39.560 0.233   0.46 18.33  ? 14  ASP A C   1 
ATOM   108  O  O   A ASP A  1 14  ? 3.081   39.040 1.345   0.54 18.98  ? 14  ASP A O   1 
ATOM   109  O  O   B ASP A  1 14  ? 3.138   39.159 1.351   0.46 18.80  ? 14  ASP A O   1 
ATOM   110  C  CB  A ASP A  1 14  ? 4.360   41.013 -0.994  0.54 20.51  ? 14  ASP A CB  1 
ATOM   111  C  CB  B ASP A  1 14  ? 4.250   41.122 -1.094  0.46 19.29  ? 14  ASP A CB  1 
ATOM   112  C  CG  A ASP A  1 14  ? 5.663   41.103 -1.766  0.54 21.96  ? 14  ASP A CG  1 
ATOM   113  C  CG  B ASP A  1 14  ? 4.980   41.711 0.101   0.46 20.33  ? 14  ASP A CG  1 
ATOM   114  O  OD1 A ASP A  1 14  ? 6.347   40.088 -1.960  0.54 22.91  ? 14  ASP A OD1 1 
ATOM   115  O  OD1 B ASP A  1 14  ? 5.917   41.074 0.572   0.46 21.62  ? 14  ASP A OD1 1 
ATOM   116  O  OD2 A ASP A  1 14  ? 6.038   42.225 -2.131  0.54 24.25  ? 14  ASP A OD2 1 
ATOM   117  O  OD2 B ASP A  1 14  ? 4.650   42.836 0.536   0.46 21.31  ? 14  ASP A OD2 1 
ATOM   118  N  N   . VAL A  1 15  ? 1.558   39.926 -0.082  1.00 18.00  ? 15  VAL A N   1 
ATOM   119  C  CA  . VAL A  1 15  ? 0.466   39.876 0.892   1.00 17.74  ? 15  VAL A CA  1 
ATOM   120  C  C   . VAL A  1 15  ? 0.285   38.444 1.427   1.00 17.15  ? 15  VAL A C   1 
ATOM   121  O  O   . VAL A  1 15  ? 0.163   38.234 2.651   1.00 16.84  ? 15  VAL A O   1 
ATOM   122  C  CB  . VAL A  1 15  ? -0.873  40.336 0.299   1.00 18.44  ? 15  VAL A CB  1 
ATOM   123  C  CG1 . VAL A  1 15  ? -2.004  40.094 1.337   1.00 19.94  ? 15  VAL A CG1 1 
ATOM   124  C  CG2 . VAL A  1 15  ? -0.777  41.824 -0.053  1.00 20.30  ? 15  VAL A CG2 1 
ATOM   125  N  N   . TYR A  1 16  ? 0.292   37.456 0.562   1.00 16.25  ? 16  TYR A N   1 
ATOM   126  C  CA  . TYR A  1 16  ? 0.089   36.071 0.945   1.00 15.97  ? 16  TYR A CA  1 
ATOM   127  C  C   . TYR A  1 16  ? 1.194   35.688 1.980   1.00 17.41  ? 16  TYR A C   1 
ATOM   128  O  O   . TYR A  1 16  ? 0.935   35.064 2.993   1.00 17.18  ? 16  TYR A O   1 
ATOM   129  C  CB  . TYR A  1 16  ? 0.132   35.144 -0.264  1.00 15.97  ? 16  TYR A CB  1 
ATOM   130  C  CG  . TYR A  1 16  ? 0.064   33.701 0.119   1.00 15.51  ? 16  TYR A CG  1 
ATOM   131  C  CD1 . TYR A  1 16  ? -1.110  33.107 0.576   1.00 14.99  ? 16  TYR A CD1 1 
ATOM   132  C  CD2 . TYR A  1 16  ? 1.195   32.893 0.072   1.00 15.75  ? 16  TYR A CD2 1 
ATOM   133  C  CE1 . TYR A  1 16  ? -1.156  31.745 0.926   1.00 15.02  ? 16  TYR A CE1 1 
ATOM   134  C  CE2 . TYR A  1 16  ? 1.150   31.547 0.434   1.00 15.88  ? 16  TYR A CE2 1 
ATOM   135  C  CZ  . TYR A  1 16  ? -0.012  30.959 0.868   1.00 15.51  ? 16  TYR A CZ  1 
ATOM   136  O  OH  . TYR A  1 16  ? -0.020  29.612 1.258   1.00 16.16  ? 16  TYR A OH  1 
ATOM   137  N  N   . HIS A  1 17  ? 2.429   36.037 1.664   1.00 18.07  ? 17  HIS A N   1 
ATOM   138  C  CA  . HIS A  1 17  ? 3.591   35.588 2.445   1.00 19.08  ? 17  HIS A CA  1 
ATOM   139  C  C   . HIS A  1 17  ? 3.630   36.252 3.790   1.00 20.64  ? 17  HIS A C   1 
ATOM   140  O  O   . HIS A  1 17  ? 4.137   35.691 4.747   1.00 20.94  ? 17  HIS A O   1 
ATOM   141  C  CB  . HIS A  1 17  ? 4.887   35.758 1.606   1.00 19.48  ? 17  HIS A CB  1 
ATOM   142  C  CG  . HIS A  1 17  ? 5.044   34.731 0.522   1.00 18.96  ? 17  HIS A CG  1 
ATOM   143  N  ND1 . HIS A  1 17  ? 4.376   34.810 -0.658  1.00 17.93  ? 17  HIS A ND1 1 
ATOM   144  C  CD2 . HIS A  1 17  ? 5.764   33.524 0.479   1.00 18.86  ? 17  HIS A CD2 1 
ATOM   145  C  CE1 . HIS A  1 17  ? 4.681   33.732 -1.413  1.00 18.48  ? 17  HIS A CE1 1 
ATOM   146  N  NE2 . HIS A  1 17  ? 5.511   32.950 -0.722  1.00 18.63  ? 17  HIS A NE2 1 
ATOM   147  N  N   . LYS A  1 18  ? 3.015   37.432 3.909   1.00 20.37  ? 18  LYS A N   1 
ATOM   148  C  CA  . LYS A  1 18  ? 2.879   38.031 5.234   1.00 21.47  ? 18  LYS A CA  1 
ATOM   149  C  C   . LYS A  1 18  ? 2.189   37.095 6.217   1.00 21.08  ? 18  LYS A C   1 
ATOM   150  O  O   . LYS A  1 18  ? 2.451   37.165 7.416   1.00 22.23  ? 18  LYS A O   1 
ATOM   151  C  CB  . LYS A  1 18  ? 2.089   39.322 5.172   1.00 23.54  ? 18  LYS A CB  1 
ATOM   152  C  CG  . LYS A  1 18  ? 2.834   40.455 4.520   1.00 26.77  ? 18  LYS A CG  1 
ATOM   153  C  CD  . LYS A  1 18  ? 2.268   41.841 4.866   1.00 29.59  ? 18  LYS A CD  1 
ATOM   154  C  CE  . LYS A  1 18  ? 0.756   41.889 5.202   1.00 31.73  ? 18  LYS A CE  1 
ATOM   155  N  NZ  . LYS A  1 18  ? 0.047   43.204 4.854   1.00 34.36  ? 18  LYS A NZ  1 
ATOM   156  N  N   . TYR A  1 19  ? 1.277   36.261 5.734   1.00 20.12  ? 19  TYR A N   1 
ATOM   157  C  CA  . TYR A  1 19  ? 0.531   35.316 6.556   1.00 19.15  ? 19  TYR A CA  1 
ATOM   158  C  C   . TYR A  1 19  ? 1.135   33.922 6.448   1.00 19.43  ? 19  TYR A C   1 
ATOM   159  O  O   . TYR A  1 19  ? 1.133   33.194 7.385   1.00 20.01  ? 19  TYR A O   1 
ATOM   160  C  CB  . TYR A  1 19  ? -0.976  35.348 6.232   1.00 18.87  ? 19  TYR A CB  1 
ATOM   161  C  CG  . TYR A  1 19  ? -1.439  36.784 6.361   1.00 19.02  ? 19  TYR A CG  1 
ATOM   162  C  CD1 . TYR A  1 19  ? -1.769  37.309 7.591   1.00 20.80  ? 19  TYR A CD1 1 
ATOM   163  C  CD2 . TYR A  1 19  ? -1.459  37.626 5.228   1.00 19.71  ? 19  TYR A CD2 1 
ATOM   164  C  CE1 . TYR A  1 19  ? -2.117  38.647 7.728   1.00 21.31  ? 19  TYR A CE1 1 
ATOM   165  C  CE2 . TYR A  1 19  ? -1.768  38.987 5.369   1.00 20.13  ? 19  TYR A CE2 1 
ATOM   166  C  CZ  . TYR A  1 19  ? -2.129  39.465 6.616   1.00 21.09  ? 19  TYR A CZ  1 
ATOM   167  O  OH  . TYR A  1 19  ? -2.439  40.804 6.796   1.00 22.48  ? 19  TYR A OH  1 
ATOM   168  N  N   . SER A  1 20  ? 1.605   33.506 5.263   1.00 18.24  ? 20  SER A N   1 
ATOM   169  C  CA  . SER A  1 20  ? 2.086   32.125 5.121   1.00 18.53  ? 20  SER A CA  1 
ATOM   170  C  C   . SER A  1 20  ? 3.407   31.853 5.875   1.00 19.82  ? 20  SER A C   1 
ATOM   171  O  O   . SER A  1 20  ? 3.680   30.714 6.310   1.00 20.80  ? 20  SER A O   1 
ATOM   172  C  CB  . SER A  1 20  ? 2.191   31.729 3.650   1.00 18.61  ? 20  SER A CB  1 
ATOM   173  O  OG  . SER A  1 20  ? 3.301   32.333 3.010   1.00 18.53  ? 20  SER A OG  1 
ATOM   174  N  N   . LEU A  1 21  ? 4.203   32.920 5.995   1.00 20.54  ? 21  LEU A N   1 
ATOM   175  C  CA  . LEU A  1 21  ? 5.509   32.846 6.696   1.00 21.52  ? 21  LEU A CA  1 
ATOM   176  C  C   . LEU A  1 21  ? 5.388   33.003 8.190   1.00 22.84  ? 21  LEU A C   1 
ATOM   177  O  O   . LEU A  1 21  ? 6.403   32.977 8.898   1.00 23.37  ? 21  LEU A O   1 
ATOM   178  C  CB  . LEU A  1 21  ? 6.459   33.884 6.069   1.00 22.29  ? 21  LEU A CB  1 
ATOM   179  C  CG  . LEU A  1 21  ? 6.810   33.638 4.608   1.00 22.24  ? 21  LEU A CG  1 
ATOM   180  C  CD1 . LEU A  1 21  ? 7.751   34.700 4.054   1.00 23.05  ? 21  LEU A CD1 1 
ATOM   181  C  CD2 . LEU A  1 21  ? 7.393   32.242 4.382   1.00 23.65  ? 21  LEU A CD2 1 
ATOM   182  N  N   . ILE A  1 22  ? 4.166   33.094 8.723   1.00 22.46  ? 22  ILE A N   1 
ATOM   183  C  CA  . ILE A  1 22  ? 3.985   33.203 10.151  1.00 23.26  ? 22  ILE A CA  1 
ATOM   184  C  C   . ILE A  1 22  ? 4.514   31.971 10.897  1.00 24.23  ? 22  ILE A C   1 
ATOM   185  O  O   . ILE A  1 22  ? 5.319   32.083 11.859  1.00 25.34  ? 22  ILE A O   1 
ATOM   186  C  CB  . ILE A  1 22  ? 2.554   33.501 10.547  1.00 22.33  ? 22  ILE A CB  1 
ATOM   187  C  CG1 . ILE A  1 22  ? 2.194   34.896 10.079  1.00 21.95  ? 22  ILE A CG1 1 
ATOM   188  C  CG2 . ILE A  1 22  ? 2.424   33.453 12.083  1.00 23.01  ? 22  ILE A CG2 1 
ATOM   189  C  CD1 . ILE A  1 22  ? 0.731   35.221 10.226  1.00 22.07  ? 22  ILE A CD1 1 
ATOM   190  N  N   . LYS A  1 23  ? 4.090   30.796 10.417  1.00 24.05  ? 23  LYS A N   1 
ATOM   191  C  CA  . LYS A  1 23  ? 4.477   29.548 11.069  1.00 25.12  ? 23  LYS A CA  1 
ATOM   192  C  C   . LYS A  1 23  ? 4.360   28.378 10.133  1.00 24.22  ? 23  LYS A C   1 
ATOM   193  O  O   . LYS A  1 23  ? 3.767   28.486 9.053   1.00 21.34  ? 23  LYS A O   1 
ATOM   194  C  CB  . LYS A  1 23  ? 3.626   29.297 12.314  1.00 25.73  ? 23  LYS A CB  1 
ATOM   195  C  CG  . LYS A  1 23  ? 2.126   29.253 12.045  1.00 26.21  ? 23  LYS A CG  1 
ATOM   196  C  CD  . LYS A  1 23  ? 1.327   28.770 13.252  1.00 28.19  ? 23  LYS A CD  1 
ATOM   197  C  CE  . LYS A  1 23  ? -0.166  28.695 12.984  1.00 28.04  ? 23  LYS A CE  1 
ATOM   198  N  NZ  . LYS A  1 23  ? -0.707  30.070 12.808  1.00 28.66  ? 23  LYS A NZ  1 
ATOM   199  N  N   . GLY A  1 24  ? 4.927   27.248 10.577  1.00 25.75  ? 24  GLY A N   1 
ATOM   200  C  CA  . GLY A  1 24  ? 4.776   25.987 9.870   1.00 25.03  ? 24  GLY A CA  1 
ATOM   201  C  C   . GLY A  1 24  ? 5.329   26.071 8.468   1.00 24.64  ? 24  GLY A C   1 
ATOM   202  O  O   . GLY A  1 24  ? 6.350   26.702 8.212   1.00 25.15  ? 24  GLY A O   1 
ATOM   203  N  N   . ASN A  1 25  ? 4.578   25.508 7.521   1.00 22.74  ? 25  ASN A N   1 
ATOM   204  C  CA  . ASN A  1 25  ? 4.985   25.412 6.153   1.00 22.01  ? 25  ASN A CA  1 
ATOM   205  C  C   . ASN A  1 25  ? 4.903   26.804 5.519   1.00 21.57  ? 25  ASN A C   1 
ATOM   206  O  O   . ASN A  1 25  ? 3.945   27.530 5.750   1.00 21.45  ? 25  ASN A O   1 
ATOM   207  C  CB  . ASN A  1 25  ? 4.090   24.356 5.465   1.00 20.78  ? 25  ASN A CB  1 
ATOM   208  C  CG  . ASN A  1 25  ? 4.264   24.325 3.950   1.00 20.46  ? 25  ASN A CG  1 
ATOM   209  O  OD1 . ASN A  1 25  ? 3.833   25.241 3.272   1.00 20.37  ? 25  ASN A OD1 1 
ATOM   210  N  ND2 . ASN A  1 25  ? 4.818   23.229 3.423   1.00 21.01  ? 25  ASN A ND2 1 
ATOM   211  N  N   . PHE A  1 26  ? 5.936   27.187 4.783   1.00 21.52  ? 26  PHE A N   1 
ATOM   212  C  CA  . PHE A  1 26  ? 5.986   28.525 4.148   1.00 21.10  ? 26  PHE A CA  1 
ATOM   213  C  C   . PHE A  1 26  ? 4.949   28.895 3.072   1.00 19.53  ? 26  PHE A C   1 
ATOM   214  O  O   . PHE A  1 26  ? 4.808   30.074 2.761   1.00 19.25  ? 26  PHE A O   1 
ATOM   215  C  CB  . PHE A  1 26  ? 7.354   28.727 3.505   1.00 22.50  ? 26  PHE A CB  1 
ATOM   216  C  CG  . PHE A  1 26  ? 7.853   27.529 2.771   1.00 22.84  ? 26  PHE A CG  1 
ATOM   217  C  CD1 . PHE A  1 26  ? 7.363   27.208 1.484   1.00 22.37  ? 26  PHE A CD1 1 
ATOM   218  C  CD2 . PHE A  1 26  ? 8.846   26.728 3.326   1.00 24.23  ? 26  PHE A CD2 1 
ATOM   219  C  CE1 . PHE A  1 26  ? 7.834   26.105 0.803   1.00 22.86  ? 26  PHE A CE1 1 
ATOM   220  C  CE2 . PHE A  1 26  ? 9.328   25.623 2.622   1.00 25.06  ? 26  PHE A CE2 1 
ATOM   221  C  CZ  . PHE A  1 26  ? 8.828   25.335 1.343   1.00 24.30  ? 26  PHE A CZ  1 
ATOM   222  N  N   . HIS A  1 27  ? 4.253   27.917 2.518   1.00 18.71  ? 27  HIS A N   1 
ATOM   223  C  CA  . HIS A  1 27  ? 3.099   28.147 1.660   1.00 18.03  ? 27  HIS A CA  1 
ATOM   224  C  C   . HIS A  1 27  ? 1.873   27.488 2.205   1.00 17.85  ? 27  HIS A C   1 
ATOM   225  O  O   . HIS A  1 27  ? 1.150   26.761 1.479   1.00 17.92  ? 27  HIS A O   1 
ATOM   226  C  CB  . HIS A  1 27  ? 3.390   27.578 0.305   1.00 17.96  ? 27  HIS A CB  1 
ATOM   227  C  CG  . HIS A  1 27  ? 4.527   28.242 -0.418  1.00 19.38  ? 27  HIS A CG  1 
ATOM   228  N  ND1 . HIS A  1 27  ? 5.327   27.544 -1.295  1.00 19.79  ? 27  HIS A ND1 1 
ATOM   229  C  CD2 . HIS A  1 27  ? 4.969   29.568 -0.444  1.00 19.42  ? 27  HIS A CD2 1 
ATOM   230  C  CE1 . HIS A  1 27  ? 6.250   28.399 -1.789  1.00 20.94  ? 27  HIS A CE1 1 
ATOM   231  N  NE2 . HIS A  1 27  ? 6.064   29.605 -1.243  1.00 19.77  ? 27  HIS A NE2 1 
ATOM   232  N  N   . ALA A  1 28  ? 1.677   27.725 3.510   1.00 17.47  ? 28  ALA A N   1 
ATOM   233  C  CA  . ALA A  1 28  ? 0.516   27.291 4.253   1.00 17.60  ? 28  ALA A CA  1 
ATOM   234  C  C   . ALA A  1 28  ? 0.034   28.430 5.070   1.00 18.15  ? 28  ALA A C   1 
ATOM   235  O  O   . ALA A  1 28  ? 0.745   28.873 5.982   1.00 18.57  ? 28  ALA A O   1 
ATOM   236  C  CB  . ALA A  1 28  ? 0.827   26.089 5.146   1.00 18.35  ? 28  ALA A CB  1 
ATOM   237  N  N   . VAL A  1 29  ? -1.174  28.874 4.783   1.00 17.51  ? 29  VAL A N   1 
ATOM   238  C  CA  . VAL A  1 29  ? -1.901  29.767 5.661   1.00 17.59  ? 29  VAL A CA  1 
ATOM   239  C  C   . VAL A  1 29  ? -2.914  28.922 6.416   1.00 18.38  ? 29  VAL A C   1 
ATOM   240  O  O   . VAL A  1 29  ? -3.823  28.350 5.828   1.00 17.95  ? 29  VAL A O   1 
ATOM   241  C  CB  . VAL A  1 29  ? -2.601  30.903 4.835   1.00 17.12  ? 29  VAL A CB  1 
ATOM   242  C  CG1 . VAL A  1 29  ? -3.638  31.656 5.715   1.00 16.85  ? 29  VAL A CG1 1 
ATOM   243  C  CG2 . VAL A  1 29  ? -1.548  31.862 4.324   1.00 17.12  ? 29  VAL A CG2 1 
ATOM   244  N  N   . TYR A  1 30  ? -2.707  28.798 7.722   1.00 19.65  ? 30  TYR A N   1 
ATOM   245  C  CA  . TYR A  1 30  ? -3.562  27.993 8.590   1.00 20.46  ? 30  TYR A CA  1 
ATOM   246  C  C   . TYR A  1 30  ? -4.812  28.727 8.958   1.00 21.34  ? 30  TYR A C   1 
ATOM   247  O  O   . TYR A  1 30  ? -4.983  29.876 8.589   1.00 21.48  ? 30  TYR A O   1 
ATOM   248  C  CB  . TYR A  1 30  ? -2.785  27.508 9.799   1.00 21.37  ? 30  TYR A CB  1 
ATOM   249  C  CG  . TYR A  1 30  ? -1.554  26.723 9.393   1.00 20.78  ? 30  TYR A CG  1 
ATOM   250  C  CD1 . TYR A  1 30  ? -1.662  25.420 8.898   1.00 21.96  ? 30  TYR A CD1 1 
ATOM   251  C  CD2 . TYR A  1 30  ? -0.266  27.274 9.512   1.00 21.72  ? 30  TYR A CD2 1 
ATOM   252  C  CE1 . TYR A  1 30  ? -0.525  24.710 8.501   1.00 22.31  ? 30  TYR A CE1 1 
ATOM   253  C  CE2 . TYR A  1 30  ? 0.869   26.567 9.118   1.00 21.88  ? 30  TYR A CE2 1 
ATOM   254  C  CZ  . TYR A  1 30  ? 0.742   25.271 8.629   1.00 22.60  ? 30  TYR A CZ  1 
ATOM   255  O  OH  . TYR A  1 30  ? 1.892   24.583 8.218   1.00 22.50  ? 30  TYR A OH  1 
ATOM   256  N  N   . ARG A  1 31  ? -5.721  28.056 9.641   1.00 23.26  ? 31  ARG A N   1 
ATOM   257  C  CA  . ARG A  1 31  ? -7.071  28.607 9.842   1.00 24.43  ? 31  ARG A CA  1 
ATOM   258  C  C   . ARG A  1 31  ? -7.020  29.959 10.573  1.00 23.68  ? 31  ARG A C   1 
ATOM   259  O  O   . ARG A  1 31  ? -7.759  30.910 10.253  1.00 22.86  ? 31  ARG A O   1 
ATOM   260  C  CB  . ARG A  1 31  ? -7.894  27.568 10.565  1.00 28.16  ? 31  ARG A CB  1 
ATOM   261  C  CG  . ARG A  1 31  ? -9.204  28.041 11.117  1.00 33.27  ? 31  ARG A CG  1 
ATOM   262  C  CD  . ARG A  1 31  ? -9.757  26.971 12.057  1.00 35.26  ? 31  ARG A CD  1 
ATOM   263  N  NE  . ARG A  1 31  ? -9.927  25.698 11.363  1.00 38.01  ? 31  ARG A NE  1 
ATOM   264  C  CZ  . ARG A  1 31  ? -10.814 25.467 10.387  1.00 38.28  ? 31  ARG A CZ  1 
ATOM   265  N  NH1 . ARG A  1 31  ? -11.676 26.421 9.984   1.00 39.97  ? 31  ARG A NH1 1 
ATOM   266  N  NH2 . ARG A  1 31  ? -10.866 24.262 9.838   1.00 36.86  ? 31  ARG A NH2 1 
ATOM   267  N  N   . ASP A  1 32  ? -6.140  30.047 11.546  1.00 22.51  ? 32  ASP A N   1 
ATOM   268  C  CA  . ASP A  1 32  ? -6.021  31.291 12.318  1.00 22.87  ? 32  ASP A CA  1 
ATOM   269  C  C   . ASP A  1 32  ? -5.327  32.387 11.526  1.00 21.26  ? 32  ASP A C   1 
ATOM   270  O  O   . ASP A  1 32  ? -5.686  33.562 11.638  1.00 21.42  ? 32  ASP A O   1 
ATOM   271  C  CB  . ASP A  1 32  ? -5.306  31.078 13.663  1.00 24.40  ? 32  ASP A CB  1 
ATOM   272  C  CG  . ASP A  1 32  ? -3.966  30.427 13.541  1.00 25.87  ? 32  ASP A CG  1 
ATOM   273  O  OD1 . ASP A  1 32  ? -3.667  29.790 12.518  1.00 27.14  ? 32  ASP A OD1 1 
ATOM   274  O  OD2 . ASP A  1 32  ? -3.206  30.566 14.498  1.00 30.36  ? 32  ASP A OD2 1 
ATOM   275  N  N   . ASP A  1 33  ? -4.348  31.987 10.698  1.00 21.32  ? 33  ASP A N   1 
ATOM   276  C  CA  . ASP A  1 33  ? -3.673  32.902 9.816   1.00 20.69  ? 33  ASP A CA  1 
ATOM   277  C  C   . ASP A  1 33  ? -4.653  33.439 8.763   1.00 19.50  ? 33  ASP A C   1 
ATOM   278  O  O   . ASP A  1 33  ? -4.573  34.625 8.397   1.00 19.37  ? 33  ASP A O   1 
ATOM   279  C  CB  . ASP A  1 33  ? -2.531  32.224 9.060   1.00 20.65  ? 33  ASP A CB  1 
ATOM   280  C  CG  . ASP A  1 33  ? -1.489  31.615 9.972   1.00 22.90  ? 33  ASP A CG  1 
ATOM   281  O  OD1 . ASP A  1 33  ? -1.104  32.219 11.009  1.00 23.10  ? 33  ASP A OD1 1 
ATOM   282  O  OD2 . ASP A  1 33  ? -1.030  30.510 9.595   1.00 23.46  ? 33  ASP A OD2 1 
ATOM   283  N  N   . LEU A  1 34  ? -5.582  32.612 8.292   1.00 18.45  ? 34  LEU A N   1 
ATOM   284  C  CA  . LEU A  1 34  ? -6.557  33.155 7.304   1.00 18.03  ? 34  LEU A CA  1 
ATOM   285  C  C   . LEU A  1 34  ? -7.516  34.143 7.978   1.00 18.50  ? 34  LEU A C   1 
ATOM   286  O  O   . LEU A  1 34  ? -7.952  35.123 7.393   1.00 18.15  ? 34  LEU A O   1 
ATOM   287  C  CB  . LEU A  1 34  ? -7.357  32.034 6.628   1.00 18.00  ? 34  LEU A CB  1 
ATOM   288  C  CG  . LEU A  1 34  ? -8.373  32.480 5.596   1.00 17.37  ? 34  LEU A CG  1 
ATOM   289  C  CD1 . LEU A  1 34  ? -7.608  32.899 4.339   1.00 17.45  ? 34  LEU A CD1 1 
ATOM   290  C  CD2 . LEU A  1 34  ? -9.378  31.397 5.144   1.00 18.28  ? 34  LEU A CD2 1 
ATOM   291  N  N   . LYS A  1 35  ? -7.874  33.881 9.221   1.00 19.56  ? 35  LYS A N   1 
ATOM   292  C  CA  . LYS A  1 35  ? -8.749  34.806 9.911   1.00 20.98  ? 35  LYS A CA  1 
ATOM   293  C  C   . LYS A  1 35  ? -8.067  36.161 10.026  1.00 21.12  ? 35  LYS A C   1 
ATOM   294  O  O   . LYS A  1 35  ? -8.666  37.187 9.806   1.00 21.71  ? 35  LYS A O   1 
ATOM   295  C  CB  . LYS A  1 35  ? -9.105  34.243 11.264  1.00 22.11  ? 35  LYS A CB  1 
ATOM   296  C  CG  . LYS A  1 35  ? -10.027 35.137 12.101  1.00 23.98  ? 35  LYS A CG  1 
ATOM   297  C  CD  . LYS A  1 35  ? -10.140 34.633 13.502  1.00 27.35  ? 35  LYS A CD  1 
ATOM   298  C  CE  . LYS A  1 35  ? -11.038 35.524 14.308  1.00 30.58  ? 35  LYS A CE  1 
ATOM   299  N  NZ  . LYS A  1 35  ? -12.412 35.044 14.033  1.00 33.97  ? 35  LYS A NZ  1 
ATOM   300  N  N   . LYS A  1 36  ? -6.801  36.155 10.375  1.00 21.74  ? 36  LYS A N   1 
ATOM   301  C  CA  A LYS A  1 36  ? -6.035  37.393 10.482  0.50 22.01  ? 36  LYS A CA  1 
ATOM   302  C  CA  B LYS A  1 36  ? -6.027  37.386 10.462  0.50 22.02  ? 36  LYS A CA  1 
ATOM   303  C  C   . LYS A  1 36  ? -5.910  38.048 9.083   1.00 20.56  ? 36  LYS A C   1 
ATOM   304  O  O   . LYS A  1 36  ? -5.980  39.281 8.960   1.00 20.81  ? 36  LYS A O   1 
ATOM   305  C  CB  A LYS A  1 36  ? -4.665  37.062 11.054  0.50 22.62  ? 36  LYS A CB  1 
ATOM   306  C  CB  B LYS A  1 36  ? -4.629  37.091 10.959  0.50 22.56  ? 36  LYS A CB  1 
ATOM   307  C  CG  A LYS A  1 36  ? -3.784  38.229 11.452  0.50 23.71  ? 36  LYS A CG  1 
ATOM   308  C  CG  B LYS A  1 36  ? -3.789  38.341 11.016  0.50 23.43  ? 36  LYS A CG  1 
ATOM   309  C  CD  A LYS A  1 36  ? -2.339  37.783 11.216  0.50 23.55  ? 36  LYS A CD  1 
ATOM   310  C  CD  B LYS A  1 36  ? -4.469  39.372 11.889  0.50 24.29  ? 36  LYS A CD  1 
ATOM   311  C  CE  A LYS A  1 36  ? -1.321  38.616 11.939  0.50 24.79  ? 36  LYS A CE  1 
ATOM   312  C  CE  B LYS A  1 36  ? -4.334  39.140 13.377  0.50 25.29  ? 36  LYS A CE  1 
ATOM   313  N  NZ  A LYS A  1 36  ? -0.193  39.135 11.125  0.50 24.11  ? 36  LYS A NZ  1 
ATOM   314  N  NZ  B LYS A  1 36  ? -4.335  40.474 14.050  0.50 25.71  ? 36  LYS A NZ  1 
ATOM   315  N  N   . LEU A  1 37  ? -5.726  37.240 8.043   1.00 19.83  ? 37  LEU A N   1 
ATOM   316  C  CA  . LEU A  1 37  ? -5.621  37.791 6.743   1.00 18.39  ? 37  LEU A CA  1 
ATOM   317  C  C   . LEU A  1 37  ? -6.890  38.516 6.341   1.00 18.04  ? 37  LEU A C   1 
ATOM   318  O  O   . LEU A  1 37  ? -6.848  39.673 5.829   1.00 17.88  ? 37  LEU A O   1 
ATOM   319  C  CB  . LEU A  1 37  ? -5.244  36.697 5.694   1.00 18.21  ? 37  LEU A CB  1 
ATOM   320  C  CG  . LEU A  1 37  ? -4.978  37.036 4.227   1.00 17.90  ? 37  LEU A CG  1 
ATOM   321  C  CD1 . LEU A  1 37  ? -4.189  35.887 3.547   1.00 17.59  ? 37  LEU A CD1 1 
ATOM   322  C  CD2 . LEU A  1 37  ? -6.280  37.292 3.466   1.00 17.57  ? 37  LEU A CD2 1 
ATOM   323  N  N   . LEU A  1 38  ? -8.021  37.855 6.537   1.00 17.30  ? 38  LEU A N   1 
ATOM   324  C  CA  . LEU A  1 38  ? -9.279  38.447 6.172   1.00 17.97  ? 38  LEU A CA  1 
ATOM   325  C  C   . LEU A  1 38  ? -9.570  39.711 6.974   1.00 19.23  ? 38  LEU A C   1 
ATOM   326  O  O   . LEU A  1 38  ? -10.050 40.687 6.447   1.00 20.44  ? 38  LEU A O   1 
ATOM   327  C  CB  . LEU A  1 38  ? -10.401 37.456 6.376   1.00 18.14  ? 38  LEU A CB  1 
ATOM   328  C  CG  . LEU A  1 38  ? -10.390 36.290 5.395   1.00 17.53  ? 38  LEU A CG  1 
ATOM   329  C  CD1 . LEU A  1 38  ? -11.223 35.138 5.925   1.00 18.50  ? 38  LEU A CD1 1 
ATOM   330  C  CD2 . LEU A  1 38  ? -10.892 36.686 3.984   1.00 17.36  ? 38  LEU A CD2 1 
ATOM   331  N  N   . GLU A  1 39  ? -9.289  39.672 8.266   1.00 19.88  ? 39  GLU A N   1 
ATOM   332  C  CA  . GLU A  1 39  ? -9.556  40.815 9.121   1.00 22.11  ? 39  GLU A CA  1 
ATOM   333  C  C   . GLU A  1 39  ? -8.716  42.022 8.722   1.00 21.64  ? 39  GLU A C   1 
ATOM   334  O  O   . GLU A  1 39  ? -9.175  43.134 8.823   1.00 22.03  ? 39  GLU A O   1 
ATOM   335  C  CB  . GLU A  1 39  ? -9.213  40.480 10.557  1.00 24.81  ? 39  GLU A CB  1 
ATOM   336  C  CG  . GLU A  1 39  ? -10.256 39.596 11.211  1.00 27.14  ? 39  GLU A CG  1 
ATOM   337  C  CD  . GLU A  1 39  ? -9.819  39.090 12.579  1.00 31.18  ? 39  GLU A CD  1 
ATOM   338  O  OE1 . GLU A  1 39  ? -8.615  39.155 12.947  1.00 32.93  ? 39  GLU A OE1 1 
ATOM   339  O  OE2 . GLU A  1 39  ? -10.718 38.586 13.272  1.00 34.91  ? 39  GLU A OE2 1 
ATOM   340  N  N   . THR A  1 40  ? -7.481  41.774 8.304   1.00 22.04  ? 40  THR A N   1 
ATOM   341  C  CA  . THR A  1 40  ? -6.519  42.805 7.913   1.00 22.39  ? 40  THR A CA  1 
ATOM   342  C  C   . THR A  1 40  ? -6.609  43.292 6.439   1.00 21.79  ? 40  THR A C   1 
ATOM   343  O  O   . THR A  1 40  ? -6.470  44.506 6.195   1.00 21.67  ? 40  THR A O   1 
ATOM   344  C  CB  . THR A  1 40  ? -5.094  42.276 8.159   1.00 23.50  ? 40  THR A CB  1 
ATOM   345  O  OG1 . THR A  1 40  ? -5.010  41.858 9.534   1.00 25.57  ? 40  THR A OG1 1 
ATOM   346  C  CG2 . THR A  1 40  ? -4.052  43.348 7.862   1.00 24.96  ? 40  THR A CG2 1 
ATOM   347  N  N   . GLU A  1 41  ? -6.853  42.383 5.482   1.00 21.06  ? 41  GLU A N   1 
ATOM   348  C  CA  . GLU A  1 41  ? -6.691  42.668 4.066   1.00 20.21  ? 41  GLU A CA  1 
ATOM   349  C  C   . GLU A  1 41  ? -7.991  42.812 3.302   1.00 20.41  ? 41  GLU A C   1 
ATOM   350  O  O   . GLU A  1 41  ? -7.984  43.311 2.188   1.00 19.42  ? 41  GLU A O   1 
ATOM   351  C  CB  . GLU A  1 41  ? -5.913  41.573 3.350   1.00 21.21  ? 41  GLU A CB  1 
ATOM   352  C  CG  . GLU A  1 41  ? -4.581  41.251 3.990   1.00 20.97  ? 41  GLU A CG  1 
ATOM   353  C  CD  . GLU A  1 41  ? -3.562  42.375 3.857   1.00 23.64  ? 41  GLU A CD  1 
ATOM   354  O  OE1 . GLU A  1 41  ? -3.723  43.241 2.988   1.00 23.52  ? 41  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A  1 41  ? -2.609  42.348 4.639   1.00 25.17  ? 41  GLU A OE2 1 
ATOM   356  N  N   . SER A  1 42  ? -9.096  42.351 3.860   1.00 19.88  ? 42  SER A N   1 
ATOM   357  C  CA  . SER A  1 42  ? -10.332 42.305 3.067   1.00 20.36  ? 42  SER A CA  1 
ATOM   358  C  C   . SER A  1 42  ? -11.428 43.218 3.648   1.00 20.11  ? 42  SER A C   1 
ATOM   359  O  O   . SER A  1 42  ? -11.493 43.466 4.876   1.00 20.35  ? 42  SER A O   1 
ATOM   360  C  CB  . SER A  1 42  ? -10.786 40.849 2.900   1.00 20.61  ? 42  SER A CB  1 
ATOM   361  O  OG  . SER A  1 42  ? -11.516 40.430 4.024   1.00 22.15  ? 42  SER A OG  1 
ATOM   362  N  N   . PRO A  1 43  ? -12.317 43.702 2.768   1.00 20.63  ? 43  PRO A N   1 
ATOM   363  C  CA  . PRO A  1 43  ? -13.378 44.595 3.239   1.00 21.93  ? 43  PRO A CA  1 
ATOM   364  C  C   . PRO A  1 43  ? -14.515 43.868 3.954   1.00 22.28  ? 43  PRO A C   1 
ATOM   365  O  O   . PRO A  1 43  ? -14.604 42.627 3.892   1.00 20.70  ? 43  PRO A O   1 
ATOM   366  C  CB  . PRO A  1 43  ? -13.833 45.280 1.950   1.00 22.35  ? 43  PRO A CB  1 
ATOM   367  C  CG  . PRO A  1 43  ? -13.594 44.264 0.891   1.00 21.17  ? 43  PRO A CG  1 
ATOM   368  C  CD  . PRO A  1 43  ? -12.295 43.610 1.295   1.00 20.16  ? 43  PRO A CD  1 
ATOM   369  N  N   . GLN A  1 44  ? -15.367 44.613 4.672   1.00 23.72  ? 44  GLN A N   1 
ATOM   370  C  CA  . GLN A  1 44  ? -16.395 43.971 5.469   1.00 25.83  ? 44  GLN A CA  1 
ATOM   371  C  C   . GLN A  1 44  ? -17.263 43.045 4.644   1.00 24.14  ? 44  GLN A C   1 
ATOM   372  O  O   . GLN A  1 44  ? -17.646 41.983 5.146   1.00 24.59  ? 44  GLN A O   1 
ATOM   373  C  CB  . GLN A  1 44  ? -17.300 44.957 6.223   1.00 30.19  ? 44  GLN A CB  1 
ATOM   374  C  CG  . GLN A  1 44  ? -18.248 44.304 7.275   1.00 34.19  ? 44  GLN A CG  1 
ATOM   375  C  CD  . GLN A  1 44  ? -17.621 43.186 8.160   1.00 38.37  ? 44  GLN A CD  1 
ATOM   376  O  OE1 . GLN A  1 44  ? -16.493 43.320 8.689   1.00 43.86  ? 44  GLN A OE1 1 
ATOM   377  N  NE2 . GLN A  1 44  ? -18.359 42.059 8.317   1.00 40.27  ? 44  GLN A NE2 1 
ATOM   378  N  N   . TYR A  1 45  ? -17.521 43.386 3.381   1.00 23.32  ? 45  TYR A N   1 
ATOM   379  C  CA  . TYR A  1 45  ? -18.435 42.558 2.622   1.00 22.94  ? 45  TYR A CA  1 
ATOM   380  C  C   . TYR A  1 45  ? -17.830 41.215 2.257   1.00 22.20  ? 45  TYR A C   1 
ATOM   381  O  O   . TYR A  1 45  ? -18.583 40.274 1.944   1.00 24.24  ? 45  TYR A O   1 
ATOM   382  C  CB  . TYR A  1 45  ? -19.003 43.248 1.390   1.00 23.96  ? 45  TYR A CB  1 
ATOM   383  C  CG  . TYR A  1 45  ? -17.993 43.630 0.359   1.00 22.30  ? 45  TYR A CG  1 
ATOM   384  C  CD1 . TYR A  1 45  ? -17.549 42.712 -0.592  1.00 21.98  ? 45  TYR A CD1 1 
ATOM   385  C  CD2 . TYR A  1 45  ? -17.485 44.916 0.309   1.00 22.77  ? 45  TYR A CD2 1 
ATOM   386  C  CE1 . TYR A  1 45  ? -16.599 43.071 -1.545  1.00 21.19  ? 45  TYR A CE1 1 
ATOM   387  C  CE2 . TYR A  1 45  ? -16.543 45.280 -0.626  1.00 21.82  ? 45  TYR A CE2 1 
ATOM   388  C  CZ  . TYR A  1 45  ? -16.086 44.338 -1.553  1.00 21.73  ? 45  TYR A CZ  1 
ATOM   389  O  OH  . TYR A  1 45  ? -15.173 44.691 -2.536  1.00 21.59  ? 45  TYR A OH  1 
ATOM   390  N  N   . ILE A  1 46  ? -16.491 41.120 2.302   1.00 19.92  ? 46  ILE A N   1 
ATOM   391  C  CA  . ILE A  1 46  ? -15.774 39.824 2.158   1.00 19.76  ? 46  ILE A CA  1 
ATOM   392  C  C   . ILE A  1 46  ? -15.684 39.145 3.511   1.00 19.83  ? 46  ILE A C   1 
ATOM   393  O  O   . ILE A  1 46  ? -15.977 37.955 3.611   1.00 20.57  ? 46  ILE A O   1 
ATOM   394  C  CB  . ILE A  1 46  ? -14.382 40.041 1.583   1.00 18.63  ? 46  ILE A CB  1 
ATOM   395  C  CG1 . ILE A  1 46  ? -14.541 40.584 0.168   1.00 19.24  ? 46  ILE A CG1 1 
ATOM   396  C  CG2 . ILE A  1 46  ? -13.540 38.765 1.614   1.00 17.99  ? 46  ILE A CG2 1 
ATOM   397  C  CD1 . ILE A  1 46  ? -15.077 39.592 -0.852  1.00 20.09  ? 46  ILE A CD1 1 
ATOM   398  N  N   . ARG A  1 47  ? -15.329 39.881 4.559   1.00 21.20  ? 47  ARG A N   1 
ATOM   399  C  CA  . ARG A  1 47  ? -15.219 39.321 5.907   1.00 22.88  ? 47  ARG A CA  1 
ATOM   400  C  C   . ARG A  1 47  ? -16.523 38.709 6.419   1.00 23.06  ? 47  ARG A C   1 
ATOM   401  O  O   . ARG A  1 47  ? -16.488 37.663 7.063   1.00 23.00  ? 47  ARG A O   1 
ATOM   402  C  CB  . ARG A  1 47  ? -14.769 40.364 6.929   1.00 25.20  ? 47  ARG A CB  1 
ATOM   403  C  CG  . ARG A  1 47  ? -13.378 40.899 6.702   1.00 26.98  ? 47  ARG A CG  1 
ATOM   404  C  CD  . ARG A  1 47  ? -12.932 41.927 7.710   1.00 30.15  ? 47  ARG A CD  1 
ATOM   405  N  NE  . ARG A  1 47  ? -13.766 43.125 7.757   1.00 35.83  ? 47  ARG A NE  1 
ATOM   406  C  CZ  . ARG A  1 47  ? -13.529 44.169 8.539   1.00 39.63  ? 47  ARG A CZ  1 
ATOM   407  N  NH1 . ARG A  1 47  ? -12.476 44.160 9.366   1.00 42.81  ? 47  ARG A NH1 1 
ATOM   408  N  NH2 . ARG A  1 47  ? -14.352 45.216 8.528   1.00 42.92  ? 47  ARG A NH2 1 
ATOM   409  N  N   . LYS A  1 48  ? -17.663 39.316 6.075   1.00 23.39  ? 48  LYS A N   1 
ATOM   410  C  CA  . LYS A  1 48  ? -18.964 38.880 6.600   1.00 25.32  ? 48  LYS A CA  1 
ATOM   411  C  C   . LYS A  1 48  ? -19.370 37.451 6.230   1.00 24.11  ? 48  LYS A C   1 
ATOM   412  O  O   . LYS A  1 48  ? -20.188 36.859 6.909   1.00 23.69  ? 48  LYS A O   1 
ATOM   413  C  CB  . LYS A  1 48  ? -20.069 39.849 6.175   1.00 28.61  ? 48  LYS A CB  1 
ATOM   414  C  CG  . LYS A  1 48  ? -20.396 39.722 4.707   1.00 28.86  ? 48  LYS A CG  1 
ATOM   415  C  CD  . LYS A  1 48  ? -21.445 40.707 4.235   1.00 32.62  ? 48  LYS A CD  1 
ATOM   416  C  CE  . LYS A  1 48  ? -21.654 40.614 2.723   1.00 32.76  ? 48  LYS A CE  1 
ATOM   417  N  NZ  . LYS A  1 48  ? -22.667 41.660 2.363   1.00 37.56  ? 48  LYS A NZ  1 
ATOM   418  N  N   . LYS A  1 49  ? -18.752 36.871 5.207   1.00 22.76  ? 49  LYS A N   1 
ATOM   419  C  CA  . LYS A  1 49  ? -18.979 35.468 4.887   1.00 23.14  ? 49  LYS A CA  1 
ATOM   420  C  C   . LYS A  1 49  ? -18.512 34.553 6.028   1.00 21.30  ? 49  LYS A C   1 
ATOM   421  O  O   . LYS A  1 49  ? -19.060 33.448 6.204   1.00 22.48  ? 49  LYS A O   1 
ATOM   422  C  CB  . LYS A  1 49  ? -18.249 35.064 3.603   1.00 24.05  ? 49  LYS A CB  1 
ATOM   423  C  CG  . LYS A  1 49  ? -18.499 33.618 3.235   1.00 26.17  ? 49  LYS A CG  1 
ATOM   424  C  CD  . LYS A  1 49  ? -17.577 33.058 2.169   1.00 26.66  ? 49  LYS A CD  1 
ATOM   425  C  CE  . LYS A  1 49  ? -18.175 33.282 0.815   1.00 28.35  ? 49  LYS A CE  1 
ATOM   426  N  NZ  . LYS A  1 49  ? -17.339 32.886 -0.345  1.00 29.78  ? 49  LYS A NZ  1 
ATOM   427  N  N   . GLY A  1 50  ? -17.509 34.975 6.790   1.00 20.67  ? 50  GLY A N   1 
ATOM   428  C  CA  . GLY A  1 50  ? -17.023 34.198 7.918   1.00 20.39  ? 50  GLY A CA  1 
ATOM   429  C  C   . GLY A  1 50  ? -15.705 33.555 7.560   1.00 18.93  ? 50  GLY A C   1 
ATOM   430  O  O   . GLY A  1 50  ? -15.558 33.003 6.473   1.00 17.79  ? 50  GLY A O   1 
ATOM   431  N  N   . ALA A  1 51  ? -14.698 33.684 8.423   1.00 17.90  ? 51  ALA A N   1 
ATOM   432  C  CA  . ALA A  1 51  ? -13.415 33.076 8.161   1.00 17.53  ? 51  ALA A CA  1 
ATOM   433  C  C   . ALA A  1 51  ? -13.524 31.567 8.094   1.00 17.00  ? 51  ALA A C   1 
ATOM   434  O  O   . ALA A  1 51  ? -12.764 30.925 7.347   1.00 17.43  ? 51  ALA A O   1 
ATOM   435  C  CB  . ALA A  1 51  ? -12.375 33.461 9.211   1.00 19.31  ? 51  ALA A CB  1 
ATOM   436  N  N   . ASP A  1 52  ? -14.401 30.989 8.917   1.00 18.21  ? 52  ASP A N   1 
ATOM   437  C  CA  . ASP A  1 52  ? -14.656 29.547 8.870   1.00 18.30  ? 52  ASP A CA  1 
ATOM   438  C  C   . ASP A  1 52  ? -15.169 29.079 7.518   1.00 17.40  ? 52  ASP A C   1 
ATOM   439  O  O   . ASP A  1 52  ? -14.754 28.012 7.066   1.00 17.57  ? 52  ASP A O   1 
ATOM   440  C  CB  . ASP A  1 52  ? -15.576 29.065 10.023  1.00 20.73  ? 52  ASP A CB  1 
ATOM   441  C  CG  . ASP A  1 52  ? -16.938 29.801 10.099  1.00 22.57  ? 52  ASP A CG  1 
ATOM   442  O  OD1 . ASP A  1 52  ? -17.177 30.824 9.383   1.00 24.07  ? 52  ASP A OD1 1 
ATOM   443  O  OD2 . ASP A  1 52  ? -17.738 29.370 10.983  1.00 25.83  ? 52  ASP A OD2 1 
ATOM   444  N  N   . VAL A  1 53  ? -16.077 29.857 6.912   1.00 17.41  ? 53  VAL A N   1 
ATOM   445  C  CA  . VAL A  1 53  ? -16.663 29.500 5.621   1.00 17.43  ? 53  VAL A CA  1 
ATOM   446  C  C   . VAL A  1 53  ? -15.595 29.685 4.570   1.00 16.47  ? 53  VAL A C   1 
ATOM   447  O  O   . VAL A  1 53  ? -15.425 28.842 3.689   1.00 17.78  ? 53  VAL A O   1 
ATOM   448  C  CB  . VAL A  1 53  ? -17.926 30.320 5.313   1.00 18.38  ? 53  VAL A CB  1 
ATOM   449  C  CG1 . VAL A  1 53  ? -18.476 30.001 3.927   1.00 19.92  ? 53  VAL A CG1 1 
ATOM   450  C  CG2 . VAL A  1 53  ? -18.988 30.069 6.424   1.00 20.25  ? 53  VAL A CG2 1 
ATOM   451  N  N   . TRP A  1 54  ? -14.909 30.828 4.619   1.00 15.92  ? 54  TRP A N   1 
ATOM   452  C  CA  . TRP A  1 54  ? -13.821 31.033 3.661   1.00 16.06  ? 54  TRP A CA  1 
ATOM   453  C  C   . TRP A  1 54  ? -12.823 29.897 3.722   1.00 16.03  ? 54  TRP A C   1 
ATOM   454  O  O   . TRP A  1 54  ? -12.354 29.375 2.691   1.00 16.89  ? 54  TRP A O   1 
ATOM   455  C  CB  . TRP A  1 54  ? -13.132 32.368 3.907   1.00 15.87  ? 54  TRP A CB  1 
ATOM   456  C  CG  . TRP A  1 54  ? -13.764 33.527 3.143   1.00 16.96  ? 54  TRP A CG  1 
ATOM   457  C  CD1 . TRP A  1 54  ? -14.341 34.665 3.685   1.00 17.21  ? 54  TRP A CD1 1 
ATOM   458  C  CD2 . TRP A  1 54  ? -13.872 33.684 1.690   1.00 16.11  ? 54  TRP A CD2 1 
ATOM   459  N  NE1 . TRP A  1 54  ? -14.791 35.486 2.730   1.00 16.25  ? 54  TRP A NE1 1 
ATOM   460  C  CE2 . TRP A  1 54  ? -14.532 34.962 1.480   1.00 16.44  ? 54  TRP A CE2 1 
ATOM   461  C  CE3 . TRP A  1 54  ? -13.516 32.916 0.581   1.00 16.49  ? 54  TRP A CE3 1 
ATOM   462  C  CZ2 . TRP A  1 54  ? -14.834 35.433 0.214   1.00 17.59  ? 54  TRP A CZ2 1 
ATOM   463  C  CZ3 . TRP A  1 54  ? -13.787 33.412 -0.686  1.00 17.16  ? 54  TRP A CZ3 1 
ATOM   464  C  CH2 . TRP A  1 54  ? -14.435 34.650 -0.863  1.00 17.36  ? 54  TRP A CH2 1 
ATOM   465  N  N   . PHE A  1 55  ? -12.420 29.531 4.931   1.00 16.08  ? 55  PHE A N   1 
ATOM   466  C  CA  . PHE A  1 55  ? -11.381 28.478 5.070   1.00 17.19  ? 55  PHE A CA  1 
ATOM   467  C  C   . PHE A  1 55  ? -11.845 27.176 4.420   1.00 17.48  ? 55  PHE A C   1 
ATOM   468  O  O   . PHE A  1 55  ? -11.142 26.543 3.659   1.00 18.06  ? 55  PHE A O   1 
ATOM   469  C  CB  . PHE A  1 55  ? -10.993 28.255 6.530   1.00 17.70  ? 55  PHE A CB  1 
ATOM   470  C  CG  . PHE A  1 55  ? -9.789  27.361 6.676   1.00 18.52  ? 55  PHE A CG  1 
ATOM   471  C  CD1 . PHE A  1 55  ? -8.507  27.884 6.545   1.00 19.62  ? 55  PHE A CD1 1 
ATOM   472  C  CD2 . PHE A  1 55  ? -9.948  26.022 6.831   1.00 19.31  ? 55  PHE A CD2 1 
ATOM   473  C  CE1 . PHE A  1 55  ? -7.379  27.072 6.601   1.00 20.30  ? 55  PHE A CE1 1 
ATOM   474  C  CE2 . PHE A  1 55  ? -8.825  25.189 6.886   1.00 20.75  ? 55  PHE A CE2 1 
ATOM   475  C  CZ  . PHE A  1 55  ? -7.550  25.729 6.764   1.00 20.91  ? 55  PHE A CZ  1 
ATOM   476  N  N   . LYS A  1 56  ? -13.088 26.804 4.680   1.00 17.63  ? 56  LYS A N   1 
ATOM   477  C  CA  . LYS A  1 56  ? -13.589 25.544 4.201   1.00 19.44  ? 56  LYS A CA  1 
ATOM   478  C  C   . LYS A  1 56  ? -13.645 25.606 2.668   1.00 18.68  ? 56  LYS A C   1 
ATOM   479  O  O   . LYS A  1 56  ? -13.348 24.632 1.966   1.00 20.09  ? 56  LYS A O   1 
ATOM   480  C  CB  . LYS A  1 56  ? -14.974 25.239 4.766   1.00 22.38  ? 56  LYS A CB  1 
ATOM   481  C  CG  . LYS A  1 56  ? -15.524 23.939 4.197   1.00 26.46  ? 56  LYS A CG  1 
ATOM   482  C  CD  . LYS A  1 56  ? -16.297 23.132 5.192   1.00 30.00  ? 56  LYS A CD  1 
ATOM   483  C  CE  . LYS A  1 56  ? -16.722 21.776 4.598   1.00 34.30  ? 56  LYS A CE  1 
ATOM   484  N  NZ  . LYS A  1 56  ? -17.461 21.925 3.295   1.00 39.22  ? 56  LYS A NZ  1 
ATOM   485  N  N   . GLU A  1 57  ? -14.047 26.761 2.160   1.00 18.47  ? 57  GLU A N   1 
ATOM   486  C  CA  . GLU A  1 57  ? -14.139 26.928 0.726   1.00 18.22  ? 57  GLU A CA  1 
ATOM   487  C  C   . GLU A  1 57  ? -12.772 26.902 0.040   1.00 17.12  ? 57  GLU A C   1 
ATOM   488  O  O   . GLU A  1 57  ? -12.641 26.399 -1.120  1.00 18.28  ? 57  GLU A O   1 
ATOM   489  C  CB  . GLU A  1 57  ? -14.872 28.206 0.363   1.00 19.18  ? 57  GLU A CB  1 
ATOM   490  C  CG  . GLU A  1 57  ? -16.362 28.161 0.668   1.00 21.03  ? 57  GLU A CG  1 
ATOM   491  C  CD  . GLU A  1 57  ? -17.086 29.410 0.176   1.00 23.21  ? 57  GLU A CD  1 
ATOM   492  O  OE1 . GLU A  1 57  ? -18.313 29.469 0.439   1.00 26.62  ? 57  GLU A OE1 1 
ATOM   493  O  OE2 . GLU A  1 57  ? -16.455 30.314 -0.456  1.00 25.02  ? 57  GLU A OE2 1 
ATOM   494  N  N   . LEU A  1 58  ? -11.778 27.513 0.661   1.00 16.31  ? 58  LEU A N   1 
ATOM   495  C  CA  . LEU A  1 58  ? -10.481 27.677 -0.004  1.00 15.49  ? 58  LEU A CA  1 
ATOM   496  C  C   . LEU A  1 58  ? -9.607  26.437 0.131   1.00 15.52  ? 58  LEU A C   1 
ATOM   497  O  O   . LEU A  1 58  ? -8.748  26.223 -0.677  1.00 15.00  ? 58  LEU A O   1 
ATOM   498  C  CB  . LEU A  1 58  ? -9.747  28.874 0.541   1.00 15.63  ? 58  LEU A CB  1 
ATOM   499  C  CG  . LEU A  1 58  ? -10.437 30.234 0.403   1.00 15.56  ? 58  LEU A CG  1 
ATOM   500  C  CD1 . LEU A  1 58  ? -9.677  31.357 1.098   1.00 15.68  ? 58  LEU A CD1 1 
ATOM   501  C  CD2 . LEU A  1 58  ? -10.522 30.569 -1.094  1.00 14.65  ? 58  LEU A CD2 1 
ATOM   502  N  N   . ASP A  1 59  ? -9.772  25.668 1.198   1.00 15.53  ? 59  ASP A N   1 
ATOM   503  C  CA  . ASP A  1 59  ? -8.939  24.475 1.453   1.00 15.62  ? 59  ASP A CA  1 
ATOM   504  C  C   . ASP A  1 59  ? -9.492  23.290 0.652   1.00 15.56  ? 59  ASP A C   1 
ATOM   505  O  O   . ASP A  1 59  ? -10.126 22.378 1.155   1.00 16.19  ? 59  ASP A O   1 
ATOM   506  C  CB  . ASP A  1 59  ? -8.800  24.204 2.935   1.00 16.30  ? 59  ASP A CB  1 
ATOM   507  C  CG  . ASP A  1 59  ? -7.905  23.038 3.216   1.00 17.16  ? 59  ASP A CG  1 
ATOM   508  O  OD1 . ASP A  1 59  ? -7.107  22.658 2.329   1.00 16.18  ? 59  ASP A OD1 1 
ATOM   509  O  OD2 . ASP A  1 59  ? -8.003  22.459 4.323   1.00 17.75  ? 59  ASP A OD2 1 
ATOM   510  N  N   A ILE A  1 60  ? -9.200  23.356 -0.658  0.39 15.20  ? 60  ILE A N   1 
ATOM   511  N  N   B ILE A  1 60  ? -9.205  23.274 -0.625  0.61 15.02  ? 60  ILE A N   1 
ATOM   512  C  CA  A ILE A  1 60  ? -9.723  22.473 -1.726  0.39 15.51  ? 60  ILE A CA  1 
ATOM   513  C  CA  B ILE A  1 60  ? -9.921  22.372 -1.481  0.61 15.39  ? 60  ILE A CA  1 
ATOM   514  C  C   A ILE A  1 60  ? -9.366  21.006 -1.474  0.39 16.03  ? 60  ILE A C   1 
ATOM   515  C  C   B ILE A  1 60  ? -9.428  20.941 -1.343  0.61 15.99  ? 60  ILE A C   1 
ATOM   516  O  O   A ILE A  1 60  ? -10.144 20.093 -1.802  0.39 17.01  ? 60  ILE A O   1 
ATOM   517  O  O   B ILE A  1 60  ? -10.168 19.980 -1.633  0.61 17.05  ? 60  ILE A O   1 
ATOM   518  C  CB  A ILE A  1 60  ? -9.148  22.928 -3.107  0.39 15.04  ? 60  ILE A CB  1 
ATOM   519  C  CB  B ILE A  1 60  ? -9.831  22.859 -2.918  0.61 14.72  ? 60  ILE A CB  1 
ATOM   520  C  CG1 A ILE A  1 60  ? -9.601  24.355 -3.470  0.39 14.72  ? 60  ILE A CG1 1 
ATOM   521  C  CG1 B ILE A  1 60  ? -8.384  22.877 -3.405  0.61 14.51  ? 60  ILE A CG1 1 
ATOM   522  C  CG2 A ILE A  1 60  ? -9.529  21.999 -4.267  0.39 15.32  ? 60  ILE A CG2 1 
ATOM   523  C  CG2 B ILE A  1 60  ? -10.425 24.280 -3.071  0.61 14.95  ? 60  ILE A CG2 1 
ATOM   524  C  CD1 A ILE A  1 60  ? -11.101 24.578 -3.337  0.39 14.63  ? 60  ILE A CD1 1 
ATOM   525  C  CD1 B ILE A  1 60  ? -8.286  23.156 -4.888  0.61 13.89  ? 60  ILE A CD1 1 
ATOM   526  N  N   . ASN A  1 61  ? -8.175  20.793 -0.909  1.00 15.98  ? 61  ASN A N   1 
ATOM   527  C  CA  . ASN A  1 61  ? -7.650  19.421 -0.623  1.00 16.07  ? 61  ASN A CA  1 
ATOM   528  C  C   . ASN A  1 61  ? -7.794  18.973 0.791   1.00 17.68  ? 61  ASN A C   1 
ATOM   529  O  O   . ASN A  1 61  ? -7.285  17.919 1.138   1.00 18.53  ? 61  ASN A O   1 
ATOM   530  C  CB  . ASN A  1 61  ? -6.201  19.251 -1.108  1.00 15.99  ? 61  ASN A CB  1 
ATOM   531  C  CG  . ASN A  1 61  ? -5.211  20.063 -0.333  1.00 15.82  ? 61  ASN A CG  1 
ATOM   532  O  OD1 . ASN A  1 61  ? -5.532  21.172 0.045   1.00 15.38  ? 61  ASN A OD1 1 
ATOM   533  N  ND2 . ASN A  1 61  ? -3.972  19.603 -0.288  1.00 15.14  ? 61  ASN A ND2 1 
ATOM   534  N  N   A THR A  1 62  ? -8.483  19.784 1.579   0.62 17.30  ? 62  THR A N   1 
ATOM   535  N  N   B THR A  1 62  ? -8.506  19.763 1.587   0.38 17.43  ? 62  THR A N   1 
ATOM   536  C  CA  A THR A  1 62  ? -8.758  19.469 2.977   0.62 18.56  ? 62  THR A CA  1 
ATOM   537  C  CA  B THR A  1 62  ? -8.786  19.457 2.997   0.38 18.49  ? 62  THR A CA  1 
ATOM   538  C  C   A THR A  1 62  ? -7.502  18.943 3.633   0.62 19.17  ? 62  THR A C   1 
ATOM   539  C  C   B THR A  1 62  ? -7.542  19.032 3.770   0.38 19.10  ? 62  THR A C   1 
ATOM   540  O  O   A THR A  1 62  ? -7.504  17.870 4.261   0.62 20.49  ? 62  THR A O   1 
ATOM   541  O  O   B THR A  1 62  ? -7.608  18.127 4.636   0.38 19.96  ? 62  THR A O   1 
ATOM   542  C  CB  A THR A  1 62  ? -9.970  18.520 3.124   0.62 19.45  ? 62  THR A CB  1 
ATOM   543  C  CB  B THR A  1 62  ? -9.905  18.398 3.154   0.38 19.18  ? 62  THR A CB  1 
ATOM   544  O  OG1 A THR A  1 62  ? -9.835  17.407 2.234   0.62 19.74  ? 62  THR A OG1 1 
ATOM   545  O  OG1 B THR A  1 62  ? -10.959 18.666 2.214   0.38 19.34  ? 62  THR A OG1 1 
ATOM   546  C  CG2 A THR A  1 62  ? -11.277 19.281 2.744   0.62 19.39  ? 62  THR A CG2 1 
ATOM   547  C  CG2 B THR A  1 62  ? -10.489 18.445 4.551   0.38 19.56  ? 62  THR A CG2 1 
ATOM   548  N  N   . ASP A  1 63  ? -6.427  19.726 3.518   1.00 19.28  ? 63  ASP A N   1 
ATOM   549  C  CA  . ASP A  1 63  ? -5.179  19.444 4.242   1.00 19.62  ? 63  ASP A CA  1 
ATOM   550  C  C   . ASP A  1 63  ? -4.875  20.357 5.426   1.00 20.65  ? 63  ASP A C   1 
ATOM   551  O  O   . ASP A  1 63  ? -3.827  20.254 6.077   1.00 21.53  ? 63  ASP A O   1 
ATOM   552  C  CB  . ASP A  1 63  ? -3.986  19.406 3.314   1.00 19.02  ? 63  ASP A CB  1 
ATOM   553  C  CG  . ASP A  1 63  ? -3.594  20.752 2.793   1.00 18.68  ? 63  ASP A CG  1 
ATOM   554  O  OD1 . ASP A  1 63  ? -4.337  21.726 2.994   1.00 17.54  ? 63  ASP A OD1 1 
ATOM   555  O  OD2 . ASP A  1 63  ? -2.581  20.786 2.057   1.00 19.64  ? 63  ASP A OD2 1 
ATOM   556  N  N   . GLY A  1 64  ? -5.806  21.254 5.725   1.00 20.41  ? 64  GLY A N   1 
ATOM   557  C  CA  . GLY A  1 64  ? -5.647  22.152 6.822   1.00 19.50  ? 64  GLY A CA  1 
ATOM   558  C  C   . GLY A  1 64  ? -4.932  23.461 6.603   1.00 18.58  ? 64  GLY A C   1 
ATOM   559  O  O   . GLY A  1 64  ? -4.675  24.218 7.613   1.00 19.17  ? 64  GLY A O   1 
ATOM   560  N  N   . ALA A  1 65  ? -4.653  23.767 5.327   1.00 19.58  ? 65  ALA A N   1 
ATOM   561  C  CA  . ALA A  1 65  ? -4.043  25.054 5.019   1.00 19.32  ? 65  ALA A CA  1 
ATOM   562  C  C   . ALA A  1 65  ? -4.501  25.521 3.685   1.00 17.86  ? 65  ALA A C   1 
ATOM   563  O  O   . ALA A  1 65  ? -4.976  24.752 2.880   1.00 18.03  ? 65  ALA A O   1 
ATOM   564  C  CB  . ALA A  1 65  ? -2.542  24.916 5.038   1.00 20.28  ? 65  ALA A CB  1 
ATOM   565  N  N   . VAL A  1 66  ? -4.337  26.829 3.487   1.00 17.20  ? 66  VAL A N   1 
ATOM   566  C  CA  . VAL A  1 66  ? -4.528  27.467 2.199   1.00 16.37  ? 66  VAL A CA  1 
ATOM   567  C  C   . VAL A  1 66  ? -3.141  27.766 1.614   1.00 16.32  ? 66  VAL A C   1 
ATOM   568  O  O   . VAL A  1 66  ? -2.372  28.561 2.137   1.00 16.64  ? 66  VAL A O   1 
ATOM   569  C  CB  . VAL A  1 66  ? -5.306  28.781 2.387   1.00 16.19  ? 66  VAL A CB  1 
ATOM   570  C  CG1 . VAL A  1 66  ? -5.394  29.604 1.117   1.00 15.94  ? 66  VAL A CG1 1 
ATOM   571  C  CG2 . VAL A  1 66  ? -6.664  28.466 3.026   1.00 16.16  ? 66  VAL A CG2 1 
ATOM   572  N  N   . ASN A  1 67  ? -2.855  27.131 0.503   1.00 15.74  ? 67  ASN A N   1 
ATOM   573  C  CA  . ASN A  1 67  ? -1.598  27.354 -0.210  1.00 15.84  ? 67  ASN A CA  1 
ATOM   574  C  C   . ASN A  1 67  ? -1.762  28.540 -1.182  1.00 16.16  ? 67  ASN A C   1 
ATOM   575  O  O   . ASN A  1 67  ? -2.803  29.207 -1.147  1.00 15.51  ? 67  ASN A O   1 
ATOM   576  C  CB  . ASN A  1 67  ? -1.109  26.042 -0.867  1.00 16.13  ? 67  ASN A CB  1 
ATOM   577  C  CG  . ASN A  1 67  ? -1.918  25.588 -2.079  1.00 15.74  ? 67  ASN A CG  1 
ATOM   578  O  OD1 . ASN A  1 67  ? -2.648  26.352 -2.697  1.00 15.35  ? 67  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A  1 67  ? -1.778  24.287 -2.395  1.00 16.22  ? 67  ASN A ND2 1 
ATOM   580  N  N   . PHE A  1 68  ? -0.776  28.794 -2.059  1.00 16.48  ? 68  PHE A N   1 
ATOM   581  C  CA  . PHE A  1 68  ? -0.801  30.041 -2.776  1.00 16.92  ? 68  PHE A CA  1 
ATOM   582  C  C   . PHE A  1 68  ? -1.886  29.963 -3.854  1.00 16.15  ? 68  PHE A C   1 
ATOM   583  O  O   . PHE A  1 68  ? -2.573  30.962 -4.102  1.00 15.91  ? 68  PHE A O   1 
ATOM   584  C  CB  . PHE A  1 68  ? 0.556   30.395 -3.413  1.00 17.37  ? 68  PHE A CB  1 
ATOM   585  C  CG  . PHE A  1 68  ? 0.555   31.733 -4.086  1.00 17.52  ? 68  PHE A CG  1 
ATOM   586  C  CD1 . PHE A  1 68  ? 0.243   32.864 -3.320  1.00 17.59  ? 68  PHE A CD1 1 
ATOM   587  C  CD2 . PHE A  1 68  ? 0.780   31.889 -5.436  1.00 18.39  ? 68  PHE A CD2 1 
ATOM   588  C  CE1 . PHE A  1 68  ? 0.166   34.110 -3.849  1.00 17.95  ? 68  PHE A CE1 1 
ATOM   589  C  CE2 . PHE A  1 68  ? 0.731   33.154 -6.016  1.00 18.33  ? 68  PHE A CE2 1 
ATOM   590  C  CZ  . PHE A  1 68  ? 0.439   34.274 -5.201  1.00 17.77  ? 68  PHE A CZ  1 
ATOM   591  N  N   . GLN A  1 69  ? -2.034  28.785 -4.489  1.00 16.49  ? 69  GLN A N   1 
ATOM   592  C  CA  . GLN A  1 69  ? -3.026  28.620 -5.534  1.00 17.86  ? 69  GLN A CA  1 
ATOM   593  C  C   . GLN A  1 69  ? -4.428  28.745 -4.940  1.00 15.96  ? 69  GLN A C   1 
ATOM   594  O  O   . GLN A  1 69  ? -5.319  29.250 -5.614  1.00 15.99  ? 69  GLN A O   1 
ATOM   595  C  CB  . GLN A  1 69  ? -3.019  27.241 -6.243  1.00 19.14  ? 69  GLN A CB  1 
ATOM   596  C  CG  . GLN A  1 69  ? -1.888  26.443 -6.822  1.00 24.87  ? 69  GLN A CG  1 
ATOM   597  C  CD  . GLN A  1 69  ? -1.170  25.488 -5.831  1.00 24.77  ? 69  GLN A CD  1 
ATOM   598  O  OE1 . GLN A  1 69  ? -1.277  24.090 -5.799  1.00 20.39  ? 69  GLN A OE1 1 
ATOM   599  N  NE2 . GLN A  1 69  ? -0.414  26.206 -4.987  1.00 24.59  ? 69  GLN A NE2 1 
ATOM   600  N  N   . GLU A  1 70  ? -4.652  28.160 -3.760  1.00 15.03  ? 70  GLU A N   1 
ATOM   601  C  CA  . GLU A  1 70  ? -5.905  28.261 -3.063  1.00 14.76  ? 70  GLU A CA  1 
ATOM   602  C  C   . GLU A  1 70  ? -6.209  29.723 -2.714  1.00 14.44  ? 70  GLU A C   1 
ATOM   603  O  O   . GLU A  1 70  ? -7.359  30.189 -2.815  1.00 15.32  ? 70  GLU A O   1 
ATOM   604  C  CB  . GLU A  1 70  ? -5.894  27.386 -1.828  1.00 14.97  ? 70  GLU A CB  1 
ATOM   605  C  CG  . GLU A  1 70  ? -6.003  25.902 -2.137  1.00 15.14  ? 70  GLU A CG  1 
ATOM   606  C  CD  . GLU A  1 70  ? -5.716  24.995 -0.975  1.00 15.31  ? 70  GLU A CD  1 
ATOM   607  O  OE1 . GLU A  1 70  ? -4.821  25.320 -0.114  1.00 16.31  ? 70  GLU A OE1 1 
ATOM   608  O  OE2 . GLU A  1 70  ? -6.330  23.905 -0.899  1.00 15.82  ? 70  GLU A OE2 1 
ATOM   609  N  N   . PHE A  1 71  ? -5.207  30.445 -2.249  1.00 13.65  ? 71  PHE A N   1 
ATOM   610  C  CA  . PHE A  1 71  ? -5.347  31.884 -1.981  1.00 14.34  ? 71  PHE A CA  1 
ATOM   611  C  C   . PHE A  1 71  ? -5.796  32.653 -3.219  1.00 14.58  ? 71  PHE A C   1 
ATOM   612  O  O   . PHE A  1 71  ? -6.565  33.640 -3.105  1.00 14.60  ? 71  PHE A O   1 
ATOM   613  C  CB  . PHE A  1 71  ? -4.036  32.432 -1.444  1.00 15.05  ? 71  PHE A CB  1 
ATOM   614  C  CG  . PHE A  1 71  ? -3.981  33.927 -1.346  1.00 15.32  ? 71  PHE A CG  1 
ATOM   615  C  CD1 . PHE A  1 71  ? -4.712  34.621 -0.363  1.00 16.09  ? 71  PHE A CD1 1 
ATOM   616  C  CD2 . PHE A  1 71  ? -3.130  34.639 -2.166  1.00 15.95  ? 71  PHE A CD2 1 
ATOM   617  C  CE1 . PHE A  1 71  ? -4.611  36.002 -0.251  1.00 16.56  ? 71  PHE A CE1 1 
ATOM   618  C  CE2 . PHE A  1 71  ? -3.025  36.023 -2.070  1.00 16.65  ? 71  PHE A CE2 1 
ATOM   619  C  CZ  . PHE A  1 71  ? -3.779  36.695 -1.136  1.00 16.60  ? 71  PHE A CZ  1 
ATOM   620  N  N   . LEU A  1 72  ? -5.304  32.268 -4.365  1.00 15.22  ? 72  LEU A N   1 
ATOM   621  C  CA  . LEU A  1 72  ? -5.682  32.987 -5.568  1.00 15.33  ? 72  LEU A CA  1 
ATOM   622  C  C   . LEU A  1 72  ? -7.186  32.879 -5.848  1.00 15.28  ? 72  LEU A C   1 
ATOM   623  O  O   . LEU A  1 72  ? -7.761  33.758 -6.488  1.00 14.58  ? 72  LEU A O   1 
ATOM   624  C  CB  . LEU A  1 72  ? -4.838  32.582 -6.761  1.00 15.40  ? 72  LEU A CB  1 
ATOM   625  C  CG  . LEU A  1 72  ? -3.400  33.036 -6.692  1.00 16.68  ? 72  LEU A CG  1 
ATOM   626  C  CD1 . LEU A  1 72  ? -2.635  32.493 -7.899  1.00 17.39  ? 72  LEU A CD1 1 
ATOM   627  C  CD2 . LEU A  1 72  ? -3.299  34.565 -6.625  1.00 17.39  ? 72  LEU A CD2 1 
ATOM   628  N  N   . ILE A  1 73  ? -7.837  31.842 -5.327  1.00 14.96  ? 73  ILE A N   1 
ATOM   629  C  CA  . ILE A  1 73  ? -9.332  31.788 -5.398  1.00 14.88  ? 73  ILE A CA  1 
ATOM   630  C  C   . ILE A  1 73  ? -9.947  33.006 -4.677  1.00 14.37  ? 73  ILE A C   1 
ATOM   631  O  O   . ILE A  1 73  ? -10.841 33.660 -5.208  1.00 14.75  ? 73  ILE A O   1 
ATOM   632  C  CB  . ILE A  1 73  ? -9.934  30.469 -4.812  1.00 14.85  ? 73  ILE A CB  1 
ATOM   633  C  CG1 . ILE A  1 73  ? -9.464  29.274 -5.630  1.00 15.50  ? 73  ILE A CG1 1 
ATOM   634  C  CG2 . ILE A  1 73  ? -11.437 30.552 -4.782  1.00 14.36  ? 73  ILE A CG2 1 
ATOM   635  C  CD1 . ILE A  1 73  ? -9.666  27.978 -4.845  1.00 15.92  ? 73  ILE A CD1 1 
ATOM   636  N  N   . LEU A  1 74  ? -9.480  33.305 -3.452  1.00 14.73  ? 74  LEU A N   1 
ATOM   637  C  CA  . LEU A  1 74  ? -9.961  34.456 -2.712  1.00 14.34  ? 74  LEU A CA  1 
ATOM   638  C  C   . LEU A  1 74  ? -9.661  35.753 -3.483  1.00 14.09  ? 74  LEU A C   1 
ATOM   639  O  O   . LEU A  1 74  ? -10.467 36.642 -3.562  1.00 14.13  ? 74  LEU A O   1 
ATOM   640  C  CB  . LEU A  1 74  ? -9.282  34.467 -1.322  1.00 15.09  ? 74  LEU A CB  1 
ATOM   641  C  CG  . LEU A  1 74  ? -9.466  35.700 -0.463  1.00 15.81  ? 74  LEU A CG  1 
ATOM   642  C  CD1 . LEU A  1 74  ? -10.958 35.823 -0.112  1.00 17.06  ? 74  LEU A CD1 1 
ATOM   643  C  CD2 . LEU A  1 74  ? -8.613  35.596 0.810   1.00 16.86  ? 74  LEU A CD2 1 
ATOM   644  N  N   . VAL A  1 75  ? -8.491  35.829 -4.093  1.00 14.03  ? 75  VAL A N   1 
ATOM   645  C  CA  . VAL A  1 75  ? -8.067  37.028 -4.819  1.00 13.72  ? 75  VAL A CA  1 
ATOM   646  C  C   . VAL A  1 75  ? -9.033  37.256 -5.962  1.00 13.45  ? 75  VAL A C   1 
ATOM   647  O  O   . VAL A  1 75  ? -9.519  38.365 -6.179  1.00 13.55  ? 75  VAL A O   1 
ATOM   648  C  CB  . VAL A  1 75  ? -6.620  36.929 -5.309  1.00 14.19  ? 75  VAL A CB  1 
ATOM   649  C  CG1 . VAL A  1 75  ? -6.278  38.173 -6.150  1.00 14.14  ? 75  VAL A CG1 1 
ATOM   650  C  CG2 . VAL A  1 75  ? -5.663  36.886 -4.117  1.00 14.68  ? 75  VAL A CG2 1 
ATOM   651  N  N   . ILE A  1 76  ? -9.253  36.211 -6.761  1.00 13.78  ? 76  ILE A N   1 
ATOM   652  C  CA  . ILE A  1 76  ? -10.192 36.279 -7.870  1.00 13.52  ? 76  ILE A CA  1 
ATOM   653  C  C   . ILE A  1 76  ? -11.549 36.733 -7.381  1.00 13.64  ? 76  ILE A C   1 
ATOM   654  O  O   . ILE A  1 76  ? -12.141 37.689 -7.938  1.00 14.41  ? 76  ILE A O   1 
ATOM   655  C  CB  . ILE A  1 76  ? -10.298 34.929 -8.633  1.00 13.16  ? 76  ILE A CB  1 
ATOM   656  C  CG1 . ILE A  1 76  ? -9.019  34.676 -9.418  1.00 13.53  ? 76  ILE A CG1 1 
ATOM   657  C  CG2 . ILE A  1 76  ? -11.549 34.886 -9.528  1.00 13.51  ? 76  ILE A CG2 1 
ATOM   658  C  CD1 . ILE A  1 76  ? -8.833  33.212 -9.917  1.00 14.00  ? 76  ILE A CD1 1 
ATOM   659  N  N   . LYS A  1 77  ? -12.084 36.092 -6.371  1.00 13.93  ? 77  LYS A N   1 
ATOM   660  C  CA  . LYS A  1 77  ? -13.425 36.506 -5.873  1.00 14.39  ? 77  LYS A CA  1 
ATOM   661  C  C   . LYS A  1 77  ? -13.437 37.947 -5.316  1.00 14.62  ? 77  LYS A C   1 
ATOM   662  O  O   . LYS A  1 77  ? -14.386 38.686 -5.518  1.00 14.51  ? 77  LYS A O   1 
ATOM   663  C  CB  . LYS A  1 77  ? -14.000 35.507 -4.873  1.00 15.38  ? 77  LYS A CB  1 
ATOM   664  C  CG  . LYS A  1 77  ? -14.311 34.161 -5.531  1.00 16.18  ? 77  LYS A CG  1 
ATOM   665  C  CD  . LYS A  1 77  ? -14.962 33.150 -4.576  1.00 17.17  ? 77  LYS A CD  1 
ATOM   666  C  CE  . LYS A  1 77  ? -15.515 31.986 -5.390  1.00 18.30  ? 77  LYS A CE  1 
ATOM   667  N  NZ  . LYS A  1 77  ? -16.337 31.118 -4.507  1.00 20.01  ? 77  LYS A NZ  1 
ATOM   668  N  N   . MET A  1 78  ? -12.410 38.333 -4.557  1.00 14.41  ? 78  MET A N   1 
ATOM   669  C  CA  . MET A  1 78  ? -12.317 39.737 -4.135  1.00 14.57  ? 78  MET A CA  1 
ATOM   670  C  C   . MET A  1 78  ? -12.276 40.721 -5.285  1.00 14.53  ? 78  MET A C   1 
ATOM   671  O  O   . MET A  1 78  ? -12.886 41.780 -5.246  1.00 15.10  ? 78  MET A O   1 
ATOM   672  C  CB  . MET A  1 78  ? -11.080 39.920 -3.270  1.00 14.91  ? 78  MET A CB  1 
ATOM   673  C  CG  . MET A  1 78  ? -11.286 39.381 -1.904  1.00 15.61  ? 78  MET A CG  1 
ATOM   674  S  SD  . MET A  1 78  ? -9.845  39.636 -0.827  1.00 18.75  ? 78  MET A SD  1 
ATOM   675  C  CE  . MET A  1 78  ? -9.786  41.456 -0.768  1.00 16.82  ? 78  MET A CE  1 
ATOM   676  N  N   . GLY A  1 79  ? -11.504 40.393 -6.313  1.00 14.25  ? 79  GLY A N   1 
ATOM   677  C  CA  . GLY A  1 79  ? -11.422 41.158 -7.542  1.00 14.10  ? 79  GLY A CA  1 
ATOM   678  C  C   . GLY A  1 79  ? -12.760 41.347 -8.248  1.00 14.06  ? 79  GLY A C   1 
ATOM   679  O  O   . GLY A  1 79  ? -13.195 42.465 -8.545  1.00 14.59  ? 79  GLY A O   1 
ATOM   680  N  N   . VAL A  1 80  ? -13.413 40.231 -8.541  1.00 13.51  ? 80  VAL A N   1 
ATOM   681  C  CA  . VAL A  1 80  ? -14.744 40.301 -9.118  1.00 13.67  ? 80  VAL A CA  1 
ATOM   682  C  C   . VAL A  1 80  ? -15.722 41.142 -8.322  1.00 13.71  ? 80  VAL A C   1 
ATOM   683  O  O   . VAL A  1 80  ? -16.474 41.962 -8.866  1.00 14.93  ? 80  VAL A O   1 
ATOM   684  C  CB  . VAL A  1 80  ? -15.281 38.895 -9.360  1.00 13.52  ? 80  VAL A CB  1 
ATOM   685  C  CG1 . VAL A  1 80  ? -16.739 38.902 -9.802  1.00 14.23  ? 80  VAL A CG1 1 
ATOM   686  C  CG2 . VAL A  1 80  ? -14.409 38.270 -10.486 1.00 13.45  ? 80  VAL A CG2 1 
ATOM   687  N  N   . ALA A  1 81  ? -15.718 40.943 -7.010  1.00 14.06  ? 81  ALA A N   1 
ATOM   688  C  CA  . ALA A  1 81  ? -16.645 41.678 -6.187  1.00 15.21  ? 81  ALA A CA  1 
ATOM   689  C  C   . ALA A  1 81  ? -16.339 43.171 -6.174  1.00 15.82  ? 81  ALA A C   1 
ATOM   690  O  O   . ALA A  1 81  ? -17.247 43.998 -6.235  1.00 17.65  ? 81  ALA A O   1 
ATOM   691  C  CB  . ALA A  1 81  ? -16.627 41.125 -4.783  1.00 15.16  ? 81  ALA A CB  1 
ATOM   692  N  N   . ALA A  1 82  ? -15.066 43.524 -6.052  1.00 15.81  ? 82  ALA A N   1 
ATOM   693  C  CA  . ALA A  1 82  ? -14.674 44.943 -6.030  1.00 15.87  ? 82  ALA A CA  1 
ATOM   694  C  C   . ALA A  1 82  ? -14.969 45.661 -7.362  1.00 16.32  ? 82  ALA A C   1 
ATOM   695  O  O   . ALA A  1 82  ? -15.308 46.861 -7.394  1.00 17.10  ? 82  ALA A O   1 
ATOM   696  C  CB  . ALA A  1 82  ? -13.197 45.028 -5.666  1.00 15.58  ? 82  ALA A CB  1 
ATOM   697  N  N   . HIS A  1 83  ? -14.820 44.937 -8.461  1.00 16.32  ? 83  HIS A N   1 
ATOM   698  C  CA  . HIS A  1 83  ? -15.146 45.495 -9.745  1.00 16.27  ? 83  HIS A CA  1 
ATOM   699  C  C   . HIS A  1 83  ? -16.619 45.761 -9.860  1.00 17.85  ? 83  HIS A C   1 
ATOM   700  O  O   . HIS A  1 83  ? -17.051 46.822 -10.326 1.00 16.89  ? 83  HIS A O   1 
ATOM   701  C  CB  . HIS A  1 83  ? -14.643 44.613 -10.888 1.00 16.02  ? 83  HIS A CB  1 
ATOM   702  C  CG  . HIS A  1 83  ? -15.228 45.013 -12.211 1.00 16.02  ? 83  HIS A CG  1 
ATOM   703  N  ND1 . HIS A  1 83  ? -16.328 44.437 -12.708 1.00 16.66  ? 83  HIS A ND1 1 
ATOM   704  C  CD2 . HIS A  1 83  ? -14.884 46.035 -13.079 1.00 16.66  ? 83  HIS A CD2 1 
ATOM   705  C  CE1 . HIS A  1 83  ? -16.627 45.014 -13.899 1.00 16.75  ? 83  HIS A CE1 1 
ATOM   706  N  NE2 . HIS A  1 83  ? -15.762 46.032 -14.091 1.00 16.36  ? 83  HIS A NE2 1 
ATOM   707  N  N   . LYS A  1 84  ? -17.419 44.853 -9.297  1.00 16.98  ? 84  LYS A N   1 
ATOM   708  C  CA  . LYS A  1 84  ? -18.877 45.065 -9.329  1.00 21.38  ? 84  LYS A CA  1 
ATOM   709  C  C   . LYS A  1 84  ? -19.223 46.293 -8.465  1.00 21.68  ? 84  LYS A C   1 
ATOM   710  O  O   . LYS A  1 84  ? -20.026 47.150 -8.872  1.00 23.81  ? 84  LYS A O   1 
ATOM   711  C  CB  . LYS A  1 84  ? -19.579 43.770 -8.846  1.00 26.65  ? 84  LYS A CB  1 
ATOM   712  C  CG  . LYS A  1 84  ? -21.070 43.837 -8.681  1.00 34.53  ? 84  LYS A CG  1 
ATOM   713  C  CD  . LYS A  1 84  ? -21.637 42.494 -8.189  1.00 42.57  ? 84  LYS A CD  1 
ATOM   714  C  CE  . LYS A  1 84  ? -22.109 42.485 -6.717  1.00 49.66  ? 84  LYS A CE  1 
ATOM   715  N  NZ  . LYS A  1 84  ? -22.399 43.817 -6.060  1.00 49.81  ? 84  LYS A NZ  1 
ATOM   716  N  N   . LYS A  1 85  ? -18.609 46.381 -7.287  1.00 21.90  ? 85  LYS A N   1 
ATOM   717  C  CA  . LYS A  1 85  ? -18.851 47.506 -6.373  1.00 23.70  ? 85  LYS A CA  1 
ATOM   718  C  C   . LYS A  1 85  ? -18.463 48.835 -6.974  1.00 21.44  ? 85  LYS A C   1 
ATOM   719  O  O   . LYS A  1 85  ? -19.080 49.831 -6.662  1.00 24.25  ? 85  LYS A O   1 
ATOM   720  C  CB  . LYS A  1 85  ? -18.082 47.359 -5.063  1.00 26.91  ? 85  LYS A CB  1 
ATOM   721  C  CG  . LYS A  1 85  ? -18.336 46.099 -4.267  1.00 32.54  ? 85  LYS A CG  1 
ATOM   722  C  CD  . LYS A  1 85  ? -19.786 45.947 -3.910  1.00 39.59  ? 85  LYS A CD  1 
ATOM   723  C  CE  . LYS A  1 85  ? -19.975 45.075 -2.687  1.00 45.77  ? 85  LYS A CE  1 
ATOM   724  N  NZ  . LYS A  1 85  ? -21.395 45.062 -2.276  1.00 54.61  ? 85  LYS A NZ  1 
ATOM   725  N  N   . SER A  1 86  ? -17.482 48.847 -7.862  1.00 19.17  ? 86  SER A N   1 
ATOM   726  C  CA  . SER A  1 86  ? -17.049 50.108 -8.494  1.00 19.24  ? 86  SER A CA  1 
ATOM   727  C  C   . SER A  1 86  ? -18.151 50.739 -9.366  1.00 19.13  ? 86  SER A C   1 
ATOM   728  O  O   . SER A  1 86  ? -18.151 51.958 -9.578  1.00 19.98  ? 86  SER A O   1 
ATOM   729  C  CB  . SER A  1 86  ? -15.774 49.894 -9.335  1.00 18.60  ? 86  SER A CB  1 
ATOM   730  O  OG  . SER A  1 86  ? -16.045 49.335 -10.608 1.00 17.67  ? 86  SER A OG  1 
ATOM   731  N  N   . HIS A  1 87  ? -19.108 49.919 -9.819  1.00 18.72  ? 87  HIS A N   1 
ATOM   732  C  CA  . HIS A  1 87  ? -20.230 50.391 -10.626 1.00 21.35  ? 87  HIS A CA  1 
ATOM   733  C  C   . HIS A  1 87  ? -21.542 50.543 -9.882  1.00 25.89  ? 87  HIS A C   1 
ATOM   734  O  O   . HIS A  1 87  ? -22.578 50.817 -10.482 1.00 27.94  ? 87  HIS A O   1 
ATOM   735  C  CB  . HIS A  1 87  ? -20.377 49.486 -11.820 1.00 20.51  ? 87  HIS A CB  1 
ATOM   736  C  CG  . HIS A  1 87  ? -19.208 49.534 -12.750 1.00 19.35  ? 87  HIS A CG  1 
ATOM   737  N  ND1 . HIS A  1 87  ? -18.800 50.690 -13.367 1.00 19.60  ? 87  HIS A ND1 1 
ATOM   738  C  CD2 . HIS A  1 87  ? -18.340 48.533 -13.163 1.00 18.74  ? 87  HIS A CD2 1 
ATOM   739  C  CE1 . HIS A  1 87  ? -17.712 50.407 -14.130 1.00 20.75  ? 87  HIS A CE1 1 
ATOM   740  N  NE2 . HIS A  1 87  ? -17.413 49.099 -13.978 1.00 20.53  ? 87  HIS A NE2 1 
ATOM   741  N  N   . GLU A  1 88  ? -21.504 50.432 -8.555  1.00 28.77  ? 88  GLU A N   1 
ATOM   742  C  CA  . GLU A  1 88  ? -22.692 50.580 -7.721  1.00 38.15  ? 88  GLU A CA  1 
ATOM   743  C  C   . GLU A  1 88  ? -22.680 51.918 -7.012  1.00 43.27  ? 88  GLU A C   1 
ATOM   744  O  O   . GLU A  1 88  ? -21.612 52.356 -6.596  1.00 44.09  ? 88  GLU A O   1 
ATOM   745  C  CB  . GLU A  1 88  ? -22.714 49.479 -6.687  1.00 40.85  ? 88  GLU A CB  1 
ATOM   746  C  CG  . GLU A  1 88  ? -22.849 48.121 -7.334  1.00 42.74  ? 88  GLU A CG  1 
ATOM   747  C  CD  . GLU A  1 88  ? -22.932 46.978 -6.357  1.00 47.57  ? 88  GLU A CD  1 
ATOM   748  O  OE1 . GLU A  1 88  ? -23.183 45.875 -6.861  1.00 51.72  ? 88  GLU A OE1 1 
ATOM   749  O  OE2 . GLU A  1 88  ? -22.791 47.173 -5.118  1.00 52.09  ? 88  GLU A OE2 1 
ATOM   750  N  N   . GLU A  1 89  ? -23.828 52.578 -6.871  1.00 53.52  ? 89  GLU A N   1 
ATOM   751  C  CA  . GLU A  1 89  ? -25.130 52.122 -7.387  1.00 59.20  ? 89  GLU A CA  1 
ATOM   752  C  C   . GLU A  1 89  ? -26.044 53.319 -7.608  1.00 67.62  ? 89  GLU A C   1 
ATOM   753  O  O   . GLU A  1 89  ? -25.856 54.379 -7.007  1.00 73.63  ? 89  GLU A O   1 
ATOM   754  C  CB  . GLU A  1 89  ? -25.780 51.129 -6.422  1.00 64.75  ? 89  GLU A CB  1 
ATOM   755  N  N   . LYS B  2 4   ? -6.971  53.781 4.491   1.00 51.17  ? 4   LYS C N   1 
ATOM   756  C  CA  . LYS B  2 4   ? -7.959  52.840 5.073   1.00 50.18  ? 4   LYS C CA  1 
ATOM   757  C  C   . LYS B  2 4   ? -7.785  51.550 4.298   1.00 40.62  ? 4   LYS C C   1 
ATOM   758  O  O   . LYS B  2 4   ? -7.646  50.517 4.919   1.00 42.52  ? 4   LYS C O   1 
ATOM   759  C  CB  . LYS B  2 4   ? -9.408  53.327 4.931   1.00 55.06  ? 4   LYS C CB  1 
ATOM   760  C  CG  . LYS B  2 4   ? -10.377 52.959 6.062   1.00 61.59  ? 4   LYS C CG  1 
ATOM   761  C  CD  . LYS B  2 4   ? -10.376 51.515 6.570   1.00 61.36  ? 4   LYS C CD  1 
ATOM   762  C  CE  . LYS B  2 4   ? -10.882 50.479 5.565   1.00 60.64  ? 4   LYS C CE  1 
ATOM   763  N  NZ  . LYS B  2 4   ? -11.945 50.965 4.639   1.00 64.26  ? 4   LYS C NZ  1 
ATOM   764  N  N   . MET B  2 5   ? -7.746  51.613 2.958   1.00 35.00  ? 5   MET C N   1 
ATOM   765  C  CA  . MET B  2 5   ? -7.619  50.403 2.140   1.00 28.66  ? 5   MET C CA  1 
ATOM   766  C  C   . MET B  2 5   ? -6.345  49.623 2.425   1.00 24.79  ? 5   MET C C   1 
ATOM   767  O  O   . MET B  2 5   ? -5.260  50.172 2.583   1.00 25.84  ? 5   MET C O   1 
ATOM   768  C  CB  . MET B  2 5   ? -7.656  50.701 0.623   1.00 27.44  ? 5   MET C CB  1 
ATOM   769  C  CG  . MET B  2 5   ? -9.000  51.244 0.140   1.00 29.79  ? 5   MET C CG  1 
ATOM   770  S  SD  . MET B  2 5   ? -8.876  51.826 -1.569  1.00 32.34  ? 5   MET C SD  1 
ATOM   771  C  CE  . MET B  2 5   ? -8.676  50.241 -2.375  1.00 22.93  ? 5   MET C CE  1 
ATOM   772  N  N   . SER B  2 6   ? -6.502  48.318 2.506   1.00 21.45  ? 6   SER C N   1 
ATOM   773  C  CA  . SER B  2 6   ? -5.361  47.455 2.707   1.00 20.80  ? 6   SER C CA  1 
ATOM   774  C  C   . SER B  2 6   ? -4.460  47.335 1.504   1.00 19.17  ? 6   SER C C   1 
ATOM   775  O  O   . SER B  2 6   ? -4.825  47.712 0.373   1.00 18.27  ? 6   SER C O   1 
ATOM   776  C  CB  . SER B  2 6   ? -5.816  46.066 3.115   1.00 19.75  ? 6   SER C CB  1 
ATOM   777  O  OG  . SER B  2 6   ? -6.379  45.423 2.020   1.00 18.08  ? 6   SER C OG  1 
ATOM   778  N  N   . GLN B  2 7   ? -3.284  46.744 1.724   1.00 19.74  ? 7   GLN C N   1 
ATOM   779  C  CA  . GLN B  2 7   ? -2.357  46.476 0.565   1.00 19.30  ? 7   GLN C CA  1 
ATOM   780  C  C   . GLN B  2 7   ? -3.058  45.654 -0.518  1.00 16.81  ? 7   GLN C C   1 
ATOM   781  O  O   . GLN B  2 7   ? -2.993  45.985 -1.706  1.00 16.92  ? 7   GLN C O   1 
ATOM   782  C  CB  . GLN B  2 7   ? -1.119  45.758 1.066   1.00 21.89  ? 7   GLN C CB  1 
ATOM   783  C  CG  . GLN B  2 7   ? -0.096  45.372 0.041   1.00 22.99  ? 7   GLN C CG  1 
ATOM   784  C  CD  . GLN B  2 7   ? 1.109   44.657 0.673   1.00 27.30  ? 7   GLN C CD  1 
ATOM   785  O  OE1 . GLN B  2 7   ? 1.176   44.511 1.919   1.00 29.65  ? 7   GLN C OE1 1 
ATOM   786  N  NE2 . GLN B  2 7   ? 2.071   44.194 -0.181  1.00 28.82  ? 7   GLN C NE2 1 
ATOM   787  N  N   . LEU B  2 8   ? -3.731  44.578 -0.105  1.00 15.93  ? 8   LEU C N   1 
ATOM   788  C  CA  . LEU B  2 8   ? -4.468  43.743 -1.025  1.00 15.69  ? 8   LEU C CA  1 
ATOM   789  C  C   . LEU B  2 8   ? -5.534  44.499 -1.779  1.00 15.45  ? 8   LEU C C   1 
ATOM   790  O  O   . LEU B  2 8   ? -5.685  44.343 -2.990  1.00 15.17  ? 8   LEU C O   1 
ATOM   791  C  CB  . LEU B  2 8   ? -5.007  42.498 -0.303  1.00 16.66  ? 8   LEU C CB  1 
ATOM   792  C  CG  . LEU B  2 8   ? -5.716  41.459 -1.135  1.00 17.56  ? 8   LEU C CG  1 
ATOM   793  C  CD1 . LEU B  2 8   ? -4.844  41.029 -2.323  1.00 18.01  ? 8   LEU C CD1 1 
ATOM   794  C  CD2 . LEU B  2 8   ? -6.163  40.221 -0.336  1.00 18.33  ? 8   LEU C CD2 1 
ATOM   795  N  N   . GLU B  2 9   ? -6.350  45.258 -1.065  1.00 15.44  ? 9   GLU C N   1 
ATOM   796  C  CA  . GLU B  2 9   ? -7.399  46.077 -1.726  1.00 16.59  ? 9   GLU C CA  1 
ATOM   797  C  C   . GLU B  2 9   ? -6.778  47.061 -2.723  1.00 15.96  ? 9   GLU C C   1 
ATOM   798  O  O   . GLU B  2 9   ? -7.348  47.267 -3.794  1.00 16.09  ? 9   GLU C O   1 
ATOM   799  C  CB  . GLU B  2 9   ? -8.219  46.809 -0.706  1.00 18.16  ? 9   GLU C CB  1 
ATOM   800  C  CG  . GLU B  2 9   ? -9.052  45.921 0.192   1.00 20.37  ? 9   GLU C CG  1 
ATOM   801  C  CD  . GLU B  2 9   ? -9.742  46.777 1.238   1.00 23.60  ? 9   GLU C CD  1 
ATOM   802  O  OE1 . GLU B  2 9   ? -9.116  47.325 2.198   1.00 25.26  ? 9   GLU C OE1 1 
ATOM   803  O  OE2 . GLU B  2 9   ? -10.944 46.999 1.025   1.00 28.17  ? 9   GLU C OE2 1 
ATOM   804  N  N   . ARG B  2 10  ? -5.632  47.662 -2.370  1.00 16.26  ? 10  ARG C N   1 
ATOM   805  C  CA  . ARG B  2 10  ? -4.981  48.650 -3.225  1.00 17.80  ? 10  ARG C CA  1 
ATOM   806  C  C   . ARG B  2 10  ? -4.465  47.943 -4.502  1.00 16.08  ? 10  ARG C C   1 
ATOM   807  O  O   . ARG B  2 10  ? -4.531  48.449 -5.642  1.00 18.06  ? 10  ARG C O   1 
ATOM   808  C  CB  . ARG B  2 10  ? -3.839  49.369 -2.489  1.00 21.12  ? 10  ARG C CB  1 
ATOM   809  C  CG  . ARG B  2 10  ? -4.337  50.374 -1.449  1.00 26.24  ? 10  ARG C CG  1 
ATOM   810  C  CD  . ARG B  2 10  ? -3.220  51.314 -1.002  1.00 33.19  ? 10  ARG C CD  1 
ATOM   811  N  NE  . ARG B  2 10  ? -1.993  50.580 -0.695  1.00 38.06  ? 10  ARG C NE  1 
ATOM   812  C  CZ  . ARG B  2 10  ? -1.573  50.215 0.520   1.00 41.22  ? 10  ARG C CZ  1 
ATOM   813  N  NH1 . ARG B  2 10  ? -2.264  50.510 1.623   1.00 47.30  ? 10  ARG C NH1 1 
ATOM   814  N  NH2 . ARG B  2 10  ? -0.435  49.537 0.636   1.00 43.30  ? 10  ARG C NH2 1 
ATOM   815  N  N   . ASN B  2 11  ? -4.016  46.705 -4.317  1.00 16.16  ? 11  ASN C N   1 
ATOM   816  C  CA  . ASN B  2 11  ? -3.520  45.925 -5.480  1.00 15.33  ? 11  ASN C CA  1 
ATOM   817  C  C   . ASN B  2 11  ? -4.678  45.539 -6.385  1.00 14.69  ? 11  ASN C C   1 
ATOM   818  O  O   . ASN B  2 11  ? -4.558  45.654 -7.603  1.00 13.61  ? 11  ASN C O   1 
ATOM   819  C  CB  . ASN B  2 11  ? -2.768  44.659 -5.050  1.00 15.75  ? 11  ASN C CB  1 
ATOM   820  C  CG  . ASN B  2 11  ? -1.521  44.956 -4.251  1.00 16.58  ? 11  ASN C CG  1 
ATOM   821  O  OD1 . ASN B  2 11  ? -0.849  46.025 -4.428  1.00 18.84  ? 11  ASN C OD1 1 
ATOM   822  N  ND2 . ASN B  2 11  ? -1.172  44.032 -3.409  1.00 15.51  ? 11  ASN C ND2 1 
ATOM   823  N  N   . ILE B  2 12  ? -5.801  45.111 -5.801  1.00 14.52  ? 12  ILE C N   1 
ATOM   824  C  CA  . ILE B  2 12  ? -6.985  44.808 -6.597  1.00 15.29  ? 12  ILE C CA  1 
ATOM   825  C  C   . ILE B  2 12  ? -7.451  46.071 -7.312  1.00 14.78  ? 12  ILE C C   1 
ATOM   826  O  O   . ILE B  2 12  ? -7.839  46.013 -8.481  1.00 14.91  ? 12  ILE C O   1 
ATOM   827  C  CB  . ILE B  2 12  ? -8.059  44.143 -5.742  1.00 16.20  ? 12  ILE C CB  1 
ATOM   828  C  CG1 . ILE B  2 12  ? -7.561  42.717 -5.445  1.00 17.42  ? 12  ILE C CG1 1 
ATOM   829  C  CG2 . ILE B  2 12  ? -9.406  44.152 -6.447  1.00 15.52  ? 12  ILE C CG2 1 
ATOM   830  C  CD1 . ILE B  2 12  ? -8.235  42.095 -4.263  1.00 19.30  ? 12  ILE C CD1 1 
ATOM   831  N  N   . GLU B  2 13  ? -7.414  47.199 -6.631  1.00 15.52  ? 13  GLU C N   1 
ATOM   832  C  CA  . GLU B  2 13  ? -7.844  48.465 -7.245  1.00 16.50  ? 13  GLU C CA  1 
ATOM   833  C  C   . GLU B  2 13  ? -6.969  48.802 -8.459  1.00 15.08  ? 13  GLU C C   1 
ATOM   834  O  O   . GLU B  2 13  ? -7.474  49.281 -9.461  1.00 15.09  ? 13  GLU C O   1 
ATOM   835  C  CB  . GLU B  2 13  ? -7.806  49.553 -6.191  1.00 18.04  ? 13  GLU C CB  1 
ATOM   836  C  CG  . GLU B  2 13  ? -8.274  50.901 -6.662  1.00 20.11  ? 13  GLU C CG  1 
ATOM   837  C  CD  . GLU B  2 13  ? -8.096  51.995 -5.630  1.00 22.88  ? 13  GLU C CD  1 
ATOM   838  O  OE1 . GLU B  2 13  ? -9.011  52.809 -5.600  1.00 24.81  ? 13  GLU C OE1 1 
ATOM   839  O  OE2 . GLU B  2 13  ? -7.054  52.083 -4.902  1.00 27.99  ? 13  GLU C OE2 1 
ATOM   840  N  N   . THR B  2 14  ? -5.668  48.562 -8.361  1.00 15.21  ? 14  THR C N   1 
ATOM   841  C  CA  . THR B  2 14  ? -4.775  48.798 -9.479  1.00 15.50  ? 14  THR C CA  1 
ATOM   842  C  C   . THR B  2 14  ? -5.212  47.946 -10.705 1.00 15.00  ? 14  THR C C   1 
ATOM   843  O  O   . THR B  2 14  ? -5.207  48.437 -11.854 1.00 14.96  ? 14  THR C O   1 
ATOM   844  C  CB  . THR B  2 14  ? -3.323  48.520 -9.097  1.00 16.54  ? 14  THR C CB  1 
ATOM   845  O  OG1 . THR B  2 14  ? -2.944  49.433 -8.073  1.00 17.26  ? 14  THR C OG1 1 
ATOM   846  C  CG2 . THR B  2 14  ? -2.396  48.677 -10.299 1.00 16.94  ? 14  THR C CG2 1 
ATOM   847  N  N   . ILE B  2 15  ? -5.565  46.677 -10.450 1.00 14.83  ? 15  ILE C N   1 
ATOM   848  C  CA  . ILE B  2 15  ? -6.019  45.792 -11.520 1.00 14.66  ? 15  ILE C CA  1 
ATOM   849  C  C   . ILE B  2 15  ? -7.291  46.375 -12.179 1.00 13.80  ? 15  ILE C C   1 
ATOM   850  O  O   . ILE B  2 15  ? -7.392  46.459 -13.398 1.00 14.77  ? 15  ILE C O   1 
ATOM   851  C  CB  . ILE B  2 15  ? -6.279  44.350 -11.022 1.00 14.79  ? 15  ILE C CB  1 
ATOM   852  C  CG1 . ILE B  2 15  ? -4.993  43.701 -10.516 1.00 15.37  ? 15  ILE C CG1 1 
ATOM   853  C  CG2 . ILE B  2 15  ? -6.951  43.520 -12.130 1.00 15.30  ? 15  ILE C CG2 1 
ATOM   854  C  CD1 . ILE B  2 15  ? -5.204  42.363 -9.811  1.00 16.68  ? 15  ILE C CD1 1 
ATOM   855  N  N   . ILE B  2 16  ? -8.243  46.759 -11.330 1.00 14.48  ? 16  ILE C N   1 
ATOM   856  C  CA  . ILE B  2 16  ? -9.501  47.318 -11.786 1.00 14.50  ? 16  ILE C CA  1 
ATOM   857  C  C   . ILE B  2 16  ? -9.267  48.624 -12.601 1.00 14.71  ? 16  ILE C C   1 
ATOM   858  O  O   . ILE B  2 16  ? -9.839  48.799 -13.705 1.00 14.13  ? 16  ILE C O   1 
ATOM   859  C  CB  . ILE B  2 16  ? -10.483 47.549 -10.638 1.00 14.91  ? 16  ILE C CB  1 
ATOM   860  C  CG1 . ILE B  2 16  ? -10.907 46.195 -10.026 1.00 14.92  ? 16  ILE C CG1 1 
ATOM   861  C  CG2 . ILE B  2 16  ? -11.712 48.395 -11.131 1.00 15.99  ? 16  ILE C CG2 1 
ATOM   862  C  CD1 . ILE B  2 16  ? -11.621 46.283 -8.663  1.00 16.07  ? 16  ILE C CD1 1 
ATOM   863  N  N   . ASN B  2 17  ? -8.447  49.512 -12.059 1.00 15.08  ? 17  ASN C N   1 
ATOM   864  C  CA  . ASN B  2 17  ? -8.181  50.814 -12.712 1.00 15.67  ? 17  ASN C CA  1 
ATOM   865  C  C   . ASN B  2 17  ? -7.531  50.562 -14.073 1.00 15.16  ? 17  ASN C C   1 
ATOM   866  O  O   . ASN B  2 17  ? -7.841  51.236 -15.057 1.00 16.00  ? 17  ASN C O   1 
ATOM   867  C  CB  . ASN B  2 17  ? -7.234  51.654 -11.830 1.00 16.04  ? 17  ASN C CB  1 
ATOM   868  C  CG  . ASN B  2 17  ? -7.912  52.262 -10.626 1.00 16.44  ? 17  ASN C CG  1 
ATOM   869  O  OD1 . ASN B  2 17  ? -9.129  52.300 -10.577 1.00 17.98  ? 17  ASN C OD1 1 
ATOM   870  N  ND2 . ASN B  2 17  ? -7.116  52.755 -9.627  1.00 17.12  ? 17  ASN C ND2 1 
ATOM   871  N  N   . THR B  2 18  ? -6.620  49.605 -14.128 1.00 14.62  ? 18  THR C N   1 
ATOM   872  C  CA  . THR B  2 18  ? -5.907  49.331 -15.357 1.00 14.77  ? 18  THR C CA  1 
ATOM   873  C  C   . THR B  2 18  ? -6.864  48.788 -16.404 1.00 14.96  ? 18  THR C C   1 
ATOM   874  O  O   . THR B  2 18  ? -6.803  49.193 -17.590 1.00 15.22  ? 18  THR C O   1 
ATOM   875  C  CB  . THR B  2 18  ? -4.716  48.389 -15.120 1.00 15.48  ? 18  THR C CB  1 
ATOM   876  O  OG1 . THR B  2 18  ? -3.878  48.930 -14.090 1.00 16.72  ? 18  THR C OG1 1 
ATOM   877  C  CG2 . THR B  2 18  ? -3.888  48.253 -16.438 1.00 16.08  ? 18  THR C CG2 1 
ATOM   878  N  N   . PHE B  2 19  ? -7.690  47.811 -16.001 1.00 14.47  ? 19  PHE C N   1 
ATOM   879  C  CA  . PHE B  2 19  ? -8.745  47.307 -16.876 1.00 15.18  ? 19  PHE C CA  1 
ATOM   880  C  C   . PHE B  2 19  ? -9.568  48.448 -17.434 1.00 15.95  ? 19  PHE C C   1 
ATOM   881  O  O   . PHE B  2 19  ? -9.711  48.603 -18.649 1.00 15.67  ? 19  PHE C O   1 
ATOM   882  C  CB  . PHE B  2 19  ? -9.579  46.264 -16.178 1.00 15.73  ? 19  PHE C CB  1 
ATOM   883  C  CG  . PHE B  2 19  ? -10.740 45.745 -16.963 1.00 15.81  ? 19  PHE C CG  1 
ATOM   884  C  CD1 . PHE B  2 19  ? -11.972 46.350 -16.846 1.00 15.50  ? 19  PHE C CD1 1 
ATOM   885  C  CD2 . PHE B  2 19  ? -10.641 44.592 -17.718 1.00 15.90  ? 19  PHE C CD2 1 
ATOM   886  C  CE1 . PHE B  2 19  ? -13.084 45.862 -17.497 1.00 16.57  ? 19  PHE C CE1 1 
ATOM   887  C  CE2 . PHE B  2 19  ? -11.755 44.109 -18.401 1.00 16.37  ? 19  PHE C CE2 1 
ATOM   888  C  CZ  . PHE B  2 19  ? -12.969 44.738 -18.292 1.00 16.83  ? 19  PHE C CZ  1 
ATOM   889  N  N   . HIS B  2 20  ? -10.073 49.291 -16.573 1.00 15.61  ? 20  HIS C N   1 
ATOM   890  C  CA  . HIS B  2 20  ? -10.936 50.375 -16.997 1.00 15.66  ? 20  HIS C CA  1 
ATOM   891  C  C   . HIS B  2 20  ? -10.342 51.432 -17.877 1.00 15.80  ? 20  HIS C C   1 
ATOM   892  O  O   . HIS B  2 20  ? -11.027 51.950 -18.749 1.00 16.61  ? 20  HIS C O   1 
ATOM   893  C  CB  . HIS B  2 20  ? -11.519 51.064 -15.779 1.00 15.77  ? 20  HIS C CB  1 
ATOM   894  C  CG  . HIS B  2 20  ? -12.651 50.319 -15.125 1.00 15.94  ? 20  HIS C CG  1 
ATOM   895  N  ND1 . HIS B  2 20  ? -12.873 50.430 -13.802 1.00 15.96  ? 20  HIS C ND1 1 
ATOM   896  C  CD2 . HIS B  2 20  ? -13.647 49.508 -15.636 1.00 16.20  ? 20  HIS C CD2 1 
ATOM   897  C  CE1 . HIS B  2 20  ? -13.974 49.736 -13.474 1.00 17.17  ? 20  HIS C CE1 1 
ATOM   898  N  NE2 . HIS B  2 20  ? -14.453 49.161 -14.591 1.00 17.42  ? 20  HIS C NE2 1 
ATOM   899  N  N   A GLN B  2 21  ? -9.052  51.704 -17.724 0.76 15.78  ? 21  GLN C N   1 
ATOM   900  N  N   B GLN B  2 21  ? -9.071  51.768 -17.679 0.24 15.49  ? 21  GLN C N   1 
ATOM   901  C  CA  A GLN B  2 21  ? -8.438  52.778 -18.497 0.76 16.54  ? 21  GLN C CA  1 
ATOM   902  C  CA  B GLN B  2 21  ? -8.410  52.757 -18.535 0.24 15.81  ? 21  GLN C CA  1 
ATOM   903  C  C   A GLN B  2 21  ? -8.344  52.388 -19.998 0.76 16.44  ? 21  GLN C C   1 
ATOM   904  C  C   B GLN B  2 21  ? -8.513  52.372 -20.006 0.24 16.10  ? 21  GLN C C   1 
ATOM   905  O  O   A GLN B  2 21  ? -8.221  53.251 -20.862 0.76 17.59  ? 21  GLN C O   1 
ATOM   906  O  O   B GLN B  2 21  ? -8.704  53.224 -20.874 0.24 16.93  ? 21  GLN C O   1 
ATOM   907  C  CB  A GLN B  2 21  ? -7.087  53.170 -17.909 0.76 17.03  ? 21  GLN C CB  1 
ATOM   908  C  CB  B GLN B  2 21  ? -6.946  52.879 -18.163 0.24 15.51  ? 21  GLN C CB  1 
ATOM   909  C  CG  A GLN B  2 21  ? -5.928  52.298 -18.316 0.76 17.57  ? 21  GLN C CG  1 
ATOM   910  C  CG  B GLN B  2 21  ? -6.746  53.397 -16.762 0.24 15.35  ? 21  GLN C CG  1 
ATOM   911  C  CD  A GLN B  2 21  ? -4.647  52.603 -17.523 0.76 17.87  ? 21  GLN C CD  1 
ATOM   912  C  CD  B GLN B  2 21  ? -5.379  53.083 -16.233 0.24 15.22  ? 21  GLN C CD  1 
ATOM   913  O  OE1 A GLN B  2 21  ? -4.687  53.221 -16.463 0.76 17.60  ? 21  GLN C OE1 1 
ATOM   914  O  OE1 B GLN B  2 21  ? -4.598  52.395 -16.879 0.24 15.15  ? 21  GLN C OE1 1 
ATOM   915  N  NE2 A GLN B  2 21  ? -3.503  52.156 -18.047 0.76 18.82  ? 21  GLN C NE2 1 
ATOM   916  N  NE2 B GLN B  2 21  ? -5.078  53.591 -15.046 0.24 15.34  ? 21  GLN C NE2 1 
ATOM   917  N  N   . TYR B  2 22  ? -8.400  51.074 -20.274 1.00 16.00  ? 22  TYR C N   1 
ATOM   918  C  CA  . TYR B  2 22  ? -8.518  50.566 -21.638 1.00 16.27  ? 22  TYR C CA  1 
ATOM   919  C  C   . TYR B  2 22  ? -9.949  50.211 -22.047 1.00 16.00  ? 22  TYR C C   1 
ATOM   920  O  O   . TYR B  2 22  ? -10.335 50.463 -23.224 1.00 17.83  ? 22  TYR C O   1 
ATOM   921  C  CB  . TYR B  2 22  ? -7.541  49.411 -21.877 1.00 16.09  ? 22  TYR C CB  1 
ATOM   922  C  CG  . TYR B  2 22  ? -6.112  49.827 -21.636 1.00 16.56  ? 22  TYR C CG  1 
ATOM   923  C  CD1 . TYR B  2 22  ? -5.418  50.630 -22.557 1.00 17.59  ? 22  TYR C CD1 1 
ATOM   924  C  CD2 . TYR B  2 22  ? -5.505  49.491 -20.459 1.00 16.53  ? 22  TYR C CD2 1 
ATOM   925  C  CE1 . TYR B  2 22  ? -4.110  51.052 -22.315 1.00 17.93  ? 22  TYR C CE1 1 
ATOM   926  C  CE2 . TYR B  2 22  ? -4.189  49.857 -20.220 1.00 16.86  ? 22  TYR C CE2 1 
ATOM   927  C  CZ  . TYR B  2 22  ? -3.505  50.645 -21.105 1.00 17.47  ? 22  TYR C CZ  1 
ATOM   928  O  OH  . TYR B  2 22  ? -2.232  51.003 -20.783 1.00 18.54  ? 22  TYR C OH  1 
ATOM   929  N  N   . SER B  2 23  ? -10.765 49.668 -21.120 1.00 16.19  ? 23  SER C N   1 
ATOM   930  C  CA  . SER B  2 23  ? -12.100 49.173 -21.525 1.00 16.39  ? 23  SER C CA  1 
ATOM   931  C  C   . SER B  2 23  ? -12.980 50.314 -21.987 1.00 17.04  ? 23  SER C C   1 
ATOM   932  O  O   . SER B  2 23  ? -13.779 50.167 -22.917 1.00 17.10  ? 23  SER C O   1 
ATOM   933  C  CB  . SER B  2 23  ? -12.768 48.389 -20.401 1.00 16.50  ? 23  SER C CB  1 
ATOM   934  O  OG  . SER B  2 23  ? -13.158 49.219 -19.329 1.00 16.28  ? 23  SER C OG  1 
ATOM   935  N  N   . VAL B  2 24  ? -12.778 51.486 -21.395 1.00 17.44  ? 24  VAL C N   1 
ATOM   936  C  CA  . VAL B  2 24  ? -13.584 52.673 -21.709 1.00 18.69  ? 24  VAL C CA  1 
ATOM   937  C  C   . VAL B  2 24  ? -13.385 53.247 -23.125 1.00 18.92  ? 24  VAL C C   1 
ATOM   938  O  O   . VAL B  2 24  ? -14.199 54.065 -23.589 1.00 20.75  ? 24  VAL C O   1 
ATOM   939  C  CB  . VAL B  2 24  ? -13.337 53.774 -20.639 1.00 20.04  ? 24  VAL C CB  1 
ATOM   940  C  CG1 . VAL B  2 24  ? -11.966 54.411 -20.845 1.00 19.59  ? 24  VAL C CG1 1 
ATOM   941  C  CG2 . VAL B  2 24  ? -14.424 54.855 -20.642 1.00 22.13  ? 24  VAL C CG2 1 
ATOM   942  N  N   . LYS B  2 25  ? -12.325 52.879 -23.802 1.00 18.04  ? 25  LYS C N   1 
ATOM   943  C  CA  . LYS B  2 25  ? -11.928 53.581 -25.016 1.00 19.37  ? 25  LYS C CA  1 
ATOM   944  C  C   . LYS B  2 25  ? -12.904 53.424 -26.217 1.00 20.50  ? 25  LYS C C   1 
ATOM   945  O  O   . LYS B  2 25  ? -13.329 54.468 -26.899 1.00 22.88  ? 25  LYS C O   1 
ATOM   946  C  CB  . LYS B  2 25  ? -10.478 53.184 -25.435 1.00 19.25  ? 25  LYS C CB  1 
ATOM   947  C  CG  . LYS B  2 25  ? -9.418  53.724 -24.474 1.00 19.27  ? 25  LYS C CG  1 
ATOM   948  C  CD  . LYS B  2 25  ? -7.994  53.470 -24.928 1.00 19.42  ? 25  LYS C CD  1 
ATOM   949  C  CE  . LYS B  2 25  ? -6.931  54.013 -23.949 1.00 19.24  ? 25  LYS C CE  1 
ATOM   950  N  NZ  . LYS B  2 25  ? -5.595  54.104 -24.649 1.00 19.18  ? 25  LYS C NZ  1 
ATOM   951  N  N   . LEU B  2 26  ? -13.232 52.163 -26.499 1.00 21.56  ? 26  LEU C N   1 
ATOM   952  C  CA  . LEU B  2 26  ? -14.016 51.826 -27.690 1.00 22.84  ? 26  LEU C CA  1 
ATOM   953  C  C   . LEU B  2 26  ? -15.154 50.881 -27.358 1.00 22.00  ? 26  LEU C C   1 
ATOM   954  O  O   . LEU B  2 26  ? -15.052 50.059 -26.467 1.00 20.06  ? 26  LEU C O   1 
ATOM   955  C  CB  . LEU B  2 26  ? -13.121 51.222 -28.778 1.00 25.00  ? 26  LEU C CB  1 
ATOM   956  C  CG  . LEU B  2 26  ? -11.956 52.104 -29.250 1.00 26.22  ? 26  LEU C CG  1 
ATOM   957  C  CD1 . LEU B  2 26  ? -11.154 51.350 -30.309 1.00 28.88  ? 26  LEU C CD1 1 
ATOM   958  C  CD2 . LEU B  2 26  ? -12.505 53.391 -29.781 1.00 26.95  ? 26  LEU C CD2 1 
ATOM   959  N  N   . GLY B  2 27  ? -16.262 50.987 -28.101 1.00 23.41  ? 27  GLY C N   1 
ATOM   960  C  CA  . GLY B  2 27  ? -17.321 49.983 -27.908 1.00 23.64  ? 27  GLY C CA  1 
ATOM   961  C  C   . GLY B  2 27  ? -17.840 49.981 -26.488 1.00 22.70  ? 27  GLY C C   1 
ATOM   962  O  O   . GLY B  2 27  ? -18.030 51.049 -25.884 1.00 23.21  ? 27  GLY C O   1 
ATOM   963  N  N   . HIS B  2 28  ? -18.119 48.798 -25.953 1.00 22.28  ? 28  HIS C N   1 
ATOM   964  C  CA  . HIS B  2 28  ? -18.667 48.707 -24.631 1.00 22.69  ? 28  HIS C CA  1 
ATOM   965  C  C   . HIS B  2 28  ? -17.631 49.247 -23.667 1.00 21.11  ? 28  HIS C C   1 
ATOM   966  O  O   . HIS B  2 28  ? -16.452 48.844 -23.727 1.00 19.83  ? 28  HIS C O   1 
ATOM   967  C  CB  . HIS B  2 28  ? -18.987 47.265 -24.233 1.00 23.86  ? 28  HIS C CB  1 
ATOM   968  C  CG  . HIS B  2 28  ? -19.899 47.174 -23.017 1.00 26.56  ? 28  HIS C CG  1 
ATOM   969  N  ND1 . HIS B  2 28  ? -19.461 47.395 -21.762 1.00 25.35  ? 28  HIS C ND1 1 
ATOM   970  C  CD2 . HIS B  2 28  ? -21.292 46.951 -22.916 1.00 29.66  ? 28  HIS C CD2 1 
ATOM   971  C  CE1 . HIS B  2 28  ? -20.488 47.293 -20.887 1.00 28.21  ? 28  HIS C CE1 1 
ATOM   972  N  NE2 . HIS B  2 28  ? -21.611 46.988 -21.589 1.00 31.31  ? 28  HIS C NE2 1 
ATOM   973  N  N   . PRO B  2 29  ? -18.051 50.154 -22.764 1.00 21.59  ? 29  PRO C N   1 
ATOM   974  C  CA  . PRO B  2 29  ? -17.060 50.726 -21.836 1.00 21.14  ? 29  PRO C CA  1 
ATOM   975  C  C   . PRO B  2 29  ? -16.562 49.863 -20.680 1.00 21.06  ? 29  PRO C C   1 
ATOM   976  O  O   . PRO B  2 29  ? -15.585 50.261 -20.022 1.00 20.29  ? 29  PRO C O   1 
ATOM   977  C  CB  . PRO B  2 29  ? -17.784 51.960 -21.279 1.00 22.08  ? 29  PRO C CB  1 
ATOM   978  C  CG  . PRO B  2 29  ? -19.213 51.584 -21.327 1.00 22.36  ? 29  PRO C CG  1 
ATOM   979  C  CD  . PRO B  2 29  ? -19.366 50.801 -22.610 1.00 22.60  ? 29  PRO C CD  1 
ATOM   980  N  N   A ASP B  2 30  ? -17.216 48.718 -20.417 0.50 21.13  ? 30  ASP C N   1 
ATOM   981  N  N   B ASP B  2 30  ? -17.193 48.709 -20.441 0.50 20.82  ? 30  ASP C N   1 
ATOM   982  C  CA  A ASP B  2 30  ? -16.796 47.802 -19.355 0.50 20.80  ? 30  ASP C CA  1 
ATOM   983  C  CA  B ASP B  2 30  ? -16.745 47.822 -19.390 0.50 20.34  ? 30  ASP C CA  1 
ATOM   984  C  C   A ASP B  2 30  ? -16.208 46.488 -19.889 0.50 19.84  ? 30  ASP C C   1 
ATOM   985  C  C   B ASP B  2 30  ? -16.311 46.455 -19.924 0.50 19.57  ? 30  ASP C C   1 
ATOM   986  O  O   A ASP B  2 30  ? -16.014 45.577 -19.119 0.50 19.65  ? 30  ASP C O   1 
ATOM   987  O  O   B ASP B  2 30  ? -16.356 45.479 -19.216 0.50 19.36  ? 30  ASP C O   1 
ATOM   988  C  CB  A ASP B  2 30  ? -17.961 47.465 -18.407 0.50 22.42  ? 30  ASP C CB  1 
ATOM   989  C  CB  B ASP B  2 30  ? -17.836 47.637 -18.352 0.50 21.54  ? 30  ASP C CB  1 
ATOM   990  C  CG  A ASP B  2 30  ? -17.489 46.825 -17.078 0.50 21.81  ? 30  ASP C CG  1 
ATOM   991  C  CG  B ASP B  2 30  ? -17.270 47.357 -16.967 0.50 21.02  ? 30  ASP C CG  1 
ATOM   992  O  OD1 A ASP B  2 30  ? -16.440 47.228 -16.531 0.50 22.89  ? 30  ASP C OD1 1 
ATOM   993  O  OD1 B ASP B  2 30  ? -16.146 47.847 -16.644 0.50 20.65  ? 30  ASP C OD1 1 
ATOM   994  O  OD2 A ASP B  2 30  ? -18.188 45.933 -16.555 0.50 23.61  ? 30  ASP C OD2 1 
ATOM   995  O  OD2 B ASP B  2 30  ? -17.973 46.708 -16.184 0.50 21.50  ? 30  ASP C OD2 1 
ATOM   996  N  N   . THR B  2 31  ? -15.908 46.396 -21.187 1.00 19.28  ? 31  THR C N   1 
ATOM   997  C  CA  . THR B  2 31  ? -15.229 45.198 -21.735 1.00 18.84  ? 31  THR C CA  1 
ATOM   998  C  C   . THR B  2 31  ? -14.067 45.624 -22.662 1.00 17.91  ? 31  THR C C   1 
ATOM   999  O  O   . THR B  2 31  ? -14.073 46.744 -23.182 1.00 16.99  ? 31  THR C O   1 
ATOM   1000 C  CB  . THR B  2 31  ? -16.135 44.251 -22.521 1.00 20.20  ? 31  THR C CB  1 
ATOM   1001 O  OG1 . THR B  2 31  ? -16.582 44.834 -23.766 1.00 20.80  ? 31  THR C OG1 1 
ATOM   1002 C  CG2 . THR B  2 31  ? -17.362 43.870 -21.704 1.00 20.99  ? 31  THR C CG2 1 
ATOM   1003 N  N   . LEU B  2 32  ? -13.064 44.773 -22.743 1.00 17.03  ? 32  LEU C N   1 
ATOM   1004 C  CA  . LEU B  2 32  ? -11.909 44.990 -23.595 1.00 17.08  ? 32  LEU C CA  1 
ATOM   1005 C  C   . LEU B  2 32  ? -12.110 44.310 -24.899 1.00 17.80  ? 32  LEU C C   1 
ATOM   1006 O  O   . LEU B  2 32  ? -12.310 43.057 -24.932 1.00 17.79  ? 32  LEU C O   1 
ATOM   1007 C  CB  . LEU B  2 32  ? -10.641 44.418 -22.988 1.00 16.60  ? 32  LEU C CB  1 
ATOM   1008 C  CG  . LEU B  2 32  ? -10.197 44.946 -21.625 1.00 15.66  ? 32  LEU C CG  1 
ATOM   1009 C  CD1 . LEU B  2 32  ? -9.134  44.018 -20.964 1.00 15.64  ? 32  LEU C CD1 1 
ATOM   1010 C  CD2 . LEU B  2 32  ? -9.631  46.370 -21.751 1.00 15.50  ? 32  LEU C CD2 1 
ATOM   1011 N  N   . ASN B  2 33  ? -12.074 45.091 -25.967 1.00 18.18  ? 33  ASN C N   1 
ATOM   1012 C  CA  . ASN B  2 33  ? -12.056 44.504 -27.291 1.00 19.27  ? 33  ASN C CA  1 
ATOM   1013 C  C   . ASN B  2 33  ? -10.622 44.109 -27.602 1.00 19.24  ? 33  ASN C C   1 
ATOM   1014 O  O   . ASN B  2 33  ? -9.746  44.274 -26.792 1.00 18.60  ? 33  ASN C O   1 
ATOM   1015 C  CB  . ASN B  2 33  ? -12.733 45.414 -28.344 1.00 20.09  ? 33  ASN C CB  1 
ATOM   1016 C  CG  . ASN B  2 33  ? -11.959 46.660 -28.651 1.00 20.31  ? 33  ASN C CG  1 
ATOM   1017 O  OD1 . ASN B  2 33  ? -10.800 46.795 -28.292 1.00 19.41  ? 33  ASN C OD1 1 
ATOM   1018 N  ND2 . ASN B  2 33  ? -12.615 47.594 -29.351 1.00 22.05  ? 33  ASN C ND2 1 
ATOM   1019 N  N   . GLN B  2 34  ? -10.373 43.564 -28.785 1.00 20.89  ? 34  GLN C N   1 
ATOM   1020 C  CA  . GLN B  2 34  ? -9.030  43.060 -29.045 1.00 22.40  ? 34  GLN C CA  1 
ATOM   1021 C  C   . GLN B  2 34  ? -7.951  44.152 -28.976 1.00 21.49  ? 34  GLN C C   1 
ATOM   1022 O  O   . GLN B  2 34  ? -6.870  43.934 -28.430 1.00 20.05  ? 34  GLN C O   1 
ATOM   1023 C  CB  . GLN B  2 34  ? -8.941  42.361 -30.407 1.00 25.64  ? 34  GLN C CB  1 
ATOM   1024 C  CG  . GLN B  2 34  ? -7.679  41.549 -30.478 1.00 27.30  ? 34  GLN C CG  1 
ATOM   1025 C  CD  . GLN B  2 34  ? -7.670  40.620 -31.636 1.00 31.82  ? 34  GLN C CD  1 
ATOM   1026 O  OE1 . GLN B  2 34  ? -7.760  39.395 -31.482 1.00 40.62  ? 34  GLN C OE1 1 
ATOM   1027 N  NE2 . GLN B  2 34  ? -7.538  41.179 -32.781 1.00 30.84  ? 34  GLN C NE2 1 
ATOM   1028 N  N   . GLY B  2 35  ? -8.250  45.304 -29.583 1.00 21.23  ? 35  GLY C N   1 
ATOM   1029 C  CA  . GLY B  2 35  ? -7.319  46.432 -29.622 1.00 20.93  ? 35  GLY C CA  1 
ATOM   1030 C  C   . GLY B  2 35  ? -6.990  46.925 -28.216 1.00 19.87  ? 35  GLY C C   1 
ATOM   1031 O  O   . GLY B  2 35  ? -5.838  47.275 -27.936 1.00 21.40  ? 35  GLY C O   1 
ATOM   1032 N  N   . GLU B  2 36  ? -8.029  47.018 -27.380 1.00 18.82  ? 36  GLU C N   1 
ATOM   1033 C  CA  . GLU B  2 36  ? -7.887  47.490 -25.994 1.00 17.73  ? 36  GLU C CA  1 
ATOM   1034 C  C   . GLU B  2 36  ? -7.044  46.526 -25.163 1.00 17.23  ? 36  GLU C C   1 
ATOM   1035 O  O   . GLU B  2 36  ? -6.144  46.929 -24.427 1.00 16.62  ? 36  GLU C O   1 
ATOM   1036 C  CB  . GLU B  2 36  ? -9.235  47.738 -25.307 1.00 17.62  ? 36  GLU C CB  1 
ATOM   1037 C  CG  . GLU B  2 36  ? -10.055 48.862 -25.902 1.00 18.79  ? 36  GLU C CG  1 
ATOM   1038 C  CD  . GLU B  2 36  ? -11.519 48.827 -25.488 1.00 19.80  ? 36  GLU C CD  1 
ATOM   1039 O  OE1 . GLU B  2 36  ? -12.065 47.741 -25.106 1.00 20.01  ? 36  GLU C OE1 1 
ATOM   1040 O  OE2 . GLU B  2 36  ? -12.152 49.897 -25.582 1.00 19.59  ? 36  GLU C OE2 1 
ATOM   1041 N  N   . PHE B  2 37  ? -7.294  45.241 -25.324 1.00 17.00  ? 37  PHE C N   1 
ATOM   1042 C  CA  . PHE B  2 37  ? -6.510  44.221 -24.631 1.00 16.31  ? 37  PHE C CA  1 
ATOM   1043 C  C   . PHE B  2 37  ? -5.058  44.220 -25.073 1.00 16.41  ? 37  PHE C C   1 
ATOM   1044 O  O   . PHE B  2 37  ? -4.154  44.193 -24.243 1.00 17.40  ? 37  PHE C O   1 
ATOM   1045 C  CB  . PHE B  2 37  ? -7.138  42.837 -24.905 1.00 16.27  ? 37  PHE C CB  1 
ATOM   1046 C  CG  . PHE B  2 37  ? -6.347  41.690 -24.307 1.00 16.24  ? 37  PHE C CG  1 
ATOM   1047 C  CD1 . PHE B  2 37  ? -6.305  41.516 -22.941 1.00 15.70  ? 37  PHE C CD1 1 
ATOM   1048 C  CD2 . PHE B  2 37  ? -5.674  40.776 -25.094 1.00 16.89  ? 37  PHE C CD2 1 
ATOM   1049 C  CE1 . PHE B  2 37  ? -5.615  40.465 -22.358 1.00 16.33  ? 37  PHE C CE1 1 
ATOM   1050 C  CE2 . PHE B  2 37  ? -4.974  39.723 -24.531 1.00 17.24  ? 37  PHE C CE2 1 
ATOM   1051 C  CZ  . PHE B  2 37  ? -4.930  39.577 -23.142 1.00 16.40  ? 37  PHE C CZ  1 
ATOM   1052 N  N   . LYS B  2 38  ? -4.841  44.284 -26.387 1.00 17.52  ? 38  LYS C N   1 
ATOM   1053 C  CA  . LYS B  2 38  ? -3.488  44.353 -26.916 1.00 18.32  ? 38  LYS C CA  1 
ATOM   1054 C  C   . LYS B  2 38  ? -2.728  45.548 -26.419 1.00 18.35  ? 38  LYS C C   1 
ATOM   1055 O  O   . LYS B  2 38  ? -1.560  45.410 -26.076 1.00 19.27  ? 38  LYS C O   1 
ATOM   1056 C  CB  . LYS B  2 38  ? -3.465  44.348 -28.421 1.00 19.65  ? 38  LYS C CB  1 
ATOM   1057 C  CG  . LYS B  2 38  ? -3.757  42.982 -29.049 1.00 20.09  ? 38  LYS C CG  1 
ATOM   1058 C  CD  . LYS B  2 38  ? -3.830  43.124 -30.533 1.00 21.91  ? 38  LYS C CD  1 
ATOM   1059 C  CE  . LYS B  2 38  ? -3.931  41.779 -31.191 1.00 22.29  ? 38  LYS C CE  1 
ATOM   1060 N  NZ  . LYS B  2 38  ? -4.091  41.943 -32.675 1.00 23.88  ? 38  LYS C NZ  1 
ATOM   1061 N  N   . GLU B  2 39  ? -3.384  46.699 -26.291 1.00 18.22  ? 39  GLU C N   1 
ATOM   1062 C  CA  . GLU B  2 39  ? -2.744  47.879 -25.708 1.00 19.01  ? 39  GLU C CA  1 
ATOM   1063 C  C   . GLU B  2 39  ? -2.365  47.699 -24.266 1.00 18.14  ? 39  GLU C C   1 
ATOM   1064 O  O   . GLU B  2 39  ? -1.247  47.993 -23.834 1.00 19.43  ? 39  GLU C O   1 
ATOM   1065 C  CB  . GLU B  2 39  ? -3.616  49.140 -25.854 1.00 19.25  ? 39  GLU C CB  1 
ATOM   1066 C  CG  . GLU B  2 39  ? -2.774  50.403 -25.654 1.00 20.32  ? 39  GLU C CG  1 
ATOM   1067 C  CD  . GLU B  2 39  ? -3.555  51.689 -25.590 1.00 21.47  ? 39  GLU C CD  1 
ATOM   1068 O  OE1 . GLU B  2 39  ? -2.892  52.761 -25.473 1.00 21.87  ? 39  GLU C OE1 1 
ATOM   1069 O  OE2 . GLU B  2 39  ? -4.782  51.621 -25.693 1.00 22.10  ? 39  GLU C OE2 1 
ATOM   1070 N  N   . LEU B  2 40  ? -3.302  47.175 -23.481 1.00 17.47  ? 40  LEU C N   1 
ATOM   1071 C  CA  . LEU B  2 40  ? -3.001  46.877 -22.081 1.00 16.29  ? 40  LEU C CA  1 
ATOM   1072 C  C   . LEU B  2 40  ? -1.781  45.973 -21.952 1.00 16.57  ? 40  LEU C C   1 
ATOM   1073 O  O   . LEU B  2 40  ? -0.881  46.191 -21.116 1.00 16.03  ? 40  LEU C O   1 
ATOM   1074 C  CB  . LEU B  2 40  ? -4.225  46.259 -21.433 1.00 15.78  ? 40  LEU C CB  1 
ATOM   1075 C  CG  . LEU B  2 40  ? -4.223  46.006 -19.937 1.00 15.39  ? 40  LEU C CG  1 
ATOM   1076 C  CD1 . LEU B  2 40  ? -5.670  45.878 -19.438 1.00 17.06  ? 40  LEU C CD1 1 
ATOM   1077 C  CD2 . LEU B  2 40  ? -3.347  44.813 -19.518 1.00 16.88  ? 40  LEU C CD2 1 
ATOM   1078 N  N   . VAL B  2 41  ? -1.778  44.910 -22.702 1.00 17.37  ? 41  VAL C N   1 
ATOM   1079 C  CA  . VAL B  2 41  ? -0.729  43.903 -22.572 1.00 18.22  ? 41  VAL C CA  1 
ATOM   1080 C  C   . VAL B  2 41  ? 0.618   44.468 -23.008 1.00 19.00  ? 41  VAL C C   1 
ATOM   1081 O  O   . VAL B  2 41  ? 1.634   44.262 -22.320 1.00 18.71  ? 41  VAL C O   1 
ATOM   1082 C  CB  . VAL B  2 41  ? -1.075  42.663 -23.403 1.00 18.46  ? 41  VAL C CB  1 
ATOM   1083 C  CG1 . VAL B  2 41  ? 0.186   41.791 -23.533 1.00 19.70  ? 41  VAL C CG1 1 
ATOM   1084 C  CG2 . VAL B  2 41  ? -2.262  41.904 -22.795 1.00 18.58  ? 41  VAL C CG2 1 
ATOM   1085 N  N   . ARG B  2 42  ? 0.579   45.271 -24.070 1.00 19.92  ? 42  ARG C N   1 
ATOM   1086 C  CA  . ARG B  2 42  ? 1.773   45.915 -24.642 1.00 21.18  ? 42  ARG C CA  1 
ATOM   1087 C  C   . ARG B  2 42  ? 2.424   46.878 -23.661 1.00 20.59  ? 42  ARG C C   1 
ATOM   1088 O  O   . ARG B  2 42  ? 3.672   46.949 -23.522 1.00 21.74  ? 42  ARG C O   1 
ATOM   1089 C  CB  . ARG B  2 42  ? 1.431   46.672 -25.938 1.00 21.93  ? 42  ARG C CB  1 
ATOM   1090 C  CG  . ARG B  2 42  ? 2.599   47.400 -26.571 1.00 23.86  ? 42  ARG C CG  1 
ATOM   1091 C  CD  . ARG B  2 42  ? 2.253   47.834 -27.974 1.00 24.08  ? 42  ARG C CD  1 
ATOM   1092 N  NE  . ARG B  2 42  ? 1.103   48.733 -28.088 1.00 23.66  ? 42  ARG C NE  1 
ATOM   1093 C  CZ  . ARG B  2 42  ? 1.170   50.062 -27.983 1.00 24.77  ? 42  ARG C CZ  1 
ATOM   1094 N  NH1 . ARG B  2 42  ? 0.057   50.775 -28.105 1.00 25.62  ? 42  ARG C NH1 1 
ATOM   1095 N  NH2 . ARG B  2 42  ? 2.304   50.690 -27.657 1.00 25.89  ? 42  ARG C NH2 1 
ATOM   1096 N  N   . LYS B  2 43  ? 1.572   47.652 -23.001 1.00 20.43  ? 43  LYS C N   1 
ATOM   1097 C  CA  . LYS B  2 43  ? 2.057   48.689 -22.067 1.00 21.09  ? 43  LYS C CA  1 
ATOM   1098 C  C   . LYS B  2 43  ? 2.216   48.199 -20.659 1.00 20.91  ? 43  LYS C C   1 
ATOM   1099 O  O   . LYS B  2 43  ? 3.306   48.269 -20.104 1.00 22.08  ? 43  LYS C O   1 
ATOM   1100 C  CB  . LYS B  2 43  ? 1.168   49.905 -22.106 1.00 20.73  ? 43  LYS C CB  1 
ATOM   1101 C  CG  . LYS B  2 43  ? 1.134   50.578 -23.470 1.00 21.87  ? 43  LYS C CG  1 
ATOM   1102 C  CD  . LYS B  2 43  ? 0.228   51.788 -23.497 1.00 21.81  ? 43  LYS C CD  1 
ATOM   1103 C  CE  . LYS B  2 43  ? 0.498   52.580 -24.755 1.00 23.06  ? 43  LYS C CE  1 
ATOM   1104 N  NZ  . LYS B  2 43  ? -0.443  53.735 -25.004 1.00 22.77  ? 43  LYS C NZ  1 
ATOM   1105 N  N   . ASP B  2 44  ? 1.147   47.691 -20.054 1.00 19.36  ? 44  ASP C N   1 
ATOM   1106 C  CA  . ASP B  2 44  ? 1.192   47.385 -18.636 1.00 19.25  ? 44  ASP C CA  1 
ATOM   1107 C  C   . ASP B  2 44  ? 1.731   45.993 -18.283 1.00 18.27  ? 44  ASP C C   1 
ATOM   1108 O  O   . ASP B  2 44  ? 1.982   45.733 -17.117 1.00 18.98  ? 44  ASP C O   1 
ATOM   1109 C  CB  . ASP B  2 44  ? -0.184  47.661 -18.030 1.00 19.60  ? 44  ASP C CB  1 
ATOM   1110 C  CG  . ASP B  2 44  ? -0.585  49.085 -18.237 1.00 22.06  ? 44  ASP C CG  1 
ATOM   1111 O  OD1 . ASP B  2 44  ? 0.109   49.941 -17.655 1.00 22.26  ? 44  ASP C OD1 1 
ATOM   1112 O  OD2 . ASP B  2 44  ? -1.455  49.315 -19.129 1.00 24.57  ? 44  ASP C OD2 1 
ATOM   1113 N  N   . LEU B  2 45  ? 1.843   45.120 -19.289 1.00 17.71  ? 45  LEU C N   1 
ATOM   1114 C  CA  . LEU B  2 45  ? 2.438   43.801 -19.115 1.00 18.65  ? 45  LEU C CA  1 
ATOM   1115 C  C   . LEU B  2 45  ? 3.661   43.668 -20.038 1.00 19.08  ? 45  LEU C C   1 
ATOM   1116 O  O   . LEU B  2 45  ? 4.054   42.582 -20.431 1.00 19.85  ? 45  LEU C O   1 
ATOM   1117 C  CB  . LEU B  2 45  ? 1.420   42.672 -19.293 1.00 18.13  ? 45  LEU C CB  1 
ATOM   1118 C  CG  . LEU B  2 45  ? 0.277   42.700 -18.245 1.00 17.69  ? 45  LEU C CG  1 
ATOM   1119 C  CD1 . LEU B  2 45  ? -0.862  41.749 -18.655 1.00 18.71  ? 45  LEU C CD1 1 
ATOM   1120 C  CD2 . LEU B  2 45  ? 0.748   42.433 -16.813 1.00 18.27  ? 45  LEU C CD2 1 
ATOM   1121 N  N   . GLN B  2 46  ? 4.313   44.798 -20.322 1.00 20.07  ? 46  GLN C N   1 
ATOM   1122 C  CA  . GLN B  2 46  ? 5.528   44.763 -21.146 1.00 21.41  ? 46  GLN C CA  1 
ATOM   1123 C  C   . GLN B  2 46  ? 6.662   43.884 -20.600 1.00 22.14  ? 46  GLN C C   1 
ATOM   1124 O  O   . GLN B  2 46  ? 7.463   43.394 -21.360 1.00 23.58  ? 46  GLN C O   1 
ATOM   1125 C  CB  . GLN B  2 46  ? 6.046   46.178 -21.397 1.00 22.72  ? 46  GLN C CB  1 
ATOM   1126 C  CG  . GLN B  2 46  ? 6.545   46.878 -20.155 1.00 22.73  ? 46  GLN C CG  1 
ATOM   1127 C  CD  . GLN B  2 46  ? 6.985   48.294 -20.462 1.00 25.17  ? 46  GLN C CD  1 
ATOM   1128 O  OE1 . GLN B  2 46  ? 8.157   48.521 -20.781 1.00 26.68  ? 46  GLN C OE1 1 
ATOM   1129 N  NE2 . GLN B  2 46  ? 6.048   49.233 -20.457 1.00 24.89  ? 46  GLN C NE2 1 
ATOM   1130 N  N   . ASN B  2 47  ? 6.750   43.689 -19.288 1.00 21.63  ? 47  ASN C N   1 
ATOM   1131 C  CA  . ASN B  2 47  ? 7.774   42.841 -18.756 1.00 22.27  ? 47  ASN C CA  1 
ATOM   1132 C  C   . ASN B  2 47  ? 7.282   41.420 -18.520 1.00 21.96  ? 47  ASN C C   1 
ATOM   1133 O  O   . ASN B  2 47  ? 7.945   40.474 -18.921 1.00 23.45  ? 47  ASN C O   1 
ATOM   1134 C  CB  . ASN B  2 47  ? 8.331   43.448 -17.494 1.00 21.53  ? 47  ASN C CB  1 
ATOM   1135 C  CG  . ASN B  2 47  ? 8.818   44.851 -17.728 1.00 22.64  ? 47  ASN C CG  1 
ATOM   1136 O  OD1 . ASN B  2 47  ? 9.792   45.045 -18.456 1.00 23.89  ? 47  ASN C OD1 1 
ATOM   1137 N  ND2 . ASN B  2 47  ? 8.135   45.837 -17.163 1.00 21.50  ? 47  ASN C ND2 1 
ATOM   1138 N  N   . PHE B  2 48  ? 6.117   41.279 -17.883 1.00 21.71  ? 48  PHE C N   1 
ATOM   1139 C  CA  . PHE B  2 48  ? 5.579   39.950 -17.546 1.00 20.50  ? 48  PHE C CA  1 
ATOM   1140 C  C   . PHE B  2 48  ? 5.280   39.119 -18.802 1.00 21.54  ? 48  PHE C C   1 
ATOM   1141 O  O   . PHE B  2 48  ? 5.428   37.885 -18.794 1.00 22.64  ? 48  PHE C O   1 
ATOM   1142 C  CB  . PHE B  2 48  ? 4.323   40.090 -16.625 1.00 19.38  ? 48  PHE C CB  1 
ATOM   1143 C  CG  . PHE B  2 48  ? 4.591   40.215 -15.144 1.00 19.03  ? 48  PHE C CG  1 
ATOM   1144 C  CD1 . PHE B  2 48  ? 5.776   40.715 -14.626 1.00 19.92  ? 48  PHE C CD1 1 
ATOM   1145 C  CD2 . PHE B  2 48  ? 3.592   39.838 -14.274 1.00 18.45  ? 48  PHE C CD2 1 
ATOM   1146 C  CE1 . PHE B  2 48  ? 5.942   40.812 -13.264 1.00 19.04  ? 48  PHE C CE1 1 
ATOM   1147 C  CE2 . PHE B  2 48  ? 3.769   39.947 -12.888 1.00 18.23  ? 48  PHE C CE2 1 
ATOM   1148 C  CZ  . PHE B  2 48  ? 4.947   40.406 -12.407 1.00 18.54  ? 48  PHE C CZ  1 
ATOM   1149 N  N   . LEU B  2 49  ? 4.852   39.802 -19.867 1.00 20.84  ? 49  LEU C N   1 
ATOM   1150 C  CA  . LEU B  2 49  ? 4.580   39.201 -21.166 1.00 21.42  ? 49  LEU C CA  1 
ATOM   1151 C  C   . LEU B  2 49  ? 5.549   39.707 -22.238 1.00 22.63  ? 49  LEU C C   1 
ATOM   1152 O  O   . LEU B  2 49  ? 5.152   39.943 -23.347 1.00 22.55  ? 49  LEU C O   1 
ATOM   1153 C  CB  . LEU B  2 49  ? 3.118   39.411 -21.579 1.00 19.90  ? 49  LEU C CB  1 
ATOM   1154 C  CG  . LEU B  2 49  ? 2.101   38.645 -20.727 1.00 20.20  ? 49  LEU C CG  1 
ATOM   1155 C  CD1 . LEU B  2 49  ? 0.671   39.093 -20.992 1.00 19.44  ? 49  LEU C CD1 1 
ATOM   1156 C  CD2 . LEU B  2 49  ? 2.267   37.140 -20.950 1.00 21.73  ? 49  LEU C CD2 1 
ATOM   1157 N  N   . LYS B  2 50  ? 6.816   39.866 -21.891 1.00 25.24  ? 50  LYS C N   1 
ATOM   1158 C  CA  . LYS B  2 50  ? 7.768   40.418 -22.802 1.00 27.24  ? 50  LYS C CA  1 
ATOM   1159 C  C   . LYS B  2 50  ? 7.909   39.550 -24.064 1.00 26.59  ? 50  LYS C C   1 
ATOM   1160 O  O   . LYS B  2 50  ? 7.930   40.046 -25.181 1.00 27.38  ? 50  LYS C O   1 
ATOM   1161 C  CB  . LYS B  2 50  ? 9.135   40.573 -22.121 1.00 30.46  ? 50  LYS C CB  1 
ATOM   1162 C  CG  . LYS B  2 50  ? 10.199  41.235 -23.000 1.00 33.22  ? 50  LYS C CG  1 
ATOM   1163 C  CD  . LYS B  2 50  ? 11.544  41.291 -22.277 1.00 37.05  ? 50  LYS C CD  1 
ATOM   1164 C  CE  . LYS B  2 50  ? 11.873  42.656 -21.679 1.00 40.45  ? 50  LYS C CE  1 
ATOM   1165 N  NZ  . LYS B  2 50  ? 11.023  43.153 -20.532 1.00 44.38  ? 50  LYS C NZ  1 
ATOM   1166 N  N   . LYS B  2 51  ? 8.057   38.250 -23.883 1.00 27.46  ? 51  LYS C N   1 
ATOM   1167 C  CA  . LYS B  2 51  ? 8.323   37.385 -25.043 1.00 29.45  ? 51  LYS C CA  1 
ATOM   1168 C  C   . LYS B  2 51  ? 7.045   37.276 -25.894 1.00 26.24  ? 51  LYS C C   1 
ATOM   1169 O  O   . LYS B  2 51  ? 7.052   37.343 -27.145 1.00 26.82  ? 51  LYS C O   1 
ATOM   1170 C  CB  . LYS B  2 51  ? 8.772   36.005 -24.563 1.00 32.83  ? 51  LYS C CB  1 
ATOM   1171 C  CG  . LYS B  2 51  ? 8.901   35.034 -25.717 1.00 36.48  ? 51  LYS C CG  1 
ATOM   1172 C  CD  . LYS B  2 51  ? 9.506   33.668 -25.404 1.00 41.05  ? 51  LYS C CD  1 
ATOM   1173 C  CE  . LYS B  2 51  ? 9.817   33.003 -26.761 1.00 43.52  ? 51  LYS C CE  1 
ATOM   1174 N  NZ  . LYS B  2 51  ? 10.723  31.827 -26.741 1.00 48.97  ? 51  LYS C NZ  1 
ATOM   1175 N  N   . GLU B  2 52  ? 5.921   37.151 -25.203 1.00 24.56  ? 52  GLU C N   1 
ATOM   1176 C  CA  . GLU B  2 52  ? 4.623   36.981 -25.855 1.00 22.76  ? 52  GLU C CA  1 
ATOM   1177 C  C   . GLU B  2 52  ? 4.232   38.221 -26.671 1.00 22.22  ? 52  GLU C C   1 
ATOM   1178 O  O   . GLU B  2 52  ? 3.697   38.122 -27.819 1.00 22.64  ? 52  GLU C O   1 
ATOM   1179 C  CB  . GLU B  2 52  ? 3.541   36.706 -24.793 1.00 21.80  ? 52  GLU C CB  1 
ATOM   1180 C  CG  . GLU B  2 52  ? 3.667   35.408 -24.030 1.00 23.30  ? 52  GLU C CG  1 
ATOM   1181 C  CD  . GLU B  2 52  ? 4.554   35.470 -22.777 1.00 25.02  ? 52  GLU C CD  1 
ATOM   1182 O  OE1 . GLU B  2 52  ? 5.340   36.420 -22.584 1.00 26.14  ? 52  GLU C OE1 1 
ATOM   1183 O  OE2 . GLU B  2 52  ? 4.518   34.512 -21.994 1.00 27.10  ? 52  GLU C OE2 1 
ATOM   1184 N  N   . ASN B  2 53  ? 4.588   39.386 -26.137 1.00 22.64  ? 53  ASN C N   1 
ATOM   1185 C  CA  . ASN B  2 53  ? 4.356   40.665 -26.806 1.00 22.91  ? 53  ASN C CA  1 
ATOM   1186 C  C   . ASN B  2 53  ? 5.073   40.737 -28.146 1.00 24.68  ? 53  ASN C C   1 
ATOM   1187 O  O   . ASN B  2 53  ? 4.679   41.520 -28.997 1.00 26.05  ? 53  ASN C O   1 
ATOM   1188 C  CB  . ASN B  2 53  ? 4.748   41.878 -25.922 1.00 23.71  ? 53  ASN C CB  1 
ATOM   1189 C  CG  . ASN B  2 53  ? 3.560   42.467 -25.170 1.00 23.15  ? 53  ASN C CG  1 
ATOM   1190 O  OD1 . ASN B  2 53  ? 2.541   42.813 -25.764 1.00 24.62  ? 53  ASN C OD1 1 
ATOM   1191 N  ND2 . ASN B  2 53  ? 3.713   42.625 -23.861 1.00 22.55  ? 53  ASN C ND2 1 
ATOM   1192 N  N   . LYS B  2 54  ? 6.123   39.947 -28.334 1.00 26.13  ? 54  LYS C N   1 
ATOM   1193 C  CA  . LYS B  2 54  ? 6.830   39.934 -29.625 1.00 27.99  ? 54  LYS C CA  1 
ATOM   1194 C  C   . LYS B  2 54  ? 6.044   39.238 -30.747 1.00 28.29  ? 54  LYS C C   1 
ATOM   1195 O  O   . LYS B  2 54  ? 6.390   39.361 -31.925 1.00 30.38  ? 54  LYS C O   1 
ATOM   1196 C  CB  . LYS B  2 54  ? 8.165   39.215 -29.490 1.00 30.46  ? 54  LYS C CB  1 
ATOM   1197 C  CG  . LYS B  2 54  ? 9.228   39.946 -28.703 1.00 33.22  ? 54  LYS C CG  1 
ATOM   1198 C  CD  . LYS B  2 54  ? 10.472  39.061 -28.533 1.00 37.06  ? 54  LYS C CD  1 
ATOM   1199 C  CE  . LYS B  2 54  ? 11.637  39.781 -27.852 1.00 39.72  ? 54  LYS C CE  1 
ATOM   1200 N  NZ  . LYS B  2 54  ? 12.745  40.097 -28.799 1.00 44.73  ? 54  LYS C NZ  1 
ATOM   1201 N  N   . ASN B  2 55  ? 5.016   38.485 -30.375 1.00 26.82  ? 55  ASN C N   1 
ATOM   1202 C  CA  . ASN B  2 55  ? 4.251   37.680 -31.327 1.00 27.42  ? 55  ASN C CA  1 
ATOM   1203 C  C   . ASN B  2 55  ? 2.755   38.019 -31.214 1.00 25.98  ? 55  ASN C C   1 
ATOM   1204 O  O   . ASN B  2 55  ? 2.053   37.542 -30.299 1.00 23.27  ? 55  ASN C O   1 
ATOM   1205 C  CB  . ASN B  2 55  ? 4.487   36.211 -31.021 1.00 28.35  ? 55  ASN C CB  1 
ATOM   1206 C  CG  . ASN B  2 55  ? 3.893   35.303 -32.052 1.00 30.69  ? 55  ASN C CG  1 
ATOM   1207 O  OD1 . ASN B  2 55  ? 2.894   35.644 -32.714 1.00 32.81  ? 55  ASN C OD1 1 
ATOM   1208 N  ND2 . ASN B  2 55  ? 4.553   34.158 -32.278 1.00 33.22  ? 55  ASN C ND2 1 
ATOM   1209 N  N   . GLU B  2 56  ? 2.272   38.876 -32.113 1.00 26.39  ? 56  GLU C N   1 
ATOM   1210 C  CA  . GLU B  2 56  ? 0.898   39.314 -32.034 1.00 26.94  ? 56  GLU C CA  1 
ATOM   1211 C  C   . GLU B  2 56  ? -0.104  38.140 -32.023 1.00 26.10  ? 56  GLU C C   1 
ATOM   1212 O  O   . GLU B  2 56  ? -1.152  38.222 -31.351 1.00 24.67  ? 56  GLU C O   1 
ATOM   1213 C  CB  . GLU B  2 56  ? 0.558   40.267 -33.161 1.00 29.42  ? 56  GLU C CB  1 
ATOM   1214 C  CG  . GLU B  2 56  ? -0.739  41.028 -32.944 1.00 29.48  ? 56  GLU C CG  1 
ATOM   1215 C  CD  . GLU B  2 56  ? -0.822  42.268 -33.807 1.00 33.14  ? 56  GLU C CD  1 
ATOM   1216 O  OE1 . GLU B  2 56  ? 0.111   42.497 -34.615 1.00 37.56  ? 56  GLU C OE1 1 
ATOM   1217 O  OE2 . GLU B  2 56  ? -1.831  42.999 -33.737 1.00 33.36  ? 56  GLU C OE2 1 
ATOM   1218 N  N   . LYS B  2 57  ? 0.205   37.060 -32.734 1.00 27.84  ? 57  LYS C N   1 
ATOM   1219 C  CA  . LYS B  2 57  ? -0.739  35.919 -32.779 1.00 27.93  ? 57  LYS C CA  1 
ATOM   1220 C  C   . LYS B  2 57  ? -0.795  35.192 -31.452 1.00 24.59  ? 57  LYS C C   1 
ATOM   1221 O  O   . LYS B  2 57  ? -1.840  34.632 -31.100 1.00 22.81  ? 57  LYS C O   1 
ATOM   1222 C  CB  . LYS B  2 57  ? -0.409  34.986 -33.933 1.00 31.90  ? 57  LYS C CB  1 
ATOM   1223 C  CG  . LYS B  2 57  ? -0.934  35.518 -35.254 1.00 36.45  ? 57  LYS C CG  1 
ATOM   1224 C  CD  . LYS B  2 57  ? -0.031  35.185 -36.403 1.00 41.83  ? 57  LYS C CD  1 
ATOM   1225 C  CE  . LYS B  2 57  ? 0.549   33.778 -36.372 1.00 43.58  ? 57  LYS C CE  1 
ATOM   1226 N  NZ  . LYS B  2 57  ? 1.798   33.724 -37.200 1.00 46.85  ? 57  LYS C NZ  1 
ATOM   1227 N  N   . VAL B  2 58  ? 0.301   35.231 -30.695 1.00 23.46  ? 58  VAL C N   1 
ATOM   1228 C  CA  . VAL B  2 58  ? 0.266   34.728 -29.322 1.00 21.07  ? 58  VAL C CA  1 
ATOM   1229 C  C   . VAL B  2 58  ? -0.701  35.523 -28.466 1.00 20.02  ? 58  VAL C C   1 
ATOM   1230 O  O   . VAL B  2 58  ? -1.535  34.964 -27.743 1.00 19.82  ? 58  VAL C O   1 
ATOM   1231 C  CB  . VAL B  2 58  ? 1.686   34.622 -28.706 1.00 21.98  ? 58  VAL C CB  1 
ATOM   1232 C  CG1 . VAL B  2 58  ? 1.598   34.358 -27.207 1.00 20.54  ? 58  VAL C CG1 1 
ATOM   1233 C  CG2 . VAL B  2 58  ? 2.476   33.461 -29.312 1.00 23.69  ? 58  VAL C CG2 1 
ATOM   1234 N  N   . ILE B  2 59  ? -0.559  36.844 -28.477 1.00 19.76  ? 59  ILE C N   1 
ATOM   1235 C  CA  . ILE B  2 59  ? -1.495  37.693 -27.750 1.00 17.62  ? 59  ILE C CA  1 
ATOM   1236 C  C   . ILE B  2 59  ? -2.959  37.471 -28.191 1.00 17.92  ? 59  ILE C C   1 
ATOM   1237 O  O   . ILE B  2 59  ? -3.861  37.442 -27.341 1.00 17.85  ? 59  ILE C O   1 
ATOM   1238 C  CB  . ILE B  2 59  ? -1.127  39.180 -27.892 1.00 18.35  ? 59  ILE C CB  1 
ATOM   1239 C  CG1 . ILE B  2 59  ? 0.327   39.398 -27.470 1.00 18.85  ? 59  ILE C CG1 1 
ATOM   1240 C  CG2 . ILE B  2 59  ? -2.158  40.114 -27.217 1.00 18.53  ? 59  ILE C CG2 1 
ATOM   1241 C  CD1 . ILE B  2 59  ? 0.648   38.833 -26.106 1.00 18.55  ? 59  ILE C CD1 1 
ATOM   1242 N  N   . GLU B  2 60  ? -3.196  37.278 -29.487 1.00 19.93  ? 60  GLU C N   1 
ATOM   1243 C  CA  . GLU B  2 60  ? -4.571  36.977 -29.960 1.00 20.34  ? 60  GLU C CA  1 
ATOM   1244 C  C   . GLU B  2 60  ? -5.085  35.639 -29.373 1.00 19.98  ? 60  GLU C C   1 
ATOM   1245 O  O   . GLU B  2 60  ? -6.238  35.519 -29.023 1.00 20.68  ? 60  GLU C O   1 
ATOM   1246 C  CB  . GLU B  2 60  ? -4.627  37.007 -31.475 1.00 23.13  ? 60  GLU C CB  1 
ATOM   1247 C  CG  . GLU B  2 60  ? -4.505  38.423 -32.064 1.00 24.41  ? 60  GLU C CG  1 
ATOM   1248 C  CD  . GLU B  2 60  ? -4.257  38.446 -33.543 1.00 27.75  ? 60  GLU C CD  1 
ATOM   1249 O  OE1 . GLU B  2 60  ? -4.279  37.361 -34.177 1.00 29.74  ? 60  GLU C OE1 1 
ATOM   1250 O  OE2 . GLU B  2 60  ? -4.066  39.552 -34.126 1.00 28.43  ? 60  GLU C OE2 1 
ATOM   1251 N  N   . HIS B  2 61  ? -4.199  34.668 -29.203 1.00 20.50  ? 61  HIS C N   1 
ATOM   1252 C  CA  . HIS B  2 61  ? -4.574  33.369 -28.704 1.00 20.57  ? 61  HIS C CA  1 
ATOM   1253 C  C   . HIS B  2 61  ? -4.867  33.507 -27.239 1.00 18.62  ? 61  HIS C C   1 
ATOM   1254 O  O   . HIS B  2 61  ? -5.794  32.861 -26.748 1.00 17.63  ? 61  HIS C O   1 
ATOM   1255 C  CB  . HIS B  2 61  ? -3.473  32.302 -28.909 1.00 22.85  ? 61  HIS C CB  1 
ATOM   1256 C  CG  . HIS B  2 61  ? -3.660  31.052 -28.002 1.00 25.01  ? 61  HIS C CG  1 
ATOM   1257 N  ND1 . HIS B  2 61  ? -4.502  30.040 -28.315 1.00 28.32  ? 61  HIS C ND1 1 
ATOM   1258 C  CD2 . HIS B  2 61  ? -3.130  30.742 -26.732 1.00 25.81  ? 61  HIS C CD2 1 
ATOM   1259 C  CE1 . HIS B  2 61  ? -4.512  29.122 -27.319 1.00 28.01  ? 61  HIS C CE1 1 
ATOM   1260 N  NE2 . HIS B  2 61  ? -3.679  29.546 -26.341 1.00 27.86  ? 61  HIS C NE2 1 
ATOM   1261 N  N   . ILE B  2 62  ? -4.061  34.303 -26.505 1.00 17.95  ? 62  ILE C N   1 
ATOM   1262 C  CA  . ILE B  2 62  ? -4.304  34.533 -25.076 1.00 17.48  ? 62  ILE C CA  1 
ATOM   1263 C  C   . ILE B  2 62  ? -5.685  35.112 -24.930 1.00 16.91  ? 62  ILE C C   1 
ATOM   1264 O  O   . ILE B  2 62  ? -6.449  34.675 -24.095 1.00 16.62  ? 62  ILE C O   1 
ATOM   1265 C  CB  . ILE B  2 62  ? -3.235  35.379 -24.372 1.00 16.50  ? 62  ILE C CB  1 
ATOM   1266 C  CG1 . ILE B  2 62  ? -1.931  34.596 -24.327 1.00 17.80  ? 62  ILE C CG1 1 
ATOM   1267 C  CG2 . ILE B  2 62  ? -3.670  35.793 -22.925 1.00 16.75  ? 62  ILE C CG2 1 
ATOM   1268 C  CD1 . ILE B  2 62  ? -0.737  35.493 -24.040 1.00 18.76  ? 62  ILE C CD1 1 
ATOM   1269 N  N   . MET B  2 63  ? -6.030  36.115 -25.717 1.00 17.37  ? 63  MET C N   1 
ATOM   1270 C  CA  A MET B  2 63  ? -7.362  36.673 -25.586 0.50 17.03  ? 63  MET C CA  1 
ATOM   1271 C  CA  B MET B  2 63  ? -7.365  36.699 -25.622 0.50 17.53  ? 63  MET C CA  1 
ATOM   1272 C  C   . MET B  2 63  ? -8.480  35.657 -25.920 1.00 17.36  ? 63  MET C C   1 
ATOM   1273 O  O   . MET B  2 63  ? -9.492  35.557 -25.183 1.00 16.86  ? 63  MET C O   1 
ATOM   1274 C  CB  A MET B  2 63  ? -7.556  37.880 -26.425 0.50 17.93  ? 63  MET C CB  1 
ATOM   1275 C  CB  B MET B  2 63  ? -7.487  37.881 -26.546 0.50 19.24  ? 63  MET C CB  1 
ATOM   1276 C  CG  A MET B  2 63  ? -8.983  38.323 -26.285 0.50 18.42  ? 63  MET C CG  1 
ATOM   1277 C  CG  B MET B  2 63  ? -8.918  38.230 -26.871 0.50 21.12  ? 63  MET C CG  1 
ATOM   1278 S  SD  A MET B  2 63  ? -9.098  40.036 -26.436 0.50 23.57  ? 63  MET C SD  1 
ATOM   1279 S  SD  B MET B  2 63  ? -8.974  39.855 -27.552 0.50 23.70  ? 63  MET C SD  1 
ATOM   1280 C  CE  A MET B  2 63  ? -10.776 40.267 -27.046 0.50 19.64  ? 63  MET C CE  1 
ATOM   1281 C  CE  B MET B  2 63  ? -9.698  40.643 -26.115 0.50 22.79  ? 63  MET C CE  1 
ATOM   1282 N  N   . GLU B  2 64  ? -8.288  34.870 -26.940 1.00 17.95  ? 64  GLU C N   1 
ATOM   1283 C  CA  . GLU B  2 64  ? -9.287  33.855 -27.306 1.00 19.04  ? 64  GLU C CA  1 
ATOM   1284 C  C   . GLU B  2 64  ? -9.479  32.851 -26.183 1.00 18.13  ? 64  GLU C C   1 
ATOM   1285 O  O   . GLU B  2 64  ? -10.612 32.476 -25.859 1.00 17.56  ? 64  GLU C O   1 
ATOM   1286 C  CB  . GLU B  2 64  ? -8.884  33.113 -28.587 1.00 22.12  ? 64  GLU C CB  1 
ATOM   1287 C  CG  . GLU B  2 64  ? -9.929  32.114 -29.035 1.00 26.95  ? 64  GLU C CG  1 
ATOM   1288 C  CD  . GLU B  2 64  ? -9.558  31.443 -30.339 1.00 30.85  ? 64  GLU C CD  1 
ATOM   1289 O  OE1 . GLU B  2 64  ? -10.430 30.793 -30.978 1.00 37.79  ? 64  GLU C OE1 1 
ATOM   1290 O  OE2 . GLU B  2 64  ? -8.378  31.600 -30.723 1.00 34.20  ? 64  GLU C OE2 1 
ATOM   1291 N  N   . ASP B  2 65  ? -8.386  32.477 -25.535 1.00 17.30  ? 65  ASP C N   1 
ATOM   1292 C  CA  . ASP B  2 65  ? -8.428  31.568 -24.395 1.00 17.99  ? 65  ASP C CA  1 
ATOM   1293 C  C   . ASP B  2 65  ? -9.267  32.164 -23.261 1.00 15.69  ? 65  ASP C C   1 
ATOM   1294 O  O   . ASP B  2 65  ? -10.073 31.477 -22.632 1.00 16.07  ? 65  ASP C O   1 
ATOM   1295 C  CB  . ASP B  2 65  ? -6.971  31.266 -23.922 1.00 19.05  ? 65  ASP C CB  1 
ATOM   1296 C  CG  . ASP B  2 65  ? -6.904  30.264 -22.814 1.00 22.73  ? 65  ASP C CG  1 
ATOM   1297 O  OD1 . ASP B  2 65  ? -7.562  29.234 -22.834 1.00 27.38  ? 65  ASP C OD1 1 
ATOM   1298 O  OD2 . ASP B  2 65  ? -6.165  30.533 -21.866 1.00 27.47  ? 65  ASP C OD2 1 
ATOM   1299 N  N   . LEU B  2 66  ? -9.071  33.443 -22.991 1.00 14.46  ? 66  LEU C N   1 
ATOM   1300 C  CA  . LEU B  2 66  ? -9.690  34.049 -21.822 1.00 14.04  ? 66  LEU C CA  1 
ATOM   1301 C  C   . LEU B  2 66  ? -11.141 34.382 -22.084 1.00 13.84  ? 66  LEU C C   1 
ATOM   1302 O  O   . LEU B  2 66  ? -11.914 34.582 -21.126 1.00 14.73  ? 66  LEU C O   1 
ATOM   1303 C  CB  . LEU B  2 66  ? -8.965  35.332 -21.463 1.00 14.85  ? 66  LEU C CB  1 
ATOM   1304 C  CG  . LEU B  2 66  ? -7.540  35.224 -20.911 1.00 14.01  ? 66  LEU C CG  1 
ATOM   1305 C  CD1 . LEU B  2 66  ? -6.875  36.594 -21.042 1.00 14.16  ? 66  LEU C CD1 1 
ATOM   1306 C  CD2 . LEU B  2 66  ? -7.613  34.714 -19.500 1.00 15.97  ? 66  LEU C CD2 1 
ATOM   1307 N  N   . ASP B  2 67  ? -11.518 34.485 -23.373 1.00 14.23  ? 67  ASP C N   1 
ATOM   1308 C  CA  . ASP B  2 67  ? -12.871 34.872 -23.759 1.00 14.98  ? 67  ASP C CA  1 
ATOM   1309 C  C   . ASP B  2 67  ? -13.870 33.721 -23.643 1.00 15.47  ? 67  ASP C C   1 
ATOM   1310 O  O   . ASP B  2 67  ? -14.292 33.141 -24.657 1.00 16.94  ? 67  ASP C O   1 
ATOM   1311 C  CB  . ASP B  2 67  ? -12.837 35.377 -25.162 1.00 15.68  ? 67  ASP C CB  1 
ATOM   1312 C  CG  . ASP B  2 67  ? -14.187 35.872 -25.632 1.00 16.90  ? 67  ASP C CG  1 
ATOM   1313 O  OD1 . ASP B  2 67  ? -15.095 36.174 -24.789 1.00 17.03  ? 67  ASP C OD1 1 
ATOM   1314 O  OD2 . ASP B  2 67  ? -14.346 35.968 -26.882 1.00 18.54  ? 67  ASP C OD2 1 
ATOM   1315 N  N   A THR B  2 68  ? -14.302 33.414 -22.425 0.46 15.90  ? 68  THR C N   1 
ATOM   1316 N  N   B THR B  2 68  ? -14.256 33.506 -22.385 0.54 15.87  ? 68  THR C N   1 
ATOM   1317 C  CA  A THR B  2 68  ? -15.085 32.193 -22.195 0.46 16.95  ? 68  THR C CA  1 
ATOM   1318 C  CA  B THR B  2 68  ? -15.053 32.388 -21.936 0.54 17.02  ? 68  THR C CA  1 
ATOM   1319 C  C   A THR B  2 68  ? -16.493 32.247 -22.733 0.46 18.27  ? 68  THR C C   1 
ATOM   1320 C  C   B THR B  2 68  ? -16.387 32.295 -22.661 0.54 18.26  ? 68  THR C C   1 
ATOM   1321 O  O   A THR B  2 68  ? -17.073 31.220 -23.096 0.46 19.63  ? 68  THR C O   1 
ATOM   1322 O  O   B THR B  2 68  ? -16.776 31.213 -23.079 0.54 20.04  ? 68  THR C O   1 
ATOM   1323 C  CB  A THR B  2 68  ? -15.119 31.832 -20.695 0.46 17.34  ? 68  THR C CB  1 
ATOM   1324 C  CB  B THR B  2 68  ? -15.284 32.503 -20.396 0.54 17.11  ? 68  THR C CB  1 
ATOM   1325 O  OG1 A THR B  2 68  ? -15.515 32.964 -19.922 0.46 17.23  ? 68  THR C OG1 1 
ATOM   1326 O  OG1 B THR B  2 68  ? -14.018 32.584 -19.684 0.54 16.73  ? 68  THR C OG1 1 
ATOM   1327 C  CG2 A THR B  2 68  ? -13.736 31.407 -20.243 0.46 17.29  ? 68  THR C CG2 1 
ATOM   1328 C  CG2 B THR B  2 68  ? -16.057 31.341 -19.898 0.54 17.98  ? 68  THR C CG2 1 
ATOM   1329 N  N   . ASN B  2 69  ? -17.080 33.429 -22.825 1.00 18.75  ? 69  ASN C N   1 
ATOM   1330 C  CA  . ASN B  2 69  ? -18.413 33.460 -23.455 1.00 20.88  ? 69  ASN C CA  1 
ATOM   1331 C  C   . ASN B  2 69  ? -18.387 33.758 -24.944 1.00 22.27  ? 69  ASN C C   1 
ATOM   1332 O  O   . ASN B  2 69  ? -19.454 34.032 -25.535 1.00 24.49  ? 69  ASN C O   1 
ATOM   1333 C  CB  . ASN B  2 69  ? -19.319 34.430 -22.702 1.00 21.80  ? 69  ASN C CB  1 
ATOM   1334 C  CG  . ASN B  2 69  ? -18.952 35.862 -22.919 1.00 22.25  ? 69  ASN C CG  1 
ATOM   1335 O  OD1 . ASN B  2 69  ? -17.969 36.208 -23.587 1.00 21.44  ? 69  ASN C OD1 1 
ATOM   1336 N  ND2 . ASN B  2 69  ? -19.755 36.750 -22.315 1.00 26.00  ? 69  ASN C ND2 1 
ATOM   1337 N  N   . ALA B  2 70  ? -17.182 33.779 -25.542 1.00 21.43  ? 70  ALA C N   1 
ATOM   1338 C  CA  . ALA B  2 70  ? -16.981 33.819 -27.002 1.00 23.76  ? 70  ALA C CA  1 
ATOM   1339 C  C   . ALA B  2 70  ? -17.590 35.039 -27.752 1.00 25.65  ? 70  ALA C C   1 
ATOM   1340 O  O   . ALA B  2 70  ? -18.049 34.963 -28.940 1.00 28.05  ? 70  ALA C O   1 
ATOM   1341 C  CB  . ALA B  2 70  ? -17.452 32.499 -27.654 1.00 23.98  ? 70  ALA C CB  1 
ATOM   1342 N  N   . ASP B  2 71  ? -17.637 36.183 -27.070 1.00 25.40  ? 71  ASP C N   1 
ATOM   1343 C  CA  . ASP B  2 71  ? -18.205 37.392 -27.631 1.00 26.17  ? 71  ASP C CA  1 
ATOM   1344 C  C   . ASP B  2 71  ? -17.161 38.344 -28.206 1.00 27.32  ? 71  ASP C C   1 
ATOM   1345 O  O   . ASP B  2 71  ? -17.464 39.494 -28.549 1.00 28.97  ? 71  ASP C O   1 
ATOM   1346 C  CB  . ASP B  2 71  ? -19.142 38.109 -26.623 1.00 26.38  ? 71  ASP C CB  1 
ATOM   1347 C  CG  . ASP B  2 71  ? -18.428 38.663 -25.438 1.00 26.05  ? 71  ASP C CG  1 
ATOM   1348 O  OD1 . ASP B  2 71  ? -17.197 38.428 -25.309 1.00 23.97  ? 71  ASP C OD1 1 
ATOM   1349 O  OD2 . ASP B  2 71  ? -19.105 39.323 -24.614 1.00 26.54  ? 71  ASP C OD2 1 
ATOM   1350 N  N   . LYS B  2 72  ? -15.912 37.876 -28.286 1.00 26.38  ? 72  LYS C N   1 
ATOM   1351 C  CA  . LYS B  2 72  ? -14.780 38.650 -28.766 1.00 26.56  ? 72  LYS C CA  1 
ATOM   1352 C  C   . LYS B  2 72  ? -14.436 39.877 -27.914 1.00 24.83  ? 72  LYS C C   1 
ATOM   1353 O  O   . LYS B  2 72  ? -13.783 40.789 -28.398 1.00 26.21  ? 72  LYS C O   1 
ATOM   1354 C  CB  . LYS B  2 72  ? -14.982 39.101 -30.223 1.00 29.81  ? 72  LYS C CB  1 
ATOM   1355 C  CG  . LYS B  2 72  ? -15.787 38.115 -31.017 1.00 33.67  ? 72  LYS C CG  1 
ATOM   1356 C  CD  . LYS B  2 72  ? -15.055 36.838 -31.250 1.00 35.10  ? 72  LYS C CD  1 
ATOM   1357 C  CE  . LYS B  2 72  ? -15.779 36.094 -32.392 1.00 39.90  ? 72  LYS C CE  1 
ATOM   1358 N  NZ  . LYS B  2 72  ? -14.902 35.144 -33.133 1.00 43.63  ? 72  LYS C NZ  1 
ATOM   1359 N  N   A GLN B  2 73  ? -14.856 39.863 -26.653 0.17 22.26  ? 73  GLN C N   1 
ATOM   1360 N  N   B GLN B  2 73  ? -14.897 39.881 -26.659 0.83 22.61  ? 73  GLN C N   1 
ATOM   1361 C  CA  A GLN B  2 73  ? -14.521 40.911 -25.706 0.17 20.78  ? 73  GLN C CA  1 
ATOM   1362 C  CA  B GLN B  2 73  ? -14.645 40.940 -25.667 0.83 22.62  ? 73  GLN C CA  1 
ATOM   1363 C  C   A GLN B  2 73  ? -14.263 40.283 -24.364 0.17 19.05  ? 73  GLN C C   1 
ATOM   1364 C  C   B GLN B  2 73  ? -14.175 40.231 -24.421 0.83 19.87  ? 73  GLN C C   1 
ATOM   1365 O  O   A GLN B  2 73  ? -14.888 39.283 -24.004 0.17 18.63  ? 73  GLN C O   1 
ATOM   1366 O  O   B GLN B  2 73  ? -14.540 39.060 -24.195 0.83 19.45  ? 73  GLN C O   1 
ATOM   1367 C  CB  A GLN B  2 73  ? -15.674 41.890 -25.537 0.17 20.46  ? 73  GLN C CB  1 
ATOM   1368 C  CB  B GLN B  2 73  ? -15.937 41.714 -25.309 0.83 23.09  ? 73  GLN C CB  1 
ATOM   1369 C  CG  A GLN B  2 73  ? -16.008 42.736 -26.741 0.17 21.43  ? 73  GLN C CG  1 
ATOM   1370 C  CG  B GLN B  2 73  ? -16.730 42.377 -26.434 0.83 25.71  ? 73  GLN C CG  1 
ATOM   1371 C  CD  A GLN B  2 73  ? -17.126 43.716 -26.419 0.17 21.33  ? 73  GLN C CD  1 
ATOM   1372 C  CD  B GLN B  2 73  ? -16.068 43.631 -26.980 0.83 27.30  ? 73  GLN C CD  1 
ATOM   1373 O  OE1 A GLN B  2 73  ? -17.899 43.496 -25.490 0.17 20.37  ? 73  GLN C OE1 1 
ATOM   1374 O  OE1 B GLN B  2 73  ? -16.036 43.862 -28.197 0.83 29.04  ? 73  GLN C OE1 1 
ATOM   1375 N  NE2 A GLN B  2 73  ? -17.205 44.805 -27.176 0.17 22.37  ? 73  GLN C NE2 1 
ATOM   1376 N  NE2 B GLN B  2 73  ? -15.521 44.442 -26.081 0.83 26.29  ? 73  GLN C NE2 1 
ATOM   1377 N  N   . LEU B  2 74  ? -13.365 40.890 -23.606 1.00 18.31  ? 74  LEU C N   1 
ATOM   1378 C  CA  . LEU B  2 74  ? -13.066 40.426 -22.236 1.00 16.20  ? 74  LEU C CA  1 
ATOM   1379 C  C   . LEU B  2 74  ? -13.808 41.259 -21.198 1.00 16.19  ? 74  LEU C C   1 
ATOM   1380 O  O   . LEU B  2 74  ? -13.550 42.456 -21.067 1.00 16.98  ? 74  LEU C O   1 
ATOM   1381 C  CB  . LEU B  2 74  ? -11.570 40.337 -21.930 1.00 15.78  ? 74  LEU C CB  1 
ATOM   1382 C  CG  . LEU B  2 74  ? -10.669 39.523 -22.838 1.00 16.49  ? 74  LEU C CG  1 
ATOM   1383 C  CD1 . LEU B  2 74  ? -9.232  39.565 -22.321 1.00 16.80  ? 74  LEU C CD1 1 
ATOM   1384 C  CD2 . LEU B  2 74  ? -11.141 38.068 -22.986 1.00 16.09  ? 74  LEU C CD2 1 
ATOM   1385 N  N   . SER B  2 75  ? -14.668 40.604 -20.432 1.00 15.45  ? 75  SER C N   1 
ATOM   1386 C  CA  . SER B  2 75  ? -15.235 41.176 -19.227 1.00 15.36  ? 75  SER C CA  1 
ATOM   1387 C  C   . SER B  2 75  ? -14.147 41.198 -18.193 1.00 14.79  ? 75  SER C C   1 
ATOM   1388 O  O   . SER B  2 75  ? -13.104 40.519 -18.329 1.00 14.70  ? 75  SER C O   1 
ATOM   1389 C  CB  . SER B  2 75  ? -16.406 40.327 -18.738 1.00 15.49  ? 75  SER C CB  1 
ATOM   1390 O  OG  . SER B  2 75  ? -15.986 38.999 -18.462 1.00 15.42  ? 75  SER C OG  1 
ATOM   1391 N  N   . PHE B  2 76  ? -14.429 41.904 -17.114 1.00 15.01  ? 76  PHE C N   1 
ATOM   1392 C  CA  . PHE B  2 76  ? -13.515 41.882 -15.989 1.00 14.44  ? 76  PHE C CA  1 
ATOM   1393 C  C   . PHE B  2 76  ? -13.350 40.433 -15.381 1.00 14.16  ? 76  PHE C C   1 
ATOM   1394 O  O   . PHE B  2 76  ? -12.223 39.999 -15.062 1.00 13.24  ? 76  PHE C O   1 
ATOM   1395 C  CB  . PHE B  2 76  ? -13.941 42.837 -14.862 1.00 15.56  ? 76  PHE C CB  1 
ATOM   1396 C  CG  . PHE B  2 76  ? -12.927 42.890 -13.762 1.00 15.25  ? 76  PHE C CG  1 
ATOM   1397 C  CD1 . PHE B  2 76  ? -11.807 43.689 -13.888 1.00 16.08  ? 76  PHE C CD1 1 
ATOM   1398 C  CD2 . PHE B  2 76  ? -13.003 42.053 -12.686 1.00 16.21  ? 76  PHE C CD2 1 
ATOM   1399 C  CE1 . PHE B  2 76  ? -10.805 43.682 -12.979 1.00 16.02  ? 76  PHE C CE1 1 
ATOM   1400 C  CE2 . PHE B  2 76  ? -12.047 42.096 -11.709 1.00 15.71  ? 76  PHE C CE2 1 
ATOM   1401 C  CZ  . PHE B  2 76  ? -10.924 42.879 -11.850 1.00 15.93  ? 76  PHE C CZ  1 
ATOM   1402 N  N   . GLU B  2 77  ? -14.472 39.725 -15.245 1.00 14.67  ? 77  GLU C N   1 
ATOM   1403 C  CA  . GLU B  2 77  ? -14.476 38.331 -14.810 1.00 14.51  ? 77  GLU C CA  1 
ATOM   1404 C  C   . GLU B  2 77  ? -13.532 37.468 -15.638 1.00 14.38  ? 77  GLU C C   1 
ATOM   1405 O  O   . GLU B  2 77  ? -12.777 36.679 -15.060 1.00 14.54  ? 77  GLU C O   1 
ATOM   1406 C  CB  . GLU B  2 77  ? -15.868 37.774 -14.857 1.00 15.50  ? 77  GLU C CB  1 
ATOM   1407 C  CG  . GLU B  2 77  ? -16.769 38.305 -13.752 1.00 17.05  ? 77  GLU C CG  1 
ATOM   1408 C  CD  . GLU B  2 77  ? -17.455 39.643 -14.081 1.00 18.52  ? 77  GLU C CD  1 
ATOM   1409 O  OE1 . GLU B  2 77  ? -17.206 40.290 -15.171 1.00 18.05  ? 77  GLU C OE1 1 
ATOM   1410 O  OE2 . GLU B  2 77  ? -18.327 40.008 -13.229 1.00 20.20  ? 77  GLU C OE2 1 
ATOM   1411 N  N   . GLU B  2 78  ? -13.538 37.668 -16.958 1.00 14.20  ? 78  GLU C N   1 
ATOM   1412 C  CA  . GLU B  2 78  ? -12.699 36.871 -17.845 1.00 14.37  ? 78  GLU C CA  1 
ATOM   1413 C  C   . GLU B  2 78  ? -11.244 37.308 -17.665 1.00 14.69  ? 78  GLU C C   1 
ATOM   1414 O  O   . GLU B  2 78  ? -10.340 36.487 -17.504 1.00 15.01  ? 78  GLU C O   1 
ATOM   1415 C  CB  . GLU B  2 78  ? -13.099 36.985 -19.294 1.00 15.04  ? 78  GLU C CB  1 
ATOM   1416 C  CG  . GLU B  2 78  ? -14.394 36.274 -19.607 1.00 15.51  ? 78  GLU C CG  1 
ATOM   1417 C  CD  . GLU B  2 78  ? -15.045 36.682 -20.913 1.00 17.76  ? 78  GLU C CD  1 
ATOM   1418 O  OE1 . GLU B  2 78  ? -14.762 37.769 -21.466 1.00 16.83  ? 78  GLU C OE1 1 
ATOM   1419 O  OE2 . GLU B  2 78  ? -15.902 35.946 -21.409 1.00 17.97  ? 78  GLU C OE2 1 
ATOM   1420 N  N   . PHE B  2 79  ? -11.045 38.621 -17.629 1.00 14.22  ? 79  PHE C N   1 
ATOM   1421 C  CA  . PHE B  2 79  ? -9.711  39.202 -17.533 1.00 14.71  ? 79  PHE C CA  1 
ATOM   1422 C  C   . PHE B  2 79  ? -8.985  38.802 -16.253 1.00 14.27  ? 79  PHE C C   1 
ATOM   1423 O  O   . PHE B  2 79  ? -7.768  38.627 -16.245 1.00 15.78  ? 79  PHE C O   1 
ATOM   1424 C  CB  . PHE B  2 79  ? -9.825  40.722 -17.639 1.00 14.82  ? 79  PHE C CB  1 
ATOM   1425 C  CG  . PHE B  2 79  ? -8.504  41.478 -17.460 1.00 15.28  ? 79  PHE C CG  1 
ATOM   1426 C  CD1 . PHE B  2 79  ? -7.531  41.531 -18.487 1.00 16.46  ? 79  PHE C CD1 1 
ATOM   1427 C  CD2 . PHE B  2 79  ? -8.268  42.142 -16.280 1.00 15.70  ? 79  PHE C CD2 1 
ATOM   1428 C  CE1 . PHE B  2 79  ? -6.363  42.271 -18.285 1.00 17.41  ? 79  PHE C CE1 1 
ATOM   1429 C  CE2 . PHE B  2 79  ? -7.088  42.831 -16.074 1.00 16.80  ? 79  PHE C CE2 1 
ATOM   1430 C  CZ  . PHE B  2 79  ? -6.133  42.883 -17.091 1.00 16.82  ? 79  PHE C CZ  1 
ATOM   1431 N  N   . ILE B  2 80  ? -9.690  38.730 -15.140 1.00 14.45  ? 80  ILE C N   1 
ATOM   1432 C  CA  . ILE B  2 80  ? -9.007  38.494 -13.878 1.00 14.19  ? 80  ILE C CA  1 
ATOM   1433 C  C   . ILE B  2 80  ? -8.295  37.146 -13.811 1.00 14.46  ? 80  ILE C C   1 
ATOM   1434 O  O   . ILE B  2 80  ? -7.359  36.995 -13.016 1.00 14.81  ? 80  ILE C O   1 
ATOM   1435 C  CB  . ILE B  2 80  ? -9.937  38.683 -12.632 1.00 14.97  ? 80  ILE C CB  1 
ATOM   1436 C  CG1 . ILE B  2 80  ? -9.089  38.860 -11.328 1.00 16.47  ? 80  ILE C CG1 1 
ATOM   1437 C  CG2 . ILE B  2 80  ? -10.969 37.554 -12.545 1.00 14.96  ? 80  ILE C CG2 1 
ATOM   1438 C  CD1 . ILE B  2 80  ? -9.705  39.583 -10.175 1.00 19.04  ? 80  ILE C CD1 1 
ATOM   1439 N  N   A MET B  2 81  ? -8.730  36.185 -14.615 0.50 14.58  ? 81  MET C N   1 
ATOM   1440 N  N   B MET B  2 81  ? -8.713  36.175 -14.633 0.50 14.03  ? 81  MET C N   1 
ATOM   1441 C  CA  A MET B  2 81  ? -7.996  34.925 -14.704 0.50 14.50  ? 81  MET C CA  1 
ATOM   1442 C  CA  B MET B  2 81  ? -7.973  34.886 -14.758 0.50 13.71  ? 81  MET C CA  1 
ATOM   1443 C  C   A MET B  2 81  ? -6.549  35.142 -15.177 0.50 14.39  ? 81  MET C C   1 
ATOM   1444 C  C   B MET B  2 81  ? -6.563  35.030 -15.345 0.50 13.80  ? 81  MET C C   1 
ATOM   1445 O  O   A MET B  2 81  ? -5.627  34.544 -14.606 0.50 14.92  ? 81  MET C O   1 
ATOM   1446 O  O   B MET B  2 81  ? -5.695  34.201 -15.149 0.50 14.13  ? 81  MET C O   1 
ATOM   1447 C  CB  A MET B  2 81  ? -8.777  33.962 -15.600 0.50 14.84  ? 81  MET C CB  1 
ATOM   1448 C  CB  B MET B  2 81  ? -8.766  33.905 -15.636 0.50 13.73  ? 81  MET C CB  1 
ATOM   1449 C  CG  A MET B  2 81  ? -10.175 33.738 -15.043 0.50 14.77  ? 81  MET C CG  1 
ATOM   1450 C  CG  B MET B  2 81  ? -9.852  33.146 -14.882 0.50 13.76  ? 81  MET C CG  1 
ATOM   1451 S  SD  A MET B  2 81  ? -10.193 33.339 -13.279 0.50 14.44  ? 81  MET C SD  1 
ATOM   1452 S  SD  B MET B  2 81  ? -9.336  31.952 -13.603 0.50 20.75  ? 81  MET C SD  1 
ATOM   1453 C  CE  A MET B  2 81  ? -10.433 31.565 -13.281 0.50 16.11  ? 81  MET C CE  1 
ATOM   1454 C  CE  B MET B  2 81  ? -10.948 31.402 -13.033 0.50 14.14  ? 81  MET C CE  1 
ATOM   1455 N  N   . LEU B  2 82  ? -6.353  36.065 -16.132 1.00 14.18  ? 82  LEU C N   1 
ATOM   1456 C  CA  . LEU B  2 82  ? -5.030  36.358 -16.646 1.00 14.60  ? 82  LEU C CA  1 
ATOM   1457 C  C   . LEU B  2 82  ? -4.203  36.891 -15.510 1.00 14.13  ? 82  LEU C C   1 
ATOM   1458 O  O   . LEU B  2 82  ? -2.991  36.544 -15.350 1.00 15.06  ? 82  LEU C O   1 
ATOM   1459 C  CB  . LEU B  2 82  ? -5.040  37.359 -17.817 1.00 15.01  ? 82  LEU C CB  1 
ATOM   1460 C  CG  . LEU B  2 82  ? -3.643  37.701 -18.328 1.00 15.66  ? 82  LEU C CG  1 
ATOM   1461 C  CD1 . LEU B  2 82  ? -2.863  36.475 -18.905 1.00 15.72  ? 82  LEU C CD1 1 
ATOM   1462 C  CD2 . LEU B  2 82  ? -3.746  38.831 -19.374 1.00 16.53  ? 82  LEU C CD2 1 
ATOM   1463 N  N   . MET B  2 83  ? -4.823  37.743 -14.675 1.00 14.34  ? 83  MET C N   1 
ATOM   1464 C  CA  . MET B  2 83  ? -4.092  38.303 -13.547 1.00 14.35  ? 83  MET C CA  1 
ATOM   1465 C  C   . MET B  2 83  ? -3.707  37.244 -12.505 1.00 15.27  ? 83  MET C C   1 
ATOM   1466 O  O   . MET B  2 83  ? -2.576  37.217 -12.050 1.00 14.22  ? 83  MET C O   1 
ATOM   1467 C  CB  . MET B  2 83  ? -4.893  39.399 -12.854 1.00 15.50  ? 83  MET C CB  1 
ATOM   1468 C  CG  . MET B  2 83  ? -5.322  40.542 -13.733 1.00 15.93  ? 83  MET C CG  1 
ATOM   1469 S  SD  . MET B  2 83  ? -3.975  41.581 -14.339 1.00 17.42  ? 83  MET C SD  1 
ATOM   1470 C  CE  . MET B  2 83  ? -3.574  40.851 -15.922 1.00 16.84  ? 83  MET C CE  1 
ATOM   1471 N  N   . ALA B  2 84  ? -4.602  36.285 -12.255 1.00 15.08  ? 84  ALA C N   1 
ATOM   1472 C  CA  . ALA B  2 84  ? -4.288  35.189 -11.393 1.00 15.36  ? 84  ALA C CA  1 
ATOM   1473 C  C   . ALA B  2 84  ? -3.176  34.339 -12.003 1.00 15.20  ? 84  ALA C C   1 
ATOM   1474 O  O   . ALA B  2 84  ? -2.241  33.927 -11.304 1.00 15.06  ? 84  ALA C O   1 
ATOM   1475 C  CB  . ALA B  2 84  ? -5.537  34.339 -11.155 1.00 16.67  ? 84  ALA C CB  1 
ATOM   1476 N  N   A ARG B  2 85  ? -3.258  34.070 -13.296 0.50 14.51  ? 85  ARG C N   1 
ATOM   1477 N  N   B ARG B  2 85  ? -3.263  34.070 -13.298 0.50 15.21  ? 85  ARG C N   1 
ATOM   1478 C  CA  A ARG B  2 85  ? -2.243  33.232 -13.932 0.50 15.37  ? 85  ARG C CA  1 
ATOM   1479 C  CA  B ARG B  2 85  ? -2.247  33.240 -13.950 0.50 16.64  ? 85  ARG C CA  1 
ATOM   1480 C  C   A ARG B  2 85  ? -0.839  33.831 -13.884 0.50 15.87  ? 85  ARG C C   1 
ATOM   1481 C  C   B ARG B  2 85  ? -0.842  33.832 -13.884 0.50 16.56  ? 85  ARG C C   1 
ATOM   1482 O  O   A ARG B  2 85  ? 0.153   33.119 -13.677 0.50 15.91  ? 85  ARG C O   1 
ATOM   1483 O  O   B ARG B  2 85  ? 0.146   33.118 -13.669 0.50 16.44  ? 85  ARG C O   1 
ATOM   1484 C  CB  A ARG B  2 85  ? -2.646  32.950 -15.371 0.50 16.22  ? 85  ARG C CB  1 
ATOM   1485 C  CB  B ARG B  2 85  ? -2.635  32.993 -15.404 0.50 18.87  ? 85  ARG C CB  1 
ATOM   1486 C  CG  A ARG B  2 85  ? -3.854  32.035 -15.453 0.50 17.10  ? 85  ARG C CG  1 
ATOM   1487 C  CG  B ARG B  2 85  ? -3.627  31.852 -15.549 0.50 21.73  ? 85  ARG C CG  1 
ATOM   1488 C  CD  A ARG B  2 85  ? -4.271  31.808 -16.901 0.50 18.41  ? 85  ARG C CD  1 
ATOM   1489 C  CD  B ARG B  2 85  ? -4.180  31.725 -16.968 0.50 24.79  ? 85  ARG C CD  1 
ATOM   1490 N  NE  A ARG B  2 85  ? -5.601  31.235 -16.991 0.50 18.32  ? 85  ARG C NE  1 
ATOM   1491 N  NE  B ARG B  2 85  ? -3.173  31.561 -18.025 0.50 27.32  ? 85  ARG C NE  1 
ATOM   1492 C  CZ  A ARG B  2 85  ? -6.265  31.066 -18.125 0.50 18.79  ? 85  ARG C CZ  1 
ATOM   1493 C  CZ  B ARG B  2 85  ? -2.021  32.224 -18.108 0.50 28.69  ? 85  ARG C CZ  1 
ATOM   1494 N  NH1 A ARG B  2 85  ? -7.459  30.539 -18.089 0.50 18.74  ? 85  ARG C NH1 1 
ATOM   1495 N  NH1 B ARG B  2 85  ? -1.667  33.088 -17.178 0.50 31.25  ? 85  ARG C NH1 1 
ATOM   1496 N  NH2 A ARG B  2 85  ? -5.715  31.428 -19.282 0.50 19.48  ? 85  ARG C NH2 1 
ATOM   1497 N  NH2 B ARG B  2 85  ? -1.205  31.999 -19.110 0.50 29.76  ? 85  ARG C NH2 1 
ATOM   1498 N  N   . LEU B  2 86  ? -0.762  35.145 -14.091 1.00 16.02  ? 86  LEU C N   1 
ATOM   1499 C  CA  . LEU B  2 86  ? 0.508   35.842 -14.097 1.00 16.89  ? 86  LEU C CA  1 
ATOM   1500 C  C   . LEU B  2 86  ? 1.070   35.961 -12.709 1.00 16.44  ? 86  LEU C C   1 
ATOM   1501 O  O   . LEU B  2 86  ? 2.273   35.884 -12.538 1.00 17.34  ? 86  LEU C O   1 
ATOM   1502 C  CB  . LEU B  2 86  ? 0.378   37.197 -14.810 1.00 17.45  ? 86  LEU C CB  1 
ATOM   1503 C  CG  . LEU B  2 86  ? 0.194   37.126 -16.329 1.00 17.93  ? 86  LEU C CG  1 
ATOM   1504 C  CD1 . LEU B  2 86  ? -0.127  38.539 -16.834 1.00 18.46  ? 86  LEU C CD1 1 
ATOM   1505 C  CD2 . LEU B  2 86  ? 1.346   36.497 -17.138 1.00 19.93  ? 86  LEU C CD2 1 
ATOM   1506 N  N   . THR B  2 87  ? 0.200   36.124 -11.727 1.00 15.48  ? 87  THR C N   1 
ATOM   1507 C  CA  . THR B  2 87  ? 0.647   36.208 -10.362 1.00 15.01  ? 87  THR C CA  1 
ATOM   1508 C  C   . THR B  2 87  ? 1.251   34.867 -10.013 1.00 14.88  ? 87  THR C C   1 
ATOM   1509 O  O   . THR B  2 87  ? 2.321   34.806 -9.375  1.00 15.80  ? 87  THR C O   1 
ATOM   1510 C  CB  . THR B  2 87  ? -0.501  36.558 -9.411  1.00 15.15  ? 87  THR C CB  1 
ATOM   1511 O  OG1 . THR B  2 87  ? -1.062  37.830 -9.767  1.00 16.39  ? 87  THR C OG1 1 
ATOM   1512 C  CG2 . THR B  2 87  ? -0.016  36.691 -8.008  1.00 15.33  ? 87  THR C CG2 1 
ATOM   1513 N  N   . TRP B  2 88  ? 0.530   33.794 -10.299 1.00 13.97  ? 88  TRP C N   1 
ATOM   1514 C  CA  . TRP B  2 88  ? 1.051   32.434 -10.133 1.00 14.96  ? 88  TRP C CA  1 
ATOM   1515 C  C   . TRP B  2 88  ? 2.390   32.268 -10.848 1.00 15.61  ? 88  TRP C C   1 
ATOM   1516 O  O   . TRP B  2 88  ? 3.354   31.754 -10.297 1.00 17.28  ? 88  TRP C O   1 
ATOM   1517 C  CB  . TRP B  2 88  ? 0.035   31.432 -10.716 1.00 16.27  ? 88  TRP C CB  1 
ATOM   1518 C  CG  . TRP B  2 88  ? 0.457   30.006 -10.706 1.00 18.47  ? 88  TRP C CG  1 
ATOM   1519 C  CD1 . TRP B  2 88  ? 0.884   29.226 -11.760 1.00 19.81  ? 88  TRP C CD1 1 
ATOM   1520 C  CD2 . TRP B  2 88  ? 0.548   29.158 -9.529  1.00 20.26  ? 88  TRP C CD2 1 
ATOM   1521 N  NE1 . TRP B  2 88  ? 1.227   27.964 -11.306 1.00 20.70  ? 88  TRP C NE1 1 
ATOM   1522 C  CE2 . TRP B  2 88  ? 1.060   27.878 -9.977  1.00 20.84  ? 88  TRP C CE2 1 
ATOM   1523 C  CE3 . TRP B  2 88  ? 0.310   29.361 -8.126  1.00 21.97  ? 88  TRP C CE3 1 
ATOM   1524 C  CZ2 . TRP B  2 88  ? 1.286   26.808 -9.083  1.00 24.52  ? 88  TRP C CZ2 1 
ATOM   1525 C  CZ3 . TRP B  2 88  ? 0.573   28.299 -7.234  1.00 23.39  ? 88  TRP C CZ3 1 
ATOM   1526 C  CH2 . TRP B  2 88  ? 1.041   27.049 -7.723  1.00 25.69  ? 88  TRP C CH2 1 
ATOM   1527 N  N   . ALA B  2 89  ? 2.439   32.592 -12.123 1.00 15.67  ? 89  ALA C N   1 
ATOM   1528 C  CA  . ALA B  2 89  ? 3.685   32.460 -12.917 1.00 16.19  ? 89  ALA C CA  1 
ATOM   1529 C  C   . ALA B  2 89  ? 4.906   33.197 -12.305 1.00 17.68  ? 89  ALA C C   1 
ATOM   1530 O  O   . ALA B  2 89  ? 6.042   32.695 -12.317 1.00 19.25  ? 89  ALA C O   1 
ATOM   1531 C  CB  . ALA B  2 89  ? 3.458   32.871 -14.397 1.00 16.49  ? 89  ALA C CB  1 
ATOM   1532 N  N   . SER B  2 90  ? 4.666   34.387 -11.798 1.00 17.07  ? 90  SER C N   1 
ATOM   1533 C  CA  . SER B  2 90  ? 5.697   35.157 -11.180 1.00 17.83  ? 90  SER C CA  1 
ATOM   1534 C  C   . SER B  2 90  ? 6.205   34.417 -9.942  1.00 17.92  ? 90  SER C C   1 
ATOM   1535 O  O   . SER B  2 90  ? 7.418   34.301 -9.741  1.00 19.40  ? 90  SER C O   1 
ATOM   1536 C  CB  . SER B  2 90  ? 5.267   36.596 -10.843 1.00 17.88  ? 90  SER C CB  1 
ATOM   1537 O  OG  . SER B  2 90  ? 6.421   37.396 -10.547 1.00 18.55  ? 90  SER C OG  1 
ATOM   1538 N  N   . HIS B  2 91  ? 5.286   33.898 -9.144  1.00 18.35  ? 91  HIS C N   1 
ATOM   1539 C  CA  . HIS B  2 91  ? 5.650   33.208 -7.925  1.00 18.12  ? 91  HIS C CA  1 
ATOM   1540 C  C   . HIS B  2 91  ? 6.421   31.937 -8.246  1.00 19.47  ? 91  HIS C C   1 
ATOM   1541 O  O   . HIS B  2 91  ? 7.408   31.603 -7.574  1.00 18.90  ? 91  HIS C O   1 
ATOM   1542 C  CB  . HIS B  2 91  ? 4.442   32.860 -7.123  1.00 18.06  ? 91  HIS C CB  1 
ATOM   1543 C  CG  . HIS B  2 91  ? 4.780   32.282 -5.764  1.00 18.66  ? 91  HIS C CG  1 
ATOM   1544 N  ND1 . HIS B  2 91  ? 4.303   31.081 -5.370  1.00 19.52  ? 91  HIS C ND1 1 
ATOM   1545 C  CD2 . HIS B  2 91  ? 5.614   32.742 -4.735  1.00 19.92  ? 91  HIS C CD2 1 
ATOM   1546 C  CE1 . HIS B  2 91  ? 4.780   30.819 -4.114  1.00 20.03  ? 91  HIS C CE1 1 
ATOM   1547 N  NE2 . HIS B  2 91  ? 5.584   31.831 -3.748  1.00 19.89  ? 91  HIS C NE2 1 
ATOM   1548 N  N   . GLU B  2 92  ? 5.970   31.233 -9.280  1.00 20.25  ? 92  GLU C N   1 
ATOM   1549 C  CA  . GLU B  2 92  ? 6.706   30.045 -9.782  1.00 21.79  ? 92  GLU C CA  1 
ATOM   1550 C  C   . GLU B  2 92  ? 8.137   30.407 -10.181 1.00 23.08  ? 92  GLU C C   1 
ATOM   1551 O  O   . GLU B  2 92  ? 9.095   29.660 -9.852  1.00 23.54  ? 92  GLU C O   1 
ATOM   1552 C  CB  . GLU B  2 92  ? 6.003   29.410 -10.987 1.00 21.61  ? 92  GLU C CB  1 
ATOM   1553 C  CG  . GLU B  2 92  ? 4.655   28.777 -10.679 1.00 22.71  ? 92  GLU C CG  1 
ATOM   1554 C  CD  . GLU B  2 92  ? 4.740   27.511 -9.869  1.00 25.78  ? 92  GLU C CD  1 
ATOM   1555 O  OE1 . GLU B  2 92  ? 5.045   26.438 -10.470 1.00 28.53  ? 92  GLU C OE1 1 
ATOM   1556 O  OE2 . GLU B  2 92  ? 4.512   27.574 -8.618  1.00 28.99  ? 92  GLU C OE2 1 
ATOM   1557 N  N   . LYS B  2 93  ? 8.291   31.553 -10.842 1.00 22.52  ? 93  LYS C N   1 
ATOM   1558 C  CA  . LYS B  2 93  ? 9.602   32.028 -11.279 1.00 23.65  ? 93  LYS C CA  1 
ATOM   1559 C  C   . LYS B  2 93  ? 10.455  32.268 -10.054 1.00 23.05  ? 93  LYS C C   1 
ATOM   1560 O  O   . LYS B  2 93  ? 11.651  31.949 -10.061 1.00 23.56  ? 93  LYS C O   1 
ATOM   1561 C  CB  . LYS B  2 93  ? 9.476   33.306 -12.121 1.00 25.23  ? 93  LYS C CB  1 
ATOM   1562 C  CG  . LYS B  2 93  ? 10.784  33.987 -12.547 1.00 28.52  ? 93  LYS C CG  1 
ATOM   1563 C  CD  . LYS B  2 93  ? 11.382  33.556 -13.843 1.00 32.05  ? 93  LYS C CD  1 
ATOM   1564 C  CE  . LYS B  2 93  ? 12.231  34.686 -14.524 1.00 35.51  ? 93  LYS C CE  1 
ATOM   1565 N  NZ  . LYS B  2 93  ? 12.991  35.718 -13.700 1.00 35.45  ? 93  LYS C NZ  1 
ATOM   1566 N  N   . MET B  2 94  ? 9.844   32.820 -9.006  1.00 22.48  ? 94  MET C N   1 
ATOM   1567 C  CA  . MET B  2 94  ? 10.562  33.107 -7.769  1.00 22.39  ? 94  MET C CA  1 
ATOM   1568 C  C   . MET B  2 94  ? 11.109  31.842 -7.144  1.00 22.69  ? 94  MET C C   1 
ATOM   1569 O  O   . MET B  2 94  ? 12.095  31.898 -6.365  1.00 23.09  ? 94  MET C O   1 
ATOM   1570 C  CB  . MET B  2 94  ? 9.683   33.862 -6.767  1.00 21.61  ? 94  MET C CB  1 
ATOM   1571 C  CG  . MET B  2 94  ? 9.265   35.228 -7.310  1.00 21.56  ? 94  MET C CG  1 
ATOM   1572 S  SD  . MET B  2 94  ? 8.191   36.045 -6.137  1.00 21.83  ? 94  MET C SD  1 
ATOM   1573 C  CE  . MET B  2 94  ? 7.769   37.504 -7.062  1.00 22.12  ? 94  MET C CE  1 
ATOM   1574 N  N   . HIS B  2 95  ? 10.507  30.696 -7.456  1.00 22.48  ? 95  HIS C N   1 
ATOM   1575 C  CA  . HIS B  2 95  ? 10.923  29.420 -6.895  1.00 22.77  ? 95  HIS C CA  1 
ATOM   1576 C  C   . HIS B  2 95  ? 11.575  28.500 -7.872  1.00 24.59  ? 95  HIS C C   1 
ATOM   1577 O  O   . HIS B  2 95  ? 11.748  27.307 -7.588  1.00 25.97  ? 95  HIS C O   1 
ATOM   1578 C  CB  . HIS B  2 95  ? 9.754   28.729 -6.224  1.00 21.44  ? 95  HIS C CB  1 
ATOM   1579 C  CG  . HIS B  2 95  ? 9.376   29.333 -4.889  1.00 20.87  ? 95  HIS C CG  1 
ATOM   1580 N  ND1 . HIS B  2 95  ? 10.094  29.110 -3.743  1.00 22.30  ? 95  HIS C ND1 1 
ATOM   1581 C  CD2 . HIS B  2 95  ? 8.301   30.168 -4.528  1.00 20.69  ? 95  HIS C CD2 1 
ATOM   1582 C  CE1 . HIS B  2 95  ? 9.494   29.748 -2.719  1.00 21.79  ? 95  HIS C CE1 1 
ATOM   1583 N  NE2 . HIS B  2 95  ? 8.395   30.390 -3.202  1.00 20.72  ? 95  HIS C NE2 1 
ATOM   1584 N  N   . GLU B  2 96  ? 11.985  29.038 -9.013  1.00 26.19  ? 96  GLU C N   1 
ATOM   1585 C  CA  . GLU B  2 96  ? 12.463  28.182 -10.131 1.00 28.58  ? 96  GLU C CA  1 
ATOM   1586 C  C   . GLU B  2 96  ? 13.793  27.545 -9.682  1.00 28.13  ? 96  GLU C C   1 
ATOM   1587 O  O   . GLU B  2 96  ? 14.659  28.240 -9.230  1.00 28.28  ? 96  GLU C O   1 
ATOM   1588 C  CB  . GLU B  2 96  ? 12.692  28.995 -11.406 1.00 32.48  ? 96  GLU C CB  1 
ATOM   1589 C  CG  . GLU B  2 96  ? 12.995  28.122 -12.610 1.00 36.25  ? 96  GLU C CG  1 
ATOM   1590 C  CD  . GLU B  2 96  ? 13.352  28.917 -13.873 1.00 42.28  ? 96  GLU C CD  1 
ATOM   1591 O  OE1 . GLU B  2 96  ? 13.250  28.323 -14.983 1.00 48.21  ? 96  GLU C OE1 1 
ATOM   1592 O  OE2 . GLU B  2 96  ? 13.704  30.128 -13.779 1.00 43.24  ? 96  GLU C OE2 1 
ATOM   1593 N  N   . GLY B  2 97  ? 13.891  26.223 -9.712  1.00 27.63  ? 97  GLY C N   1 
ATOM   1594 C  CA  . GLY B  2 97  ? 15.091  25.521 -9.269  1.00 28.44  ? 97  GLY C CA  1 
ATOM   1595 C  C   . GLY B  2 97  ? 15.440  25.583 -7.789  1.00 28.36  ? 97  GLY C C   1 
ATOM   1596 O  O   . GLY B  2 97  ? 16.598  25.381 -7.392  1.00 29.16  ? 97  GLY C O   1 
ATOM   1597 N  N   . ASP B  2 98  ? 14.448  25.892 -6.973  1.00 27.51  ? 98  ASP C N   1 
ATOM   1598 C  CA  . ASP B  2 98  ? 14.622  26.052 -5.532  1.00 27.22  ? 98  ASP C CA  1 
ATOM   1599 C  C   . ASP B  2 98  ? 15.062  24.724 -4.943  1.00 28.39  ? 98  ASP C C   1 
ATOM   1600 O  O   . ASP B  2 98  ? 14.415  23.678 -5.195  1.00 28.25  ? 98  ASP C O   1 
ATOM   1601 C  CB  . ASP B  2 98  ? 13.271  26.468 -4.943  1.00 26.66  ? 98  ASP C CB  1 
ATOM   1602 C  CG  . ASP B  2 98  ? 13.338  27.032 -3.552  1.00 27.08  ? 98  ASP C CG  1 
ATOM   1603 O  OD1 . ASP B  2 98  ? 14.350  26.896 -2.862  1.00 28.25  ? 98  ASP C OD1 1 
ATOM   1604 O  OD2 . ASP B  2 98  ? 12.287  27.593 -3.164  1.00 27.23  ? 98  ASP C OD2 1 
ATOM   1605 N  N   . GLU B  2 99  ? 16.174  24.775 -4.197  1.00 28.33  ? 99  GLU C N   1 
ATOM   1606 C  CA  . GLU B  2 99  ? 16.754  23.624 -3.479  1.00 30.02  ? 99  GLU C CA  1 
ATOM   1607 C  C   . GLU B  2 99  ? 16.480  23.655 -1.988  1.00 30.34  ? 99  GLU C C   1 
ATOM   1608 O  O   . GLU B  2 99  ? 16.852  22.747 -1.261  1.00 32.63  ? 99  GLU C O   1 
ATOM   1609 C  CB  . GLU B  2 99  ? 18.251  23.548 -3.762  1.00 31.36  ? 99  GLU C CB  1 
ATOM   1610 C  CG  . GLU B  2 99  ? 18.542  23.317 -5.242  1.00 32.07  ? 99  GLU C CG  1 
ATOM   1611 C  CD  . GLU B  2 99  ? 20.016  23.186 -5.529  1.00 34.07  ? 99  GLU C CD  1 
ATOM   1612 O  OE1 . GLU B  2 99  ? 20.802  23.150 -4.560  1.00 34.83  ? 99  GLU C OE1 1 
ATOM   1613 O  OE2 . GLU B  2 99  ? 20.391  23.097 -6.731  1.00 35.16  ? 99  GLU C OE2 1 
ATOM   1614 N  N   . GLY B  2 100 ? 15.835  24.707 -1.510  1.00 30.40  ? 100 GLY C N   1 
ATOM   1615 C  CA  . GLY B  2 100 ? 15.483  24.770 -0.085  1.00 30.50  ? 100 GLY C CA  1 
ATOM   1616 C  C   . GLY B  2 100 ? 16.723  24.822 0.799   1.00 31.34  ? 100 GLY C C   1 
ATOM   1617 O  O   . GLY B  2 100 ? 17.817  25.071 0.304   1.00 32.48  ? 100 GLY C O   1 
ATOM   1618 N  N   . PRO B  2 101 ? 16.585  24.558 2.106   1.00 31.97  ? 101 PRO C N   1 
ATOM   1619 C  CA  . PRO B  2 101 ? 15.388  24.264 2.837   1.00 32.00  ? 101 PRO C CA  1 
ATOM   1620 C  C   . PRO B  2 101 ? 14.706  25.564 3.136   1.00 31.72  ? 101 PRO C C   1 
ATOM   1621 O  O   . PRO B  2 101 ? 15.264  26.647 2.909   1.00 31.23  ? 101 PRO C O   1 
ATOM   1622 C  CB  . PRO B  2 101 ? 15.891  23.640 4.122   1.00 33.20  ? 101 PRO C CB  1 
ATOM   1623 C  CG  . PRO B  2 101 ? 17.211  24.308 4.366   1.00 33.99  ? 101 PRO C CG  1 
ATOM   1624 C  CD  . PRO B  2 101 ? 17.768  24.581 2.983   1.00 32.98  ? 101 PRO C CD  1 
ATOM   1625 N  N   . GLY B  2 102 ? 13.492  25.464 3.626   1.00 32.36  ? 102 GLY C N   1 
ATOM   1626 C  CA  . GLY B  2 102 ? 12.782  26.663 4.053   1.00 32.40  ? 102 GLY C CA  1 
ATOM   1627 C  C   . GLY B  2 102 ? 12.471  27.520 2.835   1.00 30.63  ? 102 GLY C C   1 
ATOM   1628 O  O   . GLY B  2 102 ? 12.465  27.013 1.702   1.00 31.73  ? 102 GLY C O   1 
ATOM   1629 N  N   . HIS B  2 103 ? 12.271  28.827 3.057   1.00 29.90  ? 103 HIS C N   1 
ATOM   1630 C  CA  . HIS B  2 103 ? 11.679  29.741 2.021   1.00 27.71  ? 103 HIS C CA  1 
ATOM   1631 C  C   . HIS B  2 103 ? 12.558  30.882 1.524   1.00 29.07  ? 103 HIS C C   1 
ATOM   1632 O  O   . HIS B  2 103 ? 13.165  31.596 2.333   1.00 29.91  ? 103 HIS C O   1 
ATOM   1633 C  CB  . HIS B  2 103 ? 10.444  30.402 2.570   1.00 26.83  ? 103 HIS C CB  1 
ATOM   1634 C  CG  . HIS B  2 103 ? 9.671   31.161 1.511   1.00 25.14  ? 103 HIS C CG  1 
ATOM   1635 N  ND1 . HIS B  2 103 ? 9.813   32.503 1.312   1.00 24.90  ? 103 HIS C ND1 1 
ATOM   1636 C  CD2 . HIS B  2 103 ? 8.775   30.705 0.542   1.00 23.79  ? 103 HIS C CD2 1 
ATOM   1637 C  CE1 . HIS B  2 103 ? 9.003   32.857 0.271   1.00 23.61  ? 103 HIS C CE1 1 
ATOM   1638 N  NE2 . HIS B  2 103 ? 8.383   31.762 -0.190  1.00 22.49  ? 103 HIS C NE2 1 
ATOM   1639 N  N   . HIS B  2 104 ? 12.646  31.071 0.208   1.00 28.61  ? 104 HIS C N   1 
ATOM   1640 C  CA  . HIS B  2 104 ? 13.300  32.271 -0.405  1.00 30.03  ? 104 HIS C CA  1 
ATOM   1641 C  C   . HIS B  2 104 ? 12.744  32.513 -1.786  1.00 28.63  ? 104 HIS C C   1 
ATOM   1642 O  O   . HIS B  2 104 ? 12.315  31.566 -2.460  1.00 26.71  ? 104 HIS C O   1 
ATOM   1643 C  CB  . HIS B  2 104 ? 14.833  32.098 -0.399  1.00 33.95  ? 104 HIS C CB  1 
ATOM   1644 C  CG  . HIS B  2 104 ? 15.598  32.901 -1.460  1.00 37.23  ? 104 HIS C CG  1 
ATOM   1645 N  ND1 . HIS B  2 104 ? 16.035  34.186 -1.256  1.00 39.84  ? 104 HIS C ND1 1 
ATOM   1646 C  CD2 . HIS B  2 104 ? 16.087  32.520 -2.711  1.00 39.62  ? 104 HIS C CD2 1 
ATOM   1647 C  CE1 . HIS B  2 104 ? 16.729  34.602 -2.343  1.00 40.69  ? 104 HIS C CE1 1 
ATOM   1648 N  NE2 . HIS B  2 104 ? 16.749  33.594 -3.238  1.00 41.85  ? 104 HIS C NE2 1 
ATOM   1649 N  N   . HIS B  2 105 ? 12.652  33.788 -2.167  1.00 26.68  ? 105 HIS C N   1 
ATOM   1650 C  CA  . HIS B  2 105 ? 12.324  34.169 -3.524  1.00 26.54  ? 105 HIS C CA  1 
ATOM   1651 C  C   . HIS B  2 105 ? 13.472  34.708 -4.275  1.00 28.12  ? 105 HIS C C   1 
ATOM   1652 O  O   . HIS B  2 105 ? 14.141  35.644 -3.805  1.00 30.69  ? 105 HIS C O   1 
ATOM   1653 C  CB  . HIS B  2 105 ? 11.261  35.250 -3.556  1.00 25.00  ? 105 HIS C CB  1 
ATOM   1654 C  CG  . HIS B  2 105 ? 9.910   34.773 -3.120  1.00 23.04  ? 105 HIS C CG  1 
ATOM   1655 N  ND1 . HIS B  2 105 ? 8.941   35.620 -2.669  1.00 21.94  ? 105 HIS C ND1 1 
ATOM   1656 C  CD2 . HIS B  2 105 ? 9.363   33.494 -3.072  1.00 22.66  ? 105 HIS C CD2 1 
ATOM   1657 C  CE1 . HIS B  2 105 ? 7.846   34.921 -2.379  1.00 20.59  ? 105 HIS C CE1 1 
ATOM   1658 N  NE2 . HIS B  2 105 ? 8.086   33.622 -2.621  1.00 20.75  ? 105 HIS C NE2 1 
ATOM   1659 N  N   . LYS B  2 106 ? 13.678  34.156 -5.461  1.00 27.41  ? 106 LYS C N   1 
ATOM   1660 C  CA  . LYS B  2 106 ? 14.434  34.822 -6.506  1.00 29.71  ? 106 LYS C CA  1 
ATOM   1661 C  C   . LYS B  2 106 ? 13.587  35.906 -7.177  1.00 28.94  ? 106 LYS C C   1 
ATOM   1662 O  O   . LYS B  2 106 ? 12.398  36.037 -6.873  1.00 26.43  ? 106 LYS C O   1 
ATOM   1663 C  CB  . LYS B  2 106 ? 14.825  33.785 -7.541  1.00 31.47  ? 106 LYS C CB  1 
ATOM   1664 C  CG  . LYS B  2 106 ? 15.722  32.713 -7.000  1.00 34.51  ? 106 LYS C CG  1 
ATOM   1665 C  CD  . LYS B  2 106 ? 16.428  31.998 -8.130  1.00 37.58  ? 106 LYS C CD  1 
ATOM   1666 C  CE  . LYS B  2 106 ? 15.702  30.768 -8.573  1.00 38.21  ? 106 LYS C CE  1 
ATOM   1667 N  NZ  . LYS B  2 106 ? 16.717  29.912 -9.295  1.00 42.90  ? 106 LYS C NZ  1 
ATOM   1668 N  N   . PRO B  2 107 ? 14.171  36.674 -8.099  1.00 29.71  ? 107 PRO C N   1 
ATOM   1669 C  CA  . PRO B  2 107 ? 13.359  37.592 -8.913  1.00 28.62  ? 107 PRO C CA  1 
ATOM   1670 C  C   . PRO B  2 107 ? 12.229  36.888 -9.621  1.00 26.79  ? 107 PRO C C   1 
ATOM   1671 O  O   . PRO B  2 107 ? 12.339  35.711 -9.952  1.00 26.83  ? 107 PRO C O   1 
ATOM   1672 C  CB  . PRO B  2 107 ? 14.369  38.190 -9.904  1.00 30.84  ? 107 PRO C CB  1 
ATOM   1673 C  CG  . PRO B  2 107 ? 15.662  38.150 -9.145  1.00 31.93  ? 107 PRO C CG  1 
ATOM   1674 C  CD  . PRO B  2 107 ? 15.613  36.845 -8.384  1.00 31.36  ? 107 PRO C CD  1 
ATOM   1675 N  N   . GLY B  2 108 ? 11.130  37.600 -9.807  1.00 25.04  ? 108 GLY C N   1 
ATOM   1676 C  CA  . GLY B  2 108 ? 9.966   37.036 -10.478 1.00 23.18  ? 108 GLY C CA  1 
ATOM   1677 C  C   . GLY B  2 108 ? 9.926   37.326 -11.964 1.00 23.74  ? 108 GLY C C   1 
ATOM   1678 O  O   . GLY B  2 108 ? 10.960  37.546 -12.607 1.00 24.46  ? 108 GLY C O   1 
ATOM   1679 N  N   . LEU B  2 109 ? 8.718   37.268 -12.525 1.00 22.97  ? 109 LEU C N   1 
ATOM   1680 C  CA  . LEU B  2 109 ? 8.566   37.482 -13.940 1.00 24.56  ? 109 LEU C CA  1 
ATOM   1681 C  C   . LEU B  2 109 ? 9.020   38.861 -14.362 1.00 26.25  ? 109 LEU C C   1 
ATOM   1682 O  O   . LEU B  2 109 ? 8.870   39.845 -13.646 1.00 26.38  ? 109 LEU C O   1 
ATOM   1683 C  CB  . LEU B  2 109 ? 7.133   37.306 -14.382 1.00 23.73  ? 109 LEU C CB  1 
ATOM   1684 C  CG  . LEU B  2 109 ? 6.517   35.975 -14.733 1.00 24.15  ? 109 LEU C CG  1 
ATOM   1685 C  CD1 . LEU B  2 109 ? 5.066   36.288 -15.212 1.00 22.30  ? 109 LEU C CD1 1 
ATOM   1686 C  CD2 . LEU B  2 109 ? 7.336   35.183 -15.730 1.00 24.54  ? 109 LEU C CD2 1 
ATOM   1687 N  N   . GLY B  2 110 ? 9.662   38.899 -15.521 1.00 28.58  ? 110 GLY C N   1 
ATOM   1688 C  CA  . GLY B  2 110 ? 10.038  40.133 -16.160 1.00 31.01  ? 110 GLY C CA  1 
ATOM   1689 C  C   . GLY B  2 110 ? 11.297  40.749 -15.625 1.00 33.60  ? 110 GLY C C   1 
ATOM   1690 O  O   . GLY B  2 110 ? 11.626  41.865 -15.997 1.00 34.87  ? 110 GLY C O   1 
ATOM   1691 N  N   . GLU B  2 111 ? 11.969  40.032 -14.718 1.00 33.88  ? 111 GLU C N   1 
ATOM   1692 C  CA  . GLU B  2 111 ? 13.212  40.482 -14.119 1.00 37.97  ? 111 GLU C CA  1 
ATOM   1693 C  C   . GLU B  2 111 ? 14.287  39.471 -14.456 1.00 40.25  ? 111 GLU C C   1 
ATOM   1694 O  O   . GLU B  2 111 ? 15.295  39.835 -15.046 1.00 49.18  ? 111 GLU C O   1 
ATOM   1695 C  CB  . GLU B  2 111 ? 13.081  40.589 -12.612 1.00 37.75  ? 111 GLU C CB  1 
ATOM   1696 C  CG  . GLU B  2 111 ? 11.946  41.482 -12.152 1.00 38.55  ? 111 GLU C CG  1 
ATOM   1697 C  CD  . GLU B  2 111 ? 11.933  41.652 -10.649 1.00 39.97  ? 111 GLU C CD  1 
ATOM   1698 O  OE1 . GLU B  2 111 ? 12.687  42.518 -10.166 1.00 45.84  ? 111 GLU C OE1 1 
ATOM   1699 O  OE2 . GLU B  2 111 ? 11.182  40.933 -9.951  1.00 38.26  ? 111 GLU C OE2 1 
ATOM   1700 N  N   . MET C  1 1   ? 8.361   5.628  -23.384 1.00 38.43  ? 1   MET K N   1 
ATOM   1701 C  CA  . MET C  1 1   ? 6.923   5.644  -23.069 1.00 34.59  ? 1   MET K CA  1 
ATOM   1702 C  C   . MET C  1 1   ? 6.694   6.302  -21.743 1.00 30.54  ? 1   MET K C   1 
ATOM   1703 O  O   . MET C  1 1   ? 7.463   6.127  -20.811 1.00 30.14  ? 1   MET K O   1 
ATOM   1704 C  CB  . MET C  1 1   ? 6.417   4.219  -22.986 1.00 36.09  ? 1   MET K CB  1 
ATOM   1705 C  CG  . MET C  1 1   ? 4.921   4.142  -22.884 1.00 35.74  ? 1   MET K CG  1 
ATOM   1706 S  SD  . MET C  1 1   ? 4.387   2.454  -23.134 1.00 69.34  ? 1   MET K SD  1 
ATOM   1707 C  CE  . MET C  1 1   ? 4.398   2.402  -24.931 1.00 40.61  ? 1   MET K CE  1 
ATOM   1708 N  N   . LEU C  1 2   ? 5.631   7.078  -21.629 1.00 26.50  ? 2   LEU K N   1 
ATOM   1709 C  CA  . LEU C  1 2   ? 5.265   7.621  -20.300 1.00 24.12  ? 2   LEU K CA  1 
ATOM   1710 C  C   . LEU C  1 2   ? 4.890   6.479  -19.325 1.00 22.56  ? 2   LEU K C   1 
ATOM   1711 O  O   . LEU C  1 2   ? 4.453   5.407  -19.741 1.00 23.06  ? 2   LEU K O   1 
ATOM   1712 C  CB  . LEU C  1 2   ? 4.083   8.597  -20.491 1.00 23.88  ? 2   LEU K CB  1 
ATOM   1713 C  CG  . LEU C  1 2   ? 4.259   10.108 -20.748 1.00 25.72  ? 2   LEU K CG  1 
ATOM   1714 C  CD1 . LEU C  1 2   ? 5.630   10.642 -21.158 1.00 26.03  ? 2   LEU K CD1 1 
ATOM   1715 C  CD2 . LEU C  1 2   ? 3.116   10.753 -21.521 1.00 24.86  ? 2   LEU K CD2 1 
ATOM   1716 N  N   . THR C  1 3   ? 5.010   6.735  -18.019 1.00 20.48  ? 3   THR K N   1 
ATOM   1717 C  CA  . THR C  1 3   ? 4.579   5.792  -17.007 1.00 19.90  ? 3   THR K CA  1 
ATOM   1718 C  C   . THR C  1 3   ? 3.044   5.788  -16.919 1.00 19.41  ? 3   THR K C   1 
ATOM   1719 O  O   . THR C  1 3   ? 2.366   6.718  -17.428 1.00 18.62  ? 3   THR K O   1 
ATOM   1720 C  CB  . THR C  1 3   ? 5.143   6.151  -15.634 1.00 19.01  ? 3   THR K CB  1 
ATOM   1721 O  OG1 . THR C  1 3   ? 4.443   7.299  -15.176 1.00 18.81  ? 3   THR K OG1 1 
ATOM   1722 C  CG2 . THR C  1 3   ? 6.658   6.463  -15.658 1.00 19.42  ? 3   THR K CG2 1 
ATOM   1723 N  N   . GLU C  1 4   ? 2.501   4.805  -16.205 1.00 19.68  ? 4   GLU K N   1 
ATOM   1724 C  CA  . GLU C  1 4   ? 1.043   4.702  -16.034 1.00 20.29  ? 4   GLU K CA  1 
ATOM   1725 C  C   . GLU C  1 4   ? 0.526   5.899  -15.260 1.00 18.13  ? 4   GLU K C   1 
ATOM   1726 O  O   . GLU C  1 4   ? -0.522  6.411  -15.559 1.00 17.55  ? 4   GLU K O   1 
ATOM   1727 C  CB  . GLU C  1 4   ? 0.652   3.376  -15.351 1.00 23.12  ? 4   GLU K CB  1 
ATOM   1728 C  CG  . GLU C  1 4   ? 0.993   2.156  -16.227 1.00 26.96  ? 4   GLU K CG  1 
ATOM   1729 C  CD  . GLU C  1 4   ? 0.388   2.163  -17.662 1.00 30.70  ? 4   GLU K CD  1 
ATOM   1730 O  OE1 . GLU C  1 4   ? 1.109   1.977  -18.698 1.00 37.95  ? 4   GLU K OE1 1 
ATOM   1731 O  OE2 . GLU C  1 4   ? -0.817  2.301  -17.803 1.00 32.19  ? 4   GLU K OE2 1 
ATOM   1732 N  N   . LEU C  1 5   ? 1.257   6.326  -14.221 1.00 17.28  ? 5   LEU K N   1 
ATOM   1733 C  CA  . LEU C  1 5   ? 0.872   7.567  -13.516 1.00 15.98  ? 5   LEU K CA  1 
ATOM   1734 C  C   . LEU C  1 5   ? 0.849   8.803  -14.417 1.00 15.96  ? 5   LEU K C   1 
ATOM   1735 O  O   . LEU C  1 5   ? -0.141  9.548  -14.454 1.00 15.23  ? 5   LEU K O   1 
ATOM   1736 C  CB  . LEU C  1 5   ? 1.774   7.827  -12.281 1.00 15.62  ? 5   LEU K CB  1 
ATOM   1737 C  CG  . LEU C  1 5   ? 1.430   9.090  -11.506 1.00 15.23  ? 5   LEU K CG  1 
ATOM   1738 C  CD1 . LEU C  1 5   ? 0.027   9.006  -10.907 1.00 15.64  ? 5   LEU K CD1 1 
ATOM   1739 C  CD2 . LEU C  1 5   ? 2.451   9.270  -10.367 1.00 14.76  ? 5   LEU K CD2 1 
ATOM   1740 N  N   . GLU C  1 6   ? 1.880   8.964  -15.258 1.00 16.48  ? 6   GLU K N   1 
ATOM   1741 C  CA  . GLU C  1 6   ? 1.931   10.091 -16.187 1.00 16.22  ? 6   GLU K CA  1 
ATOM   1742 C  C   . GLU C  1 6   ? 0.801   10.040 -17.199 1.00 16.30  ? 6   GLU K C   1 
ATOM   1743 O  O   . GLU C  1 6   ? 0.174   11.055 -17.552 1.00 15.62  ? 6   GLU K O   1 
ATOM   1744 C  CB  . GLU C  1 6   ? 3.320   10.096 -16.865 1.00 16.92  ? 6   GLU K CB  1 
ATOM   1745 C  CG  . GLU C  1 6   ? 4.433   10.453 -15.885 1.00 17.26  ? 6   GLU K CG  1 
ATOM   1746 C  CD  . GLU C  1 6   ? 5.825   10.159 -16.418 1.00 18.73  ? 6   GLU K CD  1 
ATOM   1747 O  OE1 . GLU C  1 6   ? 6.805   10.739 -15.889 1.00 18.06  ? 6   GLU K OE1 1 
ATOM   1748 O  OE2 . GLU C  1 6   ? 5.970   9.367  -17.387 1.00 19.30  ? 6   GLU K OE2 1 
ATOM   1749 N  N   . LYS C  1 7   ? 0.517   8.836  -17.682 1.00 16.55  ? 7   LYS K N   1 
ATOM   1750 C  CA  . LYS C  1 7   ? -0.609  8.658  -18.614 1.00 17.37  ? 7   LYS K CA  1 
ATOM   1751 C  C   . LYS C  1 7   ? -1.950  9.011  -17.958 1.00 16.39  ? 7   LYS K C   1 
ATOM   1752 O  O   . LYS C  1 7   ? -2.843  9.571  -18.608 1.00 16.79  ? 7   LYS K O   1 
ATOM   1753 C  CB  . LYS C  1 7   ? -0.624  7.202  -19.086 1.00 18.98  ? 7   LYS K CB  1 
ATOM   1754 C  CG  . LYS C  1 7   ? 0.461   6.900  -20.132 1.00 20.91  ? 7   LYS K CG  1 
ATOM   1755 C  CD  . LYS C  1 7   ? 0.368   5.443  -20.610 1.00 22.44  ? 7   LYS K CD  1 
ATOM   1756 C  CE  . LYS C  1 7   ? 1.338   5.089  -21.730 1.00 24.02  ? 7   LYS K CE  1 
ATOM   1757 N  NZ  . LYS C  1 7   ? 1.451   3.602  -21.894 1.00 26.90  ? 7   LYS K NZ  1 
ATOM   1758 N  N   . ALA C  1 8   ? -2.084  8.685  -16.671 1.00 15.67  ? 8   ALA K N   1 
ATOM   1759 C  CA  . ALA C  1 8   ? -3.299  8.984  -15.906 1.00 15.29  ? 8   ALA K CA  1 
ATOM   1760 C  C   . ALA C  1 8   ? -3.524  10.506 -15.860 1.00 15.05  ? 8   ALA K C   1 
ATOM   1761 O  O   . ALA C  1 8   ? -4.643  11.000 -16.003 1.00 15.39  ? 8   ALA K O   1 
ATOM   1762 C  CB  . ALA C  1 8   ? -3.160  8.462  -14.486 1.00 15.70  ? 8   ALA K CB  1 
ATOM   1763 N  N   . LEU C  1 9   ? -2.451  11.250 -15.625 1.00 14.70  ? 9   LEU K N   1 
ATOM   1764 C  CA  . LEU C  1 9   ? -2.507  12.729 -15.585 1.00 14.76  ? 9   LEU K CA  1 
ATOM   1765 C  C   . LEU C  1 9   ? -2.853  13.290 -16.948 1.00 15.21  ? 9   LEU K C   1 
ATOM   1766 O  O   . LEU C  1 9   ? -3.725  14.173 -17.065 1.00 15.23  ? 9   LEU K O   1 
ATOM   1767 C  CB  . LEU C  1 9   ? -1.245  13.326 -14.983 1.00 15.08  ? 9   LEU K CB  1 
ATOM   1768 C  CG  . LEU C  1 9   ? -0.797  12.829 -13.633 1.00 15.41  ? 9   LEU K CG  1 
ATOM   1769 C  CD1 . LEU C  1 9   ? 0.407   13.598 -13.111 1.00 15.93  ? 9   LEU K CD1 1 
ATOM   1770 C  CD2 . LEU C  1 9   ? -1.928  12.839 -12.579 1.00 15.41  ? 9   LEU K CD2 1 
ATOM   1771 N  N   . ASN C  1 10  ? -2.228  12.785 -17.985 1.00 15.41  ? 10  ASN K N   1 
ATOM   1772 C  CA  . ASN C  1 10  ? -2.606  13.257 -19.340 1.00 15.73  ? 10  ASN K CA  1 
ATOM   1773 C  C   . ASN C  1 10  ? -4.037  12.849 -19.696 1.00 16.17  ? 10  ASN K C   1 
ATOM   1774 O  O   . ASN C  1 10  ? -4.753  13.566 -20.438 1.00 17.57  ? 10  ASN K O   1 
ATOM   1775 C  CB  . ASN C  1 10  ? -1.643  12.809 -20.439 1.00 16.69  ? 10  ASN K CB  1 
ATOM   1776 C  CG  . ASN C  1 10  ? -0.358  13.605 -20.453 1.00 16.71  ? 10  ASN K CG  1 
ATOM   1777 O  OD1 . ASN C  1 10  ? -0.296  14.731 -19.941 1.00 16.49  ? 10  ASN K OD1 1 
ATOM   1778 N  ND2 . ASN C  1 10  ? 0.680   13.025 -21.050 1.00 17.04  ? 10  ASN K ND2 1 
ATOM   1779 N  N   . SER C  1 11  ? -4.477  11.696 -19.197 1.00 15.98  ? 11  SER K N   1 
ATOM   1780 C  CA  . SER C  1 11  ? -5.863  11.258 -19.426 1.00 16.23  ? 11  SER K CA  1 
ATOM   1781 C  C   . SER C  1 11  ? -6.882  12.196 -18.745 1.00 15.56  ? 11  SER K C   1 
ATOM   1782 O  O   . SER C  1 11  ? -7.981  12.459 -19.261 1.00 15.83  ? 11  SER K O   1 
ATOM   1783 C  CB  . SER C  1 11  ? -6.072  9.817  -18.940 1.00 16.60  ? 11  SER K CB  1 
ATOM   1784 O  OG  . SER C  1 11  ? -7.443  9.399  -19.132 1.00 16.96  ? 11  SER K OG  1 
ATOM   1785 N  N   . ILE C  1 12  ? -6.520  12.765 -17.609 1.00 14.93  ? 12  ILE K N   1 
ATOM   1786 C  CA  . ILE C  1 12  ? -7.356  13.800 -16.960 1.00 14.43  ? 12  ILE K CA  1 
ATOM   1787 C  C   . ILE C  1 12  ? -7.546  15.044 -17.823 1.00 14.93  ? 12  ILE K C   1 
ATOM   1788 O  O   . ILE C  1 12  ? -8.651  15.514 -18.000 1.00 14.88  ? 12  ILE K O   1 
ATOM   1789 C  CB  . ILE C  1 12  ? -6.804  14.137 -15.559 1.00 14.37  ? 12  ILE K CB  1 
ATOM   1790 C  CG1 . ILE C  1 12  ? -6.994  12.924 -14.626 1.00 14.86  ? 12  ILE K CG1 1 
ATOM   1791 C  CG2 . ILE C  1 12  ? -7.538  15.323 -14.974 1.00 14.16  ? 12  ILE K CG2 1 
ATOM   1792 C  CD1 . ILE C  1 12  ? -6.238  13.036 -13.286 1.00 14.91  ? 12  ILE K CD1 1 
ATOM   1793 N  N   . ILE C  1 13  ? -6.498  15.436 -18.537 1.00 14.96  ? 13  ILE K N   1 
ATOM   1794 C  CA  . ILE C  1 13  ? -6.593  16.491 -19.510 1.00 14.81  ? 13  ILE K CA  1 
ATOM   1795 C  C   . ILE C  1 13  ? -7.578  16.064 -20.645 1.00 14.87  ? 13  ILE K C   1 
ATOM   1796 O  O   . ILE C  1 13  ? -8.467  16.822 -21.026 1.00 14.82  ? 13  ILE K O   1 
ATOM   1797 C  CB  . ILE C  1 13  ? -5.196  16.811 -20.104 1.00 15.55  ? 13  ILE K CB  1 
ATOM   1798 C  CG1 . ILE C  1 13  ? -4.234  17.259 -18.997 1.00 15.32  ? 13  ILE K CG1 1 
ATOM   1799 C  CG2 . ILE C  1 13  ? -5.349  17.808 -21.210 1.00 16.50  ? 13  ILE K CG2 1 
ATOM   1800 C  CD1 . ILE C  1 13  ? -2.743  17.370 -19.433 1.00 15.66  ? 13  ILE K CD1 1 
ATOM   1801 N  N   A ASP C  1 14  ? -7.441  14.845 -21.153 0.49 15.54  ? 14  ASP K N   1 
ATOM   1802 N  N   B ASP C  1 14  ? -7.419  14.834 -21.114 0.51 15.37  ? 14  ASP K N   1 
ATOM   1803 C  CA  A ASP C  1 14  ? -8.350  14.397 -22.228 0.49 16.33  ? 14  ASP K CA  1 
ATOM   1804 C  CA  B ASP C  1 14  ? -8.273  14.284 -22.177 0.51 16.14  ? 14  ASP K CA  1 
ATOM   1805 C  C   A ASP C  1 14  ? -9.787  14.390 -21.759 0.49 15.88  ? 14  ASP K C   1 
ATOM   1806 C  C   B ASP C  1 14  ? -9.740  14.299 -21.779 0.51 15.78  ? 14  ASP K C   1 
ATOM   1807 O  O   A ASP C  1 14  ? -10.700 14.853 -22.473 0.49 15.84  ? 14  ASP K O   1 
ATOM   1808 O  O   B ASP C  1 14  ? -10.621 14.686 -22.565 0.51 15.83  ? 14  ASP K O   1 
ATOM   1809 C  CB  A ASP C  1 14  ? -7.962  13.018 -22.755 0.49 17.89  ? 14  ASP K CB  1 
ATOM   1810 C  CB  B ASP C  1 14  ? -7.800  12.863 -22.517 0.51 17.36  ? 14  ASP K CB  1 
ATOM   1811 C  CG  A ASP C  1 14  ? -6.584  12.995 -23.388 0.49 19.16  ? 14  ASP K CG  1 
ATOM   1812 C  CG  B ASP C  1 14  ? -8.537  12.265 -23.692 0.51 18.62  ? 14  ASP K CG  1 
ATOM   1813 O  OD1 A ASP C  1 14  ? -6.085  14.045 -23.821 0.49 19.40  ? 14  ASP K OD1 1 
ATOM   1814 O  OD1 B ASP C  1 14  ? -8.672  12.938 -24.736 0.51 19.57  ? 14  ASP K OD1 1 
ATOM   1815 O  OD2 A ASP C  1 14  ? -5.989  11.904 -23.458 0.49 21.30  ? 14  ASP K OD2 1 
ATOM   1816 O  OD2 B ASP C  1 14  ? -8.986  11.115 -23.575 0.51 19.60  ? 14  ASP K OD2 1 
ATOM   1817 N  N   . VAL C  1 15  ? -10.011 13.906 -20.547 1.00 15.11  ? 15  VAL K N   1 
ATOM   1818 C  CA  . VAL C  1 15  ? -11.388 13.851 -20.021 1.00 15.00  ? 15  VAL K CA  1 
ATOM   1819 C  C   . VAL C  1 15  ? -12.024 15.245 -20.094 1.00 14.62  ? 15  VAL K C   1 
ATOM   1820 O  O   . VAL C  1 15  ? -13.131 15.395 -20.602 1.00 14.68  ? 15  VAL K O   1 
ATOM   1821 C  CB  . VAL C  1 15  ? -11.430 13.350 -18.585 1.00 14.87  ? 15  VAL K CB  1 
ATOM   1822 C  CG1 . VAL C  1 15  ? -12.842 13.578 -17.994 1.00 15.41  ? 15  VAL K CG1 1 
ATOM   1823 C  CG2 . VAL C  1 15  ? -11.146 11.820 -18.575 1.00 15.74  ? 15  VAL K CG2 1 
ATOM   1824 N  N   . TYR C  1 16  ? -11.296 16.227 -19.607 1.00 14.32  ? 16  TYR K N   1 
ATOM   1825 C  CA  . TYR C  1 16  ? -11.815 17.621 -19.598 1.00 13.95  ? 16  TYR K CA  1 
ATOM   1826 C  C   . TYR C  1 16  ? -12.181 18.049 -21.010 1.00 14.16  ? 16  TYR K C   1 
ATOM   1827 O  O   . TYR C  1 16  ? -13.280 18.625 -21.269 1.00 14.48  ? 16  TYR K O   1 
ATOM   1828 C  CB  . TYR C  1 16  ? -10.840 18.555 -18.969 1.00 13.54  ? 16  TYR K CB  1 
ATOM   1829 C  CG  . TYR C  1 16  ? -11.255 19.999 -19.066 1.00 13.15  ? 16  TYR K CG  1 
ATOM   1830 C  CD1 . TYR C  1 16  ? -12.207 20.502 -18.249 1.00 13.46  ? 16  TYR K CD1 1 
ATOM   1831 C  CD2 . TYR C  1 16  ? -10.701 20.848 -20.035 1.00 13.39  ? 16  TYR K CD2 1 
ATOM   1832 C  CE1 . TYR C  1 16  ? -12.604 21.849 -18.319 1.00 13.60  ? 16  TYR K CE1 1 
ATOM   1833 C  CE2 . TYR C  1 16  ? -11.109 22.159 -20.145 1.00 13.42  ? 16  TYR K CE2 1 
ATOM   1834 C  CZ  . TYR C  1 16  ? -12.053 22.675 -19.242 1.00 13.06  ? 16  TYR K CZ  1 
ATOM   1835 O  OH  . TYR C  1 16  ? -12.498 23.993 -19.358 1.00 13.27  ? 16  TYR K OH  1 
ATOM   1836 N  N   . HIS C  1 17  ? -11.300 17.769 -21.959 1.00 14.97  ? 17  HIS K N   1 
ATOM   1837 C  CA  . HIS C  1 17  ? -11.533 18.194 -23.310 1.00 16.04  ? 17  HIS K CA  1 
ATOM   1838 C  C   . HIS C  1 17  ? -12.649 17.479 -24.008 1.00 17.17  ? 17  HIS K C   1 
ATOM   1839 O  O   . HIS C  1 17  ? -13.197 18.044 -24.986 1.00 17.01  ? 17  HIS K O   1 
ATOM   1840 C  CB  . HIS C  1 17  ? -10.225 18.113 -24.139 1.00 16.20  ? 17  HIS K CB  1 
ATOM   1841 C  CG  . HIS C  1 17  ? -9.195  19.162 -23.754 1.00 16.06  ? 17  HIS K CG  1 
ATOM   1842 N  ND1 . HIS C  1 17  ? -8.471  19.113 -22.572 1.00 15.21  ? 17  HIS K ND1 1 
ATOM   1843 C  CD2 . HIS C  1 17  ? -8.802  20.344 -24.391 1.00 16.17  ? 17  HIS K CD2 1 
ATOM   1844 C  CE1 . HIS C  1 17  ? -7.668  20.197 -22.518 1.00 15.64  ? 17  HIS K CE1 1 
ATOM   1845 N  NE2 . HIS C  1 17  ? -7.883  20.948 -23.600 1.00 16.47  ? 17  HIS K NE2 1 
ATOM   1846 N  N   . LYS C  1 18  ? -13.042 16.275 -23.570 1.00 17.22  ? 18  LYS K N   1 
ATOM   1847 C  CA  . LYS C  1 18  ? -14.254 15.662 -24.154 1.00 18.84  ? 18  LYS K CA  1 
ATOM   1848 C  C   . LYS C  1 18  ? -15.448 16.585 -23.982 1.00 17.53  ? 18  LYS K C   1 
ATOM   1849 O  O   . LYS C  1 18  ? -16.380 16.538 -24.791 1.00 18.59  ? 18  LYS K O   1 
ATOM   1850 C  CB  . LYS C  1 18  ? -14.585 14.296 -23.548 1.00 21.54  ? 18  LYS K CB  1 
ATOM   1851 C  CG  . LYS C  1 18  ? -13.416 13.332 -23.729 1.00 25.19  ? 18  LYS K CG  1 
ATOM   1852 C  CD  . LYS C  1 18  ? -13.678 11.894 -23.267 1.00 29.82  ? 18  LYS K CD  1 
ATOM   1853 C  CE  . LYS C  1 18  ? -12.781 10.925 -24.084 1.00 33.16  ? 18  LYS K CE  1 
ATOM   1854 N  NZ  . LYS C  1 18  ? -12.655 9.523  -23.558 1.00 37.79  ? 18  LYS K NZ  1 
ATOM   1855 N  N   . TYR C  1 19  ? -15.458 17.358 -22.893 1.00 16.35  ? 19  TYR K N   1 
ATOM   1856 C  CA  . TYR C  1 19  ? -16.586 18.254 -22.595 1.00 15.74  ? 19  TYR K CA  1 
ATOM   1857 C  C   . TYR C  1 19  ? -16.293 19.701 -23.030 1.00 15.39  ? 19  TYR K C   1 
ATOM   1858 O  O   . TYR C  1 19  ? -17.175 20.426 -23.529 1.00 15.47  ? 19  TYR K O   1 
ATOM   1859 C  CB  . TYR C  1 19  ? -16.958 18.170 -21.105 1.00 15.37  ? 19  TYR K CB  1 
ATOM   1860 C  CG  . TYR C  1 19  ? -17.223 16.734 -20.770 1.00 15.92  ? 19  TYR K CG  1 
ATOM   1861 C  CD1 . TYR C  1 19  ? -18.425 16.111 -21.146 1.00 17.10  ? 19  TYR K CD1 1 
ATOM   1862 C  CD2 . TYR C  1 19  ? -16.223 15.950 -20.233 1.00 15.77  ? 19  TYR K CD2 1 
ATOM   1863 C  CE1 . TYR C  1 19  ? -18.603 14.734 -20.983 1.00 17.78  ? 19  TYR K CE1 1 
ATOM   1864 C  CE2 . TYR C  1 19  ? -16.414 14.596 -20.027 1.00 16.94  ? 19  TYR K CE2 1 
ATOM   1865 C  CZ  . TYR C  1 19  ? -17.622 14.004 -20.354 1.00 18.32  ? 19  TYR K CZ  1 
ATOM   1866 O  OH  . TYR C  1 19  ? -17.739 12.610 -20.201 1.00 20.37  ? 19  TYR K OH  1 
ATOM   1867 N  N   . SER C  1 20  ? -15.071 20.155 -22.807 1.00 15.09  ? 20  SER K N   1 
ATOM   1868 C  CA  . SER C  1 20  ? -14.709 21.536 -23.211 1.00 14.94  ? 20  SER K CA  1 
ATOM   1869 C  C   . SER C  1 20  ? -14.732 21.784 -24.706 1.00 15.45  ? 20  SER K C   1 
ATOM   1870 O  O   . SER C  1 20  ? -14.959 22.923 -25.162 1.00 17.42  ? 20  SER K O   1 
ATOM   1871 C  CB  . SER C  1 20  ? -13.378 21.958 -22.594 1.00 14.53  ? 20  SER K CB  1 
ATOM   1872 O  OG  . SER C  1 20  ? -12.287 21.410 -23.295 1.00 14.38  ? 20  SER K OG  1 
ATOM   1873 N  N   . LEU C  1 21  ? -14.488 20.760 -25.530 1.00 15.25  ? 21  LEU K N   1 
ATOM   1874 C  CA  . LEU C  1 21  ? -14.500 20.913 -26.990 1.00 15.75  ? 21  LEU K CA  1 
ATOM   1875 C  C   . LEU C  1 21  ? -15.874 20.717 -27.630 1.00 15.53  ? 21  LEU K C   1 
ATOM   1876 O  O   . LEU C  1 21  ? -16.003 20.793 -28.873 1.00 16.38  ? 21  LEU K O   1 
ATOM   1877 C  CB  . LEU C  1 21  ? -13.458 19.971 -27.652 1.00 16.65  ? 21  LEU K CB  1 
ATOM   1878 C  CG  . LEU C  1 21  ? -12.038 20.243 -27.096 1.00 16.51  ? 21  LEU K CG  1 
ATOM   1879 C  CD1 . LEU C  1 21  ? -11.033 19.261 -27.709 1.00 18.07  ? 21  LEU K CD1 1 
ATOM   1880 C  CD2 . LEU C  1 21  ? -11.618 21.673 -27.376 1.00 16.97  ? 21  LEU K CD2 1 
ATOM   1881 N  N   . ILE C  1 22  ? -16.925 20.554 -26.819 1.00 15.10  ? 22  ILE K N   1 
ATOM   1882 C  CA  . ILE C  1 22  ? -18.298 20.434 -27.357 1.00 15.51  ? 22  ILE K CA  1 
ATOM   1883 C  C   . ILE C  1 22  ? -18.646 21.722 -28.145 1.00 15.14  ? 22  ILE K C   1 
ATOM   1884 O  O   . ILE C  1 22  ? -19.038 21.679 -29.330 1.00 15.51  ? 22  ILE K O   1 
ATOM   1885 C  CB  . ILE C  1 22  ? -19.349 20.154 -26.224 1.00 15.60  ? 22  ILE K CB  1 
ATOM   1886 C  CG1 . ILE C  1 22  ? -19.110 18.773 -25.585 1.00 16.00  ? 22  ILE K CG1 1 
ATOM   1887 C  CG2 . ILE C  1 22  ? -20.747 20.278 -26.797 1.00 16.55  ? 22  ILE K CG2 1 
ATOM   1888 C  CD1 . ILE C  1 22  ? -19.961 18.541 -24.333 1.00 16.96  ? 22  ILE K CD1 1 
ATOM   1889 N  N   . LYS C  1 23  ? -18.436 22.869 -27.511 1.00 15.04  ? 23  LYS K N   1 
ATOM   1890 C  CA  . LYS C  1 23  ? -18.804 24.140 -28.127 1.00 14.59  ? 23  LYS K CA  1 
ATOM   1891 C  C   . LYS C  1 23  ? -18.132 25.306 -27.470 1.00 13.88  ? 23  LYS K C   1 
ATOM   1892 O  O   . LYS C  1 23  ? -17.589 25.269 -26.326 1.00 13.06  ? 23  LYS K O   1 
ATOM   1893 C  CB  . LYS C  1 23  ? -20.334 24.334 -28.079 1.00 14.51  ? 23  LYS K CB  1 
ATOM   1894 C  CG  . LYS C  1 23  ? -20.901 24.340 -26.661 1.00 14.39  ? 23  LYS K CG  1 
ATOM   1895 C  CD  . LYS C  1 23  ? -22.394 24.650 -26.652 1.00 14.81  ? 23  LYS K CD  1 
ATOM   1896 C  CE  . LYS C  1 23  ? -23.001 24.680 -25.249 1.00 15.36  ? 23  LYS K CE  1 
ATOM   1897 N  NZ  . LYS C  1 23  ? -23.167 23.323 -24.668 1.00 16.37  ? 23  LYS K NZ  1 
ATOM   1898 N  N   . GLY C  1 24  ? -18.246 26.422 -28.138 1.00 14.62  ? 24  GLY K N   1 
ATOM   1899 C  CA  . GLY C  1 24  ? -17.707 27.670 -27.606 1.00 13.85  ? 24  GLY K CA  1 
ATOM   1900 C  C   . GLY C  1 24  ? -16.218 27.692 -27.375 1.00 14.35  ? 24  GLY K C   1 
ATOM   1901 O  O   . GLY C  1 24  ? -15.462 27.062 -28.077 1.00 14.80  ? 24  GLY K O   1 
ATOM   1902 N  N   . ASN C  1 25  ? -15.850 28.305 -26.256 1.00 14.08  ? 25  ASN K N   1 
ATOM   1903 C  CA  . ASN C  1 25  ? -14.430 28.450 -25.859 1.00 14.36  ? 25  ASN K CA  1 
ATOM   1904 C  C   . ASN C  1 25  ? -13.878 27.033 -25.588 1.00 14.14  ? 25  ASN K C   1 
ATOM   1905 O  O   . ASN C  1 25  ? -14.540 26.228 -24.959 1.00 13.89  ? 25  ASN K O   1 
ATOM   1906 C  CB  . ASN C  1 25  ? -14.358 29.356 -24.647 1.00 14.64  ? 25  ASN K CB  1 
ATOM   1907 C  CG  . ASN C  1 25  ? -12.935 29.532 -24.097 1.00 15.20  ? 25  ASN K CG  1 
ATOM   1908 O  OD1 . ASN C  1 25  ? -12.369 28.585 -23.582 1.00 15.60  ? 25  ASN K OD1 1 
ATOM   1909 N  ND2 . ASN C  1 25  ? -12.348 30.745 -24.226 1.00 16.33  ? 25  ASN K ND2 1 
ATOM   1910 N  N   A PHE C  1 26  ? -12.685 26.755 -26.119 0.61 14.77  ? 26  PHE K N   1 
ATOM   1911 N  N   B PHE C  1 26  ? -12.691 26.751 -26.125 0.39 14.56  ? 26  PHE K N   1 
ATOM   1912 C  CA  A PHE C  1 26  ? -12.058 25.414 -26.086 0.61 14.79  ? 26  PHE K CA  1 
ATOM   1913 C  CA  B PHE C  1 26  ? -12.095 25.414 -26.081 0.39 14.51  ? 26  PHE K CA  1 
ATOM   1914 C  C   A PHE C  1 26  ? -11.643 24.989 -24.684 0.61 14.50  ? 26  PHE K C   1 
ATOM   1915 C  C   B PHE C  1 26  ? -11.753 24.982 -24.674 0.39 14.32  ? 26  PHE K C   1 
ATOM   1916 O  O   A PHE C  1 26  ? -11.426 23.800 -24.430 0.61 14.45  ? 26  PHE K O   1 
ATOM   1917 O  O   B PHE C  1 26  ? -11.688 23.775 -24.412 0.39 14.12  ? 26  PHE K O   1 
ATOM   1918 C  CB  A PHE C  1 26  ? -10.888 25.305 -27.071 0.61 15.79  ? 26  PHE K CB  1 
ATOM   1919 C  CB  B PHE C  1 26  ? -10.845 25.346 -26.933 0.39 15.16  ? 26  PHE K CB  1 
ATOM   1920 C  CG  A PHE C  1 26  ? -10.003 26.531 -27.143 0.61 16.50  ? 26  PHE K CG  1 
ATOM   1921 C  CG  B PHE C  1 26  ? -11.087 25.588 -28.392 0.39 15.91  ? 26  PHE K CG  1 
ATOM   1922 C  CD1 A PHE C  1 26  ? -9.207  26.893 -26.055 0.61 16.50  ? 26  PHE K CD1 1 
ATOM   1923 C  CD1 B PHE C  1 26  ? -12.095 24.919 -29.074 0.39 16.10  ? 26  PHE K CD1 1 
ATOM   1924 C  CD2 A PHE C  1 26  ? -9.915  27.293 -28.322 0.61 18.01  ? 26  PHE K CD2 1 
ATOM   1925 C  CD2 B PHE C  1 26  ? -10.295 26.471 -29.084 0.39 16.76  ? 26  PHE K CD2 1 
ATOM   1926 C  CE1 A PHE C  1 26  ? -8.397  28.029 -26.114 0.61 17.01  ? 26  PHE K CE1 1 
ATOM   1927 C  CE1 B PHE C  1 26  ? -12.310 25.143 -30.403 0.39 16.70  ? 26  PHE K CE1 1 
ATOM   1928 C  CE2 A PHE C  1 26  ? -9.088  28.412 -28.393 0.61 18.51  ? 26  PHE K CE2 1 
ATOM   1929 C  CE2 B PHE C  1 26  ? -10.500 26.678 -30.416 0.39 17.63  ? 26  PHE K CE2 1 
ATOM   1930 C  CZ  A PHE C  1 26  ? -8.345  28.780 -27.286 0.61 17.92  ? 26  PHE K CZ  1 
ATOM   1931 C  CZ  B PHE C  1 26  ? -11.520 26.027 -31.080 0.39 17.45  ? 26  PHE K CZ  1 
ATOM   1932 N  N   . HIS C  1 27  ? -11.538 25.962 -23.799 1.00 14.86  ? 27  HIS K N   1 
ATOM   1933 C  CA  . HIS C  1 27  ? -11.318 25.725 -22.393 1.00 14.52  ? 27  HIS K CA  1 
ATOM   1934 C  C   . HIS C  1 27  ? -12.443 26.241 -21.510 1.00 14.90  ? 27  HIS K C   1 
ATOM   1935 O  O   . HIS C  1 27  ? -12.230 26.867 -20.449 1.00 14.44  ? 27  HIS K O   1 
ATOM   1936 C  CB  . HIS C  1 27  ? -9.931  26.159 -21.866 1.00 16.35  ? 27  HIS K CB  1 
ATOM   1937 C  CG  . HIS C  1 27  ? -8.775  25.601 -22.658 1.00 17.49  ? 27  HIS K CG  1 
ATOM   1938 N  ND1 . HIS C  1 27  ? -7.729  26.382 -23.033 1.00 19.71  ? 27  HIS K ND1 1 
ATOM   1939 C  CD2 . HIS C  1 27  ? -8.512  24.319 -23.124 1.00 18.24  ? 27  HIS K CD2 1 
ATOM   1940 C  CE1 . HIS C  1 27  ? -6.845  25.601 -23.767 1.00 20.72  ? 27  HIS K CE1 1 
ATOM   1941 N  NE2 . HIS C  1 27  ? -7.352  24.348 -23.832 1.00 19.10  ? 27  HIS K NE2 1 
ATOM   1942 N  N   . ALA C  1 28  ? -13.671 25.947 -21.933 1.00 14.22  ? 28  ALA K N   1 
ATOM   1943 C  CA  . ALA C  1 28  ? -14.857 26.297 -21.181 1.00 14.01  ? 28  ALA K CA  1 
ATOM   1944 C  C   . ALA C  1 28  ? -15.803 25.124 -21.217 1.00 13.82  ? 28  ALA K C   1 
ATOM   1945 O  O   . ALA C  1 28  ? -16.223 24.702 -22.279 1.00 15.80  ? 28  ALA K O   1 
ATOM   1946 C  CB  . ALA C  1 28  ? -15.565 27.546 -21.685 1.00 14.52  ? 28  ALA K CB  1 
ATOM   1947 N  N   . VAL C  1 29  ? -16.130 24.643 -20.017 1.00 14.48  ? 29  VAL K N   1 
ATOM   1948 C  CA  . VAL C  1 29  ? -17.218 23.692 -19.827 1.00 13.72  ? 29  VAL K CA  1 
ATOM   1949 C  C   . VAL C  1 29  ? -18.393 24.537 -19.299 1.00 13.61  ? 29  VAL K C   1 
ATOM   1950 O  O   . VAL C  1 29  ? -18.356 25.036 -18.174 1.00 14.43  ? 29  VAL K O   1 
ATOM   1951 C  CB  . VAL C  1 29  ? -16.803 22.501 -18.945 1.00 13.77  ? 29  VAL K CB  1 
ATOM   1952 C  CG1 . VAL C  1 29  ? -18.018 21.659 -18.511 1.00 14.34  ? 29  VAL K CG1 1 
ATOM   1953 C  CG2 . VAL C  1 29  ? -15.714 21.651 -19.651 1.00 14.68  ? 29  VAL K CG2 1 
ATOM   1954 N  N   . TYR C  1 30  ? -19.459 24.681 -20.089 1.00 13.63  ? 30  TYR K N   1 
ATOM   1955 C  CA  . TYR C  1 30  ? -20.602 25.504 -19.722 1.00 14.12  ? 30  TYR K CA  1 
ATOM   1956 C  C   . TYR C  1 30  ? -21.501 24.712 -18.748 1.00 14.75  ? 30  TYR K C   1 
ATOM   1957 O  O   . TYR C  1 30  ? -21.241 23.520 -18.485 1.00 14.86  ? 30  TYR K O   1 
ATOM   1958 C  CB  . TYR C  1 30  ? -21.336 25.980 -20.995 1.00 14.29  ? 30  TYR K CB  1 
ATOM   1959 C  CG  . TYR C  1 30  ? -20.438 26.813 -21.886 1.00 13.65  ? 30  TYR K CG  1 
ATOM   1960 C  CD1 . TYR C  1 30  ? -20.130 28.136 -21.572 1.00 14.02  ? 30  TYR K CD1 1 
ATOM   1961 C  CD2 . TYR C  1 30  ? -19.849 26.306 -23.029 1.00 13.55  ? 30  TYR K CD2 1 
ATOM   1962 C  CE1 . TYR C  1 30  ? -19.256 28.879 -22.364 1.00 14.28  ? 30  TYR K CE1 1 
ATOM   1963 C  CE2 . TYR C  1 30  ? -19.004 27.040 -23.799 1.00 13.72  ? 30  TYR K CE2 1 
ATOM   1964 C  CZ  . TYR C  1 30  ? -18.733 28.344 -23.474 1.00 13.72  ? 30  TYR K CZ  1 
ATOM   1965 O  OH  . TYR C  1 30  ? -17.889 29.069 -24.246 1.00 14.91  ? 30  TYR K OH  1 
ATOM   1966 N  N   . ARG C  1 31  ? -22.512 25.362 -18.190 1.00 15.94  ? 31  ARG K N   1 
ATOM   1967 C  CA  . ARG C  1 31  ? -23.307 24.728 -17.121 1.00 18.32  ? 31  ARG K CA  1 
ATOM   1968 C  C   . ARG C  1 31  ? -23.975 23.444 -17.654 1.00 18.26  ? 31  ARG K C   1 
ATOM   1969 O  O   . ARG C  1 31  ? -24.077 22.458 -16.914 1.00 18.82  ? 31  ARG K O   1 
ATOM   1970 C  CB  . ARG C  1 31  ? -24.376 25.720 -16.614 1.00 20.34  ? 31  ARG K CB  1 
ATOM   1971 C  CG  . ARG C  1 31  ? -25.294 25.236 -15.480 1.00 24.07  ? 31  ARG K CG  1 
ATOM   1972 C  CD  . ARG C  1 31  ? -26.433 26.251 -15.334 1.00 27.37  ? 31  ARG K CD  1 
ATOM   1973 N  NE  . ARG C  1 31  ? -25.979 27.508 -14.770 1.00 30.55  ? 31  ARG K NE  1 
ATOM   1974 C  CZ  . ARG C  1 31  ? -25.738 27.735 -13.464 1.00 36.23  ? 31  ARG K CZ  1 
ATOM   1975 N  NH1 . ARG C  1 31  ? -25.910 26.789 -12.516 1.00 37.25  ? 31  ARG K NH1 1 
ATOM   1976 N  NH2 . ARG C  1 31  ? -25.323 28.951 -13.085 1.00 38.24  ? 31  ARG K NH2 1 
ATOM   1977 N  N   . ASP C  1 32  ? -24.483 23.484 -18.890 1.00 18.13  ? 32  ASP K N   1 
ATOM   1978 C  CA  . ASP C  1 32  ? -25.100 22.299 -19.487 1.00 18.87  ? 32  ASP K CA  1 
ATOM   1979 C  C   . ASP C  1 32  ? -24.077 21.182 -19.784 1.00 18.81  ? 32  ASP K C   1 
ATOM   1980 O  O   . ASP C  1 32  ? -24.342 19.997 -19.543 1.00 18.53  ? 32  ASP K O   1 
ATOM   1981 C  CB  . ASP C  1 32  ? -25.920 22.642 -20.746 1.00 20.25  ? 32  ASP K CB  1 
ATOM   1982 C  CG  . ASP C  1 32  ? -25.128 23.355 -21.845 1.00 20.71  ? 32  ASP K CG  1 
ATOM   1983 O  OD1 . ASP C  1 32  ? -24.041 23.837 -21.589 1.00 20.32  ? 32  ASP K OD1 1 
ATOM   1984 O  OD2 . ASP C  1 32  ? -25.654 23.518 -22.959 1.00 22.32  ? 32  ASP K OD2 1 
ATOM   1985 N  N   . ASP C  1 33  ? -22.888 21.562 -20.266 1.00 17.99  ? 33  ASP K N   1 
ATOM   1986 C  CA  . ASP C  1 33  ? -21.801 20.631 -20.478 1.00 17.37  ? 33  ASP K CA  1 
ATOM   1987 C  C   . ASP C  1 33  ? -21.361 19.990 -19.152 1.00 16.51  ? 33  ASP K C   1 
ATOM   1988 O  O   . ASP C  1 33  ? -21.022 18.802 -19.130 1.00 16.99  ? 33  ASP K O   1 
ATOM   1989 C  CB  . ASP C  1 33  ? -20.580 21.313 -21.082 1.00 17.56  ? 33  ASP K CB  1 
ATOM   1990 C  CG  . ASP C  1 33  ? -20.854 22.032 -22.398 1.00 17.49  ? 33  ASP K CG  1 
ATOM   1991 O  OD1 . ASP C  1 33  ? -21.650 21.590 -23.271 1.00 18.39  ? 33  ASP K OD1 1 
ATOM   1992 O  OD2 . ASP C  1 33  ? -20.215 23.095 -22.596 1.00 17.27  ? 33  ASP K OD2 1 
ATOM   1993 N  N   . LEU C  1 34  ? -21.331 20.748 -18.061 1.00 16.88  ? 34  LEU K N   1 
ATOM   1994 C  CA  . LEU C  1 34  ? -20.880 20.160 -16.783 1.00 16.71  ? 34  LEU K CA  1 
ATOM   1995 C  C   . LEU C  1 34  ? -21.841 19.051 -16.300 1.00 17.54  ? 34  LEU K C   1 
ATOM   1996 O  O   . LEU C  1 34  ? -21.419 18.070 -15.718 1.00 16.42  ? 34  LEU K O   1 
ATOM   1997 C  CB  . LEU C  1 34  ? -20.792 21.225 -15.675 1.00 17.54  ? 34  LEU K CB  1 
ATOM   1998 C  CG  . LEU C  1 34  ? -20.118 20.749 -14.380 1.00 17.52  ? 34  LEU K CG  1 
ATOM   1999 C  CD1 . LEU C  1 34  ? -18.640 20.475 -14.590 1.00 19.15  ? 34  LEU K CD1 1 
ATOM   2000 C  CD2 . LEU C  1 34  ? -20.320 21.772 -13.251 1.00 18.81  ? 34  LEU K CD2 1 
ATOM   2001 N  N   . LYS C  1 35  ? -23.130 19.179 -16.573 1.00 18.03  ? 35  LYS K N   1 
ATOM   2002 C  CA  . LYS C  1 35  ? -24.076 18.117 -16.276 1.00 19.06  ? 35  LYS K CA  1 
ATOM   2003 C  C   . LYS C  1 35  ? -23.650 16.833 -16.976 1.00 18.52  ? 35  LYS K C   1 
ATOM   2004 O  O   . LYS C  1 35  ? -23.683 15.747 -16.378 1.00 18.76  ? 35  LYS K O   1 
ATOM   2005 C  CB  . LYS C  1 35  ? -25.525 18.509 -16.612 1.00 22.58  ? 35  LYS K CB  1 
ATOM   2006 C  CG  . LYS C  1 35  ? -26.528 17.469 -16.096 1.00 26.22  ? 35  LYS K CG  1 
ATOM   2007 C  CD  . LYS C  1 35  ? -27.981 17.977 -16.210 1.00 31.02  ? 35  LYS K CD  1 
ATOM   2008 C  CE  . LYS C  1 35  ? -28.987 16.928 -15.735 1.00 35.96  ? 35  LYS K CE  1 
ATOM   2009 N  NZ  . LYS C  1 35  ? -30.195 17.557 -15.102 1.00 39.18  ? 35  LYS K NZ  1 
ATOM   2010 N  N   . LYS C  1 36  ? -23.282 16.922 -18.260 1.00 18.27  ? 36  LYS K N   1 
ATOM   2011 C  CA  . LYS C  1 36  ? -22.846 15.736 -18.937 1.00 19.68  ? 36  LYS K CA  1 
ATOM   2012 C  C   . LYS C  1 36  ? -21.534 15.194 -18.414 1.00 17.31  ? 36  LYS K C   1 
ATOM   2013 O  O   . LYS C  1 36  ? -21.358 13.972 -18.294 1.00 17.79  ? 36  LYS K O   1 
ATOM   2014 C  CB  . LYS C  1 36  ? -22.644 15.995 -20.421 1.00 21.60  ? 36  LYS K CB  1 
ATOM   2015 C  CG  . LYS C  1 36  ? -23.897 16.386 -21.141 1.00 27.09  ? 36  LYS K CG  1 
ATOM   2016 C  CD  . LYS C  1 36  ? -23.648 16.181 -22.646 1.00 32.52  ? 36  LYS K CD  1 
ATOM   2017 C  CE  . LYS C  1 36  ? -24.648 15.225 -23.307 1.00 37.28  ? 36  LYS K CE  1 
ATOM   2018 N  NZ  . LYS C  1 36  ? -25.927 15.866 -23.649 1.00 43.26  ? 36  LYS K NZ  1 
ATOM   2019 N  N   . LEU C  1 37  ? -20.590 16.074 -18.164 1.00 16.63  ? 37  LEU K N   1 
ATOM   2020 C  CA  . LEU C  1 37  ? -19.329 15.648 -17.479 1.00 16.50  ? 37  LEU K CA  1 
ATOM   2021 C  C   . LEU C  1 37  ? -19.610 14.860 -16.194 1.00 16.36  ? 37  LEU K C   1 
ATOM   2022 O  O   . LEU C  1 37  ? -19.057 13.763 -15.990 1.00 17.08  ? 37  LEU K O   1 
ATOM   2023 C  CB  . LEU C  1 37  ? -18.441 16.871 -17.234 1.00 15.98  ? 37  LEU K CB  1 
ATOM   2024 C  CG  . LEU C  1 37  ? -16.993 16.591 -16.809 1.00 15.82  ? 37  LEU K CG  1 
ATOM   2025 C  CD1 . LEU C  1 37  ? -16.159 17.830 -17.097 1.00 15.92  ? 37  LEU K CD1 1 
ATOM   2026 C  CD2 . LEU C  1 37  ? -16.930 16.319 -15.326 1.00 16.94  ? 37  LEU K CD2 1 
ATOM   2027 N  N   . LEU C  1 38  ? -20.416 15.412 -15.311 1.00 16.73  ? 38  LEU K N   1 
ATOM   2028 C  CA  . LEU C  1 38  ? -20.669 14.764 -14.016 1.00 17.05  ? 38  LEU K CA  1 
ATOM   2029 C  C   . LEU C  1 38  ? -21.384 13.436 -14.147 1.00 18.80  ? 38  LEU K C   1 
ATOM   2030 O  O   . LEU C  1 38  ? -21.044 12.450 -13.476 1.00 19.30  ? 38  LEU K O   1 
ATOM   2031 C  CB  . LEU C  1 38  ? -21.462 15.669 -13.079 1.00 16.81  ? 38  LEU K CB  1 
ATOM   2032 C  CG  . LEU C  1 38  ? -20.672 16.864 -12.519 1.00 16.64  ? 38  LEU K CG  1 
ATOM   2033 C  CD1 . LEU C  1 38  ? -21.667 17.942 -12.119 1.00 17.59  ? 38  LEU K CD1 1 
ATOM   2034 C  CD2 . LEU C  1 38  ? -19.660 16.525 -11.410 1.00 17.47  ? 38  LEU K CD2 1 
ATOM   2035 N  N   . GLU C  1 39  ? -22.407 13.413 -15.003 1.00 20.01  ? 39  GLU K N   1 
ATOM   2036 C  CA  . GLU C  1 39  ? -23.172 12.189 -15.260 1.00 22.55  ? 39  GLU K CA  1 
ATOM   2037 C  C   . GLU C  1 39  ? -22.323 11.039 -15.782 1.00 21.56  ? 39  GLU K C   1 
ATOM   2038 O  O   . GLU C  1 39  ? -22.583 9.907  -15.457 1.00 22.06  ? 39  GLU K O   1 
ATOM   2039 C  CB  . GLU C  1 39  ? -24.280 12.468 -16.258 1.00 26.24  ? 39  GLU K CB  1 
ATOM   2040 C  CG  . GLU C  1 39  ? -25.428 13.230 -15.632 1.00 31.61  ? 39  GLU K CG  1 
ATOM   2041 C  CD  . GLU C  1 39  ? -26.569 13.488 -16.609 1.00 36.84  ? 39  GLU K CD  1 
ATOM   2042 O  OE1 . GLU C  1 39  ? -26.325 13.602 -17.841 1.00 41.86  ? 39  GLU K OE1 1 
ATOM   2043 O  OE2 . GLU C  1 39  ? -27.714 13.568 -16.111 1.00 45.33  ? 39  GLU K OE2 1 
ATOM   2044 N  N   . THR C  1 40  ? -21.386 11.337 -16.662 1.00 20.46  ? 40  THR K N   1 
ATOM   2045 C  CA  . THR C  1 40  ? -20.518 10.348 -17.293 1.00 21.63  ? 40  THR K CA  1 
ATOM   2046 C  C   . THR C  1 40  ? -19.274 10.024 -16.477 1.00 20.72  ? 40  THR K C   1 
ATOM   2047 O  O   . THR C  1 40  ? -18.844 8.843  -16.446 1.00 22.52  ? 40  THR K O   1 
ATOM   2048 C  CB  . THR C  1 40  ? -20.060 10.845 -18.664 1.00 22.10  ? 40  THR K CB  1 
ATOM   2049 O  OG1 . THR C  1 40  ? -21.201 11.126 -19.455 1.00 27.14  ? 40  THR K OG1 1 
ATOM   2050 C  CG2 . THR C  1 40  ? -19.245 9.839  -19.413 1.00 23.01  ? 40  THR K CG2 1 
ATOM   2051 N  N   . GLU C  1 41  ? -18.690 11.014 -15.841 1.00 19.20  ? 41  GLU K N   1 
ATOM   2052 C  CA  . GLU C  1 41  ? -17.364 10.816 -15.213 1.00 18.75  ? 41  GLU K CA  1 
ATOM   2053 C  C   . GLU C  1 41  ? -17.309 10.628 -13.721 1.00 20.77  ? 41  GLU K C   1 
ATOM   2054 O  O   . GLU C  1 41  ? -16.283 10.144 -13.240 1.00 21.74  ? 41  GLU K O   1 
ATOM   2055 C  CB  . GLU C  1 41  ? -16.415 11.974 -15.536 1.00 18.53  ? 41  GLU K CB  1 
ATOM   2056 C  CG  . GLU C  1 41  ? -16.225 12.243 -17.007 1.00 17.97  ? 41  GLU K CG  1 
ATOM   2057 C  CD  . GLU C  1 41  ? -15.595 11.160 -17.858 1.00 20.44  ? 41  GLU K CD  1 
ATOM   2058 O  OE1 . GLU C  1 41  ? -14.916 10.255 -17.349 1.00 21.42  ? 41  GLU K OE1 1 
ATOM   2059 O  OE2 . GLU C  1 41  ? -15.708 11.274 -19.105 1.00 21.63  ? 41  GLU K OE2 1 
ATOM   2060 N  N   . SER C  1 42  ? -18.313 11.073 -12.987 1.00 19.71  ? 42  SER K N   1 
ATOM   2061 C  CA  A SER C  1 42  ? -18.229 11.055 -11.529 0.61 20.94  ? 42  SER K CA  1 
ATOM   2062 C  CA  B SER C  1 42  ? -18.281 11.119 -11.521 0.39 20.77  ? 42  SER K CA  1 
ATOM   2063 C  C   . SER C  1 42  ? -19.192 10.027 -10.972 1.00 21.97  ? 42  SER K C   1 
ATOM   2064 O  O   . SER C  1 42  ? -20.225 9.720  -11.583 1.00 22.52  ? 42  SER K O   1 
ATOM   2065 C  CB  A SER C  1 42  ? -18.492 12.438 -10.927 0.61 21.02  ? 42  SER K CB  1 
ATOM   2066 C  CB  B SER C  1 42  ? -18.761 12.488 -11.001 0.39 20.60  ? 42  SER K CB  1 
ATOM   2067 O  OG  A SER C  1 42  ? -19.860 12.775 -11.016 0.61 21.97  ? 42  SER K OG  1 
ATOM   2068 O  OG  B SER C  1 42  ? -17.850 13.539 -11.275 0.39 20.62  ? 42  SER K OG  1 
ATOM   2069 N  N   . PRO C  1 43  ? -18.827 9.445  -9.822  1.00 22.68  ? 43  PRO K N   1 
ATOM   2070 C  CA  . PRO C  1 43  ? -19.670 8.462  -9.203  1.00 24.47  ? 43  PRO K CA  1 
ATOM   2071 C  C   . PRO C  1 43  ? -20.876 9.157  -8.560  1.00 24.48  ? 43  PRO K C   1 
ATOM   2072 O  O   . PRO C  1 43  ? -20.876 10.373 -8.330  1.00 22.77  ? 43  PRO K O   1 
ATOM   2073 C  CB  . PRO C  1 43  ? -18.779 7.855  -8.142  1.00 25.43  ? 43  PRO K CB  1 
ATOM   2074 C  CG  . PRO C  1 43  ? -17.746 8.833  -7.870  1.00 24.39  ? 43  PRO K CG  1 
ATOM   2075 C  CD  . PRO C  1 43  ? -17.555 9.619  -9.112  1.00 23.14  ? 43  PRO K CD  1 
ATOM   2076 N  N   . GLN C  1 44  ? -21.866 8.364  -8.217  1.00 26.78  ? 44  GLN K N   1 
ATOM   2077 C  CA  . GLN C  1 44  ? -23.101 8.915  -7.708  1.00 28.80  ? 44  GLN K CA  1 
ATOM   2078 C  C   . GLN C  1 44  ? -22.915 9.761  -6.438  1.00 27.18  ? 44  GLN K C   1 
ATOM   2079 O  O   . GLN C  1 44  ? -23.601 10.786 -6.294  1.00 26.17  ? 44  GLN K O   1 
ATOM   2080 C  CB  . GLN C  1 44  ? -24.122 7.781  -7.455  1.00 34.12  ? 44  GLN K CB  1 
ATOM   2081 C  CG  . GLN C  1 44  ? -25.532 8.237  -7.041  1.00 38.48  ? 44  GLN K CG  1 
ATOM   2082 C  CD  . GLN C  1 44  ? -26.149 9.407  -7.832  1.00 43.26  ? 44  GLN K CD  1 
ATOM   2083 O  OE1 . GLN C  1 44  ? -26.096 9.491  -9.081  1.00 45.94  ? 44  GLN K OE1 1 
ATOM   2084 N  NE2 . GLN C  1 44  ? -26.793 10.316 -7.089  1.00 47.71  ? 44  GLN K NE2 1 
ATOM   2085 N  N   . TYR C  1 45  ? -21.972 9.418  -5.573  1.00 26.37  ? 45  TYR K N   1 
ATOM   2086 C  CA  . TYR C  1 45  ? -21.823 10.195 -4.315  1.00 27.43  ? 45  TYR K CA  1 
ATOM   2087 C  C   . TYR C  1 45  ? -21.297 11.610 -4.630  1.00 26.85  ? 45  TYR K C   1 
ATOM   2088 O  O   . TYR C  1 45  ? -21.552 12.523 -3.866  1.00 27.46  ? 45  TYR K O   1 
ATOM   2089 C  CB  . TYR C  1 45  ? -20.984 9.490  -3.234  1.00 28.80  ? 45  TYR K CB  1 
ATOM   2090 C  CG  . TYR C  1 45  ? -19.538 9.264  -3.568  1.00 28.32  ? 45  TYR K CG  1 
ATOM   2091 C  CD1 . TYR C  1 45  ? -18.591 10.252 -3.341  1.00 29.04  ? 45  TYR K CD1 1 
ATOM   2092 C  CD2 . TYR C  1 45  ? -19.117 8.061  -4.138  1.00 28.46  ? 45  TYR K CD2 1 
ATOM   2093 C  CE1 . TYR C  1 45  ? -17.259 10.054 -3.694  1.00 29.77  ? 45  TYR K CE1 1 
ATOM   2094 C  CE2 . TYR C  1 45  ? -17.792 7.821  -4.423  1.00 27.84  ? 45  TYR K CE2 1 
ATOM   2095 C  CZ  . TYR C  1 45  ? -16.861 8.816  -4.214  1.00 28.98  ? 45  TYR K CZ  1 
ATOM   2096 O  OH  . TYR C  1 45  ? -15.548 8.573  -4.565  1.00 29.47  ? 45  TYR K OH  1 
ATOM   2097 N  N   . ILE C  1 46  ? -20.664 11.788 -5.805  1.00 24.98  ? 46  ILE K N   1 
ATOM   2098 C  CA  . ILE C  1 46  ? -20.184 13.093 -6.289  1.00 24.93  ? 46  ILE K CA  1 
ATOM   2099 C  C   . ILE C  1 46  ? -21.315 13.789 -7.034  1.00 25.66  ? 46  ILE K C   1 
ATOM   2100 O  O   . ILE C  1 46  ? -21.600 14.929 -6.700  1.00 28.74  ? 46  ILE K O   1 
ATOM   2101 C  CB  . ILE C  1 46  ? -18.916 12.972 -7.177  1.00 24.74  ? 46  ILE K CB  1 
ATOM   2102 C  CG1 . ILE C  1 46  ? -17.723 12.487 -6.322  1.00 26.67  ? 46  ILE K CG1 1 
ATOM   2103 C  CG2 . ILE C  1 46  ? -18.616 14.289 -7.912  1.00 25.12  ? 46  ILE K CG2 1 
ATOM   2104 C  CD1 . ILE C  1 46  ? -17.174 13.496 -5.309  1.00 26.70  ? 46  ILE K CD1 1 
ATOM   2105 N  N   . ARG C  1 47  ? -21.959 13.109 -7.984  1.00 31.96  ? 47  ARG K N   1 
ATOM   2106 C  CA  . ARG C  1 47  ? -23.098 13.665 -8.760  1.00 32.85  ? 47  ARG K CA  1 
ATOM   2107 C  C   . ARG C  1 47  ? -24.259 14.186 -7.865  1.00 32.48  ? 47  ARG K C   1 
ATOM   2108 O  O   . ARG C  1 47  ? -24.930 15.158 -8.210  1.00 30.83  ? 47  ARG K O   1 
ATOM   2109 C  CB  . ARG C  1 47  ? -23.714 12.592 -9.673  1.00 35.75  ? 47  ARG K CB  1 
ATOM   2110 C  CG  . ARG C  1 47  ? -22.867 12.021 -10.790 1.00 37.67  ? 47  ARG K CG  1 
ATOM   2111 C  CD  . ARG C  1 47  ? -23.708 11.171 -11.763 1.00 40.58  ? 47  ARG K CD  1 
ATOM   2112 N  NE  . ARG C  1 47  ? -24.425 10.019 -11.193 1.00 44.88  ? 47  ARG K NE  1 
ATOM   2113 C  CZ  . ARG C  1 47  ? -23.988 8.756  -11.182 1.00 46.46  ? 47  ARG K CZ  1 
ATOM   2114 N  NH1 . ARG C  1 47  ? -22.786 8.425  -11.668 1.00 48.65  ? 47  ARG K NH1 1 
ATOM   2115 N  NH2 . ARG C  1 47  ? -24.751 7.800  -10.658 1.00 49.80  ? 47  ARG K NH2 1 
ATOM   2116 N  N   . LYS C  1 48  ? -24.522 13.532 -6.733  1.00 32.67  ? 48  LYS K N   1 
ATOM   2117 C  CA  . LYS C  1 48  ? -25.829 13.716 -6.047  1.00 34.38  ? 48  LYS K CA  1 
ATOM   2118 C  C   . LYS C  1 48  ? -26.173 15.122 -5.477  1.00 33.50  ? 48  LYS K C   1 
ATOM   2119 O  O   . LYS C  1 48  ? -27.331 15.487 -5.442  1.00 34.01  ? 48  LYS K O   1 
ATOM   2120 C  CB  . LYS C  1 48  ? -25.989 12.691 -4.965  1.00 37.10  ? 48  LYS K CB  1 
ATOM   2121 C  CG  . LYS C  1 48  ? -25.137 12.941 -3.758  1.00 39.22  ? 48  LYS K CG  1 
ATOM   2122 C  CD  . LYS C  1 48  ? -25.107 11.751 -2.817  1.00 43.01  ? 48  LYS K CD  1 
ATOM   2123 C  CE  . LYS C  1 48  ? -26.483 11.427 -2.235  1.00 45.56  ? 48  LYS K CE  1 
ATOM   2124 N  NZ  . LYS C  1 48  ? -26.963 12.454 -1.270  1.00 47.56  ? 48  LYS K NZ  1 
ATOM   2125 N  N   . LYS C  1 49  ? -25.166 15.818 -4.953  1.00 34.14  ? 49  LYS K N   1 
ATOM   2126 C  CA  . LYS C  1 49  ? -25.105 17.286 -4.742  1.00 35.38  ? 49  LYS K CA  1 
ATOM   2127 C  C   . LYS C  1 49  ? -25.902 18.106 -5.790  1.00 33.21  ? 49  LYS K C   1 
ATOM   2128 O  O   . LYS C  1 49  ? -26.772 18.969 -5.464  1.00 34.90  ? 49  LYS K O   1 
ATOM   2129 C  CB  . LYS C  1 49  ? -23.612 17.691 -4.891  1.00 35.70  ? 49  LYS K CB  1 
ATOM   2130 C  CG  . LYS C  1 49  ? -23.096 18.860 -4.067  1.00 36.28  ? 49  LYS K CG  1 
ATOM   2131 C  CD  . LYS C  1 49  ? -21.699 19.303 -4.542  1.00 35.71  ? 49  LYS K CD  1 
ATOM   2132 C  CE  . LYS C  1 49  ? -20.845 19.848 -3.401  1.00 36.98  ? 49  LYS K CE  1 
ATOM   2133 N  NZ  . LYS C  1 49  ? -19.397 19.793 -3.699  1.00 37.85  ? 49  LYS K NZ  1 
ATOM   2134 N  N   . GLY C  1 50  ? -25.602 17.807 -7.048  1.00 29.98  ? 50  GLY K N   1 
ATOM   2135 C  CA  . GLY C  1 50  ? -26.316 18.401 -8.148  1.00 28.68  ? 50  GLY K CA  1 
ATOM   2136 C  C   . GLY C  1 50  ? -25.363 19.127 -9.059  1.00 25.62  ? 50  GLY K C   1 
ATOM   2137 O  O   . GLY C  1 50  ? -24.401 19.750 -8.603  1.00 23.72  ? 50  GLY K O   1 
ATOM   2138 N  N   . ALA C  1 51  ? -25.645 19.083 -10.351 1.00 24.58  ? 51  ALA K N   1 
ATOM   2139 C  CA  . ALA C  1 51  ? -24.788 19.754 -11.313 1.00 23.12  ? 51  ALA K CA  1 
ATOM   2140 C  C   . ALA C  1 51  ? -24.780 21.276 -11.164 1.00 22.83  ? 51  ALA K C   1 
ATOM   2141 O  O   . ALA C  1 51  ? -23.711 21.889 -11.316 1.00 21.84  ? 51  ALA K O   1 
ATOM   2142 C  CB  . ALA C  1 51  ? -25.143 19.349 -12.749 1.00 23.86  ? 51  ALA K CB  1 
ATOM   2143 N  N   . ASP C  1 52  ? -25.911 21.906 -10.850 1.00 23.42  ? 52  ASP K N   1 
ATOM   2144 C  CA  . ASP C  1 52  ? -25.910 23.372 -10.679 1.00 24.21  ? 52  ASP K CA  1 
ATOM   2145 C  C   . ASP C  1 52  ? -25.106 23.762 -9.390  1.00 22.67  ? 52  ASP K C   1 
ATOM   2146 O  O   . ASP C  1 52  ? -24.429 24.812 -9.337  1.00 21.70  ? 52  ASP K O   1 
ATOM   2147 C  CB  . ASP C  1 52  ? -27.323 23.950 -10.657 1.00 27.23  ? 52  ASP K CB  1 
ATOM   2148 C  CG  . ASP C  1 52  ? -27.988 24.033 -12.071 1.00 30.08  ? 52  ASP K CG  1 
ATOM   2149 O  OD1 . ASP C  1 52  ? -27.320 23.903 -13.117 1.00 30.04  ? 52  ASP K OD1 1 
ATOM   2150 O  OD2 . ASP C  1 52  ? -29.197 24.261 -12.113 1.00 33.69  ? 52  ASP K OD2 1 
ATOM   2151 N  N   . VAL C  1 53  ? -25.191 22.927 -8.351  1.00 22.35  ? 53  VAL K N   1 
ATOM   2152 C  CA  . VAL C  1 53  ? -24.432 23.175 -7.142  1.00 21.81  ? 53  VAL K CA  1 
ATOM   2153 C  C   . VAL C  1 53  ? -22.917 23.112 -7.401  1.00 20.20  ? 53  VAL K C   1 
ATOM   2154 O  O   . VAL C  1 53  ? -22.132 23.987 -6.943  1.00 19.93  ? 53  VAL K O   1 
ATOM   2155 C  CB  . VAL C  1 53  ? -24.830 22.231 -5.991  1.00 23.31  ? 53  VAL K CB  1 
ATOM   2156 C  CG1 . VAL C  1 53  ? -23.957 22.490 -4.769  1.00 23.23  ? 53  VAL K CG1 1 
ATOM   2157 C  CG2 . VAL C  1 53  ? -26.314 22.365 -5.628  1.00 25.29  ? 53  VAL K CG2 1 
ATOM   2158 N  N   . TRP C  1 54  ? -22.489 22.062 -8.101  1.00 18.35  ? 54  TRP K N   1 
ATOM   2159 C  CA  . TRP C  1 54  ? -21.094 21.949 -8.510  1.00 16.90  ? 54  TRP K CA  1 
ATOM   2160 C  C   . TRP C  1 54  ? -20.680 23.122 -9.371  1.00 16.10  ? 54  TRP K C   1 
ATOM   2161 O  O   . TRP C  1 54  ? -19.621 23.684 -9.239  1.00 15.30  ? 54  TRP K O   1 
ATOM   2162 C  CB  . TRP C  1 54  ? -20.880 20.645 -9.234  1.00 17.17  ? 54  TRP K CB  1 
ATOM   2163 C  CG  . TRP C  1 54  ? -20.471 19.504 -8.398  1.00 18.03  ? 54  TRP K CG  1 
ATOM   2164 C  CD1 . TRP C  1 54  ? -21.186 18.326 -8.140  1.00 19.53  ? 54  TRP K CD1 1 
ATOM   2165 C  CD2 . TRP C  1 54  ? -19.232 19.396 -7.586  1.00 17.98  ? 54  TRP K CD2 1 
ATOM   2166 N  NE1 . TRP C  1 54  ? -20.469 17.509 -7.245  1.00 20.17  ? 54  TRP K NE1 1 
ATOM   2167 C  CE2 . TRP C  1 54  ? -19.278 18.103 -6.921  1.00 19.82  ? 54  TRP K CE2 1 
ATOM   2168 C  CE3 . TRP C  1 54  ? -18.109 20.199 -7.406  1.00 17.61  ? 54  TRP K CE3 1 
ATOM   2169 C  CZ2 . TRP C  1 54  ? -18.238 17.674 -6.078  1.00 20.55  ? 54  TRP K CZ2 1 
ATOM   2170 C  CZ3 . TRP C  1 54  ? -17.093 19.757 -6.548  1.00 18.70  ? 54  TRP K CZ3 1 
ATOM   2171 C  CH2 . TRP C  1 54  ? -17.157 18.542 -5.925  1.00 20.07  ? 54  TRP K CH2 1 
ATOM   2172 N  N   . PHE C  1 55  ? -21.540 23.541 -10.282 1.00 16.58  ? 55  PHE K N   1 
ATOM   2173 C  CA  . PHE C  1 55  ? -21.150 24.603 -11.194 1.00 17.05  ? 55  PHE K CA  1 
ATOM   2174 C  C   . PHE C  1 55  ? -20.889 25.884 -10.437 1.00 16.84  ? 55  PHE K C   1 
ATOM   2175 O  O   . PHE C  1 55  ? -19.908 26.575 -10.714 1.00 16.58  ? 55  PHE K O   1 
ATOM   2176 C  CB  . PHE C  1 55  ? -22.225 24.816 -12.265 1.00 18.87  ? 55  PHE K CB  1 
ATOM   2177 C  CG  . PHE C  1 55  ? -21.806 25.781 -13.319 1.00 19.48  ? 55  PHE K CG  1 
ATOM   2178 C  CD1 . PHE C  1 55  ? -21.107 25.339 -14.431 1.00 20.08  ? 55  PHE K CD1 1 
ATOM   2179 C  CD2 . PHE C  1 55  ? -22.091 27.121 -13.204 1.00 21.43  ? 55  PHE K CD2 1 
ATOM   2180 C  CE1 . PHE C  1 55  ? -20.677 26.208 -15.410 1.00 21.18  ? 55  PHE K CE1 1 
ATOM   2181 C  CE2 . PHE C  1 55  ? -21.655 28.004 -14.191 1.00 21.55  ? 55  PHE K CE2 1 
ATOM   2182 C  CZ  . PHE C  1 55  ? -20.957 27.547 -15.272 1.00 21.72  ? 55  PHE K CZ  1 
ATOM   2183 N  N   . LYS C  1 56  ? -21.747 26.217 -9.468  1.00 18.29  ? 56  LYS K N   1 
ATOM   2184 C  CA  . LYS C  1 56  ? -21.570 27.422 -8.694  1.00 19.59  ? 56  LYS K CA  1 
ATOM   2185 C  C   . LYS C  1 56  ? -20.255 27.353 -7.871  1.00 18.64  ? 56  LYS K C   1 
ATOM   2186 O  O   . LYS C  1 56  ? -19.517 28.344 -7.724  1.00 18.55  ? 56  LYS K O   1 
ATOM   2187 C  CB  . LYS C  1 56  ? -22.754 27.644 -7.739  1.00 22.40  ? 56  LYS K CB  1 
ATOM   2188 C  CG  . LYS C  1 56  ? -22.671 28.991 -7.032  1.00 24.48  ? 56  LYS K CG  1 
ATOM   2189 C  CD  . LYS C  1 56  ? -23.908 29.276 -6.202  1.00 28.54  ? 56  LYS K CD  1 
ATOM   2190 C  CE  . LYS C  1 56  ? -23.758 30.634 -5.565  1.00 31.36  ? 56  LYS K CE  1 
ATOM   2191 N  NZ  . LYS C  1 56  ? -25.031 30.984 -4.903  1.00 36.00  ? 56  LYS K NZ  1 
ATOM   2192 N  N   . GLU C  1 57  ? -19.942 26.167 -7.376  1.00 18.62  ? 57  GLU K N   1 
ATOM   2193 C  CA  . GLU C  1 57  ? -18.710 25.967 -6.630  1.00 19.17  ? 57  GLU K CA  1 
ATOM   2194 C  C   . GLU C  1 57  ? -17.465 26.127 -7.514  1.00 18.02  ? 57  GLU K C   1 
ATOM   2195 O  O   . GLU C  1 57  ? -16.431 26.717 -7.083  1.00 19.52  ? 57  GLU K O   1 
ATOM   2196 C  CB  . GLU C  1 57  ? -18.720 24.608 -5.967  1.00 20.51  ? 57  GLU K CB  1 
ATOM   2197 C  CG  . GLU C  1 57  ? -19.616 24.557 -4.752  1.00 24.67  ? 57  GLU K CG  1 
ATOM   2198 C  CD  . GLU C  1 57  ? -19.512 23.260 -4.003  1.00 26.46  ? 57  GLU K CD  1 
ATOM   2199 O  OE1 . GLU C  1 57  ? -20.405 23.073 -3.155  1.00 28.67  ? 57  GLU K OE1 1 
ATOM   2200 O  OE2 . GLU C  1 57  ? -18.590 22.404 -4.273  1.00 25.61  ? 57  GLU K OE2 1 
ATOM   2201 N  N   . LEU C  1 58  ? -17.513 25.617 -8.729  1.00 16.01  ? 58  LEU K N   1 
ATOM   2202 C  CA  . LEU C  1 58  ? -16.332 25.539 -9.580  1.00 15.16  ? 58  LEU K CA  1 
ATOM   2203 C  C   . LEU C  1 58  ? -16.083 26.795 -10.361 1.00 14.73  ? 58  LEU K C   1 
ATOM   2204 O  O   . LEU C  1 58  ? -14.939 27.047 -10.750 1.00 14.26  ? 58  LEU K O   1 
ATOM   2205 C  CB  . LEU C  1 58  ? -16.400 24.341 -10.552 1.00 15.05  ? 58  LEU K CB  1 
ATOM   2206 C  CG  . LEU C  1 58  ? -16.481 22.952 -9.932  1.00 15.30  ? 58  LEU K CG  1 
ATOM   2207 C  CD1 . LEU C  1 58  ? -16.798 21.904 -11.031 1.00 16.29  ? 58  LEU K CD1 1 
ATOM   2208 C  CD2 . LEU C  1 58  ? -15.191 22.672 -9.077  1.00 15.87  ? 58  LEU K CD2 1 
ATOM   2209 N  N   . ASP C  1 59  ? -17.138 27.556 -10.664 1.00 14.76  ? 59  ASP K N   1 
ATOM   2210 C  CA  . ASP C  1 59  ? -17.014 28.776 -11.491 1.00 14.66  ? 59  ASP K CA  1 
ATOM   2211 C  C   . ASP C  1 59  ? -16.585 29.943 -10.600 1.00 16.32  ? 59  ASP K C   1 
ATOM   2212 O  O   . ASP C  1 59  ? -17.369 30.851 -10.253 1.00 16.58  ? 59  ASP K O   1 
ATOM   2213 C  CB  . ASP C  1 59  ? -18.291 29.063 -12.288 1.00 15.29  ? 59  ASP K CB  1 
ATOM   2214 C  CG  . ASP C  1 59  ? -18.152 30.257 -13.178 1.00 15.46  ? 59  ASP K CG  1 
ATOM   2215 O  OD1 . ASP C  1 59  ? -16.992 30.689 -13.439 1.00 15.82  ? 59  ASP K OD1 1 
ATOM   2216 O  OD2 . ASP C  1 59  ? -19.196 30.768 -13.586 1.00 15.78  ? 59  ASP K OD2 1 
ATOM   2217 N  N   A ILE C  1 60  ? -15.302 29.888 -10.254 0.23 15.21  ? 60  ILE K N   1 
ATOM   2218 N  N   B ILE C  1 60  ? -15.308 29.921 -10.235 0.77 15.30  ? 60  ILE K N   1 
ATOM   2219 C  CA  A ILE C  1 60  ? -14.671 30.789 -9.299  0.23 15.40  ? 60  ILE K CA  1 
ATOM   2220 C  CA  B ILE C  1 60  ? -14.816 30.851 -9.210  0.77 15.64  ? 60  ILE K CA  1 
ATOM   2221 C  C   A ILE C  1 60  ? -14.814 32.257 -9.677  0.23 15.50  ? 60  ILE K C   1 
ATOM   2222 C  C   B ILE C  1 60  ? -14.781 32.312 -9.649  0.77 15.63  ? 60  ILE K C   1 
ATOM   2223 O  O   A ILE C  1 60  ? -15.121 33.090 -8.830  0.23 16.19  ? 60  ILE K O   1 
ATOM   2224 O  O   B ILE C  1 60  ? -14.894 33.205 -8.811  0.77 15.42  ? 60  ILE K O   1 
ATOM   2225 C  CB  A ILE C  1 60  ? -13.179 30.466 -9.201  0.23 15.11  ? 60  ILE K CB  1 
ATOM   2226 C  CB  B ILE C  1 60  ? -13.452 30.436 -8.635  0.77 16.13  ? 60  ILE K CB  1 
ATOM   2227 C  CG1 A ILE C  1 60  ? -12.980 28.966 -9.048  0.23 15.38  ? 60  ILE K CG1 1 
ATOM   2228 C  CG1 B ILE C  1 60  ? -12.360 30.456 -9.696  0.77 15.57  ? 60  ILE K CG1 1 
ATOM   2229 C  CG2 A ILE C  1 60  ? -12.567 31.161 -7.997  0.23 16.23  ? 60  ILE K CG2 1 
ATOM   2230 C  CG2 B ILE C  1 60  ? -13.552 29.074 -7.898  0.77 16.88  ? 60  ILE K CG2 1 
ATOM   2231 C  CD1 A ILE C  1 60  ? -13.135 28.495 -7.621  0.23 16.66  ? 60  ILE K CD1 1 
ATOM   2232 C  CD1 B ILE C  1 60  ? -10.959 30.134 -9.122  0.77 15.78  ? 60  ILE K CD1 1 
ATOM   2233 N  N   . ASN C  1 61  ? -14.577 32.552 -10.956 1.00 14.88  ? 61  ASN K N   1 
ATOM   2234 C  CA  . ASN C  1 61  ? -14.669 33.903 -11.496 1.00 14.75  ? 61  ASN K CA  1 
ATOM   2235 C  C   . ASN C  1 61  ? -16.015 34.299 -12.068 1.00 15.21  ? 61  ASN K C   1 
ATOM   2236 O  O   . ASN C  1 61  ? -16.151 35.378 -12.621 1.00 16.15  ? 61  ASN K O   1 
ATOM   2237 C  CB  . ASN C  1 61  ? -13.577 34.169 -12.550 1.00 14.25  ? 61  ASN K CB  1 
ATOM   2238 C  CG  . ASN C  1 61  ? -13.771 33.396 -13.815 1.00 14.90  ? 61  ASN K CG  1 
ATOM   2239 O  OD1 . ASN C  1 61  ? -14.347 32.285 -13.793 1.00 14.73  ? 61  ASN K OD1 1 
ATOM   2240 N  ND2 . ASN C  1 61  ? -13.302 33.953 -14.978 1.00 14.26  ? 61  ASN K ND2 1 
ATOM   2241 N  N   . THR C  1 62  ? -17.041 33.472 -11.814 1.00 15.63  ? 62  THR K N   1 
ATOM   2242 C  CA  . THR C  1 62  ? -18.408 33.791 -12.172 1.00 17.08  ? 62  THR K CA  1 
ATOM   2243 C  C   . THR C  1 62  ? -18.489 34.315 -13.596 1.00 16.33  ? 62  THR K C   1 
ATOM   2244 O  O   . THR C  1 62  ? -19.180 35.329 -13.895 1.00 17.86  ? 62  THR K O   1 
ATOM   2245 C  CB  . THR C  1 62  ? -19.132 34.667 -11.109 1.00 19.53  ? 62  THR K CB  1 
ATOM   2246 O  OG1 . THR C  1 62  ? -18.341 35.816 -10.811 1.00 21.84  ? 62  THR K OG1 1 
ATOM   2247 C  CG2 . THR C  1 62  ? -19.323 33.853 -9.837  1.00 21.63  ? 62  THR K CG2 1 
ATOM   2248 N  N   . ASP C  1 63  ? -17.837 33.574 -14.481 1.00 17.17  ? 63  ASP K N   1 
ATOM   2249 C  CA  . ASP C  1 63  ? -17.866 33.925 -15.903 1.00 16.14  ? 63  ASP K CA  1 
ATOM   2250 C  C   . ASP C  1 63  ? -18.736 32.990 -16.789 1.00 16.63  ? 63  ASP K C   1 
ATOM   2251 O  O   . ASP C  1 63  ? -18.738 33.131 -18.006 1.00 17.22  ? 63  ASP K O   1 
ATOM   2252 C  CB  . ASP C  1 63  ? -16.426 34.073 -16.453 1.00 16.25  ? 63  ASP K CB  1 
ATOM   2253 C  CG  . ASP C  1 63  ? -15.715 32.766 -16.626 1.00 16.20  ? 63  ASP K CG  1 
ATOM   2254 O  OD1 . ASP C  1 63  ? -16.249 31.770 -16.117 1.00 15.52  ? 63  ASP K OD1 1 
ATOM   2255 O  OD2 . ASP C  1 63  ? -14.680 32.730 -17.320 1.00 16.82  ? 63  ASP K OD2 1 
ATOM   2256 N  N   . GLY C  1 64  ? -19.426 32.050 -16.169 1.00 16.33  ? 64  GLY K N   1 
ATOM   2257 C  CA  . GLY C  1 64  ? -20.345 31.182 -16.875 1.00 17.03  ? 64  GLY K CA  1 
ATOM   2258 C  C   . GLY C  1 64  ? -19.723 29.930 -17.442 1.00 16.60  ? 64  GLY K C   1 
ATOM   2259 O  O   . GLY C  1 64  ? -20.390 29.199 -18.186 1.00 17.49  ? 64  GLY K O   1 
ATOM   2260 N  N   . ALA C  1 65  ? -18.496 29.620 -17.050 1.00 15.69  ? 65  ALA K N   1 
ATOM   2261 C  CA  . ALA C  1 65  ? -17.894 28.358 -17.477 1.00 15.71  ? 65  ALA K CA  1 
ATOM   2262 C  C   . ALA C  1 65  ? -16.868 27.880 -16.517 1.00 15.48  ? 65  ALA K C   1 
ATOM   2263 O  O   . ALA C  1 65  ? -16.385 28.637 -15.719 1.00 14.26  ? 65  ALA K O   1 
ATOM   2264 C  CB  . ALA C  1 65  ? -17.307 28.513 -18.892 1.00 17.13  ? 65  ALA K CB  1 
ATOM   2265 N  N   . VAL C  1 66  ? -16.586 26.577 -16.616 1.00 15.14  ? 66  VAL K N   1 
ATOM   2266 C  CA  . VAL C  1 66  ? -15.546 25.932 -15.873 1.00 14.47  ? 66  VAL K CA  1 
ATOM   2267 C  C   . VAL C  1 66  ? -14.355 25.753 -16.777 1.00 14.45  ? 66  VAL K C   1 
ATOM   2268 O  O   . VAL C  1 66  ? -14.421 25.027 -17.813 1.00 14.58  ? 66  VAL K O   1 
ATOM   2269 C  CB  . VAL C  1 66  ? -16.061 24.583 -15.364 1.00 15.07  ? 66  VAL K CB  1 
ATOM   2270 C  CG1 . VAL C  1 66  ? -14.934 23.782 -14.659 1.00 14.94  ? 66  VAL K CG1 1 
ATOM   2271 C  CG2 . VAL C  1 66  ? -17.237 24.847 -14.413 1.00 15.65  ? 66  VAL K CG2 1 
ATOM   2272 N  N   . ASN C  1 67  ? -13.283 26.480 -16.480 1.00 14.31  ? 67  ASN K N   1 
ATOM   2273 C  CA  . ASN C  1 67  ? -12.038 26.342 -17.204 1.00 14.32  ? 67  ASN K CA  1 
ATOM   2274 C  C   . ASN C  1 67  ? -11.175 25.163 -16.680 1.00 14.71  ? 67  ASN K C   1 
ATOM   2275 O  O   . ASN C  1 67  ? -11.603 24.426 -15.840 1.00 13.95  ? 67  ASN K O   1 
ATOM   2276 C  CB  . ASN C  1 67  ? -11.278 27.684 -17.311 1.00 15.00  ? 67  ASN K CB  1 
ATOM   2277 C  CG  . ASN C  1 67  ? -10.596 28.102 -16.050 1.00 15.04  ? 67  ASN K CG  1 
ATOM   2278 O  OD1 . ASN C  1 67  ? -10.424 27.311 -15.148 1.00 15.26  ? 67  ASN K OD1 1 
ATOM   2279 N  ND2 . ASN C  1 67  ? -10.186 29.430 -16.009 1.00 15.60  ? 67  ASN K ND2 1 
ATOM   2280 N  N   . PHE C  1 68  ? -9.992  24.954 -17.228 1.00 15.49  ? 68  PHE K N   1 
ATOM   2281 C  CA  . PHE C  1 68  ? -9.266  23.771 -16.853 1.00 15.56  ? 68  PHE K CA  1 
ATOM   2282 C  C   . PHE C  1 68  ? -8.818  23.778 -15.390 1.00 15.41  ? 68  PHE K C   1 
ATOM   2283 O  O   . PHE C  1 68  ? -8.909  22.757 -14.742 1.00 15.74  ? 68  PHE K O   1 
ATOM   2284 C  CB  . PHE C  1 68  ? -8.052  23.507 -17.750 1.00 16.63  ? 68  PHE K CB  1 
ATOM   2285 C  CG  . PHE C  1 68  ? -7.411  22.189 -17.497 1.00 16.78  ? 68  PHE K CG  1 
ATOM   2286 C  CD1 . PHE C  1 68  ? -8.138  21.008 -17.618 1.00 16.98  ? 68  PHE K CD1 1 
ATOM   2287 C  CD2 . PHE C  1 68  ? -6.111  22.089 -17.040 1.00 17.58  ? 68  PHE K CD2 1 
ATOM   2288 C  CE1 . PHE C  1 68  ? -7.590  19.784 -17.426 1.00 17.67  ? 68  PHE K CE1 1 
ATOM   2289 C  CE2 . PHE C  1 68  ? -5.545  20.835 -16.805 1.00 18.01  ? 68  PHE K CE2 1 
ATOM   2290 C  CZ  . PHE C  1 68  ? -6.272  19.675 -16.977 1.00 17.95  ? 68  PHE K CZ  1 
ATOM   2291 N  N   A GLN C  1 69  ? -8.383  24.936 -14.900 0.50 15.75  ? 69  GLN K N   1 
ATOM   2292 N  N   B GLN C  1 69  ? -8.376  24.929 -14.893 0.50 15.52  ? 69  GLN K N   1 
ATOM   2293 C  CA  A GLN C  1 69  ? -7.925  25.045 -13.507 0.50 15.93  ? 69  GLN K CA  1 
ATOM   2294 C  CA  B GLN C  1 69  ? -7.930  25.036 -13.492 0.50 15.56  ? 69  GLN K CA  1 
ATOM   2295 C  C   A GLN C  1 69  ? -9.095  24.908 -12.549 0.50 15.37  ? 69  GLN K C   1 
ATOM   2296 C  C   B GLN C  1 69  ? -9.105  24.881 -12.553 0.50 15.12  ? 69  GLN K C   1 
ATOM   2297 O  O   A GLN C  1 69  ? -8.945  24.316 -11.485 0.50 15.31  ? 69  GLN K O   1 
ATOM   2298 O  O   B GLN C  1 69  ? -8.963  24.276 -11.493 0.50 15.08  ? 69  GLN K O   1 
ATOM   2299 C  CB  A GLN C  1 69  ? -7.091  26.325 -13.269 0.50 17.26  ? 69  GLN K CB  1 
ATOM   2300 C  CB  B GLN C  1 69  ? -7.222  26.365 -13.247 0.50 16.46  ? 69  GLN K CB  1 
ATOM   2301 C  CG  A GLN C  1 69  ? -7.741  27.702 -13.503 0.50 17.81  ? 69  GLN K CG  1 
ATOM   2302 C  CG  B GLN C  1 69  ? -5.940  26.557 -14.070 0.50 17.76  ? 69  GLN K CG  1 
ATOM   2303 C  CD  A GLN C  1 69  ? -7.430  28.371 -14.858 0.50 19.16  ? 69  GLN K CD  1 
ATOM   2304 C  CD  B GLN C  1 69  ? -6.180  26.486 -15.563 0.50 18.22  ? 69  GLN K CD  1 
ATOM   2305 O  OE1 A GLN C  1 69  ? -7.437  27.684 -15.919 0.50 20.15  ? 69  GLN K OE1 1 
ATOM   2306 O  OE1 B GLN C  1 69  ? -7.016  27.204 -16.119 0.50 18.40  ? 69  GLN K OE1 1 
ATOM   2307 N  NE2 A GLN C  1 69  ? -7.213  29.776 -14.836 0.50 17.91  ? 69  GLN K NE2 1 
ATOM   2308 N  NE2 B GLN C  1 69  ? -5.475  25.568 -16.228 0.50 18.46  ? 69  GLN K NE2 1 
ATOM   2309 N  N   . GLU C  1 70  ? -10.258 25.405 -12.938 1.00 14.46  ? 70  GLU K N   1 
ATOM   2310 C  CA  . GLU C  1 70  ? -11.479 25.213 -12.170 1.00 14.60  ? 70  GLU K CA  1 
ATOM   2311 C  C   . GLU C  1 70  ? -11.872 23.738 -12.129 1.00 14.10  ? 70  GLU K C   1 
ATOM   2312 O  O   . GLU C  1 70  ? -12.265 23.225 -11.089 1.00 15.88  ? 70  GLU K O   1 
ATOM   2313 C  CB  . GLU C  1 70  ? -12.623 26.109 -12.688 1.00 14.50  ? 70  GLU K CB  1 
ATOM   2314 C  CG  . GLU C  1 70  ? -12.365 27.616 -12.480 1.00 14.56  ? 70  GLU K CG  1 
ATOM   2315 C  CD  . GLU C  1 70  ? -13.319 28.507 -13.231 1.00 14.63  ? 70  GLU K CD  1 
ATOM   2316 O  OE1 . GLU C  1 70  ? -13.616 28.202 -14.421 1.00 15.19  ? 70  GLU K OE1 1 
ATOM   2317 O  OE2 . GLU C  1 70  ? -13.715 29.593 -12.747 1.00 14.56  ? 70  GLU K OE2 1 
ATOM   2318 N  N   . PHE C  1 71  ? -11.744 23.054 -13.227 1.00 13.90  ? 71  PHE K N   1 
ATOM   2319 C  CA  . PHE C  1 71  ? -11.979 21.603 -13.276 1.00 13.81  ? 71  PHE K CA  1 
ATOM   2320 C  C   . PHE C  1 71  ? -11.045 20.839 -12.324 1.00 13.92  ? 71  PHE K C   1 
ATOM   2321 O  O   . PHE C  1 71  ? -11.416 19.825 -11.841 1.00 13.66  ? 71  PHE K O   1 
ATOM   2322 C  CB  . PHE C  1 71  ? -11.923 21.124 -14.754 1.00 14.38  ? 71  PHE K CB  1 
ATOM   2323 C  CG  . PHE C  1 71  ? -11.799 19.651 -14.938 1.00 14.74  ? 71  PHE K CG  1 
ATOM   2324 C  CD1 . PHE C  1 71  ? -12.902 18.805 -14.745 1.00 15.34  ? 71  PHE K CD1 1 
ATOM   2325 C  CD2 . PHE C  1 71  ? -10.568 19.083 -15.316 1.00 14.71  ? 71  PHE K CD2 1 
ATOM   2326 C  CE1 . PHE C  1 71  ? -12.791 17.447 -14.931 1.00 15.95  ? 71  PHE K CE1 1 
ATOM   2327 C  CE2 . PHE C  1 71  ? -10.463 17.723 -15.490 1.00 15.54  ? 71  PHE K CE2 1 
ATOM   2328 C  CZ  . PHE C  1 71  ? -11.566 16.918 -15.275 1.00 16.00  ? 71  PHE K CZ  1 
ATOM   2329 N  N   . LEU C  1 72  ? -9.809  21.289 -12.203 1.00 14.38  ? 72  LEU K N   1 
ATOM   2330 C  CA  . LEU C  1 72  ? -8.887  20.613 -11.321 1.00 15.10  ? 72  LEU K CA  1 
ATOM   2331 C  C   . LEU C  1 72  ? -9.396  20.687 -9.894  1.00 15.41  ? 72  LEU K C   1 
ATOM   2332 O  O   . LEU C  1 72  ? -8.989  19.819 -9.101  1.00 14.69  ? 72  LEU K O   1 
ATOM   2333 C  CB  . LEU C  1 72  ? -7.463  21.118 -11.447 1.00 16.64  ? 72  LEU K CB  1 
ATOM   2334 C  CG  . LEU C  1 72  ? -6.801  20.780 -12.766 1.00 17.65  ? 72  LEU K CG  1 
ATOM   2335 C  CD1 . LEU C  1 72  ? -5.420  21.462 -12.963 1.00 19.57  ? 72  LEU K CD1 1 
ATOM   2336 C  CD2 . LEU C  1 72  ? -6.654  19.287 -12.902 1.00 18.15  ? 72  LEU K CD2 1 
ATOM   2337 N  N   . ILE C  1 73  ? -10.242 21.653 -9.523  1.00 14.93  ? 73  ILE K N   1 
ATOM   2338 C  CA  . ILE C  1 73  ? -10.825 21.618 -8.151  1.00 15.91  ? 73  ILE K CA  1 
ATOM   2339 C  C   . ILE C  1 73  ? -11.657 20.369 -7.984  1.00 15.32  ? 73  ILE K C   1 
ATOM   2340 O  O   . ILE C  1 73  ? -11.591 19.712 -6.951  1.00 16.18  ? 73  ILE K O   1 
ATOM   2341 C  CB  . ILE C  1 73  ? -11.714 22.853 -7.840  1.00 16.06  ? 73  ILE K CB  1 
ATOM   2342 C  CG1 . ILE C  1 73  ? -10.867 24.100 -8.046  1.00 17.17  ? 73  ILE K CG1 1 
ATOM   2343 C  CG2 . ILE C  1 73  ? -12.345 22.793 -6.466  1.00 17.41  ? 73  ILE K CG2 1 
ATOM   2344 C  CD1 . ILE C  1 73  ? -11.662 25.398 -7.949  1.00 17.73  ? 73  ILE K CD1 1 
ATOM   2345 N  N   . LEU C  1 74  ? -12.486 20.081 -8.994  1.00 15.25  ? 74  LEU K N   1 
ATOM   2346 C  CA  . LEU C  1 74  ? -13.303 18.884 -8.947  1.00 15.32  ? 74  LEU K CA  1 
ATOM   2347 C  C   . LEU C  1 74  ? -12.421 17.642 -8.899  1.00 15.10  ? 74  LEU K C   1 
ATOM   2348 O  O   . LEU C  1 74  ? -12.689 16.725 -8.122  1.00 16.42  ? 74  LEU K O   1 
ATOM   2349 C  CB  . LEU C  1 74  ? -14.244 18.847 -10.178 1.00 15.57  ? 74  LEU K CB  1 
ATOM   2350 C  CG  . LEU C  1 74  ? -15.027 17.551 -10.354 1.00 16.28  ? 74  LEU K CG  1 
ATOM   2351 C  CD1 . LEU C  1 74  ? -16.051 17.344 -9.209  1.00 17.27  ? 74  LEU K CD1 1 
ATOM   2352 C  CD2 . LEU C  1 74  ? -15.674 17.624 -11.755 1.00 16.66  ? 74  LEU K CD2 1 
ATOM   2353 N  N   . VAL C  1 75  ? -11.383 17.593 -9.735  1.00 14.25  ? 75  VAL K N   1 
ATOM   2354 C  CA  . VAL C  1 75  ? -10.467 16.442 -9.752  1.00 14.07  ? 75  VAL K CA  1 
ATOM   2355 C  C   . VAL C  1 75  ? -9.871  16.228 -8.335  1.00 14.09  ? 75  VAL K C   1 
ATOM   2356 O  O   . VAL C  1 75  ? -9.817  15.093 -7.875  1.00 14.70  ? 75  VAL K O   1 
ATOM   2357 C  CB  . VAL C  1 75  ? -9.364  16.622 -10.734 1.00 14.09  ? 75  VAL K CB  1 
ATOM   2358 C  CG1 . VAL C  1 75  ? -8.311  15.488 -10.655 1.00 14.99  ? 75  VAL K CG1 1 
ATOM   2359 C  CG2 . VAL C  1 75  ? -9.977  16.674 -12.164 1.00 14.26  ? 75  VAL K CG2 1 
ATOM   2360 N  N   . ILE C  1 76  ? -9.347  17.285 -7.737  1.00 14.10  ? 76  ILE K N   1 
ATOM   2361 C  CA  . ILE C  1 76  ? -8.774  17.220 -6.361  1.00 14.32  ? 76  ILE K CA  1 
ATOM   2362 C  C   . ILE C  1 76  ? -9.783  16.715 -5.331  1.00 15.22  ? 76  ILE K C   1 
ATOM   2363 O  O   . ILE C  1 76  ? -9.533  15.777 -4.620  1.00 14.69  ? 76  ILE K O   1 
ATOM   2364 C  CB  . ILE C  1 76  ? -8.239  18.597 -5.879  1.00 14.17  ? 76  ILE K CB  1 
ATOM   2365 C  CG1 . ILE C  1 76  ? -6.938  18.979 -6.638  1.00 14.41  ? 76  ILE K CG1 1 
ATOM   2366 C  CG2 . ILE C  1 76  ? -7.965  18.620 -4.345  1.00 15.02  ? 76  ILE K CG2 1 
ATOM   2367 C  CD1 . ILE C  1 76  ? -6.561  20.463 -6.577  1.00 14.76  ? 76  ILE K CD1 1 
ATOM   2368 N  N   . LYS C  1 77  ? -10.991 17.249 -5.382  1.00 15.91  ? 77  LYS K N   1 
ATOM   2369 C  CA  . LYS C  1 77  ? -12.029 16.798 -4.464  1.00 17.28  ? 77  LYS K CA  1 
ATOM   2370 C  C   . LYS C  1 77  ? -12.449 15.348 -4.674  1.00 17.24  ? 77  LYS K C   1 
ATOM   2371 O  O   . LYS C  1 77  ? -12.637 14.590 -3.721  1.00 17.67  ? 77  LYS K O   1 
ATOM   2372 C  CB  . LYS C  1 77  ? -13.201 17.732 -4.563  1.00 18.56  ? 77  LYS K CB  1 
ATOM   2373 C  CG  . LYS C  1 77  ? -12.838 19.092 -3.981  1.00 20.47  ? 77  LYS K CG  1 
ATOM   2374 C  CD  . LYS C  1 77  ? -14.006 19.957 -3.676  1.00 22.83  ? 77  LYS K CD  1 
ATOM   2375 C  CE  . LYS C  1 77  ? -13.599 21.113 -2.727  1.00 24.28  ? 77  LYS K CE  1 
ATOM   2376 N  NZ  . LYS C  1 77  ? -14.766 21.979 -2.416  1.00 27.41  ? 77  LYS K NZ  1 
ATOM   2377 N  N   . MET C  1 78  ? -12.569 14.953 -5.940  1.00 16.65  ? 78  MET K N   1 
ATOM   2378 C  CA  . MET C  1 78  ? -12.842 13.552 -6.272  1.00 16.84  ? 78  MET K CA  1 
ATOM   2379 C  C   . MET C  1 78  ? -11.760 12.636 -5.762  1.00 16.26  ? 78  MET K C   1 
ATOM   2380 O  O   . MET C  1 78  ? -12.055 11.557 -5.271  1.00 17.28  ? 78  MET K O   1 
ATOM   2381 C  CB  . MET C  1 78  ? -13.030 13.385 -7.796  1.00 16.62  ? 78  MET K CB  1 
ATOM   2382 C  CG  . MET C  1 78  ? -14.353 13.894 -8.275  1.00 17.18  ? 78  MET K CG  1 
ATOM   2383 S  SD  . MET C  1 78  ? -14.652 13.640 -10.026 1.00 20.82  ? 78  MET K SD  1 
ATOM   2384 C  CE  . MET C  1 78  ? -14.493 11.854 -10.098 1.00 19.12  ? 78  MET K CE  1 
ATOM   2385 N  N   . GLY C  1 79  ? -10.497 13.046 -5.883  1.00 15.82  ? 79  GLY K N   1 
ATOM   2386 C  CA  . GLY C  1 79  ? -9.392  12.274 -5.436  1.00 15.33  ? 79  GLY K CA  1 
ATOM   2387 C  C   . GLY C  1 79  ? -9.366  12.072 -3.939  1.00 15.70  ? 79  GLY K C   1 
ATOM   2388 O  O   . GLY C  1 79  ? -9.240  10.988 -3.494  1.00 15.92  ? 79  GLY K O   1 
ATOM   2389 N  N   . VAL C  1 80  ? -9.546  13.160 -3.212  1.00 15.49  ? 80  VAL K N   1 
ATOM   2390 C  CA  . VAL C  1 80  ? -9.479  13.047 -1.767  1.00 16.17  ? 80  VAL K CA  1 
ATOM   2391 C  C   . VAL C  1 80  ? -10.623 12.144 -1.305  1.00 17.21  ? 80  VAL K C   1 
ATOM   2392 O  O   . VAL C  1 80  ? -10.454 11.320 -0.397  1.00 18.08  ? 80  VAL K O   1 
ATOM   2393 C  CB  . VAL C  1 80  ? -9.571  14.450 -1.143  1.00 16.48  ? 80  VAL K CB  1 
ATOM   2394 C  CG1 . VAL C  1 80  ? -9.862  14.350 0.346   1.00 18.13  ? 80  VAL K CG1 1 
ATOM   2395 C  CG2 . VAL C  1 80  ? -8.269  15.182 -1.466  1.00 16.09  ? 80  VAL K CG2 1 
ATOM   2396 N  N   . ALA C  1 81  ? -11.810 12.315 -1.922  1.00 17.57  ? 81  ALA K N   1 
ATOM   2397 C  CA  . ALA C  1 81  ? -12.978 11.534 -1.513  1.00 18.79  ? 81  ALA K CA  1 
ATOM   2398 C  C   . ALA C  1 81  ? -12.795 10.052 -1.793  1.00 18.90  ? 81  ALA K C   1 
ATOM   2399 O  O   . ALA C  1 81  ? -13.032 9.183  -0.942  1.00 20.08  ? 81  ALA K O   1 
ATOM   2400 C  CB  . ALA C  1 81  ? -14.217 12.044 -2.237  1.00 19.09  ? 81  ALA K CB  1 
ATOM   2401 N  N   . ALA C  1 82  ? -12.296 9.757  -2.982  1.00 18.09  ? 82  ALA K N   1 
ATOM   2402 C  CA  . ALA C  1 82  ? -12.007 8.376  -3.333  1.00 18.65  ? 82  ALA K CA  1 
ATOM   2403 C  C   . ALA C  1 82  ? -10.945 7.709  -2.455  1.00 18.68  ? 82  ALA K C   1 
ATOM   2404 O  O   . ALA C  1 82  ? -11.019 6.512  -2.138  1.00 19.87  ? 82  ALA K O   1 
ATOM   2405 C  CB  . ALA C  1 82  ? -11.613 8.319  -4.811  1.00 18.22  ? 82  ALA K CB  1 
ATOM   2406 N  N   . HIS C  1 83  ? -9.935  8.479  -2.091  1.00 18.60  ? 83  HIS K N   1 
ATOM   2407 C  CA  . HIS C  1 83  ? -8.896  7.988  -1.237  1.00 18.77  ? 83  HIS K CA  1 
ATOM   2408 C  C   . HIS C  1 83  ? -9.479  7.652  0.142   1.00 20.63  ? 83  HIS K C   1 
ATOM   2409 O  O   . HIS C  1 83  ? -9.170  6.597  0.714   1.00 20.50  ? 83  HIS K O   1 
ATOM   2410 C  CB  . HIS C  1 83  ? -7.722  8.945  -1.112  1.00 18.51  ? 83  HIS K CB  1 
ATOM   2411 C  CG  . HIS C  1 83  ? -6.783  8.587  0.052   1.00 19.46  ? 83  HIS K CG  1 
ATOM   2412 N  ND1 . HIS C  1 83  ? -6.892  9.148  1.260   1.00 21.22  ? 83  HIS K ND1 1 
ATOM   2413 C  CD2 . HIS C  1 83  ? -5.806  7.611  0.149   1.00 20.33  ? 83  HIS K CD2 1 
ATOM   2414 C  CE1 . HIS C  1 83  ? -5.966  8.570  2.103   1.00 21.82  ? 83  HIS K CE1 1 
ATOM   2415 N  NE2 . HIS C  1 83  ? -5.317  7.630  1.420   1.00 21.24  ? 83  HIS K NE2 1 
ATOM   2416 N  N   . LYS C  1 84  ? -10.336 8.520  0.678   1.00 22.01  ? 84  LYS K N   1 
ATOM   2417 C  CA  . LYS C  1 84  ? -10.987 8.262  1.962   1.00 24.28  ? 84  LYS K CA  1 
ATOM   2418 C  C   . LYS C  1 84  ? -11.816 6.973  1.877   1.00 25.01  ? 84  LYS K C   1 
ATOM   2419 O  O   . LYS C  1 84  ? -11.761 6.117  2.782   1.00 25.48  ? 84  LYS K O   1 
ATOM   2420 C  CB  . LYS C  1 84  ? -11.847 9.491  2.379   1.00 26.85  ? 84  LYS K CB  1 
ATOM   2421 C  CG  . LYS C  1 84  ? -12.615 9.353  3.670   1.00 31.78  ? 84  LYS K CG  1 
ATOM   2422 C  CD  . LYS C  1 84  ? -13.269 10.707 3.982   1.00 33.98  ? 84  LYS K CD  1 
ATOM   2423 C  CE  . LYS C  1 84  ? -14.449 10.616 4.914   1.00 38.92  ? 84  LYS K CE  1 
ATOM   2424 N  NZ  . LYS C  1 84  ? -15.167 11.904 4.862   1.00 43.31  ? 84  LYS K NZ  1 
ATOM   2425 N  N   . LYS C  1 85  ? -12.548 6.806  0.785   1.00 24.07  ? 85  LYS K N   1 
ATOM   2426 C  CA  . LYS C  1 85  ? -13.393 5.632  0.634   1.00 26.27  ? 85  LYS K CA  1 
ATOM   2427 C  C   . LYS C  1 85  ? -12.622 4.346  0.455   1.00 25.18  ? 85  LYS K C   1 
ATOM   2428 O  O   . LYS C  1 85  ? -13.121 3.260  0.803   1.00 26.30  ? 85  LYS K O   1 
ATOM   2429 C  CB  . LYS C  1 85  ? -14.352 5.811  -0.535  1.00 28.02  ? 85  LYS K CB  1 
ATOM   2430 C  CG  . LYS C  1 85  ? -15.528 6.681  -0.107  1.00 31.70  ? 85  LYS K CG  1 
ATOM   2431 C  CD  . LYS C  1 85  ? -16.574 6.852  -1.187  1.00 33.70  ? 85  LYS K CD  1 
ATOM   2432 C  CE  . LYS C  1 85  ? -17.496 8.015  -0.902  1.00 35.02  ? 85  LYS K CE  1 
ATOM   2433 N  NZ  . LYS C  1 85  ? -18.645 7.557  -0.089  1.00 39.07  ? 85  LYS K NZ  1 
ATOM   2434 N  N   . SER C  1 86  ? -11.406 4.446  -0.058  1.00 23.25  ? 86  SER K N   1 
ATOM   2435 C  CA  . SER C  1 86  ? -10.583 3.253  -0.229  1.00 23.88  ? 86  SER K CA  1 
ATOM   2436 C  C   . SER C  1 86  ? -10.242 2.622  1.129   1.00 24.84  ? 86  SER K C   1 
ATOM   2437 O  O   . SER C  1 86  ? -9.882  1.441  1.199   1.00 25.14  ? 86  SER K O   1 
ATOM   2438 C  CB  . SER C  1 86  ? -9.312  3.592  -1.060  1.00 23.20  ? 86  SER K CB  1 
ATOM   2439 O  OG  . SER C  1 86  ? -8.301  4.136  -0.215  1.00 22.92  ? 86  SER K OG  1 
ATOM   2440 N  N   . HIS C  1 87  ? -10.358 3.388  2.200   1.00 25.34  ? 87  HIS K N   1 
ATOM   2441 C  CA  . HIS C  1 87  ? -10.098 2.892  3.533   1.00 27.44  ? 87  HIS K CA  1 
ATOM   2442 C  C   . HIS C  1 87  ? -11.356 2.603  4.333   1.00 30.51  ? 87  HIS K C   1 
ATOM   2443 O  O   . HIS C  1 87  ? -11.280 2.372  5.527   1.00 32.51  ? 87  HIS K O   1 
ATOM   2444 C  CB  . HIS C  1 87  ? -9.203  3.891  4.236   1.00 26.85  ? 87  HIS K CB  1 
ATOM   2445 C  CG  . HIS C  1 87  ? -7.837  3.967  3.653   1.00 25.44  ? 87  HIS K CG  1 
ATOM   2446 N  ND1 . HIS C  1 87  ? -6.984  2.891  3.651   1.00 25.09  ? 87  HIS K ND1 1 
ATOM   2447 C  CD2 . HIS C  1 87  ? -7.150  5.021  3.089   1.00 24.00  ? 87  HIS K CD2 1 
ATOM   2448 C  CE1 . HIS C  1 87  ? -5.836  3.260  3.090   1.00 23.99  ? 87  HIS K CE1 1 
ATOM   2449 N  NE2 . HIS C  1 87  ? -5.936  4.573  2.751   1.00 23.86  ? 87  HIS K NE2 1 
ATOM   2450 N  N   . GLU C  1 88  ? -12.509 2.574  3.672   1.00 33.10  ? 88  GLU K N   1 
ATOM   2451 C  CA  . GLU C  1 88  ? -13.797 2.245  4.355   1.00 38.73  ? 88  GLU K CA  1 
ATOM   2452 C  C   . GLU C  1 88  ? -14.302 0.872  3.897   1.00 41.66  ? 88  GLU K C   1 
ATOM   2453 O  O   . GLU C  1 88  ? -14.070 0.492  2.750   1.00 42.51  ? 88  GLU K O   1 
ATOM   2454 C  CB  . GLU C  1 88  ? -14.831 3.358  4.103   1.00 39.77  ? 88  GLU K CB  1 
ATOM   2455 C  CG  . GLU C  1 88  ? -14.390 4.705  4.676   1.00 40.21  ? 88  GLU K CG  1 
ATOM   2456 C  CD  . GLU C  1 88  ? -15.222 5.900  4.227   1.00 43.02  ? 88  GLU K CD  1 
ATOM   2457 O  OE1 . GLU C  1 88  ? -15.991 5.775  3.239   1.00 43.06  ? 88  GLU K OE1 1 
ATOM   2458 O  OE2 . GLU C  1 88  ? -15.078 7.000  4.847   1.00 44.37  ? 88  GLU K OE2 1 
ATOM   2459 N  N   . GLU C  1 89  ? -14.956 0.124  4.796   1.00 48.68  ? 89  GLU K N   1 
ATOM   2460 C  CA  . GLU C  1 89  ? -15.471 -1.235 4.489   1.00 51.42  ? 89  GLU K CA  1 
ATOM   2461 C  C   . GLU C  1 89  ? -16.912 -1.177 3.984   1.00 55.16  ? 89  GLU K C   1 
ATOM   2462 O  O   . GLU C  1 89  ? -17.180 -0.647 2.903   1.00 56.03  ? 89  GLU K O   1 
ATOM   2463 C  CB  . GLU C  1 89  ? -15.380 -2.158 5.710   1.00 53.91  ? 89  GLU K CB  1 
ATOM   2464 N  N   . LYS D  2 4   ? -18.069 -0.451 -14.926 1.00 49.65  ? 4   LYS L N   1 
ATOM   2465 C  CA  . LYS D  2 4   ? -18.655 0.649  -14.120 1.00 47.44  ? 4   LYS L CA  1 
ATOM   2466 C  C   . LYS D  2 4   ? -17.781 1.895  -14.232 1.00 39.77  ? 4   LYS L C   1 
ATOM   2467 O  O   . LYS D  2 4   ? -18.245 2.888  -14.724 1.00 41.33  ? 4   LYS L O   1 
ATOM   2468 C  CB  . LYS D  2 4   ? -18.815 0.267  -12.642 1.00 50.69  ? 4   LYS L CB  1 
ATOM   2469 C  CG  . LYS D  2 4   ? -19.842 -0.824 -12.359 1.00 56.67  ? 4   LYS L CG  1 
ATOM   2470 C  CD  . LYS D  2 4   ? -21.289 -0.406 -12.604 1.00 59.20  ? 4   LYS L CD  1 
ATOM   2471 C  CE  . LYS D  2 4   ? -21.791 -0.897 -13.955 1.00 62.44  ? 4   LYS L CE  1 
ATOM   2472 N  NZ  . LYS D  2 4   ? -23.001 -0.160 -14.406 1.00 64.26  ? 4   LYS L NZ  1 
ATOM   2473 N  N   . MET D  2 5   ? -16.522 1.820  -13.825 1.00 35.29  ? 5   MET L N   1 
ATOM   2474 C  CA  . MET D  2 5   ? -15.694 3.026  -13.671 1.00 29.87  ? 5   MET L CA  1 
ATOM   2475 C  C   . MET D  2 5   ? -15.487 3.847  -14.949 1.00 27.39  ? 5   MET L C   1 
ATOM   2476 O  O   . MET D  2 5   ? -15.080 3.363  -15.971 1.00 26.44  ? 5   MET L O   1 
ATOM   2477 C  CB  . MET D  2 5   ? -14.334 2.707  -13.052 1.00 29.36  ? 5   MET L CB  1 
ATOM   2478 C  CG  . MET D  2 5   ? -14.483 2.255  -11.602 1.00 30.39  ? 5   MET L CG  1 
ATOM   2479 S  SD  . MET D  2 5   ? -12.950 1.778  -10.786 1.00 49.68  ? 5   MET L SD  1 
ATOM   2480 C  CE  . MET D  2 5   ? -12.135 3.347  -10.784 1.00 28.62  ? 5   MET L CE  1 
ATOM   2481 N  N   . SER D  2 6   ? -15.682 5.153  -14.809 1.00 24.66  ? 6   SER L N   1 
ATOM   2482 C  CA  . SER D  2 6   ? -15.366 6.075  -15.886 1.00 23.40  ? 6   SER L CA  1 
ATOM   2483 C  C   . SER D  2 6   ? -13.854 6.232  -16.060 1.00 21.74  ? 6   SER L C   1 
ATOM   2484 O  O   . SER D  2 6   ? -13.058 5.875  -15.173 1.00 20.49  ? 6   SER L O   1 
ATOM   2485 C  CB  . SER D  2 6   ? -15.943 7.452  -15.539 1.00 22.66  ? 6   SER L CB  1 
ATOM   2486 O  OG  . SER D  2 6   ? -15.166 8.053  -14.512 1.00 20.71  ? 6   SER L OG  1 
ATOM   2487 N  N   . GLN D  2 7   ? -13.480 6.862  -17.180 1.00 21.53  ? 7   GLN L N   1 
ATOM   2488 C  CA  . GLN D  2 7   ? -12.101 7.195  -17.441 1.00 20.41  ? 7   GLN L CA  1 
ATOM   2489 C  C   . GLN D  2 7   ? -11.522 8.027  -16.284 1.00 18.74  ? 7   GLN L C   1 
ATOM   2490 O  O   . GLN D  2 7   ? -10.409 7.768  -15.806 1.00 17.87  ? 7   GLN L O   1 
ATOM   2491 C  CB  . GLN D  2 7   ? -12.019 7.916  -18.756 1.00 21.54  ? 7   GLN L CB  1 
ATOM   2492 C  CG  . GLN D  2 7   ? -10.653 8.338  -19.182 1.00 21.74  ? 7   GLN L CG  1 
ATOM   2493 C  CD  . GLN D  2 7   ? -10.668 9.055  -20.551 1.00 23.86  ? 7   GLN L CD  1 
ATOM   2494 O  OE1 . GLN D  2 7   ? -11.718 9.168  -21.259 1.00 27.25  ? 7   GLN L OE1 1 
ATOM   2495 N  NE2 . GLN D  2 7   ? -9.511  9.639  -20.894 1.00 24.28  ? 7   GLN L NE2 1 
ATOM   2496 N  N   . LEU D  2 8   ? -12.290 9.034  -15.840 1.00 18.15  ? 8   LEU L N   1 
ATOM   2497 C  CA  . LEU D  2 8   ? -11.781 9.940  -14.838 1.00 17.30  ? 8   LEU L CA  1 
ATOM   2498 C  C   . LEU D  2 8   ? -11.558 9.152  -13.537 1.00 17.30  ? 8   LEU L C   1 
ATOM   2499 O  O   . LEU D  2 8   ? -10.557 9.281  -12.845 1.00 17.21  ? 8   LEU L O   1 
ATOM   2500 C  CB  . LEU D  2 8   ? -12.758 11.099 -14.623 1.00 17.14  ? 8   LEU L CB  1 
ATOM   2501 C  CG  . LEU D  2 8   ? -12.263 12.155 -13.607 1.00 16.81  ? 8   LEU L CG  1 
ATOM   2502 C  CD1 . LEU D  2 8   ? -10.870 12.722 -13.869 1.00 16.14  ? 8   LEU L CD1 1 
ATOM   2503 C  CD2 . LEU D  2 8   ? -13.319 13.271 -13.569 1.00 16.86  ? 8   LEU L CD2 1 
ATOM   2504 N  N   . GLU D  2 9   ? -12.522 8.285  -13.232 1.00 18.51  ? 9   GLU L N   1 
ATOM   2505 C  CA  . GLU D  2 9   ? -12.436 7.467  -12.027 1.00 19.53  ? 9   GLU L CA  1 
ATOM   2506 C  C   . GLU D  2 9   ? -11.233 6.537  -12.061 1.00 18.50  ? 9   GLU L C   1 
ATOM   2507 O  O   . GLU D  2 9   ? -10.541 6.363  -11.056 1.00 17.90  ? 9   GLU L O   1 
ATOM   2508 C  CB  . GLU D  2 9   ? -13.697 6.650  -11.802 1.00 21.72  ? 9   GLU L CB  1 
ATOM   2509 C  CG  . GLU D  2 9   ? -14.883 7.410  -11.262 1.00 23.83  ? 9   GLU L CG  1 
ATOM   2510 C  CD  . GLU D  2 9   ? -16.135 6.548  -11.192 1.00 27.88  ? 9   GLU L CD  1 
ATOM   2511 O  OE1 . GLU D  2 9   ? -16.711 6.149  -12.230 1.00 29.62  ? 9   GLU L OE1 1 
ATOM   2512 O  OE2 . GLU D  2 9   ? -16.550 6.245  -10.054 1.00 31.67  ? 9   GLU L OE2 1 
ATOM   2513 N  N   . ARG D  2 10  ? -10.960 5.962  -13.238 1.00 19.74  ? 10  ARG L N   1 
ATOM   2514 C  CA  . ARG D  2 10  ? -9.790  5.087  -13.392 1.00 20.32  ? 10  ARG L CA  1 
ATOM   2515 C  C   . ARG D  2 10  ? -8.501  5.864  -13.192 1.00 18.28  ? 10  ARG L C   1 
ATOM   2516 O  O   . ARG D  2 10  ? -7.513  5.369  -12.634 1.00 17.48  ? 10  ARG L O   1 
ATOM   2517 C  CB  . ARG D  2 10  ? -9.790  4.414  -14.780 1.00 23.43  ? 10  ARG L CB  1 
ATOM   2518 C  CG  . ARG D  2 10  ? -10.947 3.454  -15.033 1.00 27.46  ? 10  ARG L CG  1 
ATOM   2519 C  CD  . ARG D  2 10  ? -10.772 2.524  -16.256 1.00 33.12  ? 10  ARG L CD  1 
ATOM   2520 N  NE  . ARG D  2 10  ? -10.588 3.259  -17.533 1.00 36.91  ? 10  ARG L NE  1 
ATOM   2521 C  CZ  . ARG D  2 10  ? -11.537 3.641  -18.403 1.00 39.93  ? 10  ARG L CZ  1 
ATOM   2522 N  NH1 . ARG D  2 10  ? -12.842 3.405  -18.217 1.00 42.98  ? 10  ARG L NH1 1 
ATOM   2523 N  NH2 . ARG D  2 10  ? -11.165 4.296  -19.496 1.00 42.20  ? 10  ARG L NH2 1 
ATOM   2524 N  N   . ASN D  2 11  ? -8.487  7.109  -13.691 1.00 17.13  ? 11  ASN L N   1 
ATOM   2525 C  CA  . ASN D  2 11  ? -7.292  7.959  -13.535 1.00 15.96  ? 11  ASN L CA  1 
ATOM   2526 C  C   . ASN D  2 11  ? -6.992  8.277  -12.082 1.00 15.11  ? 11  ASN L C   1 
ATOM   2527 O  O   . ASN D  2 11  ? -5.836  8.225  -11.663 1.00 15.26  ? 11  ASN L O   1 
ATOM   2528 C  CB  . ASN D  2 11  ? -7.381  9.201  -14.403 1.00 16.01  ? 11  ASN L CB  1 
ATOM   2529 C  CG  . ASN D  2 11  ? -7.503  8.896  -15.903 1.00 16.61  ? 11  ASN L CG  1 
ATOM   2530 O  OD1 . ASN D  2 11  ? -6.993  7.829  -16.451 1.00 18.19  ? 11  ASN L OD1 1 
ATOM   2531 N  ND2 . ASN D  2 11  ? -8.155  9.799  -16.596 1.00 15.74  ? 11  ASN L ND2 1 
ATOM   2532 N  N   . ILE D  2 12  ? -8.054  8.616  -11.354 1.00 14.96  ? 12  ILE L N   1 
ATOM   2533 C  CA  . ILE D  2 12  ? -7.935  8.884  -9.928  1.00 15.24  ? 12  ILE L CA  1 
ATOM   2534 C  C   . ILE D  2 12  ? -7.488  7.619  -9.218  1.00 15.17  ? 12  ILE L C   1 
ATOM   2535 O  O   . ILE D  2 12  ? -6.635  7.675  -8.293  1.00 14.52  ? 12  ILE L O   1 
ATOM   2536 C  CB  . ILE D  2 12  ? -9.249  9.452  -9.419  1.00 16.08  ? 12  ILE L CB  1 
ATOM   2537 C  CG1 . ILE D  2 12  ? -9.412  10.864 -9.985  1.00 16.94  ? 12  ILE L CG1 1 
ATOM   2538 C  CG2 . ILE D  2 12  ? -9.252  9.363  -7.877  1.00 16.56  ? 12  ILE L CG2 1 
ATOM   2539 C  CD1 . ILE D  2 12  ? -10.778 11.444 -9.734  1.00 18.55  ? 12  ILE L CD1 1 
ATOM   2540 N  N   . GLU D  2 13  ? -8.093  6.483  -9.577  1.00 16.37  ? 13  GLU L N   1 
ATOM   2541 C  CA  . GLU D  2 13  ? -7.682  5.185  -8.997  1.00 18.11  ? 13  GLU L CA  1 
ATOM   2542 C  C   . GLU D  2 13  ? -6.152  4.933  -9.181  1.00 17.12  ? 13  GLU L C   1 
ATOM   2543 O  O   . GLU D  2 13  ? -5.473  4.511  -8.238  1.00 16.31  ? 13  GLU L O   1 
ATOM   2544 C  CB  . GLU D  2 13  ? -8.493  4.076  -9.574  1.00 21.22  ? 13  GLU L CB  1 
ATOM   2545 C  CG  . GLU D  2 13  ? -8.108  2.687  -9.031  1.00 24.38  ? 13  GLU L CG  1 
ATOM   2546 C  CD  . GLU D  2 13  ? -9.000  1.552  -9.511  1.00 28.61  ? 13  GLU L CD  1 
ATOM   2547 O  OE1 . GLU D  2 13  ? -9.440  0.745  -8.637  1.00 31.75  ? 13  GLU L OE1 1 
ATOM   2548 O  OE2 . GLU D  2 13  ? -9.225  1.446  -10.757 1.00 34.58  ? 13  GLU L OE2 1 
ATOM   2549 N  N   . THR D  2 14  ? -5.640  5.260  -10.364 1.00 16.51  ? 14  THR L N   1 
ATOM   2550 C  CA  . THR D  2 14  ? -4.209  5.153  -10.637 1.00 16.28  ? 14  THR L CA  1 
ATOM   2551 C  C   . THR D  2 14  ? -3.389  5.998  -9.693  1.00 15.49  ? 14  THR L C   1 
ATOM   2552 O  O   . THR D  2 14  ? -2.346  5.553  -9.214  1.00 15.14  ? 14  THR L O   1 
ATOM   2553 C  CB  . THR D  2 14  ? -3.823  5.432  -12.094 1.00 17.21  ? 14  THR L CB  1 
ATOM   2554 O  OG1 . THR D  2 14  ? -4.518  4.540  -12.969 1.00 17.32  ? 14  THR L OG1 1 
ATOM   2555 C  CG2 . THR D  2 14  ? -2.289  5.311  -12.360 1.00 17.70  ? 14  THR L CG2 1 
ATOM   2556 N  N   . ILE D  2 15  ? -3.854  7.223  -9.472  1.00 14.72  ? 15  ILE L N   1 
ATOM   2557 C  CA  . ILE D  2 15  ? -3.169  8.126  -8.566  1.00 13.51  ? 15  ILE L CA  1 
ATOM   2558 C  C   . ILE D  2 15  ? -3.141  7.539  -7.148  1.00 14.14  ? 15  ILE L C   1 
ATOM   2559 O  O   . ILE D  2 15  ? -2.083  7.518  -6.485  1.00 14.03  ? 15  ILE L O   1 
ATOM   2560 C  CB  . ILE D  2 15  ? -3.769  9.547  -8.602  1.00 13.50  ? 15  ILE L CB  1 
ATOM   2561 C  CG1 . ILE D  2 15  ? -3.562  10.186 -10.025 1.00 13.50  ? 15  ILE L CG1 1 
ATOM   2562 C  CG2 . ILE D  2 15  ? -3.224  10.399 -7.395  1.00 13.86  ? 15  ILE L CG2 1 
ATOM   2563 C  CD1 . ILE D  2 15  ? -4.437  11.458 -10.270 1.00 13.68  ? 15  ILE L CD1 1 
ATOM   2564 N  N   . ILE D  2 16  ? -4.298  7.082  -6.647  1.00 14.96  ? 16  ILE L N   1 
ATOM   2565 C  CA  . ILE D  2 16  ? -4.350  6.536  -5.330  1.00 15.38  ? 16  ILE L CA  1 
ATOM   2566 C  C   . ILE D  2 16  ? -3.507  5.268  -5.196  1.00 15.61  ? 16  ILE L C   1 
ATOM   2567 O  O   . ILE D  2 16  ? -2.782  5.101  -4.188  1.00 15.95  ? 16  ILE L O   1 
ATOM   2568 C  CB  . ILE D  2 16  ? -5.829  6.222  -4.946  1.00 15.80  ? 16  ILE L CB  1 
ATOM   2569 C  CG1 . ILE D  2 16  ? -6.637  7.521  -4.839  1.00 15.73  ? 16  ILE L CG1 1 
ATOM   2570 C  CG2 . ILE D  2 16  ? -5.958  5.410  -3.683  1.00 17.03  ? 16  ILE L CG2 1 
ATOM   2571 C  CD1 . ILE D  2 16  ? -8.145  7.340  -4.794  1.00 16.27  ? 16  ILE L CD1 1 
ATOM   2572 N  N   . ASN D  2 17  ? -3.589  4.416  -6.197  1.00 15.22  ? 17  ASN L N   1 
ATOM   2573 C  CA  . ASN D  2 17  ? -2.829  3.163  -6.174  1.00 15.89  ? 17  ASN L CA  1 
ATOM   2574 C  C   . ASN D  2 17  ? -1.321  3.432  -6.134  1.00 15.40  ? 17  ASN L C   1 
ATOM   2575 O  O   . ASN D  2 17  ? -0.585  2.775  -5.380  1.00 16.26  ? 17  ASN L O   1 
ATOM   2576 C  CB  . ASN D  2 17  ? -3.150  2.272  -7.346  1.00 16.02  ? 17  ASN L CB  1 
ATOM   2577 C  CG  . ASN D  2 17  ? -4.498  1.582  -7.224  1.00 17.11  ? 17  ASN L CG  1 
ATOM   2578 O  OD1 . ASN D  2 17  ? -5.077  1.476  -6.128  1.00 18.95  ? 17  ASN L OD1 1 
ATOM   2579 N  ND2 . ASN D  2 17  ? -4.988  1.091  -8.343  1.00 17.26  ? 17  ASN L ND2 1 
ATOM   2580 N  N   . THR D  2 18  ? -0.860  4.431  -6.880  1.00 14.62  ? 18  THR L N   1 
ATOM   2581 C  CA  . THR D  2 18  ? 0.572   4.723  -6.975  1.00 15.56  ? 18  THR L CA  1 
ATOM   2582 C  C   . THR D  2 18  ? 1.036   5.286  -5.658  1.00 15.37  ? 18  THR L C   1 
ATOM   2583 O  O   . THR D  2 18  ? 2.092   4.907  -5.152  1.00 16.23  ? 18  THR L O   1 
ATOM   2584 C  CB  . THR D  2 18  ? 0.871   5.679  -8.135  1.00 16.03  ? 18  THR L CB  1 
ATOM   2585 O  OG1 . THR D  2 18  ? 0.294   5.150  -9.311  1.00 17.16  ? 18  THR L OG1 1 
ATOM   2586 C  CG2 . THR D  2 18  ? 2.377   5.864  -8.335  1.00 16.56  ? 18  THR L CG2 1 
ATOM   2587 N  N   . PHE D  2 19  ? 0.269   6.199  -5.079  1.00 14.60  ? 19  PHE L N   1 
ATOM   2588 C  CA  . PHE D  2 19  ? 0.552   6.673  -3.704  1.00 15.13  ? 19  PHE L CA  1 
ATOM   2589 C  C   . PHE D  2 19  ? 0.724   5.534  -2.734  1.00 16.18  ? 19  PHE L C   1 
ATOM   2590 O  O   . PHE D  2 19  ? 1.749   5.464  -2.029  1.00 15.81  ? 19  PHE L O   1 
ATOM   2591 C  CB  . PHE D  2 19  ? -0.565  7.604  -3.212  1.00 15.26  ? 19  PHE L CB  1 
ATOM   2592 C  CG  . PHE D  2 19  ? -0.359  8.134  -1.858  1.00 16.00  ? 19  PHE L CG  1 
ATOM   2593 C  CD1 . PHE D  2 19  ? 0.357   9.309  -1.646  1.00 16.06  ? 19  PHE L CD1 1 
ATOM   2594 C  CD2 . PHE D  2 19  ? -0.981  7.513  -0.779  1.00 16.69  ? 19  PHE L CD2 1 
ATOM   2595 C  CE1 . PHE D  2 19  ? 0.525   9.779  -0.350  1.00 16.91  ? 19  PHE L CE1 1 
ATOM   2596 C  CE2 . PHE D  2 19  ? -0.799  7.970  0.500   1.00 17.84  ? 19  PHE L CE2 1 
ATOM   2597 C  CZ  . PHE D  2 19  ? -0.070  9.132  0.717   1.00 18.07  ? 19  PHE L CZ  1 
ATOM   2598 N  N   . HIS D  2 20  ? -0.264  4.661  -2.675  1.00 16.05  ? 20  HIS L N   1 
ATOM   2599 C  CA  . HIS D  2 20  ? -0.248  3.552  -1.731  1.00 16.30  ? 20  HIS L CA  1 
ATOM   2600 C  C   . HIS D  2 20  ? 0.866   2.554  -1.923  1.00 16.45  ? 20  HIS L C   1 
ATOM   2601 O  O   . HIS D  2 20  ? 1.357   1.997  -0.946  1.00 16.85  ? 20  HIS L O   1 
ATOM   2602 C  CB  . HIS D  2 20  ? -1.581  2.824  -1.772  1.00 17.06  ? 20  HIS L CB  1 
ATOM   2603 C  CG  . HIS D  2 20  ? -2.682  3.519  -0.993  1.00 17.68  ? 20  HIS L CG  1 
ATOM   2604 N  ND1 . HIS D  2 20  ? -3.977  3.405  -1.329  1.00 18.43  ? 20  HIS L ND1 1 
ATOM   2605 C  CD2 . HIS D  2 20  ? -2.641  4.306  0.191   1.00 18.94  ? 20  HIS L CD2 1 
ATOM   2606 C  CE1 . HIS D  2 20  ? -4.736  4.069  -0.431  1.00 19.32  ? 20  HIS L CE1 1 
ATOM   2607 N  NE2 . HIS D  2 20  ? -3.927  4.624  0.498   1.00 19.61  ? 20  HIS L NE2 1 
ATOM   2608 N  N   A GLN D  2 21  ? 1.270   2.327  -3.167  0.47 15.67  ? 21  GLN L N   1 
ATOM   2609 N  N   B GLN D  2 21  ? 1.291   2.315  -3.162  0.53 15.69  ? 21  GLN L N   1 
ATOM   2610 C  CA  A GLN D  2 21  ? 2.353   1.374  -3.476  0.47 16.14  ? 21  GLN L CA  1 
ATOM   2611 C  CA  B GLN D  2 21  ? 2.346   1.297  -3.406  0.53 16.29  ? 21  GLN L CA  1 
ATOM   2612 C  C   A GLN D  2 21  ? 3.626   1.739  -2.701  0.47 16.43  ? 21  GLN L C   1 
ATOM   2613 C  C   B GLN D  2 21  ? 3.712   1.733  -2.866  0.53 16.52  ? 21  GLN L C   1 
ATOM   2614 O  O   A GLN D  2 21  ? 4.335   0.876  -2.183  0.47 16.82  ? 21  GLN L O   1 
ATOM   2615 O  O   B GLN D  2 21  ? 4.603   0.895  -2.773  0.53 16.74  ? 21  GLN L O   1 
ATOM   2616 C  CB  A GLN D  2 21  ? 2.604   1.322  -4.983  0.47 16.17  ? 21  GLN L CB  1 
ATOM   2617 C  CB  B GLN D  2 21  ? 2.479   0.880  -4.876  0.53 16.52  ? 21  GLN L CB  1 
ATOM   2618 C  CG  A GLN D  2 21  ? 1.463   0.616  -5.706  0.47 16.19  ? 21  GLN L CG  1 
ATOM   2619 C  CG  B GLN D  2 21  ? 3.142   1.927  -5.747  0.53 15.87  ? 21  GLN L CG  1 
ATOM   2620 C  CD  A GLN D  2 21  ? 1.404   0.932  -7.176  0.47 16.12  ? 21  GLN L CD  1 
ATOM   2621 C  CD  B GLN D  2 21  ? 3.099   1.599  -7.210  0.53 16.20  ? 21  GLN L CD  1 
ATOM   2622 O  OE1 A GLN D  2 21  ? 2.257   1.644  -7.676  0.47 15.61  ? 21  GLN L OE1 1 
ATOM   2623 O  OE1 B GLN D  2 21  ? 2.182   0.946  -7.671  0.53 15.95  ? 21  GLN L OE1 1 
ATOM   2624 N  NE2 A GLN D  2 21  ? 0.389   0.399  -7.877  0.47 16.90  ? 21  GLN L NE2 1 
ATOM   2625 N  NE2 B GLN D  2 21  ? 4.121   2.020  -7.946  0.53 17.12  ? 21  GLN L NE2 1 
ATOM   2626 N  N   . TYR D  2 22  ? 3.874   3.037  -2.615  1.00 15.94  ? 22  TYR L N   1 
ATOM   2627 C  CA  . TYR D  2 22  ? 5.029   3.552  -1.891  1.00 16.70  ? 22  TYR L CA  1 
ATOM   2628 C  C   . TYR D  2 22  ? 4.752   3.871  -0.432  1.00 17.31  ? 22  TYR L C   1 
ATOM   2629 O  O   . TYR D  2 22  ? 5.642   3.653  0.436   1.00 18.63  ? 22  TYR L O   1 
ATOM   2630 C  CB  . TYR D  2 22  ? 5.608   4.748  -2.597  1.00 16.46  ? 22  TYR L CB  1 
ATOM   2631 C  CG  . TYR D  2 22  ? 6.058   4.424  -3.996  1.00 16.40  ? 22  TYR L CG  1 
ATOM   2632 C  CD1 . TYR D  2 22  ? 7.240   3.763  -4.243  1.00 17.82  ? 22  TYR L CD1 1 
ATOM   2633 C  CD2 . TYR D  2 22  ? 5.239   4.663  -5.081  1.00 16.44  ? 22  TYR L CD2 1 
ATOM   2634 C  CE1 . TYR D  2 22  ? 7.631   3.422  -5.512  1.00 18.86  ? 22  TYR L CE1 1 
ATOM   2635 C  CE2 . TYR D  2 22  ? 5.646   4.330  -6.347  1.00 17.32  ? 22  TYR L CE2 1 
ATOM   2636 C  CZ  . TYR D  2 22  ? 6.835   3.715  -6.573  1.00 18.28  ? 22  TYR L CZ  1 
ATOM   2637 O  OH  . TYR D  2 22  ? 7.193   3.390  -7.860  1.00 19.60  ? 22  TYR L OH  1 
ATOM   2638 N  N   . SER D  2 23  ? 3.563   4.400  -0.096  1.00 16.97  ? 23  SER L N   1 
ATOM   2639 C  CA  . SER D  2 23  ? 3.351   4.830  1.309   1.00 17.60  ? 23  SER L CA  1 
ATOM   2640 C  C   . SER D  2 23  ? 3.480   3.659  2.277   1.00 17.96  ? 23  SER L C   1 
ATOM   2641 O  O   . SER D  2 23  ? 3.863   3.797  3.466   1.00 18.44  ? 23  SER L O   1 
ATOM   2642 C  CB  . SER D  2 23  ? 1.975   5.543  1.511   1.00 17.38  ? 23  SER L CB  1 
ATOM   2643 O  OG  . SER D  2 23  ? 0.865   4.679  1.356   1.00 17.71  ? 23  SER L OG  1 
ATOM   2644 N  N   . VAL D  2 24  ? 3.095   2.490  1.803   1.00 18.31  ? 24  VAL L N   1 
ATOM   2645 C  CA  . VAL D  2 24  ? 3.063   1.284  2.627   1.00 19.48  ? 24  VAL L CA  1 
ATOM   2646 C  C   . VAL D  2 24  ? 4.429   0.730  2.966   1.00 19.92  ? 24  VAL L C   1 
ATOM   2647 O  O   . VAL D  2 24  ? 4.567   -0.121 3.868   1.00 20.57  ? 24  VAL L O   1 
ATOM   2648 C  CB  . VAL D  2 24  ? 2.229   0.186  1.932   1.00 20.09  ? 24  VAL L CB  1 
ATOM   2649 C  CG1 . VAL D  2 24  ? 3.062   -0.434 0.804   1.00 19.87  ? 24  VAL L CG1 1 
ATOM   2650 C  CG2 . VAL D  2 24  ? 1.782   -0.825 3.018   1.00 22.84  ? 24  VAL L CG2 1 
ATOM   2651 N  N   . LYS D  2 25  ? 5.479   1.198  2.304   1.00 19.17  ? 25  LYS L N   1 
ATOM   2652 C  CA  . LYS D  2 25  ? 6.766   0.501  2.445   1.00 20.36  ? 25  LYS L CA  1 
ATOM   2653 C  C   . LYS D  2 25  ? 7.390   0.621  3.853   1.00 21.44  ? 25  LYS L C   1 
ATOM   2654 O  O   . LYS D  2 25  ? 7.797   -0.372 4.442   1.00 20.87  ? 25  LYS L O   1 
ATOM   2655 C  CB  . LYS D  2 25  ? 7.721   0.967  1.340   1.00 20.43  ? 25  LYS L CB  1 
ATOM   2656 C  CG  . LYS D  2 25  ? 7.266   0.524  -0.055  1.00 20.67  ? 25  LYS L CG  1 
ATOM   2657 C  CD  . LYS D  2 25  ? 8.266   0.864  -1.159  1.00 21.71  ? 25  LYS L CD  1 
ATOM   2658 C  CE  . LYS D  2 25  ? 7.811   0.309  -2.502  1.00 22.46  ? 25  LYS L CE  1 
ATOM   2659 N  NZ  . LYS D  2 25  ? 8.955   0.202  -3.458  1.00 23.42  ? 25  LYS L NZ  1 
ATOM   2660 N  N   . LEU D  2 26  ? 7.405   1.839  4.388   1.00 21.66  ? 26  LEU L N   1 
ATOM   2661 C  CA  . LEU D  2 26  ? 8.194   2.151  5.563   1.00 23.49  ? 26  LEU L CA  1 
ATOM   2662 C  C   . LEU D  2 26  ? 7.368   3.017  6.531   1.00 24.02  ? 26  LEU L C   1 
ATOM   2663 O  O   . LEU D  2 26  ? 6.563   3.875  6.122   1.00 23.00  ? 26  LEU L O   1 
ATOM   2664 C  CB  . LEU D  2 26  ? 9.431   2.952  5.144   1.00 24.58  ? 26  LEU L CB  1 
ATOM   2665 C  CG  . LEU D  2 26  ? 10.439  2.322  4.134   1.00 25.68  ? 26  LEU L CG  1 
ATOM   2666 C  CD1 . LEU D  2 26  ? 11.452  3.399  3.782   1.00 27.62  ? 26  LEU L CD1 1 
ATOM   2667 C  CD2 . LEU D  2 26  ? 11.138  1.102  4.666   1.00 27.74  ? 26  LEU L CD2 1 
ATOM   2668 N  N   . GLY D  2 27  ? 7.578   2.841  7.832   1.00 25.83  ? 27  GLY L N   1 
ATOM   2669 C  CA  . GLY D  2 27  ? 6.894   3.704  8.750   1.00 26.82  ? 27  GLY L CA  1 
ATOM   2670 C  C   . GLY D  2 27  ? 5.395   3.688  8.640   1.00 26.61  ? 27  GLY L C   1 
ATOM   2671 O  O   . GLY D  2 27  ? 4.788   2.619  8.479   1.00 26.42  ? 27  GLY L O   1 
ATOM   2672 N  N   . HIS D  2 28  ? 4.776   4.874  8.689   1.00 27.27  ? 28  HIS L N   1 
ATOM   2673 C  CA  . HIS D  2 28  ? 3.334   4.945  8.568   1.00 27.70  ? 28  HIS L CA  1 
ATOM   2674 C  C   . HIS D  2 28  ? 2.937   4.474  7.195   1.00 25.77  ? 28  HIS L C   1 
ATOM   2675 O  O   . HIS D  2 28  ? 3.467   4.964  6.200   1.00 23.28  ? 28  HIS L O   1 
ATOM   2676 C  CB  . HIS D  2 28  ? 2.786   6.327  8.788   1.00 29.03  ? 28  HIS L CB  1 
ATOM   2677 C  CG  . HIS D  2 28  ? 1.285   6.335  9.062   1.00 31.23  ? 28  HIS L CG  1 
ATOM   2678 N  ND1 . HIS D  2 28  ? 0.348   6.178  8.088   1.00 29.72  ? 28  HIS L ND1 1 
ATOM   2679 C  CD2 . HIS D  2 28  ? 0.579   6.399  10.273  1.00 34.48  ? 28  HIS L CD2 1 
ATOM   2680 C  CE1 . HIS D  2 28  ? -0.873  6.181  8.622   1.00 32.16  ? 28  HIS L CE1 1 
ATOM   2681 N  NE2 . HIS D  2 28  ? -0.745  6.367  9.959   1.00 35.21  ? 28  HIS L NE2 1 
ATOM   2682 N  N   . PRO D  2 29  ? 1.978   3.534  7.119   1.00 26.76  ? 29  PRO L N   1 
ATOM   2683 C  CA  . PRO D  2 29  ? 1.581   2.967  5.821   1.00 26.11  ? 29  PRO L CA  1 
ATOM   2684 C  C   . PRO D  2 29  ? 0.724   3.821  4.899   1.00 25.42  ? 29  PRO L C   1 
ATOM   2685 O  O   . PRO D  2 29  ? 0.640   3.483  3.724   1.00 24.48  ? 29  PRO L O   1 
ATOM   2686 C  CB  . PRO D  2 29  ? 0.789   1.710  6.213   1.00 27.51  ? 29  PRO L CB  1 
ATOM   2687 C  CG  . PRO D  2 29  ? 0.233   2.057  7.560   1.00 28.91  ? 29  PRO L CG  1 
ATOM   2688 C  CD  . PRO D  2 29  ? 1.332   2.823  8.248   1.00 28.74  ? 29  PRO L CD  1 
ATOM   2689 N  N   A ASP D  2 30  ? 0.104   4.896  5.411   0.50 24.95  ? 30  ASP L N   1 
ATOM   2690 N  N   B ASP D  2 30  ? 0.067   4.886  5.407   0.50 25.42  ? 30  ASP L N   1 
ATOM   2691 C  CA  A ASP D  2 30  ? -0.737  5.774  4.607   0.50 24.51  ? 30  ASP L CA  1 
ATOM   2692 C  CA  B ASP D  2 30  ? -0.769  5.797  4.590   0.50 25.34  ? 30  ASP L CA  1 
ATOM   2693 C  C   A ASP D  2 30  ? -0.119  7.165  4.408   0.50 23.20  ? 30  ASP L C   1 
ATOM   2694 C  C   B ASP D  2 30  ? -0.119  7.174  4.392   0.50 23.59  ? 30  ASP L C   1 
ATOM   2695 O  O   A ASP D  2 30  ? -0.809  8.071  3.960   0.50 22.79  ? 30  ASP L O   1 
ATOM   2696 O  O   B ASP D  2 30  ? -0.789  8.087  3.929   0.50 23.13  ? 30  ASP L O   1 
ATOM   2697 C  CB  A ASP D  2 30  ? -2.160  5.905  5.187   0.50 26.50  ? 30  ASP L CB  1 
ATOM   2698 C  CB  B ASP D  2 30  ? -2.211  5.976  5.155   0.50 27.75  ? 30  ASP L CB  1 
ATOM   2699 C  CG  A ASP D  2 30  ? -3.205  6.395  4.142   0.50 26.02  ? 30  ASP L CG  1 
ATOM   2700 C  CG  B ASP D  2 30  ? -3.252  6.606  4.113   0.50 27.73  ? 30  ASP L CG  1 
ATOM   2701 O  OD1 A ASP D  2 30  ? -3.072  6.049  2.942   0.50 25.87  ? 30  ASP L OD1 1 
ATOM   2702 O  OD1 B ASP D  2 30  ? -2.890  7.121  3.026   0.50 27.51  ? 30  ASP L OD1 1 
ATOM   2703 O  OD2 A ASP D  2 30  ? -4.183  7.113  4.549   0.50 26.58  ? 30  ASP L OD2 1 
ATOM   2704 O  OD2 B ASP D  2 30  ? -4.487  6.629  4.411   0.50 28.54  ? 30  ASP L OD2 1 
ATOM   2705 N  N   . THR D  2 31  ? 1.176   7.316  4.709   1.00 22.38  ? 31  THR L N   1 
ATOM   2706 C  CA  . THR D  2 31  ? 1.909   8.524  4.330   1.00 21.39  ? 31  THR L CA  1 
ATOM   2707 C  C   . THR D  2 31  ? 3.230   8.194  3.681   1.00 20.19  ? 31  THR L C   1 
ATOM   2708 O  O   . THR D  2 31  ? 3.808   7.130  3.932   1.00 20.27  ? 31  THR L O   1 
ATOM   2709 C  CB  . THR D  2 31  ? 2.116   9.509  5.500   1.00 22.81  ? 31  THR L CB  1 
ATOM   2710 O  OG1 . THR D  2 31  ? 2.955   8.951  6.521   1.00 22.95  ? 31  THR L OG1 1 
ATOM   2711 C  CG2 . THR D  2 31  ? 0.772   9.951  6.093   1.00 23.77  ? 31  THR L CG2 1 
ATOM   2712 N  N   . LEU D  2 32  ? 3.700   9.118  2.859   1.00 18.71  ? 32  LEU L N   1 
ATOM   2713 C  CA  . LEU D  2 32  ? 4.983   9.021  2.225   1.00 18.70  ? 32  LEU L CA  1 
ATOM   2714 C  C   . LEU D  2 32  ? 6.018   9.738  3.083   1.00 19.17  ? 32  LEU L C   1 
ATOM   2715 O  O   . LEU D  2 32  ? 5.898   10.954 3.316   1.00 19.51  ? 32  LEU L O   1 
ATOM   2716 C  CB  . LEU D  2 32  ? 4.992   9.676  0.871   1.00 18.25  ? 32  LEU L CB  1 
ATOM   2717 C  CG  . LEU D  2 32  ? 4.074   9.108  -0.195  1.00 17.16  ? 32  LEU L CG  1 
ATOM   2718 C  CD1 . LEU D  2 32  ? 3.954   10.089 -1.356  1.00 17.52  ? 32  LEU L CD1 1 
ATOM   2719 C  CD2 . LEU D  2 32  ? 4.487   7.721  -0.666  1.00 17.08  ? 32  LEU L CD2 1 
ATOM   2720 N  N   . ASN D  2 33  ? 7.077   9.037  3.410   1.00 19.86  ? 33  ASN L N   1 
ATOM   2721 C  CA  . ASN D  2 33  ? 8.239   9.688  3.996   1.00 21.24  ? 33  ASN L CA  1 
ATOM   2722 C  C   . ASN D  2 33  ? 9.137   10.145 2.840   1.00 21.05  ? 33  ASN L C   1 
ATOM   2723 O  O   . ASN D  2 33  ? 8.808   9.974  1.682   1.00 20.07  ? 33  ASN L O   1 
ATOM   2724 C  CB  . ASN D  2 33  ? 8.972   8.861  5.059   1.00 22.03  ? 33  ASN L CB  1 
ATOM   2725 C  CG  . ASN D  2 33  ? 9.636   7.615  4.515   1.00 22.01  ? 33  ASN L CG  1 
ATOM   2726 O  OD1 . ASN D  2 33  ? 9.853   7.487  3.313   1.00 20.55  ? 33  ASN L OD1 1 
ATOM   2727 N  ND2 . ASN D  2 33  ? 9.948   6.672  5.397   1.00 22.93  ? 33  ASN L ND2 1 
ATOM   2728 N  N   . GLN D  2 34  ? 10.232  10.830 3.171   1.00 22.96  ? 34  GLN L N   1 
ATOM   2729 C  CA  . GLN D  2 34  ? 11.064  11.393 2.122   1.00 23.66  ? 34  GLN L CA  1 
ATOM   2730 C  C   . GLN D  2 34  ? 11.592  10.329 1.106   1.00 22.44  ? 34  GLN L C   1 
ATOM   2731 O  O   . GLN D  2 34  ? 11.598  10.559 -0.137  1.00 21.07  ? 34  GLN L O   1 
ATOM   2732 C  CB  . GLN D  2 34  ? 12.216  12.185 2.719   1.00 27.96  ? 34  GLN L CB  1 
ATOM   2733 C  CG  . GLN D  2 34  ? 12.928  12.957 1.636   1.00 30.59  ? 34  GLN L CG  1 
ATOM   2734 C  CD  . GLN D  2 34  ? 13.715  14.115 2.166   1.00 34.51  ? 34  GLN L CD  1 
ATOM   2735 O  OE1 . GLN D  2 34  ? 13.270  15.259 2.074   1.00 41.90  ? 34  GLN L OE1 1 
ATOM   2736 N  NE2 . GLN D  2 34  ? 14.886  13.851 2.649   1.00 35.04  ? 34  GLN L NE2 1 
ATOM   2737 N  N   . GLY D  2 35  ? 12.022  9.190  1.638   1.00 21.44  ? 35  GLY L N   1 
ATOM   2738 C  CA  . GLY D  2 35  ? 12.556  8.115  0.832   1.00 21.59  ? 35  GLY L CA  1 
ATOM   2739 C  C   . GLY D  2 35  ? 11.498  7.563  -0.129  1.00 20.17  ? 35  GLY L C   1 
ATOM   2740 O  O   . GLY D  2 35  ? 11.766  7.335  -1.296  1.00 21.30  ? 35  GLY L O   1 
ATOM   2741 N  N   . GLU D  2 36  ? 10.303  7.350  0.391   1.00 19.52  ? 36  GLU L N   1 
ATOM   2742 C  CA  . GLU D  2 36  ? 9.185   6.842  -0.390  1.00 18.33  ? 36  GLU L CA  1 
ATOM   2743 C  C   . GLU D  2 36  ? 8.790   7.830  -1.494  1.00 18.10  ? 36  GLU L C   1 
ATOM   2744 O  O   . GLU D  2 36  ? 8.536   7.453  -2.612  1.00 18.56  ? 36  GLU L O   1 
ATOM   2745 C  CB  . GLU D  2 36  ? 7.970   6.520  0.504   1.00 18.37  ? 36  GLU L CB  1 
ATOM   2746 C  CG  . GLU D  2 36  ? 8.171   5.420  1.542   1.00 18.50  ? 36  GLU L CG  1 
ATOM   2747 C  CD  . GLU D  2 36  ? 7.094   5.327  2.630   1.00 19.35  ? 36  GLU L CD  1 
ATOM   2748 O  OE1 . GLU D  2 36  ? 6.523   6.347  2.970   1.00 18.82  ? 36  GLU L OE1 1 
ATOM   2749 O  OE2 . GLU D  2 36  ? 6.842   4.217  3.161   1.00 19.38  ? 36  GLU L OE2 1 
ATOM   2750 N  N   . PHE D  2 37  ? 8.747   9.106  -1.147  1.00 18.28  ? 37  PHE L N   1 
ATOM   2751 C  CA  . PHE D  2 37  ? 8.379   10.119 -2.118  1.00 17.91  ? 37  PHE L CA  1 
ATOM   2752 C  C   . PHE D  2 37  ? 9.433   10.197 -3.239  1.00 18.76  ? 37  PHE L C   1 
ATOM   2753 O  O   . PHE D  2 37  ? 9.111   10.262 -4.421  1.00 18.68  ? 37  PHE L O   1 
ATOM   2754 C  CB  . PHE D  2 37  ? 8.266   11.471 -1.433  1.00 18.42  ? 37  PHE L CB  1 
ATOM   2755 C  CG  . PHE D  2 37  ? 7.946   12.620 -2.363  1.00 18.43  ? 37  PHE L CG  1 
ATOM   2756 C  CD1 . PHE D  2 37  ? 6.709   12.742 -2.980  1.00 18.28  ? 37  PHE L CD1 1 
ATOM   2757 C  CD2 . PHE D  2 37  ? 8.904   13.601 -2.628  1.00 19.71  ? 37  PHE L CD2 1 
ATOM   2758 C  CE1 . PHE D  2 37  ? 6.421   13.807 -3.810  1.00 18.77  ? 37  PHE L CE1 1 
ATOM   2759 C  CE2 . PHE D  2 37  ? 8.616   14.666 -3.484  1.00 19.97  ? 37  PHE L CE2 1 
ATOM   2760 C  CZ  . PHE D  2 37  ? 7.386   14.770 -4.076  1.00 19.25  ? 37  PHE L CZ  1 
ATOM   2761 N  N   . LYS D  2 38  ? 10.701  10.174 -2.832  1.00 18.14  ? 38  LYS L N   1 
ATOM   2762 C  CA  . LYS D  2 38  ? 11.794  10.200 -3.782  1.00 19.02  ? 38  LYS L CA  1 
ATOM   2763 C  C   . LYS D  2 38  ? 11.707  9.005  -4.732  1.00 19.36  ? 38  LYS L C   1 
ATOM   2764 O  O   . LYS D  2 38  ? 11.956  9.162  -5.928  1.00 18.77  ? 38  LYS L O   1 
ATOM   2765 C  CB  . LYS D  2 38  ? 13.128  10.221 -3.033  1.00 20.19  ? 38  LYS L CB  1 
ATOM   2766 C  CG  . LYS D  2 38  ? 13.538  11.568 -2.585  1.00 20.25  ? 38  LYS L CG  1 
ATOM   2767 C  CD  . LYS D  2 38  ? 14.805  11.465 -1.750  1.00 21.11  ? 38  LYS L CD  1 
ATOM   2768 C  CE  . LYS D  2 38  ? 15.281  12.838 -1.364  1.00 22.09  ? 38  LYS L CE  1 
ATOM   2769 N  NZ  . LYS D  2 38  ? 16.454  12.783 -0.411  1.00 23.68  ? 38  LYS L NZ  1 
ATOM   2770 N  N   . GLU D  2 39  ? 11.387  7.823  -4.192  1.00 20.03  ? 39  GLU L N   1 
ATOM   2771 C  CA  . GLU D  2 39  ? 11.239  6.656  -5.044  1.00 20.10  ? 39  GLU L CA  1 
ATOM   2772 C  C   . GLU D  2 39  ? 10.089  6.797  -6.037  1.00 18.59  ? 39  GLU L C   1 
ATOM   2773 O  O   . GLU D  2 39  ? 10.235  6.545  -7.235  1.00 18.34  ? 39  GLU L O   1 
ATOM   2774 C  CB  . GLU D  2 39  ? 11.060  5.378  -4.222  1.00 21.03  ? 39  GLU L CB  1 
ATOM   2775 C  CG  . GLU D  2 39  ? 11.223  4.121  -5.047  1.00 22.42  ? 39  GLU L CG  1 
ATOM   2776 C  CD  . GLU D  2 39  ? 10.830  2.794  -4.373  1.00 24.42  ? 39  GLU L CD  1 
ATOM   2777 O  OE1 . GLU D  2 39  ? 10.443  2.776  -3.202  1.00 25.15  ? 39  GLU L OE1 1 
ATOM   2778 O  OE2 . GLU D  2 39  ? 10.930  1.741  -5.037  1.00 26.09  ? 39  GLU L OE2 1 
ATOM   2779 N  N   . LEU D  2 40  ? 8.933   7.217  -5.542  1.00 17.80  ? 40  LEU L N   1 
ATOM   2780 C  CA  . LEU D  2 40  ? 7.775   7.463  -6.441  1.00 17.38  ? 40  LEU L CA  1 
ATOM   2781 C  C   . LEU D  2 40  ? 8.135   8.441  -7.572  1.00 16.79  ? 40  LEU L C   1 
ATOM   2782 O  O   . LEU D  2 40  ? 7.829   8.207  -8.761  1.00 16.57  ? 40  LEU L O   1 
ATOM   2783 C  CB  . LEU D  2 40  ? 6.586   7.971  -5.627  1.00 17.35  ? 40  LEU L CB  1 
ATOM   2784 C  CG  . LEU D  2 40  ? 5.212   8.218  -6.287  1.00 16.83  ? 40  LEU L CG  1 
ATOM   2785 C  CD1 . LEU D  2 40  ? 4.172   8.333  -5.148  1.00 17.30  ? 40  LEU L CD1 1 
ATOM   2786 C  CD2 . LEU D  2 40  ? 5.159   9.440  -7.219  1.00 17.25  ? 40  LEU L CD2 1 
ATOM   2787 N  N   . VAL D  2 41  ? 8.763   9.566  -7.214  1.00 16.61  ? 41  VAL L N   1 
ATOM   2788 C  CA  . VAL D  2 41  ? 9.130   10.562 -8.198  1.00 17.46  ? 41  VAL L CA  1 
ATOM   2789 C  C   . VAL D  2 41  ? 10.161  10.036 -9.227  1.00 17.21  ? 41  VAL L C   1 
ATOM   2790 O  O   . VAL D  2 41  ? 10.041  10.283 -10.428 1.00 17.89  ? 41  VAL L O   1 
ATOM   2791 C  CB  . VAL D  2 41  ? 9.639   11.828 -7.518  1.00 17.82  ? 41  VAL L CB  1 
ATOM   2792 C  CG1 . VAL D  2 41  ? 10.236  12.750 -8.549  1.00 19.18  ? 41  VAL L CG1 1 
ATOM   2793 C  CG2 . VAL D  2 41  ? 8.489   12.497 -6.719  1.00 16.72  ? 41  VAL L CG2 1 
ATOM   2794 N  N   . ARG D  2 42  ? 11.150  9.303  -8.756  1.00 18.76  ? 42  ARG L N   1 
ATOM   2795 C  CA  . ARG D  2 42  ? 12.228  8.749  -9.560  1.00 20.10  ? 42  ARG L CA  1 
ATOM   2796 C  C   . ARG D  2 42  ? 11.669  7.737  -10.558 1.00 20.29  ? 42  ARG L C   1 
ATOM   2797 O  O   . ARG D  2 42  ? 12.134  7.656  -11.666 1.00 20.36  ? 42  ARG L O   1 
ATOM   2798 C  CB  . ARG D  2 42  ? 13.271  8.110  -8.635  1.00 22.65  ? 42  ARG L CB  1 
ATOM   2799 C  CG  . ARG D  2 42  ? 14.333  7.336  -9.299  1.00 25.01  ? 42  ARG L CG  1 
ATOM   2800 C  CD  . ARG D  2 42  ? 15.429  6.975  -8.303  1.00 26.58  ? 42  ARG L CD  1 
ATOM   2801 N  NE  . ARG D  2 42  ? 15.062  5.947  -7.327  1.00 27.21  ? 42  ARG L NE  1 
ATOM   2802 C  CZ  . ARG D  2 42  ? 14.961  4.634  -7.602  1.00 29.42  ? 42  ARG L CZ  1 
ATOM   2803 N  NH1 . ARG D  2 42  ? 14.653  3.765  -6.652  1.00 30.67  ? 42  ARG L NH1 1 
ATOM   2804 N  NH2 . ARG D  2 42  ? 15.173  4.162  -8.819  1.00 29.64  ? 42  ARG L NH2 1 
ATOM   2805 N  N   . LYS D  2 43  ? 10.701  6.939  -10.129 1.00 19.49  ? 43  LYS L N   1 
ATOM   2806 C  CA  . LYS D  2 43  ? 10.143  5.879  -10.964 1.00 19.94  ? 43  LYS L CA  1 
ATOM   2807 C  C   . LYS D  2 43  ? 8.934   6.330  -11.754 1.00 19.96  ? 43  LYS L C   1 
ATOM   2808 O  O   . LYS D  2 43  ? 8.947   6.289  -12.994 1.00 19.92  ? 43  LYS L O   1 
ATOM   2809 C  CB  . LYS D  2 43  ? 9.842   4.669  -10.097 1.00 20.93  ? 43  LYS L CB  1 
ATOM   2810 C  CG  . LYS D  2 43  ? 11.101  3.965  -9.590  1.00 22.37  ? 43  LYS L CG  1 
ATOM   2811 C  CD  . LYS D  2 43  ? 10.738  2.673  -8.868  1.00 24.44  ? 43  LYS L CD  1 
ATOM   2812 C  CE  . LYS D  2 43  ? 11.965  1.904  -8.413  1.00 27.07  ? 43  LYS L CE  1 
ATOM   2813 N  NZ  . LYS D  2 43  ? 11.651  0.803  -7.429  1.00 28.78  ? 43  LYS L NZ  1 
ATOM   2814 N  N   . ASP D  2 44  ? 7.895   6.726  -11.037 1.00 18.83  ? 44  ASP L N   1 
ATOM   2815 C  CA  . ASP D  2 44  ? 6.618   7.016  -11.700 1.00 18.96  ? 44  ASP L CA  1 
ATOM   2816 C  C   . ASP D  2 44  ? 6.468   8.422  -12.283 1.00 18.10  ? 44  ASP L C   1 
ATOM   2817 O  O   . ASP D  2 44  ? 5.579   8.629  -13.083 1.00 18.43  ? 44  ASP L O   1 
ATOM   2818 C  CB  . ASP D  2 44  ? 5.486   6.656  -10.776 1.00 19.97  ? 44  ASP L CB  1 
ATOM   2819 C  CG  . ASP D  2 44  ? 5.445   5.187  -10.533 1.00 21.77  ? 44  ASP L CG  1 
ATOM   2820 O  OD1 . ASP D  2 44  ? 5.387   4.400  -11.494 1.00 23.03  ? 44  ASP L OD1 1 
ATOM   2821 O  OD2 . ASP D  2 44  ? 5.614   4.822  -9.390  1.00 24.39  ? 44  ASP L OD2 1 
ATOM   2822 N  N   . LEU D  2 45  ? 7.404   9.319  -12.006 1.00 17.50  ? 45  LEU L N   1 
ATOM   2823 C  CA  . LEU D  2 45  ? 7.418   10.656 -12.631 1.00 17.50  ? 45  LEU L CA  1 
ATOM   2824 C  C   . LEU D  2 45  ? 8.761   10.854 -13.338 1.00 17.78  ? 45  LEU L C   1 
ATOM   2825 O  O   . LEU D  2 45  ? 9.279   11.961 -13.432 1.00 18.21  ? 45  LEU L O   1 
ATOM   2826 C  CB  . LEU D  2 45  ? 7.080   11.754 -11.617 1.00 17.41  ? 45  LEU L CB  1 
ATOM   2827 C  CG  . LEU D  2 45  ? 5.702   11.699 -10.969 1.00 17.08  ? 45  LEU L CG  1 
ATOM   2828 C  CD1 . LEU D  2 45  ? 5.566   12.654 -9.769  1.00 18.05  ? 45  LEU L CD1 1 
ATOM   2829 C  CD2 . LEU D  2 45  ? 4.671   11.998 -12.060 1.00 17.39  ? 45  LEU L CD2 1 
ATOM   2830 N  N   . GLN D  2 46  ? 9.370   9.763  -13.792 1.00 18.91  ? 46  GLN L N   1 
ATOM   2831 C  CA  . GLN D  2 46  ? 10.684  9.848  -14.427 1.00 19.19  ? 46  GLN L CA  1 
ATOM   2832 C  C   . GLN D  2 46  ? 10.744  10.769 -15.662 1.00 19.69  ? 46  GLN L C   1 
ATOM   2833 O  O   . GLN D  2 46  ? 11.816  11.322 -15.980 1.00 20.79  ? 46  GLN L O   1 
ATOM   2834 C  CB  . GLN D  2 46  ? 11.213  8.449  -14.810 1.00 19.96  ? 46  GLN L CB  1 
ATOM   2835 C  CG  . GLN D  2 46  ? 10.416  7.685  -15.813 1.00 20.83  ? 46  GLN L CG  1 
ATOM   2836 C  CD  . GLN D  2 46  ? 11.005  6.292  -15.990 1.00 22.91  ? 46  GLN L CD  1 
ATOM   2837 O  OE1 . GLN D  2 46  ? 10.712  5.353  -15.219 1.00 25.66  ? 46  GLN L OE1 1 
ATOM   2838 N  NE2 . GLN D  2 46  ? 11.850  6.150  -16.995 1.00 23.44  ? 46  GLN L NE2 1 
ATOM   2839 N  N   . ASN D  2 47  ? 9.629   10.908 -16.388 1.00 19.50  ? 47  ASN L N   1 
ATOM   2840 C  CA  . ASN D  2 47  ? 9.569   11.833 -17.512 1.00 20.03  ? 47  ASN L CA  1 
ATOM   2841 C  C   . ASN D  2 47  ? 9.074   13.216 -17.190 1.00 19.42  ? 47  ASN L C   1 
ATOM   2842 O  O   . ASN D  2 47  ? 9.673   14.225 -17.603 1.00 20.40  ? 47  ASN L O   1 
ATOM   2843 C  CB  . ASN D  2 47  ? 8.718   11.213 -18.648 1.00 20.41  ? 47  ASN L CB  1 
ATOM   2844 C  CG  . ASN D  2 47  ? 9.174   9.821  -18.982 1.00 21.24  ? 47  ASN L CG  1 
ATOM   2845 O  OD1 . ASN D  2 47  ? 10.311  9.665  -19.478 1.00 23.32  ? 47  ASN L OD1 1 
ATOM   2846 N  ND2 . ASN D  2 47  ? 8.346   8.795  -18.704 1.00 20.61  ? 47  ASN L ND2 1 
ATOM   2847 N  N   . PHE D  2 48  ? 7.989   13.272 -16.447 1.00 18.40  ? 48  PHE L N   1 
ATOM   2848 C  CA  . PHE D  2 48  ? 7.371   14.558 -16.092 1.00 18.41  ? 48  PHE L CA  1 
ATOM   2849 C  C   . PHE D  2 48  ? 8.308   15.408 -15.206 1.00 19.14  ? 48  PHE L C   1 
ATOM   2850 O  O   . PHE D  2 48  ? 8.325   16.643 -15.324 1.00 20.62  ? 48  PHE L O   1 
ATOM   2851 C  CB  . PHE D  2 48  ? 6.069   14.303 -15.330 1.00 17.47  ? 48  PHE L CB  1 
ATOM   2852 C  CG  . PHE D  2 48  ? 4.823   14.163 -16.195 1.00 17.31  ? 48  PHE L CG  1 
ATOM   2853 C  CD1 . PHE D  2 48  ? 4.870   13.670 -17.464 1.00 18.47  ? 48  PHE L CD1 1 
ATOM   2854 C  CD2 . PHE D  2 48  ? 3.598   14.505 -15.682 1.00 17.08  ? 48  PHE L CD2 1 
ATOM   2855 C  CE1 . PHE D  2 48  ? 3.713   13.550 -18.257 1.00 18.58  ? 48  PHE L CE1 1 
ATOM   2856 C  CE2 . PHE D  2 48  ? 2.424   14.333 -16.434 1.00 17.08  ? 48  PHE L CE2 1 
ATOM   2857 C  CZ  . PHE D  2 48  ? 2.488   13.883 -17.702 1.00 18.13  ? 48  PHE L CZ  1 
ATOM   2858 N  N   . LEU D  2 49  ? 9.059   14.746 -14.339 1.00 18.36  ? 49  LEU L N   1 
ATOM   2859 C  CA  . LEU D  2 49  ? 10.048  15.398 -13.492 1.00 19.09  ? 49  LEU L CA  1 
ATOM   2860 C  C   . LEU D  2 49  ? 11.499  14.964 -13.827 1.00 20.27  ? 49  LEU L C   1 
ATOM   2861 O  O   . LEU D  2 49  ? 12.354  14.764 -12.917 1.00 19.46  ? 49  LEU L O   1 
ATOM   2862 C  CB  . LEU D  2 49  ? 9.716   15.101 -12.019 1.00 18.56  ? 49  LEU L CB  1 
ATOM   2863 C  CG  . LEU D  2 49  ? 8.453   15.840 -11.496 1.00 18.43  ? 49  LEU L CG  1 
ATOM   2864 C  CD1 . LEU D  2 49  ? 8.079   15.425 -10.085 1.00 17.40  ? 49  LEU L CD1 1 
ATOM   2865 C  CD2 . LEU D  2 49  ? 8.589   17.351 -11.566 1.00 19.55  ? 49  LEU L CD2 1 
ATOM   2866 N  N   . LYS D  2 50  ? 11.798  14.814 -15.111 1.00 21.17  ? 50  LYS L N   1 
ATOM   2867 C  CA  . LYS D  2 50  ? 13.087  14.318 -15.539 1.00 24.44  ? 50  LYS L CA  1 
ATOM   2868 C  C   . LYS D  2 50  ? 14.214  15.258 -15.125 1.00 25.17  ? 50  LYS L C   1 
ATOM   2869 O  O   . LYS D  2 50  ? 15.218  14.813 -14.559 1.00 26.04  ? 50  LYS L O   1 
ATOM   2870 C  CB  . LYS D  2 50  ? 13.128  14.144 -17.042 1.00 27.34  ? 50  LYS L CB  1 
ATOM   2871 C  CG  . LYS D  2 50  ? 14.490  13.674 -17.542 1.00 30.34  ? 50  LYS L CG  1 
ATOM   2872 C  CD  . LYS D  2 50  ? 14.438  12.826 -18.796 1.00 34.23  ? 50  LYS L CD  1 
ATOM   2873 C  CE  . LYS D  2 50  ? 13.884  13.594 -19.972 1.00 37.44  ? 50  LYS L CE  1 
ATOM   2874 N  NZ  . LYS D  2 50  ? 14.082  12.839 -21.260 1.00 41.98  ? 50  LYS L NZ  1 
ATOM   2875 N  N   . LYS D  2 51  ? 14.032  16.551 -15.372 1.00 25.35  ? 51  LYS L N   1 
ATOM   2876 C  CA  . LYS D  2 51  ? 15.078  17.508 -14.997 1.00 27.81  ? 51  LYS L CA  1 
ATOM   2877 C  C   . LYS D  2 51  ? 15.245  17.550 -13.454 1.00 26.46  ? 51  LYS L C   1 
ATOM   2878 O  O   . LYS D  2 51  ? 16.369  17.447 -12.920 1.00 26.32  ? 51  LYS L O   1 
ATOM   2879 C  CB  . LYS D  2 51  ? 14.759  18.900 -15.527 1.00 30.29  ? 51  LYS L CB  1 
ATOM   2880 C  CG  . LYS D  2 51  ? 15.841  19.903 -15.158 1.00 33.61  ? 51  LYS L CG  1 
ATOM   2881 C  CD  . LYS D  2 51  ? 15.736  21.282 -15.802 1.00 36.80  ? 51  LYS L CD  1 
ATOM   2882 C  CE  . LYS D  2 51  ? 16.999  22.067 -15.425 1.00 39.14  ? 51  LYS L CE  1 
ATOM   2883 N  NZ  . LYS D  2 51  ? 17.219  23.335 -16.180 1.00 42.84  ? 51  LYS L NZ  1 
ATOM   2884 N  N   . GLU D  2 52  ? 14.129  17.701 -12.747 1.00 24.66  ? 52  GLU L N   1 
ATOM   2885 C  CA  . GLU D  2 52  ? 14.125  17.797 -11.297 1.00 24.31  ? 52  GLU L CA  1 
ATOM   2886 C  C   . GLU D  2 52  ? 14.746  16.564 -10.629 1.00 23.28  ? 52  GLU L C   1 
ATOM   2887 O  O   . GLU D  2 52  ? 15.444  16.686 -9.631  1.00 22.84  ? 52  GLU L O   1 
ATOM   2888 C  CB  . GLU D  2 52  ? 12.689  17.987 -10.780 1.00 24.36  ? 52  GLU L CB  1 
ATOM   2889 C  CG  . GLU D  2 52  ? 12.003  19.288 -11.247 1.00 24.79  ? 52  GLU L CG  1 
ATOM   2890 C  CD  . GLU D  2 52  ? 11.357  19.224 -12.629 1.00 25.50  ? 52  GLU L CD  1 
ATOM   2891 O  OE1 . GLU D  2 52  ? 11.586  18.277 -13.433 1.00 26.19  ? 52  GLU L OE1 1 
ATOM   2892 O  OE2 . GLU D  2 52  ? 10.565  20.158 -12.938 1.00 28.69  ? 52  GLU L OE2 1 
ATOM   2893 N  N   . ASN D  2 53  ? 14.469  15.377 -11.165 1.00 22.44  ? 53  ASN L N   1 
ATOM   2894 C  CA  . ASN D  2 53  ? 15.069  14.123 -10.656 1.00 23.16  ? 53  ASN L CA  1 
ATOM   2895 C  C   . ASN D  2 53  ? 16.612  14.091 -10.676 1.00 23.84  ? 53  ASN L C   1 
ATOM   2896 O  O   . ASN D  2 53  ? 17.203  13.329 -9.939  1.00 24.83  ? 53  ASN L O   1 
ATOM   2897 C  CB  . ASN D  2 53  ? 14.551  12.879 -11.431 1.00 22.64  ? 53  ASN L CB  1 
ATOM   2898 C  CG  . ASN D  2 53  ? 13.330  12.269 -10.781 1.00 22.30  ? 53  ASN L CG  1 
ATOM   2899 O  OD1 . ASN D  2 53  ? 13.367  11.945 -9.588  1.00 24.51  ? 53  ASN L OD1 1 
ATOM   2900 N  ND2 . ASN D  2 53  ? 12.239  12.129 -11.546 1.00 20.98  ? 53  ASN L ND2 1 
ATOM   2901 N  N   . LYS D  2 54  ? 17.245  14.946 -11.482 1.00 25.33  ? 54  LYS L N   1 
ATOM   2902 C  CA  . LYS D  2 54  ? 18.713  15.043 -11.470 1.00 27.11  ? 54  LYS L CA  1 
ATOM   2903 C  C   . LYS D  2 54  ? 19.263  15.765 -10.244 1.00 26.72  ? 54  LYS L C   1 
ATOM   2904 O  O   . LYS D  2 54  ? 20.448  15.704 -9.982  1.00 26.98  ? 54  LYS L O   1 
ATOM   2905 C  CB  . LYS D  2 54  ? 19.208  15.722 -12.730 1.00 29.92  ? 54  LYS L CB  1 
ATOM   2906 C  CG  . LYS D  2 54  ? 18.741  14.982 -13.953 1.00 32.23  ? 54  LYS L CG  1 
ATOM   2907 C  CD  . LYS D  2 54  ? 19.392  15.511 -15.197 1.00 35.15  ? 54  LYS L CD  1 
ATOM   2908 C  CE  . LYS D  2 54  ? 18.792  14.868 -16.426 1.00 37.78  ? 54  LYS L CE  1 
ATOM   2909 N  NZ  . LYS D  2 54  ? 19.488  15.452 -17.615 1.00 41.62  ? 54  LYS L NZ  1 
ATOM   2910 N  N   . ASN D  2 55  ? 18.400  16.420 -9.485  1.00 25.77  ? 55  ASN L N   1 
ATOM   2911 C  CA  . ASN D  2 55  ? 18.845  17.239 -8.392  1.00 26.89  ? 55  ASN L CA  1 
ATOM   2912 C  C   . ASN D  2 55  ? 18.051  16.826 -7.155  1.00 25.37  ? 55  ASN L C   1 
ATOM   2913 O  O   . ASN D  2 55  ? 16.881  17.222 -6.973  1.00 23.78  ? 55  ASN L O   1 
ATOM   2914 C  CB  . ASN D  2 55  ? 18.654  18.717 -8.762  1.00 27.73  ? 55  ASN L CB  1 
ATOM   2915 C  CG  . ASN D  2 55  ? 19.238  19.662 -7.728  1.00 29.21  ? 55  ASN L CG  1 
ATOM   2916 O  OD1 . ASN D  2 55  ? 19.402  19.317 -6.565  1.00 30.89  ? 55  ASN L OD1 1 
ATOM   2917 N  ND2 . ASN D  2 55  ? 19.538  20.870 -8.155  1.00 30.74  ? 55  ASN L ND2 1 
ATOM   2918 N  N   . GLU D  2 56  ? 18.676  16.021 -6.302  1.00 26.13  ? 56  GLU L N   1 
ATOM   2919 C  CA  . GLU D  2 56  ? 17.969  15.463 -5.150  1.00 26.10  ? 56  GLU L CA  1 
ATOM   2920 C  C   . GLU D  2 56  ? 17.431  16.559 -4.216  1.00 25.58  ? 56  GLU L C   1 
ATOM   2921 O  O   . GLU D  2 56  ? 16.393  16.390 -3.573  1.00 25.40  ? 56  GLU L O   1 
ATOM   2922 C  CB  . GLU D  2 56  ? 18.883  14.515 -4.397  1.00 28.81  ? 56  GLU L CB  1 
ATOM   2923 C  CG  . GLU D  2 56  ? 18.214  13.742 -3.266  1.00 30.12  ? 56  GLU L CG  1 
ATOM   2924 C  CD  . GLU D  2 56  ? 19.059  12.581 -2.725  1.00 33.31  ? 56  GLU L CD  1 
ATOM   2925 O  OE1 . GLU D  2 56  ? 20.231  12.433 -3.110  1.00 36.04  ? 56  GLU L OE1 1 
ATOM   2926 O  OE2 . GLU D  2 56  ? 18.574  11.826 -1.865  1.00 35.69  ? 56  GLU L OE2 1 
ATOM   2927 N  N   . LYS D  2 57  ? 18.129  17.679 -4.154  1.00 25.43  ? 57  LYS L N   1 
ATOM   2928 C  CA  . LYS D  2 57  ? 17.727  18.790 -3.295  1.00 25.50  ? 57  LYS L CA  1 
ATOM   2929 C  C   . LYS D  2 57  ? 16.501  19.489 -3.833  1.00 23.19  ? 57  LYS L C   1 
ATOM   2930 O  O   . LYS D  2 57  ? 15.695  19.973 -3.074  1.00 22.14  ? 57  LYS L O   1 
ATOM   2931 C  CB  . LYS D  2 57  ? 18.881  19.769 -3.076  1.00 28.26  ? 57  LYS L CB  1 
ATOM   2932 C  CG  . LYS D  2 57  ? 19.960  19.385 -2.013  1.00 31.84  ? 57  LYS L CG  1 
ATOM   2933 C  CD  . LYS D  2 57  ? 20.026  17.917 -1.590  1.00 34.04  ? 57  LYS L CD  1 
ATOM   2934 C  CE  . LYS D  2 57  ? 20.696  17.634 -0.235  1.00 36.06  ? 57  LYS L CE  1 
ATOM   2935 N  NZ  . LYS D  2 57  ? 19.837  17.590 0.988   1.00 37.27  ? 57  LYS L NZ  1 
ATOM   2936 N  N   . VAL D  2 58  ? 16.341  19.512 -5.160  1.00 22.03  ? 58  VAL L N   1 
ATOM   2937 C  CA  . VAL D  2 58  ? 15.070  20.011 -5.745  1.00 21.59  ? 58  VAL L CA  1 
ATOM   2938 C  C   . VAL D  2 58  ? 13.895  19.122 -5.299  1.00 20.89  ? 58  VAL L C   1 
ATOM   2939 O  O   . VAL D  2 58  ? 12.805  19.609 -4.930  1.00 20.06  ? 58  VAL L O   1 
ATOM   2940 C  CB  . VAL D  2 58  ? 15.179  20.078 -7.279  1.00 21.96  ? 58  VAL L CB  1 
ATOM   2941 C  CG1 . VAL D  2 58  ? 13.828  20.176 -7.977  1.00 21.56  ? 58  VAL L CG1 1 
ATOM   2942 C  CG2 . VAL D  2 58  ? 16.045  21.298 -7.663  1.00 22.60  ? 58  VAL L CG2 1 
ATOM   2943 N  N   . ILE D  2 59  ? 14.108  17.805 -5.378  1.00 20.92  ? 59  ILE L N   1 
ATOM   2944 C  CA  . ILE D  2 59  ? 13.050  16.852 -4.969  1.00 19.91  ? 59  ILE L CA  1 
ATOM   2945 C  C   . ILE D  2 59  ? 12.708  17.051 -3.475  1.00 20.46  ? 59  ILE L C   1 
ATOM   2946 O  O   . ILE D  2 59  ? 11.538  17.023 -3.105  1.00 19.76  ? 59  ILE L O   1 
ATOM   2947 C  CB  . ILE D  2 59  ? 13.437  15.394 -5.280  1.00 20.01  ? 59  ILE L CB  1 
ATOM   2948 C  CG1 . ILE D  2 59  ? 13.728  15.221 -6.778  1.00 20.04  ? 59  ILE L CG1 1 
ATOM   2949 C  CG2 . ILE D  2 59  ? 12.352  14.446 -4.803  1.00 20.36  ? 59  ILE L CG2 1 
ATOM   2950 C  CD1 . ILE D  2 59  ? 12.645  15.719 -7.730  1.00 19.59  ? 59  ILE L CD1 1 
ATOM   2951 N  N   . GLU D  2 60  ? 13.719  17.295 -2.648  1.00 21.94  ? 60  GLU L N   1 
ATOM   2952 C  CA  . GLU D  2 60  ? 13.510  17.582 -1.218  1.00 22.96  ? 60  GLU L CA  1 
ATOM   2953 C  C   . GLU D  2 60  ? 12.676  18.836 -0.989  1.00 23.26  ? 60  GLU L C   1 
ATOM   2954 O  O   . GLU D  2 60  ? 11.777  18.878 -0.112  1.00 23.69  ? 60  GLU L O   1 
ATOM   2955 C  CB  . GLU D  2 60  ? 14.864  17.681 -0.481  1.00 24.59  ? 60  GLU L CB  1 
ATOM   2956 C  CG  . GLU D  2 60  ? 15.534  16.306 -0.439  1.00 25.28  ? 60  GLU L CG  1 
ATOM   2957 C  CD  . GLU D  2 60  ? 16.961  16.336 0.060   1.00 27.26  ? 60  GLU L CD  1 
ATOM   2958 O  OE1 . GLU D  2 60  ? 17.449  17.431 0.361   1.00 30.08  ? 60  GLU L OE1 1 
ATOM   2959 O  OE2 . GLU D  2 60  ? 17.612  15.267 0.156   1.00 27.99  ? 60  GLU L OE2 1 
ATOM   2960 N  N   . HIS D  2 61  ? 12.936  19.851 -1.789  1.00 24.24  ? 61  HIS L N   1 
ATOM   2961 C  CA  . HIS D  2 61  ? 12.174  21.104 -1.652  1.00 23.83  ? 61  HIS L CA  1 
ATOM   2962 C  C   . HIS D  2 61  ? 10.733  20.868 -2.067  1.00 22.09  ? 61  HIS L C   1 
ATOM   2963 O  O   . HIS D  2 61  ? 9.805   21.406 -1.461  1.00 21.88  ? 61  HIS L O   1 
ATOM   2964 C  CB  . HIS D  2 61  ? 12.778  22.231 -2.478  1.00 24.35  ? 61  HIS L CB  1 
ATOM   2965 C  CG  . HIS D  2 61  ? 11.806  23.390 -2.700  1.00 25.53  ? 61  HIS L CG  1 
ATOM   2966 N  ND1 . HIS D  2 61  ? 11.584  24.350 -1.767  1.00 26.11  ? 61  HIS L ND1 1 
ATOM   2967 C  CD2 . HIS D  2 61  ? 10.972  23.681 -3.776  1.00 25.13  ? 61  HIS L CD2 1 
ATOM   2968 C  CE1 . HIS D  2 61  ? 10.631  25.189 -2.214  1.00 26.58  ? 61  HIS L CE1 1 
ATOM   2969 N  NE2 . HIS D  2 61  ? 10.257  24.786 -3.451  1.00 26.75  ? 61  HIS L NE2 1 
ATOM   2970 N  N   . ILE D  2 62  ? 10.520  20.091 -3.124  1.00 20.84  ? 62  ILE L N   1 
ATOM   2971 C  CA  . ILE D  2 62  ? 9.176   19.816 -3.580  1.00 20.07  ? 62  ILE L CA  1 
ATOM   2972 C  C   . ILE D  2 62  ? 8.421   19.123 -2.487  1.00 20.20  ? 62  ILE L C   1 
ATOM   2973 O  O   . ILE D  2 62  ? 7.289   19.501 -2.161  1.00 20.02  ? 62  ILE L O   1 
ATOM   2974 C  CB  . ILE D  2 62  ? 9.140   18.990 -4.882  1.00 19.74  ? 62  ILE L CB  1 
ATOM   2975 C  CG1 . ILE D  2 62  ? 9.710   19.794 -6.030  1.00 19.85  ? 62  ILE L CG1 1 
ATOM   2976 C  CG2 . ILE D  2 62  ? 7.709   18.510 -5.156  1.00 18.89  ? 62  ILE L CG2 1 
ATOM   2977 C  CD1 . ILE D  2 62  ? 9.979   19.008 -7.309  1.00 20.90  ? 62  ILE L CD1 1 
ATOM   2978 N  N   . MET D  2 63  ? 9.061   18.192 -1.819  1.00 20.30  ? 63  MET L N   1 
ATOM   2979 C  CA  . MET D  2 63  ? 8.390   17.545 -0.712  1.00 20.32  ? 63  MET L CA  1 
ATOM   2980 C  C   . MET D  2 63  ? 8.095   18.495 0.443   1.00 20.06  ? 63  MET L C   1 
ATOM   2981 O  O   . MET D  2 63  ? 6.980   18.507 0.971   1.00 19.29  ? 63  MET L O   1 
ATOM   2982 C  CB  . MET D  2 63  ? 9.183   16.382 -0.191  1.00 22.06  ? 63  MET L CB  1 
ATOM   2983 C  CG  . MET D  2 63  ? 8.518   15.907 1.086   1.00 22.76  ? 63  MET L CG  1 
ATOM   2984 S  SD  . MET D  2 63  ? 8.851   14.238 1.421   1.00 33.22  ? 63  MET L SD  1 
ATOM   2985 C  CE  . MET D  2 63  ? 7.908   13.872 2.893   1.00 24.06  ? 63  MET L CE  1 
ATOM   2986 N  N   . GLU D  2 64  ? 9.054   19.329 0.808   1.00 20.49  ? 64  GLU L N   1 
ATOM   2987 C  CA  . GLU D  2 64  ? 8.861   20.297 1.878   1.00 21.49  ? 64  GLU L CA  1 
ATOM   2988 C  C   . GLU D  2 64  ? 7.710   21.254 1.584   1.00 21.24  ? 64  GLU L C   1 
ATOM   2989 O  O   . GLU D  2 64  ? 6.915   21.583 2.439   1.00 20.30  ? 64  GLU L O   1 
ATOM   2990 C  CB  . GLU D  2 64  ? 10.155  21.105 2.081   1.00 23.65  ? 64  GLU L CB  1 
ATOM   2991 C  CG  . GLU D  2 64  ? 10.144  21.925 3.357   1.00 26.25  ? 64  GLU L CG  1 
ATOM   2992 C  CD  . GLU D  2 64  ? 11.459  22.670 3.536   1.00 29.97  ? 64  GLU L CD  1 
ATOM   2993 O  OE1 . GLU D  2 64  ? 12.353  22.592 2.645   1.00 34.10  ? 64  GLU L OE1 1 
ATOM   2994 O  OE2 . GLU D  2 64  ? 11.574  23.358 4.526   1.00 30.61  ? 64  GLU L OE2 1 
ATOM   2995 N  N   . ASP D  2 65  ? 7.627   21.695 0.332   1.00 19.59  ? 65  ASP L N   1 
ATOM   2996 C  CA  . ASP D  2 65  ? 6.546   22.615 -0.108  1.00 20.22  ? 65  ASP L CA  1 
ATOM   2997 C  C   . ASP D  2 65  ? 5.162   21.953 0.047   1.00 18.77  ? 65  ASP L C   1 
ATOM   2998 O  O   . ASP D  2 65  ? 4.209   22.600 0.469   1.00 19.59  ? 65  ASP L O   1 
ATOM   2999 C  CB  . ASP D  2 65  ? 6.821   22.969 -1.579  1.00 21.39  ? 65  ASP L CB  1 
ATOM   3000 C  CG  . ASP D  2 65  ? 5.821   23.908 -2.171  1.00 23.41  ? 65  ASP L CG  1 
ATOM   3001 O  OD1 . ASP D  2 65  ? 5.451   24.898 -1.560  1.00 25.10  ? 65  ASP L OD1 1 
ATOM   3002 O  OD2 . ASP D  2 65  ? 5.349   23.624 -3.265  1.00 25.73  ? 65  ASP L OD2 1 
ATOM   3003 N  N   . LEU D  2 66  ? 5.073   20.669 -0.328  1.00 18.58  ? 66  LEU L N   1 
ATOM   3004 C  CA  . LEU D  2 66  ? 3.819   19.930 -0.293  1.00 18.01  ? 66  LEU L CA  1 
ATOM   3005 C  C   . LEU D  2 66  ? 3.396   19.579 1.128   1.00 18.08  ? 66  LEU L C   1 
ATOM   3006 O  O   . LEU D  2 66  ? 2.223   19.376 1.361   1.00 18.60  ? 66  LEU L O   1 
ATOM   3007 C  CB  . LEU D  2 66  ? 3.944   18.630 -1.115  1.00 17.72  ? 66  LEU L CB  1 
ATOM   3008 C  CG  . LEU D  2 66  ? 4.031   18.813 -2.612  1.00 17.89  ? 66  LEU L CG  1 
ATOM   3009 C  CD1 . LEU D  2 66  ? 4.529   17.512 -3.289  1.00 18.35  ? 66  LEU L CD1 1 
ATOM   3010 C  CD2 . LEU D  2 66  ? 2.700   19.300 -3.222  1.00 18.03  ? 66  LEU L CD2 1 
ATOM   3011 N  N   . ASP D  2 67  ? 4.346   19.499 2.047   1.00 18.67  ? 67  ASP L N   1 
ATOM   3012 C  CA  . ASP D  2 67  ? 4.115   19.039 3.404   1.00 18.58  ? 67  ASP L CA  1 
ATOM   3013 C  C   . ASP D  2 67  ? 3.492   20.116 4.262   1.00 19.98  ? 67  ASP L C   1 
ATOM   3014 O  O   . ASP D  2 67  ? 4.157   20.744 5.065   1.00 20.01  ? 67  ASP L O   1 
ATOM   3015 C  CB  . ASP D  2 67  ? 5.431   18.538 3.996   1.00 18.75  ? 67  ASP L CB  1 
ATOM   3016 C  CG  . ASP D  2 67  ? 5.288   18.047 5.420   1.00 19.79  ? 67  ASP L CG  1 
ATOM   3017 O  OD1 . ASP D  2 67  ? 4.172   17.737 5.874   1.00 19.65  ? 67  ASP L OD1 1 
ATOM   3018 O  OD2 . ASP D  2 67  ? 6.346   17.944 6.070   1.00 20.99  ? 67  ASP L OD2 1 
ATOM   3019 N  N   A THR D  2 68  ? 2.191   20.285 4.113   0.68 20.70  ? 68  THR L N   1 
ATOM   3020 N  N   B THR D  2 68  ? 2.199   20.358 4.039   0.32 19.95  ? 68  THR L N   1 
ATOM   3021 C  CA  A THR D  2 68  ? 1.564   21.474 4.610   0.68 21.15  ? 68  THR L CA  1 
ATOM   3022 C  CA  B THR D  2 68  ? 1.542   21.542 4.596   0.32 20.44  ? 68  THR L CA  1 
ATOM   3023 C  C   A THR D  2 68  ? 1.517   21.494 6.116   0.68 21.83  ? 68  THR L C   1 
ATOM   3024 C  C   B THR D  2 68  ? 1.356   21.513 6.113   0.32 21.30  ? 68  THR L C   1 
ATOM   3025 O  O   A THR D  2 68  ? 1.639   22.535 6.702   0.68 23.96  ? 68  THR L O   1 
ATOM   3026 O  O   B THR D  2 68  ? 1.197   22.567 6.712   0.32 22.55  ? 68  THR L O   1 
ATOM   3027 C  CB  A THR D  2 68  ? 0.205   21.641 3.982   0.68 21.63  ? 68  THR L CB  1 
ATOM   3028 C  CB  B THR D  2 68  ? 0.244   21.903 3.824   0.32 20.46  ? 68  THR L CB  1 
ATOM   3029 O  OG1 A THR D  2 68  ? -0.597  20.541 4.283   0.68 21.34  ? 68  THR L OG1 1 
ATOM   3030 O  OG1 B THR D  2 68  ? -0.838  22.201 4.723   0.32 20.78  ? 68  THR L OG1 1 
ATOM   3031 C  CG2 A THR D  2 68  ? 0.340   21.707 2.483   0.68 19.96  ? 68  THR L CG2 1 
ATOM   3032 C  CG2 B THR D  2 68  ? -0.153  20.806 2.885   0.32 18.39  ? 68  THR L CG2 1 
ATOM   3033 N  N   . ASN D  2 69  ? 1.387   20.336 6.738   1.00 21.30  ? 69  ASN L N   1 
ATOM   3034 C  CA  . ASN D  2 69  ? 1.371   20.297 8.203   1.00 21.96  ? 69  ASN L CA  1 
ATOM   3035 C  C   . ASN D  2 69  ? 2.767   20.109 8.802   1.00 22.92  ? 69  ASN L C   1 
ATOM   3036 O  O   . ASN D  2 69  ? 2.909   19.963 10.054  1.00 22.95  ? 69  ASN L O   1 
ATOM   3037 C  CB  . ASN D  2 69  ? 0.357   19.291 8.710   1.00 22.84  ? 69  ASN L CB  1 
ATOM   3038 C  CG  . ASN D  2 69  ? 0.871   17.887 8.666   1.00 23.65  ? 69  ASN L CG  1 
ATOM   3039 O  OD1 . ASN D  2 69  ? 1.744   17.580 7.891   1.00 22.38  ? 69  ASN L OD1 1 
ATOM   3040 N  ND2 . ASN D  2 69  ? 0.371   17.057 9.544   1.00 26.51  ? 69  ASN L ND2 1 
ATOM   3041 N  N   . ALA D  2 70  ? 3.801   20.153 7.962   1.00 22.66  ? 70  ALA L N   1 
ATOM   3042 C  CA  . ALA D  2 70  ? 5.214   20.150 8.378   1.00 23.89  ? 70  ALA L CA  1 
ATOM   3043 C  C   . ALA D  2 70  ? 5.590   19.004 9.345   1.00 24.18  ? 70  ALA L C   1 
ATOM   3044 O  O   . ALA D  2 70  ? 6.347   19.180 10.332  1.00 25.63  ? 70  ALA L O   1 
ATOM   3045 C  CB  . ALA D  2 70  ? 5.626   21.535 8.911   1.00 26.17  ? 70  ALA L CB  1 
ATOM   3046 N  N   . ASP D  2 71  ? 5.091   17.809 9.058   1.00 23.97  ? 71  ASP L N   1 
ATOM   3047 C  CA  . ASP D  2 71  ? 5.450   16.638 9.848   1.00 25.37  ? 71  ASP L CA  1 
ATOM   3048 C  C   . ASP D  2 71  ? 6.437   15.687 9.159   1.00 24.40  ? 71  ASP L C   1 
ATOM   3049 O  O   . ASP D  2 71  ? 6.637   14.602 9.646   1.00 24.34  ? 71  ASP L O   1 
ATOM   3050 C  CB  . ASP D  2 71  ? 4.178   15.887 10.276  1.00 25.71  ? 71  ASP L CB  1 
ATOM   3051 C  CG  . ASP D  2 71  ? 3.422   15.262 9.103   1.00 23.62  ? 71  ASP L CG  1 
ATOM   3052 O  OD1 . ASP D  2 71  ? 3.773   15.446 7.896   1.00 23.11  ? 71  ASP L OD1 1 
ATOM   3053 O  OD2 . ASP D  2 71  ? 2.410   14.601 9.419   1.00 23.82  ? 71  ASP L OD2 1 
ATOM   3054 N  N   . LYS D  2 72  ? 6.983   16.078 7.995   1.00 24.06  ? 72  LYS L N   1 
ATOM   3055 C  CA  . LYS D  2 72  ? 7.965   15.308 7.236   1.00 24.65  ? 72  LYS L CA  1 
ATOM   3056 C  C   . LYS D  2 72  ? 7.388   14.043 6.591   1.00 23.49  ? 72  LYS L C   1 
ATOM   3057 O  O   . LYS D  2 72  ? 8.115   13.129 6.254   1.00 25.50  ? 72  LYS L O   1 
ATOM   3058 C  CB  . LYS D  2 72  ? 9.225   15.021 8.054   1.00 26.45  ? 72  LYS L CB  1 
ATOM   3059 C  CG  . LYS D  2 72  ? 9.953   16.279 8.525   1.00 28.85  ? 72  LYS L CG  1 
ATOM   3060 C  CD  . LYS D  2 72  ? 11.212  15.932 9.360   1.00 32.70  ? 72  LYS L CD  1 
ATOM   3061 C  CE  . LYS D  2 72  ? 11.965  17.194 9.741   1.00 34.35  ? 72  LYS L CE  1 
ATOM   3062 N  NZ  . LYS D  2 72  ? 13.268  16.914 10.418  1.00 38.31  ? 72  LYS L NZ  1 
ATOM   3063 N  N   . GLN D  2 73  ? 6.078   14.063 6.346   1.00 22.55  ? 73  GLN L N   1 
ATOM   3064 C  CA  . GLN D  2 73  ? 5.334   12.964 5.731   1.00 22.28  ? 73  GLN L CA  1 
ATOM   3065 C  C   . GLN D  2 73  ? 4.392   13.640 4.775   1.00 20.32  ? 73  GLN L C   1 
ATOM   3066 O  O   . GLN D  2 73  ? 3.911   14.753 5.031   1.00 18.79  ? 73  GLN L O   1 
ATOM   3067 C  CB  . GLN D  2 73  ? 4.485   12.201 6.755   1.00 23.81  ? 73  GLN L CB  1 
ATOM   3068 C  CG  . GLN D  2 73  ? 5.265   11.529 7.858   1.00 27.01  ? 73  GLN L CG  1 
ATOM   3069 C  CD  . GLN D  2 73  ? 6.029   10.281 7.432   1.00 27.90  ? 73  GLN L CD  1 
ATOM   3070 O  OE1 . GLN D  2 73  ? 5.560   9.498  6.603   1.00 28.62  ? 73  GLN L OE1 1 
ATOM   3071 N  NE2 . GLN D  2 73  ? 7.169   10.053 8.076   1.00 28.42  ? 73  GLN L NE2 1 
ATOM   3072 N  N   . LEU D  2 74  ? 4.093   12.993 3.657   1.00 18.54  ? 74  LEU L N   1 
ATOM   3073 C  CA  . LEU D  2 74  ? 3.031   13.482 2.773   1.00 17.85  ? 74  LEU L CA  1 
ATOM   3074 C  C   . LEU D  2 74  ? 1.820   12.581 2.870   1.00 17.12  ? 74  LEU L C   1 
ATOM   3075 O  O   . LEU D  2 74  ? 1.891   11.373 2.637   1.00 17.51  ? 74  LEU L O   1 
ATOM   3076 C  CB  . LEU D  2 74  ? 3.449   13.547 1.306   1.00 17.54  ? 74  LEU L CB  1 
ATOM   3077 C  CG  . LEU D  2 74  ? 4.572   14.504 0.934   1.00 17.15  ? 74  LEU L CG  1 
ATOM   3078 C  CD1 . LEU D  2 74  ? 4.720   14.472 -0.602  1.00 17.16  ? 74  LEU L CD1 1 
ATOM   3079 C  CD2 . LEU D  2 74  ? 4.339   15.916 1.469   1.00 17.60  ? 74  LEU L CD2 1 
ATOM   3080 N  N   . SER D  2 75  ? 0.698   13.167 3.229   1.00 17.32  ? 75  SER L N   1 
ATOM   3081 C  CA  . SER D  2 75  ? -0.570  12.493 3.263   1.00 17.18  ? 75  SER L CA  1 
ATOM   3082 C  C   . SER D  2 75  ? -1.066  12.500 1.848   1.00 16.41  ? 75  SER L C   1 
ATOM   3083 O  O   . SER D  2 75  ? -0.500  13.222 0.979   1.00 16.33  ? 75  SER L O   1 
ATOM   3084 C  CB  . SER D  2 75  ? -1.596  13.244 4.125   1.00 17.60  ? 75  SER L CB  1 
ATOM   3085 O  OG  . SER D  2 75  ? -1.767  14.575 3.646   1.00 17.70  ? 75  SER L OG  1 
ATOM   3086 N  N   . PHE D  2 76  ? -2.121  11.716 1.568   1.00 16.55  ? 76  PHE L N   1 
ATOM   3087 C  CA  . PHE D  2 76  ? -2.674  11.746 0.201   1.00 14.92  ? 76  PHE L CA  1 
ATOM   3088 C  C   . PHE D  2 76  ? -3.155  13.182 -0.160  1.00 15.24  ? 76  PHE L C   1 
ATOM   3089 O  O   . PHE D  2 76  ? -2.972  13.648 -1.309  1.00 14.38  ? 76  PHE L O   1 
ATOM   3090 C  CB  . PHE D  2 76  ? -3.808  10.744 0.017   1.00 15.40  ? 76  PHE L CB  1 
ATOM   3091 C  CG  . PHE D  2 76  ? -4.319  10.704 -1.364  1.00 15.28  ? 76  PHE L CG  1 
ATOM   3092 C  CD1 . PHE D  2 76  ? -3.576  10.066 -2.256  1.00 15.67  ? 76  PHE L CD1 1 
ATOM   3093 C  CD2 . PHE D  2 76  ? -5.460  11.383 -1.716  1.00 15.68  ? 76  PHE L CD2 1 
ATOM   3094 C  CE1 . PHE D  2 76  ? -3.942  10.039 -3.580  1.00 15.34  ? 76  PHE L CE1 1 
ATOM   3095 C  CE2 . PHE D  2 76  ? -5.879  11.375 -3.048  1.00 15.36  ? 76  PHE L CE2 1 
ATOM   3096 C  CZ  . PHE D  2 76  ? -5.109  10.706 -3.965  1.00 16.49  ? 76  PHE L CZ  1 
ATOM   3097 N  N   . GLU D  2 77  ? -3.786  13.840 0.807   1.00 15.51  ? 77  GLU L N   1 
ATOM   3098 C  CA  . GLU D  2 77  ? -4.332  15.172 0.615   1.00 16.65  ? 77  GLU L CA  1 
ATOM   3099 C  C   . GLU D  2 77  ? -3.213  16.119 0.189   1.00 16.29  ? 77  GLU L C   1 
ATOM   3100 O  O   . GLU D  2 77  ? -3.354  16.909 -0.770  1.00 16.85  ? 77  GLU L O   1 
ATOM   3101 C  CB  . GLU D  2 77  ? -4.956  15.671 1.925   1.00 18.39  ? 77  GLU L CB  1 
ATOM   3102 C  CG  . GLU D  2 77  ? -6.331  15.049 2.149   1.00 20.64  ? 77  GLU L CG  1 
ATOM   3103 C  CD  . GLU D  2 77  ? -6.290  13.752 2.990   1.00 22.29  ? 77  GLU L CD  1 
ATOM   3104 O  OE1 . GLU D  2 77  ? -5.205  13.151 3.254   1.00 21.32  ? 77  GLU L OE1 1 
ATOM   3105 O  OE2 . GLU D  2 77  ? -7.418  13.333 3.385   1.00 26.56  ? 77  GLU L OE2 1 
ATOM   3106 N  N   . GLU D  2 78  ? -2.078  16.024 0.867   1.00 15.61  ? 78  GLU L N   1 
ATOM   3107 C  CA  . GLU D  2 78  ? -0.960  16.872 0.492   1.00 15.67  ? 78  GLU L CA  1 
ATOM   3108 C  C   . GLU D  2 78  ? -0.394  16.518 -0.857  1.00 15.21  ? 78  GLU L C   1 
ATOM   3109 O  O   . GLU D  2 78  ? -0.136  17.373 -1.666  1.00 15.75  ? 78  GLU L O   1 
ATOM   3110 C  CB  . GLU D  2 78  ? 0.119   16.808 1.551   1.00 16.40  ? 78  GLU L CB  1 
ATOM   3111 C  CG  . GLU D  2 78  ? -0.265  17.345 2.931   1.00 17.35  ? 78  GLU L CG  1 
ATOM   3112 C  CD  . GLU D  2 78  ? 0.699   17.030 4.050   1.00 19.05  ? 78  GLU L CD  1 
ATOM   3113 O  OE1 . GLU D  2 78  ? 1.460   16.025 4.033   1.00 20.49  ? 78  GLU L OE1 1 
ATOM   3114 O  OE2 . GLU D  2 78  ? 0.644   17.721 5.091   1.00 18.24  ? 78  GLU L OE2 1 
ATOM   3115 N  N   . PHE D  2 79  ? -0.241  15.222 -1.116  1.00 15.24  ? 79  PHE L N   1 
ATOM   3116 C  CA  . PHE D  2 79  ? 0.309   14.716 -2.380  1.00 15.04  ? 79  PHE L CA  1 
ATOM   3117 C  C   . PHE D  2 79  ? -0.528  15.062 -3.580  1.00 15.16  ? 79  PHE L C   1 
ATOM   3118 O  O   . PHE D  2 79  ? 0.058   15.324 -4.648  1.00 15.74  ? 79  PHE L O   1 
ATOM   3119 C  CB  . PHE D  2 79  ? 0.465   13.208 -2.274  1.00 14.83  ? 79  PHE L CB  1 
ATOM   3120 C  CG  . PHE D  2 79  ? 0.937   12.515 -3.545  1.00 15.53  ? 79  PHE L CG  1 
ATOM   3121 C  CD1 . PHE D  2 79  ? 2.250   12.550 -3.901  1.00 16.22  ? 79  PHE L CD1 1 
ATOM   3122 C  CD2 . PHE D  2 79  ? 0.037   11.841 -4.330  1.00 16.08  ? 79  PHE L CD2 1 
ATOM   3123 C  CE1 . PHE D  2 79  ? 2.686   11.826 -4.988  1.00 16.24  ? 79  PHE L CE1 1 
ATOM   3124 C  CE2 . PHE D  2 79  ? 0.420   11.173 -5.500  1.00 16.32  ? 79  PHE L CE2 1 
ATOM   3125 C  CZ  . PHE D  2 79  ? 1.776   11.173 -5.824  1.00 16.95  ? 79  PHE L CZ  1 
ATOM   3126 N  N   . ILE D  2 80  ? -1.865  15.055 -3.483  1.00 14.48  ? 80  ILE L N   1 
ATOM   3127 C  CA  . ILE D  2 80  ? -2.655  15.283 -4.687  1.00 15.03  ? 80  ILE L CA  1 
ATOM   3128 C  C   . ILE D  2 80  ? -2.428  16.690 -5.285  1.00 15.10  ? 80  ILE L C   1 
ATOM   3129 O  O   . ILE D  2 80  ? -2.655  16.897 -6.481  1.00 14.94  ? 80  ILE L O   1 
ATOM   3130 C  CB  . ILE D  2 80  ? -4.154  14.960 -4.458  1.00 15.58  ? 80  ILE L CB  1 
ATOM   3131 C  CG1 . ILE D  2 80  ? -4.856  14.763 -5.802  1.00 16.49  ? 80  ILE L CG1 1 
ATOM   3132 C  CG2 . ILE D  2 80  ? -4.815  16.009 -3.538  1.00 15.99  ? 80  ILE L CG2 1 
ATOM   3133 C  CD1 . ILE D  2 80  ? -6.222  14.124 -5.738  1.00 17.90  ? 80  ILE L CD1 1 
ATOM   3134 N  N   A MET D  2 81  ? -1.949  17.651 -4.520  0.58 15.03  ? 81  MET L N   1 
ATOM   3135 N  N   B MET D  2 81  ? -2.009  17.653 -4.483  0.42 15.16  ? 81  MET L N   1 
ATOM   3136 C  CA  A MET D  2 81  ? -1.624  18.955 -5.098  0.58 15.37  ? 81  MET L CA  1 
ATOM   3137 C  CA  B MET D  2 81  ? -1.643  18.939 -5.040  0.42 15.50  ? 81  MET L CA  1 
ATOM   3138 C  C   A MET D  2 81  ? -0.466  18.848 -6.097  0.58 15.53  ? 81  MET L C   1 
ATOM   3139 C  C   B MET D  2 81  ? -0.565  18.763 -6.119  0.42 15.55  ? 81  MET L C   1 
ATOM   3140 O  O   A MET D  2 81  ? -0.372  19.634 -7.054  0.58 15.98  ? 81  MET L O   1 
ATOM   3141 O  O   B MET D  2 81  ? -0.667  19.392 -7.172  0.42 15.90  ? 81  MET L O   1 
ATOM   3142 C  CB  A MET D  2 81  ? -1.316  19.971 -4.009  0.58 15.52  ? 81  MET L CB  1 
ATOM   3143 C  CB  B MET D  2 81  ? -1.212  19.924 -3.960  0.42 15.81  ? 81  MET L CB  1 
ATOM   3144 C  CG  A MET D  2 81  ? -2.447  20.081 -3.014  0.58 15.78  ? 81  MET L CG  1 
ATOM   3145 C  CG  B MET D  2 81  ? -2.374  20.707 -3.366  0.42 16.31  ? 81  MET L CG  1 
ATOM   3146 S  SD  A MET D  2 81  ? -4.052  20.432 -3.768  0.58 18.86  ? 81  MET L SD  1 
ATOM   3147 S  SD  B MET D  2 81  ? -3.221  21.836 -4.493  0.42 18.93  ? 81  MET L SD  1 
ATOM   3148 C  CE  A MET D  2 81  ? -4.187  22.149 -3.283  0.58 16.89  ? 81  MET L CE  1 
ATOM   3149 C  CE  B MET D  2 81  ? -4.764  22.084 -3.629  0.42 18.12  ? 81  MET L CE  1 
ATOM   3150 N  N   . LEU D  2 82  ? 0.419   17.890 -5.889  1.00 15.74  ? 82  LEU L N   1 
ATOM   3151 C  CA  . LEU D  2 82  ? 1.464   17.661 -6.920  1.00 15.51  ? 82  LEU L CA  1 
ATOM   3152 C  C   . LEU D  2 82  ? 0.859   17.121 -8.191  1.00 15.47  ? 82  LEU L C   1 
ATOM   3153 O  O   . LEU D  2 82  ? 1.266   17.520 -9.286  1.00 15.48  ? 82  LEU L O   1 
ATOM   3154 C  CB  . LEU D  2 82  ? 2.536   16.731 -6.424  1.00 16.16  ? 82  LEU L CB  1 
ATOM   3155 C  CG  . LEU D  2 82  ? 3.675   16.468 -7.392  1.00 15.70  ? 82  LEU L CG  1 
ATOM   3156 C  CD1 . LEU D  2 82  ? 4.501   17.702 -7.752  1.00 16.63  ? 82  LEU L CD1 1 
ATOM   3157 C  CD2 . LEU D  2 82  ? 4.585   15.362 -6.863  1.00 16.63  ? 82  LEU L CD2 1 
ATOM   3158 N  N   . MET D  2 83  ? -0.106  16.217 -8.058  1.00 15.28  ? 83  MET L N   1 
ATOM   3159 C  CA  . MET D  2 83  ? -0.790  15.665 -9.258  1.00 14.51  ? 83  MET L CA  1 
ATOM   3160 C  C   . MET D  2 83  ? -1.511  16.754 -10.054 1.00 14.89  ? 83  MET L C   1 
ATOM   3161 O  O   . MET D  2 83  ? -1.378  16.818 -11.276 1.00 15.16  ? 83  MET L O   1 
ATOM   3162 C  CB  . MET D  2 83  ? -1.759  14.559 -8.777  1.00 15.10  ? 83  MET L CB  1 
ATOM   3163 C  CG  . MET D  2 83  ? -1.068  13.412 -8.047  1.00 15.86  ? 83  MET L CG  1 
ATOM   3164 S  SD  . MET D  2 83  ? 0.112   12.468 -9.046  1.00 16.18  ? 83  MET L SD  1 
ATOM   3165 C  CE  . MET D  2 83  ? 1.672   13.289 -8.588  1.00 20.25  ? 83  MET L CE  1 
ATOM   3166 N  N   . ALA D  2 84  ? -2.198  17.649 -9.360  1.00 15.40  ? 84  ALA L N   1 
ATOM   3167 C  CA  . ALA D  2 84  ? -2.893  18.743 -10.000 1.00 14.94  ? 84  ALA L CA  1 
ATOM   3168 C  C   . ALA D  2 84  ? -1.909  19.669 -10.697 1.00 14.85  ? 84  ALA L C   1 
ATOM   3169 O  O   . ALA D  2 84  ? -2.107  20.056 -11.823 1.00 15.44  ? 84  ALA L O   1 
ATOM   3170 C  CB  . ALA D  2 84  ? -3.738  19.485 -8.997  1.00 15.56  ? 84  ALA L CB  1 
ATOM   3171 N  N   . ARG D  2 85  ? -0.805  19.979 -10.033 1.00 15.13  ? 85  ARG L N   1 
ATOM   3172 C  CA  . ARG D  2 85  ? 0.191   20.867 -10.600 1.00 16.68  ? 85  ARG L CA  1 
ATOM   3173 C  C   . ARG D  2 85  ? 0.844   20.305 -11.828 1.00 16.06  ? 85  ARG L C   1 
ATOM   3174 O  O   . ARG D  2 85  ? 1.133   21.056 -12.757 1.00 16.56  ? 85  ARG L O   1 
ATOM   3175 C  CB  . ARG D  2 85  ? 1.275   21.138 -9.559  1.00 18.38  ? 85  ARG L CB  1 
ATOM   3176 C  CG  . ARG D  2 85  ? 0.807   22.086 -8.523  1.00 22.31  ? 85  ARG L CG  1 
ATOM   3177 C  CD  . ARG D  2 85  ? 1.811   22.135 -7.409  1.00 25.19  ? 85  ARG L CD  1 
ATOM   3178 N  NE  . ARG D  2 85  ? 1.240   22.686 -6.208  1.00 27.69  ? 85  ARG L NE  1 
ATOM   3179 C  CZ  . ARG D  2 85  ? 1.922   22.846 -5.085  1.00 29.53  ? 85  ARG L CZ  1 
ATOM   3180 N  NH1 . ARG D  2 85  ? 1.325   23.363 -4.047  1.00 31.18  ? 85  ARG L NH1 1 
ATOM   3181 N  NH2 . ARG D  2 85  ? 3.200   22.453 -5.019  1.00 30.36  ? 85  ARG L NH2 1 
ATOM   3182 N  N   . LEU D  2 86  ? 1.124   18.999 -11.820 1.00 15.91  ? 86  LEU L N   1 
ATOM   3183 C  CA  . LEU D  2 86  ? 1.752   18.368 -12.987 1.00 16.15  ? 86  LEU L CA  1 
ATOM   3184 C  C   . LEU D  2 86  ? 0.793   18.222 -14.167 1.00 15.53  ? 86  LEU L C   1 
ATOM   3185 O  O   . LEU D  2 86  ? 1.210   18.352 -15.341 1.00 16.74  ? 86  LEU L O   1 
ATOM   3186 C  CB  . LEU D  2 86  ? 2.329   16.977 -12.627 1.00 17.63  ? 86  LEU L CB  1 
ATOM   3187 C  CG  . LEU D  2 86  ? 3.795   16.853 -12.234 1.00 22.01  ? 86  LEU L CG  1 
ATOM   3188 C  CD1 . LEU D  2 86  ? 4.645   18.107 -12.207 1.00 22.73  ? 86  LEU L CD1 1 
ATOM   3189 C  CD2 . LEU D  2 86  ? 4.116   15.808 -11.159 1.00 21.13  ? 86  LEU L CD2 1 
ATOM   3190 N  N   . THR D  2 87  ? -0.493  18.010 -13.860 1.00 15.96  ? 87  THR L N   1 
ATOM   3191 C  CA  . THR D  2 87  ? -1.520  17.880 -14.883 1.00 15.20  ? 87  THR L CA  1 
ATOM   3192 C  C   . THR D  2 87  ? -1.628  19.251 -15.546 1.00 15.76  ? 87  THR L C   1 
ATOM   3193 O  O   . THR D  2 87  ? -1.677  19.371 -16.750 1.00 15.82  ? 87  THR L O   1 
ATOM   3194 C  CB  . THR D  2 87  ? -2.867  17.466 -14.238 1.00 14.89  ? 87  THR L CB  1 
ATOM   3195 O  OG1 . THR D  2 87  ? -2.729  16.190 -13.628 1.00 15.16  ? 87  THR L OG1 1 
ATOM   3196 C  CG2 . THR D  2 87  ? -3.977  17.344 -15.261 1.00 16.41  ? 87  THR L CG2 1 
ATOM   3197 N  N   A TRP D  2 88  ? -1.737  20.280 -14.705 0.50 15.78  ? 88  TRP L N   1 
ATOM   3198 N  N   B TRP D  2 88  ? -1.733  20.282 -14.718 0.50 15.85  ? 88  TRP L N   1 
ATOM   3199 C  CA  A TRP D  2 88  ? -1.698  21.679 -15.157 0.50 16.22  ? 88  TRP L CA  1 
ATOM   3200 C  CA  B TRP D  2 88  ? -1.708  21.661 -15.203 0.50 16.28  ? 88  TRP L CA  1 
ATOM   3201 C  C   A TRP D  2 88  ? -0.478  21.949 -16.022 0.50 16.26  ? 88  TRP L C   1 
ATOM   3202 C  C   B TRP D  2 88  ? -0.473  21.945 -16.039 0.50 16.28  ? 88  TRP L C   1 
ATOM   3203 O  O   A TRP D  2 88  ? -0.593  22.449 -17.146 0.50 16.66  ? 88  TRP L O   1 
ATOM   3204 O  O   B TRP D  2 88  ? -0.570  22.456 -17.160 0.50 16.60  ? 88  TRP L O   1 
ATOM   3205 C  CB  A TRP D  2 88  ? -1.712  22.604 -13.942 0.50 16.71  ? 88  TRP L CB  1 
ATOM   3206 C  CB  B TRP D  2 88  ? -1.761  22.589 -14.010 0.50 16.88  ? 88  TRP L CB  1 
ATOM   3207 C  CG  A TRP D  2 88  ? -1.644  24.069 -14.325 0.50 18.69  ? 88  TRP L CG  1 
ATOM   3208 C  CG  B TRP D  2 88  ? -1.594  24.039 -14.389 0.50 18.98  ? 88  TRP L CG  1 
ATOM   3209 C  CD1 A TRP D  2 88  ? -0.553  24.927 -14.207 0.50 19.87  ? 88  TRP L CD1 1 
ATOM   3210 C  CD1 B TRP D  2 88  ? -2.537  24.895 -14.946 0.50 19.80  ? 88  TRP L CD1 1 
ATOM   3211 C  CD2 A TRP D  2 88  ? -2.701  24.879 -14.944 0.50 19.60  ? 88  TRP L CD2 1 
ATOM   3212 C  CD2 B TRP D  2 88  ? -0.379  24.845 -14.241 0.50 20.48  ? 88  TRP L CD2 1 
ATOM   3213 N  NE1 A TRP D  2 88  ? -0.854  26.177 -14.704 0.50 20.85  ? 88  TRP L NE1 1 
ATOM   3214 N  NE1 B TRP D  2 88  ? -1.984  26.155 -15.172 0.50 21.28  ? 88  TRP L NE1 1 
ATOM   3215 C  CE2 A TRP D  2 88  ? -2.125  26.217 -15.163 0.50 20.95  ? 88  TRP L CE2 1 
ATOM   3216 C  CE2 B TRP D  2 88  ? -0.696  26.179 -14.759 0.50 21.54  ? 88  TRP L CE2 1 
ATOM   3217 C  CE3 A TRP D  2 88  ? -4.020  24.653 -15.302 0.50 19.75  ? 88  TRP L CE3 1 
ATOM   3218 C  CE3 B TRP D  2 88  ? 0.906   24.591 -13.785 0.50 21.22  ? 88  TRP L CE3 1 
ATOM   3219 C  CZ2 A TRP D  2 88  ? -2.864  27.245 -15.722 0.50 22.11  ? 88  TRP L CZ2 1 
ATOM   3220 C  CZ2 B TRP D  2 88  ? 0.249   27.198 -14.776 0.50 23.26  ? 88  TRP L CZ2 1 
ATOM   3221 C  CZ3 A TRP D  2 88  ? -4.744  25.696 -15.876 0.50 21.08  ? 88  TRP L CZ3 1 
ATOM   3222 C  CZ3 B TRP D  2 88  ? 1.850   25.623 -13.820 0.50 22.77  ? 88  TRP L CZ3 1 
ATOM   3223 C  CH2 A TRP D  2 88  ? -4.173  26.957 -16.085 0.50 21.51  ? 88  TRP L CH2 1 
ATOM   3224 C  CH2 B TRP D  2 88  ? 1.528   26.895 -14.298 0.50 23.71  ? 88  TRP L CH2 1 
ATOM   3225 N  N   . ALA D  2 89  ? 0.700   21.620 -15.494 1.00 16.03  ? 89  ALA L N   1 
ATOM   3226 C  CA  . ALA D  2 89  ? 1.974   21.796 -16.264 1.00 16.68  ? 89  ALA L CA  1 
ATOM   3227 C  C   . ALA D  2 89  ? 1.990   21.075 -17.596 1.00 16.49  ? 89  ALA L C   1 
ATOM   3228 O  O   . ALA D  2 89  ? 2.509   21.568 -18.578 1.00 18.57  ? 89  ALA L O   1 
ATOM   3229 C  CB  . ALA D  2 89  ? 3.203   21.384 -15.402 1.00 16.52  ? 89  ALA L CB  1 
ATOM   3230 N  N   . SER D  2 90  ? 1.423   19.898 -17.659 1.00 16.03  ? 90  SER L N   1 
ATOM   3231 C  CA  . SER D  2 90  ? 1.453   19.169 -18.919 1.00 16.62  ? 90  SER L CA  1 
ATOM   3232 C  C   . SER D  2 90  ? 0.545   19.843 -19.936 1.00 16.54  ? 90  SER L C   1 
ATOM   3233 O  O   . SER D  2 90  ? 0.924   20.019 -21.128 1.00 17.06  ? 90  SER L O   1 
ATOM   3234 C  CB  . SER D  2 90  ? 1.035   17.732 -18.727 1.00 16.23  ? 90  SER L CB  1 
ATOM   3235 O  OG  . SER D  2 90  ? 1.374   16.970 -19.894 1.00 16.33  ? 90  SER L OG  1 
ATOM   3236 N  N   . HIS D  2 91  ? -0.631  20.262 -19.462 1.00 16.57  ? 91  HIS L N   1 
ATOM   3237 C  CA  . HIS D  2 91  ? -1.549  20.992 -20.333 1.00 16.26  ? 91  HIS L CA  1 
ATOM   3238 C  C   . HIS D  2 91  ? -0.936  22.279 -20.823 1.00 17.84  ? 91  HIS L C   1 
ATOM   3239 O  O   . HIS D  2 91  ? -1.086  22.672 -21.989 1.00 17.74  ? 91  HIS L O   1 
ATOM   3240 C  CB  . HIS D  2 91  ? -2.893  21.244 -19.659 1.00 15.42  ? 91  HIS L CB  1 
ATOM   3241 C  CG  . HIS D  2 91  ? -3.966  21.800 -20.624 1.00 15.01  ? 91  HIS L CG  1 
ATOM   3242 N  ND1 . HIS D  2 91  ? -4.606  22.971 -20.383 1.00 15.91  ? 91  HIS L ND1 1 
ATOM   3243 C  CD2 . HIS D  2 91  ? -4.419  21.363 -21.878 1.00 15.28  ? 91  HIS L CD2 1 
ATOM   3244 C  CE1 . HIS D  2 91  ? -5.446  23.258 -21.405 1.00 16.85  ? 91  HIS L CE1 1 
ATOM   3245 N  NE2 . HIS D  2 91  ? -5.353  22.285 -22.322 1.00 15.54  ? 91  HIS L NE2 1 
ATOM   3246 N  N   . GLU D  2 92  ? -0.242  22.974 -19.954 1.00 17.42  ? 92  GLU L N   1 
ATOM   3247 C  CA  . GLU D  2 92  ? 0.466   24.210 -20.332 1.00 19.30  ? 92  GLU L CA  1 
ATOM   3248 C  C   . GLU D  2 92  ? 1.519   23.942 -21.421 1.00 20.44  ? 92  GLU L C   1 
ATOM   3249 O  O   . GLU D  2 92  ? 1.591   24.664 -22.429 1.00 21.53  ? 92  GLU L O   1 
ATOM   3250 C  CB  . GLU D  2 92  ? 1.103   24.886 -19.125 1.00 20.66  ? 92  GLU L CB  1 
ATOM   3251 C  CG  . GLU D  2 92  ? 0.136   25.407 -18.076 1.00 21.29  ? 92  GLU L CG  1 
ATOM   3252 C  CD  . GLU D  2 92  ? -0.546  26.670 -18.494 1.00 25.30  ? 92  GLU L CD  1 
ATOM   3253 O  OE1 . GLU D  2 92  ? 0.080   27.751 -18.400 1.00 29.05  ? 92  GLU L OE1 1 
ATOM   3254 O  OE2 . GLU D  2 92  ? -1.717  26.594 -18.957 1.00 27.72  ? 92  GLU L OE2 1 
ATOM   3255 N  N   . LYS D  2 93  ? 2.267   22.868 -21.265 1.00 20.51  ? 93  LYS L N   1 
ATOM   3256 C  CA  . LYS D  2 93  ? 3.267   22.467 -22.252 1.00 21.67  ? 93  LYS L CA  1 
ATOM   3257 C  C   . LYS D  2 93  ? 2.590   22.199 -23.590 1.00 21.75  ? 93  LYS L C   1 
ATOM   3258 O  O   . LYS D  2 93  ? 3.093   22.629 -24.634 1.00 23.00  ? 93  LYS L O   1 
ATOM   3259 C  CB  . LYS D  2 93  ? 4.078   21.257 -21.780 1.00 23.51  ? 93  LYS L CB  1 
ATOM   3260 C  CG  . LYS D  2 93  ? 5.164   20.803 -22.746 1.00 27.03  ? 93  LYS L CG  1 
ATOM   3261 C  CD  . LYS D  2 93  ? 6.490   21.503 -22.638 1.00 31.25  ? 93  LYS L CD  1 
ATOM   3262 C  CE  . LYS D  2 93  ? 7.590   20.685 -23.377 1.00 33.84  ? 93  LYS L CE  1 
ATOM   3263 N  NZ  . LYS D  2 93  ? 7.109   19.441 -24.115 1.00 33.63  ? 93  LYS L NZ  1 
ATOM   3264 N  N   . MET D  2 94  ? 1.422   21.568 -23.558 1.00 19.84  ? 94  MET L N   1 
ATOM   3265 C  CA  . MET D  2 94  ? 0.680   21.332 -24.812 1.00 20.57  ? 94  MET L CA  1 
ATOM   3266 C  C   . MET D  2 94  ? 0.295   22.602 -25.515 1.00 21.35  ? 94  MET L C   1 
ATOM   3267 O  O   . MET D  2 94  ? 0.035   22.552 -26.742 1.00 22.42  ? 94  MET L O   1 
ATOM   3268 C  CB  . MET D  2 94  ? -0.578  20.494 -24.532 1.00 20.21  ? 94  MET L CB  1 
ATOM   3269 C  CG  . MET D  2 94  ? -0.319  19.067 -24.087 1.00 20.66  ? 94  MET L CG  1 
ATOM   3270 S  SD  . MET D  2 94  ? -1.821  18.250 -23.497 1.00 19.82  ? 94  MET L SD  1 
ATOM   3271 C  CE  . MET D  2 94  ? -1.096  16.894 -22.547 1.00 18.53  ? 94  MET L CE  1 
ATOM   3272 N  N   . HIS D  2 95  ? 0.230   23.726 -24.788 1.00 20.80  ? 95  HIS L N   1 
ATOM   3273 C  CA  . HIS D  2 95  ? -0.162  25.017 -25.391 1.00 22.91  ? 95  HIS L CA  1 
ATOM   3274 C  C   . HIS D  2 95  ? 0.962   26.008 -25.446 1.00 24.45  ? 95  HIS L C   1 
ATOM   3275 O  O   . HIS D  2 95  ? 0.732   27.189 -25.713 1.00 25.14  ? 95  HIS L O   1 
ATOM   3276 C  CB  . HIS D  2 95  ? -1.366  25.611 -24.628 1.00 21.19  ? 95  HIS L CB  1 
ATOM   3277 C  CG  . HIS D  2 95  ? -2.658  24.925 -24.959 1.00 20.61  ? 95  HIS L CG  1 
ATOM   3278 N  ND1 . HIS D  2 95  ? -3.304  25.145 -26.150 1.00 21.55  ? 95  HIS L ND1 1 
ATOM   3279 C  CD2 . HIS D  2 95  ? -3.414  24.004 -24.262 1.00 19.20  ? 95  HIS L CD2 1 
ATOM   3280 C  CE1 . HIS D  2 95  ? -4.424  24.385 -26.197 1.00 22.04  ? 95  HIS L CE1 1 
ATOM   3281 N  NE2 . HIS D  2 95  ? -4.501  23.679 -25.056 1.00 20.02  ? 95  HIS L NE2 1 
ATOM   3282 N  N   . GLU D  2 96  ? 2.197   25.547 -25.195 1.00 26.59  ? 96  GLU L N   1 
ATOM   3283 C  CA  . GLU D  2 96  ? 3.378   26.446 -25.143 1.00 29.47  ? 96  GLU L CA  1 
ATOM   3284 C  C   . GLU D  2 96  ? 3.568   27.079 -26.526 1.00 29.47  ? 96  GLU L C   1 
ATOM   3285 O  O   . GLU D  2 96  ? 3.634   26.350 -27.508 1.00 27.92  ? 96  GLU L O   1 
ATOM   3286 C  CB  . GLU D  2 96  ? 4.639   25.660 -24.709 1.00 32.44  ? 96  GLU L CB  1 
ATOM   3287 C  CG  . GLU D  2 96  ? 5.934   26.473 -24.646 1.00 38.10  ? 96  GLU L CG  1 
ATOM   3288 C  CD  . GLU D  2 96  ? 7.204   25.642 -24.343 1.00 42.23  ? 96  GLU L CD  1 
ATOM   3289 O  OE1 . GLU D  2 96  ? 8.206   26.264 -23.932 1.00 47.51  ? 96  GLU L OE1 1 
ATOM   3290 O  OE2 . GLU D  2 96  ? 7.259   24.395 -24.547 1.00 42.86  ? 96  GLU L OE2 1 
ATOM   3291 N  N   . GLY D  2 97  ? 3.620   28.417 -26.616 1.00 29.08  ? 97  GLY L N   1 
ATOM   3292 C  CA  . GLY D  2 97  ? 3.759   29.077 -27.883 1.00 30.27  ? 97  GLY L CA  1 
ATOM   3293 C  C   . GLY D  2 97  ? 2.578   28.987 -28.842 1.00 29.70  ? 97  GLY L C   1 
ATOM   3294 O  O   . GLY D  2 97  ? 2.740   29.277 -30.020 1.00 31.82  ? 97  GLY L O   1 
ATOM   3295 N  N   . ASP D  2 98  ? 1.383   28.649 -28.336 1.00 28.57  ? 98  ASP L N   1 
ATOM   3296 C  CA  . ASP D  2 98  ? 0.200   28.403 -29.194 1.00 29.08  ? 98  ASP L CA  1 
ATOM   3297 C  C   . ASP D  2 98  ? -0.223  29.686 -29.873 1.00 31.13  ? 98  ASP L C   1 
ATOM   3298 O  O   . ASP D  2 98  ? -0.429  30.720 -29.222 1.00 32.11  ? 98  ASP L O   1 
ATOM   3299 C  CB  . ASP D  2 98  ? -0.943  27.824 -28.339 1.00 28.37  ? 98  ASP L CB  1 
ATOM   3300 C  CG  . ASP D  2 98  ? -2.115  27.276 -29.154 1.00 27.61  ? 98  ASP L CG  1 
ATOM   3301 O  OD1 . ASP D  2 98  ? -2.208  27.460 -30.384 1.00 30.76  ? 98  ASP L OD1 1 
ATOM   3302 O  OD2 . ASP D  2 98  ? -2.997  26.638 -28.498 1.00 27.42  ? 98  ASP L OD2 1 
ATOM   3303 N  N   . GLU D  2 99  ? -0.328  29.640 -31.204 1.00 32.31  ? 99  GLU L N   1 
ATOM   3304 C  CA  . GLU D  2 99  ? -0.739  30.783 -31.979 1.00 33.85  ? 99  GLU L CA  1 
ATOM   3305 C  C   . GLU D  2 99  ? -2.110  30.545 -32.609 1.00 34.64  ? 99  GLU L C   1 
ATOM   3306 O  O   . GLU D  2 99  ? -2.535  31.315 -33.490 1.00 36.78  ? 99  GLU L O   1 
ATOM   3307 C  CB  . GLU D  2 99  ? 0.296   31.069 -33.071 1.00 36.18  ? 99  GLU L CB  1 
ATOM   3308 C  CG  . GLU D  2 99  ? 1.704   31.273 -32.553 1.00 37.45  ? 99  GLU L CG  1 
ATOM   3309 C  CD  . GLU D  2 99  ? 2.710   31.597 -33.629 1.00 39.86  ? 99  GLU L CD  1 
ATOM   3310 O  OE1 . GLU D  2 99  ? 2.331   31.931 -34.764 1.00 41.65  ? 99  GLU L OE1 1 
ATOM   3311 O  OE2 . GLU D  2 99  ? 3.921   31.525 -33.341 1.00 43.15  ? 99  GLU L OE2 1 
ATOM   3312 N  N   . GLY D  2 100 ? -2.781  29.468 -32.214 1.00 33.06  ? 100 GLY L N   1 
ATOM   3313 C  CA  . GLY D  2 100 ? -4.022  29.064 -32.850 1.00 35.11  ? 100 GLY L CA  1 
ATOM   3314 C  C   . GLY D  2 100 ? -3.764  28.660 -34.301 1.00 36.39  ? 100 GLY L C   1 
ATOM   3315 O  O   . GLY D  2 100 ? -2.625  28.410 -34.674 1.00 38.25  ? 100 GLY L O   1 
ATOM   3316 N  N   . PRO D  2 101 ? -4.814  28.622 -35.135 1.00 39.47  ? 101 PRO L N   1 
ATOM   3317 C  CA  . PRO D  2 101 ? -6.173  29.014 -34.817 1.00 38.20  ? 101 PRO L CA  1 
ATOM   3318 C  C   . PRO D  2 101 ? -6.852  27.925 -33.980 1.00 37.66  ? 101 PRO L C   1 
ATOM   3319 O  O   . PRO D  2 101 ? -6.446  26.752 -34.004 1.00 37.35  ? 101 PRO L O   1 
ATOM   3320 C  CB  . PRO D  2 101 ? -6.814  29.177 -36.217 1.00 41.01  ? 101 PRO L CB  1 
ATOM   3321 C  CG  . PRO D  2 101 ? -6.092  28.196 -37.061 1.00 42.38  ? 101 PRO L CG  1 
ATOM   3322 C  CD  . PRO D  2 101 ? -4.745  27.951 -36.444 1.00 40.10  ? 101 PRO L CD  1 
ATOM   3323 N  N   . GLY D  2 102 ? -7.828  28.318 -33.191 1.00 35.62  ? 102 GLY L N   1 
ATOM   3324 C  CA  . GLY D  2 102 ? -8.582  27.324 -32.470 1.00 34.83  ? 102 GLY L CA  1 
ATOM   3325 C  C   . GLY D  2 102 ? -7.713  26.456 -31.528 1.00 31.94  ? 102 GLY L C   1 
ATOM   3326 O  O   . GLY D  2 102 ? -6.801  27.009 -30.883 1.00 34.30  ? 102 GLY L O   1 
ATOM   3327 N  N   . HIS D  2 103 ? -8.048  25.145 -31.409 1.00 39.33  ? 103 HIS L N   1 
ATOM   3328 C  CA  . HIS D  2 103 ? -7.517  24.219 -30.365 1.00 34.41  ? 103 HIS L CA  1 
ATOM   3329 C  C   . HIS D  2 103 ? -6.678  23.068 -30.872 1.00 35.38  ? 103 HIS L C   1 
ATOM   3330 O  O   . HIS D  2 103 ? -7.155  22.229 -31.639 1.00 36.19  ? 103 HIS L O   1 
ATOM   3331 C  CB  . HIS D  2 103 ? -8.648  23.616 -29.495 1.00 30.90  ? 103 HIS L CB  1 
ATOM   3332 C  CG  . HIS D  2 103 ? -8.109  22.874 -28.313 1.00 26.45  ? 103 HIS L CG  1 
ATOM   3333 N  ND1 . HIS D  2 103 ? -7.813  21.560 -28.369 1.00 26.25  ? 103 HIS L ND1 1 
ATOM   3334 C  CD2 . HIS D  2 103 ? -7.658  23.330 -27.087 1.00 23.87  ? 103 HIS L CD2 1 
ATOM   3335 C  CE1 . HIS D  2 103 ? -7.219  21.184 -27.228 1.00 22.51  ? 103 HIS L CE1 1 
ATOM   3336 N  NE2 . HIS D  2 103 ? -7.154  22.254 -26.418 1.00 20.91  ? 103 HIS L NE2 1 
ATOM   3337 N  N   . HIS D  2 104 ? -5.418  23.011 -30.413 1.00 34.87  ? 104 HIS L N   1 
ATOM   3338 C  CA  . HIS D  2 104 ? -4.474  21.904 -30.735 1.00 35.61  ? 104 HIS L CA  1 
ATOM   3339 C  C   . HIS D  2 104 ? -3.610  21.741 -29.516 1.00 31.45  ? 104 HIS L C   1 
ATOM   3340 O  O   . HIS D  2 104 ? -3.327  22.720 -28.869 1.00 30.09  ? 104 HIS L O   1 
ATOM   3341 C  CB  . HIS D  2 104 ? -3.615  22.192 -31.980 1.00 42.41  ? 104 HIS L CB  1 
ATOM   3342 C  CG  . HIS D  2 104 ? -4.410  22.516 -33.193 1.00 49.38  ? 104 HIS L CG  1 
ATOM   3343 N  ND1 . HIS D  2 104 ? -4.769  21.581 -34.121 1.00 52.65  ? 104 HIS L ND1 1 
ATOM   3344 C  CD2 . HIS D  2 104 ? -4.898  23.734 -33.659 1.00 53.15  ? 104 HIS L CD2 1 
ATOM   3345 C  CE1 . HIS D  2 104 ? -5.459  22.174 -35.093 1.00 58.87  ? 104 HIS L CE1 1 
ATOM   3346 N  NE2 . HIS D  2 104 ? -5.534  23.492 -34.814 1.00 58.14  ? 104 HIS L NE2 1 
ATOM   3347 N  N   . HIS D  2 105 ? -3.226  20.506 -29.189 1.00 28.87  ? 105 HIS L N   1 
ATOM   3348 C  CA  . HIS D  2 105 ? -2.199  20.177 -28.219 1.00 25.89  ? 105 HIS L CA  1 
ATOM   3349 C  C   . HIS D  2 105 ? -0.927  19.718 -28.866 1.00 27.63  ? 105 HIS L C   1 
ATOM   3350 O  O   . HIS D  2 105 ? -0.961  18.830 -29.739 1.00 30.67  ? 105 HIS L O   1 
ATOM   3351 C  CB  . HIS D  2 105 ? -2.685  19.030 -27.375 1.00 23.10  ? 105 HIS L CB  1 
ATOM   3352 C  CG  . HIS D  2 105 ? -3.732  19.414 -26.404 1.00 20.32  ? 105 HIS L CG  1 
ATOM   3353 N  ND1 . HIS D  2 105 ? -4.541  18.516 -25.846 1.00 19.97  ? 105 HIS L ND1 1 
ATOM   3354 C  CD2 . HIS D  2 105 ? -4.111  20.666 -25.917 1.00 19.75  ? 105 HIS L CD2 1 
ATOM   3355 C  CE1 . HIS D  2 105 ? -5.356  19.149 -24.917 1.00 18.70  ? 105 HIS L CE1 1 
ATOM   3356 N  NE2 . HIS D  2 105 ? -5.101  20.482 -25.005 1.00 18.47  ? 105 HIS L NE2 1 
ATOM   3357 N  N   . LYS D  2 106 ? 0.181   20.363 -28.533 1.00 27.88  ? 106 LYS L N   1 
ATOM   3358 C  CA  . LYS D  2 106 ? 1.526   19.827 -28.798 1.00 30.30  ? 106 LYS L CA  1 
ATOM   3359 C  C   . LYS D  2 106 ? 1.725   18.672 -27.795 1.00 27.95  ? 106 LYS L C   1 
ATOM   3360 O  O   . LYS D  2 106 ? 0.885   18.499 -26.891 1.00 25.02  ? 106 LYS L O   1 
ATOM   3361 C  CB  . LYS D  2 106 ? 2.569   20.934 -28.607 1.00 32.64  ? 106 LYS L CB  1 
ATOM   3362 C  CG  . LYS D  2 106 ? 2.471   22.123 -29.557 1.00 37.10  ? 106 LYS L CG  1 
ATOM   3363 C  CD  . LYS D  2 106 ? 3.408   23.277 -29.179 1.00 39.54  ? 106 LYS L CD  1 
ATOM   3364 C  CE  . LYS D  2 106 ? 3.154   24.485 -30.081 1.00 44.06  ? 106 LYS L CE  1 
ATOM   3365 N  NZ  . LYS D  2 106 ? 4.137   25.608 -29.935 1.00 47.62  ? 106 LYS L NZ  1 
ATOM   3366 N  N   . PRO D  2 107 ? 2.835   17.910 -27.922 1.00 29.53  ? 107 PRO L N   1 
ATOM   3367 C  CA  . PRO D  2 107 ? 3.249   17.011 -26.826 1.00 28.40  ? 107 PRO L CA  1 
ATOM   3368 C  C   . PRO D  2 107 ? 3.271   17.691 -25.473 1.00 25.98  ? 107 PRO L C   1 
ATOM   3369 O  O   . PRO D  2 107 ? 3.595   18.888 -25.383 1.00 25.99  ? 107 PRO L O   1 
ATOM   3370 C  CB  . PRO D  2 107 ? 4.661   16.576 -27.260 1.00 30.99  ? 107 PRO L CB  1 
ATOM   3371 C  CG  . PRO D  2 107 ? 4.640   16.688 -28.752 1.00 34.56  ? 107 PRO L CG  1 
ATOM   3372 C  CD  . PRO D  2 107 ? 3.836   17.924 -29.002 1.00 33.37  ? 107 PRO L CD  1 
ATOM   3373 N  N   . GLY D  2 108 ? 2.882   16.949 -24.429 1.00 23.89  ? 108 GLY L N   1 
ATOM   3374 C  CA  . GLY D  2 108 ? 2.870   17.452 -23.077 1.00 22.82  ? 108 GLY L CA  1 
ATOM   3375 C  C   . GLY D  2 108 ? 4.193   17.235 -22.372 1.00 23.43  ? 108 GLY L C   1 
ATOM   3376 O  O   . GLY D  2 108 ? 5.249   17.033 -23.014 1.00 24.86  ? 108 GLY L O   1 
ATOM   3377 N  N   . LEU D  2 109 ? 4.135   17.237 -21.042 1.00 22.55  ? 109 LEU L N   1 
ATOM   3378 C  CA  . LEU D  2 109 ? 5.301   17.071 -20.179 1.00 24.66  ? 109 LEU L CA  1 
ATOM   3379 C  C   . LEU D  2 109 ? 6.002   15.743 -20.430 1.00 26.25  ? 109 LEU L C   1 
ATOM   3380 O  O   . LEU D  2 109 ? 5.323   14.726 -20.637 1.00 24.88  ? 109 LEU L O   1 
ATOM   3381 C  CB  . LEU D  2 109 ? 4.888   17.113 -18.720 1.00 24.90  ? 109 LEU L CB  1 
ATOM   3382 C  CG  . LEU D  2 109 ? 5.132   18.360 -17.886 1.00 27.31  ? 109 LEU L CG  1 
ATOM   3383 C  CD1 . LEU D  2 109 ? 5.299   17.966 -16.433 1.00 27.66  ? 109 LEU L CD1 1 
ATOM   3384 C  CD2 . LEU D  2 109 ? 6.313   19.188 -18.379 1.00 30.02  ? 109 LEU L CD2 1 
ATOM   3385 N  N   . GLY D  2 110 ? 7.335   15.784 -20.454 1.00 28.93  ? 110 GLY L N   1 
ATOM   3386 C  CA  . GLY D  2 110 ? 8.168   14.580 -20.572 1.00 32.36  ? 110 GLY L CA  1 
ATOM   3387 C  C   . GLY D  2 110 ? 8.210   13.931 -21.940 1.00 35.31  ? 110 GLY L C   1 
ATOM   3388 O  O   . GLY D  2 110 ? 8.758   12.845 -22.079 1.00 37.80  ? 110 GLY L O   1 
ATOM   3389 N  N   . GLU D  2 111 ? 7.681   14.636 -22.944 1.00 37.14  ? 111 GLU L N   1 
ATOM   3390 C  CA  . GLU D  2 111 ? 7.458   14.165 -24.335 1.00 43.35  ? 111 GLU L CA  1 
ATOM   3391 C  C   . GLU D  2 111 ? 6.120   13.462 -24.594 1.00 43.66  ? 111 GLU L C   1 
ATOM   3392 O  O   . GLU D  2 111 ? 5.487   12.920 -23.712 1.00 45.06  ? 111 GLU L O   1 
ATOM   3393 C  CB  . GLU D  2 111 ? 8.647   13.375 -24.920 1.00 48.65  ? 111 GLU L CB  1 
ATOM   3394 C  CG  . GLU D  2 111 ? 9.594   14.171 -25.829 1.00 53.08  ? 111 GLU L CG  1 
ATOM   3395 C  CD  . GLU D  2 111 ? 9.080   15.558 -26.165 1.00 53.20  ? 111 GLU L CD  1 
ATOM   3396 O  OE1 . GLU D  2 111 ? 9.303   16.037 -27.310 1.00 58.71  ? 111 GLU L OE1 1 
ATOM   3397 O  OE2 . GLU D  2 111 ? 8.458   16.172 -25.258 1.00 49.69  ? 111 GLU L OE2 1 
ATOM   3398 N  N   . GLY D  2 112 ? 5.685   13.446 -25.836 1.00 49.41  ? 112 GLY L N   1 
ATOM   3399 C  CA  . GLY D  2 112 ? 4.426   12.758 -26.162 1.00 47.38  ? 112 GLY L CA  1 
ATOM   3400 C  C   . GLY D  2 112 ? 3.598   12.713 -24.904 1.00 43.33  ? 112 GLY L C   1 
ATOM   3401 O  O   . GLY D  2 112 ? 3.080   13.764 -24.470 1.00 41.18  ? 112 GLY L O   1 
ATOM   3402 N  N   . MET E  1 1   ? -35.587 48.766 -52.138 1.00 39.27  ? 1   MET S N   1 
ATOM   3403 C  CA  . MET E  1 1   ? -35.309 48.717 -50.686 1.00 34.93  ? 1   MET S CA  1 
ATOM   3404 C  C   . MET E  1 1   ? -36.524 48.160 -50.004 1.00 28.88  ? 1   MET S C   1 
ATOM   3405 O  O   . MET E  1 1   ? -37.668 48.493 -50.346 1.00 29.73  ? 1   MET S O   1 
ATOM   3406 C  CB  . MET E  1 1   ? -35.023 50.118 -50.157 1.00 39.90  ? 1   MET S CB  1 
ATOM   3407 C  CG  . MET E  1 1   ? -34.462 50.143 -48.743 1.00 39.08  ? 1   MET S CG  1 
ATOM   3408 S  SD  . MET E  1 1   ? -33.840 51.762 -48.244 1.00 71.56  ? 1   MET S SD  1 
ATOM   3409 C  CE  . MET E  1 1   ? -32.530 52.022 -49.449 1.00 57.34  ? 1   MET S CE  1 
ATOM   3410 N  N   A LEU E  1 2   ? -36.287 47.333 -48.993 0.50 25.05  ? 2   LEU S N   1 
ATOM   3411 N  N   B LEU E  1 2   ? -36.298 47.332 -48.995 0.50 24.26  ? 2   LEU S N   1 
ATOM   3412 C  CA  A LEU E  1 2   ? -37.361 46.814 -48.154 0.50 21.65  ? 2   LEU S CA  1 
ATOM   3413 C  CA  B LEU E  1 2   ? -37.396 46.829 -48.184 0.50 20.49  ? 2   LEU S CA  1 
ATOM   3414 C  C   A LEU E  1 2   ? -38.058 47.956 -47.401 0.50 20.98  ? 2   LEU S C   1 
ATOM   3415 C  C   B LEU E  1 2   ? -38.088 47.987 -47.473 0.50 20.39  ? 2   LEU S C   1 
ATOM   3416 O  O   A LEU E  1 2   ? -37.451 48.989 -47.116 0.50 22.44  ? 2   LEU S O   1 
ATOM   3417 O  O   B LEU E  1 2   ? -37.511 49.062 -47.307 0.50 22.14  ? 2   LEU S O   1 
ATOM   3418 C  CB  A LEU E  1 2   ? -36.797 45.800 -47.164 0.50 20.85  ? 2   LEU S CB  1 
ATOM   3419 C  CB  B LEU E  1 2   ? -36.883 45.822 -47.171 0.50 18.65  ? 2   LEU S CB  1 
ATOM   3420 C  CG  A LEU E  1 2   ? -36.306 44.462 -47.749 0.50 22.05  ? 2   LEU S CG  1 
ATOM   3421 C  CG  B LEU E  1 2   ? -36.200 44.632 -47.857 0.50 19.56  ? 2   LEU S CG  1 
ATOM   3422 C  CD1 A LEU E  1 2   ? -35.340 44.655 -48.924 0.50 24.66  ? 2   LEU S CD1 1 
ATOM   3423 C  CD1 B LEU E  1 2   ? -35.618 43.631 -46.882 0.50 20.71  ? 2   LEU S CD1 1 
ATOM   3424 C  CD2 A LEU E  1 2   ? -35.666 43.598 -46.682 0.50 23.80  ? 2   LEU S CD2 1 
ATOM   3425 C  CD2 B LEU E  1 2   ? -37.183 43.963 -48.833 0.50 18.83  ? 2   LEU S CD2 1 
ATOM   3426 N  N   . THR E  1 3   ? -39.329 47.742 -47.066 1.00 19.02  ? 3   THR S N   1 
ATOM   3427 C  CA  . THR E  1 3   ? -40.120 48.717 -46.293 1.00 18.61  ? 3   THR S CA  1 
ATOM   3428 C  C   . THR E  1 3   ? -39.622 48.663 -44.821 1.00 17.58  ? 3   THR S C   1 
ATOM   3429 O  O   . THR E  1 3   ? -38.855 47.744 -44.380 1.00 17.65  ? 3   THR S O   1 
ATOM   3430 C  CB  . THR E  1 3   ? -41.619 48.366 -46.315 1.00 17.67  ? 3   THR S CB  1 
ATOM   3431 O  OG1 . THR E  1 3   ? -41.807 47.200 -45.509 1.00 16.10  ? 3   THR S OG1 1 
ATOM   3432 C  CG2 . THR E  1 3   ? -42.229 48.162 -47.795 1.00 20.73  ? 3   THR S CG2 1 
ATOM   3433 N  N   . GLU E  1 4   ? -40.032 49.650 -44.055 1.00 18.35  ? 4   GLU S N   1 
ATOM   3434 C  CA  . GLU E  1 4   ? -39.624 49.676 -42.630 1.00 18.82  ? 4   GLU S CA  1 
ATOM   3435 C  C   . GLU E  1 4   ? -40.129 48.416 -41.897 1.00 16.60  ? 4   GLU S C   1 
ATOM   3436 O  O   . GLU E  1 4   ? -39.433 47.884 -41.038 1.00 17.57  ? 4   GLU S O   1 
ATOM   3437 C  CB  . GLU E  1 4   ? -40.115 50.919 -41.921 1.00 23.06  ? 4   GLU S CB  1 
ATOM   3438 C  CG  . GLU E  1 4   ? -39.222 52.099 -42.183 1.00 30.50  ? 4   GLU S CG  1 
ATOM   3439 C  CD  . GLU E  1 4   ? -37.899 52.035 -41.380 1.00 36.43  ? 4   GLU S CD  1 
ATOM   3440 O  OE1 . GLU E  1 4   ? -36.842 51.885 -42.022 1.00 40.81  ? 4   GLU S OE1 1 
ATOM   3441 O  OE2 . GLU E  1 4   ? -37.893 52.130 -40.106 1.00 42.88  ? 4   GLU S OE2 1 
ATOM   3442 N  N   . LEU E  1 5   ? -41.341 47.995 -42.230 1.00 16.45  ? 5   LEU S N   1 
ATOM   3443 C  CA  . LEU E  1 5   ? -41.910 46.795 -41.599 1.00 16.04  ? 5   LEU S CA  1 
ATOM   3444 C  C   . LEU E  1 5   ? -41.114 45.562 -41.946 1.00 15.98  ? 5   LEU S C   1 
ATOM   3445 O  O   . LEU E  1 5   ? -40.797 44.750 -41.091 1.00 14.91  ? 5   LEU S O   1 
ATOM   3446 C  CB  . LEU E  1 5   ? -43.365 46.599 -42.025 1.00 15.86  ? 5   LEU S CB  1 
ATOM   3447 C  CG  . LEU E  1 5   ? -44.014 45.365 -41.440 1.00 15.85  ? 5   LEU S CG  1 
ATOM   3448 C  CD1 . LEU E  1 5   ? -43.994 45.428 -39.891 1.00 15.74  ? 5   LEU S CD1 1 
ATOM   3449 C  CD2 . LEU E  1 5   ? -45.449 45.211 -42.004 1.00 16.15  ? 5   LEU S CD2 1 
ATOM   3450 N  N   . GLU E  1 6   ? -40.822 45.397 -43.229 1.00 15.39  ? 6   GLU S N   1 
ATOM   3451 C  CA  . GLU E  1 6   ? -39.997 44.270 -43.681 1.00 15.72  ? 6   GLU S CA  1 
ATOM   3452 C  C   . GLU E  1 6   ? -38.630 44.260 -43.028 1.00 15.29  ? 6   GLU S C   1 
ATOM   3453 O  O   . GLU E  1 6   ? -38.146 43.254 -42.588 1.00 14.32  ? 6   GLU S O   1 
ATOM   3454 C  CB  . GLU E  1 6   ? -39.896 44.340 -45.226 1.00 16.12  ? 6   GLU S CB  1 
ATOM   3455 C  CG  . GLU E  1 6   ? -41.213 44.001 -45.917 1.00 16.81  ? 6   GLU S CG  1 
ATOM   3456 C  CD  . GLU E  1 6   ? -41.252 44.366 -47.388 1.00 17.74  ? 6   GLU S CD  1 
ATOM   3457 O  OE1 . GLU E  1 6   ? -42.183 43.873 -48.071 1.00 18.62  ? 6   GLU S OE1 1 
ATOM   3458 O  OE2 . GLU E  1 6   ? -40.417 45.165 -47.863 1.00 18.87  ? 6   GLU S OE2 1 
ATOM   3459 N  N   . LYS E  1 7   ? -37.996 45.424 -42.940 1.00 15.65  ? 7   LYS S N   1 
ATOM   3460 C  CA  . LYS E  1 7   ? -36.734 45.549 -42.221 1.00 15.71  ? 7   LYS S CA  1 
ATOM   3461 C  C   . LYS E  1 7   ? -36.830 45.173 -40.771 1.00 14.69  ? 7   LYS S C   1 
ATOM   3462 O  O   . LYS E  1 7   ? -35.906 44.574 -40.215 1.00 15.00  ? 7   LYS S O   1 
ATOM   3463 C  CB  . LYS E  1 7   ? -36.197 46.974 -42.324 1.00 16.84  ? 7   LYS S CB  1 
ATOM   3464 C  CG  . LYS E  1 7   ? -35.656 47.268 -43.731 1.00 18.27  ? 7   LYS S CG  1 
ATOM   3465 C  CD  . LYS E  1 7   ? -35.171 48.702 -43.818 1.00 20.56  ? 7   LYS S CD  1 
ATOM   3466 C  CE  . LYS E  1 7   ? -34.554 49.072 -45.140 1.00 21.68  ? 7   LYS S CE  1 
ATOM   3467 N  NZ  . LYS E  1 7   ? -34.238 50.546 -45.140 1.00 25.17  ? 7   LYS S NZ  1 
ATOM   3468 N  N   . ALA E  1 8   ? -37.973 45.479 -40.146 1.00 13.78  ? 8   ALA S N   1 
ATOM   3469 C  CA  . ALA E  1 8   ? -38.172 45.121 -38.720 1.00 13.16  ? 8   ALA S CA  1 
ATOM   3470 C  C   . ALA E  1 8   ? -38.241 43.571 -38.558 1.00 13.06  ? 8   ALA S C   1 
ATOM   3471 O  O   . ALA E  1 8   ? -37.632 43.067 -37.632 1.00 12.72  ? 8   ALA S O   1 
ATOM   3472 C  CB  . ALA E  1 8   ? -39.445 45.731 -38.194 1.00 13.13  ? 8   ALA S CB  1 
ATOM   3473 N  N   . LEU E  1 9   ? -38.907 42.899 -39.502 1.00 13.53  ? 9   LEU S N   1 
ATOM   3474 C  CA  . LEU E  1 9   ? -38.986 41.437 -39.506 1.00 13.60  ? 9   LEU S CA  1 
ATOM   3475 C  C   . LEU E  1 9   ? -37.568 40.838 -39.696 1.00 13.66  ? 9   LEU S C   1 
ATOM   3476 O  O   . LEU E  1 9   ? -37.163 39.964 -38.927 1.00 14.27  ? 9   LEU S O   1 
ATOM   3477 C  CB  . LEU E  1 9   ? -40.034 40.924 -40.500 1.00 14.05  ? 9   LEU S CB  1 
ATOM   3478 C  CG  . LEU E  1 9   ? -41.437 41.457 -40.283 1.00 14.69  ? 9   LEU S CG  1 
ATOM   3479 C  CD1 . LEU E  1 9   ? -42.387 40.790 -41.293 1.00 15.95  ? 9   LEU S CD1 1 
ATOM   3480 C  CD2 . LEU E  1 9   ? -41.916 41.321 -38.835 1.00 15.48  ? 9   LEU S CD2 1 
ATOM   3481 N  N   . ASN E  1 10  ? -36.778 41.337 -40.644 1.00 14.26  ? 10  ASN S N   1 
ATOM   3482 C  CA  . ASN E  1 10  ? -35.418 40.818 -40.818 1.00 14.75  ? 10  ASN S CA  1 
ATOM   3483 C  C   . ASN E  1 10  ? -34.524 41.133 -39.631 1.00 14.30  ? 10  ASN S C   1 
ATOM   3484 O  O   . ASN E  1 10  ? -33.614 40.367 -39.349 1.00 13.66  ? 10  ASN S O   1 
ATOM   3485 C  CB  . ASN E  1 10  ? -34.796 41.329 -42.106 1.00 15.64  ? 10  ASN S CB  1 
ATOM   3486 C  CG  . ASN E  1 10  ? -35.320 40.587 -43.361 1.00 17.07  ? 10  ASN S CG  1 
ATOM   3487 O  OD1 . ASN E  1 10  ? -35.908 39.474 -43.297 1.00 17.77  ? 10  ASN S OD1 1 
ATOM   3488 N  ND2 . ASN E  1 10  ? -35.040 41.162 -44.490 1.00 19.49  ? 10  ASN S ND2 1 
ATOM   3489 N  N   . SER E  1 11  ? -34.760 42.269 -38.972 1.00 14.39  ? 11  SER S N   1 
ATOM   3490 C  CA  . SER E  1 11  ? -34.018 42.618 -37.788 1.00 14.48  ? 11  SER S CA  1 
ATOM   3491 C  C   . SER E  1 11  ? -34.299 41.656 -36.633 1.00 14.54  ? 11  SER S C   1 
ATOM   3492 O  O   . SER E  1 11  ? -33.402 41.354 -35.838 1.00 13.89  ? 11  SER S O   1 
ATOM   3493 C  CB  . SER E  1 11  ? -34.249 44.090 -37.379 1.00 14.91  ? 11  SER S CB  1 
ATOM   3494 O  OG  . SER E  1 11  ? -33.655 44.363 -36.111 1.00 15.58  ? 11  SER S OG  1 
ATOM   3495 N  N   . ILE E  1 12  ? -35.524 41.121 -36.557 1.00 14.32  ? 12  ILE S N   1 
ATOM   3496 C  CA  . ILE E  1 12  ? -35.856 40.088 -35.556 1.00 14.65  ? 12  ILE S CA  1 
ATOM   3497 C  C   . ILE E  1 12  ? -35.013 38.826 -35.779 1.00 14.27  ? 12  ILE S C   1 
ATOM   3498 O  O   . ILE E  1 12  ? -34.493 38.221 -34.800 1.00 14.74  ? 12  ILE S O   1 
ATOM   3499 C  CB  . ILE E  1 12  ? -37.361 39.788 -35.572 1.00 15.05  ? 12  ILE S CB  1 
ATOM   3500 C  CG1 . ILE E  1 12  ? -38.114 41.022 -35.063 1.00 15.30  ? 12  ILE S CG1 1 
ATOM   3501 C  CG2 . ILE E  1 12  ? -37.678 38.560 -34.700 1.00 14.53  ? 12  ILE S CG2 1 
ATOM   3502 C  CD1 . ILE E  1 12  ? -39.637 40.987 -35.208 1.00 15.24  ? 12  ILE S CD1 1 
ATOM   3503 N  N   . ILE E  1 13  ? -34.821 38.485 -37.027 1.00 13.41  ? 13  ILE S N   1 
ATOM   3504 C  CA  . ILE E  1 13  ? -33.870 37.412 -37.434 1.00 14.05  ? 13  ILE S CA  1 
ATOM   3505 C  C   . ILE E  1 13  ? -32.497 37.784 -36.901 1.00 14.20  ? 13  ILE S C   1 
ATOM   3506 O  O   . ILE E  1 13  ? -31.848 36.959 -36.247 1.00 14.36  ? 13  ILE S O   1 
ATOM   3507 C  CB  . ILE E  1 13  ? -33.814 37.181 -38.956 1.00 14.10  ? 13  ILE S CB  1 
ATOM   3508 C  CG1 . ILE E  1 13  ? -35.167 36.648 -39.465 1.00 14.63  ? 13  ILE S CG1 1 
ATOM   3509 C  CG2 . ILE E  1 13  ? -32.741 36.185 -39.362 1.00 14.28  ? 13  ILE S CG2 1 
ATOM   3510 C  CD1 . ILE E  1 13  ? -35.368 36.695 -40.961 1.00 15.01  ? 13  ILE S CD1 1 
ATOM   3511 N  N   A ASP E  1 14  ? -32.021 38.987 -37.205 0.56 14.15  ? 14  ASP S N   1 
ATOM   3512 N  N   B ASP E  1 14  ? -32.037 38.990 -37.195 0.44 14.10  ? 14  ASP S N   1 
ATOM   3513 C  CA  A ASP E  1 14  ? -30.674 39.388 -36.703 0.56 14.95  ? 14  ASP S CA  1 
ATOM   3514 C  CA  B ASP E  1 14  ? -30.703 39.430 -36.727 0.44 14.73  ? 14  ASP S CA  1 
ATOM   3515 C  C   A ASP E  1 14  ? -30.579 39.288 -35.188 0.56 14.42  ? 14  ASP S C   1 
ATOM   3516 C  C   B ASP E  1 14  ? -30.550 39.402 -35.203 0.44 14.36  ? 14  ASP S C   1 
ATOM   3517 O  O   A ASP E  1 14  ? -29.604 38.734 -34.658 0.56 15.00  ? 14  ASP S O   1 
ATOM   3518 O  O   B ASP E  1 14  ? -29.496 39.048 -34.686 0.44 15.08  ? 14  ASP S O   1 
ATOM   3519 C  CB  A ASP E  1 14  ? -30.304 40.813 -37.123 0.56 15.76  ? 14  ASP S CB  1 
ATOM   3520 C  CB  B ASP E  1 14  ? -30.446 40.835 -37.245 0.44 15.44  ? 14  ASP S CB  1 
ATOM   3521 C  CG  A ASP E  1 14  ? -30.172 40.971 -38.627 0.56 17.66  ? 14  ASP S CG  1 
ATOM   3522 C  CG  B ASP E  1 14  ? -29.084 41.359 -36.894 0.44 16.97  ? 14  ASP S CG  1 
ATOM   3523 O  OD1 A ASP E  1 14  ? -30.008 39.949 -39.313 0.56 18.65  ? 14  ASP S OD1 1 
ATOM   3524 O  OD1 B ASP E  1 14  ? -28.074 40.672 -37.167 0.44 18.21  ? 14  ASP S OD1 1 
ATOM   3525 O  OD2 A ASP E  1 14  ? -30.266 42.125 -39.133 0.56 18.94  ? 14  ASP S OD2 1 
ATOM   3526 O  OD2 B ASP E  1 14  ? -29.014 42.510 -36.408 0.44 19.10  ? 14  ASP S OD2 1 
ATOM   3527 N  N   . VAL E  1 15  ? -31.587 39.787 -34.473 1.00 13.99  ? 15  VAL S N   1 
ATOM   3528 C  CA  . VAL E  1 15  ? -31.525 39.750 -33.033 1.00 13.94  ? 15  VAL S CA  1 
ATOM   3529 C  C   . VAL E  1 15  ? -31.323 38.303 -32.512 1.00 13.85  ? 15  VAL S C   1 
ATOM   3530 O  O   . VAL E  1 15  ? -30.524 38.056 -31.635 1.00 13.60  ? 15  VAL S O   1 
ATOM   3531 C  CB  . VAL E  1 15  ? -32.803 40.325 -32.379 1.00 13.71  ? 15  VAL S CB  1 
ATOM   3532 C  CG1 . VAL E  1 15  ? -32.774 40.031 -30.867 1.00 14.62  ? 15  VAL S CG1 1 
ATOM   3533 C  CG2 . VAL E  1 15  ? -32.912 41.837 -32.568 1.00 14.63  ? 15  VAL S CG2 1 
ATOM   3534 N  N   . TYR E  1 16  ? -32.083 37.369 -33.034 1.00 13.48  ? 16  TYR S N   1 
ATOM   3535 C  CA  . TYR E  1 16  ? -31.908 35.967 -32.662 1.00 13.16  ? 16  TYR S CA  1 
ATOM   3536 C  C   . TYR E  1 16  ? -30.453 35.490 -32.833 1.00 13.04  ? 16  TYR S C   1 
ATOM   3537 O  O   . TYR E  1 16  ? -29.848 34.883 -31.927 1.00 13.76  ? 16  TYR S O   1 
ATOM   3538 C  CB  . TYR E  1 16  ? -32.791 35.075 -33.465 1.00 13.01  ? 16  TYR S CB  1 
ATOM   3539 C  CG  . TYR E  1 16  ? -32.606 33.607 -33.155 1.00 13.29  ? 16  TYR S CG  1 
ATOM   3540 C  CD1 . TYR E  1 16  ? -33.070 33.038 -31.953 1.00 13.84  ? 16  TYR S CD1 1 
ATOM   3541 C  CD2 . TYR E  1 16  ? -31.916 32.808 -34.028 1.00 13.77  ? 16  TYR S CD2 1 
ATOM   3542 C  CE1 . TYR E  1 16  ? -32.913 31.659 -31.709 1.00 13.89  ? 16  TYR S CE1 1 
ATOM   3543 C  CE2 . TYR E  1 16  ? -31.724 31.462 -33.750 1.00 13.84  ? 16  TYR S CE2 1 
ATOM   3544 C  CZ  . TYR E  1 16  ? -32.177 30.913 -32.553 1.00 13.93  ? 16  TYR S CZ  1 
ATOM   3545 O  OH  . TYR E  1 16  ? -31.963 29.562 -32.316 1.00 14.82  ? 16  TYR S OH  1 
ATOM   3546 N  N   . HIS E  1 17  ? -29.855 35.842 -33.947 1.00 13.21  ? 17  HIS S N   1 
ATOM   3547 C  CA  . HIS E  1 17  ? -28.536 35.375 -34.338 1.00 13.54  ? 17  HIS S CA  1 
ATOM   3548 C  C   . HIS E  1 17  ? -27.438 36.014 -33.540 1.00 14.63  ? 17  HIS S C   1 
ATOM   3549 O  O   . HIS E  1 17  ? -26.386 35.430 -33.347 1.00 15.08  ? 17  HIS S O   1 
ATOM   3550 C  CB  . HIS E  1 17  ? -28.335 35.538 -35.844 1.00 13.45  ? 17  HIS S CB  1 
ATOM   3551 C  CG  . HIS E  1 17  ? -29.098 34.556 -36.686 1.00 12.77  ? 17  HIS S CG  1 
ATOM   3552 N  ND1 . HIS E  1 17  ? -30.447 34.685 -36.950 1.00 12.47  ? 17  HIS S ND1 1 
ATOM   3553 C  CD2 . HIS E  1 17  ? -28.690 33.369 -37.300 1.00 12.73  ? 17  HIS S CD2 1 
ATOM   3554 C  CE1 . HIS E  1 17  ? -30.848 33.626 -37.656 1.00 12.22  ? 17  HIS S CE1 1 
ATOM   3555 N  NE2 . HIS E  1 17  ? -29.788 32.804 -37.850 1.00 13.01  ? 17  HIS S NE2 1 
ATOM   3556 N  N   . LYS E  1 18  ? -27.720 37.195 -32.967 1.00 15.52  ? 18  LYS S N   1 
ATOM   3557 C  CA  . LYS E  1 18  ? -26.794 37.769 -31.997 1.00 17.25  ? 18  LYS S CA  1 
ATOM   3558 C  C   . LYS E  1 18  ? -26.471 36.810 -30.877 1.00 16.27  ? 18  LYS S C   1 
ATOM   3559 O  O   . LYS E  1 18  ? -25.364 36.845 -30.272 1.00 16.50  ? 18  LYS S O   1 
ATOM   3560 C  CB  . LYS E  1 18  ? -27.347 39.072 -31.411 1.00 18.99  ? 18  LYS S CB  1 
ATOM   3561 C  CG  . LYS E  1 18  ? -27.303 40.220 -32.422 1.00 22.52  ? 18  LYS S CG  1 
ATOM   3562 C  CD  . LYS E  1 18  ? -27.460 41.623 -31.801 1.00 26.18  ? 18  LYS S CD  1 
ATOM   3563 C  CE  . LYS E  1 18  ? -28.463 41.715 -30.656 1.00 29.41  ? 18  LYS S CE  1 
ATOM   3564 N  NZ  . LYS E  1 18  ? -28.824 43.161 -30.301 1.00 32.23  ? 18  LYS S NZ  1 
ATOM   3565 N  N   . TYR E  1 19  ? -27.462 36.002 -30.542 1.00 15.23  ? 19  TYR S N   1 
ATOM   3566 C  CA  . TYR E  1 19  ? -27.366 35.062 -29.430 1.00 14.97  ? 19  TYR S CA  1 
ATOM   3567 C  C   . TYR E  1 19  ? -27.111 33.637 -29.890 1.00 14.50  ? 19  TYR S C   1 
ATOM   3568 O  O   . TYR E  1 19  ? -26.308 32.933 -29.308 1.00 14.47  ? 19  TYR S O   1 
ATOM   3569 C  CB  . TYR E  1 19  ? -28.605 35.148 -28.514 1.00 15.20  ? 19  TYR S CB  1 
ATOM   3570 C  CG  . TYR E  1 19  ? -28.725 36.542 -28.045 1.00 15.75  ? 19  TYR S CG  1 
ATOM   3571 C  CD1 . TYR E  1 19  ? -28.012 37.006 -26.923 1.00 17.13  ? 19  TYR S CD1 1 
ATOM   3572 C  CD2 . TYR E  1 19  ? -29.459 37.455 -28.750 1.00 16.56  ? 19  TYR S CD2 1 
ATOM   3573 C  CE1 . TYR E  1 19  ? -28.075 38.343 -26.546 1.00 18.43  ? 19  TYR S CE1 1 
ATOM   3574 C  CE2 . TYR E  1 19  ? -29.507 38.803 -28.369 1.00 16.34  ? 19  TYR S CE2 1 
ATOM   3575 C  CZ  . TYR E  1 19  ? -28.815 39.208 -27.236 1.00 17.77  ? 19  TYR S CZ  1 
ATOM   3576 O  OH  . TYR E  1 19  ? -28.908 40.563 -26.947 1.00 20.92  ? 19  TYR S OH  1 
ATOM   3577 N  N   . SER E  1 20  ? -27.714 33.240 -30.990 1.00 13.60  ? 20  SER S N   1 
ATOM   3578 C  CA  . SER E  1 20  ? -27.560 31.858 -31.483 1.00 13.60  ? 20  SER S CA  1 
ATOM   3579 C  C   . SER E  1 20  ? -26.174 31.606 -32.087 1.00 14.13  ? 20  SER S C   1 
ATOM   3580 O  O   . SER E  1 20  ? -25.740 30.483 -32.131 1.00 14.44  ? 20  SER S O   1 
ATOM   3581 C  CB  . SER E  1 20  ? -28.635 31.596 -32.561 1.00 13.41  ? 20  SER S CB  1 
ATOM   3582 O  OG  . SER E  1 20  ? -28.370 32.125 -33.879 1.00 13.34  ? 20  SER S OG  1 
ATOM   3583 N  N   . LEU E  1 21  ? -25.525 32.644 -32.609 1.00 13.43  ? 21  LEU S N   1 
ATOM   3584 C  CA  . LEU E  1 21  ? -24.184 32.552 -33.161 1.00 14.21  ? 21  LEU S CA  1 
ATOM   3585 C  C   . LEU E  1 21  ? -23.078 32.672 -32.148 1.00 14.69  ? 21  LEU S C   1 
ATOM   3586 O  O   . LEU E  1 21  ? -21.892 32.593 -32.514 1.00 16.16  ? 21  LEU S O   1 
ATOM   3587 C  CB  . LEU E  1 21  ? -23.995 33.499 -34.360 1.00 14.44  ? 21  LEU S CB  1 
ATOM   3588 C  CG  . LEU E  1 21  ? -24.972 33.347 -35.488 1.00 14.53  ? 21  LEU S CG  1 
ATOM   3589 C  CD1 . LEU E  1 21  ? -24.669 34.347 -36.578 1.00 14.73  ? 21  LEU S CD1 1 
ATOM   3590 C  CD2 . LEU E  1 21  ? -24.873 31.909 -36.054 1.00 14.79  ? 21  LEU S CD2 1 
ATOM   3591 N  N   . ILE E  1 22  ? -23.428 32.800 -30.876 1.00 14.37  ? 22  ILE S N   1 
ATOM   3592 C  CA  . ILE E  1 22  ? -22.385 32.807 -29.857 1.00 15.08  ? 22  ILE S CA  1 
ATOM   3593 C  C   . ILE E  1 22  ? -21.559 31.541 -29.852 1.00 14.94  ? 22  ILE S C   1 
ATOM   3594 O  O   . ILE E  1 22  ? -20.315 31.614 -29.858 1.00 16.32  ? 22  ILE S O   1 
ATOM   3595 C  CB  . ILE E  1 22  ? -22.940 33.113 -28.481 1.00 15.01  ? 22  ILE S CB  1 
ATOM   3596 C  CG1 . ILE E  1 22  ? -23.539 34.552 -28.481 1.00 15.79  ? 22  ILE S CG1 1 
ATOM   3597 C  CG2 . ILE E  1 22  ? -21.850 33.021 -27.331 1.00 15.81  ? 22  ILE S CG2 1 
ATOM   3598 C  CD1 . ILE E  1 22  ? -24.446 34.772 -27.290 1.00 16.20  ? 22  ILE S CD1 1 
ATOM   3599 N  N   . LYS E  1 23  ? -22.210 30.399 -29.820 1.00 14.02  ? 23  LYS S N   1 
ATOM   3600 C  CA  . LYS E  1 23  ? -21.495 29.124 -29.750 1.00 14.22  ? 23  LYS S CA  1 
ATOM   3601 C  C   . LYS E  1 23  ? -22.333 27.966 -30.148 1.00 13.66  ? 23  LYS S C   1 
ATOM   3602 O  O   . LYS E  1 23  ? -23.587 28.044 -30.139 1.00 13.66  ? 23  LYS S O   1 
ATOM   3603 C  CB  . LYS E  1 23  ? -21.002 28.917 -28.320 1.00 14.37  ? 23  LYS S CB  1 
ATOM   3604 C  CG  . LYS E  1 23  ? -22.092 28.838 -27.259 1.00 14.85  ? 23  LYS S CG  1 
ATOM   3605 C  CD  . LYS E  1 23  ? -21.554 28.588 -25.885 1.00 15.70  ? 23  LYS S CD  1 
ATOM   3606 C  CE  . LYS E  1 23  ? -22.604 28.335 -24.781 1.00 16.02  ? 23  LYS S CE  1 
ATOM   3607 N  NZ  . LYS E  1 23  ? -23.213 29.642 -24.417 1.00 16.81  ? 23  LYS S NZ  1 
ATOM   3608 N  N   . GLY E  1 24  ? -21.669 26.865 -30.471 1.00 13.65  ? 24  GLY S N   1 
ATOM   3609 C  CA  . GLY E  1 24  ? -22.393 25.622 -30.731 1.00 13.69  ? 24  GLY S CA  1 
ATOM   3610 C  C   . GLY E  1 24  ? -23.240 25.736 -31.972 1.00 14.28  ? 24  GLY S C   1 
ATOM   3611 O  O   . GLY E  1 24  ? -22.870 26.376 -32.998 1.00 15.52  ? 24  GLY S O   1 
ATOM   3612 N  N   . ASN E  1 25  ? -24.388 25.076 -31.905 1.00 13.55  ? 25  ASN S N   1 
ATOM   3613 C  CA  . ASN E  1 25  ? -25.276 25.046 -33.075 1.00 13.84  ? 25  ASN S CA  1 
ATOM   3614 C  C   . ASN E  1 25  ? -25.705 26.495 -33.419 1.00 13.49  ? 25  ASN S C   1 
ATOM   3615 O  O   . ASN E  1 25  ? -26.112 27.270 -32.565 1.00 13.03  ? 25  ASN S O   1 
ATOM   3616 C  CB  . ASN E  1 25  ? -26.406 24.064 -32.790 1.00 14.21  ? 25  ASN S CB  1 
ATOM   3617 C  CG  . ASN E  1 25  ? -27.457 24.010 -33.854 1.00 14.76  ? 25  ASN S CG  1 
ATOM   3618 O  OD1 . ASN E  1 25  ? -28.170 24.980 -34.058 1.00 15.89  ? 25  ASN S OD1 1 
ATOM   3619 N  ND2 . ASN E  1 25  ? -27.698 22.777 -34.358 1.00 15.01  ? 25  ASN S ND2 1 
ATOM   3620 N  N   A PHE E  1 26  ? -25.651 26.799 -34.709 0.43 13.67  ? 26  PHE S N   1 
ATOM   3621 N  N   B PHE E  1 26  ? -25.625 26.812 -34.710 0.57 13.57  ? 26  PHE S N   1 
ATOM   3622 C  CA  A PHE E  1 26  ? -25.990 28.135 -35.224 0.43 13.70  ? 26  PHE S CA  1 
ATOM   3623 C  CA  B PHE E  1 26  ? -25.946 28.183 -35.184 0.57 13.61  ? 26  PHE S CA  1 
ATOM   3624 C  C   A PHE E  1 26  ? -27.423 28.607 -34.997 0.43 13.27  ? 26  PHE S C   1 
ATOM   3625 C  C   B PHE E  1 26  ? -27.425 28.614 -35.035 0.57 13.20  ? 26  PHE S C   1 
ATOM   3626 O  O   A PHE E  1 26  ? -27.686 29.807 -35.026 0.43 13.25  ? 26  PHE S O   1 
ATOM   3627 O  O   B PHE E  1 26  ? -27.714 29.809 -35.109 0.57 13.20  ? 26  PHE S O   1 
ATOM   3628 C  CB  A PHE E  1 26  ? -25.747 28.128 -36.725 0.43 14.23  ? 26  PHE S CB  1 
ATOM   3629 C  CB  B PHE E  1 26  ? -25.413 28.420 -36.642 0.57 14.08  ? 26  PHE S CB  1 
ATOM   3630 C  CG  A PHE E  1 26  ? -24.350 27.805 -37.100 0.43 15.04  ? 26  PHE S CG  1 
ATOM   3631 C  CG  B PHE E  1 26  ? -25.670 27.290 -37.623 0.57 14.84  ? 26  PHE S CG  1 
ATOM   3632 C  CD1 A PHE E  1 26  ? -23.291 28.424 -36.458 0.43 15.27  ? 26  PHE S CD1 1 
ATOM   3633 C  CD1 B PHE E  1 26  ? -26.949 26.897 -37.949 0.57 15.04  ? 26  PHE S CD1 1 
ATOM   3634 C  CD2 A PHE E  1 26  ? -24.072 26.936 -38.134 0.43 15.95  ? 26  PHE S CD2 1 
ATOM   3635 C  CD2 B PHE E  1 26  ? -24.615 26.644 -38.237 0.57 16.05  ? 26  PHE S CD2 1 
ATOM   3636 C  CE1 A PHE E  1 26  ? -21.985 28.180 -36.834 0.43 15.93  ? 26  PHE S CE1 1 
ATOM   3637 C  CE1 B PHE E  1 26  ? -27.187 25.862 -38.881 0.57 15.91  ? 26  PHE S CE1 1 
ATOM   3638 C  CE2 A PHE E  1 26  ? -22.760 26.679 -38.503 0.43 16.60  ? 26  PHE S CE2 1 
ATOM   3639 C  CE2 B PHE E  1 26  ? -24.838 25.622 -39.148 0.57 16.91  ? 26  PHE S CE2 1 
ATOM   3640 C  CZ  A PHE E  1 26  ? -21.726 27.308 -37.852 0.43 16.72  ? 26  PHE S CZ  1 
ATOM   3641 C  CZ  B PHE E  1 26  ? -26.132 25.243 -39.474 0.57 16.53  ? 26  PHE S CZ  1 
ATOM   3642 N  N   . HIS E  1 27  ? -28.337 27.651 -34.830 1.00 13.57  ? 27  HIS S N   1 
ATOM   3643 C  CA  . HIS E  1 27  ? -29.747 27.911 -34.557 1.00 13.54  ? 27  HIS S CA  1 
ATOM   3644 C  C   . HIS E  1 27  ? -30.140 27.313 -33.217 1.00 14.28  ? 27  HIS S C   1 
ATOM   3645 O  O   . HIS E  1 27  ? -31.140 26.653 -33.082 1.00 15.64  ? 27  HIS S O   1 
ATOM   3646 C  CB  . HIS E  1 27  ? -30.608 27.432 -35.718 1.00 14.24  ? 27  HIS S CB  1 
ATOM   3647 C  CG  . HIS E  1 27  ? -30.317 28.131 -37.008 1.00 14.37  ? 27  HIS S CG  1 
ATOM   3648 N  ND1 . HIS E  1 27  ? -30.326 27.479 -38.164 1.00 15.64  ? 27  HIS S ND1 1 
ATOM   3649 C  CD2 . HIS E  1 27  ? -30.032 29.457 -37.289 1.00 14.03  ? 27  HIS S CD2 1 
ATOM   3650 C  CE1 . HIS E  1 27  ? -30.086 28.357 -39.174 1.00 16.05  ? 27  HIS S CE1 1 
ATOM   3651 N  NE2 . HIS E  1 27  ? -29.879 29.552 -38.647 1.00 15.06  ? 27  HIS S NE2 1 
ATOM   3652 N  N   . ALA E  1 28  ? -29.236 27.472 -32.265 1.00 13.42  ? 28  ALA S N   1 
ATOM   3653 C  CA  . ALA E  1 28  ? -29.403 27.106 -30.840 1.00 13.99  ? 28  ALA S CA  1 
ATOM   3654 C  C   . ALA E  1 28  ? -28.996 28.254 -29.913 1.00 14.62  ? 28  ALA S C   1 
ATOM   3655 O  O   . ALA E  1 28  ? -27.831 28.669 -29.863 1.00 14.86  ? 28  ALA S O   1 
ATOM   3656 C  CB  . ALA E  1 28  ? -28.599 25.841 -30.498 1.00 13.76  ? 28  ALA S CB  1 
ATOM   3657 N  N   . VAL E  1 29  ? -29.983 28.772 -29.181 1.00 14.54  ? 29  VAL S N   1 
ATOM   3658 C  CA  . VAL E  1 29  ? -29.727 29.628 -28.031 1.00 14.72  ? 29  VAL S CA  1 
ATOM   3659 C  C   . VAL E  1 29  ? -29.828 28.733 -26.836 1.00 14.93  ? 29  VAL S C   1 
ATOM   3660 O  O   . VAL E  1 29  ? -30.885 28.243 -26.503 1.00 15.65  ? 29  VAL S O   1 
ATOM   3661 C  CB  . VAL E  1 29  ? -30.738 30.808 -27.975 1.00 14.87  ? 29  VAL S CB  1 
ATOM   3662 C  CG1 . VAL E  1 29  ? -30.664 31.611 -26.675 1.00 14.97  ? 29  VAL S CG1 1 
ATOM   3663 C  CG2 . VAL E  1 29  ? -30.528 31.685 -29.217 1.00 14.25  ? 29  VAL S CG2 1 
ATOM   3664 N  N   . TYR E  1 30  ? -28.694 28.523 -26.166 1.00 15.38  ? 30  TYR S N   1 
ATOM   3665 C  CA  . TYR E  1 30  ? -28.669 27.631 -25.024 1.00 15.51  ? 30  TYR S CA  1 
ATOM   3666 C  C   . TYR E  1 30  ? -29.227 28.386 -23.828 1.00 16.48  ? 30  TYR S C   1 
ATOM   3667 O  O   . TYR E  1 30  ? -29.527 29.587 -23.912 1.00 16.82  ? 30  TYR S O   1 
ATOM   3668 C  CB  . TYR E  1 30  ? -27.219 27.128 -24.781 1.00 15.18  ? 30  TYR S CB  1 
ATOM   3669 C  CG  . TYR E  1 30  ? -26.726 26.343 -25.958 1.00 14.04  ? 30  TYR S CG  1 
ATOM   3670 C  CD1 . TYR E  1 30  ? -27.146 25.022 -26.151 1.00 14.46  ? 30  TYR S CD1 1 
ATOM   3671 C  CD2 . TYR E  1 30  ? -25.910 26.910 -26.907 1.00 14.05  ? 30  TYR S CD2 1 
ATOM   3672 C  CE1 . TYR E  1 30  ? -26.761 24.263 -27.266 1.00 14.26  ? 30  TYR S CE1 1 
ATOM   3673 C  CE2 . TYR E  1 30  ? -25.466 26.177 -28.020 1.00 13.30  ? 30  TYR S CE2 1 
ATOM   3674 C  CZ  . TYR E  1 30  ? -25.884 24.838 -28.213 1.00 13.80  ? 30  TYR S CZ  1 
ATOM   3675 O  OH  . TYR E  1 30  ? -25.418 24.190 -29.390 1.00 14.03  ? 30  TYR S OH  1 
ATOM   3676 N  N   . ARG E  1 31  ? -29.409 27.684 -22.733 1.00 17.84  ? 31  ARG S N   1 
ATOM   3677 C  CA  . ARG E  1 31  ? -30.021 28.249 -21.548 1.00 19.97  ? 31  ARG S CA  1 
ATOM   3678 C  C   . ARG E  1 31  ? -29.261 29.489 -21.060 1.00 20.07  ? 31  ARG S C   1 
ATOM   3679 O  O   . ARG E  1 31  ? -29.882 30.509 -20.749 1.00 20.47  ? 31  ARG S O   1 
ATOM   3680 C  CB  . ARG E  1 31  ? -30.084 27.228 -20.427 1.00 21.82  ? 31  ARG S CB  1 
ATOM   3681 C  CG  . ARG E  1 31  ? -30.782 27.706 -19.147 1.00 25.34  ? 31  ARG S CG  1 
ATOM   3682 C  CD  . ARG E  1 31  ? -30.570 26.671 -18.054 1.00 29.07  ? 31  ARG S CD  1 
ATOM   3683 N  NE  . ARG E  1 31  ? -31.251 25.408 -18.303 1.00 31.33  ? 31  ARG S NE  1 
ATOM   3684 C  CZ  . ARG E  1 31  ? -32.534 25.134 -18.014 1.00 35.21  ? 31  ARG S CZ  1 
ATOM   3685 N  NH1 . ARG E  1 31  ? -33.356 26.049 -17.492 1.00 36.05  ? 31  ARG S NH1 1 
ATOM   3686 N  NH2 . ARG E  1 31  ? -33.019 23.914 -18.274 1.00 38.06  ? 31  ARG S NH2 1 
ATOM   3687 N  N   . ASP E  1 32  ? -27.925 29.433 -21.093 1.00 17.65  ? 32  ASP S N   1 
ATOM   3688 C  CA  . ASP E  1 32  ? -27.139 30.587 -20.653 1.00 18.53  ? 32  ASP S CA  1 
ATOM   3689 C  C   . ASP E  1 32  ? -27.267 31.753 -21.621 1.00 18.52  ? 32  ASP S C   1 
ATOM   3690 O  O   . ASP E  1 32  ? -27.372 32.931 -21.190 1.00 19.35  ? 32  ASP S O   1 
ATOM   3691 C  CB  . ASP E  1 32  ? -25.679 30.207 -20.359 1.00 19.52  ? 32  ASP S CB  1 
ATOM   3692 C  CG  . ASP E  1 32  ? -24.929 29.554 -21.541 1.00 19.22  ? 32  ASP S CG  1 
ATOM   3693 O  OD1 . ASP E  1 32  ? -25.456 29.336 -22.656 1.00 18.73  ? 32  ASP S OD1 1 
ATOM   3694 O  OD2 . ASP E  1 32  ? -23.774 29.218 -21.305 1.00 21.05  ? 32  ASP S OD2 1 
ATOM   3695 N  N   . ASP E  1 33  ? -27.209 31.449 -22.916 1.00 17.63  ? 33  ASP S N   1 
ATOM   3696 C  CA  . ASP E  1 33  ? -27.463 32.457 -23.973 1.00 17.29  ? 33  ASP S CA  1 
ATOM   3697 C  C   . ASP E  1 33  ? -28.860 33.125 -23.854 1.00 16.91  ? 33  ASP S C   1 
ATOM   3698 O  O   . ASP E  1 33  ? -29.023 34.348 -24.059 1.00 16.68  ? 33  ASP S O   1 
ATOM   3699 C  CB  . ASP E  1 33  ? -27.360 31.887 -25.398 1.00 17.42  ? 33  ASP S CB  1 
ATOM   3700 C  CG  . ASP E  1 33  ? -26.064 31.162 -25.682 1.00 18.38  ? 33  ASP S CG  1 
ATOM   3701 O  OD1 . ASP E  1 33  ? -24.995 31.679 -25.298 1.00 21.00  ? 33  ASP S OD1 1 
ATOM   3702 O  OD2 . ASP E  1 33  ? -26.116 30.085 -26.337 1.00 16.86  ? 33  ASP S OD2 1 
ATOM   3703 N  N   . LEU E  1 34  ? -29.858 32.347 -23.492 1.00 16.93  ? 34  LEU S N   1 
ATOM   3704 C  CA  . LEU E  1 34  ? -31.206 32.904 -23.354 1.00 17.38  ? 34  LEU S CA  1 
ATOM   3705 C  C   . LEU E  1 34  ? -31.288 33.928 -22.200 1.00 17.73  ? 34  LEU S C   1 
ATOM   3706 O  O   . LEU E  1 34  ? -31.985 34.943 -22.319 1.00 16.85  ? 34  LEU S O   1 
ATOM   3707 C  CB  . LEU E  1 34  ? -32.274 31.813 -23.152 1.00 17.35  ? 34  LEU S CB  1 
ATOM   3708 C  CG  . LEU E  1 34  ? -33.714 32.342 -23.234 1.00 16.94  ? 34  LEU S CG  1 
ATOM   3709 C  CD1 . LEU E  1 34  ? -34.055 32.753 -24.664 1.00 17.95  ? 34  LEU S CD1 1 
ATOM   3710 C  CD2 . LEU E  1 34  ? -34.764 31.370 -22.669 1.00 18.16  ? 34  LEU S CD2 1 
ATOM   3711 N  N   . LYS E  1 35  ? -30.597 33.680 -21.106 1.00 19.63  ? 35  LYS S N   1 
ATOM   3712 C  CA  . LYS E  1 35  ? -30.540 34.664 -20.034 1.00 21.08  ? 35  LYS S CA  1 
ATOM   3713 C  C   . LYS E  1 35  ? -29.977 35.983 -20.560 1.00 21.44  ? 35  LYS S C   1 
ATOM   3714 O  O   . LYS E  1 35  ? -30.505 37.047 -20.244 1.00 21.59  ? 35  LYS S O   1 
ATOM   3715 C  CB  . LYS E  1 35  ? -29.761 34.143 -18.834 1.00 23.61  ? 35  LYS S CB  1 
ATOM   3716 C  CG  . LYS E  1 35  ? -29.599 35.147 -17.719 1.00 27.74  ? 35  LYS S CG  1 
ATOM   3717 C  CD  . LYS E  1 35  ? -28.935 34.483 -16.518 1.00 32.07  ? 35  LYS S CD  1 
ATOM   3718 C  CE  . LYS E  1 35  ? -29.120 35.269 -15.208 1.00 37.61  ? 35  LYS S CE  1 
ATOM   3719 N  NZ  . LYS E  1 35  ? -28.300 36.505 -15.105 1.00 42.34  ? 35  LYS S NZ  1 
ATOM   3720 N  N   . LYS E  1 36  ? -28.920 35.913 -21.381 1.00 20.18  ? 36  LYS S N   1 
ATOM   3721 C  CA  . LYS E  1 36  ? -28.332 37.108 -21.949 1.00 21.58  ? 36  LYS S CA  1 
ATOM   3722 C  C   . LYS E  1 36  ? -29.269 37.811 -22.956 1.00 19.10  ? 36  LYS S C   1 
ATOM   3723 O  O   . LYS E  1 36  ? -29.350 39.051 -22.985 1.00 19.41  ? 36  LYS S O   1 
ATOM   3724 C  CB  . LYS E  1 36  ? -27.050 36.751 -22.651 1.00 24.15  ? 36  LYS S CB  1 
ATOM   3725 C  CG  . LYS E  1 36  ? -25.869 36.452 -21.754 1.00 30.50  ? 36  LYS S CG  1 
ATOM   3726 C  CD  . LYS E  1 36  ? -24.541 36.851 -22.459 1.00 36.14  ? 36  LYS S CD  1 
ATOM   3727 C  CE  . LYS E  1 36  ? -24.743 37.563 -23.824 1.00 37.55  ? 36  LYS S CE  1 
ATOM   3728 N  NZ  . LYS E  1 36  ? -23.417 37.992 -24.381 1.00 45.17  ? 36  LYS S NZ  1 
ATOM   3729 N  N   . LEU E  1 37  ? -30.034 37.011 -23.683 1.00 16.90  ? 37  LEU S N   1 
ATOM   3730 C  CA  . LEU E  1 37  ? -30.980 37.509 -24.661 1.00 17.54  ? 37  LEU S CA  1 
ATOM   3731 C  C   . LEU E  1 37  ? -32.065 38.269 -23.890 1.00 17.50  ? 37  LEU S C   1 
ATOM   3732 O  O   . LEU E  1 37  ? -32.363 39.457 -24.189 1.00 17.59  ? 37  LEU S O   1 
ATOM   3733 C  CB  . LEU E  1 37  ? -31.573 36.375 -25.533 1.00 16.87  ? 37  LEU S CB  1 
ATOM   3734 C  CG  . LEU E  1 37  ? -32.550 36.708 -26.632 1.00 17.33  ? 37  LEU S CG  1 
ATOM   3735 C  CD1 . LEU E  1 37  ? -32.615 35.624 -27.712 1.00 17.16  ? 37  LEU S CD1 1 
ATOM   3736 C  CD2 . LEU E  1 37  ? -33.952 37.014 -26.114 1.00 16.87  ? 37  LEU S CD2 1 
ATOM   3737 N  N   . LEU E  1 38  ? -32.611 37.647 -22.851 1.00 18.69  ? 38  LEU S N   1 
ATOM   3738 C  CA  . LEU E  1 38  ? -33.724 38.300 -22.146 1.00 19.19  ? 38  LEU S CA  1 
ATOM   3739 C  C   . LEU E  1 38  ? -33.267 39.581 -21.482 1.00 21.43  ? 38  LEU S C   1 
ATOM   3740 O  O   . LEU E  1 38  ? -33.979 40.614 -21.470 1.00 21.09  ? 38  LEU S O   1 
ATOM   3741 C  CB  . LEU E  1 38  ? -34.319 37.369 -21.072 1.00 20.13  ? 38  LEU S CB  1 
ATOM   3742 C  CG  . LEU E  1 38  ? -35.114 36.189 -21.636 1.00 20.16  ? 38  LEU S CG  1 
ATOM   3743 C  CD1 . LEU E  1 38  ? -35.324 35.019 -20.669 1.00 21.38  ? 38  LEU S CD1 1 
ATOM   3744 C  CD2 . LEU E  1 38  ? -36.472 36.659 -22.161 1.00 24.01  ? 38  LEU S CD2 1 
ATOM   3745 N  N   . GLU E  1 39  ? -32.099 39.512 -20.825 1.00 21.61  ? 39  GLU S N   1 
ATOM   3746 C  CA  . GLU E  1 39  ? -31.552 40.675 -20.134 1.00 25.27  ? 39  GLU S CA  1 
ATOM   3747 C  C   . GLU E  1 39  ? -31.253 41.851 -21.037 1.00 23.63  ? 39  GLU S C   1 
ATOM   3748 O  O   . GLU E  1 39  ? -31.404 42.994 -20.607 1.00 24.89  ? 39  GLU S O   1 
ATOM   3749 C  CB  . GLU E  1 39  ? -30.257 40.299 -19.395 1.00 28.30  ? 39  GLU S CB  1 
ATOM   3750 C  CG  . GLU E  1 39  ? -30.506 39.416 -18.212 1.00 33.15  ? 39  GLU S CG  1 
ATOM   3751 C  CD  . GLU E  1 39  ? -29.229 39.136 -17.449 1.00 39.67  ? 39  GLU S CD  1 
ATOM   3752 O  OE1 . GLU E  1 39  ? -28.118 39.387 -18.010 1.00 46.84  ? 39  GLU S OE1 1 
ATOM   3753 O  OE2 . GLU E  1 39  ? -29.350 38.646 -16.304 1.00 45.11  ? 39  GLU S OE2 1 
ATOM   3754 N  N   . THR E  1 40  ? -30.880 41.595 -22.292 1.00 21.54  ? 40  THR S N   1 
ATOM   3755 C  CA  . THR E  1 40  ? -30.525 42.664 -23.204 1.00 21.82  ? 40  THR S CA  1 
ATOM   3756 C  C   . THR E  1 40  ? -31.696 43.142 -24.045 1.00 20.98  ? 40  THR S C   1 
ATOM   3757 O  O   . THR E  1 40  ? -31.821 44.342 -24.357 1.00 21.57  ? 40  THR S O   1 
ATOM   3758 C  CB  . THR E  1 40  ? -29.450 42.156 -24.172 1.00 23.22  ? 40  THR S CB  1 
ATOM   3759 O  OG1 . THR E  1 40  ? -28.348 41.648 -23.379 1.00 25.01  ? 40  THR S OG1 1 
ATOM   3760 C  CG2 . THR E  1 40  ? -28.929 43.253 -25.071 1.00 23.42  ? 40  THR S CG2 1 
ATOM   3761 N  N   . GLU E  1 41  ? -32.563 42.216 -24.399 1.00 19.12  ? 41  GLU S N   1 
ATOM   3762 C  CA  . GLU E  1 41  ? -33.558 42.490 -25.447 1.00 18.61  ? 41  GLU S CA  1 
ATOM   3763 C  C   . GLU E  1 41  ? -34.950 42.704 -24.915 1.00 18.55  ? 41  GLU S C   1 
ATOM   3764 O  O   . GLU E  1 41  ? -35.798 43.262 -25.618 1.00 17.89  ? 41  GLU S O   1 
ATOM   3765 C  CB  . GLU E  1 41  ? -33.639 41.396 -26.559 1.00 18.62  ? 41  GLU S CB  1 
ATOM   3766 C  CG  . GLU E  1 41  ? -32.321 41.076 -27.233 1.00 19.21  ? 41  GLU S CG  1 
ATOM   3767 C  CD  . GLU E  1 41  ? -31.752 42.224 -28.052 1.00 20.34  ? 41  GLU S CD  1 
ATOM   3768 O  OE1 . GLU E  1 41  ? -32.495 43.159 -28.458 1.00 20.36  ? 41  GLU S OE1 1 
ATOM   3769 O  OE2 . GLU E  1 41  ? -30.574 42.127 -28.365 1.00 22.25  ? 41  GLU S OE2 1 
ATOM   3770 N  N   . SER E  1 42  ? -35.239 42.271 -23.703 1.00 18.76  ? 42  SER S N   1 
ATOM   3771 C  CA  A SER E  1 42  ? -36.629 42.290 -23.256 0.61 19.20  ? 42  SER S CA  1 
ATOM   3772 C  CA  B SER E  1 42  ? -36.621 42.228 -23.220 0.39 19.04  ? 42  SER S CA  1 
ATOM   3773 C  C   . SER E  1 42  ? -36.857 43.200 -22.053 1.00 20.40  ? 42  SER S C   1 
ATOM   3774 O  O   . SER E  1 42  ? -35.984 43.382 -21.207 1.00 21.31  ? 42  SER S O   1 
ATOM   3775 C  CB  A SER E  1 42  ? -37.133 40.883 -22.965 0.61 19.53  ? 42  SER S CB  1 
ATOM   3776 C  CB  B SER E  1 42  ? -36.986 40.793 -22.812 0.39 18.91  ? 42  SER S CB  1 
ATOM   3777 O  OG  A SER E  1 42  ? -36.723 40.446 -21.706 0.61 20.34  ? 42  SER S OG  1 
ATOM   3778 O  OG  B SER E  1 42  ? -37.037 39.934 -23.955 0.39 18.26  ? 42  SER S OG  1 
ATOM   3779 N  N   . PRO E  1 43  ? -38.054 43.819 -22.003 1.00 21.25  ? 43  PRO S N   1 
ATOM   3780 C  CA  . PRO E  1 43  ? -38.360 44.698 -20.904 1.00 23.54  ? 43  PRO S CA  1 
ATOM   3781 C  C   . PRO E  1 43  ? -38.541 43.951 -19.582 1.00 25.53  ? 43  PRO S C   1 
ATOM   3782 O  O   . PRO E  1 43  ? -38.730 42.705 -19.546 1.00 24.12  ? 43  PRO S O   1 
ATOM   3783 C  CB  . PRO E  1 43  ? -39.648 45.379 -21.388 1.00 23.60  ? 43  PRO S CB  1 
ATOM   3784 C  CG  . PRO E  1 43  ? -40.308 44.393 -22.214 1.00 23.27  ? 43  PRO S CG  1 
ATOM   3785 C  CD  . PRO E  1 43  ? -39.189 43.659 -22.941 1.00 21.68  ? 43  PRO S CD  1 
ATOM   3786 N  N   . GLN E  1 44  ? -38.438 44.673 -18.465 1.00 28.31  ? 44  GLN S N   1 
ATOM   3787 C  CA  . GLN E  1 44  ? -38.608 44.089 -17.146 1.00 30.88  ? 44  GLN S CA  1 
ATOM   3788 C  C   . GLN E  1 44  ? -39.839 43.195 -16.948 1.00 29.41  ? 44  GLN S C   1 
ATOM   3789 O  O   . GLN E  1 44  ? -39.760 42.170 -16.283 1.00 30.16  ? 44  GLN S O   1 
ATOM   3790 C  CB  . GLN E  1 44  ? -38.611 45.216 -16.083 1.00 36.37  ? 44  GLN S CB  1 
ATOM   3791 C  CG  . GLN E  1 44  ? -38.475 44.766 -14.630 1.00 42.17  ? 44  GLN S CG  1 
ATOM   3792 C  CD  . GLN E  1 44  ? -37.508 43.605 -14.437 1.00 47.12  ? 44  GLN S CD  1 
ATOM   3793 O  OE1 . GLN E  1 44  ? -36.352 43.675 -14.859 1.00 54.32  ? 44  GLN S OE1 1 
ATOM   3794 N  NE2 . GLN E  1 44  ? -37.979 42.520 -13.802 1.00 52.51  ? 44  GLN S NE2 1 
ATOM   3795 N  N   . TYR E  1 45  ? -40.983 43.609 -17.450 1.00 27.18  ? 45  TYR S N   1 
ATOM   3796 C  CA  . TYR E  1 45  ? -42.203 42.813 -17.335 1.00 27.67  ? 45  TYR S CA  1 
ATOM   3797 C  C   . TYR E  1 45  ? -42.175 41.433 -18.025 1.00 27.49  ? 45  TYR S C   1 
ATOM   3798 O  O   . TYR E  1 45  ? -42.943 40.554 -17.654 1.00 29.30  ? 45  TYR S O   1 
ATOM   3799 C  CB  . TYR E  1 45  ? -43.414 43.630 -17.783 1.00 27.83  ? 45  TYR S CB  1 
ATOM   3800 C  CG  . TYR E  1 45  ? -43.507 43.995 -19.257 1.00 25.41  ? 45  TYR S CG  1 
ATOM   3801 C  CD1 . TYR E  1 45  ? -44.009 43.105 -20.172 1.00 25.08  ? 45  TYR S CD1 1 
ATOM   3802 C  CD2 . TYR E  1 45  ? -43.191 45.284 -19.682 1.00 24.71  ? 45  TYR S CD2 1 
ATOM   3803 C  CE1 . TYR E  1 45  ? -44.134 43.436 -21.522 1.00 24.15  ? 45  TYR S CE1 1 
ATOM   3804 C  CE2 . TYR E  1 45  ? -43.332 45.650 -21.009 1.00 23.49  ? 45  TYR S CE2 1 
ATOM   3805 C  CZ  . TYR E  1 45  ? -43.808 44.726 -21.919 1.00 23.99  ? 45  TYR S CZ  1 
ATOM   3806 O  OH  . TYR E  1 45  ? -43.950 45.097 -23.215 1.00 21.58  ? 45  TYR S OH  1 
ATOM   3807 N  N   . ILE E  1 46  ? -41.297 41.281 -19.012 1.00 24.85  ? 46  ILE S N   1 
ATOM   3808 C  CA  . ILE E  1 46  ? -40.955 39.984 -19.629 1.00 24.53  ? 46  ILE S CA  1 
ATOM   3809 C  C   . ILE E  1 46  ? -39.906 39.261 -18.788 1.00 24.45  ? 46  ILE S C   1 
ATOM   3810 O  O   . ILE E  1 46  ? -40.052 38.085 -18.477 1.00 24.85  ? 46  ILE S O   1 
ATOM   3811 C  CB  . ILE E  1 46  ? -40.455 40.185 -21.062 1.00 23.05  ? 46  ILE S CB  1 
ATOM   3812 C  CG1 . ILE E  1 46  ? -41.593 40.729 -21.953 1.00 23.92  ? 46  ILE S CG1 1 
ATOM   3813 C  CG2 . ILE E  1 46  ? -39.901 38.876 -21.663 1.00 22.86  ? 46  ILE S CG2 1 
ATOM   3814 C  CD1 . ILE E  1 46  ? -42.811 39.822 -22.125 1.00 25.37  ? 46  ILE S CD1 1 
ATOM   3815 N  N   . ARG E  1 47  ? -38.823 39.955 -18.472 1.00 25.50  ? 47  ARG S N   1 
ATOM   3816 C  CA  . ARG E  1 47  ? -37.722 39.372 -17.690 1.00 27.64  ? 47  ARG S CA  1 
ATOM   3817 C  C   . ARG E  1 47  ? -38.177 38.799 -16.349 1.00 29.54  ? 47  ARG S C   1 
ATOM   3818 O  O   . ARG E  1 47  ? -37.638 37.758 -15.918 1.00 29.62  ? 47  ARG S O   1 
ATOM   3819 C  CB  . ARG E  1 47  ? -36.615 40.405 -17.469 1.00 29.84  ? 47  ARG S CB  1 
ATOM   3820 C  CG  . ARG E  1 47  ? -35.896 40.825 -18.718 1.00 30.12  ? 47  ARG S CG  1 
ATOM   3821 C  CD  . ARG E  1 47  ? -34.772 41.783 -18.451 1.00 33.46  ? 47  ARG S CD  1 
ATOM   3822 N  NE  . ARG E  1 47  ? -35.213 43.041 -17.891 1.00 42.62  ? 47  ARG S NE  1 
ATOM   3823 C  CZ  . ARG E  1 47  ? -34.379 43.978 -17.439 1.00 46.17  ? 47  ARG S CZ  1 
ATOM   3824 N  NH1 . ARG E  1 47  ? -33.053 43.812 -17.566 1.00 45.57  ? 47  ARG S NH1 1 
ATOM   3825 N  NH2 . ARG E  1 47  ? -34.863 45.098 -16.914 1.00 48.40  ? 47  ARG S NH2 1 
ATOM   3826 N  N   . LYS E  1 48  ? -39.191 39.410 -15.740 1.00 31.05  ? 48  LYS S N   1 
ATOM   3827 C  CA  . LYS E  1 48  ? -39.629 39.054 -14.381 1.00 33.90  ? 48  LYS S CA  1 
ATOM   3828 C  C   . LYS E  1 48  ? -40.174 37.622 -14.281 1.00 34.38  ? 48  LYS S C   1 
ATOM   3829 O  O   . LYS E  1 48  ? -40.225 37.040 -13.212 1.00 33.94  ? 48  LYS S O   1 
ATOM   3830 C  CB  . LYS E  1 48  ? -40.681 40.039 -13.865 1.00 36.37  ? 48  LYS S CB  1 
ATOM   3831 C  CG  . LYS E  1 48  ? -42.091 39.782 -14.399 1.00 37.32  ? 48  LYS S CG  1 
ATOM   3832 C  CD  . LYS E  1 48  ? -43.068 40.804 -13.850 1.00 41.21  ? 48  LYS S CD  1 
ATOM   3833 C  CE  . LYS E  1 48  ? -44.388 40.768 -14.588 1.00 42.86  ? 48  LYS S CE  1 
ATOM   3834 N  NZ  . LYS E  1 48  ? -45.300 41.765 -13.953 1.00 46.69  ? 48  LYS S NZ  1 
ATOM   3835 N  N   . LYS E  1 49  ? -40.599 37.059 -15.400 1.00 33.83  ? 49  LYS S N   1 
ATOM   3836 C  CA  . LYS E  1 49  ? -40.989 35.661 -15.439 1.00 34.40  ? 49  LYS S CA  1 
ATOM   3837 C  C   . LYS E  1 49  ? -39.837 34.749 -15.008 1.00 33.10  ? 49  LYS S C   1 
ATOM   3838 O  O   . LYS E  1 49  ? -40.084 33.658 -14.513 1.00 33.74  ? 49  LYS S O   1 
ATOM   3839 C  CB  . LYS E  1 49  ? -41.466 35.279 -16.844 1.00 34.72  ? 49  LYS S CB  1 
ATOM   3840 C  CG  . LYS E  1 49  ? -41.800 33.810 -16.969 1.00 37.99  ? 49  LYS S CG  1 
ATOM   3841 C  CD  . LYS E  1 49  ? -43.156 33.564 -17.585 1.00 40.53  ? 49  LYS S CD  1 
ATOM   3842 C  CE  . LYS E  1 49  ? -43.036 33.499 -19.075 1.00 38.29  ? 49  LYS S CE  1 
ATOM   3843 N  NZ  . LYS E  1 49  ? -44.304 33.247 -19.796 1.00 39.54  ? 49  LYS S NZ  1 
ATOM   3844 N  N   . GLY E  1 50  ? -38.591 35.180 -15.211 1.00 29.97  ? 50  GLY S N   1 
ATOM   3845 C  CA  . GLY E  1 50  ? -37.434 34.339 -14.910 1.00 29.83  ? 50  GLY S CA  1 
ATOM   3846 C  C   . GLY E  1 50  ? -36.892 33.634 -16.144 1.00 26.66  ? 50  GLY S C   1 
ATOM   3847 O  O   . GLY E  1 50  ? -37.671 33.093 -16.949 1.00 25.52  ? 50  GLY S O   1 
ATOM   3848 N  N   . ALA E  1 51  ? -35.569 33.620 -16.323 1.00 29.64  ? 51  ALA S N   1 
ATOM   3849 C  CA  . ALA E  1 51  ? -34.970 33.032 -17.529 1.00 27.69  ? 51  ALA S CA  1 
ATOM   3850 C  C   . ALA E  1 51  ? -35.148 31.519 -17.624 1.00 26.89  ? 51  ALA S C   1 
ATOM   3851 O  O   . ALA E  1 51  ? -35.345 30.969 -18.724 1.00 25.46  ? 51  ALA S O   1 
ATOM   3852 C  CB  . ALA E  1 51  ? -33.499 33.364 -17.646 1.00 28.18  ? 51  ALA S CB  1 
ATOM   3853 N  N   . ASP E  1 52  ? -35.049 30.817 -16.511 1.00 28.25  ? 52  ASP S N   1 
ATOM   3854 C  CA  . ASP E  1 52  ? -35.239 29.361 -16.550 1.00 28.46  ? 52  ASP S CA  1 
ATOM   3855 C  C   . ASP E  1 52  ? -36.698 29.014 -16.840 1.00 27.09  ? 52  ASP S C   1 
ATOM   3856 O  O   . ASP E  1 52  ? -37.003 28.023 -17.483 1.00 26.51  ? 52  ASP S O   1 
ATOM   3857 C  CB  . ASP E  1 52  ? -34.744 28.688 -15.259 1.00 31.37  ? 52  ASP S CB  1 
ATOM   3858 C  CG  . ASP E  1 52  ? -33.219 28.617 -15.173 1.00 33.80  ? 52  ASP S CG  1 
ATOM   3859 O  OD1 . ASP E  1 52  ? -32.533 28.661 -16.213 1.00 33.60  ? 52  ASP S OD1 1 
ATOM   3860 O  OD2 . ASP E  1 52  ? -32.672 28.515 -14.049 1.00 38.05  ? 52  ASP S OD2 1 
ATOM   3861 N  N   . VAL E  1 53  ? -37.614 29.856 -16.367 1.00 26.75  ? 53  VAL S N   1 
ATOM   3862 C  CA  . VAL E  1 53  ? -39.004 29.612 -16.586 1.00 26.44  ? 53  VAL S CA  1 
ATOM   3863 C  C   . VAL E  1 53  ? -39.272 29.786 -18.064 1.00 24.48  ? 53  VAL S C   1 
ATOM   3864 O  O   . VAL E  1 53  ? -39.952 28.966 -18.680 1.00 24.71  ? 53  VAL S O   1 
ATOM   3865 C  CB  . VAL E  1 53  ? -39.865 30.530 -15.697 1.00 28.61  ? 53  VAL S CB  1 
ATOM   3866 C  CG1 . VAL E  1 53  ? -41.335 30.487 -16.107 1.00 29.31  ? 53  VAL S CG1 1 
ATOM   3867 C  CG2 . VAL E  1 53  ? -39.663 30.114 -14.255 1.00 30.30  ? 53  VAL S CG2 1 
ATOM   3868 N  N   . TRP E  1 54  ? -38.735 30.856 -18.631 1.00 22.56  ? 54  TRP S N   1 
ATOM   3869 C  CA  . TRP E  1 54  ? -38.887 31.087 -20.053 1.00 20.59  ? 54  TRP S CA  1 
ATOM   3870 C  C   . TRP E  1 54  ? -38.244 29.992 -20.846 1.00 19.91  ? 54  TRP S C   1 
ATOM   3871 O  O   . TRP E  1 54  ? -38.819 29.495 -21.801 1.00 18.63  ? 54  TRP S O   1 
ATOM   3872 C  CB  . TRP E  1 54  ? -38.247 32.411 -20.453 1.00 19.77  ? 54  TRP S CB  1 
ATOM   3873 C  CG  . TRP E  1 54  ? -39.174 33.578 -20.428 1.00 20.45  ? 54  TRP S CG  1 
ATOM   3874 C  CD1 . TRP E  1 54  ? -39.071 34.714 -19.658 1.00 21.74  ? 54  TRP S CD1 1 
ATOM   3875 C  CD2 . TRP E  1 54  ? -40.333 33.798 -21.304 1.00 19.88  ? 54  TRP S CD2 1 
ATOM   3876 N  NE1 . TRP E  1 54  ? -40.066 35.587 -19.959 1.00 21.31  ? 54  TRP S NE1 1 
ATOM   3877 C  CE2 . TRP E  1 54  ? -40.848 35.109 -20.958 1.00 20.99  ? 54  TRP S CE2 1 
ATOM   3878 C  CE3 . TRP E  1 54  ? -40.957 33.070 -22.298 1.00 19.21  ? 54  TRP S CE3 1 
ATOM   3879 C  CZ2 . TRP E  1 54  ? -41.997 35.639 -21.550 1.00 20.56  ? 54  TRP S CZ2 1 
ATOM   3880 C  CZ3 . TRP E  1 54  ? -42.118 33.598 -22.885 1.00 19.00  ? 54  TRP S CZ3 1 
ATOM   3881 C  CH2 . TRP E  1 54  ? -42.600 34.870 -22.548 1.00 19.34  ? 54  TRP S CH2 1 
ATOM   3882 N  N   . PHE E  1 55  ? -37.033 29.576 -20.460 1.00 20.47  ? 55  PHE S N   1 
ATOM   3883 C  CA  . PHE E  1 55  ? -36.349 28.509 -21.197 1.00 20.10  ? 55  PHE S CA  1 
ATOM   3884 C  C   . PHE E  1 55  ? -37.186 27.239 -21.251 1.00 20.56  ? 55  PHE S C   1 
ATOM   3885 O  O   . PHE E  1 55  ? -37.323 26.641 -22.306 1.00 19.47  ? 55  PHE S O   1 
ATOM   3886 C  CB  . PHE E  1 55  ? -34.990 28.174 -20.585 1.00 20.82  ? 55  PHE S CB  1 
ATOM   3887 C  CG  . PHE E  1 55  ? -34.179 27.214 -21.450 1.00 20.69  ? 55  PHE S CG  1 
ATOM   3888 C  CD1 . PHE E  1 55  ? -33.461 27.709 -22.542 1.00 20.13  ? 55  PHE S CD1 1 
ATOM   3889 C  CD2 . PHE E  1 55  ? -34.191 25.858 -21.201 1.00 21.80  ? 55  PHE S CD2 1 
ATOM   3890 C  CE1 . PHE E  1 55  ? -32.715 26.855 -23.368 1.00 19.81  ? 55  PHE S CE1 1 
ATOM   3891 C  CE2 . PHE E  1 55  ? -33.431 24.999 -22.003 1.00 21.57  ? 55  PHE S CE2 1 
ATOM   3892 C  CZ  . PHE E  1 55  ? -32.723 25.506 -23.080 1.00 20.34  ? 55  PHE S CZ  1 
ATOM   3893 N  N   . LYS E  1 56  ? -37.756 26.842 -20.124 1.00 22.05  ? 56  LYS S N   1 
ATOM   3894 C  CA  . LYS E  1 56  ? -38.585 25.625 -20.070 1.00 23.50  ? 56  LYS S CA  1 
ATOM   3895 C  C   . LYS E  1 56  ? -39.845 25.755 -20.934 1.00 23.42  ? 56  LYS S C   1 
ATOM   3896 O  O   . LYS E  1 56  ? -40.204 24.811 -21.637 1.00 25.25  ? 56  LYS S O   1 
ATOM   3897 C  CB  . LYS E  1 56  ? -38.979 25.297 -18.648 1.00 26.67  ? 56  LYS S CB  1 
ATOM   3898 C  CG  . LYS E  1 56  ? -39.695 23.970 -18.564 1.00 28.80  ? 56  LYS S CG  1 
ATOM   3899 C  CD  . LYS E  1 56  ? -39.743 23.487 -17.135 1.00 31.98  ? 56  LYS S CD  1 
ATOM   3900 C  CE  . LYS E  1 56  ? -40.384 22.112 -17.068 1.00 33.82  ? 56  LYS S CE  1 
ATOM   3901 N  NZ  . LYS E  1 56  ? -40.519 21.648 -15.672 1.00 37.68  ? 56  LYS S NZ  1 
ATOM   3902 N  N   . GLU E  1 57  ? -40.451 26.934 -20.968 1.00 23.08  ? 57  GLU S N   1 
ATOM   3903 C  CA  . GLU E  1 57  ? -41.578 27.173 -21.880 1.00 22.90  ? 57  GLU S CA  1 
ATOM   3904 C  C   . GLU E  1 57  ? -41.183 27.124 -23.350 1.00 20.85  ? 57  GLU S C   1 
ATOM   3905 O  O   . GLU E  1 57  ? -41.931 26.635 -24.184 1.00 21.88  ? 57  GLU S O   1 
ATOM   3906 C  CB  . GLU E  1 57  ? -42.263 28.520 -21.607 1.00 24.38  ? 57  GLU S CB  1 
ATOM   3907 C  CG  . GLU E  1 57  ? -42.960 28.553 -20.260 1.00 27.37  ? 57  GLU S CG  1 
ATOM   3908 C  CD  . GLU E  1 57  ? -43.730 29.832 -20.023 1.00 28.77  ? 57  GLU S CD  1 
ATOM   3909 O  OE1 . GLU E  1 57  ? -44.181 29.953 -18.869 1.00 32.27  ? 57  GLU S OE1 1 
ATOM   3910 O  OE2 . GLU E  1 57  ? -43.862 30.677 -20.950 1.00 27.47  ? 57  GLU S OE2 1 
ATOM   3911 N  N   . LEU E  1 58  ? -40.026 27.691 -23.674 1.00 19.06  ? 58  LEU S N   1 
ATOM   3912 C  CA  . LEU E  1 58  ? -39.645 27.846 -25.089 1.00 17.66  ? 58  LEU S CA  1 
ATOM   3913 C  C   . LEU E  1 58  ? -39.042 26.571 -25.669 1.00 17.13  ? 58  LEU S C   1 
ATOM   3914 O  O   . LEU E  1 58  ? -39.141 26.363 -26.910 1.00 16.43  ? 58  LEU S O   1 
ATOM   3915 C  CB  . LEU E  1 58  ? -38.698 29.025 -25.307 1.00 16.43  ? 58  LEU S CB  1 
ATOM   3916 C  CG  . LEU E  1 58  ? -39.269 30.402 -24.927 1.00 16.77  ? 58  LEU S CG  1 
ATOM   3917 C  CD1 . LEU E  1 58  ? -38.215 31.493 -24.999 1.00 16.34  ? 58  LEU S CD1 1 
ATOM   3918 C  CD2 . LEU E  1 58  ? -40.464 30.806 -25.804 1.00 16.12  ? 58  LEU S CD2 1 
ATOM   3919 N  N   . ASP E  1 59  ? -38.391 25.768 -24.826 1.00 17.04  ? 59  ASP S N   1 
ATOM   3920 C  CA  . ASP E  1 59  ? -37.687 24.578 -25.333 1.00 17.09  ? 59  ASP S CA  1 
ATOM   3921 C  C   . ASP E  1 59  ? -38.707 23.433 -25.483 1.00 17.81  ? 59  ASP S C   1 
ATOM   3922 O  O   . ASP E  1 59  ? -38.752 22.481 -24.703 1.00 19.33  ? 59  ASP S O   1 
ATOM   3923 C  CB  . ASP E  1 59  ? -36.486 24.196 -24.484 1.00 17.48  ? 59  ASP S CB  1 
ATOM   3924 C  CG  . ASP E  1 59  ? -35.741 22.998 -25.070 1.00 17.31  ? 59  ASP S CG  1 
ATOM   3925 O  OD1 . ASP E  1 59  ? -35.959 22.709 -26.291 1.00 17.31  ? 59  ASP S OD1 1 
ATOM   3926 O  OD2 . ASP E  1 59  ? -34.901 22.415 -24.359 1.00 18.49  ? 59  ASP S OD2 1 
ATOM   3927 N  N   A ILE E  1 60  ? -39.508 23.558 -26.539 0.28 17.84  ? 60  ILE S N   1 
ATOM   3928 N  N   B ILE E  1 60  ? -39.526 23.520 -26.530 0.72 17.82  ? 60  ILE S N   1 
ATOM   3929 C  CA  A ILE E  1 60  ? -40.654 22.706 -26.784 0.28 18.64  ? 60  ILE S CA  1 
ATOM   3930 C  CA  B ILE E  1 60  ? -40.673 22.650 -26.659 0.72 18.46  ? 60  ILE S CA  1 
ATOM   3931 C  C   A ILE E  1 60  ? -40.253 21.233 -26.958 0.28 19.29  ? 60  ILE S C   1 
ATOM   3932 C  C   B ILE E  1 60  ? -40.305 21.192 -27.016 0.72 19.17  ? 60  ILE S C   1 
ATOM   3933 O  O   A ILE E  1 60  ? -40.885 20.348 -26.380 0.28 20.21  ? 60  ILE S O   1 
ATOM   3934 O  O   B ILE E  1 60  ? -41.063 20.266 -26.693 0.72 19.64  ? 60  ILE S O   1 
ATOM   3935 C  CB  A ILE E  1 60  ? -41.448 23.225 -28.009 0.28 18.48  ? 60  ILE S CB  1 
ATOM   3936 C  CB  B ILE E  1 60  ? -41.707 23.165 -27.692 0.72 18.35  ? 60  ILE S CB  1 
ATOM   3937 C  CG1 A ILE E  1 60  ? -42.038 24.608 -27.695 0.28 18.31  ? 60  ILE S CG1 1 
ATOM   3938 C  CG1 B ILE E  1 60  ? -41.119 23.172 -29.093 0.72 17.66  ? 60  ILE S CG1 1 
ATOM   3939 C  CG2 A ILE E  1 60  ? -42.562 22.266 -28.405 0.28 19.64  ? 60  ILE S CG2 1 
ATOM   3940 C  CG2 B ILE E  1 60  ? -42.184 24.574 -27.342 0.72 18.29  ? 60  ILE S CG2 1 
ATOM   3941 C  CD1 A ILE E  1 60  ? -43.097 24.603 -26.609 0.28 19.46  ? 60  ILE S CD1 1 
ATOM   3942 C  CD1 B ILE E  1 60  ? -42.143 23.659 -30.127 0.72 17.98  ? 60  ILE S CD1 1 
ATOM   3943 N  N   . ASN E  1 61  ? -39.195 20.971 -27.726 1.00 18.76  ? 61  ASN S N   1 
ATOM   3944 C  CA  . ASN E  1 61  ? -38.696 19.585 -27.910 1.00 19.80  ? 61  ASN S CA  1 
ATOM   3945 C  C   . ASN E  1 61  ? -37.686 19.087 -26.863 1.00 20.71  ? 61  ASN S C   1 
ATOM   3946 O  O   . ASN E  1 61  ? -37.102 18.006 -27.043 1.00 21.01  ? 61  ASN S O   1 
ATOM   3947 C  CB  . ASN E  1 61  ? -38.130 19.394 -29.314 1.00 19.57  ? 61  ASN S CB  1 
ATOM   3948 C  CG  . ASN E  1 61  ? -36.845 20.112 -29.512 1.00 19.36  ? 61  ASN S CG  1 
ATOM   3949 O  OD1 . ASN E  1 61  ? -36.630 21.167 -28.896 1.00 17.98  ? 61  ASN S OD1 1 
ATOM   3950 N  ND2 . ASN E  1 61  ? -36.011 19.618 -30.446 1.00 19.13  ? 61  ASN S ND2 1 
ATOM   3951 N  N   . THR E  1 62  ? -37.521 19.847 -25.761 1.00 20.64  ? 62  THR S N   1 
ATOM   3952 C  CA  . THR E  1 62  ? -36.635 19.488 -24.631 1.00 21.23  ? 62  THR S CA  1 
ATOM   3953 C  C   . THR E  1 62  ? -35.252 18.983 -25.139 1.00 20.47  ? 62  THR S C   1 
ATOM   3954 O  O   . THR E  1 62  ? -34.787 17.924 -24.721 1.00 21.38  ? 62  THR S O   1 
ATOM   3955 C  CB  . THR E  1 62  ? -37.335 18.510 -23.656 1.00 23.40  ? 62  THR S CB  1 
ATOM   3956 O  OG1 . THR E  1 62  ? -37.867 17.384 -24.385 1.00 24.60  ? 62  THR S OG1 1 
ATOM   3957 C  CG2 . THR E  1 62  ? -38.497 19.211 -22.930 1.00 24.59  ? 62  THR S CG2 1 
ATOM   3958 N  N   . ASP E  1 63  ? -34.619 19.734 -26.052 1.00 18.34  ? 63  ASP S N   1 
ATOM   3959 C  CA  . ASP E  1 63  ? -33.280 19.372 -26.581 1.00 18.18  ? 63  ASP S CA  1 
ATOM   3960 C  C   . ASP E  1 63  ? -32.143 20.271 -26.022 1.00 17.77  ? 63  ASP S C   1 
ATOM   3961 O  O   . ASP E  1 63  ? -30.997 20.152 -26.418 1.00 18.82  ? 63  ASP S O   1 
ATOM   3962 C  CB  . ASP E  1 63  ? -33.257 19.310 -28.110 1.00 17.99  ? 63  ASP S CB  1 
ATOM   3963 C  CG  . ASP E  1 63  ? -33.371 20.658 -28.748 1.00 18.19  ? 63  ASP S CG  1 
ATOM   3964 O  OD1 . ASP E  1 63  ? -33.757 21.613 -28.030 1.00 17.29  ? 63  ASP S OD1 1 
ATOM   3965 O  OD2 . ASP E  1 63  ? -33.197 20.711 -29.997 1.00 19.99  ? 63  ASP S OD2 1 
ATOM   3966 N  N   . GLY E  1 64  ? -32.487 21.162 -25.100 1.00 17.68  ? 64  GLY S N   1 
ATOM   3967 C  CA  . GLY E  1 64  ? -31.513 21.994 -24.442 1.00 17.84  ? 64  GLY S CA  1 
ATOM   3968 C  C   . GLY E  1 64  ? -31.152 23.272 -25.134 1.00 17.18  ? 64  GLY S C   1 
ATOM   3969 O  O   . GLY E  1 64  ? -30.231 23.970 -24.718 1.00 17.34  ? 64  GLY S O   1 
ATOM   3970 N  N   . ALA E  1 65  ? -31.907 23.622 -26.167 1.00 16.37  ? 65  ALA S N   1 
ATOM   3971 C  CA  . ALA E  1 65  ? -31.733 24.955 -26.757 1.00 15.92  ? 65  ALA S CA  1 
ATOM   3972 C  C   . ALA E  1 65  ? -33.025 25.490 -27.302 1.00 15.59  ? 65  ALA S C   1 
ATOM   3973 O  O   . ALA E  1 65  ? -33.977 24.732 -27.519 1.00 15.96  ? 65  ALA S O   1 
ATOM   3974 C  CB  . ALA E  1 65  ? -30.754 24.880 -27.873 1.00 17.15  ? 65  ALA S CB  1 
ATOM   3975 N  N   . VAL E  1 66  ? -33.011 26.790 -27.554 1.00 14.69  ? 66  VAL S N   1 
ATOM   3976 C  CA  . VAL E  1 66  ? -34.112 27.477 -28.231 1.00 14.43  ? 66  VAL S CA  1 
ATOM   3977 C  C   . VAL E  1 66  ? -33.694 27.726 -29.693 1.00 14.10  ? 66  VAL S C   1 
ATOM   3978 O  O   . VAL E  1 66  ? -32.743 28.462 -30.011 1.00 14.47  ? 66  VAL S O   1 
ATOM   3979 C  CB  . VAL E  1 66  ? -34.470 28.776 -27.476 1.00 14.52  ? 66  VAL S CB  1 
ATOM   3980 C  CG1 . VAL E  1 66  ? -35.498 29.600 -28.283 1.00 14.95  ? 66  VAL S CG1 1 
ATOM   3981 C  CG2 . VAL E  1 66  ? -34.943 28.479 -26.028 1.00 15.53  ? 66  VAL S CG2 1 
ATOM   3982 N  N   . ASN E  1 67  ? -34.415 27.113 -30.614 1.00 14.23  ? 67  ASN S N   1 
ATOM   3983 C  CA  . ASN E  1 67  ? -34.171 27.312 -32.062 1.00 14.33  ? 67  ASN S CA  1 
ATOM   3984 C  C   . ASN E  1 67  ? -34.972 28.503 -32.544 1.00 14.12  ? 67  ASN S C   1 
ATOM   3985 O  O   . ASN E  1 67  ? -35.639 29.186 -31.733 1.00 13.94  ? 67  ASN S O   1 
ATOM   3986 C  CB  . ASN E  1 67  ? -34.415 26.011 -32.881 1.00 15.04  ? 67  ASN S CB  1 
ATOM   3987 C  CG  . ASN E  1 67  ? -35.880 25.586 -32.965 1.00 15.09  ? 67  ASN S CG  1 
ATOM   3988 O  OD1 . ASN E  1 67  ? -36.811 26.353 -32.699 1.00 15.14  ? 67  ASN S OD1 1 
ATOM   3989 N  ND2 . ASN E  1 67  ? -36.084 24.317 -33.363 1.00 16.69  ? 67  ASN S ND2 1 
ATOM   3990 N  N   . PHE E  1 68  ? -34.976 28.755 -33.857 1.00 14.56  ? 68  PHE S N   1 
ATOM   3991 C  CA  . PHE E  1 68  ? -35.580 30.006 -34.300 1.00 15.03  ? 68  PHE S CA  1 
ATOM   3992 C  C   . PHE E  1 68  ? -37.109 29.971 -34.136 1.00 15.31  ? 68  PHE S C   1 
ATOM   3993 O  O   . PHE E  1 68  ? -37.719 30.985 -33.747 1.00 14.97  ? 68  PHE S O   1 
ATOM   3994 C  CB  . PHE E  1 68  ? -35.195 30.343 -35.738 1.00 15.57  ? 68  PHE S CB  1 
ATOM   3995 C  CG  . PHE E  1 68  ? -35.633 31.701 -36.152 1.00 15.59  ? 68  PHE S CG  1 
ATOM   3996 C  CD1 . PHE E  1 68  ? -35.213 32.816 -35.433 1.00 15.50  ? 68  PHE S CD1 1 
ATOM   3997 C  CD2 . PHE E  1 68  ? -36.463 31.884 -37.243 1.00 15.95  ? 68  PHE S CD2 1 
ATOM   3998 C  CE1 . PHE E  1 68  ? -35.596 34.088 -35.795 1.00 15.61  ? 68  PHE S CE1 1 
ATOM   3999 C  CE2 . PHE E  1 68  ? -36.859 33.166 -37.629 1.00 15.99  ? 68  PHE S CE2 1 
ATOM   4000 C  CZ  . PHE E  1 68  ? -36.415 34.246 -36.883 1.00 16.13  ? 68  PHE S CZ  1 
ATOM   4001 N  N   . GLN E  1 69  ? -37.741 28.859 -34.514 1.00 16.58  ? 69  GLN S N   1 
ATOM   4002 C  CA  . GLN E  1 69  ? -39.210 28.779 -34.363 1.00 18.10  ? 69  GLN S CA  1 
ATOM   4003 C  C   . GLN E  1 69  ? -39.624 28.885 -32.904 1.00 16.68  ? 69  GLN S C   1 
ATOM   4004 O  O   . GLN E  1 69  ? -40.655 29.483 -32.585 1.00 16.83  ? 69  GLN S O   1 
ATOM   4005 C  CB  . GLN E  1 69  ? -39.831 27.491 -34.848 1.00 20.63  ? 69  GLN S CB  1 
ATOM   4006 C  CG  . GLN E  1 69  ? -39.347 26.794 -36.058 1.00 26.00  ? 69  GLN S CG  1 
ATOM   4007 C  CD  . GLN E  1 69  ? -38.105 25.847 -35.852 1.00 26.18  ? 69  GLN S CD  1 
ATOM   4008 O  OE1 . GLN E  1 69  ? -36.995 26.415 -35.993 1.00 25.30  ? 69  GLN S OE1 1 
ATOM   4009 N  NE2 . GLN E  1 69  ? -38.275 24.377 -35.735 1.00 24.97  ? 69  GLN S NE2 1 
ATOM   4010 N  N   . GLU E  1 70  ? -38.849 28.291 -32.002 1.00 16.14  ? 70  GLU S N   1 
ATOM   4011 C  CA  . GLU E  1 70  ? -39.155 28.408 -30.556 1.00 15.23  ? 70  GLU S CA  1 
ATOM   4012 C  C   . GLU E  1 70  ? -38.969 29.895 -30.072 1.00 15.27  ? 70  GLU S C   1 
ATOM   4013 O  O   . GLU E  1 70  ? -39.738 30.395 -29.272 1.00 16.15  ? 70  GLU S O   1 
ATOM   4014 C  CB  . GLU E  1 70  ? -38.228 27.496 -29.776 1.00 15.32  ? 70  GLU S CB  1 
ATOM   4015 C  CG  . GLU E  1 70  ? -38.522 26.026 -30.001 1.00 15.36  ? 70  GLU S CG  1 
ATOM   4016 C  CD  . GLU E  1 70  ? -37.495 25.085 -29.389 1.00 15.96  ? 70  GLU S CD  1 
ATOM   4017 O  OE1 . GLU E  1 70  ? -36.268 25.358 -29.427 1.00 15.01  ? 70  GLU S OE1 1 
ATOM   4018 O  OE2 . GLU E  1 70  ? -37.883 23.973 -28.925 1.00 16.19  ? 70  GLU S OE2 1 
ATOM   4019 N  N   . PHE E  1 71  ? -37.953 30.569 -30.566 1.00 14.13  ? 71  PHE S N   1 
ATOM   4020 C  CA  . PHE E  1 71  ? -37.793 31.990 -30.310 1.00 13.87  ? 71  PHE S CA  1 
ATOM   4021 C  C   . PHE E  1 71  ? -38.975 32.826 -30.742 1.00 14.09  ? 71  PHE S C   1 
ATOM   4022 O  O   . PHE E  1 71  ? -39.330 33.794 -30.094 1.00 14.46  ? 71  PHE S O   1 
ATOM   4023 C  CB  . PHE E  1 71  ? -36.499 32.471 -30.979 1.00 13.72  ? 71  PHE S CB  1 
ATOM   4024 C  CG  . PHE E  1 71  ? -36.344 33.980 -30.997 1.00 13.62  ? 71  PHE S CG  1 
ATOM   4025 C  CD1 . PHE E  1 71  ? -36.023 34.674 -29.795 1.00 14.23  ? 71  PHE S CD1 1 
ATOM   4026 C  CD2 . PHE E  1 71  ? -36.367 34.654 -32.225 1.00 14.25  ? 71  PHE S CD2 1 
ATOM   4027 C  CE1 . PHE E  1 71  ? -35.848 36.054 -29.839 1.00 15.06  ? 71  PHE S CE1 1 
ATOM   4028 C  CE2 . PHE E  1 71  ? -36.176 36.032 -32.265 1.00 15.06  ? 71  PHE S CE2 1 
ATOM   4029 C  CZ  . PHE E  1 71  ? -35.889 36.691 -31.068 1.00 14.59  ? 71  PHE S CZ  1 
ATOM   4030 N  N   . LEU E  1 72  ? -39.598 32.442 -31.841 1.00 14.40  ? 72  LEU S N   1 
ATOM   4031 C  CA  . LEU E  1 72  ? -40.732 33.191 -32.363 1.00 15.08  ? 72  LEU S CA  1 
ATOM   4032 C  C   . LEU E  1 72  ? -41.928 33.117 -31.420 1.00 15.40  ? 72  LEU S C   1 
ATOM   4033 O  O   . LEU E  1 72  ? -42.744 34.030 -31.420 1.00 15.40  ? 72  LEU S O   1 
ATOM   4034 C  CB  . LEU E  1 72  ? -41.083 32.775 -33.780 1.00 15.58  ? 72  LEU S CB  1 
ATOM   4035 C  CG  . LEU E  1 72  ? -40.116 33.193 -34.937 1.00 16.16  ? 72  LEU S CG  1 
ATOM   4036 C  CD1 . LEU E  1 72  ? -40.685 32.668 -36.221 1.00 18.15  ? 72  LEU S CD1 1 
ATOM   4037 C  CD2 . LEU E  1 72  ? -39.945 34.715 -34.984 1.00 16.58  ? 72  LEU S CD2 1 
ATOM   4038 N  N   . ILE E  1 73  ? -41.970 32.099 -30.546 1.00 15.59  ? 73  ILE S N   1 
ATOM   4039 C  CA  . ILE E  1 73  ? -42.978 32.060 -29.458 1.00 16.03  ? 73  ILE S CA  1 
ATOM   4040 C  C   . ILE E  1 73  ? -42.768 33.257 -28.534 1.00 16.19  ? 73  ILE S C   1 
ATOM   4041 O  O   . ILE E  1 73  ? -43.713 33.987 -28.191 1.00 16.55  ? 73  ILE S O   1 
ATOM   4042 C  CB  . ILE E  1 73  ? -42.926 30.768 -28.646 1.00 16.49  ? 73  ILE S CB  1 
ATOM   4043 C  CG1 . ILE E  1 73  ? -43.186 29.571 -29.525 1.00 17.57  ? 73  ILE S CG1 1 
ATOM   4044 C  CG2 . ILE E  1 73  ? -43.905 30.871 -27.443 1.00 17.30  ? 73  ILE S CG2 1 
ATOM   4045 C  CD1 . ILE E  1 73  ? -42.947 28.262 -28.819 1.00 17.81  ? 73  ILE S CD1 1 
ATOM   4046 N  N   . LEU E  1 74  ? -41.509 33.513 -28.133 1.00 15.79  ? 74  LEU S N   1 
ATOM   4047 C  CA  . LEU E  1 74  ? -41.204 34.676 -27.331 1.00 15.89  ? 74  LEU S CA  1 
ATOM   4048 C  C   . LEU E  1 74  ? -41.528 36.002 -28.035 1.00 15.78  ? 74  LEU S C   1 
ATOM   4049 O  O   . LEU E  1 74  ? -42.119 36.910 -27.416 1.00 16.55  ? 74  LEU S O   1 
ATOM   4050 C  CB  . LEU E  1 74  ? -39.723 34.658 -26.881 1.00 15.63  ? 74  LEU S CB  1 
ATOM   4051 C  CG  . LEU E  1 74  ? -39.197 35.886 -26.176 1.00 15.98  ? 74  LEU S CG  1 
ATOM   4052 C  CD1 . LEU E  1 74  ? -39.861 36.067 -24.803 1.00 17.16  ? 74  LEU S CD1 1 
ATOM   4053 C  CD2 . LEU E  1 74  ? -37.709 35.814 -26.006 1.00 16.43  ? 74  LEU S CD2 1 
ATOM   4054 N  N   . VAL E  1 75  ? -41.175 36.084 -29.304 1.00 15.53  ? 75  VAL S N   1 
ATOM   4055 C  CA  . VAL E  1 75  ? -41.450 37.295 -30.094 1.00 15.23  ? 75  VAL S CA  1 
ATOM   4056 C  C   . VAL E  1 75  ? -42.975 37.558 -30.050 1.00 14.93  ? 75  VAL S C   1 
ATOM   4057 O  O   . VAL E  1 75  ? -43.424 38.697 -29.833 1.00 15.16  ? 75  VAL S O   1 
ATOM   4058 C  CB  . VAL E  1 75  ? -40.936 37.199 -31.515 1.00 16.17  ? 75  VAL S CB  1 
ATOM   4059 C  CG1 . VAL E  1 75  ? -41.319 38.453 -32.293 1.00 15.73  ? 75  VAL S CG1 1 
ATOM   4060 C  CG2 . VAL E  1 75  ? -39.404 37.128 -31.473 1.00 16.71  ? 75  VAL S CG2 1 
ATOM   4061 N  N   . ILE E  1 76  ? -43.740 36.531 -30.364 1.00 14.85  ? 76  ILE S N   1 
ATOM   4062 C  CA  . ILE E  1 76  ? -45.232 36.647 -30.399 1.00 15.55  ? 76  ILE S CA  1 
ATOM   4063 C  C   . ILE E  1 76  ? -45.748 37.160 -29.045 1.00 15.80  ? 76  ILE S C   1 
ATOM   4064 O  O   . ILE E  1 76  ? -46.528 38.125 -28.981 1.00 16.09  ? 76  ILE S O   1 
ATOM   4065 C  CB  . ILE E  1 76  ? -45.907 35.327 -30.829 1.00 15.52  ? 76  ILE S CB  1 
ATOM   4066 C  CG1 . ILE E  1 76  ? -45.651 35.041 -32.311 1.00 15.79  ? 76  ILE S CG1 1 
ATOM   4067 C  CG2 . ILE E  1 76  ? -47.395 35.348 -30.479 1.00 16.92  ? 76  ILE S CG2 1 
ATOM   4068 C  CD1 . ILE E  1 76  ? -45.856 33.567 -32.696 1.00 16.67  ? 76  ILE S CD1 1 
ATOM   4069 N  N   . LYS E  1 77  ? -45.297 36.565 -27.947 1.00 16.93  ? 77  LYS S N   1 
ATOM   4070 C  CA  . LYS E  1 77  ? -45.796 36.960 -26.645 1.00 18.00  ? 77  LYS S CA  1 
ATOM   4071 C  C   . LYS E  1 77  ? -45.369 38.365 -26.263 1.00 17.54  ? 77  LYS S C   1 
ATOM   4072 O  O   . LYS E  1 77  ? -46.144 39.116 -25.673 1.00 18.24  ? 77  LYS S O   1 
ATOM   4073 C  CB  . LYS E  1 77  ? -45.362 35.978 -25.588 1.00 17.94  ? 77  LYS S CB  1 
ATOM   4074 C  CG  . LYS E  1 77  ? -46.159 34.711 -25.733 1.00 19.40  ? 77  LYS S CG  1 
ATOM   4075 C  CD  . LYS E  1 77  ? -45.819 33.664 -24.739 1.00 20.96  ? 77  LYS S CD  1 
ATOM   4076 C  CE  . LYS E  1 77  ? -46.873 32.551 -24.809 1.00 22.23  ? 77  LYS S CE  1 
ATOM   4077 N  NZ  . LYS E  1 77  ? -46.616 31.599 -23.726 1.00 25.11  ? 77  LYS S NZ  1 
ATOM   4078 N  N   . MET E  1 78  ? -44.131 38.705 -26.562 1.00 16.38  ? 78  MET S N   1 
ATOM   4079 C  CA  . MET E  1 78  ? -43.647 40.059 -26.394 1.00 16.36  ? 78  MET S CA  1 
ATOM   4080 C  C   . MET E  1 78  ? -44.478 41.069 -27.209 1.00 16.44  ? 78  MET S C   1 
ATOM   4081 O  O   . MET E  1 78  ? -44.755 42.169 -26.704 1.00 16.80  ? 78  MET S O   1 
ATOM   4082 C  CB  . MET E  1 78  ? -42.147 40.155 -26.731 1.00 15.46  ? 78  MET S CB  1 
ATOM   4083 C  CG  . MET E  1 78  ? -41.216 39.568 -25.674 1.00 15.72  ? 78  MET S CG  1 
ATOM   4084 S  SD  . MET E  1 78  ? -39.465 39.834 -26.123 1.00 18.97  ? 78  MET S SD  1 
ATOM   4085 C  CE  . MET E  1 78  ? -39.386 41.615 -26.188 1.00 15.87  ? 78  MET S CE  1 
ATOM   4086 N  N   . GLY E  1 79  ? -44.810 40.755 -28.481 1.00 16.52  ? 79  GLY S N   1 
ATOM   4087 C  CA  . GLY E  1 79  ? -45.613 41.641 -29.325 1.00 16.70  ? 79  GLY S CA  1 
ATOM   4088 C  C   . GLY E  1 79  ? -46.980 41.896 -28.741 1.00 17.21  ? 79  GLY S C   1 
ATOM   4089 O  O   . GLY E  1 79  ? -47.436 43.038 -28.645 1.00 17.27  ? 79  GLY S O   1 
ATOM   4090 N  N   . VAL E  1 80  ? -47.665 40.810 -28.412 1.00 16.80  ? 80  VAL S N   1 
ATOM   4091 C  CA  . VAL E  1 80  ? -48.989 40.904 -27.798 1.00 17.46  ? 80  VAL S CA  1 
ATOM   4092 C  C   . VAL E  1 80  ? -48.953 41.733 -26.481 1.00 18.01  ? 80  VAL S C   1 
ATOM   4093 O  O   . VAL E  1 80  ? -49.777 42.629 -26.260 1.00 19.36  ? 80  VAL S O   1 
ATOM   4094 C  CB  . VAL E  1 80  ? -49.557 39.525 -27.549 1.00 17.72  ? 80  VAL S CB  1 
ATOM   4095 C  CG1 . VAL E  1 80  ? -50.843 39.616 -26.731 1.00 18.10  ? 80  VAL S CG1 1 
ATOM   4096 C  CG2 . VAL E  1 80  ? -49.801 38.828 -28.869 1.00 17.00  ? 80  VAL S CG2 1 
ATOM   4097 N  N   . ALA E  1 81  ? -47.967 41.493 -25.636 1.00 18.31  ? 81  ALA S N   1 
ATOM   4098 C  CA  . ALA E  1 81  ? -47.814 42.254 -24.369 1.00 19.44  ? 81  ALA S CA  1 
ATOM   4099 C  C   . ALA E  1 81  ? -47.557 43.741 -24.614 1.00 19.31  ? 81  ALA S C   1 
ATOM   4100 O  O   . ALA E  1 81  ? -48.156 44.615 -23.998 1.00 20.63  ? 81  ALA S O   1 
ATOM   4101 C  CB  . ALA E  1 81  ? -46.665 41.693 -23.563 1.00 19.80  ? 81  ALA S CB  1 
ATOM   4102 N  N   . ALA E  1 82  ? -46.674 44.034 -25.584 1.00 18.29  ? 82  ALA S N   1 
ATOM   4103 C  CA  . ALA E  1 82  ? -46.355 45.430 -25.884 1.00 18.63  ? 82  ALA S CA  1 
ATOM   4104 C  C   . ALA E  1 82  ? -47.522 46.161 -26.532 1.00 18.60  ? 82  ALA S C   1 
ATOM   4105 O  O   . ALA E  1 82  ? -47.752 47.355 -26.288 1.00 19.80  ? 82  ALA S O   1 
ATOM   4106 C  CB  . ALA E  1 82  ? -45.112 45.491 -26.785 1.00 17.98  ? 82  ALA S CB  1 
ATOM   4107 N  N   . HIS E  1 83  ? -48.293 45.466 -27.352 1.00 18.54  ? 83  HIS S N   1 
ATOM   4108 C  CA  . HIS E  1 83  ? -49.477 46.077 -27.948 1.00 18.97  ? 83  HIS S CA  1 
ATOM   4109 C  C   . HIS E  1 83  ? -50.467 46.433 -26.841 1.00 20.42  ? 83  HIS S C   1 
ATOM   4110 O  O   . HIS E  1 83  ? -51.057 47.538 -26.832 1.00 20.23  ? 83  HIS S O   1 
ATOM   4111 C  CB  . HIS E  1 83  ? -50.111 45.198 -29.052 1.00 18.70  ? 83  HIS S CB  1 
ATOM   4112 C  CG  . HIS E  1 83  ? -51.470 45.692 -29.451 1.00 19.78  ? 83  HIS S CG  1 
ATOM   4113 N  ND1 . HIS E  1 83  ? -52.599 45.182 -28.913 1.00 20.60  ? 83  HIS S ND1 1 
ATOM   4114 C  CD2 . HIS E  1 83  ? -51.857 46.746 -30.247 1.00 20.48  ? 83  HIS S CD2 1 
ATOM   4115 C  CE1 . HIS E  1 83  ? -53.656 45.857 -29.377 1.00 21.74  ? 83  HIS S CE1 1 
ATOM   4116 N  NE2 . HIS E  1 83  ? -53.211 46.820 -30.184 1.00 21.76  ? 83  HIS S NE2 1 
ATOM   4117 N  N   . LYS E  1 84  ? -50.663 45.528 -25.868 1.00 21.02  ? 84  LYS S N   1 
ATOM   4118 C  CA  . LYS E  1 84  ? -51.585 45.811 -24.765 1.00 23.55  ? 84  LYS S CA  1 
ATOM   4119 C  C   . LYS E  1 84  ? -51.089 47.048 -23.978 1.00 23.69  ? 84  LYS S C   1 
ATOM   4120 O  O   . LYS E  1 84  ? -51.853 47.935 -23.620 1.00 24.39  ? 84  LYS S O   1 
ATOM   4121 C  CB  . LYS E  1 84  ? -51.735 44.563 -23.877 1.00 25.72  ? 84  LYS S CB  1 
ATOM   4122 C  CG  . LYS E  1 84  ? -52.571 44.773 -22.626 1.00 30.36  ? 84  LYS S CG  1 
ATOM   4123 C  CD  . LYS E  1 84  ? -52.701 43.476 -21.855 1.00 32.87  ? 84  LYS S CD  1 
ATOM   4124 C  CE  . LYS E  1 84  ? -52.748 43.682 -20.343 1.00 36.42  ? 84  LYS S CE  1 
ATOM   4125 N  NZ  . LYS E  1 84  ? -54.135 43.958 -19.940 1.00 39.25  ? 84  LYS S NZ  1 
ATOM   4126 N  N   . LYS E  1 85  ? -49.795 47.097 -23.725 1.00 23.22  ? 85  LYS S N   1 
ATOM   4127 C  CA  . LYS E  1 85  ? -49.203 48.209 -22.994 1.00 24.55  ? 85  LYS S CA  1 
ATOM   4128 C  C   . LYS E  1 85  ? -49.297 49.545 -23.726 1.00 23.58  ? 85  LYS S C   1 
ATOM   4129 O  O   . LYS E  1 85  ? -49.374 50.599 -23.084 1.00 24.17  ? 85  LYS S O   1 
ATOM   4130 C  CB  . LYS E  1 85  ? -47.794 47.873 -22.621 1.00 26.21  ? 85  LYS S CB  1 
ATOM   4131 C  CG  . LYS E  1 85  ? -47.868 46.881 -21.443 1.00 29.21  ? 85  LYS S CG  1 
ATOM   4132 C  CD  . LYS E  1 85  ? -46.574 46.731 -20.697 1.00 32.18  ? 85  LYS S CD  1 
ATOM   4133 C  CE  . LYS E  1 85  ? -46.628 45.537 -19.752 1.00 32.63  ? 85  LYS S CE  1 
ATOM   4134 N  NZ  . LYS E  1 85  ? -47.393 45.773 -18.498 1.00 35.91  ? 85  LYS S NZ  1 
ATOM   4135 N  N   . SER E  1 86  ? -49.303 49.523 -25.056 1.00 21.89  ? 86  SER S N   1 
ATOM   4136 C  CA  . SER E  1 86  ? -49.442 50.792 -25.802 1.00 21.61  ? 86  SER S CA  1 
ATOM   4137 C  C   . SER E  1 86  ? -50.784 51.509 -25.499 1.00 22.61  ? 86  SER S C   1 
ATOM   4138 O  O   . SER E  1 86  ? -50.925 52.743 -25.739 1.00 23.33  ? 86  SER S O   1 
ATOM   4139 C  CB  . SER E  1 86  ? -49.249 50.532 -27.301 1.00 20.36  ? 86  SER S CB  1 
ATOM   4140 O  OG  . SER E  1 86  ? -50.440 50.061 -27.887 1.00 20.98  ? 86  SER S OG  1 
ATOM   4141 N  N   . HIS E  1 87  ? -51.774 50.791 -24.972 1.00 23.49  ? 87  HIS S N   1 
ATOM   4142 C  CA  . HIS E  1 87  ? -53.045 51.392 -24.645 1.00 25.58  ? 87  HIS S CA  1 
ATOM   4143 C  C   . HIS E  1 87  ? -53.250 51.576 -23.164 1.00 28.43  ? 87  HIS S C   1 
ATOM   4144 O  O   . HIS E  1 87  ? -54.360 51.862 -22.715 1.00 29.88  ? 87  HIS S O   1 
ATOM   4145 C  CB  . HIS E  1 87  ? -54.175 50.577 -25.302 1.00 25.33  ? 87  HIS S CB  1 
ATOM   4146 C  CG  . HIS E  1 87  ? -54.080 50.510 -26.787 1.00 24.14  ? 87  HIS S CG  1 
ATOM   4147 N  ND1 . HIS E  1 87  ? -54.284 51.579 -27.577 1.00 23.62  ? 87  HIS S ND1 1 
ATOM   4148 C  CD2 . HIS E  1 87  ? -53.820 49.448 -27.630 1.00 23.51  ? 87  HIS S CD2 1 
ATOM   4149 C  CE1 . HIS E  1 87  ? -54.122 51.227 -28.855 1.00 23.62  ? 87  HIS S CE1 1 
ATOM   4150 N  NE2 . HIS E  1 87  ? -53.875 49.921 -28.899 1.00 23.51  ? 87  HIS S NE2 1 
ATOM   4151 N  N   . GLU E  1 88  ? -52.180 51.524 -22.382 1.00 31.36  ? 88  GLU S N   1 
ATOM   4152 C  CA  . GLU E  1 88  ? -52.258 51.800 -20.914 1.00 35.85  ? 88  GLU S CA  1 
ATOM   4153 C  C   . GLU E  1 88  ? -51.504 53.119 -20.608 1.00 38.25  ? 88  GLU S C   1 
ATOM   4154 O  O   . GLU E  1 88  ? -50.536 53.401 -21.314 1.00 37.97  ? 88  GLU S O   1 
ATOM   4155 C  CB  . GLU E  1 88  ? -51.642 50.596 -20.174 1.00 36.81  ? 88  GLU S CB  1 
ATOM   4156 C  CG  . GLU E  1 88  ? -52.416 49.302 -20.404 1.00 37.84  ? 88  GLU S CG  1 
ATOM   4157 C  CD  . GLU E  1 88  ? -51.796 48.091 -19.741 1.00 40.63  ? 88  GLU S CD  1 
ATOM   4158 O  OE1 . GLU E  1 88  ? -52.431 47.016 -19.789 1.00 44.25  ? 88  GLU S OE1 1 
ATOM   4159 O  OE2 . GLU E  1 88  ? -50.679 48.196 -19.187 1.00 42.24  ? 88  GLU S OE2 1 
ATOM   4160 N  N   . GLU E  1 89  ? -51.841 53.916 -19.571 1.00 45.82  ? 89  GLU S N   1 
ATOM   4161 C  CA  . GLU E  1 89  ? -52.600 53.527 -18.373 1.00 50.65  ? 89  GLU S CA  1 
ATOM   4162 C  C   . GLU E  1 89  ? -53.560 54.626 -17.932 1.00 55.38  ? 89  GLU S C   1 
ATOM   4163 O  O   . GLU E  1 89  ? -54.356 55.136 -18.725 1.00 60.20  ? 89  GLU S O   1 
ATOM   4164 C  CB  . GLU E  1 89  ? -51.634 53.220 -17.221 1.00 51.79  ? 89  GLU S CB  1 
ATOM   4165 N  N   . LYS F  2 4   ? -31.662 52.874 -24.833 1.00 51.21  ? 4   LYS T N   1 
ATOM   4166 C  CA  . LYS F  2 4   ? -33.072 52.987 -24.354 1.00 49.94  ? 4   LYS T CA  1 
ATOM   4167 C  C   . LYS F  2 4   ? -33.864 51.685 -24.655 1.00 41.12  ? 4   LYS T C   1 
ATOM   4168 O  O   . LYS F  2 4   ? -33.705 50.679 -23.954 1.00 41.36  ? 4   LYS T O   1 
ATOM   4169 C  CB  . LYS F  2 4   ? -33.723 54.260 -24.938 1.00 54.48  ? 4   LYS T CB  1 
ATOM   4170 C  CG  . LYS F  2 4   ? -34.925 54.834 -24.161 1.00 60.10  ? 4   LYS T CG  1 
ATOM   4171 C  CD  . LYS F  2 4   ? -34.572 55.446 -22.799 1.00 66.72  ? 4   LYS T CD  1 
ATOM   4172 C  CE  . LYS F  2 4   ? -34.095 54.447 -21.738 1.00 66.10  ? 4   LYS T CE  1 
ATOM   4173 N  NZ  . LYS F  2 4   ? -34.606 53.045 -21.906 1.00 58.90  ? 4   LYS T NZ  1 
ATOM   4174 N  N   . MET F  2 5   ? -34.671 51.668 -25.704 1.00 35.23  ? 5   MET T N   1 
ATOM   4175 C  CA  . MET F  2 5   ? -35.291 50.428 -26.154 1.00 28.87  ? 5   MET T CA  1 
ATOM   4176 C  C   . MET F  2 5   ? -34.273 49.544 -26.843 1.00 25.20  ? 5   MET T C   1 
ATOM   4177 O  O   . MET F  2 5   ? -33.382 50.023 -27.505 1.00 26.07  ? 5   MET T O   1 
ATOM   4178 C  CB  . MET F  2 5   ? -36.447 50.724 -27.130 1.00 28.39  ? 5   MET T CB  1 
ATOM   4179 C  CG  . MET F  2 5   ? -37.605 51.457 -26.468 1.00 30.43  ? 5   MET T CG  1 
ATOM   4180 S  SD  . MET F  2 5   ? -38.840 52.020 -27.658 1.00 33.23  ? 5   MET T SD  1 
ATOM   4181 C  CE  . MET F  2 5   ? -39.244 50.418 -28.303 1.00 24.98  ? 5   MET T CE  1 
ATOM   4182 N  N   . SER F  2 6   ? -34.409 48.238 -26.678 1.00 22.18  ? 6   SER T N   1 
ATOM   4183 C  CA  . SER F  2 6   ? -33.532 47.307 -27.368 1.00 19.81  ? 6   SER T CA  1 
ATOM   4184 C  C   . SER F  2 6   ? -33.891 47.223 -28.829 1.00 17.85  ? 6   SER T C   1 
ATOM   4185 O  O   . SER F  2 6   ? -34.968 47.671 -29.227 1.00 16.78  ? 6   SER T O   1 
ATOM   4186 C  CB  . SER F  2 6   ? -33.693 45.930 -26.784 1.00 18.91  ? 6   SER T CB  1 
ATOM   4187 O  OG  . SER F  2 6   ? -34.956 45.412 -27.185 1.00 17.06  ? 6   SER T OG  1 
ATOM   4188 N  N   . GLN F  2 7   ? -33.012 46.599 -29.619 1.00 17.81  ? 7   GLN T N   1 
ATOM   4189 C  CA  . GLN F  2 7   ? -33.333 46.357 -31.039 1.00 17.30  ? 7   GLN T CA  1 
ATOM   4190 C  C   . GLN F  2 7   ? -34.672 45.573 -31.173 1.00 16.05  ? 7   GLN T C   1 
ATOM   4191 O  O   . GLN F  2 7   ? -35.567 45.950 -31.905 1.00 15.80  ? 7   GLN T O   1 
ATOM   4192 C  CB  . GLN F  2 7   ? -32.155 45.641 -31.733 1.00 19.04  ? 7   GLN T CB  1 
ATOM   4193 C  CG  . GLN F  2 7   ? -32.289 45.267 -33.205 1.00 20.08  ? 7   GLN T CG  1 
ATOM   4194 C  CD  . GLN F  2 7   ? -31.062 44.468 -33.705 1.00 23.29  ? 7   GLN T CD  1 
ATOM   4195 O  OE1 . GLN F  2 7   ? -30.048 44.307 -32.960 1.00 25.45  ? 7   GLN T OE1 1 
ATOM   4196 N  NE2 . GLN F  2 7   ? -31.098 44.014 -35.002 1.00 26.32  ? 7   GLN T NE2 1 
ATOM   4197 N  N   . LEU F  2 8   ? -34.827 44.515 -30.414 1.00 16.52  ? 8   LEU T N   1 
ATOM   4198 C  CA  . LEU F  2 8   ? -36.038 43.712 -30.496 1.00 15.73  ? 8   LEU T CA  1 
ATOM   4199 C  C   . LEU F  2 8   ? -37.317 44.512 -30.138 1.00 15.25  ? 8   LEU T C   1 
ATOM   4200 O  O   . LEU F  2 8   ? -38.331 44.432 -30.830 1.00 14.52  ? 8   LEU T O   1 
ATOM   4201 C  CB  . LEU F  2 8   ? -35.906 42.461 -29.630 1.00 16.83  ? 8   LEU T CB  1 
ATOM   4202 C  CG  . LEU F  2 8   ? -37.076 41.473 -29.683 1.00 16.90  ? 8   LEU T CG  1 
ATOM   4203 C  CD1 . LEU F  2 8   ? -37.338 40.999 -31.102 1.00 18.26  ? 8   LEU T CD1 1 
ATOM   4204 C  CD2 . LEU F  2 8   ? -36.846 40.295 -28.717 1.00 18.40  ? 8   LEU T CD2 1 
ATOM   4205 N  N   . GLU F  2 9   ? -37.222 45.320 -29.092 1.00 16.28  ? 9   GLU T N   1 
ATOM   4206 C  CA  . GLU F  2 9   ? -38.314 46.182 -28.690 1.00 16.60  ? 9   GLU T CA  1 
ATOM   4207 C  C   . GLU F  2 9   ? -38.673 47.177 -29.789 1.00 15.93  ? 9   GLU T C   1 
ATOM   4208 O  O   . GLU F  2 9   ? -39.850 47.443 -30.018 1.00 15.87  ? 9   GLU T O   1 
ATOM   4209 C  CB  . GLU F  2 9   ? -37.988 46.928 -27.406 1.00 19.45  ? 9   GLU T CB  1 
ATOM   4210 C  CG  . GLU F  2 9   ? -37.990 46.086 -26.148 1.00 21.29  ? 9   GLU T CG  1 
ATOM   4211 C  CD  . GLU F  2 9   ? -37.575 46.900 -24.917 1.00 25.75  ? 9   GLU T CD  1 
ATOM   4212 O  OE1 . GLU F  2 9   ? -36.457 47.443 -24.864 1.00 26.36  ? 9   GLU T OE1 1 
ATOM   4213 O  OE2 . GLU F  2 9   ? -38.417 47.051 -24.023 1.00 31.67  ? 9   GLU T OE2 1 
ATOM   4214 N  N   . ARG F  2 10  ? -37.657 47.738 -30.419 1.00 16.35  ? 10  ARG T N   1 
ATOM   4215 C  CA  . ARG F  2 10  ? -37.908 48.693 -31.492 1.00 17.85  ? 10  ARG T CA  1 
ATOM   4216 C  C   . ARG F  2 10  ? -38.586 47.988 -32.684 1.00 15.48  ? 10  ARG T C   1 
ATOM   4217 O  O   . ARG F  2 10  ? -39.413 48.561 -33.354 1.00 14.95  ? 10  ARG T O   1 
ATOM   4218 C  CB  . ARG F  2 10  ? -36.605 49.353 -31.929 1.00 21.91  ? 10  ARG T CB  1 
ATOM   4219 C  CG  . ARG F  2 10  ? -36.103 50.361 -30.898 1.00 26.89  ? 10  ARG T CG  1 
ATOM   4220 C  CD  . ARG F  2 10  ? -35.189 51.378 -31.533 1.00 34.72  ? 10  ARG T CD  1 
ATOM   4221 N  NE  . ARG F  2 10  ? -34.020 50.717 -32.104 1.00 39.73  ? 10  ARG T NE  1 
ATOM   4222 C  CZ  . ARG F  2 10  ? -32.957 50.299 -31.408 1.00 44.15  ? 10  ARG T CZ  1 
ATOM   4223 N  NH1 . ARG F  2 10  ? -32.886 50.478 -30.086 1.00 47.82  ? 10  ARG T NH1 1 
ATOM   4224 N  NH2 . ARG F  2 10  ? -31.949 49.690 -32.040 1.00 45.46  ? 10  ARG T NH2 1 
ATOM   4225 N  N   . ASN F  2 11  ? -38.178 46.752 -32.963 1.00 15.67  ? 11  ASN T N   1 
ATOM   4226 C  CA  . ASN F  2 11  ? -38.761 46.022 -34.104 1.00 14.88  ? 11  ASN T CA  1 
ATOM   4227 C  C   . ASN F  2 11  ? -40.232 45.700 -33.828 1.00 14.53  ? 11  ASN T C   1 
ATOM   4228 O  O   . ASN F  2 11  ? -41.083 45.857 -34.708 1.00 14.98  ? 11  ASN T O   1 
ATOM   4229 C  CB  . ASN F  2 11  ? -37.999 44.733 -34.433 1.00 14.84  ? 11  ASN T CB  1 
ATOM   4230 C  CG  . ASN F  2 11  ? -36.558 44.986 -34.857 1.00 15.14  ? 11  ASN T CG  1 
ATOM   4231 O  OD1 . ASN F  2 11  ? -36.224 46.104 -35.397 1.00 16.35  ? 11  ASN T OD1 1 
ATOM   4232 N  ND2 . ASN F  2 11  ? -35.706 44.020 -34.605 1.00 14.59  ? 11  ASN T ND2 1 
ATOM   4233 N  N   . ILE F  2 12  ? -40.527 45.333 -32.587 1.00 15.56  ? 12  ILE T N   1 
ATOM   4234 C  CA  . ILE F  2 12  ? -41.891 45.062 -32.198 1.00 15.31  ? 12  ILE T CA  1 
ATOM   4235 C  C   . ILE F  2 12  ? -42.699 46.359 -32.240 1.00 15.52  ? 12  ILE T C   1 
ATOM   4236 O  O   . ILE F  2 12  ? -43.850 46.367 -32.662 1.00 15.18  ? 12  ILE T O   1 
ATOM   4237 C  CB  . ILE F  2 12  ? -41.918 44.419 -30.807 1.00 15.69  ? 12  ILE T CB  1 
ATOM   4238 C  CG1 . ILE F  2 12  ? -41.407 42.964 -30.930 1.00 15.83  ? 12  ILE T CG1 1 
ATOM   4239 C  CG2 . ILE F  2 12  ? -43.313 44.492 -30.165 1.00 16.10  ? 12  ILE T CG2 1 
ATOM   4240 C  CD1 . ILE F  2 12  ? -41.062 42.358 -29.556 1.00 17.35  ? 12  ILE T CD1 1 
ATOM   4241 N  N   . GLU F  2 13  ? -42.082 47.453 -31.814 1.00 15.71  ? 13  GLU T N   1 
ATOM   4242 C  CA  . GLU F  2 13  ? -42.743 48.765 -31.906 1.00 16.23  ? 13  GLU T CA  1 
ATOM   4243 C  C   . GLU F  2 13  ? -43.104 49.098 -33.363 1.00 15.29  ? 13  GLU T C   1 
ATOM   4244 O  O   . GLU F  2 13  ? -44.216 49.590 -33.684 1.00 16.01  ? 13  GLU T O   1 
ATOM   4245 C  CB  . GLU F  2 13  ? -41.869 49.843 -31.305 1.00 17.61  ? 13  GLU T CB  1 
ATOM   4246 C  CG  . GLU F  2 13  ? -42.510 51.246 -31.363 1.00 19.31  ? 13  GLU T CG  1 
ATOM   4247 C  CD  . GLU F  2 13  ? -41.567 52.325 -30.819 1.00 22.45  ? 13  GLU T CD  1 
ATOM   4248 O  OE1 . GLU F  2 13  ? -42.051 53.205 -30.099 1.00 26.01  ? 13  GLU T OE1 1 
ATOM   4249 O  OE2 . GLU F  2 13  ? -40.363 52.287 -31.081 1.00 24.88  ? 13  GLU T OE2 1 
ATOM   4250 N  N   . THR F  2 14  ? -42.201 48.827 -34.304 1.00 14.48  ? 14  THR T N   1 
ATOM   4251 C  CA  . THR F  2 14  ? -42.544 49.053 -35.703 1.00 14.60  ? 14  THR T CA  1 
ATOM   4252 C  C   . THR F  2 14  ? -43.762 48.264 -36.140 1.00 14.39  ? 14  THR T C   1 
ATOM   4253 O  O   . THR F  2 14  ? -44.651 48.739 -36.874 1.00 14.55  ? 14  THR T O   1 
ATOM   4254 C  CB  . THR F  2 14  ? -41.312 48.724 -36.597 1.00 14.77  ? 14  THR T CB  1 
ATOM   4255 O  OG1 . THR F  2 14  ? -40.244 49.576 -36.190 1.00 16.63  ? 14  THR T OG1 1 
ATOM   4256 C  CG2 . THR F  2 14  ? -41.612 48.862 -38.168 1.00 14.96  ? 14  THR T CG2 1 
ATOM   4257 N  N   . ILE F  2 15  ? -43.805 47.011 -35.691 1.00 14.56  ? 15  ILE T N   1 
ATOM   4258 C  CA  . ILE F  2 15  ? -44.957 46.137 -35.975 1.00 14.65  ? 15  ILE T CA  1 
ATOM   4259 C  C   . ILE F  2 15  ? -46.251 46.779 -35.447 1.00 14.50  ? 15  ILE T C   1 
ATOM   4260 O  O   . ILE F  2 15  ? -47.268 46.867 -36.168 1.00 15.02  ? 15  ILE T O   1 
ATOM   4261 C  CB  . ILE F  2 15  ? -44.768 44.727 -35.453 1.00 14.48  ? 15  ILE T CB  1 
ATOM   4262 C  CG1 . ILE F  2 15  ? -43.630 44.039 -36.221 1.00 14.48  ? 15  ILE T CG1 1 
ATOM   4263 C  CG2 . ILE F  2 15  ? -46.081 43.892 -35.590 1.00 15.20  ? 15  ILE T CG2 1 
ATOM   4264 C  CD1 . ILE F  2 15  ? -43.161 42.735 -35.566 1.00 15.03  ? 15  ILE T CD1 1 
ATOM   4265 N  N   . ILE F  2 16  ? -46.210 47.206 -34.203 1.00 14.47  ? 16  ILE T N   1 
ATOM   4266 C  CA  . ILE F  2 16  ? -47.373 47.777 -33.554 1.00 15.02  ? 16  ILE T CA  1 
ATOM   4267 C  C   . ILE F  2 16  ? -47.792 49.084 -34.219 1.00 15.13  ? 16  ILE T C   1 
ATOM   4268 O  O   . ILE F  2 16  ? -48.987 49.297 -34.503 1.00 15.52  ? 16  ILE T O   1 
ATOM   4269 C  CB  . ILE F  2 16  ? -47.106 47.995 -32.063 1.00 15.38  ? 16  ILE T CB  1 
ATOM   4270 C  CG1 . ILE F  2 16  ? -46.968 46.656 -31.364 1.00 15.86  ? 16  ILE T CG1 1 
ATOM   4271 C  CG2 . ILE F  2 16  ? -48.241 48.809 -31.435 1.00 16.05  ? 16  ILE T CG2 1 
ATOM   4272 C  CD1 . ILE F  2 16  ? -46.312 46.735 -29.984 1.00 16.29  ? 16  ILE T CD1 1 
ATOM   4273 N  N   . ASN F  2 17  ? -46.807 49.914 -34.498 1.00 15.47  ? 17  ASN T N   1 
ATOM   4274 C  CA  . ASN F  2 17  ? -47.033 51.200 -35.206 1.00 15.43  ? 17  ASN T CA  1 
ATOM   4275 C  C   . ASN F  2 17  ? -47.676 50.947 -36.572 1.00 15.66  ? 17  ASN T C   1 
ATOM   4276 O  O   . ASN F  2 17  ? -48.645 51.629 -36.931 1.00 15.92  ? 17  ASN T O   1 
ATOM   4277 C  CB  . ASN F  2 17  ? -45.730 51.998 -35.429 1.00 15.77  ? 17  ASN T CB  1 
ATOM   4278 C  CG  . ASN F  2 17  ? -45.244 52.663 -34.162 1.00 16.26  ? 17  ASN T CG  1 
ATOM   4279 O  OD1 . ASN F  2 17  ? -45.983 52.747 -33.153 1.00 17.55  ? 17  ASN T OD1 1 
ATOM   4280 N  ND2 . ASN F  2 17  ? -44.011 53.130 -34.180 1.00 17.38  ? 17  ASN T ND2 1 
ATOM   4281 N  N   . THR F  2 18  ? -47.150 49.993 -37.358 1.00 14.83  ? 18  THR T N   1 
ATOM   4282 C  CA  . THR F  2 18  ? -47.696 49.722 -38.668 1.00 15.81  ? 18  THR T CA  1 
ATOM   4283 C  C   . THR F  2 18  ? -49.131 49.232 -38.594 1.00 16.32  ? 18  THR T C   1 
ATOM   4284 O  O   . THR F  2 18  ? -49.955 49.709 -39.364 1.00 17.32  ? 18  THR T O   1 
ATOM   4285 C  CB  . THR F  2 18  ? -46.785 48.787 -39.489 1.00 15.30  ? 18  THR T CB  1 
ATOM   4286 O  OG1 . THR F  2 18  ? -45.433 49.261 -39.397 1.00 16.28  ? 18  THR T OG1 1 
ATOM   4287 C  CG2 . THR F  2 18  ? -47.257 48.735 -41.015 1.00 15.33  ? 18  THR T CG2 1 
ATOM   4288 N  N   . PHE F  2 19  ? -49.442 48.294 -37.682 1.00 15.29  ? 19  PHE T N   1 
ATOM   4289 C  CA  . PHE F  2 19  ? -50.791 47.849 -37.462 1.00 15.96  ? 19  PHE T CA  1 
ATOM   4290 C  C   . PHE F  2 19  ? -51.710 49.053 -37.215 1.00 16.35  ? 19  PHE T C   1 
ATOM   4291 O  O   . PHE F  2 19  ? -52.747 49.182 -37.897 1.00 17.02  ? 19  PHE T O   1 
ATOM   4292 C  CB  . PHE F  2 19  ? -50.807 46.832 -36.311 1.00 16.04  ? 19  PHE T CB  1 
ATOM   4293 C  CG  . PHE F  2 19  ? -52.172 46.386 -35.870 1.00 16.45  ? 19  PHE T CG  1 
ATOM   4294 C  CD1 . PHE F  2 19  ? -52.848 47.080 -34.934 1.00 17.13  ? 19  PHE T CD1 1 
ATOM   4295 C  CD2 . PHE F  2 19  ? -52.787 45.215 -36.396 1.00 16.65  ? 19  PHE T CD2 1 
ATOM   4296 C  CE1 . PHE F  2 19  ? -54.094 46.660 -34.497 1.00 17.93  ? 19  PHE T CE1 1 
ATOM   4297 C  CE2 . PHE F  2 19  ? -54.032 44.827 -35.987 1.00 17.22  ? 19  PHE T CE2 1 
ATOM   4298 C  CZ  . PHE F  2 19  ? -54.698 45.538 -35.018 1.00 18.36  ? 19  PHE T CZ  1 
ATOM   4299 N  N   . HIS F  2 20  ? -51.310 49.893 -36.262 1.00 15.73  ? 20  HIS T N   1 
ATOM   4300 C  CA  . HIS F  2 20  ? -52.116 51.055 -35.862 1.00 16.14  ? 20  HIS T CA  1 
ATOM   4301 C  C   . HIS F  2 20  ? -52.376 52.078 -36.902 1.00 16.76  ? 20  HIS T C   1 
ATOM   4302 O  O   . HIS F  2 20  ? -53.464 52.633 -36.932 1.00 16.11  ? 20  HIS T O   1 
ATOM   4303 C  CB  . HIS F  2 20  ? -51.491 51.730 -34.691 1.00 16.18  ? 20  HIS T CB  1 
ATOM   4304 C  CG  . HIS F  2 20  ? -51.720 51.016 -33.394 1.00 16.28  ? 20  HIS T CG  1 
ATOM   4305 N  ND1 . HIS F  2 20  ? -50.854 51.121 -32.353 1.00 16.48  ? 20  HIS T ND1 1 
ATOM   4306 C  CD2 . HIS F  2 20  ? -52.779 50.235 -32.949 1.00 16.87  ? 20  HIS T CD2 1 
ATOM   4307 C  CE1 . HIS F  2 20  ? -51.355 50.440 -31.298 1.00 16.93  ? 20  HIS T CE1 1 
ATOM   4308 N  NE2 . HIS F  2 20  ? -52.539 49.920 -31.656 1.00 17.38  ? 20  HIS T NE2 1 
ATOM   4309 N  N   . GLN F  2 21  ? -51.430 52.284 -37.821 1.00 16.23  ? 21  GLN T N   1 
ATOM   4310 C  CA  . GLN F  2 21  ? -51.577 53.286 -38.867 1.00 17.82  ? 21  GLN T CA  1 
ATOM   4311 C  C   . GLN F  2 21  ? -52.734 52.948 -39.759 1.00 17.28  ? 21  GLN T C   1 
ATOM   4312 O  O   . GLN F  2 21  ? -53.361 53.850 -40.345 1.00 17.42  ? 21  GLN T O   1 
ATOM   4313 C  CB  . GLN F  2 21  ? -50.296 53.343 -39.724 1.00 18.86  ? 21  GLN T CB  1 
ATOM   4314 C  CG  . GLN F  2 21  ? -49.138 53.890 -38.927 1.00 21.24  ? 21  GLN T CG  1 
ATOM   4315 C  CD  . GLN F  2 21  ? -47.801 53.656 -39.624 1.00 21.41  ? 21  GLN T CD  1 
ATOM   4316 O  OE1 . GLN F  2 21  ? -47.776 53.200 -40.748 1.00 22.08  ? 21  GLN T OE1 1 
ATOM   4317 N  NE2 . GLN F  2 21  ? -46.691 54.008 -38.937 1.00 24.06  ? 21  GLN T NE2 1 
ATOM   4318 N  N   . TYR F  2 22  ? -53.029 51.648 -39.878 1.00 16.73  ? 22  TYR T N   1 
ATOM   4319 C  CA  . TYR F  2 22  ? -54.150 51.225 -40.719 1.00 17.03  ? 22  TYR T CA  1 
ATOM   4320 C  C   . TYR F  2 22  ? -55.403 50.940 -39.903 1.00 17.24  ? 22  TYR T C   1 
ATOM   4321 O  O   . TYR F  2 22  ? -56.533 51.199 -40.372 1.00 18.75  ? 22  TYR T O   1 
ATOM   4322 C  CB  . TYR F  2 22  ? -53.735 50.009 -41.559 1.00 17.23  ? 22  TYR T CB  1 
ATOM   4323 C  CG  . TYR F  2 22  ? -52.609 50.364 -42.518 1.00 17.62  ? 22  TYR T CG  1 
ATOM   4324 C  CD1 . TYR F  2 22  ? -52.850 51.091 -43.679 1.00 18.84  ? 22  TYR T CD1 1 
ATOM   4325 C  CD2 . TYR F  2 22  ? -51.319 50.063 -42.218 1.00 17.87  ? 22  TYR T CD2 1 
ATOM   4326 C  CE1 . TYR F  2 22  ? -51.809 51.449 -44.550 1.00 19.16  ? 22  TYR T CE1 1 
ATOM   4327 C  CE2 . TYR F  2 22  ? -50.289 50.414 -43.048 1.00 18.45  ? 22  TYR T CE2 1 
ATOM   4328 C  CZ  . TYR F  2 22  ? -50.526 51.115 -44.203 1.00 18.77  ? 22  TYR T CZ  1 
ATOM   4329 O  OH  . TYR F  2 22  ? -49.458 51.436 -45.044 1.00 20.01  ? 22  TYR T OH  1 
ATOM   4330 N  N   . SER F  2 23  ? -55.222 50.403 -38.705 1.00 16.73  ? 23  SER T N   1 
ATOM   4331 C  CA  . SER F  2 23  ? -56.372 49.969 -37.866 1.00 17.39  ? 23  SER T CA  1 
ATOM   4332 C  C   . SER F  2 23  ? -57.276 51.132 -37.491 1.00 17.46  ? 23  SER T C   1 
ATOM   4333 O  O   . SER F  2 23  ? -58.499 51.021 -37.452 1.00 17.52  ? 23  SER T O   1 
ATOM   4334 C  CB  . SER F  2 23  ? -55.933 49.176 -36.627 1.00 17.55  ? 23  SER T CB  1 
ATOM   4335 O  OG  . SER F  2 23  ? -55.330 49.974 -35.602 1.00 17.33  ? 23  SER T OG  1 
ATOM   4336 N  N   . VAL F  2 24  ? -56.652 52.272 -37.238 1.00 17.99  ? 24  VAL T N   1 
ATOM   4337 C  CA  . VAL F  2 24  ? -57.389 53.497 -36.878 1.00 18.30  ? 24  VAL T CA  1 
ATOM   4338 C  C   . VAL F  2 24  ? -58.282 54.110 -37.980 1.00 18.61  ? 24  VAL T C   1 
ATOM   4339 O  O   . VAL F  2 24  ? -59.102 54.994 -37.701 1.00 19.88  ? 24  VAL T O   1 
ATOM   4340 C  CB  . VAL F  2 24  ? -56.386 54.543 -36.371 1.00 19.21  ? 24  VAL T CB  1 
ATOM   4341 C  CG1 . VAL F  2 24  ? -55.623 55.104 -37.579 1.00 18.63  ? 24  VAL T CG1 1 
ATOM   4342 C  CG2 . VAL F  2 24  ? -57.088 55.607 -35.523 1.00 20.86  ? 24  VAL T CG2 1 
ATOM   4343 N  N   . LYS F  2 25  ? -58.114 53.723 -39.233 1.00 18.29  ? 25  LYS T N   1 
ATOM   4344 C  CA  . LYS F  2 25  ? -58.736 54.450 -40.341 1.00 19.01  ? 25  LYS T CA  1 
ATOM   4345 C  C   . LYS F  2 25  ? -60.257 54.369 -40.355 1.00 19.69  ? 25  LYS T C   1 
ATOM   4346 O  O   . LYS F  2 25  ? -60.930 55.398 -40.406 1.00 19.50  ? 25  LYS T O   1 
ATOM   4347 C  CB  . LYS F  2 25  ? -58.195 54.032 -41.686 1.00 18.75  ? 25  LYS T CB  1 
ATOM   4348 C  CG  . LYS F  2 25  ? -56.733 54.426 -41.867 1.00 18.78  ? 25  LYS T CG  1 
ATOM   4349 C  CD  . LYS F  2 25  ? -56.228 54.273 -43.305 1.00 19.74  ? 25  LYS T CD  1 
ATOM   4350 C  CE  . LYS F  2 25  ? -54.741 54.665 -43.441 1.00 19.31  ? 25  LYS T CE  1 
ATOM   4351 N  NZ  . LYS F  2 25  ? -54.286 54.690 -44.870 1.00 19.43  ? 25  LYS T NZ  1 
ATOM   4352 N  N   . LEU F  2 26  ? -60.760 53.147 -40.306 1.00 20.55  ? 26  LEU T N   1 
ATOM   4353 C  CA  . LEU F  2 26  ? -62.185 52.867 -40.413 1.00 22.05  ? 26  LEU T CA  1 
ATOM   4354 C  C   . LEU F  2 26  ? -62.681 51.964 -39.288 1.00 22.54  ? 26  LEU T C   1 
ATOM   4355 O  O   . LEU F  2 26  ? -61.936 51.167 -38.722 1.00 21.23  ? 26  LEU T O   1 
ATOM   4356 C  CB  . LEU F  2 26  ? -62.429 52.212 -41.751 1.00 23.67  ? 26  LEU T CB  1 
ATOM   4357 C  CG  . LEU F  2 26  ? -62.144 53.060 -42.992 1.00 25.56  ? 26  LEU T CG  1 
ATOM   4358 C  CD1 . LEU F  2 26  ? -62.329 52.102 -44.189 1.00 27.49  ? 26  LEU T CD1 1 
ATOM   4359 C  CD2 . LEU F  2 26  ? -63.052 54.278 -42.973 1.00 26.45  ? 26  LEU T CD2 1 
ATOM   4360 N  N   . GLY F  2 27  ? -63.956 52.122 -38.946 1.00 23.77  ? 27  GLY T N   1 
ATOM   4361 C  CA  . GLY F  2 27  ? -64.602 51.252 -37.980 1.00 25.13  ? 27  GLY T CA  1 
ATOM   4362 C  C   . GLY F  2 27  ? -63.881 51.222 -36.658 1.00 24.10  ? 27  GLY T C   1 
ATOM   4363 O  O   . GLY F  2 27  ? -63.390 52.254 -36.211 1.00 24.61  ? 27  GLY T O   1 
ATOM   4364 N  N   . HIS F  2 28  ? -63.694 50.030 -36.094 1.00 24.56  ? 28  HIS T N   1 
ATOM   4365 C  CA  . HIS F  2 28  ? -62.996 49.904 -34.830 1.00 24.40  ? 28  HIS T CA  1 
ATOM   4366 C  C   . HIS F  2 28  ? -61.588 50.359 -35.012 1.00 23.38  ? 28  HIS T C   1 
ATOM   4367 O  O   . HIS F  2 28  ? -60.891 49.869 -35.914 1.00 22.51  ? 28  HIS T O   1 
ATOM   4368 C  CB  . HIS F  2 28  ? -62.951 48.475 -34.352 1.00 26.12  ? 28  HIS T CB  1 
ATOM   4369 C  CG  . HIS F  2 28  ? -62.638 48.368 -32.882 1.00 28.68  ? 28  HIS T CG  1 
ATOM   4370 N  ND1 . HIS F  2 28  ? -61.401 48.618 -32.384 1.00 27.05  ? 28  HIS T ND1 1 
ATOM   4371 C  CD2 . HIS F  2 28  ? -63.474 48.116 -31.779 1.00 32.56  ? 28  HIS T CD2 1 
ATOM   4372 C  CE1 . HIS F  2 28  ? -61.406 48.509 -31.048 1.00 29.90  ? 28  HIS T CE1 1 
ATOM   4373 N  NE2 . HIS F  2 28  ? -62.684 48.169 -30.660 1.00 33.25  ? 28  HIS T NE2 1 
ATOM   4374 N  N   . PRO F  2 29  ? -61.125 51.290 -34.168 1.00 23.90  ? 29  PRO T N   1 
ATOM   4375 C  CA  . PRO F  2 29  ? -59.763 51.767 -34.366 1.00 23.36  ? 29  PRO T CA  1 
ATOM   4376 C  C   . PRO F  2 29  ? -58.606 50.843 -33.978 1.00 22.77  ? 29  PRO T C   1 
ATOM   4377 O  O   . PRO F  2 29  ? -57.486 51.161 -34.305 1.00 23.40  ? 29  PRO T O   1 
ATOM   4378 C  CB  . PRO F  2 29  ? -59.711 53.009 -33.470 1.00 24.41  ? 29  PRO T CB  1 
ATOM   4379 C  CG  . PRO F  2 29  ? -60.591 52.647 -32.341 1.00 24.77  ? 29  PRO T CG  1 
ATOM   4380 C  CD  . PRO F  2 29  ? -61.770 51.977 -33.033 1.00 25.29  ? 29  PRO T CD  1 
ATOM   4381 N  N   A ASP F  2 30  ? -58.868 49.722 -33.294 0.50 23.20  ? 30  ASP T N   1 
ATOM   4382 N  N   B ASP F  2 30  ? -58.869 49.727 -33.292 0.50 23.34  ? 30  ASP T N   1 
ATOM   4383 C  CA  A ASP F  2 30  ? -57.827 48.767 -32.906 0.50 22.64  ? 30  ASP T CA  1 
ATOM   4384 C  CA  B ASP F  2 30  ? -57.821 48.781 -32.933 0.50 22.79  ? 30  ASP T CA  1 
ATOM   4385 C  C   A ASP F  2 30  ? -57.950 47.426 -33.629 0.50 21.61  ? 30  ASP T C   1 
ATOM   4386 C  C   B ASP F  2 30  ? -57.941 47.434 -33.641 0.50 21.73  ? 30  ASP T C   1 
ATOM   4387 O  O   A ASP F  2 30  ? -57.301 46.480 -33.230 0.50 22.23  ? 30  ASP T O   1 
ATOM   4388 O  O   B ASP F  2 30  ? -57.278 46.498 -33.245 0.50 22.27  ? 30  ASP T O   1 
ATOM   4389 C  CB  A ASP F  2 30  ? -57.821 48.546 -31.385 0.50 23.85  ? 30  ASP T CB  1 
ATOM   4390 C  CB  B ASP F  2 30  ? -57.752 48.567 -31.420 0.50 24.07  ? 30  ASP T CB  1 
ATOM   4391 C  CG  A ASP F  2 30  ? -56.556 47.812 -30.871 0.50 23.89  ? 30  ASP T CG  1 
ATOM   4392 C  CG  B ASP F  2 30  ? -56.325 48.339 -30.923 0.50 24.04  ? 30  ASP T CG  1 
ATOM   4393 O  OD1 A ASP F  2 30  ? -55.440 48.040 -31.363 0.50 22.74  ? 30  ASP T OD1 1 
ATOM   4394 O  OD1 B ASP F  2 30  ? -55.394 48.785 -31.612 0.50 23.90  ? 30  ASP T OD1 1 
ATOM   4395 O  OD2 A ASP F  2 30  ? -56.679 47.020 -29.909 0.50 24.36  ? 30  ASP T OD2 1 
ATOM   4396 O  OD2 B ASP F  2 30  ? -56.140 47.740 -29.831 0.50 24.52  ? 30  ASP T OD2 1 
ATOM   4397 N  N   . THR F  2 31  ? -58.750 47.353 -34.698 1.00 21.50  ? 31  THR T N   1 
ATOM   4398 C  CA  . THR F  2 31  ? -58.735 46.168 -35.579 1.00 20.84  ? 31  THR T CA  1 
ATOM   4399 C  C   . THR F  2 31  ? -58.665 46.567 -37.022 1.00 20.37  ? 31  THR T C   1 
ATOM   4400 O  O   . THR F  2 31  ? -59.120 47.660 -37.399 1.00 20.16  ? 31  THR T O   1 
ATOM   4401 C  CB  . THR F  2 31  ? -59.949 45.230 -35.362 1.00 21.36  ? 31  THR T CB  1 
ATOM   4402 O  OG1 . THR F  2 31  ? -61.169 45.875 -35.765 1.00 21.65  ? 31  THR T OG1 1 
ATOM   4403 C  CG2 . THR F  2 31  ? -60.084 44.839 -33.890 1.00 22.04  ? 31  THR T CG2 1 
ATOM   4404 N  N   . LEU F  2 32  ? -58.100 45.679 -37.830 1.00 19.43  ? 32  LEU T N   1 
ATOM   4405 C  CA  . LEU F  2 32  ? -58.046 45.852 -39.265 1.00 18.85  ? 32  LEU T CA  1 
ATOM   4406 C  C   . LEU F  2 32  ? -59.244 45.207 -39.916 1.00 19.91  ? 32  LEU T C   1 
ATOM   4407 O  O   . LEU F  2 32  ? -59.441 43.967 -39.823 1.00 20.12  ? 32  LEU T O   1 
ATOM   4408 C  CB  . LEU F  2 32  ? -56.774 45.217 -39.826 1.00 18.16  ? 32  LEU T CB  1 
ATOM   4409 C  CG  . LEU F  2 32  ? -55.389 45.676 -39.344 1.00 17.45  ? 32  LEU T CG  1 
ATOM   4410 C  CD1 . LEU F  2 32  ? -54.240 44.699 -39.766 1.00 17.74  ? 32  LEU T CD1 1 
ATOM   4411 C  CD2 . LEU F  2 32  ? -55.130 47.090 -39.883 1.00 17.92  ? 32  LEU T CD2 1 
ATOM   4412 N  N   . ASN F  2 33  ? -60.001 45.992 -40.674 1.00 20.34  ? 33  ASN T N   1 
ATOM   4413 C  CA  . ASN F  2 33  ? -60.974 45.399 -41.563 1.00 21.70  ? 33  ASN T CA  1 
ATOM   4414 C  C   . ASN F  2 33  ? -60.276 44.957 -42.845 1.00 21.99  ? 33  ASN T C   1 
ATOM   4415 O  O   . ASN F  2 33  ? -59.081 45.123 -42.966 1.00 20.15  ? 33  ASN T O   1 
ATOM   4416 C  CB  . ASN F  2 33  ? -62.171 46.325 -41.807 1.00 22.76  ? 33  ASN T CB  1 
ATOM   4417 C  CG  . ASN F  2 33  ? -61.852 47.557 -42.625 1.00 22.05  ? 33  ASN T CG  1 
ATOM   4418 O  OD1 . ASN F  2 33  ? -60.855 47.659 -43.353 1.00 20.87  ? 33  ASN T OD1 1 
ATOM   4419 N  ND2 . ASN F  2 33  ? -62.770 48.542 -42.529 1.00 23.18  ? 33  ASN T ND2 1 
ATOM   4420 N  N   . GLN F  2 34  ? -61.011 44.349 -43.780 1.00 23.37  ? 34  GLN T N   1 
ATOM   4421 C  CA  . GLN F  2 34  ? -60.362 43.814 -44.956 1.00 24.33  ? 34  GLN T CA  1 
ATOM   4422 C  C   . GLN F  2 34  ? -59.684 44.876 -45.803 1.00 23.15  ? 34  GLN T C   1 
ATOM   4423 O  O   . GLN F  2 34  ? -58.566 44.669 -46.301 1.00 22.46  ? 34  GLN T O   1 
ATOM   4424 C  CB  . GLN F  2 34  ? -61.315 42.990 -45.807 1.00 26.58  ? 34  GLN T CB  1 
ATOM   4425 C  CG  . GLN F  2 34  ? -60.542 42.318 -46.916 1.00 28.50  ? 34  GLN T CG  1 
ATOM   4426 C  CD  . GLN F  2 34  ? -61.268 41.144 -47.481 1.00 33.02  ? 34  GLN T CD  1 
ATOM   4427 O  OE1 . GLN F  2 34  ? -62.258 41.320 -48.173 1.00 36.10  ? 34  GLN T OE1 1 
ATOM   4428 N  NE2 . GLN F  2 34  ? -60.785 39.927 -47.180 1.00 35.40  ? 34  GLN T NE2 1 
ATOM   4429 N  N   . GLY F  2 35  ? -60.319 46.037 -45.966 1.00 22.74  ? 35  GLY T N   1 
ATOM   4430 C  CA  . GLY F  2 35  ? -59.651 47.124 -46.679 1.00 21.92  ? 35  GLY T CA  1 
ATOM   4431 C  C   . GLY F  2 35  ? -58.360 47.643 -46.040 1.00 21.15  ? 35  GLY T C   1 
ATOM   4432 O  O   . GLY F  2 35  ? -57.407 47.981 -46.758 1.00 21.02  ? 35  GLY T O   1 
ATOM   4433 N  N   . GLU F  2 36  ? -58.372 47.749 -44.711 1.00 20.00  ? 36  GLU T N   1 
ATOM   4434 C  CA  . GLU F  2 36  ? -57.236 48.210 -43.938 1.00 18.78  ? 36  GLU T CA  1 
ATOM   4435 C  C   . GLU F  2 36  ? -56.096 47.226 -44.093 1.00 18.61  ? 36  GLU T C   1 
ATOM   4436 O  O   . GLU F  2 36  ? -54.927 47.590 -44.367 1.00 19.09  ? 36  GLU T O   1 
ATOM   4437 C  CB  . GLU F  2 36  ? -57.649 48.435 -42.474 1.00 19.01  ? 36  GLU T CB  1 
ATOM   4438 C  CG  . GLU F  2 36  ? -58.551 49.656 -42.244 1.00 19.13  ? 36  GLU T CG  1 
ATOM   4439 C  CD  . GLU F  2 36  ? -59.109 49.718 -40.826 1.00 19.61  ? 36  GLU T CD  1 
ATOM   4440 O  OE1 . GLU F  2 36  ? -59.115 48.679 -40.169 1.00 20.00  ? 36  GLU T OE1 1 
ATOM   4441 O  OE2 . GLU F  2 36  ? -59.544 50.760 -40.355 1.00 20.61  ? 36  GLU T OE2 1 
ATOM   4442 N  N   . PHE F  2 37  ? -56.445 45.948 -43.971 1.00 18.05  ? 37  PHE T N   1 
ATOM   4443 C  CA  . PHE F  2 37  ? -55.444 44.874 -44.115 1.00 17.88  ? 37  PHE T CA  1 
ATOM   4444 C  C   . PHE F  2 37  ? -54.853 44.855 -45.532 1.00 18.39  ? 37  PHE T C   1 
ATOM   4445 O  O   . PHE F  2 37  ? -53.621 44.729 -45.694 1.00 18.02  ? 37  PHE T O   1 
ATOM   4446 C  CB  . PHE F  2 37  ? -56.056 43.540 -43.723 1.00 18.62  ? 37  PHE T CB  1 
ATOM   4447 C  CG  . PHE F  2 37  ? -55.126 42.342 -43.894 1.00 18.61  ? 37  PHE T CG  1 
ATOM   4448 C  CD1 . PHE F  2 37  ? -54.081 42.127 -43.004 1.00 18.53  ? 37  PHE T CD1 1 
ATOM   4449 C  CD2 . PHE F  2 37  ? -55.289 41.442 -44.950 1.00 19.27  ? 37  PHE T CD2 1 
ATOM   4450 C  CE1 . PHE F  2 37  ? -53.215 41.072 -43.167 1.00 18.83  ? 37  PHE T CE1 1 
ATOM   4451 C  CE2 . PHE F  2 37  ? -54.422 40.355 -45.105 1.00 19.30  ? 37  PHE T CE2 1 
ATOM   4452 C  CZ  . PHE F  2 37  ? -53.386 40.161 -44.190 1.00 18.76  ? 37  PHE T CZ  1 
ATOM   4453 N  N   . LYS F  2 38  ? -55.692 44.909 -46.564 1.00 18.86  ? 38  LYS T N   1 
ATOM   4454 C  CA  . LYS F  2 38  ? -55.160 44.937 -47.925 1.00 19.26  ? 38  LYS T CA  1 
ATOM   4455 C  C   . LYS F  2 38  ? -54.199 46.083 -48.166 1.00 18.88  ? 38  LYS T C   1 
ATOM   4456 O  O   . LYS F  2 38  ? -53.226 45.905 -48.934 1.00 19.05  ? 38  LYS T O   1 
ATOM   4457 C  CB  . LYS F  2 38  ? -56.275 44.990 -48.952 1.00 20.42  ? 38  LYS T CB  1 
ATOM   4458 C  CG  . LYS F  2 38  ? -56.988 43.657 -49.123 1.00 21.38  ? 38  LYS T CG  1 
ATOM   4459 C  CD  . LYS F  2 38  ? -58.188 43.793 -50.059 1.00 22.82  ? 38  LYS T CD  1 
ATOM   4460 C  CE  . LYS F  2 38  ? -58.914 42.478 -50.223 1.00 23.70  ? 38  LYS T CE  1 
ATOM   4461 N  NZ  . LYS F  2 38  ? -60.101 42.618 -51.153 1.00 24.89  ? 38  LYS T NZ  1 
ATOM   4462 N  N   . GLU F  2 39  ? -54.513 47.250 -47.584 1.00 18.47  ? 39  GLU T N   1 
ATOM   4463 C  CA  . GLU F  2 39  ? -53.671 48.444 -47.766 1.00 18.52  ? 39  GLU T CA  1 
ATOM   4464 C  C   . GLU F  2 39  ? -52.315 48.205 -47.147 1.00 17.66  ? 39  GLU T C   1 
ATOM   4465 O  O   . GLU F  2 39  ? -51.263 48.454 -47.714 1.00 17.08  ? 39  GLU T O   1 
ATOM   4466 C  CB  . GLU F  2 39  ? -54.306 49.745 -47.211 1.00 18.94  ? 39  GLU T CB  1 
ATOM   4467 C  CG  . GLU F  2 39  ? -53.533 50.984 -47.680 1.00 20.42  ? 39  GLU T CG  1 
ATOM   4468 C  CD  . GLU F  2 39  ? -54.029 52.289 -47.106 1.00 21.06  ? 39  GLU T CD  1 
ATOM   4469 O  OE1 . GLU F  2 39  ? -53.553 53.336 -47.598 1.00 22.29  ? 39  GLU T OE1 1 
ATOM   4470 O  OE2 . GLU F  2 39  ? -54.878 52.266 -46.195 1.00 21.32  ? 39  GLU T OE2 1 
ATOM   4471 N  N   . LEU F  2 40  ? -52.367 47.697 -45.929 1.00 17.59  ? 40  LEU T N   1 
ATOM   4472 C  CA  . LEU F  2 40  ? -51.105 47.365 -45.172 1.00 17.02  ? 40  LEU T CA  1 
ATOM   4473 C  C   . LEU F  2 40  ? -50.236 46.420 -45.996 1.00 17.60  ? 40  LEU T C   1 
ATOM   4474 O  O   . LEU F  2 40  ? -49.048 46.629 -46.197 1.00 17.73  ? 40  LEU T O   1 
ATOM   4475 C  CB  . LEU F  2 40  ? -51.436 46.783 -43.832 1.00 17.50  ? 40  LEU T CB  1 
ATOM   4476 C  CG  . LEU F  2 40  ? -50.290 46.532 -42.846 1.00 16.84  ? 40  LEU T CG  1 
ATOM   4477 C  CD1 . LEU F  2 40  ? -50.811 46.434 -41.408 1.00 16.83  ? 40  LEU T CD1 1 
ATOM   4478 C  CD2 . LEU F  2 40  ? -49.447 45.289 -43.224 1.00 16.82  ? 40  LEU T CD2 1 
ATOM   4479 N  N   . VAL F  2 41  ? -50.840 45.338 -46.451 1.00 17.53  ? 41  VAL T N   1 
ATOM   4480 C  CA  . VAL F  2 41  ? -50.107 44.337 -47.224 1.00 18.80  ? 41  VAL T CA  1 
ATOM   4481 C  C   . VAL F  2 41  ? -49.571 44.901 -48.543 1.00 18.51  ? 41  VAL T C   1 
ATOM   4482 O  O   . VAL F  2 41  ? -48.424 44.660 -48.937 1.00 18.36  ? 41  VAL T O   1 
ATOM   4483 C  CB  . VAL F  2 41  ? -51.017 43.098 -47.483 1.00 19.97  ? 41  VAL T CB  1 
ATOM   4484 C  CG1 . VAL F  2 41  ? -50.411 42.130 -48.504 1.00 20.43  ? 41  VAL T CG1 1 
ATOM   4485 C  CG2 . VAL F  2 41  ? -51.324 42.411 -46.155 1.00 20.19  ? 41  VAL T CG2 1 
ATOM   4486 N  N   . ARG F  2 42  ? -50.393 45.705 -49.210 1.00 19.21  ? 42  ARG T N   1 
ATOM   4487 C  CA  . ARG F  2 42  ? -50.042 46.303 -50.454 1.00 20.04  ? 42  ARG T CA  1 
ATOM   4488 C  C   . ARG F  2 42  ? -48.879 47.259 -50.334 1.00 19.75  ? 42  ARG T C   1 
ATOM   4489 O  O   . ARG F  2 42  ? -47.958 47.247 -51.177 1.00 19.73  ? 42  ARG T O   1 
ATOM   4490 C  CB  . ARG F  2 42  ? -51.253 47.051 -51.066 1.00 21.23  ? 42  ARG T CB  1 
ATOM   4491 C  CG  . ARG F  2 42  ? -50.902 47.777 -52.329 1.00 22.68  ? 42  ARG T CG  1 
ATOM   4492 C  CD  . ARG F  2 42  ? -52.124 48.296 -53.068 1.00 23.93  ? 42  ARG T CD  1 
ATOM   4493 N  NE  . ARG F  2 42  ? -52.954 49.224 -52.340 1.00 25.03  ? 42  ARG T NE  1 
ATOM   4494 C  CZ  . ARG F  2 42  ? -52.754 50.538 -52.279 1.00 26.21  ? 42  ARG T CZ  1 
ATOM   4495 N  NH1 . ARG F  2 42  ? -53.621 51.298 -51.593 1.00 27.52  ? 42  ARG T NH1 1 
ATOM   4496 N  NH2 . ARG F  2 42  ? -51.701 51.099 -52.875 1.00 26.60  ? 42  ARG T NH2 1 
ATOM   4497 N  N   . LYS F  2 43  ? -48.854 48.019 -49.237 1.00 19.00  ? 43  LYS T N   1 
ATOM   4498 C  CA  . LYS F  2 43  ? -47.825 49.030 -49.060 1.00 19.53  ? 43  LYS T CA  1 
ATOM   4499 C  C   . LYS F  2 43  ? -46.655 48.491 -48.244 1.00 19.10  ? 43  LYS T C   1 
ATOM   4500 O  O   . LYS F  2 43  ? -45.530 48.487 -48.737 1.00 21.66  ? 43  LYS T O   1 
ATOM   4501 C  CB  . LYS F  2 43  ? -48.380 50.301 -48.421 1.00 19.48  ? 43  LYS T CB  1 
ATOM   4502 C  CG  . LYS F  2 43  ? -49.359 51.017 -49.375 1.00 20.00  ? 43  LYS T CG  1 
ATOM   4503 C  CD  . LYS F  2 43  ? -49.889 52.294 -48.740 1.00 20.54  ? 43  LYS T CD  1 
ATOM   4504 C  CE  . LYS F  2 43  ? -50.766 53.081 -49.695 1.00 22.26  ? 43  LYS T CE  1 
ATOM   4505 N  NZ  . LYS F  2 43  ? -51.508 54.175 -49.029 1.00 22.04  ? 43  LYS T NZ  1 
ATOM   4506 N  N   . ASP F  2 44  ? -46.910 48.044 -47.024 1.00 18.30  ? 44  ASP T N   1 
ATOM   4507 C  CA  . ASP F  2 44  ? -45.791 47.682 -46.127 1.00 17.18  ? 44  ASP T CA  1 
ATOM   4508 C  C   . ASP F  2 44  ? -45.206 46.268 -46.269 1.00 17.32  ? 44  ASP T C   1 
ATOM   4509 O  O   . ASP F  2 44  ? -44.161 45.937 -45.701 1.00 16.59  ? 44  ASP T O   1 
ATOM   4510 C  CB  . ASP F  2 44  ? -46.192 48.006 -44.690 1.00 18.66  ? 44  ASP T CB  1 
ATOM   4511 C  CG  . ASP F  2 44  ? -46.452 49.478 -44.558 1.00 20.44  ? 44  ASP T CG  1 
ATOM   4512 O  OD1 . ASP F  2 44  ? -45.551 50.265 -44.876 1.00 21.03  ? 44  ASP T OD1 1 
ATOM   4513 O  OD2 . ASP F  2 44  ? -47.586 49.846 -44.315 1.00 22.99  ? 44  ASP T OD2 1 
ATOM   4514 N  N   . LEU F  2 45  ? -45.871 45.411 -47.025 1.00 16.71  ? 45  LEU T N   1 
ATOM   4515 C  CA  . LEU F  2 45  ? -45.380 44.040 -47.379 1.00 16.90  ? 45  LEU T CA  1 
ATOM   4516 C  C   . LEU F  2 45  ? -45.288 43.908 -48.898 1.00 17.76  ? 45  LEU T C   1 
ATOM   4517 O  O   . LEU F  2 45  ? -45.400 42.826 -49.492 1.00 18.29  ? 45  LEU T O   1 
ATOM   4518 C  CB  . LEU F  2 45  ? -46.263 42.957 -46.802 1.00 16.93  ? 45  LEU T CB  1 
ATOM   4519 C  CG  . LEU F  2 45  ? -46.200 42.961 -45.278 1.00 16.09  ? 45  LEU T CG  1 
ATOM   4520 C  CD1 . LEU F  2 45  ? -47.311 42.077 -44.743 1.00 17.43  ? 45  LEU T CD1 1 
ATOM   4521 C  CD2 . LEU F  2 45  ? -44.805 42.665 -44.662 1.00 16.44  ? 45  LEU T CD2 1 
ATOM   4522 N  N   . GLN F  2 46  ? -45.003 45.017 -49.531 1.00 18.91  ? 46  GLN T N   1 
ATOM   4523 C  CA  . GLN F  2 46  ? -44.949 45.007 -50.979 1.00 20.32  ? 46  GLN T CA  1 
ATOM   4524 C  C   . GLN F  2 46  ? -43.884 44.075 -51.574 1.00 20.28  ? 46  GLN T C   1 
ATOM   4525 O  O   . GLN F  2 46  ? -44.027 43.633 -52.722 1.00 20.90  ? 46  GLN T O   1 
ATOM   4526 C  CB  . GLN F  2 46  ? -44.822 46.418 -51.561 1.00 21.88  ? 46  GLN T CB  1 
ATOM   4527 C  CG  . GLN F  2 46  ? -43.513 47.122 -51.269 1.00 22.32  ? 46  GLN T CG  1 
ATOM   4528 C  CD  . GLN F  2 46  ? -43.449 48.523 -51.859 1.00 23.64  ? 46  GLN T CD  1 
ATOM   4529 O  OE1 . GLN F  2 46  ? -42.919 48.694 -52.968 1.00 28.34  ? 46  GLN T OE1 1 
ATOM   4530 N  NE2 . GLN F  2 46  ? -44.063 49.500 -51.194 1.00 25.40  ? 46  GLN T NE2 1 
ATOM   4531 N  N   . ASN F  2 47  ? -42.810 43.798 -50.835 1.00 20.08  ? 47  ASN T N   1 
ATOM   4532 C  CA  . ASN F  2 47  ? -41.760 42.898 -51.314 1.00 20.63  ? 47  ASN T CA  1 
ATOM   4533 C  C   . ASN F  2 47  ? -41.943 41.490 -50.805 1.00 20.46  ? 47  ASN T C   1 
ATOM   4534 O  O   . ASN F  2 47  ? -41.895 40.521 -51.539 1.00 21.13  ? 47  ASN T O   1 
ATOM   4535 C  CB  . ASN F  2 47  ? -40.410 43.465 -50.886 1.00 21.06  ? 47  ASN T CB  1 
ATOM   4536 C  CG  . ASN F  2 47  ? -40.202 44.877 -51.408 1.00 21.45  ? 47  ASN T CG  1 
ATOM   4537 O  OD1 . ASN F  2 47  ? -40.175 45.072 -52.624 1.00 22.42  ? 47  ASN T OD1 1 
ATOM   4538 N  ND2 . ASN F  2 47  ? -40.147 45.861 -50.521 1.00 20.26  ? 47  ASN T ND2 1 
ATOM   4539 N  N   . PHE F  2 48  ? -42.133 41.372 -49.494 1.00 19.59  ? 48  PHE T N   1 
ATOM   4540 C  CA  . PHE F  2 48  ? -42.303 40.076 -48.879 1.00 19.61  ? 48  PHE T CA  1 
ATOM   4541 C  C   . PHE F  2 48  ? -43.524 39.325 -49.456 1.00 20.75  ? 48  PHE T C   1 
ATOM   4542 O  O   . PHE F  2 48  ? -43.485 38.090 -49.574 1.00 22.10  ? 48  PHE T O   1 
ATOM   4543 C  CB  . PHE F  2 48  ? -42.510 40.249 -47.398 1.00 18.81  ? 48  PHE T CB  1 
ATOM   4544 C  CG  . PHE F  2 48  ? -41.236 40.350 -46.556 1.00 18.76  ? 48  PHE T CG  1 
ATOM   4545 C  CD1 . PHE F  2 48  ? -40.022 40.827 -47.061 1.00 18.69  ? 48  PHE T CD1 1 
ATOM   4546 C  CD2 . PHE F  2 48  ? -41.298 39.964 -45.258 1.00 18.41  ? 48  PHE T CD2 1 
ATOM   4547 C  CE1 . PHE F  2 48  ? -38.898 40.872 -46.280 1.00 18.01  ? 48  PHE T CE1 1 
ATOM   4548 C  CE2 . PHE F  2 48  ? -40.182 40.023 -44.439 1.00 17.71  ? 48  PHE T CE2 1 
ATOM   4549 C  CZ  . PHE F  2 48  ? -39.002 40.495 -44.943 1.00 18.09  ? 48  PHE T CZ  1 
ATOM   4550 N  N   . LEU F  2 49  ? -44.615 40.048 -49.761 1.00 20.09  ? 49  LEU T N   1 
ATOM   4551 C  CA  . LEU F  2 49  ? -45.779 39.433 -50.314 1.00 20.47  ? 49  LEU T CA  1 
ATOM   4552 C  C   . LEU F  2 49  ? -45.957 39.913 -51.737 1.00 21.31  ? 49  LEU T C   1 
ATOM   4553 O  O   . LEU F  2 49  ? -47.064 40.178 -52.146 1.00 21.24  ? 49  LEU T O   1 
ATOM   4554 C  CB  . LEU F  2 49  ? -47.022 39.722 -49.493 1.00 19.88  ? 49  LEU T CB  1 
ATOM   4555 C  CG  . LEU F  2 49  ? -47.024 38.949 -48.161 1.00 19.39  ? 49  LEU T CG  1 
ATOM   4556 C  CD1 . LEU F  2 49  ? -48.162 39.327 -47.224 1.00 20.11  ? 49  LEU T CD1 1 
ATOM   4557 C  CD2 . LEU F  2 49  ? -46.993 37.418 -48.366 1.00 20.55  ? 49  LEU T CD2 1 
ATOM   4558 N  N   . LYS F  2 50  ? -44.860 40.029 -52.478 1.00 23.29  ? 50  LYS T N   1 
ATOM   4559 C  CA  . LYS F  2 50  ? -44.957 40.562 -53.817 1.00 25.12  ? 50  LYS T CA  1 
ATOM   4560 C  C   . LYS F  2 50  ? -45.844 39.710 -54.736 1.00 25.31  ? 50  LYS T C   1 
ATOM   4561 O  O   . LYS F  2 50  ? -46.731 40.221 -55.409 1.00 25.16  ? 50  LYS T O   1 
ATOM   4562 C  CB  . LYS F  2 50  ? -43.573 40.723 -54.435 1.00 27.62  ? 50  LYS T CB  1 
ATOM   4563 C  CG  . LYS F  2 50  ? -43.616 41.398 -55.779 1.00 30.81  ? 50  LYS T CG  1 
ATOM   4564 C  CD  . LYS F  2 50  ? -42.213 41.725 -56.310 1.00 34.04  ? 50  LYS T CD  1 
ATOM   4565 C  CE  . LYS F  2 50  ? -42.330 42.185 -57.761 1.00 37.27  ? 50  LYS T CE  1 
ATOM   4566 N  NZ  . LYS F  2 50  ? -41.072 42.015 -58.550 1.00 42.91  ? 50  LYS T NZ  1 
ATOM   4567 N  N   . LYS F  2 51  ? -45.608 38.400 -54.778 1.00 26.51  ? 51  LYS T N   1 
ATOM   4568 C  CA  . LYS F  2 51  ? -46.449 37.523 -55.606 1.00 28.97  ? 51  LYS T CA  1 
ATOM   4569 C  C   . LYS F  2 51  ? -47.919 37.550 -55.185 1.00 26.56  ? 51  LYS T C   1 
ATOM   4570 O  O   . LYS F  2 51  ? -48.855 37.597 -56.048 1.00 28.86  ? 51  LYS T O   1 
ATOM   4571 C  CB  . LYS F  2 51  ? -45.918 36.098 -55.458 1.00 32.81  ? 51  LYS T CB  1 
ATOM   4572 C  CG  . LYS F  2 51  ? -46.691 35.080 -56.249 1.00 36.63  ? 51  LYS T CG  1 
ATOM   4573 C  CD  . LYS F  2 51  ? -46.048 33.703 -56.154 1.00 40.13  ? 51  LYS T CD  1 
ATOM   4574 C  CE  . LYS F  2 51  ? -46.953 32.624 -56.740 1.00 44.00  ? 51  LYS T CE  1 
ATOM   4575 N  NZ  . LYS F  2 51  ? -46.893 32.600 -58.229 1.00 46.70  ? 51  LYS T NZ  1 
ATOM   4576 N  N   . GLU F  2 52  ? -48.125 37.486 -53.871 1.00 24.51  ? 52  GLU T N   1 
ATOM   4577 C  CA  . GLU F  2 52  ? -49.426 37.330 -53.288 1.00 23.57  ? 52  GLU T CA  1 
ATOM   4578 C  C   . GLU F  2 52  ? -50.278 38.586 -53.544 1.00 23.78  ? 52  GLU T C   1 
ATOM   4579 O  O   . GLU F  2 52  ? -51.485 38.508 -53.802 1.00 26.04  ? 52  GLU T O   1 
ATOM   4580 C  CB  . GLU F  2 52  ? -49.268 37.086 -51.785 1.00 22.58  ? 52  GLU T CB  1 
ATOM   4581 C  CG  . GLU F  2 52  ? -48.629 35.734 -51.450 1.00 24.63  ? 52  GLU T CG  1 
ATOM   4582 C  CD  . GLU F  2 52  ? -47.117 35.735 -51.356 1.00 25.45  ? 52  GLU T CD  1 
ATOM   4583 O  OE1 . GLU F  2 52  ? -46.485 36.700 -51.833 1.00 26.00  ? 52  GLU T OE1 1 
ATOM   4584 O  OE2 . GLU F  2 52  ? -46.548 34.735 -50.847 1.00 26.89  ? 52  GLU T OE2 1 
ATOM   4585 N  N   . ASN F  2 53  ? -49.624 39.739 -53.544 1.00 24.38  ? 53  ASN T N   1 
ATOM   4586 C  CA  . ASN F  2 53  ? -50.289 41.014 -53.848 1.00 24.52  ? 53  ASN T CA  1 
ATOM   4587 C  C   . ASN F  2 53  ? -50.875 41.109 -55.266 1.00 26.09  ? 53  ASN T C   1 
ATOM   4588 O  O   . ASN F  2 53  ? -51.742 41.954 -55.497 1.00 25.94  ? 53  ASN T O   1 
ATOM   4589 C  CB  . ASN F  2 53  ? -49.329 42.190 -53.564 1.00 24.13  ? 53  ASN T CB  1 
ATOM   4590 C  CG  . ASN F  2 53  ? -49.495 42.747 -52.166 1.00 24.06  ? 53  ASN T CG  1 
ATOM   4591 O  OD1 . ASN F  2 53  ? -50.586 43.147 -51.799 1.00 25.71  ? 53  ASN T OD1 1 
ATOM   4592 N  ND2 . ASN F  2 53  ? -48.409 42.824 -51.412 1.00 22.17  ? 53  ASN T ND2 1 
ATOM   4593 N  N   . LYS F  2 54  ? -50.386 40.283 -56.194 1.00 27.14  ? 54  LYS T N   1 
ATOM   4594 C  CA  . LYS F  2 54  ? -50.857 40.303 -57.574 1.00 29.61  ? 54  LYS T CA  1 
ATOM   4595 C  C   . LYS F  2 54  ? -52.225 39.693 -57.688 1.00 29.17  ? 54  LYS T C   1 
ATOM   4596 O  O   . LYS F  2 54  ? -52.887 39.812 -58.729 1.00 29.53  ? 54  LYS T O   1 
ATOM   4597 C  CB  . LYS F  2 54  ? -49.914 39.516 -58.473 1.00 31.70  ? 54  LYS T CB  1 
ATOM   4598 C  CG  . LYS F  2 54  ? -48.557 40.167 -58.705 1.00 33.40  ? 54  LYS T CG  1 
ATOM   4599 C  CD  . LYS F  2 54  ? -47.577 39.211 -59.380 1.00 36.35  ? 54  LYS T CD  1 
ATOM   4600 C  CE  . LYS F  2 54  ? -46.424 39.996 -60.008 1.00 39.20  ? 54  LYS T CE  1 
ATOM   4601 N  NZ  . LYS F  2 54  ? -45.263 39.121 -60.415 1.00 41.90  ? 54  LYS T NZ  1 
ATOM   4602 N  N   . ASN F  2 55  ? -52.634 38.994 -56.648 1.00 28.33  ? 55  ASN T N   1 
ATOM   4603 C  CA  . ASN F  2 55  ? -53.891 38.305 -56.636 1.00 30.15  ? 55  ASN T CA  1 
ATOM   4604 C  C   . ASN F  2 55  ? -54.712 38.635 -55.404 1.00 28.35  ? 55  ASN T C   1 
ATOM   4605 O  O   . ASN F  2 55  ? -54.451 38.138 -54.284 1.00 28.46  ? 55  ASN T O   1 
ATOM   4606 C  CB  . ASN F  2 55  ? -53.655 36.791 -56.773 1.00 31.44  ? 55  ASN T CB  1 
ATOM   4607 C  CG  . ASN F  2 55  ? -54.922 36.028 -57.000 1.00 33.82  ? 55  ASN T CG  1 
ATOM   4608 O  OD1 . ASN F  2 55  ? -56.024 36.497 -56.671 1.00 35.25  ? 55  ASN T OD1 1 
ATOM   4609 N  ND2 . ASN F  2 55  ? -54.795 34.851 -57.644 1.00 36.18  ? 55  ASN T ND2 1 
ATOM   4610 N  N   . GLU F  2 56  ? -55.720 39.489 -55.639 1.00 29.15  ? 56  GLU T N   1 
ATOM   4611 C  CA  . GLU F  2 56  ? -56.529 39.998 -54.541 1.00 29.19  ? 56  GLU T CA  1 
ATOM   4612 C  C   . GLU F  2 56  ? -57.192 38.877 -53.759 1.00 29.12  ? 56  GLU T C   1 
ATOM   4613 O  O   . GLU F  2 56  ? -57.341 38.993 -52.555 1.00 27.44  ? 56  GLU T O   1 
ATOM   4614 C  CB  . GLU F  2 56  ? -57.590 40.978 -55.021 1.00 30.68  ? 56  GLU T CB  1 
ATOM   4615 C  CG  . GLU F  2 56  ? -58.230 41.744 -53.870 1.00 31.81  ? 56  GLU T CG  1 
ATOM   4616 C  CD  . GLU F  2 56  ? -58.918 43.010 -54.309 1.00 33.03  ? 56  GLU T CD  1 
ATOM   4617 O  OE1 . GLU F  2 56  ? -58.987 43.289 -55.514 1.00 36.36  ? 56  GLU T OE1 1 
ATOM   4618 O  OE2 . GLU F  2 56  ? -59.463 43.689 -53.434 1.00 32.67  ? 56  GLU T OE2 1 
ATOM   4619 N  N   . LYS F  2 57  ? -57.586 37.792 -54.430 1.00 28.96  ? 57  LYS T N   1 
ATOM   4620 C  CA  . LYS F  2 57  ? -58.229 36.711 -53.677 1.00 29.73  ? 57  LYS T CA  1 
ATOM   4621 C  C   . LYS F  2 57  ? -57.229 35.928 -52.853 1.00 26.74  ? 57  LYS T C   1 
ATOM   4622 O  O   . LYS F  2 57  ? -57.616 35.325 -51.861 1.00 26.91  ? 57  LYS T O   1 
ATOM   4623 C  CB  . LYS F  2 57  ? -58.998 35.741 -54.544 1.00 33.20  ? 57  LYS T CB  1 
ATOM   4624 C  CG  . LYS F  2 57  ? -60.270 36.356 -55.101 1.00 37.28  ? 57  LYS T CG  1 
ATOM   4625 C  CD  . LYS F  2 57  ? -60.063 36.602 -56.565 1.00 42.57  ? 57  LYS T CD  1 
ATOM   4626 C  CE  . LYS F  2 57  ? -60.137 35.298 -57.345 1.00 45.71  ? 57  LYS T CE  1 
ATOM   4627 N  NZ  . LYS F  2 57  ? -58.990 35.206 -58.306 1.00 50.09  ? 57  LYS T NZ  1 
ATOM   4628 N  N   . VAL F  2 58  ? -55.969 35.916 -53.254 1.00 25.87  ? 58  VAL T N   1 
ATOM   4629 C  CA  . VAL F  2 58  ? -54.935 35.372 -52.317 1.00 24.59  ? 58  VAL T CA  1 
ATOM   4630 C  C   . VAL F  2 58  ? -54.878 36.194 -51.030 1.00 24.09  ? 58  VAL T C   1 
ATOM   4631 O  O   . VAL F  2 58  ? -54.855 35.631 -49.901 1.00 23.97  ? 58  VAL T O   1 
ATOM   4632 C  CB  . VAL F  2 58  ? -53.556 35.216 -53.006 1.00 24.35  ? 58  VAL T CB  1 
ATOM   4633 C  CG1 . VAL F  2 58  ? -52.457 34.884 -51.978 1.00 23.83  ? 58  VAL T CG1 1 
ATOM   4634 C  CG2 . VAL F  2 58  ? -53.621 34.135 -54.099 1.00 25.89  ? 58  VAL T CG2 1 
ATOM   4635 N  N   . ILE F  2 59  ? -54.866 37.519 -51.156 1.00 22.38  ? 59  ILE T N   1 
ATOM   4636 C  CA  . ILE F  2 59  ? -54.814 38.350 -49.944 1.00 21.54  ? 59  ILE T CA  1 
ATOM   4637 C  C   . ILE F  2 59  ? -56.058 38.147 -49.084 1.00 22.17  ? 59  ILE T C   1 
ATOM   4638 O  O   . ILE F  2 59  ? -56.004 38.135 -47.828 1.00 21.72  ? 59  ILE T O   1 
ATOM   4639 C  CB  . ILE F  2 59  ? -54.593 39.827 -50.268 1.00 20.92  ? 59  ILE T CB  1 
ATOM   4640 C  CG1 . ILE F  2 59  ? -53.360 40.008 -51.147 1.00 21.33  ? 59  ILE T CG1 1 
ATOM   4641 C  CG2 . ILE F  2 59  ? -54.513 40.668 -48.984 1.00 20.99  ? 59  ILE T CG2 1 
ATOM   4642 C  CD1 . ILE F  2 59  ? -52.070 39.503 -50.484 1.00 20.89  ? 59  ILE T CD1 1 
ATOM   4643 N  N   . GLU F  2 60  ? -57.183 37.898 -49.724 1.00 23.61  ? 60  GLU T N   1 
ATOM   4644 C  CA  . GLU F  2 60  ? -58.413 37.680 -48.987 1.00 24.42  ? 60  GLU T CA  1 
ATOM   4645 C  C   . GLU F  2 60  ? -58.337 36.369 -48.254 1.00 25.47  ? 60  GLU T C   1 
ATOM   4646 O  O   . GLU F  2 60  ? -58.785 36.307 -47.122 1.00 25.30  ? 60  GLU T O   1 
ATOM   4647 C  CB  . GLU F  2 60  ? -59.637 37.723 -49.913 1.00 26.15  ? 60  GLU T CB  1 
ATOM   4648 C  CG  . GLU F  2 60  ? -59.993 39.113 -50.402 1.00 27.04  ? 60  GLU T CG  1 
ATOM   4649 C  CD  . GLU F  2 60  ? -60.986 39.164 -51.544 1.00 29.51  ? 60  GLU T CD  1 
ATOM   4650 O  OE1 . GLU F  2 60  ? -61.514 38.108 -51.974 1.00 31.01  ? 60  GLU T OE1 1 
ATOM   4651 O  OE2 . GLU F  2 60  ? -61.225 40.283 -52.067 1.00 28.82  ? 60  GLU T OE2 1 
ATOM   4652 N  N   . HIS F  2 61  ? -57.750 35.336 -48.876 1.00 25.54  ? 61  HIS T N   1 
ATOM   4653 C  CA  . HIS F  2 61  ? -57.553 34.045 -48.184 1.00 26.34  ? 61  HIS T CA  1 
ATOM   4654 C  C   . HIS F  2 61  ? -56.674 34.215 -46.939 1.00 24.38  ? 61  HIS T C   1 
ATOM   4655 O  O   . HIS F  2 61  ? -56.961 33.652 -45.861 1.00 23.82  ? 61  HIS T O   1 
ATOM   4656 C  CB  . HIS F  2 61  ? -56.952 32.976 -49.107 1.00 27.72  ? 61  HIS T CB  1 
ATOM   4657 C  CG  . HIS F  2 61  ? -56.338 31.803 -48.329 1.00 28.71  ? 61  HIS T CG  1 
ATOM   4658 N  ND1 . HIS F  2 61  ? -57.099 30.822 -47.782 1.00 29.53  ? 61  HIS T ND1 1 
ATOM   4659 C  CD2 . HIS F  2 61  ? -55.020 31.525 -47.989 1.00 27.92  ? 61  HIS T CD2 1 
ATOM   4660 C  CE1 . HIS F  2 61  ? -56.299 29.965 -47.119 1.00 30.19  ? 61  HIS T CE1 1 
ATOM   4661 N  NE2 . HIS F  2 61  ? -55.023 30.413 -47.226 1.00 29.54  ? 61  HIS T NE2 1 
ATOM   4662 N  N   . ILE F  2 62  ? -55.620 35.020 -47.065 1.00 22.89  ? 62  ILE T N   1 
ATOM   4663 C  CA  . ILE F  2 62  ? -54.675 35.257 -45.962 1.00 22.24  ? 62  ILE T CA  1 
ATOM   4664 C  C   . ILE F  2 62  ? -55.454 35.909 -44.824 1.00 22.32  ? 62  ILE T C   1 
ATOM   4665 O  O   . ILE F  2 62  ? -55.321 35.506 -43.683 1.00 20.75  ? 62  ILE T O   1 
ATOM   4666 C  CB  . ILE F  2 62  ? -53.448 36.077 -46.395 1.00 21.08  ? 62  ILE T CB  1 
ATOM   4667 C  CG1 . ILE F  2 62  ? -52.563 35.246 -47.317 1.00 22.30  ? 62  ILE T CG1 1 
ATOM   4668 C  CG2 . ILE F  2 62  ? -52.651 36.546 -45.168 1.00 20.06  ? 62  ILE T CG2 1 
ATOM   4669 C  CD1 . ILE F  2 62  ? -51.545 36.087 -48.062 1.00 23.46  ? 62  ILE T CD1 1 
ATOM   4670 N  N   . MET F  2 63  ? -56.273 36.914 -45.126 1.00 23.45  ? 63  MET T N   1 
ATOM   4671 C  CA  . MET F  2 63  ? -57.067 37.545 -44.058 1.00 23.33  ? 63  MET T CA  1 
ATOM   4672 C  C   . MET F  2 63  ? -58.001 36.560 -43.378 1.00 23.51  ? 63  MET T C   1 
ATOM   4673 O  O   . MET F  2 63  ? -58.091 36.512 -42.150 1.00 22.51  ? 63  MET T O   1 
ATOM   4674 C  CB  . MET F  2 63  ? -57.842 38.754 -44.573 1.00 25.16  ? 63  MET T CB  1 
ATOM   4675 C  CG  . MET F  2 63  ? -59.032 39.150 -43.685 1.00 26.83  ? 63  MET T CG  1 
ATOM   4676 S  SD  . MET F  2 63  ? -58.774 40.807 -43.150 1.00 35.67  ? 63  MET T SD  1 
ATOM   4677 C  CE  . MET F  2 63  ? -60.046 41.121 -41.949 1.00 25.54  ? 63  MET T CE  1 
ATOM   4678 N  N   . GLU F  2 64  ? -58.698 35.762 -44.185 1.00 23.77  ? 64  GLU T N   1 
ATOM   4679 C  CA  . GLU F  2 64  ? -59.649 34.777 -43.633 1.00 25.28  ? 64  GLU T CA  1 
ATOM   4680 C  C   . GLU F  2 64  ? -58.958 33.742 -42.711 1.00 24.47  ? 64  GLU T C   1 
ATOM   4681 O  O   . GLU F  2 64  ? -59.434 33.435 -41.618 1.00 25.06  ? 64  GLU T O   1 
ATOM   4682 C  CB  . GLU F  2 64  ? -60.336 34.107 -44.787 1.00 26.13  ? 64  GLU T CB  1 
ATOM   4683 C  CG  . GLU F  2 64  ? -61.379 33.095 -44.420 1.00 29.38  ? 64  GLU T CG  1 
ATOM   4684 C  CD  . GLU F  2 64  ? -62.060 32.522 -45.671 1.00 31.80  ? 64  GLU T CD  1 
ATOM   4685 O  OE1 . GLU F  2 64  ? -63.050 31.817 -45.522 1.00 33.45  ? 64  GLU T OE1 1 
ATOM   4686 O  OE2 . GLU F  2 64  ? -61.568 32.781 -46.803 1.00 33.53  ? 64  GLU T OE2 1 
ATOM   4687 N  N   . ASP F  2 65  ? -57.766 33.318 -43.121 1.00 23.60  ? 65  ASP T N   1 
ATOM   4688 C  CA  . ASP F  2 65  ? -56.958 32.376 -42.368 1.00 23.00  ? 65  ASP T CA  1 
ATOM   4689 C  C   . ASP F  2 65  ? -56.566 32.964 -41.004 1.00 21.34  ? 65  ASP T C   1 
ATOM   4690 O  O   . ASP F  2 65  ? -56.670 32.308 -39.985 1.00 21.86  ? 65  ASP T O   1 
ATOM   4691 C  CB  . ASP F  2 65  ? -55.723 32.035 -43.205 1.00 24.39  ? 65  ASP T CB  1 
ATOM   4692 C  CG  . ASP F  2 65  ? -54.800 31.030 -42.531 1.00 27.01  ? 65  ASP T CG  1 
ATOM   4693 O  OD1 . ASP F  2 65  ? -55.247 30.066 -41.888 1.00 27.92  ? 65  ASP T OD1 1 
ATOM   4694 O  OD2 . ASP F  2 65  ? -53.587 31.227 -42.694 1.00 31.42  ? 65  ASP T OD2 1 
ATOM   4695 N  N   . LEU F  2 66  ? -56.147 34.231 -41.012 1.00 20.74  ? 66  LEU T N   1 
ATOM   4696 C  CA  . LEU F  2 66  ? -55.674 34.881 -39.785 1.00 20.03  ? 66  LEU T CA  1 
ATOM   4697 C  C   . LEU F  2 66  ? -56.816 35.235 -38.834 1.00 20.23  ? 66  LEU T C   1 
ATOM   4698 O  O   . LEU F  2 66  ? -56.568 35.382 -37.621 1.00 20.74  ? 66  LEU T O   1 
ATOM   4699 C  CB  . LEU F  2 66  ? -54.917 36.151 -40.125 1.00 18.89  ? 66  LEU T CB  1 
ATOM   4700 C  CG  . LEU F  2 66  ? -53.615 35.943 -40.894 1.00 19.17  ? 66  LEU T CG  1 
ATOM   4701 C  CD1 . LEU F  2 66  ? -53.131 37.282 -41.512 1.00 18.22  ? 66  LEU T CD1 1 
ATOM   4702 C  CD2 . LEU F  2 66  ? -52.569 35.417 -39.905 1.00 18.95  ? 66  LEU T CD2 1 
ATOM   4703 N  N   . ASP F  2 67  ? -58.023 35.410 -39.381 1.00 21.93  ? 67  ASP T N   1 
ATOM   4704 C  CA  . ASP F  2 67  ? -59.188 35.903 -38.650 1.00 21.81  ? 67  ASP T CA  1 
ATOM   4705 C  C   . ASP F  2 67  ? -59.772 34.767 -37.820 1.00 23.02  ? 67  ASP T C   1 
ATOM   4706 O  O   . ASP F  2 67  ? -60.827 34.226 -38.151 1.00 23.77  ? 67  ASP T O   1 
ATOM   4707 C  CB  . ASP F  2 67  ? -60.242 36.470 -39.620 1.00 22.79  ? 67  ASP T CB  1 
ATOM   4708 C  CG  . ASP F  2 67  ? -61.483 36.955 -38.915 1.00 23.70  ? 67  ASP T CG  1 
ATOM   4709 O  OD1 . ASP F  2 67  ? -61.417 37.207 -37.675 1.00 23.39  ? 67  ASP T OD1 1 
ATOM   4710 O  OD2 . ASP F  2 67  ? -62.524 37.121 -39.597 1.00 24.57  ? 67  ASP T OD2 1 
ATOM   4711 N  N   . THR F  2 68  ? -59.109 34.487 -36.701 1.00 22.65  ? 68  THR T N   1 
ATOM   4712 C  CA  . THR F  2 68  ? -59.322 33.301 -35.913 1.00 24.77  ? 68  THR T CA  1 
ATOM   4713 C  C   . THR F  2 68  ? -60.728 33.277 -35.297 1.00 25.05  ? 68  THR T C   1 
ATOM   4714 O  O   . THR F  2 68  ? -61.323 32.240 -35.268 1.00 26.43  ? 68  THR T O   1 
ATOM   4715 C  CB  . THR F  2 68  ? -58.209 33.088 -34.853 1.00 27.02  ? 68  THR T CB  1 
ATOM   4716 O  OG1 . THR F  2 68  ? -58.352 33.992 -33.780 1.00 29.63  ? 68  THR T OG1 1 
ATOM   4717 C  CG2 . THR F  2 68  ? -56.871 33.381 -35.431 1.00 25.19  ? 68  THR T CG2 1 
ATOM   4718 N  N   . ASN F  2 69  ? -61.279 34.427 -34.865 1.00 25.01  ? 69  ASN T N   1 
ATOM   4719 C  CA  . ASN F  2 69  ? -62.669 34.429 -34.363 1.00 26.00  ? 69  ASN T CA  1 
ATOM   4720 C  C   . ASN F  2 69  ? -63.740 34.729 -35.392 1.00 26.60  ? 69  ASN T C   1 
ATOM   4721 O  O   . ASN F  2 69  ? -64.929 34.853 -35.039 1.00 27.98  ? 69  ASN T O   1 
ATOM   4722 C  CB  . ASN F  2 69  ? -62.824 35.349 -33.174 1.00 26.63  ? 69  ASN T CB  1 
ATOM   4723 C  CG  . ASN F  2 69  ? -62.789 36.816 -33.563 1.00 26.29  ? 69  ASN T CG  1 
ATOM   4724 O  OD1 . ASN F  2 69  ? -62.347 37.176 -34.647 1.00 24.87  ? 69  ASN T OD1 1 
ATOM   4725 N  ND2 . ASN F  2 69  ? -63.300 37.657 -32.692 1.00 28.92  ? 69  ASN T ND2 1 
ATOM   4726 N  N   . ALA F  2 70  ? -63.339 34.795 -36.653 1.00 25.90  ? 70  ALA T N   1 
ATOM   4727 C  CA  . ALA F  2 70  ? -64.281 34.863 -37.778 1.00 27.04  ? 70  ALA T CA  1 
ATOM   4728 C  C   . ALA F  2 70  ? -65.202 36.089 -37.725 1.00 27.78  ? 70  ALA T C   1 
ATOM   4729 O  O   . ALA F  2 70  ? -66.378 36.002 -38.079 1.00 29.94  ? 70  ALA T O   1 
ATOM   4730 C  CB  . ALA F  2 70  ? -65.103 33.553 -37.840 1.00 29.24  ? 70  ALA T CB  1 
ATOM   4731 N  N   . ASP F  2 71  ? -64.681 37.241 -37.296 1.00 31.08  ? 71  ASP T N   1 
ATOM   4732 C  CA  . ASP F  2 71  ? -65.537 38.446 -37.192 1.00 31.02  ? 71  ASP T CA  1 
ATOM   4733 C  C   . ASP F  2 71  ? -65.239 39.481 -38.265 1.00 30.13  ? 71  ASP T C   1 
ATOM   4734 O  O   . ASP F  2 71  ? -65.700 40.612 -38.155 1.00 30.05  ? 71  ASP T O   1 
ATOM   4735 C  CB  . ASP F  2 71  ? -65.453 39.091 -35.800 1.00 30.30  ? 71  ASP T CB  1 
ATOM   4736 C  CG  . ASP F  2 71  ? -64.083 39.640 -35.483 1.00 28.97  ? 71  ASP T CG  1 
ATOM   4737 O  OD1 . ASP F  2 71  ? -63.153 39.496 -36.308 1.00 27.85  ? 71  ASP T OD1 1 
ATOM   4738 O  OD2 . ASP F  2 71  ? -63.935 40.191 -34.383 1.00 29.16  ? 71  ASP T OD2 1 
ATOM   4739 N  N   . LYS F  2 72  ? -64.456 39.087 -39.268 1.00 29.83  ? 72  LYS T N   1 
ATOM   4740 C  CA  . LYS F  2 72  ? -64.099 39.910 -40.427 1.00 30.03  ? 72  LYS T CA  1 
ATOM   4741 C  C   . LYS F  2 72  ? -63.206 41.080 -40.070 1.00 27.90  ? 72  LYS T C   1 
ATOM   4742 O  O   . LYS F  2 72  ? -63.140 42.066 -40.821 1.00 28.12  ? 72  LYS T O   1 
ATOM   4743 C  CB  . LYS F  2 72  ? -65.346 40.402 -41.151 1.00 33.00  ? 72  LYS T CB  1 
ATOM   4744 C  CG  . LYS F  2 72  ? -66.313 39.272 -41.417 1.00 36.19  ? 72  LYS T CG  1 
ATOM   4745 C  CD  . LYS F  2 72  ? -67.450 39.785 -42.265 1.00 39.57  ? 72  LYS T CD  1 
ATOM   4746 C  CE  . LYS F  2 72  ? -67.167 39.497 -43.726 1.00 42.09  ? 72  LYS T CE  1 
ATOM   4747 N  NZ  . LYS F  2 72  ? -67.440 38.045 -44.018 1.00 44.63  ? 72  LYS T NZ  1 
ATOM   4748 N  N   A GLN F  2 73  ? -62.497 40.929 -38.953 0.22 26.19  ? 73  GLN T N   1 
ATOM   4749 N  N   B GLN F  2 73  ? -62.541 40.998 -38.913 0.78 25.96  ? 73  GLN T N   1 
ATOM   4750 C  CA  A GLN F  2 73  ? -61.554 41.902 -38.452 0.22 24.73  ? 73  GLN T CA  1 
ATOM   4751 C  CA  B GLN F  2 73  ? -61.583 42.004 -38.455 0.78 24.77  ? 73  GLN T CA  1 
ATOM   4752 C  C   A GLN F  2 73  ? -60.303 41.165 -38.049 0.22 23.16  ? 73  GLN T C   1 
ATOM   4753 C  C   B GLN F  2 73  ? -60.348 41.258 -37.957 0.78 23.15  ? 73  GLN T C   1 
ATOM   4754 O  O   A GLN F  2 73  ? -60.370 39.994 -37.667 0.22 23.26  ? 73  GLN T O   1 
ATOM   4755 O  O   B GLN F  2 73  ? -60.475 40.149 -37.432 0.78 23.25  ? 73  GLN T O   1 
ATOM   4756 C  CB  A GLN F  2 73  ? -62.094 42.544 -37.196 0.22 24.83  ? 73  GLN T CB  1 
ATOM   4757 C  CB  B GLN F  2 73  ? -62.151 42.760 -37.270 0.78 24.97  ? 73  GLN T CB  1 
ATOM   4758 C  CG  A GLN F  2 73  ? -63.383 43.283 -37.377 0.22 25.98  ? 73  GLN T CG  1 
ATOM   4759 C  CG  B GLN F  2 73  ? -63.492 43.412 -37.480 0.78 26.47  ? 73  GLN T CG  1 
ATOM   4760 C  CD  A GLN F  2 73  ? -63.276 44.647 -36.770 0.22 26.11  ? 73  GLN T CD  1 
ATOM   4761 C  CD  B GLN F  2 73  ? -63.428 44.680 -38.313 0.78 27.19  ? 73  GLN T CD  1 
ATOM   4762 O  OE1 A GLN F  2 73  ? -63.752 44.885 -35.667 0.22 26.13  ? 73  GLN T OE1 1 
ATOM   4763 O  OE1 B GLN F  2 73  ? -64.339 44.945 -39.131 0.78 29.71  ? 73  GLN T OE1 1 
ATOM   4764 N  NE2 A GLN F  2 73  ? -62.597 45.550 -37.473 0.22 25.90  ? 73  GLN T NE2 1 
ATOM   4765 N  NE2 B GLN F  2 73  ? -62.383 45.486 -38.101 0.78 26.12  ? 73  GLN T NE2 1 
ATOM   4766 N  N   . LEU F  2 74  ? -59.159 41.832 -38.125 1.00 21.70  ? 74  LEU T N   1 
ATOM   4767 C  CA  . LEU F  2 74  ? -57.943 41.285 -37.493 1.00 20.26  ? 74  LEU T CA  1 
ATOM   4768 C  C   . LEU F  2 74  ? -57.601 42.091 -36.235 1.00 19.38  ? 74  LEU T C   1 
ATOM   4769 O  O   . LEU F  2 74  ? -57.319 43.304 -36.289 1.00 19.30  ? 74  LEU T O   1 
ATOM   4770 C  CB  . LEU F  2 74  ? -56.751 41.225 -38.430 1.00 19.63  ? 74  LEU T CB  1 
ATOM   4771 C  CG  . LEU F  2 74  ? -56.852 40.427 -39.713 1.00 20.39  ? 74  LEU T CG  1 
ATOM   4772 C  CD1 . LEU F  2 74  ? -55.478 40.333 -40.322 1.00 19.98  ? 74  LEU T CD1 1 
ATOM   4773 C  CD2 . LEU F  2 74  ? -57.451 39.016 -39.486 1.00 21.06  ? 74  LEU T CD2 1 
ATOM   4774 N  N   . SER F  2 75  ? -57.640 41.440 -35.091 1.00 19.04  ? 75  SER T N   1 
ATOM   4775 C  CA  . SER F  2 75  ? -56.990 41.973 -33.916 1.00 18.79  ? 75  SER T CA  1 
ATOM   4776 C  C   . SER F  2 75  ? -55.479 41.934 -34.060 1.00 18.01  ? 75  SER T C   1 
ATOM   4777 O  O   . SER F  2 75  ? -54.908 41.306 -34.969 1.00 17.45  ? 75  SER T O   1 
ATOM   4778 C  CB  . SER F  2 75  ? -57.406 41.220 -32.658 1.00 19.37  ? 75  SER T CB  1 
ATOM   4779 O  OG  . SER F  2 75  ? -56.928 39.871 -32.751 1.00 19.50  ? 75  SER T OG  1 
ATOM   4780 N  N   . PHE F  2 76  ? -54.801 42.614 -33.129 1.00 17.94  ? 76  PHE T N   1 
ATOM   4781 C  CA  . PHE F  2 76  ? -53.380 42.568 -33.140 1.00 17.43  ? 76  PHE T CA  1 
ATOM   4782 C  C   . PHE F  2 76  ? -52.899 41.134 -32.899 1.00 17.42  ? 76  PHE T C   1 
ATOM   4783 O  O   . PHE F  2 76  ? -51.964 40.683 -33.566 1.00 16.86  ? 76  PHE T O   1 
ATOM   4784 C  CB  . PHE F  2 76  ? -52.732 43.524 -32.142 1.00 17.51  ? 76  PHE T CB  1 
ATOM   4785 C  CG  . PHE F  2 76  ? -51.272 43.523 -32.234 1.00 17.11  ? 76  PHE T CG  1 
ATOM   4786 C  CD1 . PHE F  2 76  ? -50.629 44.278 -33.216 1.00 16.74  ? 76  PHE T CD1 1 
ATOM   4787 C  CD2 . PHE F  2 76  ? -50.485 42.737 -31.403 1.00 17.36  ? 76  PHE T CD2 1 
ATOM   4788 C  CE1 . PHE F  2 76  ? -49.270 44.259 -33.340 1.00 16.57  ? 76  PHE T CE1 1 
ATOM   4789 C  CE2 . PHE F  2 76  ? -49.116 42.692 -31.536 1.00 17.00  ? 76  PHE T CE2 1 
ATOM   4790 C  CZ  . PHE F  2 76  ? -48.493 43.453 -32.534 1.00 16.60  ? 76  PHE T CZ  1 
ATOM   4791 N  N   . GLU F  2 77  ? -53.539 40.470 -31.961 1.00 18.24  ? 77  GLU T N   1 
ATOM   4792 C  CA  . GLU F  2 77  ? -53.253 39.060 -31.679 1.00 18.92  ? 77  GLU T CA  1 
ATOM   4793 C  C   . GLU F  2 77  ? -53.335 38.211 -32.889 1.00 18.46  ? 77  GLU T C   1 
ATOM   4794 O  O   . GLU F  2 77  ? -52.452 37.395 -33.145 1.00 18.86  ? 77  GLU T O   1 
ATOM   4795 C  CB  . GLU F  2 77  ? -54.238 38.552 -30.649 1.00 20.39  ? 77  GLU T CB  1 
ATOM   4796 C  CG  . GLU F  2 77  ? -53.949 39.030 -29.257 1.00 21.76  ? 77  GLU T CG  1 
ATOM   4797 C  CD  . GLU F  2 77  ? -54.538 40.371 -28.885 1.00 22.60  ? 77  GLU T CD  1 
ATOM   4798 O  OE1 . GLU F  2 77  ? -55.178 41.061 -29.739 1.00 23.45  ? 77  GLU T OE1 1 
ATOM   4799 O  OE2 . GLU F  2 77  ? -54.372 40.734 -27.684 1.00 24.63  ? 77  GLU T OE2 1 
ATOM   4800 N  N   . GLU F  2 78  ? -54.374 38.398 -33.699 1.00 18.43  ? 78  GLU T N   1 
ATOM   4801 C  CA  . GLU F  2 78  ? -54.472 37.618 -34.919 1.00 18.48  ? 78  GLU T CA  1 
ATOM   4802 C  C   . GLU F  2 78  ? -53.397 38.011 -35.940 1.00 17.71  ? 78  GLU T C   1 
ATOM   4803 O  O   . GLU F  2 78  ? -52.730 37.186 -36.547 1.00 17.49  ? 78  GLU T O   1 
ATOM   4804 C  CB  . GLU F  2 78  ? -55.880 37.740 -35.512 1.00 19.22  ? 78  GLU T CB  1 
ATOM   4805 C  CG  . GLU F  2 78  ? -56.977 37.205 -34.594 1.00 20.24  ? 78  GLU T CG  1 
ATOM   4806 C  CD  . GLU F  2 78  ? -58.360 37.584 -35.073 1.00 21.23  ? 78  GLU T CD  1 
ATOM   4807 O  OE1 . GLU F  2 78  ? -58.471 38.625 -35.740 1.00 21.14  ? 78  GLU T OE1 1 
ATOM   4808 O  OE2 . GLU F  2 78  ? -59.338 36.900 -34.752 1.00 22.50  ? 78  GLU T OE2 1 
ATOM   4809 N  N   . PHE F  2 79  ? -53.190 39.320 -36.071 1.00 17.26  ? 79  PHE T N   1 
ATOM   4810 C  CA  . PHE F  2 79  ? -52.237 39.853 -37.013 1.00 16.94  ? 79  PHE T CA  1 
ATOM   4811 C  C   . PHE F  2 79  ? -50.796 39.428 -36.752 1.00 16.53  ? 79  PHE T C   1 
ATOM   4812 O  O   . PHE F  2 79  ? -49.982 39.201 -37.692 1.00 17.15  ? 79  PHE T O   1 
ATOM   4813 C  CB  . PHE F  2 79  ? -52.349 41.362 -36.959 1.00 16.94  ? 79  PHE T CB  1 
ATOM   4814 C  CG  . PHE F  2 79  ? -51.376 42.064 -37.820 1.00 16.85  ? 79  PHE T CG  1 
ATOM   4815 C  CD1 . PHE F  2 79  ? -51.580 42.096 -39.173 1.00 17.01  ? 79  PHE T CD1 1 
ATOM   4816 C  CD2 . PHE F  2 79  ? -50.258 42.677 -37.279 1.00 16.41  ? 79  PHE T CD2 1 
ATOM   4817 C  CE1 . PHE F  2 79  ? -50.680 42.728 -40.008 1.00 17.14  ? 79  PHE T CE1 1 
ATOM   4818 C  CE2 . PHE F  2 79  ? -49.363 43.342 -38.100 1.00 16.71  ? 79  PHE T CE2 1 
ATOM   4819 C  CZ  . PHE F  2 79  ? -49.570 43.373 -39.470 1.00 16.77  ? 79  PHE T CZ  1 
ATOM   4820 N  N   . ILE F  2 80  ? -50.423 39.310 -35.493 1.00 16.35  ? 80  ILE T N   1 
ATOM   4821 C  CA  . ILE F  2 80  ? -49.038 39.039 -35.242 1.00 16.53  ? 80  ILE T CA  1 
ATOM   4822 C  C   . ILE F  2 80  ? -48.575 37.651 -35.764 1.00 16.12  ? 80  ILE T C   1 
ATOM   4823 O  O   . ILE F  2 80  ? -47.388 37.435 -36.009 1.00 16.25  ? 80  ILE T O   1 
ATOM   4824 C  CB  . ILE F  2 80  ? -48.648 39.278 -33.800 1.00 17.12  ? 80  ILE T CB  1 
ATOM   4825 C  CG1 . ILE F  2 80  ? -47.115 39.479 -33.712 1.00 17.57  ? 80  ILE T CG1 1 
ATOM   4826 C  CG2 . ILE F  2 80  ? -49.169 38.200 -32.839 1.00 18.26  ? 80  ILE T CG2 1 
ATOM   4827 C  CD1 . ILE F  2 80  ? -46.686 39.902 -32.335 1.00 19.04  ? 80  ILE T CD1 1 
ATOM   4828 N  N   A MET F  2 81  ? -49.485 36.702 -35.917 0.50 16.34  ? 81  MET T N   1 
ATOM   4829 N  N   B MET F  2 81  ? -49.505 36.703 -35.889 0.50 16.66  ? 81  MET T N   1 
ATOM   4830 C  CA  A MET F  2 81  ? -49.074 35.444 -36.522 0.50 16.17  ? 81  MET T CA  1 
ATOM   4831 C  CA  B MET F  2 81  ? -49.182 35.424 -36.529 0.50 16.72  ? 81  MET T CA  1 
ATOM   4832 C  C   A MET F  2 81  ? -48.593 35.627 -37.951 0.50 16.01  ? 81  MET T C   1 
ATOM   4833 C  C   B MET F  2 81  ? -48.629 35.616 -37.938 0.50 16.31  ? 81  MET T C   1 
ATOM   4834 O  O   A MET F  2 81  ? -47.728 34.866 -38.396 0.50 15.96  ? 81  MET T O   1 
ATOM   4835 O  O   B MET F  2 81  ? -47.768 34.842 -38.360 0.50 16.21  ? 81  MET T O   1 
ATOM   4836 C  CB  A MET F  2 81  ? -50.184 34.413 -36.483 0.50 16.90  ? 81  MET T CB  1 
ATOM   4837 C  CB  B MET F  2 81  ? -50.396 34.489 -36.616 0.50 17.91  ? 81  MET T CB  1 
ATOM   4838 C  CG  A MET F  2 81  ? -50.816 34.301 -35.115 0.50 17.11  ? 81  MET T CG  1 
ATOM   4839 C  CG  B MET F  2 81  ? -50.614 33.502 -35.457 0.50 18.74  ? 81  MET T CG  1 
ATOM   4840 S  SD  A MET F  2 81  ? -49.557 33.888 -33.878 0.50 22.08  ? 81  MET T SD  1 
ATOM   4841 S  SD  B MET F  2 81  ? -49.212 32.459 -34.943 0.50 20.04  ? 81  MET T SD  1 
ATOM   4842 C  CE  A MET F  2 81  ? -49.835 32.143 -33.498 0.50 17.74  ? 81  MET T CE  1 
ATOM   4843 C  CE  B MET F  2 81  ? -48.837 33.475 -33.516 0.50 19.33  ? 81  MET T CE  1 
ATOM   4844 N  N   . LEU F  2 82  ? -49.125 36.606 -38.686 1.00 16.11  ? 82  LEU T N   1 
ATOM   4845 C  CA  . LEU F  2 82  ? -48.613 36.842 -40.047 1.00 16.25  ? 82  LEU T CA  1 
ATOM   4846 C  C   . LEU F  2 82  ? -47.146 37.296 -39.959 1.00 15.78  ? 82  LEU T C   1 
ATOM   4847 O  O   . LEU F  2 82  ? -46.319 36.942 -40.811 1.00 16.31  ? 82  LEU T O   1 
ATOM   4848 C  CB  . LEU F  2 82  ? -49.435 37.877 -40.834 1.00 16.69  ? 82  LEU T CB  1 
ATOM   4849 C  CG  . LEU F  2 82  ? -48.928 38.260 -42.188 1.00 17.07  ? 82  LEU T CG  1 
ATOM   4850 C  CD1 . LEU F  2 82  ? -48.935 37.056 -43.128 1.00 18.36  ? 82  LEU T CD1 1 
ATOM   4851 C  CD2 . LEU F  2 82  ? -49.826 39.379 -42.756 1.00 17.91  ? 82  LEU T CD2 1 
ATOM   4852 N  N   . MET F  2 83  ? -46.851 38.145 -38.971 1.00 15.41  ? 83  MET T N   1 
ATOM   4853 C  CA  . MET F  2 83  ? -45.526 38.697 -38.769 1.00 15.18  ? 83  MET T CA  1 
ATOM   4854 C  C   . MET F  2 83  ? -44.521 37.591 -38.466 1.00 14.85  ? 83  MET T C   1 
ATOM   4855 O  O   . MET F  2 83  ? -43.437 37.494 -39.085 1.00 14.62  ? 83  MET T O   1 
ATOM   4856 C  CB  . MET F  2 83  ? -45.532 39.707 -37.629 1.00 14.89  ? 83  MET T CB  1 
ATOM   4857 C  CG  . MET F  2 83  ? -46.403 40.957 -37.887 1.00 15.33  ? 83  MET T CG  1 
ATOM   4858 S  SD  . MET F  2 83  ? -45.995 41.945 -39.383 1.00 17.01  ? 83  MET T SD  1 
ATOM   4859 C  CE  . MET F  2 83  ? -46.983 41.231 -40.731 1.00 16.04  ? 83  MET T CE  1 
ATOM   4860 N  N   . ALA F  2 84  ? -44.936 36.659 -37.627 1.00 14.75  ? 84  ALA T N   1 
ATOM   4861 C  CA  . ALA F  2 84  ? -44.087 35.527 -37.264 1.00 15.16  ? 84  ALA T CA  1 
ATOM   4862 C  C   . ALA F  2 84  ? -43.879 34.608 -38.441 1.00 15.84  ? 84  ALA T C   1 
ATOM   4863 O  O   . ALA F  2 84  ? -42.739 34.164 -38.705 1.00 15.44  ? 84  ALA T O   1 
ATOM   4864 C  CB  . ALA F  2 84  ? -44.692 34.793 -36.067 1.00 15.36  ? 84  ALA T CB  1 
ATOM   4865 N  N   A ARG F  2 85  ? -44.944 34.370 -39.206 0.50 16.14  ? 85  ARG T N   1 
ATOM   4866 N  N   B ARG F  2 85  ? -44.953 34.360 -39.199 0.50 16.70  ? 85  ARG T N   1 
ATOM   4867 C  CA  A ARG F  2 85  ? -44.840 33.505 -40.366 0.50 17.11  ? 85  ARG T CA  1 
ATOM   4868 C  CA  B ARG F  2 85  ? -44.834 33.485 -40.350 0.50 18.14  ? 85  ARG T CA  1 
ATOM   4869 C  C   A ARG F  2 85  ? -43.916 34.084 -41.432 0.50 16.86  ? 85  ARG T C   1 
ATOM   4870 C  C   B ARG F  2 85  ? -43.911 34.081 -41.423 0.50 17.40  ? 85  ARG T C   1 
ATOM   4871 O  O   A ARG F  2 85  ? -43.146 33.364 -42.087 0.50 16.75  ? 85  ARG T O   1 
ATOM   4872 O  O   B ARG F  2 85  ? -43.143 33.364 -42.080 0.50 17.20  ? 85  ARG T O   1 
ATOM   4873 C  CB  A ARG F  2 85  ? -46.216 33.286 -40.968 0.50 18.23  ? 85  ARG T CB  1 
ATOM   4874 C  CB  B ARG F  2 85  ? -46.182 33.174 -41.002 0.50 20.35  ? 85  ARG T CB  1 
ATOM   4875 C  CG  A ARG F  2 85  ? -47.078 32.451 -40.067 0.50 19.19  ? 85  ARG T CG  1 
ATOM   4876 C  CG  B ARG F  2 85  ? -45.936 32.437 -42.311 0.50 23.00  ? 85  ARG T CG  1 
ATOM   4877 C  CD  A ARG F  2 85  ? -48.436 32.334 -40.728 0.50 20.80  ? 85  ARG T CD  1 
ATOM   4878 C  CD  B ARG F  2 85  ? -47.049 31.487 -42.673 0.50 26.08  ? 85  ARG T CD  1 
ATOM   4879 N  NE  A ARG F  2 85  ? -49.371 31.844 -39.761 0.50 21.98  ? 85  ARG T NE  1 
ATOM   4880 N  NE  B ARG F  2 85  ? -48.327 32.198 -42.725 0.50 27.45  ? 85  ARG T NE  1 
ATOM   4881 C  CZ  A ARG F  2 85  ? -50.655 31.717 -40.011 0.50 22.84  ? 85  ARG T CZ  1 
ATOM   4882 C  CZ  B ARG F  2 85  ? -48.741 32.859 -43.800 0.50 29.83  ? 85  ARG T CZ  1 
ATOM   4883 N  NH1 A ARG F  2 85  ? -51.440 31.262 -39.082 0.50 23.44  ? 85  ARG T NH1 1 
ATOM   4884 N  NH1 B ARG F  2 85  ? -49.932 33.456 -43.802 0.50 31.36  ? 85  ARG T NH1 1 
ATOM   4885 N  NH2 A ARG F  2 85  ? -51.138 32.073 -41.189 0.50 23.76  ? 85  ARG T NH2 1 
ATOM   4886 N  NH2 B ARG F  2 85  ? -47.942 32.940 -44.854 0.50 30.06  ? 85  ARG T NH2 1 
ATOM   4887 N  N   . LEU F  2 86  ? -43.981 35.397 -41.612 1.00 16.58  ? 86  LEU T N   1 
ATOM   4888 C  CA  . LEU F  2 86  ? -43.146 36.026 -42.654 1.00 16.77  ? 86  LEU T CA  1 
ATOM   4889 C  C   . LEU F  2 86  ? -41.697 36.112 -42.199 1.00 15.88  ? 86  LEU T C   1 
ATOM   4890 O  O   . LEU F  2 86  ? -40.778 36.031 -43.010 1.00 16.62  ? 86  LEU T O   1 
ATOM   4891 C  CB  . LEU F  2 86  ? -43.657 37.440 -42.927 1.00 16.94  ? 86  LEU T CB  1 
ATOM   4892 C  CG  . LEU F  2 86  ? -44.937 37.409 -43.760 1.00 17.84  ? 86  LEU T CG  1 
ATOM   4893 C  CD1 . LEU F  2 86  ? -45.443 38.818 -44.030 1.00 18.61  ? 86  LEU T CD1 1 
ATOM   4894 C  CD2 . LEU F  2 86  ? -44.889 36.626 -45.052 1.00 19.54  ? 86  LEU T CD2 1 
ATOM   4895 N  N   . THR F  2 87  ? -41.471 36.291 -40.913 1.00 15.48  ? 87  THR T N   1 
ATOM   4896 C  CA  . THR F  2 87  ? -40.122 36.315 -40.421 1.00 14.80  ? 87  THR T CA  1 
ATOM   4897 C  C   . THR F  2 87  ? -39.509 34.915 -40.600 1.00 15.32  ? 87  THR T C   1 
ATOM   4898 O  O   . THR F  2 87  ? -38.375 34.769 -41.040 1.00 15.37  ? 87  THR T O   1 
ATOM   4899 C  CB  . THR F  2 87  ? -40.146 36.696 -38.927 1.00 14.32  ? 87  THR T CB  1 
ATOM   4900 O  OG1 . THR F  2 87  ? -40.734 38.012 -38.768 1.00 14.71  ? 87  THR T OG1 1 
ATOM   4901 C  CG2 . THR F  2 87  ? -38.710 36.741 -38.251 1.00 14.40  ? 87  THR T CG2 1 
ATOM   4902 N  N   . TRP F  2 88  ? -40.288 33.899 -40.228 1.00 16.08  ? 88  TRP T N   1 
ATOM   4903 C  CA  . TRP F  2 88  ? -39.874 32.512 -40.486 1.00 16.72  ? 88  TRP T CA  1 
ATOM   4904 C  C   . TRP F  2 88  ? -39.537 32.320 -41.946 1.00 16.73  ? 88  TRP T C   1 
ATOM   4905 O  O   . TRP F  2 88  ? -38.465 31.769 -42.298 1.00 17.24  ? 88  TRP T O   1 
ATOM   4906 C  CB  . TRP F  2 88  ? -40.972 31.600 -40.021 1.00 18.56  ? 88  TRP T CB  1 
ATOM   4907 C  CG  . TRP F  2 88  ? -40.727 30.156 -40.384 1.00 20.91  ? 88  TRP T CG  1 
ATOM   4908 C  CD1 . TRP F  2 88  ? -41.251 29.420 -41.465 1.00 22.82  ? 88  TRP T CD1 1 
ATOM   4909 C  CD2 . TRP F  2 88  ? -39.812 29.270 -39.708 1.00 22.66  ? 88  TRP T CD2 1 
ATOM   4910 N  NE1 . TRP F  2 88  ? -40.749 28.119 -41.440 1.00 24.52  ? 88  TRP T NE1 1 
ATOM   4911 C  CE2 . TRP F  2 88  ? -39.879 27.980 -40.405 1.00 23.67  ? 88  TRP T CE2 1 
ATOM   4912 C  CE3 . TRP F  2 88  ? -38.995 29.394 -38.583 1.00 23.82  ? 88  TRP T CE3 1 
ATOM   4913 C  CZ2 . TRP F  2 88  ? -39.111 26.865 -39.974 1.00 26.66  ? 88  TRP T CZ2 1 
ATOM   4914 C  CZ3 . TRP F  2 88  ? -38.188 28.299 -38.188 1.00 24.81  ? 88  TRP T CZ3 1 
ATOM   4915 C  CH2 . TRP F  2 88  ? -38.270 27.059 -38.870 1.00 26.45  ? 88  TRP T CH2 1 
ATOM   4916 N  N   . ALA F  2 89  ? -40.458 32.708 -42.822 1.00 16.68  ? 89  ALA T N   1 
ATOM   4917 C  CA  . ALA F  2 89  ? -40.272 32.490 -44.244 1.00 17.07  ? 89  ALA T CA  1 
ATOM   4918 C  C   . ALA F  2 89  ? -39.048 33.184 -44.791 1.00 17.03  ? 89  ALA T C   1 
ATOM   4919 O  O   . ALA F  2 89  ? -38.331 32.659 -45.659 1.00 18.12  ? 89  ALA T O   1 
ATOM   4920 C  CB  . ALA F  2 89  ? -41.550 32.884 -45.066 1.00 18.09  ? 89  ALA T CB  1 
ATOM   4921 N  N   . SER F  2 90  ? -38.803 34.397 -44.315 1.00 15.99  ? 90  SER T N   1 
ATOM   4922 C  CA  . SER F  2 90  ? -37.609 35.080 -44.746 1.00 16.09  ? 90  SER T CA  1 
ATOM   4923 C  C   . SER F  2 90  ? -36.313 34.349 -44.291 1.00 15.91  ? 90  SER T C   1 
ATOM   4924 O  O   . SER F  2 90  ? -35.400 34.132 -45.101 1.00 16.06  ? 90  SER T O   1 
ATOM   4925 C  CB  . SER F  2 90  ? -37.694 36.516 -44.330 1.00 16.08  ? 90  SER T CB  1 
ATOM   4926 O  OG  . SER F  2 90  ? -36.622 37.250 -44.816 1.00 16.96  ? 90  SER T OG  1 
ATOM   4927 N  N   . HIS F  2 91  ? -36.259 33.902 -43.064 1.00 15.05  ? 91  HIS T N   1 
ATOM   4928 C  CA  . HIS F  2 91  ? -35.100 33.127 -42.590 1.00 15.39  ? 91  HIS T CA  1 
ATOM   4929 C  C   . HIS F  2 91  ? -34.942 31.811 -43.343 1.00 16.31  ? 91  HIS T C   1 
ATOM   4930 O  O   . HIS F  2 91  ? -33.822 31.446 -43.762 1.00 16.31  ? 91  HIS T O   1 
ATOM   4931 C  CB  . HIS F  2 91  ? -35.255 32.824 -41.126 1.00 14.50  ? 91  HIS T CB  1 
ATOM   4932 C  CG  . HIS F  2 91  ? -34.031 32.190 -40.498 1.00 14.81  ? 91  HIS T CG  1 
ATOM   4933 N  ND1 . HIS F  2 91  ? -34.103 31.040 -39.767 1.00 15.09  ? 91  HIS T ND1 1 
ATOM   4934 C  CD2 . HIS F  2 91  ? -32.664 32.550 -40.549 1.00 14.72  ? 91  HIS T CD2 1 
ATOM   4935 C  CE1 . HIS F  2 91  ? -32.832 30.718 -39.341 1.00 15.34  ? 91  HIS T CE1 1 
ATOM   4936 N  NE2 . HIS F  2 91  ? -31.967 31.605 -39.840 1.00 14.90  ? 91  HIS T NE2 1 
ATOM   4937 N  N   . GLU F  2 92  ? -36.061 31.141 -43.625 1.00 17.72  ? 92  GLU T N   1 
ATOM   4938 C  CA  . GLU F  2 92  ? -36.004 29.944 -44.480 1.00 19.15  ? 92  GLU T CA  1 
ATOM   4939 C  C   . GLU F  2 92  ? -35.378 30.243 -45.848 1.00 19.76  ? 92  GLU T C   1 
ATOM   4940 O  O   . GLU F  2 92  ? -34.575 29.467 -46.289 1.00 20.04  ? 92  GLU T O   1 
ATOM   4941 C  CB  . GLU F  2 92  ? -37.359 29.311 -44.732 1.00 21.09  ? 92  GLU T CB  1 
ATOM   4942 C  CG  . GLU F  2 92  ? -38.014 28.767 -43.498 1.00 21.90  ? 92  GLU T CG  1 
ATOM   4943 C  CD  . GLU F  2 92  ? -37.308 27.562 -42.987 1.00 25.24  ? 92  GLU T CD  1 
ATOM   4944 O  OE1 . GLU F  2 92  ? -37.468 26.474 -43.610 1.00 26.74  ? 92  GLU T OE1 1 
ATOM   4945 O  OE2 . GLU F  2 92  ? -36.616 27.703 -41.946 1.00 26.86  ? 92  GLU T OE2 1 
ATOM   4946 N  N   . LYS F  2 93  ? -35.693 31.392 -46.475 1.00 19.60  ? 93  LYS T N   1 
ATOM   4947 C  CA  . LYS F  2 93  ? -35.134 31.705 -47.797 1.00 21.59  ? 93  LYS T CA  1 
ATOM   4948 C  C   . LYS F  2 93  ? -33.642 31.961 -47.677 1.00 20.70  ? 93  LYS T C   1 
ATOM   4949 O  O   . LYS F  2 93  ? -32.879 31.624 -48.626 1.00 22.04  ? 93  LYS T O   1 
ATOM   4950 C  CB  . LYS F  2 93  ? -35.861 32.904 -48.405 1.00 22.83  ? 93  LYS T CB  1 
ATOM   4951 C  CG  . LYS F  2 93  ? -35.622 33.048 -49.874 1.00 25.68  ? 93  LYS T CG  1 
ATOM   4952 C  CD  . LYS F  2 93  ? -35.852 34.471 -50.262 1.00 27.42  ? 93  LYS T CD  1 
ATOM   4953 C  CE  . LYS F  2 93  ? -35.931 34.635 -51.750 1.00 29.23  ? 93  LYS T CE  1 
ATOM   4954 N  NZ  . LYS F  2 93  ? -34.797 35.574 -52.048 1.00 30.34  ? 93  LYS T NZ  1 
ATOM   4955 N  N   . MET F  2 94  ? -33.238 32.511 -46.532 1.00 19.80  ? 94  MET T N   1 
ATOM   4956 C  CA  . MET F  2 94  ? -31.838 32.822 -46.289 1.00 19.12  ? 94  MET T CA  1 
ATOM   4957 C  C   . MET F  2 94  ? -30.998 31.557 -46.291 1.00 18.89  ? 94  MET T C   1 
ATOM   4958 O  O   . MET F  2 94  ? -29.788 31.604 -46.607 1.00 19.75  ? 94  MET T O   1 
ATOM   4959 C  CB  . MET F  2 94  ? -31.667 33.582 -45.001 1.00 19.13  ? 94  MET T CB  1 
ATOM   4960 C  CG  . MET F  2 94  ? -32.333 34.977 -45.022 1.00 18.54  ? 94  MET T CG  1 
ATOM   4961 S  SD  . MET F  2 94  ? -32.065 35.785 -43.432 1.00 18.09  ? 94  MET T SD  1 
ATOM   4962 C  CE  . MET F  2 94  ? -32.919 37.321 -43.733 1.00 20.50  ? 94  MET T CE  1 
ATOM   4963 N  N   . HIS F  2 95  ? -31.634 30.429 -46.014 1.00 18.44  ? 95  HIS T N   1 
ATOM   4964 C  CA  . HIS F  2 95  ? -30.945 29.131 -45.973 1.00 19.23  ? 95  HIS T CA  1 
ATOM   4965 C  C   . HIS F  2 95  ? -31.369 28.152 -47.026 1.00 21.01  ? 95  HIS T C   1 
ATOM   4966 O  O   . HIS F  2 95  ? -31.011 26.961 -46.968 1.00 21.07  ? 95  HIS T O   1 
ATOM   4967 C  CB  . HIS F  2 95  ? -31.182 28.492 -44.599 1.00 18.00  ? 95  HIS T CB  1 
ATOM   4968 C  CG  . HIS F  2 95  ? -30.380 29.131 -43.465 1.00 17.32  ? 95  HIS T CG  1 
ATOM   4969 N  ND1 . HIS F  2 95  ? -29.043 28.986 -43.349 1.00 17.01  ? 95  HIS T ND1 1 
ATOM   4970 C  CD2 . HIS F  2 95  ? -30.778 29.958 -42.444 1.00 16.31  ? 95  HIS T CD2 1 
ATOM   4971 C  CE1 . HIS F  2 95  ? -28.618 29.658 -42.247 1.00 16.68  ? 95  HIS T CE1 1 
ATOM   4972 N  NE2 . HIS F  2 95  ? -29.685 30.232 -41.682 1.00 16.02  ? 95  HIS T NE2 1 
ATOM   4973 N  N   . GLU F  2 96  ? -32.087 28.621 -48.054 1.00 22.98  ? 96  GLU T N   1 
ATOM   4974 C  CA  . GLU F  2 96  ? -32.566 27.717 -49.093 1.00 25.30  ? 96  GLU T CA  1 
ATOM   4975 C  C   . GLU F  2 96  ? -31.360 27.229 -49.890 1.00 25.42  ? 96  GLU T C   1 
ATOM   4976 O  O   . GLU F  2 96  ? -30.572 28.022 -50.362 1.00 24.69  ? 96  GLU T O   1 
ATOM   4977 C  CB  . GLU F  2 96  ? -33.601 28.432 -49.958 1.00 28.62  ? 96  GLU T CB  1 
ATOM   4978 C  CG  . GLU F  2 96  ? -33.936 27.783 -51.282 1.00 33.80  ? 96  GLU T CG  1 
ATOM   4979 C  CD  . GLU F  2 96  ? -34.405 26.347 -51.166 1.00 38.03  ? 96  GLU T CD  1 
ATOM   4980 O  OE1 . GLU F  2 96  ? -35.189 26.071 -50.203 1.00 43.60  ? 96  GLU T OE1 1 
ATOM   4981 O  OE2 . GLU F  2 96  ? -34.007 25.515 -52.036 1.00 40.17  ? 96  GLU T OE2 1 
ATOM   4982 N  N   . GLY F  2 97  ? -31.210 25.920 -50.007 1.00 25.61  ? 97  GLY T N   1 
ATOM   4983 C  CA  . GLY F  2 97  ? -30.095 25.345 -50.729 1.00 27.11  ? 97  GLY T CA  1 
ATOM   4984 C  C   . GLY F  2 97  ? -28.737 25.470 -50.054 1.00 26.37  ? 97  GLY T C   1 
ATOM   4985 O  O   . GLY F  2 97  ? -27.716 25.253 -50.705 1.00 27.01  ? 97  GLY T O   1 
ATOM   4986 N  N   . ASP F  2 98  ? -28.729 25.806 -48.765 1.00 25.36  ? 98  ASP T N   1 
ATOM   4987 C  CA  . ASP F  2 98  ? -27.490 26.049 -47.988 1.00 24.47  ? 98  ASP T CA  1 
ATOM   4988 C  C   . ASP F  2 98  ? -26.618 24.787 -47.953 1.00 25.76  ? 98  ASP T C   1 
ATOM   4989 O  O   . ASP F  2 98  ? -27.078 23.767 -47.449 1.00 25.56  ? 98  ASP T O   1 
ATOM   4990 C  CB  . ASP F  2 98  ? -27.855 26.449 -46.571 1.00 23.87  ? 98  ASP T CB  1 
ATOM   4991 C  CG  . ASP F  2 98  ? -26.684 27.045 -45.793 1.00 23.13  ? 98  ASP T CG  1 
ATOM   4992 O  OD1 . ASP F  2 98  ? -25.517 26.957 -46.240 1.00 22.65  ? 98  ASP T OD1 1 
ATOM   4993 O  OD2 . ASP F  2 98  ? -26.963 27.608 -44.709 1.00 21.61  ? 98  ASP T OD2 1 
ATOM   4994 N  N   . GLU F  2 99  ? -25.379 24.867 -48.475 1.00 26.35  ? 99  GLU T N   1 
ATOM   4995 C  CA  . GLU F  2 99  ? -24.402 23.755 -48.410 1.00 27.83  ? 99  GLU T CA  1 
ATOM   4996 C  C   . GLU F  2 99  ? -23.397 23.932 -47.262 1.00 26.33  ? 99  GLU T C   1 
ATOM   4997 O  O   . GLU F  2 99  ? -22.499 23.092 -47.082 1.00 26.35  ? 99  GLU T O   1 
ATOM   4998 C  CB  . GLU F  2 99  ? -23.606 23.697 -49.725 1.00 30.46  ? 99  GLU T CB  1 
ATOM   4999 C  CG  . GLU F  2 99  ? -24.445 23.572 -50.975 1.00 34.18  ? 99  GLU T CG  1 
ATOM   5000 C  CD  . GLU F  2 99  ? -23.610 23.542 -52.248 1.00 37.57  ? 99  GLU T CD  1 
ATOM   5001 O  OE1 . GLU F  2 99  ? -22.592 24.265 -52.332 1.00 40.19  ? 99  GLU T OE1 1 
ATOM   5002 O  OE2 . GLU F  2 99  ? -23.960 22.801 -53.190 1.00 42.76  ? 99  GLU T OE2 1 
ATOM   5003 N  N   . GLY F  2 100 ? -23.464 25.064 -46.563 1.00 23.68  ? 100 GLY T N   1 
ATOM   5004 C  CA  . GLY F  2 100 ? -22.410 25.413 -45.656 1.00 23.17  ? 100 GLY T CA  1 
ATOM   5005 C  C   . GLY F  2 100 ? -21.125 25.689 -46.391 1.00 23.26  ? 100 GLY T C   1 
ATOM   5006 O  O   . GLY F  2 100 ? -21.151 25.899 -47.606 1.00 24.40  ? 100 GLY T O   1 
ATOM   5007 N  N   . PRO F  2 101 ? -19.999 25.676 -45.697 1.00 22.79  ? 101 PRO T N   1 
ATOM   5008 C  CA  . PRO F  2 101 ? -19.829 25.450 -44.311 1.00 22.72  ? 101 PRO T CA  1 
ATOM   5009 C  C   . PRO F  2 101 ? -20.242 26.670 -43.541 1.00 22.00  ? 101 PRO T C   1 
ATOM   5010 O  O   . PRO F  2 101 ? -20.494 27.759 -44.104 1.00 22.13  ? 101 PRO T O   1 
ATOM   5011 C  CB  . PRO F  2 101 ? -18.310 25.222 -44.179 1.00 23.79  ? 101 PRO T CB  1 
ATOM   5012 C  CG  . PRO F  2 101 ? -17.769 26.132 -45.167 1.00 23.38  ? 101 PRO T CG  1 
ATOM   5013 C  CD  . PRO F  2 101 ? -18.723 26.050 -46.332 1.00 23.72  ? 101 PRO T CD  1 
ATOM   5014 N  N   . GLY F  2 102 ? -20.385 26.438 -42.255 1.00 22.16  ? 102 GLY T N   1 
ATOM   5015 C  CA  . GLY F  2 102 ? -20.649 27.493 -41.340 1.00 21.20  ? 102 GLY T CA  1 
ATOM   5016 C  C   . GLY F  2 102 ? -22.060 28.006 -41.450 1.00 20.04  ? 102 GLY T C   1 
ATOM   5017 O  O   . GLY F  2 102 ? -22.966 27.319 -41.987 1.00 20.14  ? 102 GLY T O   1 
ATOM   5018 N  N   . HIS F  2 103 ? -22.211 29.227 -40.942 1.00 19.05  ? 103 HIS T N   1 
ATOM   5019 C  CA  . HIS F  2 103 ? -23.508 29.889 -40.953 1.00 18.16  ? 103 HIS T CA  1 
ATOM   5020 C  C   . HIS F  2 103 ? -23.460 31.155 -41.780 1.00 18.53  ? 103 HIS T C   1 
ATOM   5021 O  O   . HIS F  2 103 ? -22.760 32.104 -41.409 1.00 18.69  ? 103 HIS T O   1 
ATOM   5022 C  CB  . HIS F  2 103 ? -23.946 30.264 -39.558 1.00 17.56  ? 103 HIS T CB  1 
ATOM   5023 C  CG  . HIS F  2 103 ? -25.238 30.962 -39.576 1.00 16.37  ? 103 HIS T CG  1 
ATOM   5024 N  ND1 . HIS F  2 103 ? -25.323 32.297 -39.796 1.00 16.13  ? 103 HIS T ND1 1 
ATOM   5025 C  CD2 . HIS F  2 103 ? -26.524 30.476 -39.520 1.00 16.07  ? 103 HIS T CD2 1 
ATOM   5026 C  CE1 . HIS F  2 103 ? -26.630 32.631 -39.849 1.00 15.91  ? 103 HIS T CE1 1 
ATOM   5027 N  NE2 . HIS F  2 103 ? -27.362 31.512 -39.704 1.00 15.49  ? 103 HIS T NE2 1 
ATOM   5028 N  N   . HIS F  2 104 ? -24.196 31.174 -42.883 1.00 19.30  ? 104 HIS T N   1 
ATOM   5029 C  CA  . HIS F  2 104 ? -24.289 32.334 -43.741 1.00 20.35  ? 104 HIS T CA  1 
ATOM   5030 C  C   . HIS F  2 104 ? -25.690 32.475 -44.286 1.00 20.79  ? 104 HIS T C   1 
ATOM   5031 O  O   . HIS F  2 104 ? -26.352 31.469 -44.578 1.00 22.76  ? 104 HIS T O   1 
ATOM   5032 C  CB  . HIS F  2 104 ? -23.295 32.243 -44.885 1.00 22.11  ? 104 HIS T CB  1 
ATOM   5033 C  CG  . HIS F  2 104 ? -21.882 32.313 -44.406 1.00 22.93  ? 104 HIS T CG  1 
ATOM   5034 N  ND1 . HIS F  2 104 ? -21.137 31.220 -44.216 1.00 25.03  ? 104 HIS T ND1 1 
ATOM   5035 C  CD2 . HIS F  2 104 ? -21.152 33.380 -43.926 1.00 23.42  ? 104 HIS T CD2 1 
ATOM   5036 C  CE1 . HIS F  2 104 ? -19.953 31.577 -43.682 1.00 23.67  ? 104 HIS T CE1 1 
ATOM   5037 N  NE2 . HIS F  2 104 ? -19.953 32.891 -43.533 1.00 25.77  ? 104 HIS T NE2 1 
ATOM   5038 N  N   . HIS F  2 105 ? -26.167 33.708 -44.361 1.00 19.40  ? 105 HIS T N   1 
ATOM   5039 C  CA  . HIS F  2 105 ? -27.477 33.974 -44.945 1.00 18.31  ? 105 HIS T CA  1 
ATOM   5040 C  C   . HIS F  2 105 ? -27.384 34.443 -46.384 1.00 19.59  ? 105 HIS T C   1 
ATOM   5041 O  O   . HIS F  2 105 ? -26.661 35.375 -46.712 1.00 20.03  ? 105 HIS T O   1 
ATOM   5042 C  CB  . HIS F  2 105 ? -28.216 35.023 -44.149 1.00 17.61  ? 105 HIS T CB  1 
ATOM   5043 C  CG  . HIS F  2 105 ? -28.694 34.553 -42.834 1.00 16.45  ? 105 HIS T CG  1 
ATOM   5044 N  ND1 . HIS F  2 105 ? -29.027 35.393 -41.838 1.00 16.32  ? 105 HIS T ND1 1 
ATOM   5045 C  CD2 . HIS F  2 105 ? -28.922 33.259 -42.375 1.00 16.22  ? 105 HIS T CD2 1 
ATOM   5046 C  CE1 . HIS F  2 105 ? -29.417 34.638 -40.742 1.00 16.10  ? 105 HIS T CE1 1 
ATOM   5047 N  NE2 . HIS F  2 105 ? -29.384 33.351 -41.091 1.00 15.76  ? 105 HIS T NE2 1 
ATOM   5048 N  N   . LYS F  2 106 ? -28.193 33.860 -47.228 1.00 19.80  ? 106 LYS T N   1 
ATOM   5049 C  CA  . LYS F  2 106 ? -28.439 34.428 -48.518 1.00 21.25  ? 106 LYS T CA  1 
ATOM   5050 C  C   . LYS F  2 106 ? -29.484 35.554 -48.291 1.00 20.62  ? 106 LYS T C   1 
ATOM   5051 O  O   . LYS F  2 106 ? -30.069 35.719 -47.195 1.00 19.21  ? 106 LYS T O   1 
ATOM   5052 C  CB  . LYS F  2 106 ? -29.022 33.340 -49.448 1.00 22.66  ? 106 LYS T CB  1 
ATOM   5053 C  CG  . LYS F  2 106 ? -28.152 32.080 -49.616 1.00 24.10  ? 106 LYS T CG  1 
ATOM   5054 C  CD  . LYS F  2 106 ? -28.839 31.009 -50.474 1.00 26.01  ? 106 LYS T CD  1 
ATOM   5055 C  CE  . LYS F  2 106 ? -27.949 29.798 -50.801 1.00 27.42  ? 106 LYS T CE  1 
ATOM   5056 N  NZ  . LYS F  2 106 ? -28.613 29.005 -51.905 1.00 30.03  ? 106 LYS T NZ  1 
ATOM   5057 N  N   . PRO F  2 107 ? -29.786 36.310 -49.337 1.00 21.25  ? 107 PRO T N   1 
ATOM   5058 C  CA  . PRO F  2 107 ? -30.867 37.277 -49.198 1.00 21.28  ? 107 PRO T CA  1 
ATOM   5059 C  C   . PRO F  2 107 ? -32.208 36.654 -48.741 1.00 20.79  ? 107 PRO T C   1 
ATOM   5060 O  O   . PRO F  2 107 ? -32.521 35.487 -49.039 1.00 21.31  ? 107 PRO T O   1 
ATOM   5061 C  CB  . PRO F  2 107 ? -30.997 37.843 -50.626 1.00 22.79  ? 107 PRO T CB  1 
ATOM   5062 C  CG  . PRO F  2 107 ? -29.755 37.498 -51.349 1.00 23.80  ? 107 PRO T CG  1 
ATOM   5063 C  CD  . PRO F  2 107 ? -29.303 36.211 -50.717 1.00 22.83  ? 107 PRO T CD  1 
ATOM   5064 N  N   . GLY F  2 108 ? -32.974 37.416 -47.966 1.00 20.42  ? 108 GLY T N   1 
ATOM   5065 C  CA  . GLY F  2 108 ? -34.266 36.963 -47.472 1.00 19.82  ? 108 GLY T CA  1 
ATOM   5066 C  C   . GLY F  2 108 ? -35.432 37.184 -48.437 1.00 20.58  ? 108 GLY T C   1 
ATOM   5067 O  O   . GLY F  2 108 ? -35.280 37.351 -49.631 1.00 21.61  ? 108 GLY T O   1 
ATOM   5068 N  N   . LEU F  2 109 ? -36.629 37.112 -47.905 1.00 20.66  ? 109 LEU T N   1 
ATOM   5069 C  CA  . LEU F  2 109 ? -37.837 37.370 -48.644 1.00 22.72  ? 109 LEU T CA  1 
ATOM   5070 C  C   . LEU F  2 109 ? -37.805 38.730 -49.323 1.00 23.73  ? 109 LEU T C   1 
ATOM   5071 O  O   . LEU F  2 109 ? -37.303 39.693 -48.770 1.00 22.82  ? 109 LEU T O   1 
ATOM   5072 C  CB  . LEU F  2 109 ? -39.047 37.335 -47.724 1.00 23.12  ? 109 LEU T CB  1 
ATOM   5073 C  CG  . LEU F  2 109 ? -40.011 36.152 -47.749 1.00 24.39  ? 109 LEU T CG  1 
ATOM   5074 C  CD1 . LEU F  2 109 ? -41.184 36.462 -46.823 1.00 23.62  ? 109 LEU T CD1 1 
ATOM   5075 C  CD2 . LEU F  2 109 ? -40.461 35.670 -49.133 1.00 27.75  ? 109 LEU T CD2 1 
ATOM   5076 N  N   . GLY F  2 110 ? -38.335 38.801 -50.530 1.00 25.87  ? 110 GLY T N   1 
ATOM   5077 C  CA  . GLY F  2 110 ? -38.496 40.083 -51.150 1.00 28.59  ? 110 GLY T CA  1 
ATOM   5078 C  C   . GLY F  2 110 ? -37.235 40.606 -51.803 1.00 31.00  ? 110 GLY T C   1 
ATOM   5079 O  O   . GLY F  2 110 ? -37.285 41.677 -52.396 1.00 32.28  ? 110 GLY T O   1 
ATOM   5080 N  N   . GLU F  2 111 ? -36.135 39.845 -51.725 1.00 32.37  ? 111 GLU T N   1 
ATOM   5081 C  CA  . GLU F  2 111 ? -34.858 40.173 -52.349 1.00 36.09  ? 111 GLU T CA  1 
ATOM   5082 C  C   . GLU F  2 111 ? -34.472 39.004 -53.291 1.00 40.38  ? 111 GLU T C   1 
ATOM   5083 O  O   . GLU F  2 111 ? -34.437 37.842 -52.868 1.00 38.98  ? 111 GLU T O   1 
ATOM   5084 C  CB  . GLU F  2 111 ? -33.770 40.389 -51.288 1.00 35.77  ? 111 GLU T CB  1 
ATOM   5085 C  CG  . GLU F  2 111 ? -34.183 41.239 -50.102 1.00 35.55  ? 111 GLU T CG  1 
ATOM   5086 C  CD  . GLU F  2 111 ? -33.072 41.344 -49.062 1.00 36.94  ? 111 GLU T CD  1 
ATOM   5087 O  OE1 . GLU F  2 111 ? -32.281 42.299 -49.210 1.00 39.61  ? 111 GLU T OE1 1 
ATOM   5088 O  OE2 . GLU F  2 111 ? -32.975 40.479 -48.128 1.00 33.11  ? 111 GLU T OE2 1 
ATOM   5089 N  N   . GLY F  2 112 ? -34.189 39.329 -54.547 1.00 47.42  ? 112 GLY T N   1 
ATOM   5090 C  CA  . GLY F  2 112 ? -34.043 38.345 -55.654 1.00 49.31  ? 112 GLY T CA  1 
ATOM   5091 C  C   . GLY F  2 112 ? -32.820 37.464 -55.478 1.00 51.83  ? 112 GLY T C   1 
ATOM   5092 O  O   . GLY F  2 112 ? -32.020 37.665 -54.538 1.00 52.24  ? 112 GLY T O   1 
ATOM   5093 N  N   . MET G  1 1   ? -46.025 7.311  -55.628 1.00 47.18  ? 1   MET U N   1 
ATOM   5094 C  CA  . MET G  1 1   ? -46.572 7.074  -54.267 1.00 42.77  ? 1   MET U CA  1 
ATOM   5095 C  C   . MET G  1 1   ? -45.645 7.587  -53.160 1.00 39.16  ? 1   MET U C   1 
ATOM   5096 O  O   . MET G  1 1   ? -44.441 7.399  -53.214 1.00 39.92  ? 1   MET U O   1 
ATOM   5097 C  CB  . MET G  1 1   ? -46.810 5.595  -54.053 1.00 44.24  ? 1   MET U CB  1 
ATOM   5098 C  CG  . MET G  1 1   ? -47.716 5.303  -52.869 1.00 44.12  ? 1   MET U CG  1 
ATOM   5099 S  SD  . MET G  1 1   ? -48.118 3.559  -52.739 1.00 93.63  ? 1   MET U SD  1 
ATOM   5100 C  CE  . MET G  1 1   ? -48.973 3.279  -54.293 1.00 50.45  ? 1   MET U CE  1 
ATOM   5101 N  N   . LEU G  1 2   ? -46.235 8.246  -52.170 1.00 34.65  ? 2   LEU U N   1 
ATOM   5102 C  CA  . LEU G  1 2   ? -45.492 8.739  -51.002 1.00 31.97  ? 2   LEU U CA  1 
ATOM   5103 C  C   . LEU G  1 2   ? -45.096 7.564  -50.120 1.00 30.19  ? 2   LEU U C   1 
ATOM   5104 O  O   . LEU G  1 2   ? -45.773 6.514  -50.131 1.00 32.59  ? 2   LEU U O   1 
ATOM   5105 C  CB  . LEU G  1 2   ? -46.383 9.700  -50.203 1.00 31.47  ? 2   LEU U CB  1 
ATOM   5106 C  CG  . LEU G  1 2   ? -46.286 11.212 -50.306 1.00 32.88  ? 2   LEU U CG  1 
ATOM   5107 C  CD1 . LEU G  1 2   ? -45.624 11.815 -51.526 1.00 31.69  ? 2   LEU U CD1 1 
ATOM   5108 C  CD2 . LEU G  1 2   ? -47.648 11.818 -49.960 1.00 31.67  ? 2   LEU U CD2 1 
ATOM   5109 N  N   . THR G  1 3   ? -44.029 7.745  -49.335 1.00 27.58  ? 3   THR U N   1 
ATOM   5110 C  CA  . THR G  1 3   ? -43.548 6.710  -48.426 1.00 26.96  ? 3   THR U CA  1 
ATOM   5111 C  C   . THR G  1 3   ? -44.465 6.627  -47.207 1.00 25.76  ? 3   THR U C   1 
ATOM   5112 O  O   . THR G  1 3   ? -45.290 7.489  -46.997 1.00 26.32  ? 3   THR U O   1 
ATOM   5113 C  CB  . THR G  1 3   ? -42.110 6.988  -47.927 1.00 25.52  ? 3   THR U CB  1 
ATOM   5114 O  OG1 . THR G  1 3   ? -42.118 8.173  -47.116 1.00 23.85  ? 3   THR U OG1 1 
ATOM   5115 C  CG2 . THR G  1 3   ? -41.123 7.195  -49.118 1.00 27.20  ? 3   THR U CG2 1 
ATOM   5116 N  N   . GLU G  1 4   ? -44.317 5.581  -46.392 1.00 26.60  ? 4   GLU U N   1 
ATOM   5117 C  CA  . GLU G  1 4   ? -45.123 5.487  -45.167 1.00 26.56  ? 4   GLU U CA  1 
ATOM   5118 C  C   . GLU G  1 4   ? -44.877 6.670  -44.268 1.00 24.92  ? 4   GLU U C   1 
ATOM   5119 O  O   . GLU G  1 4   ? -45.792 7.167  -43.655 1.00 23.94  ? 4   GLU U O   1 
ATOM   5120 C  CB  . GLU G  1 4   ? -44.857 4.207  -44.343 1.00 28.89  ? 4   GLU U CB  1 
ATOM   5121 C  CG  . GLU G  1 4   ? -45.636 2.978  -44.673 1.00 33.24  ? 4   GLU U CG  1 
ATOM   5122 C  CD  . GLU G  1 4   ? -47.119 3.078  -44.379 1.00 33.54  ? 4   GLU U CD  1 
ATOM   5123 O  OE1 . GLU G  1 4   ? -47.866 3.083  -45.358 1.00 39.46  ? 4   GLU U OE1 1 
ATOM   5124 O  OE2 . GLU G  1 4   ? -47.540 3.173  -43.197 1.00 35.23  ? 4   GLU U OE2 1 
ATOM   5125 N  N   . LEU G  1 5   ? -43.613 7.095  -44.143 1.00 24.01  ? 5   LEU U N   1 
ATOM   5126 C  CA  . LEU G  1 5   ? -43.301 8.237  -43.290 1.00 23.32  ? 5   LEU U CA  1 
ATOM   5127 C  C   . LEU G  1 5   ? -43.999 9.484  -43.795 1.00 22.65  ? 5   LEU U C   1 
ATOM   5128 O  O   . LEU G  1 5   ? -44.641 10.209 -43.059 1.00 22.84  ? 5   LEU U O   1 
ATOM   5129 C  CB  . LEU G  1 5   ? -41.799 8.463  -43.251 1.00 22.92  ? 5   LEU U CB  1 
ATOM   5130 C  CG  . LEU G  1 5   ? -41.179 9.085  -41.955 1.00 24.40  ? 5   LEU U CG  1 
ATOM   5131 C  CD1 . LEU G  1 5   ? -39.911 9.876  -42.232 1.00 22.82  ? 5   LEU U CD1 1 
ATOM   5132 C  CD2 . LEU G  1 5   ? -42.065 9.591  -40.845 1.00 23.18  ? 5   LEU U CD2 1 
ATOM   5133 N  N   . GLU G  1 6   ? -43.850 9.723  -45.093 1.00 23.47  ? 6   GLU U N   1 
ATOM   5134 C  CA  . GLU G  1 6   ? -44.470 10.863 -45.705 1.00 23.09  ? 6   GLU U CA  1 
ATOM   5135 C  C   . GLU G  1 6   ? -45.983 10.845 -45.519 1.00 23.72  ? 6   GLU U C   1 
ATOM   5136 O  O   . GLU G  1 6   ? -46.583 11.883 -45.160 1.00 23.00  ? 6   GLU U O   1 
ATOM   5137 C  CB  . GLU G  1 6   ? -44.035 10.957 -47.154 1.00 24.33  ? 6   GLU U CB  1 
ATOM   5138 C  CG  . GLU G  1 6   ? -42.543 11.221 -47.331 1.00 23.65  ? 6   GLU U CG  1 
ATOM   5139 C  CD  . GLU G  1 6   ? -42.039 11.010 -48.749 1.00 25.25  ? 6   GLU U CD  1 
ATOM   5140 O  OE1 . GLU G  1 6   ? -40.944 11.576 -49.062 1.00 25.94  ? 6   GLU U OE1 1 
ATOM   5141 O  OE2 . GLU G  1 6   ? -42.728 10.307 -49.567 1.00 26.59  ? 6   GLU U OE2 1 
ATOM   5142 N  N   . LYS G  1 7   ? -46.620 9.692  -45.750 1.00 24.76  ? 7   LYS U N   1 
ATOM   5143 C  CA  . LYS G  1 7   ? -48.050 9.494  -45.466 1.00 25.45  ? 7   LYS U CA  1 
ATOM   5144 C  C   . LYS G  1 7   ? -48.424 9.779  -44.021 1.00 24.66  ? 7   LYS U C   1 
ATOM   5145 O  O   . LYS G  1 7   ? -49.474 10.391 -43.768 1.00 24.80  ? 7   LYS U O   1 
ATOM   5146 C  CB  . LYS G  1 7   ? -48.481 8.052  -45.822 1.00 27.36  ? 7   LYS U CB  1 
ATOM   5147 C  CG  . LYS G  1 7   ? -48.508 7.777  -47.314 1.00 30.14  ? 7   LYS U CG  1 
ATOM   5148 C  CD  . LYS G  1 7   ? -48.861 6.313  -47.625 1.00 32.88  ? 7   LYS U CD  1 
ATOM   5149 C  CE  . LYS G  1 7   ? -49.100 6.098  -49.117 1.00 35.19  ? 7   LYS U CE  1 
ATOM   5150 N  NZ  . LYS G  1 7   ? -49.379 4.676  -49.491 1.00 38.27  ? 7   LYS U NZ  1 
ATOM   5151 N  N   . ALA G  1 8   ? -47.537 9.430  -43.066 1.00 23.45  ? 8   ALA U N   1 
ATOM   5152 C  CA  . ALA G  1 8   ? -47.833 9.694  -41.645 1.00 22.32  ? 8   ALA U CA  1 
ATOM   5153 C  C   . ALA G  1 8   ? -47.830 11.219 -41.356 1.00 21.82  ? 8   ALA U C   1 
ATOM   5154 O  O   . ALA G  1 8   ? -48.638 11.702 -40.570 1.00 21.81  ? 8   ALA U O   1 
ATOM   5155 C  CB  . ALA G  1 8   ? -46.840 8.999  -40.716 1.00 22.51  ? 8   ALA U CB  1 
ATOM   5156 N  N   . LEU G  1 9   ? -46.925 11.953 -41.991 1.00 21.33  ? 9   LEU U N   1 
ATOM   5157 C  CA  . LEU G  1 9   ? -46.841 13.389 -41.748 1.00 21.02  ? 9   LEU U CA  1 
ATOM   5158 C  C   . LEU G  1 9   ? -48.109 14.068 -42.358 1.00 21.29  ? 9   LEU U C   1 
ATOM   5159 O  O   . LEU G  1 9   ? -48.698 14.997 -41.759 1.00 20.57  ? 9   LEU U O   1 
ATOM   5160 C  CB  . LEU G  1 9   ? -45.563 13.974 -42.342 1.00 21.16  ? 9   LEU U CB  1 
ATOM   5161 C  CG  . LEU G  1 9   ? -44.244 13.421 -41.762 1.00 21.15  ? 9   LEU U CG  1 
ATOM   5162 C  CD1 . LEU G  1 9   ? -43.075 14.166 -42.326 1.00 21.95  ? 9   LEU U CD1 1 
ATOM   5163 C  CD2 . LEU G  1 9   ? -44.278 13.405 -40.245 1.00 19.81  ? 9   LEU U CD2 1 
ATOM   5164 N  N   . ASN G  1 10  ? -48.515 13.620 -43.539 1.00 22.48  ? 10  ASN U N   1 
ATOM   5165 C  CA  . ASN G  1 10  ? -49.727 14.167 -44.147 1.00 23.23  ? 10  ASN U CA  1 
ATOM   5166 C  C   . ASN G  1 10  ? -50.970 13.808 -43.313 1.00 23.72  ? 10  ASN U C   1 
ATOM   5167 O  O   . ASN G  1 10  ? -51.941 14.575 -43.238 1.00 24.69  ? 10  ASN U O   1 
ATOM   5168 C  CB  . ASN G  1 10  ? -49.850 13.699 -45.600 1.00 24.81  ? 10  ASN U CB  1 
ATOM   5169 C  CG  . ASN G  1 10  ? -49.018 14.553 -46.588 1.00 25.28  ? 10  ASN U CG  1 
ATOM   5170 O  OD1 . ASN G  1 10  ? -48.560 15.671 -46.260 1.00 24.92  ? 10  ASN U OD1 1 
ATOM   5171 N  ND2 . ASN G  1 10  ? -48.896 14.067 -47.821 1.00 25.42  ? 10  ASN U ND2 1 
ATOM   5172 N  N   . SER G  1 11  ? -50.963 12.640 -42.683 1.00 25.24  ? 11  SER U N   1 
ATOM   5173 C  CA  . SER G  1 11  ? -52.047 12.231 -41.787 1.00 25.16  ? 11  SER U CA  1 
ATOM   5174 C  C   . SER G  1 11  ? -52.177 13.103 -40.542 1.00 24.92  ? 11  SER U C   1 
ATOM   5175 O  O   . SER G  1 11  ? -53.282 13.367 -40.037 1.00 23.68  ? 11  SER U O   1 
ATOM   5176 C  CB  . SER G  1 11  ? -51.862 10.753 -41.409 1.00 26.70  ? 11  SER U CB  1 
ATOM   5177 O  OG  . SER G  1 11  ? -52.826 10.344 -40.474 1.00 25.82  ? 11  SER U OG  1 
ATOM   5178 N  N   . ILE G  1 12  ? -51.050 13.594 -40.038 1.00 23.45  ? 12  ILE U N   1 
ATOM   5179 C  CA  . ILE G  1 12  ? -51.081 14.559 -38.945 1.00 22.67  ? 12  ILE U CA  1 
ATOM   5180 C  C   . ILE G  1 12  ? -51.840 15.841 -39.363 1.00 22.33  ? 12  ILE U C   1 
ATOM   5181 O  O   . ILE G  1 12  ? -52.621 16.418 -38.606 1.00 21.80  ? 12  ILE U O   1 
ATOM   5182 C  CB  . ILE G  1 12  ? -49.641 14.864 -38.454 1.00 21.64  ? 12  ILE U CB  1 
ATOM   5183 C  CG1 . ILE G  1 12  ? -49.068 13.630 -37.758 1.00 22.36  ? 12  ILE U CG1 1 
ATOM   5184 C  CG2 . ILE G  1 12  ? -49.621 16.101 -37.562 1.00 21.16  ? 12  ILE U CG2 1 
ATOM   5185 C  CD1 . ILE G  1 12  ? -47.541 13.629 -37.698 1.00 21.71  ? 12  ILE U CD1 1 
ATOM   5186 N  N   . ILE G  1 13  ? -51.618 16.301 -40.590 1.00 22.18  ? 13  ILE U N   1 
ATOM   5187 C  CA  . ILE G  1 13  ? -52.412 17.415 -41.130 1.00 21.85  ? 13  ILE U CA  1 
ATOM   5188 C  C   . ILE G  1 13  ? -53.919 17.067 -41.113 1.00 23.39  ? 13  ILE U C   1 
ATOM   5189 O  O   . ILE G  1 13  ? -54.759 17.857 -40.660 1.00 22.46  ? 13  ILE U O   1 
ATOM   5190 C  CB  . ILE G  1 13  ? -51.971 17.738 -42.588 1.00 22.89  ? 13  ILE U CB  1 
ATOM   5191 C  CG1 . ILE G  1 13  ? -50.484 18.139 -42.636 1.00 22.14  ? 13  ILE U CG1 1 
ATOM   5192 C  CG2 . ILE G  1 13  ? -52.858 18.821 -43.178 1.00 23.59  ? 13  ILE U CG2 1 
ATOM   5193 C  CD1 . ILE G  1 13  ? -49.923 18.416 -44.021 1.00 22.48  ? 13  ILE U CD1 1 
ATOM   5194 N  N   A ASP G  1 14  ? -54.266 15.876 -41.600 0.50 24.00  ? 14  ASP U N   1 
ATOM   5195 N  N   B ASP G  1 14  ? -54.246 15.867 -41.598 0.50 23.31  ? 14  ASP U N   1 
ATOM   5196 C  CA  A ASP G  1 14  ? -55.670 15.491 -41.676 0.50 25.75  ? 14  ASP U CA  1 
ATOM   5197 C  CA  B ASP G  1 14  ? -55.628 15.390 -41.689 0.50 24.78  ? 14  ASP U CA  1 
ATOM   5198 C  C   A ASP G  1 14  ? -56.277 15.418 -40.270 0.50 24.89  ? 14  ASP U C   1 
ATOM   5199 C  C   B ASP G  1 14  ? -56.267 15.375 -40.295 0.50 24.32  ? 14  ASP U C   1 
ATOM   5200 O  O   A ASP G  1 14  ? -57.398 15.853 -40.072 0.50 25.88  ? 14  ASP U O   1 
ATOM   5201 O  O   B ASP G  1 14  ? -57.385 15.827 -40.130 0.50 25.34  ? 14  ASP U O   1 
ATOM   5202 C  CB  A ASP G  1 14  ? -55.848 14.165 -42.416 0.50 27.47  ? 14  ASP U CB  1 
ATOM   5203 C  CB  B ASP G  1 14  ? -55.625 14.003 -42.357 0.50 25.61  ? 14  ASP U CB  1 
ATOM   5204 C  CG  A ASP G  1 14  ? -55.446 14.240 -43.891 0.50 29.90  ? 14  ASP U CG  1 
ATOM   5205 C  CG  B ASP G  1 14  ? -57.009 13.391 -42.518 0.50 27.76  ? 14  ASP U CG  1 
ATOM   5206 O  OD1 A ASP G  1 14  ? -55.585 15.313 -44.524 0.50 32.79  ? 14  ASP U OD1 1 
ATOM   5207 O  OD1 B ASP G  1 14  ? -57.890 14.041 -43.081 0.50 28.11  ? 14  ASP U OD1 1 
ATOM   5208 O  OD2 A ASP G  1 14  ? -55.030 13.190 -44.431 0.50 31.46  ? 14  ASP U OD2 1 
ATOM   5209 O  OD2 B ASP G  1 14  ? -57.205 12.209 -42.143 0.50 29.66  ? 14  ASP U OD2 1 
ATOM   5210 N  N   . VAL G  1 15  ? -55.518 14.935 -39.286 1.00 23.98  ? 15  VAL U N   1 
ATOM   5211 C  CA  . VAL G  1 15  ? -56.023 14.874 -37.893 1.00 24.10  ? 15  VAL U CA  1 
ATOM   5212 C  C   . VAL G  1 15  ? -56.407 16.264 -37.420 1.00 24.17  ? 15  VAL U C   1 
ATOM   5213 O  O   . VAL G  1 15  ? -57.522 16.477 -36.913 1.00 24.55  ? 15  VAL U O   1 
ATOM   5214 C  CB  . VAL G  1 15  ? -55.014 14.297 -36.897 1.00 23.90  ? 15  VAL U CB  1 
ATOM   5215 C  CG1 . VAL G  1 15  ? -55.520 14.433 -35.473 1.00 25.01  ? 15  VAL U CG1 1 
ATOM   5216 C  CG2 . VAL G  1 15  ? -54.787 12.792 -37.149 1.00 25.25  ? 15  VAL U CG2 1 
ATOM   5217 N  N   . TYR G  1 16  ? -55.490 17.223 -37.593 1.00 22.92  ? 16  TYR U N   1 
ATOM   5218 C  CA  . TYR G  1 16  ? -55.800 18.599 -37.186 1.00 22.61  ? 16  TYR U CA  1 
ATOM   5219 C  C   . TYR G  1 16  ? -57.145 19.066 -37.790 1.00 23.66  ? 16  TYR U C   1 
ATOM   5220 O  O   . TYR G  1 16  ? -58.001 19.633 -37.093 1.00 24.67  ? 16  TYR U O   1 
ATOM   5221 C  CB  . TYR G  1 16  ? -54.689 19.545 -37.601 1.00 21.59  ? 16  TYR U CB  1 
ATOM   5222 C  CG  . TYR G  1 16  ? -55.017 20.995 -37.284 1.00 20.42  ? 16  TYR U CG  1 
ATOM   5223 C  CD1 . TYR G  1 16  ? -54.960 21.473 -35.978 1.00 20.98  ? 16  TYR U CD1 1 
ATOM   5224 C  CD2 . TYR G  1 16  ? -55.395 21.883 -38.299 1.00 21.28  ? 16  TYR U CD2 1 
ATOM   5225 C  CE1 . TYR G  1 16  ? -55.240 22.808 -35.680 1.00 21.30  ? 16  TYR U CE1 1 
ATOM   5226 C  CE2 . TYR G  1 16  ? -55.704 23.195 -38.000 1.00 21.70  ? 16  TYR U CE2 1 
ATOM   5227 C  CZ  . TYR G  1 16  ? -55.625 23.650 -36.681 1.00 21.02  ? 16  TYR U CZ  1 
ATOM   5228 O  OH  . TYR G  1 16  ? -55.936 24.982 -36.373 1.00 21.29  ? 16  TYR U OH  1 
ATOM   5229 N  N   . HIS G  1 17  ? -57.300 18.864 -39.097 1.00 25.37  ? 17  HIS U N   1 
ATOM   5230 C  CA  . HIS G  1 17  ? -58.473 19.348 -39.818 1.00 24.83  ? 17  HIS U CA  1 
ATOM   5231 C  C   . HIS G  1 17  ? -59.756 18.655 -39.438 1.00 26.97  ? 17  HIS U C   1 
ATOM   5232 O  O   . HIS G  1 17  ? -60.830 19.214 -39.648 1.00 26.97  ? 17  HIS U O   1 
ATOM   5233 C  CB  . HIS G  1 17  ? -58.208 19.309 -41.321 1.00 26.19  ? 17  HIS U CB  1 
ATOM   5234 C  CG  . HIS G  1 17  ? -57.219 20.365 -41.765 1.00 27.52  ? 17  HIS U CG  1 
ATOM   5235 N  ND1 . HIS G  1 17  ? -55.861 20.233 -41.580 1.00 26.63  ? 17  HIS U ND1 1 
ATOM   5236 C  CD2 . HIS G  1 17  ? -57.424 21.615 -42.292 1.00 28.13  ? 17  HIS U CD2 1 
ATOM   5237 C  CE1 . HIS G  1 17  ? -55.249 21.346 -42.031 1.00 28.45  ? 17  HIS U CE1 1 
ATOM   5238 N  NE2 . HIS G  1 17  ? -56.204 22.201 -42.483 1.00 28.00  ? 17  HIS U NE2 1 
ATOM   5239 N  N   . LYS G  1 18  ? -59.699 17.453 -38.839 1.00 27.16  ? 18  LYS U N   1 
ATOM   5240 C  CA  . LYS G  1 18  ? -60.919 16.828 -38.261 1.00 29.42  ? 18  LYS U CA  1 
ATOM   5241 C  C   . LYS G  1 18  ? -61.557 17.702 -37.189 1.00 28.73  ? 18  LYS U C   1 
ATOM   5242 O  O   . LYS G  1 18  ? -62.787 17.663 -36.997 1.00 29.57  ? 18  LYS U O   1 
ATOM   5243 C  CB  . LYS G  1 18  ? -60.638 15.433 -37.681 1.00 31.03  ? 18  LYS U CB  1 
ATOM   5244 C  CG  . LYS G  1 18  ? -60.187 14.520 -38.780 1.00 33.75  ? 18  LYS U CG  1 
ATOM   5245 C  CD  . LYS G  1 18  ? -60.199 13.037 -38.475 1.00 36.19  ? 18  LYS U CD  1 
ATOM   5246 C  CE  . LYS G  1 18  ? -60.124 12.317 -39.821 1.00 39.16  ? 18  LYS U CE  1 
ATOM   5247 N  NZ  . LYS G  1 18  ? -59.866 10.867 -39.728 1.00 41.73  ? 18  LYS U NZ  1 
ATOM   5248 N  N   . TYR G  1 19  ? -60.729 18.506 -36.514 1.00 26.11  ? 19  TYR U N   1 
ATOM   5249 C  CA  . TYR G  1 19  ? -61.234 19.347 -35.440 1.00 27.08  ? 19  TYR U CA  1 
ATOM   5250 C  C   . TYR G  1 19  ? -61.323 20.819 -35.852 1.00 26.00  ? 19  TYR U C   1 
ATOM   5251 O  O   . TYR G  1 19  ? -62.249 21.540 -35.415 1.00 27.25  ? 19  TYR U O   1 
ATOM   5252 C  CB  . TYR G  1 19  ? -60.372 19.144 -34.179 1.00 25.96  ? 19  TYR U CB  1 
ATOM   5253 C  CG  . TYR G  1 19  ? -60.327 17.681 -33.840 1.00 27.39  ? 19  TYR U CG  1 
ATOM   5254 C  CD1 . TYR G  1 19  ? -59.326 16.870 -34.351 1.00 27.60  ? 19  TYR U CD1 1 
ATOM   5255 C  CD2 . TYR G  1 19  ? -61.343 17.089 -33.090 1.00 28.17  ? 19  TYR U CD2 1 
ATOM   5256 C  CE1 . TYR G  1 19  ? -59.298 15.506 -34.090 1.00 28.35  ? 19  TYR U CE1 1 
ATOM   5257 C  CE2 . TYR G  1 19  ? -61.322 15.732 -32.832 1.00 29.18  ? 19  TYR U CE2 1 
ATOM   5258 C  CZ  . TYR G  1 19  ? -60.300 14.952 -33.339 1.00 29.11  ? 19  TYR U CZ  1 
ATOM   5259 O  OH  . TYR G  1 19  ? -60.314 13.609 -33.048 1.00 29.86  ? 19  TYR U OH  1 
ATOM   5260 N  N   . SER G  1 20  ? -60.406 21.271 -36.705 1.00 25.61  ? 20  SER U N   1 
ATOM   5261 C  CA  . SER G  1 20  ? -60.359 22.682 -37.080 1.00 24.49  ? 20  SER U CA  1 
ATOM   5262 C  C   . SER G  1 20  ? -61.500 23.018 -38.041 1.00 25.74  ? 20  SER U C   1 
ATOM   5263 O  O   . SER G  1 20  ? -61.922 24.165 -38.148 1.00 24.89  ? 20  SER U O   1 
ATOM   5264 C  CB  . SER G  1 20  ? -59.024 23.026 -37.703 1.00 24.32  ? 20  SER U CB  1 
ATOM   5265 O  OG  . SER G  1 20  ? -58.907 22.563 -39.043 1.00 23.56  ? 20  SER U OG  1 
ATOM   5266 N  N   . LEU G  1 21  ? -62.042 21.990 -38.676 1.00 26.28  ? 21  LEU U N   1 
ATOM   5267 C  CA  . LEU G  1 21  ? -63.095 22.143 -39.668 1.00 29.69  ? 21  LEU U CA  1 
ATOM   5268 C  C   . LEU G  1 21  ? -64.482 22.016 -39.039 1.00 30.23  ? 21  LEU U C   1 
ATOM   5269 O  O   . LEU G  1 21  ? -65.511 22.158 -39.728 1.00 32.20  ? 21  LEU U O   1 
ATOM   5270 C  CB  . LEU G  1 21  ? -62.864 21.134 -40.774 1.00 31.18  ? 21  LEU U CB  1 
ATOM   5271 C  CG  . LEU G  1 21  ? -62.273 21.553 -42.133 1.00 33.42  ? 21  LEU U CG  1 
ATOM   5272 C  CD1 . LEU G  1 21  ? -61.585 22.902 -42.240 1.00 30.51  ? 21  LEU U CD1 1 
ATOM   5273 C  CD2 . LEU G  1 21  ? -61.518 20.419 -42.822 1.00 31.84  ? 21  LEU U CD2 1 
ATOM   5274 N  N   . ILE G  1 22  ? -64.541 21.816 -37.725 1.00 29.68  ? 22  ILE U N   1 
ATOM   5275 C  CA  . ILE G  1 22  ? -65.838 21.659 -37.051 1.00 30.65  ? 22  ILE U CA  1 
ATOM   5276 C  C   . ILE G  1 22  ? -66.689 22.938 -37.165 1.00 31.24  ? 22  ILE U C   1 
ATOM   5277 O  O   . ILE G  1 22  ? -67.876 22.869 -37.515 1.00 31.49  ? 22  ILE U O   1 
ATOM   5278 C  CB  . ILE G  1 22  ? -65.698 21.290 -35.559 1.00 30.89  ? 22  ILE U CB  1 
ATOM   5279 C  CG1 . ILE G  1 22  ? -65.187 19.833 -35.424 1.00 30.95  ? 22  ILE U CG1 1 
ATOM   5280 C  CG2 . ILE G  1 22  ? -67.023 21.472 -34.843 1.00 32.39  ? 22  ILE U CG2 1 
ATOM   5281 C  CD1 . ILE G  1 22  ? -64.725 19.442 -34.037 1.00 31.15  ? 22  ILE U CD1 1 
ATOM   5282 N  N   . LYS G  1 23  ? -66.079 24.079 -36.899 1.00 30.10  ? 23  LYS U N   1 
ATOM   5283 C  CA  . LYS G  1 23  ? -66.780 25.380 -36.911 1.00 30.84  ? 23  LYS U CA  1 
ATOM   5284 C  C   . LYS G  1 23  ? -65.829 26.549 -37.053 1.00 29.45  ? 23  LYS U C   1 
ATOM   5285 O  O   . LYS G  1 23  ? -64.588 26.413 -36.821 1.00 28.07  ? 23  LYS U O   1 
ATOM   5286 C  CB  . LYS G  1 23  ? -67.600 25.565 -35.634 1.00 32.47  ? 23  LYS U CB  1 
ATOM   5287 C  CG  . LYS G  1 23  ? -66.791 25.625 -34.354 1.00 31.81  ? 23  LYS U CG  1 
ATOM   5288 C  CD  . LYS G  1 23  ? -67.716 25.892 -33.200 1.00 33.86  ? 23  LYS U CD  1 
ATOM   5289 C  CE  . LYS G  1 23  ? -66.972 25.900 -31.899 1.00 33.19  ? 23  LYS U CE  1 
ATOM   5290 N  NZ  . LYS G  1 23  ? -66.479 24.579 -31.456 1.00 34.59  ? 23  LYS U NZ  1 
ATOM   5291 N  N   . GLY G  1 24  ? -66.389 27.689 -37.413 1.00 28.51  ? 24  GLY U N   1 
ATOM   5292 C  CA  . GLY G  1 24  ? -65.619 28.917 -37.432 1.00 27.63  ? 24  GLY U CA  1 
ATOM   5293 C  C   . GLY G  1 24  ? -64.494 28.898 -38.448 1.00 26.77  ? 24  GLY U C   1 
ATOM   5294 O  O   . GLY G  1 24  ? -64.652 28.363 -39.576 1.00 26.80  ? 24  GLY U O   1 
ATOM   5295 N  N   . ASN G  1 25  ? -63.354 29.447 -38.030 1.00 25.22  ? 25  ASN U N   1 
ATOM   5296 C  CA  . ASN G  1 25  ? -62.184 29.567 -38.889 1.00 24.47  ? 25  ASN U CA  1 
ATOM   5297 C  C   . ASN G  1 25  ? -61.624 28.192 -39.178 1.00 23.89  ? 25  ASN U C   1 
ATOM   5298 O  O   . ASN G  1 25  ? -61.535 27.375 -38.292 1.00 23.25  ? 25  ASN U O   1 
ATOM   5299 C  CB  . ASN G  1 25  ? -61.162 30.494 -38.214 1.00 23.79  ? 25  ASN U CB  1 
ATOM   5300 C  CG  . ASN G  1 25  ? -59.819 30.506 -38.904 1.00 23.01  ? 25  ASN U CG  1 
ATOM   5301 O  OD1 . ASN G  1 25  ? -59.087 29.519 -38.884 1.00 22.94  ? 25  ASN U OD1 1 
ATOM   5302 N  ND2 . ASN G  1 25  ? -59.455 31.669 -39.486 1.00 24.34  ? 25  ASN U ND2 1 
ATOM   5303 N  N   . PHE G  1 26  ? -61.229 27.937 -40.436 1.00 24.23  ? 26  PHE U N   1 
ATOM   5304 C  CA  . PHE G  1 26  ? -60.817 26.573 -40.853 1.00 24.47  ? 26  PHE U CA  1 
ATOM   5305 C  C   . PHE G  1 26  ? -59.481 26.105 -40.286 1.00 23.13  ? 26  PHE U C   1 
ATOM   5306 O  O   . PHE G  1 26  ? -59.133 24.905 -40.366 1.00 24.00  ? 26  PHE U O   1 
ATOM   5307 C  CB  . PHE G  1 26  ? -60.824 26.441 -42.395 1.00 25.10  ? 26  PHE U CB  1 
ATOM   5308 C  CG  . PHE G  1 26  ? -60.209 27.621 -43.115 1.00 24.97  ? 26  PHE U CG  1 
ATOM   5309 C  CD1 . PHE G  1 26  ? -58.874 27.949 -42.960 1.00 23.71  ? 26  PHE U CD1 1 
ATOM   5310 C  CD2 . PHE G  1 26  ? -60.961 28.379 -43.985 1.00 26.13  ? 26  PHE U CD2 1 
ATOM   5311 C  CE1 . PHE G  1 26  ? -58.317 29.027 -43.633 1.00 24.15  ? 26  PHE U CE1 1 
ATOM   5312 C  CE2 . PHE G  1 26  ? -60.406 29.458 -44.671 1.00 26.52  ? 26  PHE U CE2 1 
ATOM   5313 C  CZ  . PHE G  1 26  ? -59.091 29.780 -44.507 1.00 25.75  ? 26  PHE U CZ  1 
ATOM   5314 N  N   . HIS G  1 27  ? -58.716 27.043 -39.746 1.00 22.39  ? 27  HIS U N   1 
ATOM   5315 C  CA  . HIS G  1 27  ? -57.454 26.760 -39.060 1.00 20.87  ? 27  HIS U CA  1 
ATOM   5316 C  C   . HIS G  1 27  ? -57.503 27.257 -37.637 1.00 21.36  ? 27  HIS U C   1 
ATOM   5317 O  O   . HIS G  1 27  ? -56.534 27.832 -37.139 1.00 21.55  ? 27  HIS U O   1 
ATOM   5318 C  CB  . HIS G  1 27  ? -56.286 27.361 -39.809 1.00 20.41  ? 27  HIS U CB  1 
ATOM   5319 C  CG  . HIS G  1 27  ? -56.010 26.743 -41.159 1.00 20.16  ? 27  HIS U CG  1 
ATOM   5320 N  ND1 . HIS G  1 27  ? -55.431 27.462 -42.147 1.00 21.61  ? 27  HIS U ND1 1 
ATOM   5321 C  CD2 . HIS G  1 27  ? -56.222 25.452 -41.674 1.00 21.05  ? 27  HIS U CD2 1 
ATOM   5322 C  CE1 . HIS G  1 27  ? -55.279 26.697 -43.235 1.00 21.92  ? 27  HIS U CE1 1 
ATOM   5323 N  NE2 . HIS G  1 27  ? -55.775 25.459 -42.954 1.00 22.24  ? 27  HIS U NE2 1 
ATOM   5324 N  N   . ALA G  1 28  ? -58.610 26.971 -36.957 1.00 21.08  ? 28  ALA U N   1 
ATOM   5325 C  CA  . ALA G  1 28  ? -58.800 27.327 -35.556 1.00 21.20  ? 28  ALA U CA  1 
ATOM   5326 C  C   . ALA G  1 28  ? -59.479 26.168 -34.883 1.00 23.03  ? 28  ALA U C   1 
ATOM   5327 O  O   . ALA G  1 28  ? -60.583 25.748 -35.285 1.00 23.29  ? 28  ALA U O   1 
ATOM   5328 C  CB  . ALA G  1 28  ? -59.666 28.590 -35.419 1.00 21.00  ? 28  ALA U CB  1 
ATOM   5329 N  N   . VAL G  1 29  ? -58.808 25.637 -33.882 1.00 22.54  ? 29  VAL U N   1 
ATOM   5330 C  CA  . VAL G  1 29  ? -59.390 24.648 -32.997 1.00 23.96  ? 29  VAL U CA  1 
ATOM   5331 C  C   . VAL G  1 29  ? -59.686 25.434 -31.704 1.00 24.19  ? 29  VAL U C   1 
ATOM   5332 O  O   . VAL G  1 29  ? -58.786 25.938 -31.037 1.00 23.69  ? 29  VAL U O   1 
ATOM   5333 C  CB  . VAL G  1 29  ? -58.389 23.482 -32.817 1.00 23.56  ? 29  VAL U CB  1 
ATOM   5334 C  CG1 . VAL G  1 29  ? -58.735 22.652 -31.587 1.00 24.83  ? 29  VAL U CG1 1 
ATOM   5335 C  CG2 . VAL G  1 29  ? -58.253 22.634 -34.095 1.00 23.62  ? 29  VAL U CG2 1 
ATOM   5336 N  N   . TYR G  1 30  ? -60.976 25.626 -31.416 1.00 24.70  ? 30  TYR U N   1 
ATOM   5337 C  CA  . TYR G  1 30  ? -61.370 26.397 -30.269 1.00 25.36  ? 30  TYR U CA  1 
ATOM   5338 C  C   . TYR G  1 30  ? -61.254 25.535 -29.043 1.00 26.91  ? 30  TYR U C   1 
ATOM   5339 O  O   . TYR G  1 30  ? -60.925 24.342 -29.131 1.00 26.60  ? 30  TYR U O   1 
ATOM   5340 C  CB  . TYR G  1 30  ? -62.771 26.987 -30.465 1.00 25.79  ? 30  TYR U CB  1 
ATOM   5341 C  CG  . TYR G  1 30  ? -62.853 27.848 -31.696 1.00 24.87  ? 30  TYR U CG  1 
ATOM   5342 C  CD1 . TYR G  1 30  ? -62.309 29.142 -31.729 1.00 24.92  ? 30  TYR U CD1 1 
ATOM   5343 C  CD2 . TYR G  1 30  ? -63.395 27.360 -32.848 1.00 25.53  ? 30  TYR U CD2 1 
ATOM   5344 C  CE1 . TYR G  1 30  ? -62.370 29.907 -32.886 1.00 24.75  ? 30  TYR U CE1 1 
ATOM   5345 C  CE2 . TYR G  1 30  ? -63.434 28.125 -34.006 1.00 25.79  ? 30  TYR U CE2 1 
ATOM   5346 C  CZ  . TYR G  1 30  ? -62.892 29.381 -34.013 1.00 25.32  ? 30  TYR U CZ  1 
ATOM   5347 O  OH  . TYR G  1 30  ? -62.981 30.140 -35.133 1.00 25.35  ? 30  TYR U OH  1 
ATOM   5348 N  N   . ARG G  1 31  ? -61.465 26.137 -27.883 1.00 28.08  ? 31  ARG U N   1 
ATOM   5349 C  CA  . ARG G  1 31  ? -61.184 25.425 -26.656 1.00 29.92  ? 31  ARG U CA  1 
ATOM   5350 C  C   . ARG G  1 31  ? -62.003 24.118 -26.511 1.00 31.21  ? 31  ARG U C   1 
ATOM   5351 O  O   . ARG G  1 31  ? -61.441 23.083 -26.099 1.00 30.59  ? 31  ARG U O   1 
ATOM   5352 C  CB  . ARG G  1 31  ? -61.359 26.371 -25.485 1.00 32.66  ? 31  ARG U CB  1 
ATOM   5353 C  CG  . ARG G  1 31  ? -61.228 25.733 -24.108 1.00 36.54  ? 31  ARG U CG  1 
ATOM   5354 C  CD  . ARG G  1 31  ? -61.804 26.661 -23.047 1.00 38.79  ? 31  ARG U CD  1 
ATOM   5355 N  NE  . ARG G  1 31  ? -61.166 27.971 -23.047 1.00 40.60  ? 31  ARG U NE  1 
ATOM   5356 C  CZ  . ARG G  1 31  ? -60.038 28.293 -22.401 1.00 43.51  ? 31  ARG U CZ  1 
ATOM   5357 N  NH1 . ARG G  1 31  ? -59.354 27.389 -21.695 1.00 44.26  ? 31  ARG U NH1 1 
ATOM   5358 N  NH2 . ARG G  1 31  ? -59.564 29.537 -22.487 1.00 42.38  ? 31  ARG U NH2 1 
ATOM   5359 N  N   . ASP G  1 32  ? -63.283 24.149 -26.870 1.00 31.33  ? 32  ASP U N   1 
ATOM   5360 C  CA  . ASP G  1 32  ? -64.068 22.904 -26.886 1.00 32.69  ? 32  ASP U CA  1 
ATOM   5361 C  C   . ASP G  1 32  ? -63.603 21.889 -27.953 1.00 31.85  ? 32  ASP U C   1 
ATOM   5362 O  O   . ASP G  1 32  ? -63.650 20.666 -27.710 1.00 32.63  ? 32  ASP U O   1 
ATOM   5363 C  CB  . ASP G  1 32  ? -65.582 23.187 -27.035 1.00 35.08  ? 32  ASP U CB  1 
ATOM   5364 C  CG  . ASP G  1 32  ? -65.947 23.971 -28.317 1.00 35.31  ? 32  ASP U CG  1 
ATOM   5365 O  OD1 . ASP G  1 32  ? -65.067 24.573 -28.967 1.00 34.28  ? 32  ASP U OD1 1 
ATOM   5366 O  OD2 . ASP G  1 32  ? -67.146 23.993 -28.685 1.00 36.90  ? 32  ASP U OD2 1 
ATOM   5367 N  N   . ASP G  1 33  ? -63.226 22.379 -29.135 1.00 30.04  ? 33  ASP U N   1 
ATOM   5368 C  CA  . ASP G  1 33  ? -62.679 21.509 -30.181 1.00 29.45  ? 33  ASP U CA  1 
ATOM   5369 C  C   . ASP G  1 33  ? -61.372 20.837 -29.706 1.00 28.18  ? 33  ASP U C   1 
ATOM   5370 O  O   . ASP G  1 33  ? -61.091 19.684 -30.054 1.00 28.02  ? 33  ASP U O   1 
ATOM   5371 C  CB  . ASP G  1 33  ? -62.396 22.288 -31.481 1.00 28.30  ? 33  ASP U CB  1 
ATOM   5372 C  CG  . ASP G  1 33  ? -63.620 23.000 -32.045 1.00 30.31  ? 33  ASP U CG  1 
ATOM   5373 O  OD1 . ASP G  1 33  ? -64.755 22.491 -31.882 1.00 31.32  ? 33  ASP U OD1 1 
ATOM   5374 O  OD2 . ASP G  1 33  ? -63.411 24.070 -32.684 1.00 27.99  ? 33  ASP U OD2 1 
ATOM   5375 N  N   . LEU G  1 34  ? -60.571 21.554 -28.914 1.00 27.24  ? 34  LEU U N   1 
ATOM   5376 C  CA  . LEU G  1 34  ? -59.315 20.980 -28.413 1.00 27.52  ? 34  LEU U CA  1 
ATOM   5377 C  C   . LEU G  1 34  ? -59.586 19.866 -27.394 1.00 28.58  ? 34  LEU U C   1 
ATOM   5378 O  O   . LEU G  1 34  ? -58.932 18.848 -27.434 1.00 28.49  ? 34  LEU U O   1 
ATOM   5379 C  CB  . LEU G  1 34  ? -58.360 22.040 -27.827 1.00 26.19  ? 34  LEU U CB  1 
ATOM   5380 C  CG  . LEU G  1 34  ? -56.997 21.455 -27.391 1.00 26.30  ? 34  LEU U CG  1 
ATOM   5381 C  CD1 . LEU G  1 34  ? -56.125 21.085 -28.599 1.00 25.50  ? 34  LEU U CD1 1 
ATOM   5382 C  CD2 . LEU G  1 34  ? -56.292 22.402 -26.435 1.00 25.92  ? 34  LEU U CD2 1 
ATOM   5383 N  N   . LYS G  1 35  ? -60.553 20.056 -26.506 1.00 30.48  ? 35  LYS U N   1 
ATOM   5384 C  CA  . LYS G  1 35  ? -60.945 18.996 -25.585 1.00 33.62  ? 35  LYS U CA  1 
ATOM   5385 C  C   . LYS G  1 35  ? -61.292 17.702 -26.340 1.00 33.15  ? 35  LYS U C   1 
ATOM   5386 O  O   . LYS G  1 35  ? -60.856 16.616 -25.968 1.00 31.73  ? 35  LYS U O   1 
ATOM   5387 C  CB  . LYS G  1 35  ? -62.125 19.458 -24.749 1.00 36.54  ? 35  LYS U CB  1 
ATOM   5388 C  CG  . LYS G  1 35  ? -62.514 18.572 -23.584 1.00 41.42  ? 35  LYS U CG  1 
ATOM   5389 C  CD  . LYS G  1 35  ? -63.804 19.127 -23.010 1.00 44.50  ? 35  LYS U CD  1 
ATOM   5390 C  CE  . LYS G  1 35  ? -64.075 18.720 -21.571 1.00 48.93  ? 35  LYS U CE  1 
ATOM   5391 N  NZ  . LYS G  1 35  ? -64.264 17.254 -21.462 1.00 51.82  ? 35  LYS U NZ  1 
ATOM   5392 N  N   . LYS G  1 36  ? -62.121 17.834 -27.371 1.00 33.36  ? 36  LYS U N   1 
ATOM   5393 C  CA  . LYS G  1 36  ? -62.448 16.721 -28.251 1.00 34.40  ? 36  LYS U CA  1 
ATOM   5394 C  C   . LYS G  1 36  ? -61.218 16.084 -28.906 1.00 32.42  ? 36  LYS U C   1 
ATOM   5395 O  O   . LYS G  1 36  ? -61.076 14.861 -28.918 1.00 32.78  ? 36  LYS U O   1 
ATOM   5396 C  CB  . LYS G  1 36  ? -63.408 17.213 -29.323 1.00 37.28  ? 36  LYS U CB  1 
ATOM   5397 C  CG  . LYS G  1 36  ? -63.908 16.162 -30.291 1.00 40.56  ? 36  LYS U CG  1 
ATOM   5398 C  CD  . LYS G  1 36  ? -65.168 16.622 -31.023 1.00 44.78  ? 36  LYS U CD  1 
ATOM   5399 C  CE  . LYS G  1 36  ? -66.040 15.440 -31.390 1.00 48.41  ? 36  LYS U CE  1 
ATOM   5400 N  NZ  . LYS G  1 36  ? -66.415 14.672 -30.177 1.00 52.20  ? 36  LYS U NZ  1 
ATOM   5401 N  N   . LEU G  1 37  ? -60.318 16.909 -29.440 1.00 29.52  ? 37  LEU U N   1 
ATOM   5402 C  CA  . LEU G  1 37  ? -59.122 16.403 -30.102 1.00 28.30  ? 37  LEU U CA  1 
ATOM   5403 C  C   . LEU G  1 37  ? -58.310 15.603 -29.094 1.00 28.36  ? 37  LEU U C   1 
ATOM   5404 O  O   . LEU G  1 37  ? -57.886 14.460 -29.380 1.00 27.44  ? 37  LEU U O   1 
ATOM   5405 C  CB  . LEU G  1 37  ? -58.297 17.568 -30.658 1.00 27.37  ? 37  LEU U CB  1 
ATOM   5406 C  CG  . LEU G  1 37  ? -56.999 17.304 -31.453 1.00 26.18  ? 37  LEU U CG  1 
ATOM   5407 C  CD1 . LEU G  1 37  ? -56.625 18.545 -32.260 1.00 25.01  ? 37  LEU U CD1 1 
ATOM   5408 C  CD2 . LEU G  1 37  ? -55.864 16.881 -30.555 1.00 26.03  ? 37  LEU U CD2 1 
ATOM   5409 N  N   . LEU G  1 38  ? -58.119 16.175 -27.905 1.00 27.62  ? 38  LEU U N   1 
ATOM   5410 C  CA  . LEU G  1 38  ? -57.316 15.496 -26.888 1.00 28.49  ? 38  LEU U CA  1 
ATOM   5411 C  C   . LEU G  1 38  ? -57.967 14.183 -26.458 1.00 29.73  ? 38  LEU U C   1 
ATOM   5412 O  O   . LEU G  1 38  ? -57.296 13.166 -26.309 1.00 29.48  ? 38  LEU U O   1 
ATOM   5413 C  CB  . LEU G  1 38  ? -57.066 16.389 -25.653 1.00 28.53  ? 38  LEU U CB  1 
ATOM   5414 C  CG  . LEU G  1 38  ? -56.111 17.583 -25.872 1.00 27.61  ? 38  LEU U CG  1 
ATOM   5415 C  CD1 . LEU G  1 38  ? -56.239 18.626 -24.764 1.00 28.49  ? 38  LEU U CD1 1 
ATOM   5416 C  CD2 . LEU G  1 38  ? -54.634 17.118 -26.021 1.00 27.06  ? 38  LEU U CD2 1 
ATOM   5417 N  N   . GLU G  1 39  ? -59.278 14.196 -26.245 1.00 32.35  ? 39  GLU U N   1 
ATOM   5418 C  CA  . GLU G  1 39  ? -59.967 12.980 -25.801 1.00 34.75  ? 39  GLU U CA  1 
ATOM   5419 C  C   . GLU G  1 39  ? -59.957 11.857 -26.827 1.00 34.68  ? 39  GLU U C   1 
ATOM   5420 O  O   . GLU G  1 39  ? -59.914 10.689 -26.456 1.00 35.69  ? 39  GLU U O   1 
ATOM   5421 C  CB  . GLU G  1 39  ? -61.396 13.305 -25.350 1.00 39.54  ? 39  GLU U CB  1 
ATOM   5422 C  CG  . GLU G  1 39  ? -61.383 14.030 -24.010 1.00 43.30  ? 39  GLU U CG  1 
ATOM   5423 C  CD  . GLU G  1 39  ? -62.723 14.641 -23.607 1.00 48.37  ? 39  GLU U CD  1 
ATOM   5424 O  OE1 . GLU G  1 39  ? -63.759 14.425 -24.298 1.00 52.47  ? 39  GLU U OE1 1 
ATOM   5425 O  OE2 . GLU G  1 39  ? -62.736 15.358 -22.581 1.00 52.21  ? 39  GLU U OE2 1 
ATOM   5426 N  N   . THR G  1 40  ? -59.957 12.204 -28.111 1.00 33.14  ? 40  THR U N   1 
ATOM   5427 C  CA  . THR G  1 40  ? -60.004 11.242 -29.191 1.00 32.88  ? 40  THR U CA  1 
ATOM   5428 C  C   . THR G  1 40  ? -58.618 10.788 -29.656 1.00 32.03  ? 40  THR U C   1 
ATOM   5429 O  O   . THR G  1 40  ? -58.426 9.614  -29.969 1.00 31.73  ? 40  THR U O   1 
ATOM   5430 C  CB  . THR G  1 40  ? -60.763 11.861 -30.389 1.00 33.80  ? 40  THR U CB  1 
ATOM   5431 O  OG1 . THR G  1 40  ? -62.053 12.331 -29.944 1.00 35.88  ? 40  THR U OG1 1 
ATOM   5432 C  CG2 . THR G  1 40  ? -60.978 10.856 -31.536 1.00 34.53  ? 40  THR U CG2 1 
ATOM   5433 N  N   . GLU G  1 41  ? -57.651 11.711 -29.688 1.00 30.34  ? 41  GLU U N   1 
ATOM   5434 C  CA  . GLU G  1 41  ? -56.376 11.468 -30.374 1.00 30.27  ? 41  GLU U CA  1 
ATOM   5435 C  C   . GLU G  1 41  ? -55.188 11.236 -29.446 1.00 30.65  ? 41  GLU U C   1 
ATOM   5436 O  O   . GLU G  1 41  ? -54.172 10.731 -29.909 1.00 30.79  ? 41  GLU U O   1 
ATOM   5437 C  CB  . GLU G  1 41  ? -55.999 12.679 -31.240 1.00 29.68  ? 41  GLU U CB  1 
ATOM   5438 C  CG  . GLU G  1 41  ? -57.041 13.112 -32.254 1.00 30.51  ? 41  GLU U CG  1 
ATOM   5439 C  CD  . GLU G  1 41  ? -57.337 12.072 -33.309 1.00 31.33  ? 41  GLU U CD  1 
ATOM   5440 O  OE1 . GLU G  1 41  ? -56.517 11.133 -33.505 1.00 32.16  ? 41  GLU U OE1 1 
ATOM   5441 O  OE2 . GLU G  1 41  ? -58.383 12.226 -33.962 1.00 31.21  ? 41  GLU U OE2 1 
ATOM   5442 N  N   . SER G  1 42  ? -55.286 11.612 -28.172 1.00 31.21  ? 42  SER U N   1 
ATOM   5443 C  CA  . SER G  1 42  ? -54.114 11.568 -27.299 1.00 32.18  ? 42  SER U CA  1 
ATOM   5444 C  C   . SER G  1 42  ? -54.250 10.527 -26.192 1.00 33.36  ? 42  SER U C   1 
ATOM   5445 O  O   . SER G  1 42  ? -55.334 10.278 -25.720 1.00 33.94  ? 42  SER U O   1 
ATOM   5446 C  CB  . SER G  1 42  ? -53.778 12.946 -26.706 1.00 32.79  ? 42  SER U CB  1 
ATOM   5447 O  OG  . SER G  1 42  ? -54.608 13.269 -25.597 1.00 37.68  ? 42  SER U OG  1 
ATOM   5448 N  N   . PRO G  1 43  ? -53.128 9.923  -25.774 1.00 33.14  ? 43  PRO U N   1 
ATOM   5449 C  CA  . PRO G  1 43  ? -53.175 8.988  -24.660 1.00 35.52  ? 43  PRO U CA  1 
ATOM   5450 C  C   . PRO G  1 43  ? -53.403 9.658  -23.299 1.00 35.76  ? 43  PRO U C   1 
ATOM   5451 O  O   . PRO G  1 43  ? -53.252 10.849 -23.156 1.00 33.45  ? 43  PRO U O   1 
ATOM   5452 C  CB  . PRO G  1 43  ? -51.794 8.327  -24.704 1.00 35.21  ? 43  PRO U CB  1 
ATOM   5453 C  CG  . PRO G  1 43  ? -50.914 9.385  -25.250 1.00 33.22  ? 43  PRO U CG  1 
ATOM   5454 C  CD  . PRO G  1 43  ? -51.751 10.074 -26.287 1.00 32.20  ? 43  PRO U CD  1 
ATOM   5455 N  N   . GLN G  1 44  ? -53.748 8.843  -22.316 1.00 40.67  ? 44  GLN U N   1 
ATOM   5456 C  CA  . GLN G  1 44  ? -54.075 9.304  -20.970 1.00 44.01  ? 44  GLN U CA  1 
ATOM   5457 C  C   . GLN G  1 44  ? -52.989 10.172 -20.348 1.00 42.82  ? 44  GLN U C   1 
ATOM   5458 O  O   . GLN G  1 44  ? -53.293 11.190 -19.738 1.00 43.02  ? 44  GLN U O   1 
ATOM   5459 C  CB  . GLN G  1 44  ? -54.393 8.090  -20.080 1.00 49.35  ? 44  GLN U CB  1 
ATOM   5460 C  CG  . GLN G  1 44  ? -53.686 8.021  -18.719 1.00 52.39  ? 44  GLN U CG  1 
ATOM   5461 C  CD  . GLN G  1 44  ? -54.246 8.999  -17.704 1.00 53.53  ? 44  GLN U CD  1 
ATOM   5462 O  OE1 . GLN G  1 44  ? -55.184 9.741  -17.991 1.00 57.42  ? 44  GLN U OE1 1 
ATOM   5463 N  NE2 . GLN G  1 44  ? -53.669 9.010  -16.511 1.00 56.35  ? 44  GLN U NE2 1 
ATOM   5464 N  N   . TYR G  1 45  ? -51.725 9.783  -20.514 1.00 41.73  ? 45  TYR U N   1 
ATOM   5465 C  CA  . TYR G  1 45  ? -50.619 10.523 -19.890 1.00 40.72  ? 45  TYR U CA  1 
ATOM   5466 C  C   . TYR G  1 45  ? -50.508 11.947 -20.480 1.00 38.98  ? 45  TYR U C   1 
ATOM   5467 O  O   . TYR G  1 45  ? -49.974 12.847 -19.847 1.00 39.67  ? 45  TYR U O   1 
ATOM   5468 C  CB  . TYR G  1 45  ? -49.298 9.718  -19.941 1.00 40.24  ? 45  TYR U CB  1 
ATOM   5469 C  CG  . TYR G  1 45  ? -48.755 9.418  -21.336 1.00 37.62  ? 45  TYR U CG  1 
ATOM   5470 C  CD1 . TYR G  1 45  ? -48.038 10.379 -22.043 1.00 36.51  ? 45  TYR U CD1 1 
ATOM   5471 C  CD2 . TYR G  1 45  ? -48.952 8.197  -21.945 1.00 37.24  ? 45  TYR U CD2 1 
ATOM   5472 C  CE1 . TYR G  1 45  ? -47.529 10.106 -23.313 1.00 35.56  ? 45  TYR U CE1 1 
ATOM   5473 C  CE2 . TYR G  1 45  ? -48.444 7.922  -23.215 1.00 36.23  ? 45  TYR U CE2 1 
ATOM   5474 C  CZ  . TYR G  1 45  ? -47.732 8.888  -23.897 1.00 35.68  ? 45  TYR U CZ  1 
ATOM   5475 O  OH  . TYR G  1 45  ? -47.228 8.652  -25.175 1.00 34.22  ? 45  TYR U OH  1 
ATOM   5476 N  N   . ILE G  1 46  ? -51.028 12.143 -21.693 1.00 36.75  ? 46  ILE U N   1 
ATOM   5477 C  CA  . ILE G  1 46  ? -51.128 13.491 -22.297 1.00 34.64  ? 46  ILE U CA  1 
ATOM   5478 C  C   . ILE G  1 46  ? -52.393 14.191 -21.815 1.00 36.60  ? 46  ILE U C   1 
ATOM   5479 O  O   . ILE G  1 46  ? -52.377 15.366 -21.436 1.00 37.21  ? 46  ILE U O   1 
ATOM   5480 C  CB  . ILE G  1 46  ? -51.146 13.385 -23.840 1.00 32.90  ? 46  ILE U CB  1 
ATOM   5481 C  CG1 . ILE G  1 46  ? -49.807 12.811 -24.325 1.00 32.48  ? 46  ILE U CG1 1 
ATOM   5482 C  CG2 . ILE G  1 46  ? -51.460 14.735 -24.495 1.00 30.95  ? 46  ILE U CG2 1 
ATOM   5483 C  CD1 . ILE G  1 46  ? -48.600 13.708 -24.107 1.00 33.40  ? 46  ILE U CD1 1 
ATOM   5484 N  N   . ARG G  1 47  ? -53.504 13.486 -21.893 1.00 38.12  ? 47  ARG U N   1 
ATOM   5485 C  CA  . ARG G  1 47  ? -54.788 14.037 -21.466 1.00 41.41  ? 47  ARG U CA  1 
ATOM   5486 C  C   . ARG G  1 47  ? -54.778 14.567 -20.041 1.00 42.42  ? 47  ARG U C   1 
ATOM   5487 O  O   . ARG G  1 47  ? -55.494 15.501 -19.726 1.00 42.23  ? 47  ARG U O   1 
ATOM   5488 C  CB  . ARG G  1 47  ? -55.880 12.981 -21.600 1.00 45.51  ? 47  ARG U CB  1 
ATOM   5489 C  CG  . ARG G  1 47  ? -56.315 12.791 -23.036 1.00 47.63  ? 47  ARG U CG  1 
ATOM   5490 C  CD  . ARG G  1 47  ? -57.476 11.842 -23.138 1.00 52.21  ? 47  ARG U CD  1 
ATOM   5491 N  NE  . ARG G  1 47  ? -57.096 10.516 -22.659 1.00 58.05  ? 47  ARG U NE  1 
ATOM   5492 C  CZ  . ARG G  1 47  ? -57.948 9.532  -22.402 1.00 60.44  ? 47  ARG U CZ  1 
ATOM   5493 N  NH1 . ARG G  1 47  ? -59.261 9.711  -22.570 1.00 64.89  ? 47  ARG U NH1 1 
ATOM   5494 N  NH2 . ARG G  1 47  ? -57.486 8.362  -21.968 1.00 63.50  ? 47  ARG U NH2 1 
ATOM   5495 N  N   . LYS G  1 48  ? -53.969 13.977 -19.173 1.00 44.38  ? 48  LYS U N   1 
ATOM   5496 C  CA  . LYS G  1 48  ? -54.119 14.233 -17.734 1.00 48.11  ? 48  LYS U CA  1 
ATOM   5497 C  C   . LYS G  1 48  ? -53.663 15.629 -17.304 1.00 47.01  ? 48  LYS U C   1 
ATOM   5498 O  O   . LYS G  1 48  ? -53.972 16.073 -16.215 1.00 49.32  ? 48  LYS U O   1 
ATOM   5499 C  CB  . LYS G  1 48  ? -53.391 13.156 -16.940 1.00 52.78  ? 48  LYS U CB  1 
ATOM   5500 C  CG  . LYS G  1 48  ? -51.907 13.394 -16.724 1.00 55.33  ? 48  LYS U CG  1 
ATOM   5501 C  CD  . LYS G  1 48  ? -51.632 13.931 -15.315 1.00 61.11  ? 48  LYS U CD  1 
ATOM   5502 C  CE  . LYS G  1 48  ? -50.145 14.157 -15.095 1.00 63.28  ? 48  LYS U CE  1 
ATOM   5503 N  NZ  . LYS G  1 48  ? -49.393 12.895 -15.343 1.00 64.22  ? 48  LYS U NZ  1 
ATOM   5504 N  N   . LYS G  1 49  ? -52.895 16.300 -18.144 1.00 43.95  ? 49  LYS U N   1 
ATOM   5505 C  CA  . LYS G  1 49  ? -52.548 17.695 -17.889 1.00 44.53  ? 49  LYS U CA  1 
ATOM   5506 C  C   . LYS G  1 49  ? -53.823 18.570 -17.801 1.00 42.34  ? 49  LYS U C   1 
ATOM   5507 O  O   . LYS G  1 49  ? -53.876 19.523 -17.024 1.00 41.95  ? 49  LYS U O   1 
ATOM   5508 C  CB  . LYS G  1 49  ? -51.612 18.224 -18.985 1.00 42.76  ? 49  LYS U CB  1 
ATOM   5509 C  CG  . LYS G  1 49  ? -51.134 19.664 -18.773 1.00 43.61  ? 49  LYS U CG  1 
ATOM   5510 C  CD  . LYS G  1 49  ? -50.334 20.204 -19.951 1.00 42.63  ? 49  LYS U CD  1 
ATOM   5511 C  CE  . LYS G  1 49  ? -48.844 19.974 -19.796 1.00 44.50  ? 49  LYS U CE  1 
ATOM   5512 N  NZ  . LYS G  1 49  ? -48.207 20.286 -21.104 1.00 42.88  ? 49  LYS U NZ  1 
ATOM   5513 N  N   . GLY G  1 50  ? -54.829 18.225 -18.606 1.00 39.68  ? 50  GLY U N   1 
ATOM   5514 C  CA  . GLY G  1 50  ? -56.099 18.940 -18.637 1.00 39.98  ? 50  GLY U CA  1 
ATOM   5515 C  C   . GLY G  1 50  ? -56.232 19.745 -19.912 1.00 36.98  ? 50  GLY U C   1 
ATOM   5516 O  O   . GLY G  1 50  ? -55.277 20.399 -20.343 1.00 34.12  ? 50  GLY U O   1 
ATOM   5517 N  N   . ALA G  1 51  ? -57.409 19.713 -20.530 1.00 35.93  ? 51  ALA U N   1 
ATOM   5518 C  CA  . ALA G  1 51  ? -57.565 20.370 -21.820 1.00 33.95  ? 51  ALA U CA  1 
ATOM   5519 C  C   . ALA G  1 51  ? -57.435 21.893 -21.682 1.00 32.40  ? 51  ALA U C   1 
ATOM   5520 O  O   . ALA G  1 51  ? -56.878 22.535 -22.575 1.00 30.53  ? 51  ALA U O   1 
ATOM   5521 C  CB  . ALA G  1 51  ? -58.882 19.968 -22.502 1.00 35.88  ? 51  ALA U CB  1 
ATOM   5522 N  N   . ASP G  1 52  ? -57.949 22.481 -20.589 1.00 33.62  ? 52  ASP U N   1 
ATOM   5523 C  CA  . ASP G  1 52  ? -57.773 23.943 -20.389 1.00 33.69  ? 52  ASP U CA  1 
ATOM   5524 C  C   . ASP G  1 52  ? -56.301 24.321 -20.218 1.00 31.20  ? 52  ASP U C   1 
ATOM   5525 O  O   . ASP G  1 52  ? -55.885 25.350 -20.713 1.00 28.59  ? 52  ASP U O   1 
ATOM   5526 C  CB  . ASP G  1 52  ? -58.547 24.447 -19.177 1.00 36.73  ? 52  ASP U CB  1 
ATOM   5527 C  CG  . ASP G  1 52  ? -60.058 24.562 -19.437 1.00 40.31  ? 52  ASP U CG  1 
ATOM   5528 O  OD1 . ASP G  1 52  ? -60.473 24.599 -20.614 1.00 41.43  ? 52  ASP U OD1 1 
ATOM   5529 O  OD2 . ASP G  1 52  ? -60.828 24.627 -18.456 1.00 45.78  ? 52  ASP U OD2 1 
ATOM   5530 N  N   . VAL G  1 53  ? -55.538 23.522 -19.459 1.00 32.47  ? 53  VAL U N   1 
ATOM   5531 C  CA  . VAL G  1 53  ? -54.096 23.770 -19.308 1.00 31.79  ? 53  VAL U CA  1 
ATOM   5532 C  C   . VAL G  1 53  ? -53.377 23.637 -20.661 1.00 28.77  ? 53  VAL U C   1 
ATOM   5533 O  O   . VAL G  1 53  ? -52.586 24.510 -21.006 1.00 30.04  ? 53  VAL U O   1 
ATOM   5534 C  CB  . VAL G  1 53  ? -53.447 22.864 -18.229 1.00 35.93  ? 53  VAL U CB  1 
ATOM   5535 C  CG1 . VAL G  1 53  ? -51.982 23.230 -18.035 1.00 38.00  ? 53  VAL U CG1 1 
ATOM   5536 C  CG2 . VAL G  1 53  ? -54.193 22.997 -16.922 1.00 38.04  ? 53  VAL U CG2 1 
ATOM   5537 N  N   . TRP G  1 54  ? -53.671 22.585 -21.442 1.00 26.11  ? 54  TRP U N   1 
ATOM   5538 C  CA  . TRP G  1 54  ? -53.111 22.477 -22.802 1.00 24.15  ? 54  TRP U CA  1 
ATOM   5539 C  C   . TRP G  1 54  ? -53.511 23.660 -23.663 1.00 23.42  ? 54  TRP U C   1 
ATOM   5540 O  O   . TRP G  1 54  ? -52.687 24.228 -24.389 1.00 21.39  ? 54  TRP U O   1 
ATOM   5541 C  CB  . TRP G  1 54  ? -53.565 21.206 -23.481 1.00 24.08  ? 54  TRP U CB  1 
ATOM   5542 C  CG  . TRP G  1 54  ? -52.665 20.008 -23.265 1.00 24.42  ? 54  TRP U CG  1 
ATOM   5543 C  CD1 . TRP G  1 54  ? -52.996 18.796 -22.660 1.00 26.04  ? 54  TRP U CD1 1 
ATOM   5544 C  CD2 . TRP G  1 54  ? -51.293 19.864 -23.693 1.00 25.03  ? 54  TRP U CD2 1 
ATOM   5545 N  NE1 . TRP G  1 54  ? -51.934 17.936 -22.669 1.00 25.76  ? 54  TRP U NE1 1 
ATOM   5546 C  CE2 . TRP G  1 54  ? -50.870 18.530 -23.283 1.00 25.63  ? 54  TRP U CE2 1 
ATOM   5547 C  CE3 . TRP G  1 54  ? -50.379 20.696 -24.344 1.00 24.51  ? 54  TRP U CE3 1 
ATOM   5548 C  CZ2 . TRP G  1 54  ? -49.594 18.066 -23.531 1.00 25.76  ? 54  TRP U CZ2 1 
ATOM   5549 C  CZ3 . TRP G  1 54  ? -49.095 20.217 -24.590 1.00 25.43  ? 54  TRP U CZ3 1 
ATOM   5550 C  CH2 . TRP G  1 54  ? -48.714 18.935 -24.196 1.00 26.51  ? 54  TRP U CH2 1 
ATOM   5551 N  N   . PHE G  1 55  ? -54.778 24.060 -23.592 1.00 23.42  ? 55  PHE U N   1 
ATOM   5552 C  CA  . PHE G  1 55  ? -55.237 25.233 -24.384 1.00 23.92  ? 55  PHE U CA  1 
ATOM   5553 C  C   . PHE G  1 55  ? -54.419 26.491 -24.135 1.00 24.34  ? 55  PHE U C   1 
ATOM   5554 O  O   . PHE G  1 55  ? -53.898 27.133 -25.069 1.00 23.08  ? 55  PHE U O   1 
ATOM   5555 C  CB  . PHE G  1 55  ? -56.723 25.553 -24.127 1.00 25.07  ? 55  PHE U CB  1 
ATOM   5556 C  CG  . PHE G  1 55  ? -57.281 26.545 -25.111 1.00 25.42  ? 55  PHE U CG  1 
ATOM   5557 C  CD1 . PHE G  1 55  ? -57.662 26.138 -26.375 1.00 26.14  ? 55  PHE U CD1 1 
ATOM   5558 C  CD2 . PHE G  1 55  ? -57.325 27.870 -24.806 1.00 26.38  ? 55  PHE U CD2 1 
ATOM   5559 C  CE1 . PHE G  1 55  ? -58.133 27.036 -27.311 1.00 27.06  ? 55  PHE U CE1 1 
ATOM   5560 C  CE2 . PHE G  1 55  ? -57.804 28.777 -25.717 1.00 27.07  ? 55  PHE U CE2 1 
ATOM   5561 C  CZ  . PHE G  1 55  ? -58.196 28.351 -26.990 1.00 26.57  ? 55  PHE U CZ  1 
ATOM   5562 N  N   . LYS G  1 56  ? -54.289 26.806 -22.854 1.00 25.47  ? 56  LYS U N   1 
ATOM   5563 C  CA  . LYS G  1 56  ? -53.534 27.968 -22.449 1.00 25.49  ? 56  LYS U CA  1 
ATOM   5564 C  C   . LYS G  1 56  ? -52.089 27.893 -22.925 1.00 24.94  ? 56  LYS U C   1 
ATOM   5565 O  O   . LYS G  1 56  ? -51.533 28.883 -23.397 1.00 25.07  ? 56  LYS U O   1 
ATOM   5566 C  CB  . LYS G  1 56  ? -53.565 28.142 -20.919 1.00 28.19  ? 56  LYS U CB  1 
ATOM   5567 C  CG  . LYS G  1 56  ? -53.222 29.561 -20.558 1.00 29.99  ? 56  LYS U CG  1 
ATOM   5568 C  CD  . LYS G  1 56  ? -53.289 29.825 -19.075 1.00 33.66  ? 56  LYS U CD  1 
ATOM   5569 C  CE  . LYS G  1 56  ? -52.706 31.184 -18.750 1.00 35.86  ? 56  LYS U CE  1 
ATOM   5570 N  NZ  . LYS G  1 56  ? -52.393 31.227 -17.301 1.00 41.07  ? 56  LYS U NZ  1 
ATOM   5571 N  N   . GLU G  1 57  ? -51.476 26.716 -22.809 1.00 25.66  ? 57  GLU U N   1 
ATOM   5572 C  CA  . GLU G  1 57  ? -50.123 26.517 -23.344 1.00 24.59  ? 57  GLU U CA  1 
ATOM   5573 C  C   . GLU G  1 57  ? -49.952 26.669 -24.859 1.00 24.04  ? 57  GLU U C   1 
ATOM   5574 O  O   . GLU G  1 57  ? -48.939 27.180 -25.317 1.00 25.03  ? 57  GLU U O   1 
ATOM   5575 C  CB  . GLU G  1 57  ? -49.580 25.147 -22.929 1.00 26.47  ? 57  GLU U CB  1 
ATOM   5576 C  CG  . GLU G  1 57  ? -49.144 25.125 -21.489 1.00 28.16  ? 57  GLU U CG  1 
ATOM   5577 C  CD  . GLU G  1 57  ? -48.589 23.779 -21.021 1.00 31.17  ? 57  GLU U CD  1 
ATOM   5578 O  OE1 . GLU G  1 57  ? -48.566 23.578 -19.781 1.00 35.28  ? 57  GLU U OE1 1 
ATOM   5579 O  OE2 . GLU G  1 57  ? -48.237 22.921 -21.861 1.00 30.59  ? 57  GLU U OE2 1 
ATOM   5580 N  N   . LEU G  1 58  ? -50.927 26.204 -25.613 1.00 22.37  ? 58  LEU U N   1 
ATOM   5581 C  CA  . LEU G  1 58  ? -50.836 26.097 -27.053 1.00 21.11  ? 58  LEU U CA  1 
ATOM   5582 C  C   . LEU G  1 58  ? -51.262 27.401 -27.735 1.00 20.85  ? 58  LEU U C   1 
ATOM   5583 O  O   . LEU G  1 58  ? -50.816 27.703 -28.842 1.00 19.42  ? 58  LEU U O   1 
ATOM   5584 C  CB  . LEU G  1 58  ? -51.690 24.963 -27.549 1.00 21.46  ? 58  LEU U CB  1 
ATOM   5585 C  CG  . LEU G  1 58  ? -51.189 23.575 -27.115 1.00 21.78  ? 58  LEU U CG  1 
ATOM   5586 C  CD1 . LEU G  1 58  ? -52.194 22.563 -27.617 1.00 23.32  ? 58  LEU U CD1 1 
ATOM   5587 C  CD2 . LEU G  1 58  ? -49.761 23.281 -27.577 1.00 20.80  ? 58  LEU U CD2 1 
ATOM   5588 N  N   . ASP G  1 59  ? -52.146 28.160 -27.082 1.00 21.50  ? 59  ASP U N   1 
ATOM   5589 C  CA  . ASP G  1 59  ? -52.624 29.431 -27.629 1.00 20.94  ? 59  ASP U CA  1 
ATOM   5590 C  C   . ASP G  1 59  ? -51.667 30.595 -27.348 1.00 20.37  ? 59  ASP U C   1 
ATOM   5591 O  O   . ASP G  1 59  ? -51.935 31.491 -26.533 1.00 20.96  ? 59  ASP U O   1 
ATOM   5592 C  CB  . ASP G  1 59  ? -54.049 29.758 -27.180 1.00 21.81  ? 59  ASP U CB  1 
ATOM   5593 C  CG  . ASP G  1 59  ? -54.609 31.015 -27.875 1.00 21.98  ? 59  ASP U CG  1 
ATOM   5594 O  OD1 . ASP G  1 59  ? -54.106 31.384 -28.982 1.00 19.72  ? 59  ASP U OD1 1 
ATOM   5595 O  OD2 . ASP G  1 59  ? -55.584 31.609 -27.359 1.00 23.23  ? 59  ASP U OD2 1 
ATOM   5596 N  N   A ILE G  1 60  ? -50.557 30.520 -28.083 0.36 19.28  ? 60  ILE U N   1 
ATOM   5597 N  N   B ILE G  1 60  ? -50.549 30.618 -28.077 0.64 18.80  ? 60  ILE U N   1 
ATOM   5598 C  CA  A ILE G  1 60  ? -49.392 31.366 -27.961 0.36 18.65  ? 60  ILE U CA  1 
ATOM   5599 C  CA  B ILE G  1 60  ? -49.408 31.472 -27.735 0.64 18.17  ? 60  ILE U CA  1 
ATOM   5600 C  C   A ILE G  1 60  ? -49.768 32.835 -28.042 0.36 18.61  ? 60  ILE U C   1 
ATOM   5601 C  C   B ILE G  1 60  ? -49.659 32.930 -28.117 0.64 18.14  ? 60  ILE U C   1 
ATOM   5602 O  O   A ILE G  1 60  ? -49.385 33.622 -27.179 0.36 18.42  ? 60  ILE U O   1 
ATOM   5603 O  O   B ILE G  1 60  ? -49.019 33.829 -27.612 0.64 17.46  ? 60  ILE U O   1 
ATOM   5604 C  CB  A ILE G  1 60  ? -48.409 30.998 -29.096 0.36 17.80  ? 60  ILE U CB  1 
ATOM   5605 C  CB  B ILE G  1 60  ? -48.094 30.970 -28.385 0.64 17.17  ? 60  ILE U CB  1 
ATOM   5606 C  CG1 A ILE G  1 60  ? -48.098 29.505 -29.008 0.36 17.84  ? 60  ILE U CG1 1 
ATOM   5607 C  CG1 B ILE G  1 60  ? -48.197 31.050 -29.920 0.64 16.32  ? 60  ILE U CG1 1 
ATOM   5608 C  CG2 A ILE G  1 60  ? -47.126 31.811 -29.008 0.36 17.98  ? 60  ILE U CG2 1 
ATOM   5609 C  CG2 B ILE G  1 60  ? -47.794 29.540 -27.916 0.64 17.15  ? 60  ILE U CG2 1 
ATOM   5610 C  CD1 A ILE G  1 60  ? -47.258 29.148 -27.800 0.36 17.75  ? 60  ILE U CD1 1 
ATOM   5611 C  CD1 B ILE G  1 60  ? -46.935 30.647 -30.649 0.64 16.37  ? 60  ILE U CD1 1 
ATOM   5612 N  N   . ASN G  1 61  ? -50.580 33.160 -29.053 1.00 18.16  ? 61  ASN U N   1 
ATOM   5613 C  CA  . ASN G  1 61  ? -50.985 34.528 -29.341 1.00 19.18  ? 61  ASN U CA  1 
ATOM   5614 C  C   . ASN G  1 61  ? -52.266 34.971 -28.663 1.00 20.28  ? 61  ASN U C   1 
ATOM   5615 O  O   . ASN G  1 61  ? -52.704 36.084 -28.915 1.00 21.71  ? 61  ASN U O   1 
ATOM   5616 C  CB  . ASN G  1 61  ? -51.097 34.800 -30.850 1.00 18.57  ? 61  ASN U CB  1 
ATOM   5617 C  CG  . ASN G  1 61  ? -52.227 34.069 -31.501 1.00 19.94  ? 61  ASN U CG  1 
ATOM   5618 O  OD1 . ASN G  1 61  ? -52.564 32.946 -31.125 1.00 20.72  ? 61  ASN U OD1 1 
ATOM   5619 N  ND2 . ASN G  1 61  ? -52.803 34.686 -32.537 1.00 19.12  ? 61  ASN U ND2 1 
ATOM   5620 N  N   . THR G  1 62  ? -52.801 34.128 -27.779 1.00 21.80  ? 62  THR U N   1 
ATOM   5621 C  CA  . THR G  1 62  ? -53.958 34.464 -26.935 1.00 23.30  ? 62  THR U CA  1 
ATOM   5622 C  C   . THR G  1 62  ? -55.070 35.090 -27.794 1.00 22.76  ? 62  THR U C   1 
ATOM   5623 O  O   . THR G  1 62  ? -55.643 36.151 -27.474 1.00 24.20  ? 62  THR U O   1 
ATOM   5624 C  CB  . THR G  1 62  ? -53.589 35.313 -25.694 1.00 25.39  ? 62  THR U CB  1 
ATOM   5625 O  OG1 . THR G  1 62  ? -52.847 36.459 -26.085 1.00 25.40  ? 62  THR U OG1 1 
ATOM   5626 C  CG2 . THR G  1 62  ? -52.717 34.514 -24.698 1.00 26.24  ? 62  THR U CG2 1 
ATOM   5627 N  N   . ASP G  1 63  ? -55.374 34.400 -28.895 1.00 21.92  ? 63  ASP U N   1 
ATOM   5628 C  CA  . ASP G  1 63  ? -56.496 34.780 -29.757 1.00 22.32  ? 63  ASP U CA  1 
ATOM   5629 C  C   . ASP G  1 63  ? -57.707 33.873 -29.636 1.00 23.19  ? 63  ASP U C   1 
ATOM   5630 O  O   . ASP G  1 63  ? -58.651 34.042 -30.392 1.00 23.99  ? 63  ASP U O   1 
ATOM   5631 C  CB  . ASP G  1 63  ? -56.070 34.898 -31.233 1.00 21.10  ? 63  ASP U CB  1 
ATOM   5632 C  CG  . ASP G  1 63  ? -55.720 33.586 -31.875 1.00 21.83  ? 63  ASP U CG  1 
ATOM   5633 O  OD1 . ASP G  1 63  ? -55.646 32.542 -31.169 1.00 22.44  ? 63  ASP U OD1 1 
ATOM   5634 O  OD2 . ASP G  1 63  ? -55.406 33.617 -33.085 1.00 23.62  ? 63  ASP U OD2 1 
ATOM   5635 N  N   . GLY G  1 64  ? -57.688 32.931 -28.688 1.00 23.52  ? 64  GLY U N   1 
ATOM   5636 C  CA  . GLY G  1 64  ? -58.827 32.027 -28.445 1.00 24.21  ? 64  GLY U CA  1 
ATOM   5637 C  C   . GLY G  1 64  ? -58.948 30.788 -29.335 1.00 24.42  ? 64  GLY U C   1 
ATOM   5638 O  O   . GLY G  1 64  ? -59.909 30.045 -29.212 1.00 25.23  ? 64  GLY U O   1 
ATOM   5639 N  N   . ALA G  1 65  ? -57.946 30.510 -30.171 1.00 22.74  ? 65  ALA U N   1 
ATOM   5640 C  CA  . ALA G  1 65  ? -57.893 29.248 -30.931 1.00 22.55  ? 65  ALA U CA  1 
ATOM   5641 C  C   . ALA G  1 65  ? -56.471 28.708 -31.070 1.00 22.23  ? 65  ALA U C   1 
ATOM   5642 O  O   . ALA G  1 65  ? -55.479 29.428 -30.877 1.00 20.29  ? 65  ALA U O   1 
ATOM   5643 C  CB  . ALA G  1 65  ? -58.489 29.467 -32.309 1.00 25.53  ? 65  ALA U CB  1 
ATOM   5644 N  N   . VAL G  1 66  ? -56.401 27.416 -31.358 1.00 21.21  ? 66  VAL U N   1 
ATOM   5645 C  CA  . VAL G  1 66  ? -55.158 26.727 -31.674 1.00 21.21  ? 66  VAL U CA  1 
ATOM   5646 C  C   . VAL G  1 66  ? -55.097 26.568 -33.175 1.00 21.10  ? 66  VAL U C   1 
ATOM   5647 O  O   . VAL G  1 66  ? -55.935 25.889 -33.795 1.00 21.87  ? 66  VAL U O   1 
ATOM   5648 C  CB  . VAL G  1 66  ? -55.079 25.382 -30.979 1.00 21.80  ? 66  VAL U CB  1 
ATOM   5649 C  CG1 . VAL G  1 66  ? -53.852 24.591 -31.476 1.00 20.96  ? 66  VAL U CG1 1 
ATOM   5650 C  CG2 . VAL G  1 66  ? -55.051 25.574 -29.455 1.00 21.32  ? 66  VAL U CG2 1 
ATOM   5651 N  N   . ASN G  1 67  ? -54.111 27.233 -33.761 1.00 20.16  ? 67  ASN U N   1 
ATOM   5652 C  CA  . ASN G  1 67  ? -53.875 27.118 -35.195 1.00 20.05  ? 67  ASN U CA  1 
ATOM   5653 C  C   . ASN G  1 67  ? -52.980 25.921 -35.523 1.00 19.77  ? 67  ASN U C   1 
ATOM   5654 O  O   . ASN G  1 67  ? -52.702 25.157 -34.669 1.00 19.07  ? 67  ASN U O   1 
ATOM   5655 C  CB  . ASN G  1 67  ? -53.408 28.450 -35.820 1.00 20.03  ? 67  ASN U CB  1 
ATOM   5656 C  CG  . ASN G  1 67  ? -52.012 28.817 -35.485 1.00 19.85  ? 67  ASN U CG  1 
ATOM   5657 O  OD1 . ASN G  1 67  ? -51.234 28.003 -35.031 1.00 21.59  ? 67  ASN U OD1 1 
ATOM   5658 N  ND2 . ASN G  1 67  ? -51.683 30.108 -35.706 1.00 19.84  ? 67  ASN U ND2 1 
ATOM   5659 N  N   . PHE G  1 68  ? -52.558 25.753 -36.779 1.00 19.99  ? 68  PHE U N   1 
ATOM   5660 C  CA  . PHE G  1 68  ? -51.872 24.505 -37.141 1.00 20.87  ? 68  PHE U CA  1 
ATOM   5661 C  C   . PHE G  1 68  ? -50.467 24.460 -36.517 1.00 20.11  ? 68  PHE U C   1 
ATOM   5662 O  O   . PHE G  1 68  ? -50.033 23.454 -35.982 1.00 20.02  ? 68  PHE U O   1 
ATOM   5663 C  CB  . PHE G  1 68  ? -51.800 24.301 -38.665 1.00 21.62  ? 68  PHE U CB  1 
ATOM   5664 C  CG  . PHE G  1 68  ? -51.225 22.980 -39.030 1.00 22.67  ? 68  PHE U CG  1 
ATOM   5665 C  CD1 . PHE G  1 68  ? -51.846 21.817 -38.579 1.00 23.68  ? 68  PHE U CD1 1 
ATOM   5666 C  CD2 . PHE G  1 68  ? -50.047 22.875 -39.746 1.00 21.63  ? 68  PHE U CD2 1 
ATOM   5667 C  CE1 . PHE G  1 68  ? -51.289 20.550 -38.823 1.00 23.12  ? 68  PHE U CE1 1 
ATOM   5668 C  CE2 . PHE G  1 68  ? -49.502 21.624 -40.005 1.00 23.18  ? 68  PHE U CE2 1 
ATOM   5669 C  CZ  . PHE G  1 68  ? -50.116 20.468 -39.550 1.00 22.74  ? 68  PHE U CZ  1 
ATOM   5670 N  N   . GLN G  1 69  ? -49.773 25.588 -36.575 1.00 20.74  ? 69  GLN U N   1 
ATOM   5671 C  CA  . GLN G  1 69  ? -48.458 25.662 -36.008 1.00 19.98  ? 69  GLN U CA  1 
ATOM   5672 C  C   . GLN G  1 69  ? -48.448 25.542 -34.472 1.00 19.11  ? 69  GLN U C   1 
ATOM   5673 O  O   . GLN G  1 69  ? -47.557 24.921 -33.910 1.00 19.05  ? 69  GLN U O   1 
ATOM   5674 C  CB  . GLN G  1 69  ? -47.736 26.912 -36.515 1.00 21.26  ? 69  GLN U CB  1 
ATOM   5675 C  CG  . GLN G  1 69  ? -48.306 28.283 -36.136 1.00 25.25  ? 69  GLN U CG  1 
ATOM   5676 C  CD  . GLN G  1 69  ? -49.059 28.965 -37.283 1.00 28.07  ? 69  GLN U CD  1 
ATOM   5677 O  OE1 . GLN G  1 69  ? -49.844 28.254 -38.058 1.00 24.98  ? 69  GLN U OE1 1 
ATOM   5678 N  NE2 . GLN G  1 69  ? -48.866 30.391 -37.393 1.00 24.10  ? 69  GLN U NE2 1 
ATOM   5679 N  N   . GLU G  1 70  ? -49.478 26.098 -33.821 1.00 19.21  ? 70  GLU U N   1 
ATOM   5680 C  CA  . GLU G  1 70  ? -49.666 25.902 -32.405 1.00 18.03  ? 70  GLU U CA  1 
ATOM   5681 C  C   . GLU G  1 70  ? -49.924 24.399 -32.109 1.00 19.13  ? 70  GLU U C   1 
ATOM   5682 O  O   . GLU G  1 70  ? -49.377 23.836 -31.154 1.00 18.59  ? 70  GLU U O   1 
ATOM   5683 C  CB  . GLU G  1 70  ? -50.802 26.787 -31.869 1.00 18.54  ? 70  GLU U CB  1 
ATOM   5684 C  CG  . GLU G  1 70  ? -50.432 28.258 -31.783 1.00 18.35  ? 70  GLU U CG  1 
ATOM   5685 C  CD  . GLU G  1 70  ? -51.617 29.188 -31.552 1.00 19.45  ? 70  GLU U CD  1 
ATOM   5686 O  OE1 . GLU G  1 70  ? -52.768 28.910 -31.991 1.00 20.03  ? 70  GLU U OE1 1 
ATOM   5687 O  OE2 . GLU G  1 70  ? -51.408 30.233 -30.889 1.00 20.06  ? 70  GLU U OE2 1 
ATOM   5688 N  N   . PHE G  1 71  ? -50.757 23.769 -32.923 1.00 19.17  ? 71  PHE U N   1 
ATOM   5689 C  CA  . PHE G  1 71  ? -51.006 22.318 -32.815 1.00 19.93  ? 71  PHE U CA  1 
ATOM   5690 C  C   . PHE G  1 71  ? -49.718 21.512 -32.957 1.00 20.34  ? 71  PHE U C   1 
ATOM   5691 O  O   . PHE G  1 71  ? -49.539 20.487 -32.290 1.00 20.61  ? 71  PHE U O   1 
ATOM   5692 C  CB  . PHE G  1 71  ? -52.012 21.878 -33.891 1.00 20.79  ? 71  PHE U CB  1 
ATOM   5693 C  CG  . PHE G  1 71  ? -52.125 20.389 -34.072 1.00 21.57  ? 71  PHE U CG  1 
ATOM   5694 C  CD1 . PHE G  1 71  ? -52.780 19.625 -33.145 1.00 22.54  ? 71  PHE U CD1 1 
ATOM   5695 C  CD2 . PHE G  1 71  ? -51.664 19.767 -35.223 1.00 20.74  ? 71  PHE U CD2 1 
ATOM   5696 C  CE1 . PHE G  1 71  ? -52.933 18.248 -33.328 1.00 23.11  ? 71  PHE U CE1 1 
ATOM   5697 C  CE2 . PHE G  1 71  ? -51.807 18.392 -35.410 1.00 21.98  ? 71  PHE U CE2 1 
ATOM   5698 C  CZ  . PHE G  1 71  ? -52.440 17.631 -34.466 1.00 22.79  ? 71  PHE U CZ  1 
ATOM   5699 N  N   . LEU G  1 72  ? -48.800 21.961 -33.799 1.00 20.39  ? 72  LEU U N   1 
ATOM   5700 C  CA  . LEU G  1 72  ? -47.518 21.225 -33.921 1.00 19.13  ? 72  LEU U CA  1 
ATOM   5701 C  C   . LEU G  1 72  ? -46.697 21.179 -32.631 1.00 19.25  ? 72  LEU U C   1 
ATOM   5702 O  O   . LEU G  1 72  ? -45.904 20.254 -32.473 1.00 19.49  ? 72  LEU U O   1 
ATOM   5703 C  CB  . LEU G  1 72  ? -46.683 21.733 -35.108 1.00 18.99  ? 72  LEU U CB  1 
ATOM   5704 C  CG  . LEU G  1 72  ? -47.252 21.381 -36.475 1.00 19.06  ? 72  LEU U CG  1 
ATOM   5705 C  CD1 . LEU G  1 72  ? -46.463 21.991 -37.642 1.00 20.01  ? 72  LEU U CD1 1 
ATOM   5706 C  CD2 . LEU G  1 72  ? -47.346 19.866 -36.663 1.00 21.66  ? 72  LEU U CD2 1 
ATOM   5707 N  N   . ILE G  1 73  ? -46.894 22.138 -31.725 1.00 19.53  ? 73  ILE U N   1 
ATOM   5708 C  CA  . ILE G  1 73  ? -46.287 22.097 -30.368 1.00 19.18  ? 73  ILE U CA  1 
ATOM   5709 C  C   . ILE G  1 73  ? -46.740 20.843 -29.628 1.00 19.90  ? 73  ILE U C   1 
ATOM   5710 O  O   . ILE G  1 73  ? -45.935 20.096 -29.070 1.00 19.79  ? 73  ILE U O   1 
ATOM   5711 C  CB  . ILE G  1 73  ? -46.640 23.354 -29.523 1.00 19.67  ? 73  ILE U CB  1 
ATOM   5712 C  CG1 . ILE G  1 73  ? -45.969 24.621 -30.089 1.00 18.34  ? 73  ILE U CG1 1 
ATOM   5713 C  CG2 . ILE G  1 73  ? -46.170 23.183 -28.073 1.00 19.99  ? 73  ILE U CG2 1 
ATOM   5714 C  CD1 . ILE G  1 73  ? -46.582 25.916 -29.545 1.00 18.84  ? 73  ILE U CD1 1 
ATOM   5715 N  N   . LEU G  1 74  ? -48.052 20.597 -29.622 1.00 20.44  ? 74  LEU U N   1 
ATOM   5716 C  CA  . LEU G  1 74  ? -48.602 19.360 -29.078 1.00 21.44  ? 74  LEU U CA  1 
ATOM   5717 C  C   . LEU G  1 74  ? -48.056 18.121 -29.773 1.00 21.31  ? 74  LEU U C   1 
ATOM   5718 O  O   . LEU G  1 74  ? -47.707 17.166 -29.122 1.00 23.04  ? 74  LEU U O   1 
ATOM   5719 C  CB  . LEU G  1 74  ? -50.142 19.389 -29.153 1.00 22.20  ? 74  LEU U CB  1 
ATOM   5720 C  CG  . LEU G  1 74  ? -50.929 18.159 -28.678 1.00 22.98  ? 74  LEU U CG  1 
ATOM   5721 C  CD1 . LEU G  1 74  ? -50.706 17.919 -27.176 1.00 23.36  ? 74  LEU U CD1 1 
ATOM   5722 C  CD2 . LEU G  1 74  ? -52.422 18.237 -29.030 1.00 24.78  ? 74  LEU U CD2 1 
ATOM   5723 N  N   . VAL G  1 75  ? -47.960 18.126 -31.100 1.00 21.04  ? 75  VAL U N   1 
ATOM   5724 C  CA  . VAL G  1 75  ? -47.481 16.942 -31.808 1.00 19.78  ? 75  VAL U CA  1 
ATOM   5725 C  C   . VAL G  1 75  ? -46.042 16.656 -31.401 1.00 19.26  ? 75  VAL U C   1 
ATOM   5726 O  O   . VAL G  1 75  ? -45.677 15.528 -31.139 1.00 20.01  ? 75  VAL U O   1 
ATOM   5727 C  CB  . VAL G  1 75  ? -47.580 17.127 -33.334 1.00 20.46  ? 75  VAL U CB  1 
ATOM   5728 C  CG1 . VAL G  1 75  ? -46.906 15.951 -34.046 1.00 20.36  ? 75  VAL U CG1 1 
ATOM   5729 C  CG2 . VAL G  1 75  ? -49.048 17.287 -33.786 1.00 21.22  ? 75  VAL U CG2 1 
ATOM   5730 N  N   . ILE G  1 76  ? -45.232 17.705 -31.342 1.00 18.65  ? 76  ILE U N   1 
ATOM   5731 C  CA  . ILE G  1 76  ? -43.842 17.594 -30.895 1.00 18.42  ? 76  ILE U CA  1 
ATOM   5732 C  C   . ILE G  1 76  ? -43.749 16.995 -29.503 1.00 19.74  ? 76  ILE U C   1 
ATOM   5733 O  O   . ILE G  1 76  ? -43.035 16.031 -29.285 1.00 19.77  ? 76  ILE U O   1 
ATOM   5734 C  CB  . ILE G  1 76  ? -43.093 18.954 -30.984 1.00 17.26  ? 76  ILE U CB  1 
ATOM   5735 C  CG1 . ILE G  1 76  ? -42.767 19.279 -32.444 1.00 17.74  ? 76  ILE U CG1 1 
ATOM   5736 C  CG2 . ILE G  1 76  ? -41.804 18.959 -30.110 1.00 17.82  ? 76  ILE U CG2 1 
ATOM   5737 C  CD1 . ILE G  1 76  ? -42.366 20.735 -32.672 1.00 17.10  ? 76  ILE U CD1 1 
ATOM   5738 N  N   . LYS G  1 77  ? -44.523 17.527 -28.573 1.00 20.70  ? 77  LYS U N   1 
ATOM   5739 C  CA  . LYS G  1 77  ? -44.471 17.049 -27.197 1.00 21.52  ? 77  LYS U CA  1 
ATOM   5740 C  C   . LYS G  1 77  ? -45.017 15.632 -27.037 1.00 22.72  ? 77  LYS U C   1 
ATOM   5741 O  O   . LYS G  1 77  ? -44.457 14.800 -26.261 1.00 23.12  ? 77  LYS U O   1 
ATOM   5742 C  CB  . LYS G  1 77  ? -45.208 18.007 -26.298 1.00 23.33  ? 77  LYS U CB  1 
ATOM   5743 C  CG  . LYS G  1 77  ? -44.380 19.285 -26.143 1.00 23.17  ? 77  LYS U CG  1 
ATOM   5744 C  CD  . LYS G  1 77  ? -44.954 20.195 -25.105 1.00 25.10  ? 77  LYS U CD  1 
ATOM   5745 C  CE  . LYS G  1 77  ? -43.911 21.231 -24.674 1.00 25.44  ? 77  LYS U CE  1 
ATOM   5746 N  NZ  . LYS G  1 77  ? -44.502 22.183 -23.728 1.00 24.54  ? 77  LYS U NZ  1 
ATOM   5747 N  N   . MET G  1 78  ? -46.056 15.324 -27.804 1.00 23.19  ? 78  MET U N   1 
ATOM   5748 C  CA  . MET G  1 78  ? -46.554 13.950 -27.824 1.00 23.80  ? 78  MET U CA  1 
ATOM   5749 C  C   . MET G  1 78  ? -45.514 12.950 -28.388 1.00 22.56  ? 78  MET U C   1 
ATOM   5750 O  O   . MET G  1 78  ? -45.372 11.855 -27.891 1.00 23.51  ? 78  MET U O   1 
ATOM   5751 C  CB  . MET G  1 78  ? -47.826 13.831 -28.662 1.00 23.65  ? 78  MET U CB  1 
ATOM   5752 C  CG  . MET G  1 78  ? -49.057 14.385 -27.947 1.00 26.19  ? 78  MET U CG  1 
ATOM   5753 S  SD  . MET G  1 78  ? -50.560 14.258 -28.919 1.00 30.29  ? 78  MET U SD  1 
ATOM   5754 C  CE  . MET G  1 78  ? -50.745 12.487 -29.127 1.00 27.02  ? 78  MET U CE  1 
ATOM   5755 N  N   . GLY G  1 79  ? -44.836 13.318 -29.462 1.00 22.16  ? 79  GLY U N   1 
ATOM   5756 C  CA  . GLY G  1 79  ? -43.818 12.463 -30.059 1.00 20.86  ? 79  GLY U CA  1 
ATOM   5757 C  C   . GLY G  1 79  ? -42.653 12.232 -29.125 1.00 21.41  ? 79  GLY U C   1 
ATOM   5758 O  O   . GLY G  1 79  ? -42.182 11.081 -28.989 1.00 22.72  ? 79  GLY U O   1 
ATOM   5759 N  N   . VAL G  1 80  ? -42.185 13.309 -28.480 1.00 20.80  ? 80  VAL U N   1 
ATOM   5760 C  CA  . VAL G  1 80  ? -41.092 13.191 -27.511 1.00 21.85  ? 80  VAL U CA  1 
ATOM   5761 C  C   . VAL G  1 80  ? -41.527 12.256 -26.373 1.00 23.22  ? 80  VAL U C   1 
ATOM   5762 O  O   . VAL G  1 80  ? -40.770 11.363 -25.995 1.00 24.11  ? 80  VAL U O   1 
ATOM   5763 C  CB  . VAL G  1 80  ? -40.588 14.559 -26.990 1.00 22.18  ? 80  VAL U CB  1 
ATOM   5764 C  CG1 . VAL G  1 80  ? -39.683 14.358 -25.773 1.00 23.38  ? 80  VAL U CG1 1 
ATOM   5765 C  CG2 . VAL G  1 80  ? -39.888 15.320 -28.123 1.00 21.02  ? 80  VAL U CG2 1 
ATOM   5766 N  N   . ALA G  1 81  ? -42.750 12.443 -25.863 1.00 24.08  ? 81  ALA U N   1 
ATOM   5767 C  CA  . ALA G  1 81  ? -43.265 11.645 -24.742 1.00 26.06  ? 81  ALA U CA  1 
ATOM   5768 C  C   . ALA G  1 81  ? -43.431 10.188 -25.111 1.00 25.94  ? 81  ALA U C   1 
ATOM   5769 O  O   . ALA G  1 81  ? -43.060 9.295  -24.356 1.00 27.72  ? 81  ALA U O   1 
ATOM   5770 C  CB  . ALA G  1 81  ? -44.583 12.252 -24.237 1.00 26.88  ? 81  ALA U CB  1 
ATOM   5771 N  N   . ALA G  1 82  ? -43.954 9.929  -26.310 1.00 25.38  ? 82  ALA U N   1 
ATOM   5772 C  CA  . ALA G  1 82  ? -44.139 8.556  -26.777 1.00 25.08  ? 82  ALA U CA  1 
ATOM   5773 C  C   . ALA G  1 82  ? -42.790 7.856  -27.020 1.00 25.59  ? 82  ALA U C   1 
ATOM   5774 O  O   . ALA G  1 82  ? -42.630 6.655  -26.730 1.00 27.62  ? 82  ALA U O   1 
ATOM   5775 C  CB  . ALA G  1 82  ? -44.990 8.510  -28.040 1.00 26.04  ? 82  ALA U CB  1 
ATOM   5776 N  N   . HIS G  1 83  ? -41.800 8.566  -27.535 1.00 32.86  ? 83  HIS U N   1 
ATOM   5777 C  CA  . HIS G  1 83  ? -40.474 7.956  -27.708 1.00 31.42  ? 83  HIS U CA  1 
ATOM   5778 C  C   . HIS G  1 83  ? -39.853 7.617  -26.365 1.00 32.23  ? 83  HIS U C   1 
ATOM   5779 O  O   . HIS G  1 83  ? -39.241 6.552  -26.184 1.00 33.14  ? 83  HIS U O   1 
ATOM   5780 C  CB  . HIS G  1 83  ? -39.553 8.854  -28.520 1.00 31.56  ? 83  HIS U CB  1 
ATOM   5781 C  CG  . HIS G  1 83  ? -38.126 8.386  -28.520 1.00 31.59  ? 83  HIS U CG  1 
ATOM   5782 N  ND1 . HIS G  1 83  ? -37.203 8.864  -27.654 1.00 31.83  ? 83  HIS U ND1 1 
ATOM   5783 C  CD2 . HIS G  1 83  ? -37.463 7.444  -29.317 1.00 34.23  ? 83  HIS U CD2 1 
ATOM   5784 C  CE1 . HIS G  1 83  ? -36.025 8.237  -27.859 1.00 33.87  ? 83  HIS U CE1 1 
ATOM   5785 N  NE2 . HIS G  1 83  ? -36.183 7.375  -28.878 1.00 35.07  ? 83  HIS U NE2 1 
ATOM   5786 N  N   . LYS G  1 84  ? -40.028 8.513  -25.398 1.00 34.43  ? 84  LYS U N   1 
ATOM   5787 C  CA  . LYS G  1 84  ? -39.498 8.305  -24.064 1.00 39.79  ? 84  LYS U CA  1 
ATOM   5788 C  C   . LYS G  1 84  ? -40.094 7.074  -23.378 1.00 44.97  ? 84  LYS U C   1 
ATOM   5789 O  O   . LYS G  1 84  ? -39.370 6.341  -22.713 1.00 51.11  ? 84  LYS U O   1 
ATOM   5790 C  CB  . LYS G  1 84  ? -39.686 9.543  -23.205 1.00 44.20  ? 84  LYS U CB  1 
ATOM   5791 C  CG  . LYS G  1 84  ? -39.011 9.435  -21.845 1.00 52.34  ? 84  LYS U CG  1 
ATOM   5792 C  CD  . LYS G  1 84  ? -38.798 10.810 -21.237 1.00 60.95  ? 84  LYS U CD  1 
ATOM   5793 C  CE  . LYS G  1 84  ? -38.747 10.744 -19.715 1.00 72.76  ? 84  LYS U CE  1 
ATOM   5794 N  NZ  . LYS G  1 84  ? -37.778 9.730  -19.201 1.00 75.84  ? 84  LYS U NZ  1 
ATOM   5795 N  N   . LYS G  1 85  ? -41.401 6.862  -23.544 1.00 48.26  ? 85  LYS U N   1 
ATOM   5796 C  CA  . LYS G  1 85  ? -42.096 5.668  -23.018 1.00 56.52  ? 85  LYS U CA  1 
ATOM   5797 C  C   . LYS G  1 85  ? -41.511 4.369  -23.550 1.00 62.33  ? 85  LYS U C   1 
ATOM   5798 O  O   . LYS G  1 85  ? -41.271 3.423  -22.781 1.00 69.91  ? 85  LYS U O   1 
ATOM   5799 C  CB  . LYS G  1 85  ? -43.579 5.689  -23.399 1.00 58.55  ? 85  LYS U CB  1 
ATOM   5800 C  CG  . LYS G  1 85  ? -44.400 6.790  -22.760 1.00 60.25  ? 85  LYS U CG  1 
ATOM   5801 C  CD  . LYS G  1 85  ? -44.747 6.484  -21.315 1.00 69.52  ? 85  LYS U CD  1 
ATOM   5802 C  CE  . LYS G  1 85  ? -45.539 7.634  -20.710 1.00 73.58  ? 85  LYS U CE  1 
ATOM   5803 N  NZ  . LYS G  1 85  ? -45.531 7.601  -19.223 1.00 84.36  ? 85  LYS U NZ  1 
ATOM   5804 N  N   . SER G  1 86  ? -41.302 4.325  -24.870 1.00 61.29  ? 86  SER U N   1 
ATOM   5805 C  CA  . SER G  1 86  ? -40.635 3.195  -25.545 1.00 69.25  ? 86  SER U CA  1 
ATOM   5806 C  C   . SER G  1 86  ? -39.358 2.735  -24.840 1.00 76.48  ? 86  SER U C   1 
ATOM   5807 O  O   . SER G  1 86  ? -38.881 1.645  -25.112 1.00 84.11  ? 86  SER U O   1 
ATOM   5808 C  CB  . SER G  1 86  ? -40.293 3.540  -27.002 1.00 66.99  ? 86  SER U CB  1 
ATOM   5809 O  OG  . SER G  1 86  ? -41.455 3.707  -27.794 1.00 68.04  ? 86  SER U OG  1 
ATOM   5810 N  N   . HIS G  1 87  ? -38.781 3.583  -23.987 1.00 75.85  ? 87  HIS U N   1 
ATOM   5811 C  CA  . HIS G  1 87  ? -37.779 3.139  -23.017 1.00 85.32  ? 87  HIS U CA  1 
ATOM   5812 C  C   . HIS G  1 87  ? -38.452 2.644  -21.762 1.00 95.42  ? 87  HIS U C   1 
ATOM   5813 O  O   . HIS G  1 87  ? -38.985 3.426  -20.973 1.00 95.07  ? 87  HIS U O   1 
ATOM   5814 C  CB  . HIS G  1 87  ? -36.787 4.253  -22.681 1.00 82.41  ? 87  HIS U CB  1 
ATOM   5815 C  CG  . HIS G  1 87  ? -35.988 3.989  -21.421 1.00 95.26  ? 87  HIS U CG  1 
ATOM   5816 N  ND1 . HIS G  1 87  ? -36.334 4.503  -20.224 1.00 100.40 ? 87  HIS U ND1 1 
ATOM   5817 C  CD2 . HIS G  1 87  ? -34.852 3.208  -21.199 1.00 105.40 ? 87  HIS U CD2 1 
ATOM   5818 C  CE1 . HIS G  1 87  ? -35.457 4.088  -19.289 1.00 113.27 ? 87  HIS U CE1 1 
ATOM   5819 N  NE2 . HIS G  1 87  ? -34.551 3.300  -19.888 1.00 116.84 ? 87  HIS U NE2 1 
ATOM   5820 N  N   . LYS H  2 4   ? -57.934 0.553  -31.660 1.00 45.92  ? 4   LYS V N   1 
ATOM   5821 C  CA  . LYS H  2 4   ? -58.252 1.640  -30.729 1.00 43.66  ? 4   LYS V CA  1 
ATOM   5822 C  C   . LYS H  2 4   ? -57.048 2.543  -30.428 1.00 40.63  ? 4   LYS V C   1 
ATOM   5823 O  O   . LYS H  2 4   ? -57.209 3.473  -29.653 1.00 42.45  ? 4   LYS V O   1 
ATOM   5824 C  CB  . LYS H  2 4   ? -58.800 1.104  -29.419 1.00 44.80  ? 4   LYS V CB  1 
ATOM   5825 C  CG  . LYS H  2 4   ? -57.790 0.331  -28.613 1.00 45.76  ? 4   LYS V CG  1 
ATOM   5826 C  CD  . LYS H  2 4   ? -57.118 1.090  -27.493 1.00 45.51  ? 4   LYS V CD  1 
ATOM   5827 C  CE  . LYS H  2 4   ? -55.701 0.573  -27.304 1.00 45.40  ? 4   LYS V CE  1 
ATOM   5828 N  NZ  . LYS H  2 4   ? -54.713 1.533  -26.738 1.00 45.68  ? 4   LYS V NZ  1 
ATOM   5829 N  N   . MET H  2 5   ? -55.864 2.298  -30.999 1.00 36.30  ? 5   MET V N   1 
ATOM   5830 C  CA  . MET H  2 5   ? -54.882 3.389  -31.101 1.00 33.72  ? 5   MET V CA  1 
ATOM   5831 C  C   . MET H  2 5   ? -55.460 4.461  -32.033 1.00 32.24  ? 5   MET V C   1 
ATOM   5832 O  O   . MET H  2 5   ? -56.023 4.141  -33.058 1.00 30.92  ? 5   MET V O   1 
ATOM   5833 C  CB  . MET H  2 5   ? -53.515 2.905  -31.638 1.00 32.56  ? 5   MET V CB  1 
ATOM   5834 C  CG  . MET H  2 5   ? -52.462 3.984  -31.634 1.00 31.68  ? 5   MET V CG  1 
ATOM   5835 S  SD  . MET H  2 5   ? -50.811 3.434  -32.096 1.00 34.97  ? 5   MET V SD  1 
ATOM   5836 C  CE  . MET H  2 5   ? -50.462 2.449  -30.622 1.00 31.40  ? 5   MET V CE  1 
ATOM   5837 N  N   . SER H  2 6   ? -55.315 5.739  -31.681 1.00 31.49  ? 6   SER V N   1 
ATOM   5838 C  CA  . SER H  2 6   ? -55.862 6.813  -32.511 1.00 30.70  ? 6   SER V CA  1 
ATOM   5839 C  C   . SER H  2 6   ? -55.027 7.060  -33.771 1.00 29.71  ? 6   SER V C   1 
ATOM   5840 O  O   . SER H  2 6   ? -53.898 6.629  -33.866 1.00 28.99  ? 6   SER V O   1 
ATOM   5841 C  CB  . SER H  2 6   ? -55.893 8.093  -31.718 1.00 30.50  ? 6   SER V CB  1 
ATOM   5842 O  OG  . SER H  2 6   ? -54.595 8.656  -31.691 1.00 29.78  ? 6   SER V OG  1 
ATOM   5843 N  N   . GLN H  2 7   ? -55.602 7.780  -34.717 1.00 29.70  ? 7   GLN V N   1 
ATOM   5844 C  CA  . GLN H  2 7   ? -54.911 8.136  -35.949 1.00 29.00  ? 7   GLN V CA  1 
ATOM   5845 C  C   . GLN H  2 7   ? -53.620 8.871  -35.643 1.00 27.31  ? 7   GLN V C   1 
ATOM   5846 O  O   . GLN H  2 7   ? -52.559 8.535  -36.187 1.00 26.68  ? 7   GLN V O   1 
ATOM   5847 C  CB  . GLN H  2 7   ? -55.806 9.033  -36.793 1.00 30.10  ? 7   GLN V CB  1 
ATOM   5848 C  CG  . GLN H  2 7   ? -55.248 9.360  -38.165 1.00 29.92  ? 7   GLN V CG  1 
ATOM   5849 C  CD  . GLN H  2 7   ? -56.194 10.202 -38.981 1.00 32.08  ? 7   GLN V CD  1 
ATOM   5850 O  OE1 . GLN H  2 7   ? -57.381 10.403 -38.610 1.00 33.63  ? 7   GLN V OE1 1 
ATOM   5851 N  NE2 . GLN H  2 7   ? -55.680 10.712 -40.118 1.00 31.21  ? 7   GLN V NE2 1 
ATOM   5852 N  N   . LEU H  2 8   ? -53.723 9.901  -34.801 1.00 27.24  ? 8   LEU V N   1 
ATOM   5853 C  CA  . LEU H  2 8   ? -52.541 10.686 -34.396 1.00 25.32  ? 8   LEU V CA  1 
ATOM   5854 C  C   . LEU H  2 8   ? -51.457 9.819  -33.737 1.00 26.02  ? 8   LEU V C   1 
ATOM   5855 O  O   . LEU H  2 8   ? -50.264 9.910  -34.096 1.00 24.53  ? 8   LEU V O   1 
ATOM   5856 C  CB  . LEU H  2 8   ? -52.931 11.841 -33.479 1.00 25.40  ? 8   LEU V CB  1 
ATOM   5857 C  CG  . LEU H  2 8   ? -51.779 12.831 -33.164 1.00 24.70  ? 8   LEU V CG  1 
ATOM   5858 C  CD1 . LEU H  2 8   ? -51.090 13.406 -34.419 1.00 24.22  ? 8   LEU V CD1 1 
ATOM   5859 C  CD2 . LEU H  2 8   ? -52.270 13.916 -32.222 1.00 25.85  ? 8   LEU V CD2 1 
ATOM   5860 N  N   . GLU H  2 9   ? -51.866 8.925  -32.837 1.00 26.94  ? 9   GLU V N   1 
ATOM   5861 C  CA  . GLU H  2 9   ? -50.899 8.014  -32.226 1.00 28.84  ? 9   GLU V CA  1 
ATOM   5862 C  C   . GLU H  2 9   ? -50.218 7.098  -33.219 1.00 28.35  ? 9   GLU V C   1 
ATOM   5863 O  O   . GLU H  2 9   ? -49.021 6.874  -33.091 1.00 27.08  ? 9   GLU V O   1 
ATOM   5864 C  CB  . GLU H  2 9   ? -51.539 7.155  -31.168 1.00 30.80  ? 9   GLU V CB  1 
ATOM   5865 C  CG  . GLU H  2 9   ? -51.914 7.921  -29.925 1.00 33.65  ? 9   GLU V CG  1 
ATOM   5866 C  CD  . GLU H  2 9   ? -52.837 7.118  -28.999 1.00 38.69  ? 9   GLU V CD  1 
ATOM   5867 O  OE1 . GLU H  2 9   ? -53.901 6.567  -29.435 1.00 38.91  ? 9   GLU V OE1 1 
ATOM   5868 O  OE2 . GLU H  2 9   ? -52.502 7.056  -27.796 1.00 42.94  ? 9   GLU V OE2 1 
ATOM   5869 N  N   . ARG H  2 10  ? -50.982 6.505  -34.141 1.00 30.06  ? 10  ARG V N   1 
ATOM   5870 C  CA  . ARG H  2 10  ? -50.394 5.672  -35.176 1.00 28.69  ? 10  ARG V CA  1 
ATOM   5871 C  C   . ARG H  2 10  ? -49.386 6.473  -35.967 1.00 26.40  ? 10  ARG V C   1 
ATOM   5872 O  O   . ARG H  2 10  ? -48.349 5.962  -36.335 1.00 24.52  ? 10  ARG V O   1 
ATOM   5873 C  CB  . ARG H  2 10  ? -51.441 5.109  -36.172 1.00 31.27  ? 10  ARG V CB  1 
ATOM   5874 C  CG  . ARG H  2 10  ? -52.452 4.118  -35.635 1.00 35.49  ? 10  ARG V CG  1 
ATOM   5875 C  CD  . ARG H  2 10  ? -53.255 3.443  -36.772 1.00 36.94  ? 10  ARG V CD  1 
ATOM   5876 N  NE  . ARG H  2 10  ? -53.825 4.389  -37.750 1.00 39.54  ? 10  ARG V NE  1 
ATOM   5877 C  CZ  . ARG H  2 10  ? -55.022 4.972  -37.673 1.00 42.46  ? 10  ARG V CZ  1 
ATOM   5878 N  NH1 . ARG H  2 10  ? -55.854 4.747  -36.650 1.00 43.18  ? 10  ARG V NH1 1 
ATOM   5879 N  NH2 . ARG H  2 10  ? -55.391 5.829  -38.625 1.00 43.00  ? 10  ARG V NH2 1 
ATOM   5880 N  N   . ASN H  2 11  ? -49.703 7.733  -36.259 1.00 24.53  ? 11  ASN V N   1 
ATOM   5881 C  CA  . ASN H  2 11  ? -48.793 8.574  -37.055 1.00 23.81  ? 11  ASN V CA  1 
ATOM   5882 C  C   . ASN H  2 11  ? -47.468 8.780  -36.341 1.00 22.87  ? 11  ASN V C   1 
ATOM   5883 O  O   . ASN H  2 11  ? -46.382 8.696  -36.939 1.00 22.20  ? 11  ASN V O   1 
ATOM   5884 C  CB  . ASN H  2 11  ? -49.475 9.914  -37.385 1.00 23.40  ? 11  ASN V CB  1 
ATOM   5885 C  CG  . ASN H  2 11  ? -50.696 9.771  -38.303 1.00 24.74  ? 11  ASN V CG  1 
ATOM   5886 O  OD1 . ASN H  2 11  ? -51.581 10.625 -38.306 1.00 25.44  ? 11  ASN V OD1 1 
ATOM   5887 N  ND2 . ASN H  2 11  ? -50.773 8.675  -39.057 1.00 27.04  ? 11  ASN V ND2 1 
ATOM   5888 N  N   . ILE H  2 12  ? -47.563 9.083  -35.062 1.00 22.44  ? 12  ILE V N   1 
ATOM   5889 C  CA  . ILE H  2 12  ? -46.403 9.220  -34.187 1.00 23.57  ? 12  ILE V CA  1 
ATOM   5890 C  C   . ILE H  2 12  ? -45.577 7.915  -34.084 1.00 23.12  ? 12  ILE V C   1 
ATOM   5891 O  O   . ILE H  2 12  ? -44.342 7.910  -34.190 1.00 23.26  ? 12  ILE V O   1 
ATOM   5892 C  CB  . ILE H  2 12  ? -46.866 9.760  -32.799 1.00 24.23  ? 12  ILE V CB  1 
ATOM   5893 C  CG1 . ILE H  2 12  ? -47.266 11.263 -32.954 1.00 25.37  ? 12  ILE V CG1 1 
ATOM   5894 C  CG2 . ILE H  2 12  ? -45.776 9.635  -31.743 1.00 25.37  ? 12  ILE V CG2 1 
ATOM   5895 C  CD1 . ILE H  2 12  ? -47.810 11.875 -31.691 1.00 26.36  ? 12  ILE V CD1 1 
ATOM   5896 N  N   . GLU H  2 13  ? -46.243 6.790  -33.912 1.00 23.78  ? 13  GLU V N   1 
ATOM   5897 C  CA  . GLU H  2 13  ? -45.564 5.511  -33.962 1.00 23.17  ? 13  GLU V CA  1 
ATOM   5898 C  C   . GLU H  2 13  ? -44.822 5.301  -35.258 1.00 22.66  ? 13  GLU V C   1 
ATOM   5899 O  O   . GLU H  2 13  ? -43.706 4.787  -35.217 1.00 24.13  ? 13  GLU V O   1 
ATOM   5900 C  CB  . GLU H  2 13  ? -46.535 4.361  -33.741 1.00 26.84  ? 13  GLU V CB  1 
ATOM   5901 C  CG  . GLU H  2 13  ? -47.128 4.325  -32.344 1.00 29.61  ? 13  GLU V CG  1 
ATOM   5902 C  CD  . GLU H  2 13  ? -46.067 4.157  -31.273 1.00 32.37  ? 13  GLU V CD  1 
ATOM   5903 O  OE1 . GLU H  2 13  ? -45.416 3.093  -31.245 1.00 32.86  ? 13  GLU V OE1 1 
ATOM   5904 O  OE2 . GLU H  2 13  ? -45.877 5.093  -30.465 1.00 33.04  ? 13  GLU V OE2 1 
ATOM   5905 N  N   . THR H  2 14  ? -45.401 5.679  -36.395 1.00 21.93  ? 14  THR V N   1 
ATOM   5906 C  CA  . THR H  2 14  ? -44.665 5.568  -37.678 1.00 21.89  ? 14  THR V CA  1 
ATOM   5907 C  C   . THR H  2 14  ? -43.369 6.364  -37.634 1.00 21.51  ? 14  THR V C   1 
ATOM   5908 O  O   . THR H  2 14  ? -42.324 5.875  -38.089 1.00 20.94  ? 14  THR V O   1 
ATOM   5909 C  CB  . THR H  2 14  ? -45.490 5.973  -38.873 1.00 22.33  ? 14  THR V CB  1 
ATOM   5910 O  OG1 . THR H  2 14  ? -46.628 5.078  -38.982 1.00 24.40  ? 14  THR V OG1 1 
ATOM   5911 C  CG2 . THR H  2 14  ? -44.657 5.955  -40.175 1.00 22.99  ? 14  THR V CG2 1 
ATOM   5912 N  N   . ILE H  2 15  ? -43.426 7.581  -37.081 1.00 21.70  ? 15  ILE V N   1 
ATOM   5913 C  CA  . ILE H  2 15  ? -42.220 8.411  -36.975 1.00 21.79  ? 15  ILE V CA  1 
ATOM   5914 C  C   . ILE H  2 15  ? -41.145 7.747  -36.111 1.00 22.70  ? 15  ILE V C   1 
ATOM   5915 O  O   . ILE H  2 15  ? -39.944 7.637  -36.492 1.00 23.55  ? 15  ILE V O   1 
ATOM   5916 C  CB  . ILE H  2 15  ? -42.527 9.825  -36.394 1.00 21.58  ? 15  ILE V CB  1 
ATOM   5917 C  CG1 . ILE H  2 15  ? -43.449 10.597 -37.335 1.00 21.26  ? 15  ILE V CG1 1 
ATOM   5918 C  CG2 . ILE H  2 15  ? -41.216 10.585 -36.169 1.00 22.29  ? 15  ILE V CG2 1 
ATOM   5919 C  CD1 . ILE H  2 15  ? -44.086 11.873 -36.772 1.00 21.97  ? 15  ILE V CD1 1 
ATOM   5920 N  N   . ILE H  2 16  ? -41.562 7.262  -34.949 1.00 23.92  ? 16  ILE V N   1 
ATOM   5921 C  CA  . ILE H  2 16  ? -40.659 6.549  -34.067 1.00 24.95  ? 16  ILE V CA  1 
ATOM   5922 C  C   . ILE H  2 16  ? -40.096 5.250  -34.689 1.00 26.16  ? 16  ILE V C   1 
ATOM   5923 O  O   . ILE H  2 16  ? -38.896 4.944  -34.525 1.00 26.55  ? 16  ILE V O   1 
ATOM   5924 C  CB  . ILE H  2 16  ? -41.347 6.207  -32.710 1.00 26.08  ? 16  ILE V CB  1 
ATOM   5925 C  CG1 . ILE H  2 16  ? -41.635 7.484  -31.950 1.00 26.82  ? 16  ILE V CG1 1 
ATOM   5926 C  CG2 . ILE H  2 16  ? -40.437 5.290  -31.906 1.00 26.81  ? 16  ILE V CG2 1 
ATOM   5927 C  CD1 . ILE H  2 16  ? -42.539 7.319  -30.722 1.00 28.80  ? 16  ILE V CD1 1 
ATOM   5928 N  N   . ASN H  2 17  ? -40.948 4.474  -35.345 1.00 26.44  ? 17  ASN V N   1 
ATOM   5929 C  CA  . ASN H  2 17  ? -40.546 3.202  -35.913 1.00 27.96  ? 17  ASN V CA  1 
ATOM   5930 C  C   . ASN H  2 17  ? -39.521 3.488  -36.981 1.00 27.24  ? 17  ASN V C   1 
ATOM   5931 O  O   . ASN H  2 17  ? -38.576 2.726  -37.133 1.00 26.80  ? 17  ASN V O   1 
ATOM   5932 C  CB  . ASN H  2 17  ? -41.720 2.450  -36.573 1.00 30.98  ? 17  ASN V CB  1 
ATOM   5933 C  CG  . ASN H  2 17  ? -42.762 1.920  -35.571 1.00 34.67  ? 17  ASN V CG  1 
ATOM   5934 O  OD1 . ASN H  2 17  ? -42.489 1.789  -34.377 1.00 39.03  ? 17  ASN V OD1 1 
ATOM   5935 N  ND2 . ASN H  2 17  ? -43.978 1.614  -36.079 1.00 38.76  ? 17  ASN V ND2 1 
ATOM   5936 N  N   . THR H  2 18  ? -39.718 4.565  -37.735 1.00 24.17  ? 18  THR V N   1 
ATOM   5937 C  CA  . THR H  2 18  ? -38.823 4.837  -38.868 1.00 24.26  ? 18  THR V CA  1 
ATOM   5938 C  C   . THR H  2 18  ? -37.461 5.291  -38.299 1.00 23.46  ? 18  THR V C   1 
ATOM   5939 O  O   . THR H  2 18  ? -36.420 4.828  -38.726 1.00 22.69  ? 18  THR V O   1 
ATOM   5940 C  CB  . THR H  2 18  ? -39.384 5.881  -39.846 1.00 24.25  ? 18  THR V CB  1 
ATOM   5941 O  OG1 . THR H  2 18  ? -40.705 5.502  -40.312 1.00 25.52  ? 18  THR V OG1 1 
ATOM   5942 C  CG2 . THR H  2 18  ? -38.433 6.094  -41.051 1.00 24.74  ? 18  THR V CG2 1 
ATOM   5943 N  N   . PHE H  2 19  ? -37.500 6.183  -37.311 1.00 23.92  ? 19  PHE V N   1 
ATOM   5944 C  CA  . PHE H  2 19  ? -36.287 6.583  -36.536 1.00 22.34  ? 19  PHE V CA  1 
ATOM   5945 C  C   . PHE H  2 19  ? -35.511 5.356  -36.068 1.00 24.02  ? 19  PHE V C   1 
ATOM   5946 O  O   . PHE H  2 19  ? -34.297 5.260  -36.290 1.00 23.51  ? 19  PHE V O   1 
ATOM   5947 C  CB  . PHE H  2 19  ? -36.696 7.461  -35.356 1.00 22.69  ? 19  PHE V CB  1 
ATOM   5948 C  CG  . PHE H  2 19  ? -35.531 7.969  -34.510 1.00 21.58  ? 19  PHE V CG  1 
ATOM   5949 C  CD1 . PHE H  2 19  ? -34.885 9.129  -34.839 1.00 21.46  ? 19  PHE V CD1 1 
ATOM   5950 C  CD2 . PHE H  2 19  ? -35.163 7.339  -33.327 1.00 22.89  ? 19  PHE V CD2 1 
ATOM   5951 C  CE1 . PHE H  2 19  ? -33.859 9.638  -34.065 1.00 21.74  ? 19  PHE V CE1 1 
ATOM   5952 C  CE2 . PHE H  2 19  ? -34.102 7.813  -32.554 1.00 22.59  ? 19  PHE V CE2 1 
ATOM   5953 C  CZ  . PHE H  2 19  ? -33.474 9.009  -32.910 1.00 22.34  ? 19  PHE V CZ  1 
ATOM   5954 N  N   . HIS H  2 20  ? -36.221 4.406  -35.448 1.00 24.60  ? 20  HIS V N   1 
ATOM   5955 C  CA  . HIS H  2 20  ? -35.638 3.172  -34.845 1.00 26.47  ? 20  HIS V CA  1 
ATOM   5956 C  C   . HIS H  2 20  ? -35.064 2.249  -35.880 1.00 27.77  ? 20  HIS V C   1 
ATOM   5957 O  O   . HIS H  2 20  ? -34.073 1.573  -35.614 1.00 28.82  ? 20  HIS V O   1 
ATOM   5958 C  CB  . HIS H  2 20  ? -36.738 2.500  -34.019 1.00 28.50  ? 20  HIS V CB  1 
ATOM   5959 C  CG  . HIS H  2 20  ? -36.295 1.341  -33.135 1.00 31.33  ? 20  HIS V CG  1 
ATOM   5960 N  ND1 . HIS H  2 20  ? -35.290 1.439  -32.225 1.00 32.79  ? 20  HIS V ND1 1 
ATOM   5961 C  CD2 . HIS H  2 20  ? -36.846 0.057  -32.978 1.00 33.88  ? 20  HIS V CD2 1 
ATOM   5962 C  CE1 . HIS H  2 20  ? -35.180 0.249  -31.558 1.00 32.38  ? 20  HIS V CE1 1 
ATOM   5963 N  NE2 . HIS H  2 20  ? -36.123 -0.592 -32.033 1.00 33.93  ? 20  HIS V NE2 1 
ATOM   5964 N  N   . GLN H  2 21  ? -35.643 2.214  -37.074 1.00 26.47  ? 21  GLN V N   1 
ATOM   5965 C  CA  . GLN H  2 21  ? -35.153 1.312  -38.111 1.00 27.04  ? 21  GLN V CA  1 
ATOM   5966 C  C   . GLN H  2 21  ? -33.722 1.676  -38.489 1.00 25.83  ? 21  GLN V C   1 
ATOM   5967 O  O   . GLN H  2 21  ? -32.875 0.798  -38.736 1.00 26.10  ? 21  GLN V O   1 
ATOM   5968 C  CB  . GLN H  2 21  ? -36.065 1.373  -39.354 1.00 27.95  ? 21  GLN V CB  1 
ATOM   5969 C  CG  . GLN H  2 21  ? -35.471 0.733  -40.615 1.00 30.05  ? 21  GLN V CG  1 
ATOM   5970 C  CD  . GLN H  2 21  ? -36.363 0.890  -41.810 1.00 32.05  ? 21  GLN V CD  1 
ATOM   5971 O  OE1 . GLN H  2 21  ? -37.493 1.363  -41.684 1.00 33.90  ? 21  GLN V OE1 1 
ATOM   5972 N  NE2 . GLN H  2 21  ? -35.864 0.517  -42.992 1.00 33.57  ? 21  GLN V NE2 1 
ATOM   5973 N  N   . TYR H  2 22  ? -33.438 2.971  -38.468 1.00 24.69  ? 22  TYR V N   1 
ATOM   5974 C  CA  . TYR H  2 22  ? -32.153 3.463  -38.884 1.00 24.63  ? 22  TYR V CA  1 
ATOM   5975 C  C   . TYR H  2 22  ? -31.228 3.686  -37.678 1.00 23.67  ? 22  TYR V C   1 
ATOM   5976 O  O   . TYR H  2 22  ? -30.018 3.480  -37.760 1.00 24.16  ? 22  TYR V O   1 
ATOM   5977 C  CB  . TYR H  2 22  ? -32.305 4.705  -39.765 1.00 24.92  ? 22  TYR V CB  1 
ATOM   5978 C  CG  . TYR H  2 22  ? -33.009 4.388  -41.063 1.00 24.76  ? 22  TYR V CG  1 
ATOM   5979 C  CD1 . TYR H  2 22  ? -32.319 3.854  -42.155 1.00 26.00  ? 22  TYR V CD1 1 
ATOM   5980 C  CD2 . TYR H  2 22  ? -34.343 4.599  -41.190 1.00 25.32  ? 22  TYR V CD2 1 
ATOM   5981 C  CE1 . TYR H  2 22  ? -32.991 3.525  -43.327 1.00 26.88  ? 22  TYR V CE1 1 
ATOM   5982 C  CE2 . TYR H  2 22  ? -35.008 4.329  -42.349 1.00 26.56  ? 22  TYR V CE2 1 
ATOM   5983 C  CZ  . TYR H  2 22  ? -34.335 3.791  -43.426 1.00 26.22  ? 22  TYR V CZ  1 
ATOM   5984 O  OH  . TYR H  2 22  ? -35.041 3.518  -44.570 1.00 27.41  ? 22  TYR V OH  1 
ATOM   5985 N  N   . SER H  2 23  ? -31.763 4.107  -36.543 1.00 23.20  ? 23  SER V N   1 
ATOM   5986 C  CA  . SER H  2 23  ? -30.859 4.473  -35.432 1.00 23.64  ? 23  SER V CA  1 
ATOM   5987 C  C   . SER H  2 23  ? -30.074 3.304  -34.856 1.00 24.50  ? 23  SER V C   1 
ATOM   5988 O  O   . SER H  2 23  ? -28.995 3.456  -34.277 1.00 23.02  ? 23  SER V O   1 
ATOM   5989 C  CB  . SER H  2 23  ? -31.623 5.187  -34.315 1.00 23.36  ? 23  SER V CB  1 
ATOM   5990 O  OG  . SER H  2 23  ? -32.507 4.275  -33.690 1.00 23.25  ? 23  SER V OG  1 
ATOM   5991 N  N   . VAL H  2 24  ? -30.654 2.130  -34.979 1.00 25.15  ? 24  VAL V N   1 
ATOM   5992 C  CA  . VAL H  2 24  ? -30.086 0.929  -34.434 1.00 26.35  ? 24  VAL V CA  1 
ATOM   5993 C  C   . VAL H  2 24  ? -28.878 0.366  -35.221 1.00 26.83  ? 24  VAL V C   1 
ATOM   5994 O  O   . VAL H  2 24  ? -28.116 -0.505 -34.718 1.00 27.05  ? 24  VAL V O   1 
ATOM   5995 C  CB  . VAL H  2 24  ? -31.344 0.052  -34.375 1.00 28.23  ? 24  VAL V CB  1 
ATOM   5996 C  CG1 . VAL H  2 24  ? -31.439 -0.957 -35.484 1.00 27.81  ? 24  VAL V CG1 1 
ATOM   5997 C  CG2 . VAL H  2 24  ? -31.787 -0.207 -32.950 1.00 30.34  ? 24  VAL V CG2 1 
ATOM   5998 N  N   . LYS H  2 25  ? -28.699 0.843  -36.446 1.00 25.94  ? 25  LYS V N   1 
ATOM   5999 C  CA  . LYS H  2 25  ? -27.733 0.218  -37.367 1.00 27.37  ? 25  LYS V CA  1 
ATOM   6000 C  C   . LYS H  2 25  ? -26.268 0.312  -36.939 1.00 28.80  ? 25  LYS V C   1 
ATOM   6001 O  O   . LYS H  2 25  ? -25.498 -0.624 -37.158 1.00 28.90  ? 25  LYS V O   1 
ATOM   6002 C  CB  . LYS H  2 25  ? -27.910 0.804  -38.764 1.00 27.56  ? 25  LYS V CB  1 
ATOM   6003 C  CG  . LYS H  2 25  ? -29.219 0.403  -39.367 1.00 29.30  ? 25  LYS V CG  1 
ATOM   6004 C  CD  . LYS H  2 25  ? -29.321 0.745  -40.835 1.00 29.99  ? 25  LYS V CD  1 
ATOM   6005 C  CE  . LYS H  2 25  ? -30.664 0.310  -41.336 1.00 31.38  ? 25  LYS V CE  1 
ATOM   6006 N  NZ  . LYS H  2 25  ? -30.682 0.071  -42.786 1.00 33.50  ? 25  LYS V NZ  1 
ATOM   6007 N  N   . LEU H  2 26  ? -25.900 1.441  -36.335 1.00 27.77  ? 26  LEU V N   1 
ATOM   6008 C  CA  . LEU H  2 26  ? -24.508 1.773  -36.016 1.00 29.11  ? 26  LEU V CA  1 
ATOM   6009 C  C   . LEU H  2 26  ? -24.446 2.538  -34.705 1.00 28.73  ? 26  LEU V C   1 
ATOM   6010 O  O   . LEU H  2 26  ? -25.316 3.348  -34.404 1.00 27.71  ? 26  LEU V O   1 
ATOM   6011 C  CB  . LEU H  2 26  ? -23.943 2.687  -37.102 1.00 29.92  ? 26  LEU V CB  1 
ATOM   6012 C  CG  . LEU H  2 26  ? -23.910 2.148  -38.536 1.00 31.77  ? 26  LEU V CG  1 
ATOM   6013 C  CD1 . LEU H  2 26  ? -23.588 3.303  -39.472 1.00 32.77  ? 26  LEU V CD1 1 
ATOM   6014 C  CD2 . LEU H  2 26  ? -22.906 1.017  -38.675 1.00 33.17  ? 26  LEU V CD2 1 
ATOM   6015 N  N   . GLY H  2 27  ? -23.384 2.291  -33.944 1.00 30.58  ? 27  GLY V N   1 
ATOM   6016 C  CA  . GLY H  2 27  ? -23.107 3.001  -32.698 1.00 30.85  ? 27  GLY V CA  1 
ATOM   6017 C  C   . GLY H  2 27  ? -24.296 3.026  -31.749 1.00 30.47  ? 27  GLY V C   1 
ATOM   6018 O  O   . GLY H  2 27  ? -24.972 2.008  -31.550 1.00 29.75  ? 27  GLY V O   1 
ATOM   6019 N  N   . HIS H  2 28  ? -24.565 4.194  -31.188 1.00 28.57  ? 28  HIS V N   1 
ATOM   6020 C  CA  . HIS H  2 28  ? -25.708 4.305  -30.296 1.00 29.04  ? 28  HIS V CA  1 
ATOM   6021 C  C   . HIS H  2 28  ? -26.997 3.952  -31.025 1.00 26.36  ? 28  HIS V C   1 
ATOM   6022 O  O   . HIS H  2 28  ? -27.318 4.523  -32.120 1.00 24.04  ? 28  HIS V O   1 
ATOM   6023 C  CB  . HIS H  2 28  ? -25.812 5.695  -29.673 1.00 30.25  ? 28  HIS V CB  1 
ATOM   6024 C  CG  . HIS H  2 28  ? -26.662 5.713  -28.419 1.00 33.07  ? 28  HIS V CG  1 
ATOM   6025 N  ND1 . HIS H  2 28  ? -27.988 5.425  -28.437 1.00 32.87  ? 28  HIS V ND1 1 
ATOM   6026 C  CD2 . HIS H  2 28  ? -26.324 5.900  -27.077 1.00 36.37  ? 28  HIS V CD2 1 
ATOM   6027 C  CE1 . HIS H  2 28  ? -28.476 5.476  -27.189 1.00 35.15  ? 28  HIS V CE1 1 
ATOM   6028 N  NE2 . HIS H  2 28  ? -27.467 5.787  -26.358 1.00 37.04  ? 28  HIS V NE2 1 
ATOM   6029 N  N   . PRO H  2 29  ? -27.740 2.982  -30.440 1.00 27.02  ? 29  PRO V N   1 
ATOM   6030 C  CA  . PRO H  2 29  ? -28.935 2.460  -31.077 1.00 26.94  ? 29  PRO V CA  1 
ATOM   6031 C  C   . PRO H  2 29  ? -30.126 3.380  -30.999 1.00 26.38  ? 29  PRO V C   1 
ATOM   6032 O  O   . PRO H  2 29  ? -31.126 3.081  -31.632 1.00 25.28  ? 29  PRO V O   1 
ATOM   6033 C  CB  . PRO H  2 29  ? -29.233 1.187  -30.290 1.00 28.45  ? 29  PRO V CB  1 
ATOM   6034 C  CG  . PRO H  2 29  ? -28.723 1.463  -28.905 1.00 30.05  ? 29  PRO V CG  1 
ATOM   6035 C  CD  . PRO H  2 29  ? -27.506 2.336  -29.119 1.00 30.03  ? 29  PRO V CD  1 
ATOM   6036 N  N   . ASP H  2 30  ? -30.029 4.465  -30.240 1.00 25.97  ? 30  ASP V N   1 
ATOM   6037 C  CA  . ASP H  2 30  ? -31.185 5.374  -30.131 1.00 26.23  ? 30  ASP V CA  1 
ATOM   6038 C  C   . ASP H  2 30  ? -30.845 6.779  -30.629 1.00 24.62  ? 30  ASP V C   1 
ATOM   6039 O  O   . ASP H  2 30  ? -31.576 7.706  -30.363 1.00 24.04  ? 30  ASP V O   1 
ATOM   6040 C  CB  . ASP H  2 30  ? -31.726 5.386  -28.694 1.00 27.76  ? 30  ASP V CB  1 
ATOM   6041 C  CG  . ASP H  2 30  ? -33.159 5.994  -28.592 1.00 28.46  ? 30  ASP V CG  1 
ATOM   6042 O  OD1 . ASP H  2 30  ? -34.012 5.795  -29.502 1.00 27.38  ? 30  ASP V OD1 1 
ATOM   6043 O  OD2 . ASP H  2 30  ? -33.440 6.726  -27.612 1.00 30.12  ? 30  ASP V OD2 1 
ATOM   6044 N  N   . THR H  2 31  ? -29.743 6.936  -31.356 1.00 24.03  ? 31  THR V N   1 
ATOM   6045 C  CA  . THR H  2 31  ? -29.456 8.189  -32.038 1.00 23.06  ? 31  THR V CA  1 
ATOM   6046 C  C   . THR H  2 31  ? -29.048 7.867  -33.464 1.00 23.51  ? 31  THR V C   1 
ATOM   6047 O  O   . THR H  2 31  ? -28.556 6.747  -33.738 1.00 22.77  ? 31  THR V O   1 
ATOM   6048 C  CB  . THR H  2 31  ? -28.394 9.024  -31.283 1.00 24.23  ? 31  THR V CB  1 
ATOM   6049 O  OG1 . THR H  2 31  ? -27.144 8.343  -31.295 1.00 24.63  ? 31  THR V OG1 1 
ATOM   6050 C  CG2 . THR H  2 31  ? -28.811 9.286  -29.823 1.00 25.36  ? 31  THR V CG2 1 
ATOM   6051 N  N   . LEU H  2 32  ? -29.331 8.787  -34.378 1.00 22.50  ? 32  LEU V N   1 
ATOM   6052 C  CA  . LEU H  2 32  ? -28.881 8.729  -35.746 1.00 22.89  ? 32  LEU V CA  1 
ATOM   6053 C  C   . LEU H  2 32  ? -27.548 9.443  -35.898 1.00 22.94  ? 32  LEU V C   1 
ATOM   6054 O  O   . LEU H  2 32  ? -27.440 10.651 -35.612 1.00 22.49  ? 32  LEU V O   1 
ATOM   6055 C  CB  . LEU H  2 32  ? -29.899 9.424  -36.657 1.00 21.56  ? 32  LEU V CB  1 
ATOM   6056 C  CG  . LEU H  2 32  ? -31.320 8.848  -36.753 1.00 22.08  ? 32  LEU V CG  1 
ATOM   6057 C  CD1 . LEU H  2 32  ? -32.209 9.903  -37.369 1.00 21.69  ? 32  LEU V CD1 1 
ATOM   6058 C  CD2 . LEU H  2 32  ? -31.440 7.534  -37.499 1.00 22.59  ? 32  LEU V CD2 1 
ATOM   6059 N  N   . ASN H  2 33  ? -26.544 8.721  -36.367 1.00 23.75  ? 33  ASN V N   1 
ATOM   6060 C  CA  . ASN H  2 33  ? -25.316 9.369  -36.819 1.00 24.56  ? 33  ASN V CA  1 
ATOM   6061 C  C   . ASN H  2 33  ? -25.576 9.877  -38.242 1.00 23.97  ? 33  ASN V C   1 
ATOM   6062 O  O   . ASN H  2 33  ? -26.689 9.690  -38.777 1.00 24.54  ? 33  ASN V O   1 
ATOM   6063 C  CB  . ASN H  2 33  ? -24.081 8.451  -36.703 1.00 25.75  ? 33  ASN V CB  1 
ATOM   6064 C  CG  . ASN H  2 33  ? -24.109 7.257  -37.654 1.00 26.38  ? 33  ASN V CG  1 
ATOM   6065 O  OD1 . ASN H  2 33  ? -24.902 7.176  -38.613 1.00 25.09  ? 33  ASN V OD1 1 
ATOM   6066 N  ND2 . ASN H  2 33  ? -23.269 6.260  -37.333 1.00 28.02  ? 33  ASN V ND2 1 
ATOM   6067 N  N   . GLN H  2 34  ? -24.589 10.497 -38.861 1.00 25.46  ? 34  GLN V N   1 
ATOM   6068 C  CA  . GLN H  2 34  ? -24.818 11.119 -40.186 1.00 26.50  ? 34  GLN V CA  1 
ATOM   6069 C  C   . GLN H  2 34  ? -25.196 10.121 -41.300 1.00 26.48  ? 34  GLN V C   1 
ATOM   6070 O  O   . GLN H  2 34  ? -26.051 10.403 -42.141 1.00 27.11  ? 34  GLN V O   1 
ATOM   6071 C  CB  . GLN H  2 34  ? -23.612 11.963 -40.590 1.00 30.07  ? 34  GLN V CB  1 
ATOM   6072 C  CG  . GLN H  2 34  ? -23.659 12.511 -42.014 1.00 32.19  ? 34  GLN V CG  1 
ATOM   6073 C  CD  . GLN H  2 34  ? -22.793 13.753 -42.195 1.00 35.18  ? 34  GLN V CD  1 
ATOM   6074 O  OE1 . GLN H  2 34  ? -23.220 14.875 -41.897 1.00 40.62  ? 34  GLN V OE1 1 
ATOM   6075 N  NE2 . GLN H  2 34  ? -21.609 13.563 -42.711 1.00 37.64  ? 34  GLN V NE2 1 
ATOM   6076 N  N   . GLY H  2 35  ? -24.567 8.948  -41.303 1.00 26.29  ? 35  GLY V N   1 
ATOM   6077 C  CA  . GLY H  2 35  ? -24.843 7.959  -42.315 1.00 27.51  ? 35  GLY V CA  1 
ATOM   6078 C  C   . GLY H  2 35  ? -26.263 7.436  -42.163 1.00 26.00  ? 35  GLY V C   1 
ATOM   6079 O  O   . GLY H  2 35  ? -26.930 7.207  -43.161 1.00 27.72  ? 35  GLY V O   1 
ATOM   6080 N  N   . GLU H  2 36  ? -26.712 7.211  -40.920 1.00 24.57  ? 36  GLU V N   1 
ATOM   6081 C  CA  . GLU H  2 36  ? -28.024 6.650  -40.681 1.00 24.23  ? 36  GLU V CA  1 
ATOM   6082 C  C   . GLU H  2 36  ? -29.093 7.679  -41.049 1.00 23.56  ? 36  GLU V C   1 
ATOM   6083 O  O   . GLU H  2 36  ? -30.131 7.358  -41.671 1.00 22.61  ? 36  GLU V O   1 
ATOM   6084 C  CB  . GLU H  2 36  ? -28.216 6.269  -39.206 1.00 24.56  ? 36  GLU V CB  1 
ATOM   6085 C  CG  . GLU H  2 36  ? -27.418 5.057  -38.715 1.00 25.78  ? 36  GLU V CG  1 
ATOM   6086 C  CD  . GLU H  2 36  ? -27.359 4.961  -37.198 1.00 25.92  ? 36  GLU V CD  1 
ATOM   6087 O  OE1 . GLU H  2 36  ? -27.426 5.981  -36.518 1.00 24.83  ? 36  GLU V OE1 1 
ATOM   6088 O  OE2 . GLU H  2 36  ? -27.250 3.854  -36.635 1.00 27.35  ? 36  GLU V OE2 1 
ATOM   6089 N  N   . PHE H  2 37  ? -28.822 8.922  -40.672 1.00 22.36  ? 37  PHE V N   1 
ATOM   6090 C  CA  . PHE H  2 37  ? -29.710 10.011 -41.061 1.00 22.09  ? 37  PHE V CA  1 
ATOM   6091 C  C   . PHE H  2 37  ? -29.841 10.125 -42.590 1.00 23.21  ? 37  PHE V C   1 
ATOM   6092 O  O   . PHE H  2 37  ? -30.935 10.256 -43.117 1.00 21.65  ? 37  PHE V O   1 
ATOM   6093 C  CB  . PHE H  2 37  ? -29.236 11.360 -40.457 1.00 21.90  ? 37  PHE V CB  1 
ATOM   6094 C  CG  . PHE H  2 37  ? -30.077 12.547 -40.867 1.00 21.40  ? 37  PHE V CG  1 
ATOM   6095 C  CD1 . PHE H  2 37  ? -31.390 12.687 -40.405 1.00 21.82  ? 37  PHE V CD1 1 
ATOM   6096 C  CD2 . PHE H  2 37  ? -29.551 13.546 -41.692 1.00 22.01  ? 37  PHE V CD2 1 
ATOM   6097 C  CE1 . PHE H  2 37  ? -32.162 13.802 -40.760 1.00 19.68  ? 37  PHE V CE1 1 
ATOM   6098 C  CE2 . PHE H  2 37  ? -30.322 14.638 -42.065 1.00 21.31  ? 37  PHE V CE2 1 
ATOM   6099 C  CZ  . PHE H  2 37  ? -31.634 14.757 -41.596 1.00 20.92  ? 37  PHE V CZ  1 
ATOM   6100 N  N   . LYS H  2 38  ? -28.713 10.057 -43.296 1.00 25.66  ? 38  LYS V N   1 
ATOM   6101 C  CA  . LYS H  2 38  ? -28.715 10.203 -44.736 1.00 26.40  ? 38  LYS V CA  1 
ATOM   6102 C  C   . LYS H  2 38  ? -29.518 9.073  -45.366 1.00 26.65  ? 38  LYS V C   1 
ATOM   6103 O  O   . LYS H  2 38  ? -30.208 9.282  -46.352 1.00 26.51  ? 38  LYS V O   1 
ATOM   6104 C  CB  . LYS H  2 38  ? -27.265 10.214 -45.284 1.00 27.90  ? 38  LYS V CB  1 
ATOM   6105 C  CG  . LYS H  2 38  ? -26.475 11.488 -45.034 1.00 27.36  ? 38  LYS V CG  1 
ATOM   6106 C  CD  . LYS H  2 38  ? -25.096 11.387 -45.736 1.00 28.91  ? 38  LYS V CD  1 
ATOM   6107 C  CE  . LYS H  2 38  ? -24.258 12.652 -45.618 1.00 29.65  ? 38  LYS V CE  1 
ATOM   6108 N  NZ  . LYS H  2 38  ? -22.827 12.489 -46.047 1.00 30.02  ? 38  LYS V NZ  1 
ATOM   6109 N  N   . GLU H  2 39  ? -29.446 7.870  -44.778 1.00 26.81  ? 39  GLU V N   1 
ATOM   6110 C  CA  . GLU H  2 39  ? -30.143 6.747  -45.351 1.00 27.48  ? 39  GLU V CA  1 
ATOM   6111 C  C   . GLU H  2 39  ? -31.647 6.919  -45.185 1.00 25.83  ? 39  GLU V C   1 
ATOM   6112 O  O   . GLU H  2 39  ? -32.395 6.714  -46.133 1.00 24.54  ? 39  GLU V O   1 
ATOM   6113 C  CB  . GLU H  2 39  ? -29.678 5.428  -44.742 1.00 29.06  ? 39  GLU V CB  1 
ATOM   6114 C  CG  . GLU H  2 39  ? -30.287 4.234  -45.466 1.00 31.38  ? 39  GLU V CG  1 
ATOM   6115 C  CD  . GLU H  2 39  ? -29.888 2.908  -44.879 1.00 33.39  ? 39  GLU V CD  1 
ATOM   6116 O  OE1 . GLU H  2 39  ? -29.067 2.884  -43.930 1.00 35.82  ? 39  GLU V OE1 1 
ATOM   6117 O  OE2 . GLU H  2 39  ? -30.404 1.903  -45.399 1.00 38.26  ? 39  GLU V OE2 1 
ATOM   6118 N  N   . LEU H  2 40  ? -32.067 7.341  -43.985 1.00 24.51  ? 40  LEU V N   1 
ATOM   6119 C  CA  . LEU H  2 40  ? -33.466 7.622  -43.706 1.00 24.12  ? 40  LEU V CA  1 
ATOM   6120 C  C   . LEU H  2 40  ? -33.980 8.672  -44.683 1.00 23.93  ? 40  LEU V C   1 
ATOM   6121 O  O   . LEU H  2 40  ? -35.020 8.484  -45.316 1.00 24.35  ? 40  LEU V O   1 
ATOM   6122 C  CB  . LEU H  2 40  ? -33.608 8.122  -42.275 1.00 23.59  ? 40  LEU V CB  1 
ATOM   6123 C  CG  . LEU H  2 40  ? -35.016 8.258  -41.750 1.00 23.79  ? 40  LEU V CG  1 
ATOM   6124 C  CD1 . LEU H  2 40  ? -34.966 8.233  -40.248 1.00 22.87  ? 40  LEU V CD1 1 
ATOM   6125 C  CD2 . LEU H  2 40  ? -35.673 9.559  -42.234 1.00 22.02  ? 40  LEU V CD2 1 
ATOM   6126 N  N   . VAL H  2 41  ? -33.266 9.788  -44.802 1.00 23.80  ? 41  VAL V N   1 
ATOM   6127 C  CA  . VAL H  2 41  ? -33.721 10.867 -45.698 1.00 24.06  ? 41  VAL V CA  1 
ATOM   6128 C  C   . VAL H  2 41  ? -33.816 10.457 -47.187 1.00 25.49  ? 41  VAL V C   1 
ATOM   6129 O  O   . VAL H  2 41  ? -34.763 10.815 -47.921 1.00 24.20  ? 41  VAL V O   1 
ATOM   6130 C  CB  . VAL H  2 41  ? -32.829 12.089 -45.529 1.00 25.63  ? 41  VAL V CB  1 
ATOM   6131 C  CG1 . VAL H  2 41  ? -33.039 13.094 -46.664 1.00 26.09  ? 41  VAL V CG1 1 
ATOM   6132 C  CG2 . VAL H  2 41  ? -33.023 12.702 -44.116 1.00 24.47  ? 41  VAL V CG2 1 
ATOM   6133 N  N   . ARG H  2 42  ? -32.828 9.674  -47.613 1.00 27.68  ? 42  ARG V N   1 
ATOM   6134 C  CA  . ARG H  2 42  ? -32.752 9.221  -48.992 1.00 29.91  ? 42  ARG V CA  1 
ATOM   6135 C  C   . ARG H  2 42  ? -33.919 8.296  -49.373 1.00 29.62  ? 42  ARG V C   1 
ATOM   6136 O  O   . ARG H  2 42  ? -34.417 8.305  -50.530 1.00 29.43  ? 42  ARG V O   1 
ATOM   6137 C  CB  . ARG H  2 42  ? -31.411 8.506  -49.192 1.00 33.35  ? 42  ARG V CB  1 
ATOM   6138 C  CG  . ARG H  2 42  ? -31.156 8.056  -50.610 1.00 38.34  ? 42  ARG V CG  1 
ATOM   6139 C  CD  . ARG H  2 42  ? -29.835 7.315  -50.718 1.00 42.32  ? 42  ARG V CD  1 
ATOM   6140 N  NE  . ARG H  2 42  ? -30.121 5.952  -51.117 1.00 49.61  ? 42  ARG V NE  1 
ATOM   6141 C  CZ  . ARG H  2 42  ? -29.853 4.854  -50.418 1.00 50.12  ? 42  ARG V CZ  1 
ATOM   6142 N  NH1 . ARG H  2 42  ? -30.227 3.705  -50.928 1.00 53.63  ? 42  ARG V NH1 1 
ATOM   6143 N  NH2 . ARG H  2 42  ? -29.224 4.891  -49.235 1.00 50.27  ? 42  ARG V NH2 1 
ATOM   6144 N  N   . LYS H  2 43  ? -34.323 7.467  -48.420 1.00 28.93  ? 43  LYS V N   1 
ATOM   6145 C  CA  . LYS H  2 43  ? -35.327 6.464  -48.681 1.00 29.70  ? 43  LYS V CA  1 
ATOM   6146 C  C   . LYS H  2 43  ? -36.685 6.945  -48.283 1.00 29.03  ? 43  LYS V C   1 
ATOM   6147 O  O   . LYS H  2 43  ? -37.575 7.082  -49.115 1.00 29.31  ? 43  LYS V O   1 
ATOM   6148 C  CB  . LYS H  2 43  ? -34.981 5.167  -47.964 1.00 31.11  ? 43  LYS V CB  1 
ATOM   6149 C  CG  . LYS H  2 43  ? -33.667 4.592  -48.476 1.00 33.24  ? 43  LYS V CG  1 
ATOM   6150 C  CD  . LYS H  2 43  ? -33.381 3.185  -47.952 1.00 35.81  ? 43  LYS V CD  1 
ATOM   6151 C  CE  . LYS H  2 43  ? -32.039 2.681  -48.471 1.00 38.27  ? 43  LYS V CE  1 
ATOM   6152 N  NZ  . LYS H  2 43  ? -31.535 1.473  -47.749 1.00 41.69  ? 43  LYS V NZ  1 
ATOM   6153 N  N   . ASP H  2 44  ? -36.825 7.270  -47.016 1.00 26.66  ? 44  ASP V N   1 
ATOM   6154 C  CA  . ASP H  2 44  ? -38.156 7.560  -46.474 1.00 26.60  ? 44  ASP V CA  1 
ATOM   6155 C  C   . ASP H  2 44  ? -38.652 8.992  -46.642 1.00 24.58  ? 44  ASP V C   1 
ATOM   6156 O  O   . ASP H  2 44  ? -39.840 9.263  -46.477 1.00 24.83  ? 44  ASP V O   1 
ATOM   6157 C  CB  . ASP H  2 44  ? -38.213 7.110  -45.005 1.00 26.23  ? 44  ASP V CB  1 
ATOM   6158 C  CG  . ASP H  2 44  ? -38.011 5.621  -44.847 1.00 28.82  ? 44  ASP V CG  1 
ATOM   6159 O  OD1 . ASP H  2 44  ? -38.804 4.845  -45.368 1.00 32.66  ? 44  ASP V OD1 1 
ATOM   6160 O  OD2 . ASP H  2 44  ? -37.050 5.213  -44.205 1.00 34.79  ? 44  ASP V OD2 1 
ATOM   6161 N  N   . LEU H  2 45  ? -37.784 9.893  -47.050 1.00 23.98  ? 45  LEU V N   1 
ATOM   6162 C  CA  . LEU H  2 45  ? -38.175 11.254 -47.417 1.00 23.49  ? 45  LEU V CA  1 
ATOM   6163 C  C   . LEU H  2 45  ? -37.768 11.491 -48.888 1.00 24.71  ? 45  LEU V C   1 
ATOM   6164 O  O   . LEU H  2 45  ? -37.416 12.596 -49.314 1.00 24.50  ? 45  LEU V O   1 
ATOM   6165 C  CB  . LEU H  2 45  ? -37.506 12.222 -46.436 1.00 22.53  ? 45  LEU V CB  1 
ATOM   6166 C  CG  . LEU H  2 45  ? -38.027 12.071 -44.987 1.00 21.23  ? 45  LEU V CG  1 
ATOM   6167 C  CD1 . LEU H  2 45  ? -37.262 12.965 -44.014 1.00 20.30  ? 45  LEU V CD1 1 
ATOM   6168 C  CD2 . LEU H  2 45  ? -39.512 12.403 -44.922 1.00 21.61  ? 45  LEU V CD2 1 
ATOM   6169 N  N   . GLN H  2 46  ? -37.799 10.416 -49.679 1.00 27.03  ? 46  GLN V N   1 
ATOM   6170 C  CA  . GLN H  2 46  ? -37.355 10.520 -51.056 1.00 28.48  ? 46  GLN V CA  1 
ATOM   6171 C  C   . GLN H  2 46  ? -38.212 11.504 -51.867 1.00 28.99  ? 46  GLN V C   1 
ATOM   6172 O  O   . GLN H  2 46  ? -37.732 12.067 -52.866 1.00 31.50  ? 46  GLN V O   1 
ATOM   6173 C  CB  . GLN H  2 46  ? -37.324 9.165  -51.718 1.00 29.99  ? 46  GLN V CB  1 
ATOM   6174 C  CG  . GLN H  2 46  ? -38.691 8.564  -52.004 1.00 30.44  ? 46  GLN V CG  1 
ATOM   6175 C  CD  . GLN H  2 46  ? -38.582 7.209  -52.674 1.00 32.23  ? 46  GLN V CD  1 
ATOM   6176 O  OE1 . GLN H  2 46  ? -38.967 7.042  -53.846 1.00 33.96  ? 46  GLN V OE1 1 
ATOM   6177 N  NE2 . GLN H  2 46  ? -38.076 6.236  -51.947 1.00 32.73  ? 46  GLN V NE2 1 
ATOM   6178 N  N   . ASN H  2 47  ? -39.443 11.758 -51.431 1.00 28.30  ? 47  ASN V N   1 
ATOM   6179 C  CA  . ASN H  2 47  ? -40.293 12.735 -52.131 1.00 28.10  ? 47  ASN V CA  1 
ATOM   6180 C  C   . ASN H  2 47  ? -40.321 14.121 -51.453 1.00 26.99  ? 47  ASN V C   1 
ATOM   6181 O  O   . ASN H  2 47  ? -40.178 15.171 -52.117 1.00 28.62  ? 47  ASN V O   1 
ATOM   6182 C  CB  . ASN H  2 47  ? -41.716 12.215 -52.309 1.00 28.62  ? 47  ASN V CB  1 
ATOM   6183 C  CG  . ASN H  2 47  ? -41.749 10.870 -52.992 1.00 29.64  ? 47  ASN V CG  1 
ATOM   6184 O  OD1 . ASN H  2 47  ? -41.392 10.769 -54.171 1.00 30.13  ? 47  ASN V OD1 1 
ATOM   6185 N  ND2 . ASN H  2 47  ? -42.188 9.848  -52.280 1.00 28.48  ? 47  ASN V ND2 1 
ATOM   6186 N  N   . PHE H  2 48  ? -40.513 14.113 -50.151 1.00 25.73  ? 48  PHE V N   1 
ATOM   6187 C  CA  . PHE H  2 48  ? -40.561 15.361 -49.364 1.00 25.22  ? 48  PHE V CA  1 
ATOM   6188 C  C   . PHE H  2 48  ? -39.255 16.139 -49.435 1.00 24.92  ? 48  PHE V C   1 
ATOM   6189 O  O   . PHE H  2 48  ? -39.280 17.376 -49.394 1.00 25.66  ? 48  PHE V O   1 
ATOM   6190 C  CB  . PHE H  2 48  ? -40.921 15.070 -47.899 1.00 24.45  ? 48  PHE V CB  1 
ATOM   6191 C  CG  . PHE H  2 48  ? -42.416 14.938 -47.633 1.00 25.03  ? 48  PHE V CG  1 
ATOM   6192 C  CD1 . PHE H  2 48  ? -43.322 14.595 -48.613 1.00 26.65  ? 48  PHE V CD1 1 
ATOM   6193 C  CD2 . PHE H  2 48  ? -42.888 15.151 -46.355 1.00 25.95  ? 48  PHE V CD2 1 
ATOM   6194 C  CE1 . PHE H  2 48  ? -44.681 14.488 -48.329 1.00 26.97  ? 48  PHE V CE1 1 
ATOM   6195 C  CE2 . PHE H  2 48  ? -44.220 15.073 -46.055 1.00 25.70  ? 48  PHE V CE2 1 
ATOM   6196 C  CZ  . PHE H  2 48  ? -45.129 14.728 -47.020 1.00 26.15  ? 48  PHE V CZ  1 
ATOM   6197 N  N   . LEU H  2 49  ? -38.117 15.425 -49.524 1.00 25.78  ? 49  LEU V N   1 
ATOM   6198 C  CA  . LEU H  2 49  ? -36.791 16.051 -49.654 1.00 25.05  ? 49  LEU V CA  1 
ATOM   6199 C  C   . LEU H  2 49  ? -36.094 15.717 -50.996 1.00 26.48  ? 49  LEU V C   1 
ATOM   6200 O  O   . LEU H  2 49  ? -34.879 15.472 -51.077 1.00 26.22  ? 49  LEU V O   1 
ATOM   6201 C  CB  . LEU H  2 49  ? -35.937 15.678 -48.429 1.00 24.73  ? 49  LEU V CB  1 
ATOM   6202 C  CG  . LEU H  2 49  ? -36.385 16.272 -47.058 1.00 24.02  ? 49  LEU V CG  1 
ATOM   6203 C  CD1 . LEU H  2 49  ? -35.546 15.764 -45.906 1.00 24.35  ? 49  LEU V CD1 1 
ATOM   6204 C  CD2 . LEU H  2 49  ? -36.314 17.784 -47.089 1.00 24.31  ? 49  LEU V CD2 1 
ATOM   6205 N  N   . LYS H  2 50  ? -36.870 15.725 -52.069 1.00 27.14  ? 50  LYS V N   1 
ATOM   6206 C  CA  . LYS H  2 50  ? -36.362 15.292 -53.343 1.00 30.27  ? 50  LYS V CA  1 
ATOM   6207 C  C   . LYS H  2 50  ? -35.259 16.214 -53.857 1.00 30.03  ? 50  LYS V C   1 
ATOM   6208 O  O   . LYS H  2 50  ? -34.210 15.750 -54.326 1.00 30.72  ? 50  LYS V O   1 
ATOM   6209 C  CB  . LYS H  2 50  ? -37.497 15.200 -54.386 1.00 32.76  ? 50  LYS V CB  1 
ATOM   6210 C  CG  . LYS H  2 50  ? -37.029 14.748 -55.779 1.00 36.37  ? 50  LYS V CG  1 
ATOM   6211 C  CD  . LYS H  2 50  ? -38.136 14.696 -56.818 1.00 39.32  ? 50  LYS V CD  1 
ATOM   6212 C  CE  . LYS H  2 50  ? -37.671 14.038 -58.117 1.00 42.01  ? 50  LYS V CE  1 
ATOM   6213 N  NZ  . LYS H  2 50  ? -38.778 13.205 -58.677 1.00 44.82  ? 50  LYS V NZ  1 
ATOM   6214 N  N   . LYS H  2 51  ? -35.493 17.507 -53.787 1.00 29.11  ? 51  LYS V N   1 
ATOM   6215 C  CA  . LYS H  2 51  ? -34.498 18.431 -54.278 1.00 30.69  ? 51  LYS V CA  1 
ATOM   6216 C  C   . LYS H  2 51  ? -33.228 18.356 -53.415 1.00 29.33  ? 51  LYS V C   1 
ATOM   6217 O  O   . LYS H  2 51  ? -32.099 18.326 -53.910 1.00 28.87  ? 51  LYS V O   1 
ATOM   6218 C  CB  . LYS H  2 51  ? -35.069 19.835 -54.270 1.00 32.38  ? 51  LYS V CB  1 
ATOM   6219 C  CG  . LYS H  2 51  ? -34.113 20.848 -54.890 1.00 35.76  ? 51  LYS V CG  1 
ATOM   6220 C  CD  . LYS H  2 51  ? -34.625 22.265 -54.707 1.00 36.41  ? 51  LYS V CD  1 
ATOM   6221 C  CE  . LYS H  2 51  ? -33.690 23.267 -55.359 1.00 38.78  ? 51  LYS V CE  1 
ATOM   6222 N  NZ  . LYS H  2 51  ? -34.218 24.630 -55.077 1.00 40.28  ? 51  LYS V NZ  1 
ATOM   6223 N  N   . GLU H  2 52  ? -33.451 18.312 -52.115 1.00 28.91  ? 52  GLU V N   1 
ATOM   6224 C  CA  . GLU H  2 52  ? -32.405 18.318 -51.109 1.00 27.83  ? 52  GLU V CA  1 
ATOM   6225 C  C   . GLU H  2 52  ? -31.537 17.076 -51.233 1.00 28.06  ? 52  GLU V C   1 
ATOM   6226 O  O   . GLU H  2 52  ? -30.304 17.171 -51.176 1.00 27.77  ? 52  GLU V O   1 
ATOM   6227 C  CB  . GLU H  2 52  ? -33.009 18.399 -49.687 1.00 28.51  ? 52  GLU V CB  1 
ATOM   6228 C  CG  . GLU H  2 52  ? -33.737 19.701 -49.352 1.00 28.03  ? 52  GLU V CG  1 
ATOM   6229 C  CD  . GLU H  2 52  ? -35.166 19.766 -49.846 1.00 30.41  ? 52  GLU V CD  1 
ATOM   6230 O  OE1 . GLU H  2 52  ? -35.574 18.933 -50.702 1.00 30.54  ? 52  GLU V OE1 1 
ATOM   6231 O  OE2 . GLU H  2 52  ? -35.879 20.697 -49.385 1.00 32.28  ? 52  GLU V OE2 1 
ATOM   6232 N  N   . ASN H  2 53  ? -32.166 15.914 -51.395 1.00 27.38  ? 53  ASN V N   1 
ATOM   6233 C  CA  . ASN H  2 53  ? -31.425 14.631 -51.561 1.00 28.91  ? 53  ASN V CA  1 
ATOM   6234 C  C   . ASN H  2 53  ? -30.415 14.604 -52.726 1.00 30.64  ? 53  ASN V C   1 
ATOM   6235 O  O   . ASN H  2 53  ? -29.495 13.784 -52.747 1.00 30.69  ? 53  ASN V O   1 
ATOM   6236 C  CB  . ASN H  2 53  ? -32.383 13.434 -51.717 1.00 30.21  ? 53  ASN V CB  1 
ATOM   6237 C  CG  . ASN H  2 53  ? -32.747 12.775 -50.381 1.00 28.91  ? 53  ASN V CG  1 
ATOM   6238 O  OD1 . ASN H  2 53  ? -31.866 12.321 -49.649 1.00 31.14  ? 53  ASN V OD1 1 
ATOM   6239 N  ND2 . ASN H  2 53  ? -34.041 12.655 -50.098 1.00 28.20  ? 53  ASN V ND2 1 
ATOM   6240 N  N   . LYS H  2 54  ? -30.581 15.463 -53.711 1.00 31.02  ? 54  LYS V N   1 
ATOM   6241 C  CA  . LYS H  2 54  ? -29.576 15.512 -54.789 1.00 33.64  ? 54  LYS V CA  1 
ATOM   6242 C  C   . LYS H  2 54  ? -28.202 15.979 -54.359 1.00 33.90  ? 54  LYS V C   1 
ATOM   6243 O  O   . LYS H  2 54  ? -27.189 15.718 -55.059 1.00 36.21  ? 54  LYS V O   1 
ATOM   6244 C  CB  . LYS H  2 54  ? -30.043 16.460 -55.858 1.00 34.66  ? 54  LYS V CB  1 
ATOM   6245 C  CG  . LYS H  2 54  ? -31.260 15.954 -56.553 1.00 35.47  ? 54  LYS V CG  1 
ATOM   6246 C  CD  . LYS H  2 54  ? -31.610 16.887 -57.683 1.00 36.74  ? 54  LYS V CD  1 
ATOM   6247 C  CE  . LYS H  2 54  ? -33.019 16.609 -58.141 1.00 37.44  ? 54  LYS V CE  1 
ATOM   6248 N  NZ  . LYS H  2 54  ? -33.054 16.775 -59.633 1.00 39.49  ? 54  LYS V NZ  1 
ATOM   6249 N  N   . ASN H  2 55  ? -28.173 16.725 -53.252 1.00 32.78  ? 55  ASN V N   1 
ATOM   6250 C  CA  . ASN H  2 55  ? -26.984 17.441 -52.820 1.00 33.58  ? 55  ASN V CA  1 
ATOM   6251 C  C   . ASN H  2 55  ? -26.591 16.985 -51.421 1.00 33.02  ? 55  ASN V C   1 
ATOM   6252 O  O   . ASN H  2 55  ? -27.295 17.281 -50.428 1.00 31.11  ? 55  ASN V O   1 
ATOM   6253 C  CB  . ASN H  2 55  ? -27.272 18.946 -52.853 1.00 33.51  ? 55  ASN V CB  1 
ATOM   6254 C  CG  . ASN H  2 55  ? -26.023 19.791 -52.730 1.00 34.74  ? 55  ASN V CG  1 
ATOM   6255 O  OD1 . ASN H  2 55  ? -25.040 19.380 -52.130 1.00 37.02  ? 55  ASN V OD1 1 
ATOM   6256 N  ND2 . ASN H  2 55  ? -26.052 20.979 -53.322 1.00 36.78  ? 55  ASN V ND2 1 
ATOM   6257 N  N   . GLU H  2 56  ? -25.507 16.219 -51.352 1.00 34.25  ? 56  GLU V N   1 
ATOM   6258 C  CA  . GLU H  2 56  ? -25.062 15.637 -50.100 1.00 35.06  ? 56  GLU V CA  1 
ATOM   6259 C  C   . GLU H  2 56  ? -24.697 16.704 -49.088 1.00 32.32  ? 56  GLU V C   1 
ATOM   6260 O  O   . GLU H  2 56  ? -24.922 16.515 -47.916 1.00 30.47  ? 56  GLU V O   1 
ATOM   6261 C  CB  . GLU H  2 56  ? -23.883 14.671 -50.292 1.00 38.36  ? 56  GLU V CB  1 
ATOM   6262 C  CG  . GLU H  2 56  ? -23.777 13.662 -49.146 1.00 40.63  ? 56  GLU V CG  1 
ATOM   6263 C  CD  . GLU H  2 56  ? -22.818 12.497 -49.413 1.00 43.69  ? 56  GLU V CD  1 
ATOM   6264 O  OE1 . GLU H  2 56  ? -21.978 12.590 -50.337 1.00 49.80  ? 56  GLU V OE1 1 
ATOM   6265 O  OE2 . GLU H  2 56  ? -22.899 11.484 -48.675 1.00 44.98  ? 56  GLU V OE2 1 
ATOM   6266 N  N   . LYS H  2 57  ? -24.181 17.840 -49.555 1.00 32.50  ? 57  LYS V N   1 
ATOM   6267 C  CA  . LYS H  2 57  ? -23.818 18.936 -48.686 1.00 31.90  ? 57  LYS V CA  1 
ATOM   6268 C  C   . LYS H  2 57  ? -25.061 19.568 -48.089 1.00 28.84  ? 57  LYS V C   1 
ATOM   6269 O  O   . LYS H  2 57  ? -24.990 20.119 -47.003 1.00 26.76  ? 57  LYS V O   1 
ATOM   6270 C  CB  . LYS H  2 57  ? -23.069 20.037 -49.439 1.00 34.70  ? 57  LYS V CB  1 
ATOM   6271 C  CG  . LYS H  2 57  ? -21.603 19.745 -49.751 1.00 37.66  ? 57  LYS V CG  1 
ATOM   6272 C  CD  . LYS H  2 57  ? -21.357 18.323 -50.189 1.00 41.03  ? 57  LYS V CD  1 
ATOM   6273 C  CE  . LYS H  2 57  ? -21.144 17.309 -49.052 1.00 41.35  ? 57  LYS V CE  1 
ATOM   6274 N  NZ  . LYS H  2 57  ? -20.200 16.203 -49.471 1.00 43.17  ? 57  LYS V NZ  1 
ATOM   6275 N  N   . VAL H  2 58  ? -26.141 19.608 -48.857 1.00 27.45  ? 58  VAL V N   1 
ATOM   6276 C  CA  . VAL H  2 58  ? -27.393 20.168 -48.389 1.00 26.27  ? 58  VAL V CA  1 
ATOM   6277 C  C   . VAL H  2 58  ? -27.906 19.269 -47.260 1.00 24.58  ? 58  VAL V C   1 
ATOM   6278 O  O   . VAL H  2 58  ? -28.344 19.766 -46.193 1.00 23.06  ? 58  VAL V O   1 
ATOM   6279 C  CB  . VAL H  2 58  ? -28.413 20.292 -49.538 1.00 27.05  ? 58  VAL V CB  1 
ATOM   6280 C  CG1 . VAL H  2 58  ? -29.804 20.503 -48.987 1.00 26.26  ? 58  VAL V CG1 1 
ATOM   6281 C  CG2 . VAL H  2 58  ? -27.982 21.411 -50.512 1.00 28.41  ? 58  VAL V CG2 1 
ATOM   6282 N  N   . ILE H  2 59  ? -27.816 17.952 -47.452 1.00 25.26  ? 59  ILE V N   1 
ATOM   6283 C  CA  . ILE H  2 59  ? -28.364 17.015 -46.437 1.00 24.77  ? 59  ILE V CA  1 
ATOM   6284 C  C   . ILE H  2 59  ? -27.489 17.080 -45.153 1.00 25.96  ? 59  ILE V C   1 
ATOM   6285 O  O   . ILE H  2 59  ? -27.986 17.048 -44.007 1.00 26.78  ? 59  ILE V O   1 
ATOM   6286 C  CB  . ILE H  2 59  ? -28.398 15.564 -46.952 1.00 25.79  ? 59  ILE V CB  1 
ATOM   6287 C  CG1 . ILE H  2 59  ? -29.389 15.427 -48.124 1.00 26.16  ? 59  ILE V CG1 1 
ATOM   6288 C  CG2 . ILE H  2 59  ? -28.759 14.576 -45.804 1.00 23.97  ? 59  ILE V CG2 1 
ATOM   6289 C  CD1 . ILE H  2 59  ? -30.812 15.851 -47.799 1.00 26.13  ? 59  ILE V CD1 1 
ATOM   6290 N  N   . GLU H  2 60  ? -26.196 17.233 -45.375 1.00 26.73  ? 60  GLU V N   1 
ATOM   6291 C  CA  . GLU H  2 60  ? -25.262 17.466 -44.285 1.00 27.52  ? 60  GLU V CA  1 
ATOM   6292 C  C   . GLU H  2 60  ? -25.596 18.714 -43.480 1.00 26.08  ? 60  GLU V C   1 
ATOM   6293 O  O   . GLU H  2 60  ? -25.523 18.655 -42.237 1.00 26.49  ? 60  GLU V O   1 
ATOM   6294 C  CB  . GLU H  2 60  ? -23.810 17.506 -44.803 1.00 29.61  ? 60  GLU V CB  1 
ATOM   6295 C  CG  . GLU H  2 60  ? -23.374 16.125 -45.211 1.00 31.16  ? 60  GLU V CG  1 
ATOM   6296 C  CD  . GLU H  2 60  ? -21.995 16.039 -45.848 1.00 32.96  ? 60  GLU V CD  1 
ATOM   6297 O  OE1 . GLU H  2 60  ? -21.272 17.056 -45.985 1.00 35.34  ? 60  GLU V OE1 1 
ATOM   6298 O  OE2 . GLU H  2 60  ? -21.633 14.911 -46.194 1.00 34.63  ? 60  GLU V OE2 1 
ATOM   6299 N  N   . HIS H  2 61  ? -25.900 19.826 -44.161 1.00 25.07  ? 61  HIS V N   1 
ATOM   6300 C  CA  . HIS H  2 61  ? -26.290 21.063 -43.482 1.00 23.64  ? 61  HIS V CA  1 
ATOM   6301 C  C   . HIS H  2 61  ? -27.532 20.840 -42.621 1.00 22.01  ? 61  HIS V C   1 
ATOM   6302 O  O   . HIS H  2 61  ? -27.613 21.325 -41.476 1.00 19.70  ? 61  HIS V O   1 
ATOM   6303 C  CB  . HIS H  2 61  ? -26.395 22.273 -44.444 1.00 25.05  ? 61  HIS V CB  1 
ATOM   6304 C  CG  . HIS H  2 61  ? -27.046 23.491 -43.826 1.00 24.83  ? 61  HIS V CG  1 
ATOM   6305 N  ND1 . HIS H  2 61  ? -26.334 24.492 -43.192 1.00 24.67  ? 61  HIS V ND1 1 
ATOM   6306 C  CD2 . HIS H  2 61  ? -28.378 23.830 -43.724 1.00 26.00  ? 61  HIS V CD2 1 
ATOM   6307 C  CE1 . HIS H  2 61  ? -27.174 25.395 -42.704 1.00 25.17  ? 61  HIS V CE1 1 
ATOM   6308 N  NE2 . HIS H  2 61  ? -28.438 25.008 -43.002 1.00 26.41  ? 61  HIS V NE2 1 
ATOM   6309 N  N   . ILE H  2 62  ? -28.488 20.067 -43.135 1.00 21.60  ? 62  ILE V N   1 
ATOM   6310 C  CA  . ILE H  2 62  ? -29.717 19.789 -42.407 1.00 20.84  ? 62  ILE V CA  1 
ATOM   6311 C  C   . ILE H  2 62  ? -29.454 19.033 -41.112 1.00 20.68  ? 62  ILE V C   1 
ATOM   6312 O  O   . ILE H  2 62  ? -29.987 19.367 -40.035 1.00 19.35  ? 62  ILE V O   1 
ATOM   6313 C  CB  . ILE H  2 62  ? -30.764 19.068 -43.296 1.00 21.36  ? 62  ILE V CB  1 
ATOM   6314 C  CG1 . ILE H  2 62  ? -31.209 20.032 -44.416 1.00 21.74  ? 62  ILE V CG1 1 
ATOM   6315 C  CG2 . ILE H  2 62  ? -31.930 18.551 -42.456 1.00 20.63  ? 62  ILE V CG2 1 
ATOM   6316 C  CD1 . ILE H  2 62  ? -32.036 19.419 -45.513 1.00 21.99  ? 62  ILE V CD1 1 
ATOM   6317 N  N   . MET H  2 63  ? -28.621 18.011 -41.211 1.00 22.24  ? 63  MET V N   1 
ATOM   6318 C  CA  . MET H  2 63  ? -28.193 17.266 -40.047 1.00 22.92  ? 63  MET V CA  1 
ATOM   6319 C  C   . MET H  2 63  ? -27.560 18.187 -39.013 1.00 22.84  ? 63  MET V C   1 
ATOM   6320 O  O   . MET H  2 63  ? -27.940 18.158 -37.830 1.00 21.06  ? 63  MET V O   1 
ATOM   6321 C  CB  . MET H  2 63  ? -27.146 16.214 -40.447 1.00 24.91  ? 63  MET V CB  1 
ATOM   6322 C  CG  . MET H  2 63  ? -26.369 15.606 -39.269 1.00 27.47  ? 63  MET V CG  1 
ATOM   6323 S  SD  . MET H  2 63  ? -27.033 14.022 -38.771 1.00 36.15  ? 63  MET V SD  1 
ATOM   6324 C  CE  . MET H  2 63  ? -26.029 13.516 -37.347 1.00 27.57  ? 63  MET V CE  1 
ATOM   6325 N  N   . GLU H  2 64  ? -26.628 19.026 -39.471 1.00 22.78  ? 64  GLU V N   1 
ATOM   6326 C  CA  . GLU H  2 64  ? -25.900 19.955 -38.591 1.00 22.97  ? 64  GLU V CA  1 
ATOM   6327 C  C   . GLU H  2 64  ? -26.888 20.937 -37.935 1.00 21.11  ? 64  GLU V C   1 
ATOM   6328 O  O   . GLU H  2 64  ? -26.772 21.222 -36.770 1.00 20.18  ? 64  GLU V O   1 
ATOM   6329 C  CB  . GLU H  2 64  ? -24.867 20.798 -39.358 1.00 26.89  ? 64  GLU V CB  1 
ATOM   6330 C  CG  . GLU H  2 64  ? -23.672 20.120 -39.983 1.00 34.28  ? 64  GLU V CG  1 
ATOM   6331 C  CD  . GLU H  2 64  ? -22.813 21.156 -40.693 1.00 38.35  ? 64  GLU V CD  1 
ATOM   6332 O  OE1 . GLU H  2 64  ? -22.131 20.756 -41.667 1.00 51.57  ? 64  GLU V OE1 1 
ATOM   6333 O  OE2 . GLU H  2 64  ? -22.877 22.386 -40.296 1.00 41.94  ? 64  GLU V OE2 1 
ATOM   6334 N  N   . ASP H  2 65  ? -27.869 21.432 -38.698 1.00 19.37  ? 65  ASP V N   1 
ATOM   6335 C  CA  . ASP H  2 65  ? -28.887 22.336 -38.162 1.00 19.89  ? 65  ASP V CA  1 
ATOM   6336 C  C   . ASP H  2 65  ? -29.723 21.687 -37.019 1.00 16.74  ? 65  ASP V C   1 
ATOM   6337 O  O   . ASP H  2 65  ? -30.058 22.300 -35.985 1.00 17.23  ? 65  ASP V O   1 
ATOM   6338 C  CB  . ASP H  2 65  ? -29.795 22.771 -39.309 1.00 20.56  ? 65  ASP V CB  1 
ATOM   6339 C  CG  . ASP H  2 65  ? -30.879 23.730 -38.845 1.00 23.85  ? 65  ASP V CG  1 
ATOM   6340 O  OD1 . ASP H  2 65  ? -30.534 24.726 -38.213 1.00 25.81  ? 65  ASP V OD1 1 
ATOM   6341 O  OD2 . ASP H  2 65  ? -32.043 23.433 -39.049 1.00 26.44  ? 65  ASP V OD2 1 
ATOM   6342 N  N   . LEU H  2 66  ? -30.082 20.430 -37.228 1.00 17.07  ? 66  LEU V N   1 
ATOM   6343 C  CA  . LEU H  2 66  ? -30.896 19.708 -36.289 1.00 15.78  ? 66  LEU V CA  1 
ATOM   6344 C  C   . LEU H  2 66  ? -30.161 19.270 -34.998 1.00 16.30  ? 66  LEU V C   1 
ATOM   6345 O  O   . LEU H  2 66  ? -30.790 19.029 -33.936 1.00 16.29  ? 66  LEU V O   1 
ATOM   6346 C  CB  . LEU H  2 66  ? -31.449 18.466 -36.979 1.00 17.09  ? 66  LEU V CB  1 
ATOM   6347 C  CG  . LEU H  2 66  ? -32.505 18.746 -38.039 1.00 16.25  ? 66  LEU V CG  1 
ATOM   6348 C  CD1 . LEU H  2 66  ? -32.764 17.454 -38.856 1.00 17.61  ? 66  LEU V CD1 1 
ATOM   6349 C  CD2 . LEU H  2 66  ? -33.776 19.356 -37.446 1.00 16.89  ? 66  LEU V CD2 1 
ATOM   6350 N  N   . ASP H  2 67  ? -28.842 19.179 -35.099 1.00 16.63  ? 67  ASP V N   1 
ATOM   6351 C  CA  . ASP H  2 67  ? -27.982 18.641 -34.038 1.00 17.17  ? 67  ASP V CA  1 
ATOM   6352 C  C   . ASP H  2 67  ? -27.659 19.743 -33.017 1.00 16.66  ? 67  ASP V C   1 
ATOM   6353 O  O   . ASP H  2 67  ? -26.574 20.286 -32.961 1.00 17.13  ? 67  ASP V O   1 
ATOM   6354 C  CB  . ASP H  2 67  ? -26.696 18.064 -34.620 1.00 18.38  ? 67  ASP V CB  1 
ATOM   6355 C  CG  . ASP H  2 67  ? -25.774 17.506 -33.558 1.00 19.29  ? 67  ASP V CG  1 
ATOM   6356 O  OD1 . ASP H  2 67  ? -26.236 17.250 -32.403 1.00 19.60  ? 67  ASP V OD1 1 
ATOM   6357 O  OD2 . ASP H  2 67  ? -24.557 17.418 -33.845 1.00 20.50  ? 67  ASP V OD2 1 
ATOM   6358 N  N   A THR H  2 68  ? -28.617 20.082 -32.173 0.34 16.49  ? 68  THR V N   1 
ATOM   6359 N  N   B THR H  2 68  ? -28.663 19.977 -32.194 0.66 16.76  ? 68  THR V N   1 
ATOM   6360 C  CA  A THR H  2 68  ? -28.467 21.261 -31.317 0.34 16.40  ? 68  THR V CA  1 
ATOM   6361 C  CA  B THR H  2 68  ? -28.729 21.048 -31.210 0.66 16.46  ? 68  THR V CA  1 
ATOM   6362 C  C   A THR H  2 68  ? -27.484 21.098 -30.157 0.34 17.42  ? 68  THR V C   1 
ATOM   6363 C  C   B THR H  2 68  ? -27.546 21.045 -30.246 0.66 17.40  ? 68  THR V C   1 
ATOM   6364 O  O   A THR H  2 68  ? -26.969 22.091 -29.668 0.34 17.80  ? 68  THR V O   1 
ATOM   6365 O  O   B THR H  2 68  ? -26.924 22.065 -30.081 0.66 17.21  ? 68  THR V O   1 
ATOM   6366 C  CB  A THR H  2 68  ? -29.791 21.696 -30.702 0.34 16.18  ? 68  THR V CB  1 
ATOM   6367 C  CB  B THR H  2 68  ? -30.050 20.922 -30.405 0.66 16.55  ? 68  THR V CB  1 
ATOM   6368 O  OG1 A THR H  2 68  ? -30.299 20.624 -29.905 0.34 16.17  ? 68  THR V OG1 1 
ATOM   6369 O  OG1 B THR H  2 68  ? -31.163 20.871 -31.334 0.66 16.71  ? 68  THR V OG1 1 
ATOM   6370 C  CG2 A THR H  2 68  ? -30.785 22.040 -31.801 0.34 15.36  ? 68  THR V CG2 1 
ATOM   6371 C  CG2 B THR H  2 68  ? -30.231 22.111 -29.509 0.66 16.15  ? 68  THR V CG2 1 
ATOM   6372 N  N   . ASN H  2 69  ? -27.221 19.878 -29.691 1.00 18.34  ? 69  ASN V N   1 
ATOM   6373 C  CA  . ASN H  2 69  ? -26.194 19.763 -28.645 1.00 19.02  ? 69  ASN V CA  1 
ATOM   6374 C  C   . ASN H  2 69  ? -24.783 19.525 -29.223 1.00 19.92  ? 69  ASN V C   1 
ATOM   6375 O  O   . ASN H  2 69  ? -23.816 19.375 -28.490 1.00 20.66  ? 69  ASN V O   1 
ATOM   6376 C  CB  . ASN H  2 69  ? -26.606 18.767 -27.575 1.00 20.29  ? 69  ASN V CB  1 
ATOM   6377 C  CG  . ASN H  2 69  ? -26.574 17.329 -28.050 1.00 20.68  ? 69  ASN V CG  1 
ATOM   6378 O  OD1 . ASN H  2 69  ? -26.330 17.038 -29.238 1.00 20.42  ? 69  ASN V OD1 1 
ATOM   6379 N  ND2 . ASN H  2 69  ? -26.764 16.404 -27.099 1.00 22.92  ? 69  ASN V ND2 1 
ATOM   6380 N  N   . ALA H  2 70  ? -24.671 19.478 -30.547 1.00 19.58  ? 70  ALA V N   1 
ATOM   6381 C  CA  . ALA H  2 70  ? -23.396 19.462 -31.274 1.00 21.03  ? 70  ALA V CA  1 
ATOM   6382 C  C   . ALA H  2 70  ? -22.570 18.169 -31.009 1.00 22.36  ? 70  ALA V C   1 
ATOM   6383 O  O   . ALA H  2 70  ? -21.331 18.164 -31.077 1.00 23.51  ? 70  ALA V O   1 
ATOM   6384 C  CB  . ALA H  2 70  ? -22.572 20.743 -30.986 1.00 21.75  ? 70  ALA V CB  1 
ATOM   6385 N  N   . ASP H  2 71  ? -23.271 17.059 -30.769 1.00 22.41  ? 71  ASP V N   1 
ATOM   6386 C  CA  . ASP H  2 71  ? -22.611 15.785 -30.463 1.00 24.15  ? 71  ASP V CA  1 
ATOM   6387 C  C   . ASP H  2 71  ? -22.496 14.857 -31.695 1.00 25.42  ? 71  ASP V C   1 
ATOM   6388 O  O   . ASP H  2 71  ? -22.046 13.695 -31.580 1.00 26.36  ? 71  ASP V O   1 
ATOM   6389 C  CB  . ASP H  2 71  ? -23.255 15.090 -29.246 1.00 24.87  ? 71  ASP V CB  1 
ATOM   6390 C  CG  . ASP H  2 71  ? -24.608 14.499 -29.543 1.00 24.20  ? 71  ASP V CG  1 
ATOM   6391 O  OD1 . ASP H  2 71  ? -25.099 14.641 -30.676 1.00 23.32  ? 71  ASP V OD1 1 
ATOM   6392 O  OD2 . ASP H  2 71  ? -25.200 13.897 -28.628 1.00 24.43  ? 71  ASP V OD2 1 
ATOM   6393 N  N   . LYS H  2 72  ? -22.898 15.368 -32.860 1.00 25.66  ? 72  LYS V N   1 
ATOM   6394 C  CA  . LYS H  2 72  ? -22.819 14.660 -34.164 1.00 27.61  ? 72  LYS V CA  1 
ATOM   6395 C  C   . LYS H  2 72  ? -23.747 13.418 -34.242 1.00 26.37  ? 72  LYS V C   1 
ATOM   6396 O  O   . LYS H  2 72  ? -23.518 12.456 -34.998 1.00 27.39  ? 72  LYS V O   1 
ATOM   6397 C  CB  . LYS H  2 72  ? -21.357 14.318 -34.510 1.00 30.13  ? 72  LYS V CB  1 
ATOM   6398 C  CG  . LYS H  2 72  ? -20.532 15.603 -34.689 1.00 33.74  ? 72  LYS V CG  1 
ATOM   6399 C  CD  . LYS H  2 72  ? -19.058 15.427 -34.383 1.00 39.49  ? 72  LYS V CD  1 
ATOM   6400 C  CE  . LYS H  2 72  ? -18.329 16.778 -34.308 1.00 41.87  ? 72  LYS V CE  1 
ATOM   6401 N  NZ  . LYS H  2 72  ? -18.680 17.673 -35.460 1.00 43.91  ? 72  LYS V NZ  1 
ATOM   6402 N  N   . GLN H  2 73  ? -24.798 13.457 -33.433 1.00 24.61  ? 73  GLN V N   1 
ATOM   6403 C  CA  . GLN H  2 73  ? -25.833 12.438 -33.461 1.00 24.93  ? 73  GLN V CA  1 
ATOM   6404 C  C   . GLN H  2 73  ? -27.148 13.187 -33.419 1.00 22.98  ? 73  GLN V C   1 
ATOM   6405 O  O   . GLN H  2 73  ? -27.178 14.286 -32.883 1.00 22.80  ? 73  GLN V O   1 
ATOM   6406 C  CB  . GLN H  2 73  ? -25.736 11.592 -32.189 1.00 26.07  ? 73  GLN V CB  1 
ATOM   6407 C  CG  . GLN H  2 73  ? -24.425 10.886 -32.000 1.00 28.90  ? 73  GLN V CG  1 
ATOM   6408 C  CD  . GLN H  2 73  ? -24.328 9.608  -32.819 1.00 30.54  ? 73  GLN V CD  1 
ATOM   6409 O  OE1 . GLN H  2 73  ? -25.341 8.948  -33.141 1.00 29.75  ? 73  GLN V OE1 1 
ATOM   6410 N  NE2 . GLN H  2 73  ? -23.100 9.271  -33.203 1.00 32.62  ? 73  GLN V NE2 1 
ATOM   6411 N  N   . LEU H  2 74  ? -28.225 12.644 -33.993 1.00 21.33  ? 74  LEU V N   1 
ATOM   6412 C  CA  . LEU H  2 74  ? -29.532 13.214 -33.723 1.00 20.45  ? 74  LEU V CA  1 
ATOM   6413 C  C   . LEU H  2 74  ? -30.262 12.342 -32.742 1.00 20.41  ? 74  LEU V C   1 
ATOM   6414 O  O   . LEU H  2 74  ? -30.443 11.134 -32.999 1.00 21.65  ? 74  LEU V O   1 
ATOM   6415 C  CB  . LEU H  2 74  ? -30.340 13.381 -34.994 1.00 20.21  ? 74  LEU V CB  1 
ATOM   6416 C  CG  . LEU H  2 74  ? -29.782 14.197 -36.132 1.00 20.61  ? 74  LEU V CG  1 
ATOM   6417 C  CD1 . LEU H  2 74  ? -30.826 14.286 -37.242 1.00 19.81  ? 74  LEU V CD1 1 
ATOM   6418 C  CD2 . LEU H  2 74  ? -29.430 15.627 -35.699 1.00 20.44  ? 74  LEU V CD2 1 
ATOM   6419 N  N   . SER H  2 75  ? -30.627 12.907 -31.595 1.00 18.74  ? 75  SER V N   1 
ATOM   6420 C  CA  . SER H  2 75  ? -31.586 12.255 -30.739 1.00 19.56  ? 75  SER V CA  1 
ATOM   6421 C  C   . SER H  2 75  ? -32.975 12.342 -31.380 1.00 18.85  ? 75  SER V C   1 
ATOM   6422 O  O   . SER H  2 75  ? -33.234 13.101 -32.337 1.00 19.29  ? 75  SER V O   1 
ATOM   6423 C  CB  . SER H  2 75  ? -31.618 12.939 -29.394 1.00 18.86  ? 75  SER V CB  1 
ATOM   6424 O  OG  . SER H  2 75  ? -32.032 14.303 -29.606 1.00 18.92  ? 75  SER V OG  1 
ATOM   6425 N  N   . PHE H  2 76  ? -33.919 11.587 -30.828 1.00 19.74  ? 76  PHE V N   1 
ATOM   6426 C  CA  . PHE H  2 76  ? -35.317 11.737 -31.256 1.00 19.60  ? 76  PHE V CA  1 
ATOM   6427 C  C   . PHE H  2 76  ? -35.857 13.144 -31.043 1.00 19.06  ? 76  PHE V C   1 
ATOM   6428 O  O   . PHE H  2 76  ? -36.570 13.667 -31.899 1.00 18.99  ? 76  PHE V O   1 
ATOM   6429 C  CB  . PHE H  2 76  ? -36.223 10.771 -30.525 1.00 21.42  ? 76  PHE V CB  1 
ATOM   6430 C  CG  . PHE H  2 76  ? -37.582 10.728 -31.117 1.00 21.09  ? 76  PHE V CG  1 
ATOM   6431 C  CD1 . PHE H  2 76  ? -37.821 10.058 -32.314 1.00 22.55  ? 76  PHE V CD1 1 
ATOM   6432 C  CD2 . PHE H  2 76  ? -38.610 11.448 -30.532 1.00 23.10  ? 76  PHE V CD2 1 
ATOM   6433 C  CE1 . PHE H  2 76  ? -39.077 10.099 -32.926 1.00 22.11  ? 76  PHE V CE1 1 
ATOM   6434 C  CE2 . PHE H  2 76  ? -39.850 11.444 -31.100 1.00 22.57  ? 76  PHE V CE2 1 
ATOM   6435 C  CZ  . PHE H  2 76  ? -40.095 10.783 -32.303 1.00 23.74  ? 76  PHE V CZ  1 
ATOM   6436 N  N   . GLU H  2 77  ? -35.491 13.735 -29.907 1.00 19.62  ? 77  GLU V N   1 
ATOM   6437 C  CA  . GLU H  2 77  ? -35.875 15.127 -29.578 1.00 20.48  ? 77  GLU V CA  1 
ATOM   6438 C  C   . GLU H  2 77  ? -35.446 16.074 -30.690 1.00 18.50  ? 77  GLU V C   1 
ATOM   6439 O  O   . GLU H  2 77  ? -36.217 16.886 -31.144 1.00 17.57  ? 77  GLU V O   1 
ATOM   6440 C  CB  . GLU H  2 77  ? -35.258 15.557 -28.266 1.00 21.23  ? 77  GLU V CB  1 
ATOM   6441 C  CG  . GLU H  2 77  ? -35.921 14.996 -27.012 1.00 23.78  ? 77  GLU V CG  1 
ATOM   6442 C  CD  . GLU H  2 77  ? -35.491 13.591 -26.632 1.00 26.27  ? 77  GLU V CD  1 
ATOM   6443 O  OE1 . GLU H  2 77  ? -34.632 12.951 -27.304 1.00 25.10  ? 77  GLU V OE1 1 
ATOM   6444 O  OE2 . GLU H  2 77  ? -36.061 13.121 -25.632 1.00 28.99  ? 77  GLU V OE2 1 
ATOM   6445 N  N   . GLU H  2 78  ? -34.220 15.922 -31.176 1.00 18.35  ? 78  GLU V N   1 
ATOM   6446 C  CA  . GLU H  2 78  ? -33.717 16.771 -32.251 1.00 17.26  ? 78  GLU V CA  1 
ATOM   6447 C  C   . GLU H  2 78  ? -34.393 16.446 -33.599 1.00 17.59  ? 78  GLU V C   1 
ATOM   6448 O  O   . GLU H  2 78  ? -34.810 17.352 -34.308 1.00 16.39  ? 78  GLU V O   1 
ATOM   6449 C  CB  . GLU H  2 78  ? -32.201 16.611 -32.338 1.00 17.81  ? 78  GLU V CB  1 
ATOM   6450 C  CG  . GLU H  2 78  ? -31.434 17.140 -31.128 1.00 18.09  ? 78  GLU V CG  1 
ATOM   6451 C  CD  . GLU H  2 78  ? -29.954 16.758 -31.138 1.00 18.93  ? 78  GLU V CD  1 
ATOM   6452 O  OE1 . GLU H  2 78  ? -29.588 15.691 -31.710 1.00 18.24  ? 78  GLU V OE1 1 
ATOM   6453 O  OE2 . GLU H  2 78  ? -29.144 17.478 -30.484 1.00 19.44  ? 78  GLU V OE2 1 
ATOM   6454 N  N   . PHE H  2 79  ? -34.537 15.160 -33.896 1.00 16.79  ? 79  PHE V N   1 
ATOM   6455 C  CA  . PHE H  2 79  ? -35.107 14.693 -35.145 1.00 17.85  ? 79  PHE V CA  1 
ATOM   6456 C  C   . PHE H  2 79  ? -36.559 15.102 -35.348 1.00 17.19  ? 79  PHE V C   1 
ATOM   6457 O  O   . PHE H  2 79  ? -37.007 15.439 -36.444 1.00 18.21  ? 79  PHE V O   1 
ATOM   6458 C  CB  . PHE H  2 79  ? -35.004 13.148 -35.149 1.00 18.52  ? 79  PHE V CB  1 
ATOM   6459 C  CG  . PHE H  2 79  ? -35.601 12.522 -36.332 1.00 18.59  ? 79  PHE V CG  1 
ATOM   6460 C  CD1 . PHE H  2 79  ? -34.957 12.562 -37.560 1.00 19.41  ? 79  PHE V CD1 1 
ATOM   6461 C  CD2 . PHE H  2 79  ? -36.796 11.874 -36.208 1.00 19.72  ? 79  PHE V CD2 1 
ATOM   6462 C  CE1 . PHE H  2 79  ? -35.521 11.935 -38.651 1.00 21.08  ? 79  PHE V CE1 1 
ATOM   6463 C  CE2 . PHE H  2 79  ? -37.375 11.272 -37.318 1.00 20.22  ? 79  PHE V CE2 1 
ATOM   6464 C  CZ  . PHE H  2 79  ? -36.721 11.291 -38.521 1.00 20.78  ? 79  PHE V CZ  1 
ATOM   6465 N  N   . ILE H  2 80  ? -37.316 15.154 -34.281 1.00 18.00  ? 80  ILE V N   1 
ATOM   6466 C  CA  . ILE H  2 80  ? -38.724 15.428 -34.448 1.00 18.94  ? 80  ILE V CA  1 
ATOM   6467 C  C   . ILE H  2 80  ? -39.002 16.844 -34.933 1.00 18.02  ? 80  ILE V C   1 
ATOM   6468 O  O   . ILE H  2 80  ? -40.068 17.142 -35.439 1.00 18.92  ? 80  ILE V O   1 
ATOM   6469 C  CB  . ILE H  2 80  ? -39.477 15.135 -33.132 1.00 19.19  ? 80  ILE V CB  1 
ATOM   6470 C  CG1 . ILE H  2 80  ? -40.959 14.924 -33.499 1.00 22.91  ? 80  ILE V CG1 1 
ATOM   6471 C  CG2 . ILE H  2 80  ? -39.208 16.191 -32.066 1.00 20.10  ? 80  ILE V CG2 1 
ATOM   6472 C  CD1 . ILE H  2 80  ? -41.835 14.376 -32.410 1.00 23.65  ? 80  ILE V CD1 1 
ATOM   6473 N  N   A MET H  2 81  ? -38.026 17.728 -34.766 0.49 18.59  ? 81  MET V N   1 
ATOM   6474 N  N   B MET H  2 81  ? -38.042 17.752 -34.771 0.51 17.75  ? 81  MET V N   1 
ATOM   6475 C  CA  A MET H  2 81  ? -38.125 19.077 -35.286 0.49 17.89  ? 81  MET V CA  1 
ATOM   6476 C  CA  B MET H  2 81  ? -38.207 19.080 -35.345 0.51 16.61  ? 81  MET V CA  1 
ATOM   6477 C  C   A MET H  2 81  ? -38.156 19.069 -36.834 0.49 17.92  ? 81  MET V C   1 
ATOM   6478 C  C   B MET H  2 81  ? -38.252 19.017 -36.866 0.51 17.23  ? 81  MET V C   1 
ATOM   6479 O  O   A MET H  2 81  ? -38.834 19.902 -37.437 0.49 18.33  ? 81  MET V O   1 
ATOM   6480 O  O   B MET H  2 81  ? -39.038 19.755 -37.480 0.51 17.70  ? 81  MET V O   1 
ATOM   6481 C  CB  A MET H  2 81  ? -36.974 19.921 -34.699 0.49 18.02  ? 81  MET V CB  1 
ATOM   6482 C  CB  B MET H  2 81  ? -37.124 20.058 -34.866 0.51 15.74  ? 81  MET V CB  1 
ATOM   6483 C  CG  A MET H  2 81  ? -37.207 21.425 -34.617 0.49 19.02  ? 81  MET V CG  1 
ATOM   6484 C  CG  B MET H  2 81  ? -37.147 20.337 -33.371 0.51 15.15  ? 81  MET V CG  1 
ATOM   6485 S  SD  A MET H  2 81  ? -38.627 22.024 -33.668 0.49 18.31  ? 81  MET V SD  1 
ATOM   6486 S  SD  B MET H  2 81  ? -38.767 20.564 -32.642 0.51 22.32  ? 81  MET V SD  1 
ATOM   6487 C  CE  A MET H  2 81  ? -38.031 22.143 -31.982 0.49 18.05  ? 81  MET V CE  1 
ATOM   6488 C  CE  B MET H  2 81  ? -38.798 22.282 -32.100 0.51 14.08  ? 81  MET V CE  1 
ATOM   6489 N  N   . LEU H  2 82  ? -37.492 18.106 -37.475 1.00 17.47  ? 82  LEU V N   1 
ATOM   6490 C  CA  . LEU H  2 82  ? -37.549 17.926 -38.921 1.00 17.81  ? 82  LEU V CA  1 
ATOM   6491 C  C   . LEU H  2 82  ? -38.945 17.464 -39.318 1.00 18.01  ? 82  LEU V C   1 
ATOM   6492 O  O   . LEU H  2 82  ? -39.516 17.898 -40.293 1.00 18.56  ? 82  LEU V O   1 
ATOM   6493 C  CB  . LEU H  2 82  ? -36.523 16.922 -39.433 1.00 18.53  ? 82  LEU V CB  1 
ATOM   6494 C  CG  . LEU H  2 82  ? -36.470 16.762 -40.964 1.00 18.50  ? 82  LEU V CG  1 
ATOM   6495 C  CD1 . LEU H  2 82  ? -36.157 18.090 -41.640 1.00 20.50  ? 82  LEU V CD1 1 
ATOM   6496 C  CD2 . LEU H  2 82  ? -35.460 15.660 -41.346 1.00 19.75  ? 82  LEU V CD2 1 
ATOM   6497 N  N   . MET H  2 83  ? -39.485 16.565 -38.513 1.00 18.55  ? 83  MET V N   1 
ATOM   6498 C  CA  . MET H  2 83  ? -40.826 16.072 -38.800 1.00 19.10  ? 83  MET V CA  1 
ATOM   6499 C  C   . MET H  2 83  ? -41.842 17.178 -38.730 1.00 18.56  ? 83  MET V C   1 
ATOM   6500 O  O   . MET H  2 83  ? -42.679 17.284 -39.661 1.00 18.90  ? 83  MET V O   1 
ATOM   6501 C  CB  . MET H  2 83  ? -41.175 14.944 -37.837 1.00 18.78  ? 83  MET V CB  1 
ATOM   6502 C  CG  . MET H  2 83  ? -40.263 13.718 -37.918 1.00 21.09  ? 83  MET V CG  1 
ATOM   6503 S  SD  . MET H  2 83  ? -40.208 12.810 -39.486 1.00 21.04  ? 83  MET V SD  1 
ATOM   6504 C  CE  . MET H  2 83  ? -38.855 13.630 -40.402 1.00 22.68  ? 83  MET V CE  1 
ATOM   6505 N  N   . ALA H  2 84  ? -41.761 17.999 -37.668 1.00 18.57  ? 84  ALA V N   1 
ATOM   6506 C  CA  . ALA H  2 84  ? -42.645 19.163 -37.545 1.00 18.65  ? 84  ALA V CA  1 
ATOM   6507 C  C   . ALA H  2 84  ? -42.498 20.129 -38.711 1.00 19.56  ? 84  ALA V C   1 
ATOM   6508 O  O   . ALA H  2 84  ? -43.508 20.562 -39.296 1.00 17.88  ? 84  ALA V O   1 
ATOM   6509 C  CB  . ALA H  2 84  ? -42.480 19.852 -36.194 1.00 18.52  ? 84  ALA V CB  1 
ATOM   6510 N  N   . ARG H  2 85  ? -41.269 20.418 -39.100 1.00 20.40  ? 85  ARG V N   1 
ATOM   6511 C  CA  . ARG H  2 85  ? -41.056 21.313 -40.209 1.00 21.15  ? 85  ARG V CA  1 
ATOM   6512 C  C   . ARG H  2 85  ? -41.614 20.794 -41.521 1.00 19.60  ? 85  ARG V C   1 
ATOM   6513 O  O   . ARG H  2 85  ? -42.170 21.562 -42.303 1.00 20.23  ? 85  ARG V O   1 
ATOM   6514 C  CB  . ARG H  2 85  ? -39.605 21.597 -40.428 1.00 23.99  ? 85  ARG V CB  1 
ATOM   6515 C  CG  . ARG H  2 85  ? -39.039 22.414 -39.321 1.00 27.26  ? 85  ARG V CG  1 
ATOM   6516 C  CD  . ARG H  2 85  ? -37.544 22.449 -39.511 1.00 29.89  ? 85  ARG V CD  1 
ATOM   6517 N  NE  . ARG H  2 85  ? -36.982 22.843 -38.255 1.00 32.54  ? 85  ARG V NE  1 
ATOM   6518 C  CZ  . ARG H  2 85  ? -35.691 22.876 -37.992 1.00 31.91  ? 85  ARG V CZ  1 
ATOM   6519 N  NH1 . ARG H  2 85  ? -35.319 23.239 -36.789 1.00 30.00  ? 85  ARG V NH1 1 
ATOM   6520 N  NH2 . ARG H  2 85  ? -34.799 22.537 -38.941 1.00 32.62  ? 85  ARG V NH2 1 
ATOM   6521 N  N   . LEU H  2 86  ? -41.400 19.503 -41.811 1.00 19.39  ? 86  LEU V N   1 
ATOM   6522 C  CA  . LEU H  2 86  ? -41.879 18.962 -43.088 1.00 20.52  ? 86  LEU V CA  1 
ATOM   6523 C  C   . LEU H  2 86  ? -43.413 18.856 -43.150 1.00 20.81  ? 86  LEU V C   1 
ATOM   6524 O  O   . LEU H  2 86  ? -44.054 19.001 -44.209 1.00 21.78  ? 86  LEU V O   1 
ATOM   6525 C  CB  . LEU H  2 86  ? -41.289 17.573 -43.264 1.00 22.03  ? 86  LEU V CB  1 
ATOM   6526 C  CG  . LEU H  2 86  ? -40.009 17.330 -44.069 1.00 23.61  ? 86  LEU V CG  1 
ATOM   6527 C  CD1 . LEU H  2 86  ? -39.237 18.522 -44.580 1.00 25.33  ? 86  LEU V CD1 1 
ATOM   6528 C  CD2 . LEU H  2 86  ? -39.199 16.117 -43.619 1.00 23.37  ? 86  LEU V CD2 1 
ATOM   6529 N  N   . THR H  2 87  ? -44.010 18.579 -41.987 1.00 20.16  ? 87  THR V N   1 
ATOM   6530 C  CA  . THR H  2 87  ? -45.495 18.552 -41.877 1.00 20.54  ? 87  THR V CA  1 
ATOM   6531 C  C   . THR H  2 87  ? -46.043 19.956 -42.156 1.00 20.07  ? 87  THR V C   1 
ATOM   6532 O  O   . THR H  2 87  ? -47.001 20.147 -42.965 1.00 20.45  ? 87  THR V O   1 
ATOM   6533 C  CB  . THR H  2 87  ? -45.937 18.051 -40.464 1.00 19.43  ? 87  THR V CB  1 
ATOM   6534 O  OG1 . THR H  2 87  ? -45.360 16.760 -40.186 1.00 21.19  ? 87  THR V OG1 1 
ATOM   6535 C  CG2 . THR H  2 87  ? -47.461 17.975 -40.340 1.00 20.24  ? 87  THR V CG2 1 
ATOM   6536 N  N   . TRP H  2 88  ? -45.393 20.935 -41.549 1.00 21.14  ? 88  TRP V N   1 
ATOM   6537 C  CA  . TRP H  2 88  ? -45.685 22.338 -41.757 1.00 20.96  ? 88  TRP V CA  1 
ATOM   6538 C  C   . TRP H  2 88  ? -45.544 22.655 -43.217 1.00 22.52  ? 88  TRP V C   1 
ATOM   6539 O  O   . TRP H  2 88  ? -46.452 23.279 -43.811 1.00 21.67  ? 88  TRP V O   1 
ATOM   6540 C  CB  . TRP H  2 88  ? -44.761 23.226 -40.896 1.00 22.48  ? 88  TRP V CB  1 
ATOM   6541 C  CG  . TRP H  2 88  ? -44.857 24.701 -41.247 1.00 24.05  ? 88  TRP V CG  1 
ATOM   6542 C  CD1 . TRP H  2 88  ? -43.989 25.444 -42.027 1.00 25.85  ? 88  TRP V CD1 1 
ATOM   6543 C  CD2 . TRP H  2 88  ? -45.938 25.625 -40.876 1.00 26.34  ? 88  TRP V CD2 1 
ATOM   6544 N  NE1 . TRP H  2 88  ? -44.447 26.761 -42.155 1.00 27.30  ? 88  TRP V NE1 1 
ATOM   6545 C  CE2 . TRP H  2 88  ? -45.624 26.911 -41.504 1.00 27.11  ? 88  TRP V CE2 1 
ATOM   6546 C  CE3 . TRP H  2 88  ? -47.128 25.498 -40.154 1.00 29.50  ? 88  TRP V CE3 1 
ATOM   6547 C  CZ2 . TRP H  2 88  ? -46.456 28.038 -41.351 1.00 32.61  ? 88  TRP V CZ2 1 
ATOM   6548 C  CZ3 . TRP H  2 88  ? -47.988 26.633 -40.024 1.00 29.45  ? 88  TRP V CZ3 1 
ATOM   6549 C  CH2 . TRP H  2 88  ? -47.636 27.881 -40.589 1.00 31.95  ? 88  TRP V CH2 1 
ATOM   6550 N  N   . ALA H  2 89  ? -44.431 22.228 -43.821 1.00 21.33  ? 89  ALA V N   1 
ATOM   6551 C  CA  . ALA H  2 89  ? -44.168 22.533 -45.217 1.00 23.24  ? 89  ALA V CA  1 
ATOM   6552 C  C   . ALA H  2 89  ? -45.186 21.898 -46.168 1.00 23.71  ? 89  ALA V C   1 
ATOM   6553 O  O   . ALA H  2 89  ? -45.528 22.468 -47.223 1.00 23.60  ? 89  ALA V O   1 
ATOM   6554 C  CB  . ALA H  2 89  ? -42.729 22.131 -45.599 1.00 23.42  ? 89  ALA V CB  1 
ATOM   6555 N  N   . SER H  2 90  ? -45.635 20.691 -45.836 1.00 22.40  ? 90  SER V N   1 
ATOM   6556 C  CA  . SER H  2 90  ? -46.596 20.026 -46.710 1.00 24.29  ? 90  SER V CA  1 
ATOM   6557 C  C   . SER H  2 90  ? -47.904 20.757 -46.675 1.00 24.60  ? 90  SER V C   1 
ATOM   6558 O  O   . SER H  2 90  ? -48.519 20.979 -47.743 1.00 25.42  ? 90  SER V O   1 
ATOM   6559 C  CB  . SER H  2 90  ? -46.782 18.560 -46.335 1.00 24.32  ? 90  SER V CB  1 
ATOM   6560 O  OG  . SER H  2 90  ? -47.494 17.891 -47.377 1.00 25.58  ? 90  SER V OG  1 
ATOM   6561 N  N   . HIS H  2 91  ? -48.335 21.150 -45.476 1.00 25.55  ? 91  HIS V N   1 
ATOM   6562 C  CA  . HIS H  2 91  ? -49.554 21.941 -45.320 1.00 26.75  ? 91  HIS V CA  1 
ATOM   6563 C  C   . HIS H  2 91  ? -49.455 23.274 -46.038 1.00 27.13  ? 91  HIS V C   1 
ATOM   6564 O  O   . HIS H  2 91  ? -50.390 23.717 -46.718 1.00 24.80  ? 91  HIS V O   1 
ATOM   6565 C  CB  . HIS H  2 91  ? -49.909 22.105 -43.843 1.00 25.29  ? 91  HIS V CB  1 
ATOM   6566 C  CG  . HIS H  2 91  ? -51.224 22.769 -43.633 1.00 25.50  ? 91  HIS V CG  1 
ATOM   6567 N  ND1 . HIS H  2 91  ? -51.353 23.903 -42.906 1.00 23.83  ? 91  HIS V ND1 1 
ATOM   6568 C  CD2 . HIS H  2 91  ? -52.489 22.430 -44.096 1.00 25.08  ? 91  HIS V CD2 1 
ATOM   6569 C  CE1 . HIS H  2 91  ? -52.672 24.275 -42.907 1.00 24.47  ? 91  HIS V CE1 1 
ATOM   6570 N  NE2 . HIS H  2 91  ? -53.365 23.371 -43.645 1.00 24.52  ? 91  HIS V NE2 1 
ATOM   6571 N  N   . GLU H  2 92  ? -48.304 23.912 -45.927 1.00 25.38  ? 92  GLU V N   1 
ATOM   6572 C  CA  . GLU H  2 92  ? -48.070 25.147 -46.695 1.00 26.53  ? 92  GLU V CA  1 
ATOM   6573 C  C   . GLU H  2 92  ? -48.231 24.923 -48.218 1.00 26.49  ? 92  GLU V C   1 
ATOM   6574 O  O   . GLU H  2 92  ? -48.859 25.738 -48.942 1.00 26.78  ? 92  GLU V O   1 
ATOM   6575 C  CB  . GLU H  2 92  ? -46.682 25.694 -46.360 1.00 26.39  ? 92  GLU V CB  1 
ATOM   6576 C  CG  . GLU H  2 92  ? -46.568 26.146 -44.914 1.00 28.14  ? 92  GLU V CG  1 
ATOM   6577 C  CD  . GLU H  2 92  ? -47.289 27.431 -44.637 1.00 31.27  ? 92  GLU V CD  1 
ATOM   6578 O  OE1 . GLU H  2 92  ? -46.824 28.533 -45.085 1.00 34.31  ? 92  GLU V OE1 1 
ATOM   6579 O  OE2 . GLU H  2 92  ? -48.341 27.340 -43.976 1.00 34.98  ? 92  GLU V OE2 1 
ATOM   6580 N  N   . LYS H  2 93  ? -47.690 23.808 -48.702 1.00 26.49  ? 93  LYS V N   1 
ATOM   6581 C  CA  . LYS H  2 93  ? -47.786 23.474 -50.144 1.00 28.51  ? 93  LYS V CA  1 
ATOM   6582 C  C   . LYS H  2 93  ? -49.244 23.295 -50.543 1.00 29.39  ? 93  LYS V C   1 
ATOM   6583 O  O   . LYS H  2 93  ? -49.665 23.765 -51.621 1.00 27.94  ? 93  LYS V O   1 
ATOM   6584 C  CB  . LYS H  2 93  ? -46.987 22.205 -50.438 1.00 29.75  ? 93  LYS V CB  1 
ATOM   6585 C  CG  . LYS H  2 93  ? -46.868 21.859 -51.924 1.00 32.65  ? 93  LYS V CG  1 
ATOM   6586 C  CD  . LYS H  2 93  ? -46.174 22.993 -52.669 1.00 34.66  ? 93  LYS V CD  1 
ATOM   6587 C  CE  . LYS H  2 93  ? -45.929 22.662 -54.131 1.00 38.94  ? 93  LYS V CE  1 
ATOM   6588 N  NZ  . LYS H  2 93  ? -44.883 21.624 -54.294 1.00 42.44  ? 93  LYS V NZ  1 
ATOM   6589 N  N   . MET H  2 94  ? -50.011 22.645 -49.675 1.00 27.26  ? 94  MET V N   1 
ATOM   6590 C  CA  . MET H  2 94  ? -51.443 22.453 -49.899 1.00 28.49  ? 94  MET V CA  1 
ATOM   6591 C  C   . MET H  2 94  ? -52.194 23.775 -50.073 1.00 38.04  ? 94  MET V C   1 
ATOM   6592 O  O   . MET H  2 94  ? -53.207 23.800 -50.782 1.00 32.29  ? 94  MET V O   1 
ATOM   6593 C  CB  . MET H  2 94  ? -52.075 21.675 -48.745 1.00 24.48  ? 94  MET V CB  1 
ATOM   6594 C  CG  . MET H  2 94  ? -51.530 20.291 -48.632 1.00 25.41  ? 94  MET V CG  1 
ATOM   6595 S  SD  . MET H  2 94  ? -52.293 19.410 -47.252 1.00 31.28  ? 94  MET V SD  1 
ATOM   6596 C  CE  . MET H  2 94  ? -51.321 17.936 -47.228 1.00 33.13  ? 94  MET V CE  1 
ATOM   6597 N  N   . HIS H  2 95  ? -51.702 24.844 -49.461 1.00 38.38  ? 95  HIS V N   1 
ATOM   6598 C  CA  . HIS H  2 95  ? -52.324 26.184 -49.576 1.00 36.44  ? 95  HIS V CA  1 
ATOM   6599 C  C   . HIS H  2 95  ? -51.603 27.173 -50.444 1.00 31.71  ? 95  HIS V C   1 
ATOM   6600 O  O   . HIS H  2 95  ? -51.939 28.351 -50.431 1.00 28.47  ? 95  HIS V O   1 
ATOM   6601 C  CB  . HIS H  2 95  ? -52.494 26.795 -48.182 1.00 34.97  ? 95  HIS V CB  1 
ATOM   6602 C  CG  . HIS H  2 95  ? -53.596 26.170 -47.393 1.00 30.62  ? 95  HIS V CG  1 
ATOM   6603 N  ND1 . HIS H  2 95  ? -54.904 26.461 -47.610 1.00 27.62  ? 95  HIS V ND1 1 
ATOM   6604 C  CD2 . HIS H  2 95  ? -53.566 25.231 -46.383 1.00 27.71  ? 95  HIS V CD2 1 
ATOM   6605 C  CE1 . HIS H  2 95  ? -55.650 25.728 -46.765 1.00 26.75  ? 95  HIS V CE1 1 
ATOM   6606 N  NE2 . HIS H  2 95  ? -54.829 25.005 -46.008 1.00 27.13  ? 95  HIS V NE2 1 
ATOM   6607 N  N   A GLU H  2 96  ? -50.597 26.763 -51.200 0.50 29.69  ? 96  GLU V N   1 
ATOM   6608 N  N   B GLU H  2 96  ? -50.647 26.716 -51.241 0.50 31.61  ? 96  GLU V N   1 
ATOM   6609 C  CA  A GLU H  2 96  ? -49.850 27.761 -51.962 0.50 29.81  ? 96  GLU V CA  1 
ATOM   6610 C  CA  B GLU H  2 96  ? -49.848 27.621 -52.065 0.50 32.29  ? 96  GLU V CA  1 
ATOM   6611 C  C   A GLU H  2 96  ? -50.671 28.215 -53.157 0.50 30.44  ? 96  GLU V C   1 
ATOM   6612 C  C   B GLU H  2 96  ? -50.731 28.196 -53.176 0.50 32.11  ? 96  GLU V C   1 
ATOM   6613 O  O   A GLU H  2 96  ? -51.164 27.403 -53.951 0.50 30.92  ? 96  GLU V O   1 
ATOM   6614 O  O   B GLU H  2 96  ? -51.353 27.437 -53.933 0.50 32.35  ? 96  GLU V O   1 
ATOM   6615 C  CB  A GLU H  2 96  ? -48.463 27.300 -52.401 0.50 30.03  ? 96  GLU V CB  1 
ATOM   6616 C  CB  B GLU H  2 96  ? -48.623 26.899 -52.649 0.50 33.15  ? 96  GLU V CB  1 
ATOM   6617 C  CG  A GLU H  2 96  ? -47.537 28.486 -52.696 0.50 31.65  ? 96  GLU V CG  1 
ATOM   6618 C  CG  B GLU H  2 96  ? -48.725 26.536 -54.128 0.50 36.20  ? 96  GLU V CG  1 
ATOM   6619 C  CD  A GLU H  2 96  ? -47.607 29.580 -51.628 0.50 32.07  ? 96  GLU V CD  1 
ATOM   6620 C  CD  B GLU H  2 96  ? -47.448 25.905 -54.661 0.50 38.16  ? 96  GLU V CD  1 
ATOM   6621 O  OE1 A GLU H  2 96  ? -46.603 29.805 -50.917 0.50 33.82  ? 96  GLU V OE1 1 
ATOM   6622 O  OE1 B GLU H  2 96  ? -46.357 26.192 -54.119 0.50 39.59  ? 96  GLU V OE1 1 
ATOM   6623 O  OE2 A GLU H  2 96  ? -48.671 30.220 -51.478 0.50 32.12  ? 96  GLU V OE2 1 
ATOM   6624 O  OE2 B GLU H  2 96  ? -47.543 25.109 -55.613 0.50 40.08  ? 96  GLU V OE2 1 
ATOM   6625 N  N   . GLY H  2 97  ? -50.828 29.528 -53.243 1.00 31.26  ? 97  GLY V N   1 
ATOM   6626 C  CA  . GLY H  2 97  ? -51.642 30.154 -54.256 1.00 31.96  ? 97  GLY V CA  1 
ATOM   6627 C  C   . GLY H  2 97  ? -53.132 30.034 -54.002 1.00 32.13  ? 97  GLY V C   1 
ATOM   6628 O  O   . GLY H  2 97  ? -53.931 30.271 -54.907 1.00 33.81  ? 97  GLY V O   1 
ATOM   6629 N  N   . ASP H  2 98  ? -53.512 29.696 -52.772 1.00 29.74  ? 98  ASP V N   1 
ATOM   6630 C  CA  . ASP H  2 98  ? -54.924 29.471 -52.418 1.00 29.95  ? 98  ASP V CA  1 
ATOM   6631 C  C   . ASP H  2 98  ? -55.725 30.752 -52.455 1.00 31.14  ? 98  ASP V C   1 
ATOM   6632 O  O   . ASP H  2 98  ? -55.326 31.753 -51.791 1.00 30.70  ? 98  ASP V O   1 
ATOM   6633 C  CB  . ASP H  2 98  ? -54.987 28.913 -51.022 1.00 28.24  ? 98  ASP V CB  1 
ATOM   6634 C  CG  . ASP H  2 98  ? -56.355 28.432 -50.584 1.00 28.63  ? 98  ASP V CG  1 
ATOM   6635 O  OD1 . ASP H  2 98  ? -57.379 28.576 -51.275 1.00 30.55  ? 98  ASP V OD1 1 
ATOM   6636 O  OD2 . ASP H  2 98  ? -56.396 27.879 -49.472 1.00 27.47  ? 98  ASP V OD2 1 
ATOM   6637 N  N   . GLU H  2 99  ? -56.835 30.717 -53.204 1.00 33.03  ? 99  GLU V N   1 
ATOM   6638 C  CA  . GLU H  2 99  ? -57.722 31.863 -53.393 1.00 35.21  ? 99  GLU V CA  1 
ATOM   6639 C  C   . GLU H  2 99  ? -58.913 31.751 -52.464 1.00 36.86  ? 99  GLU V C   1 
ATOM   6640 O  O   . GLU H  2 99  ? -59.472 30.686 -52.267 1.00 36.08  ? 99  GLU V O   1 
ATOM   6641 C  CB  . GLU H  2 99  ? -58.188 31.999 -54.844 1.00 37.21  ? 99  GLU V CB  1 
ATOM   6642 C  CG  . GLU H  2 99  ? -57.045 32.216 -55.814 1.00 37.46  ? 99  GLU V CG  1 
ATOM   6643 C  CD  . GLU H  2 99  ? -57.469 32.378 -57.233 1.00 41.66  ? 99  GLU V CD  1 
ATOM   6644 O  OE1 . GLU H  2 99  ? -58.663 32.228 -57.530 1.00 42.21  ? 99  GLU V OE1 1 
ATOM   6645 O  OE2 . GLU H  2 99  ? -56.580 32.661 -58.050 1.00 45.31  ? 99  GLU V OE2 1 
ATOM   6646 N  N   . GLY H  2 100 ? -59.237 32.869 -51.825 1.00 40.73  ? 100 GLY V N   1 
ATOM   6647 C  CA  . GLY H  2 100 ? -60.382 32.957 -50.922 1.00 40.66  ? 100 GLY V CA  1 
ATOM   6648 C  C   . GLY H  2 100 ? -61.670 32.948 -51.722 1.00 42.29  ? 100 GLY V C   1 
ATOM   6649 O  O   . GLY H  2 100 ? -61.671 33.345 -52.897 1.00 44.87  ? 100 GLY V O   1 
ATOM   6650 N  N   . PRO H  2 101 ? -62.795 32.549 -51.080 1.00 40.80  ? 101 PRO V N   1 
ATOM   6651 C  CA  . PRO H  2 101 ? -62.954 32.096 -49.702 1.00 38.34  ? 101 PRO V CA  1 
ATOM   6652 C  C   . PRO H  2 101 ? -63.093 30.570 -49.554 1.00 36.74  ? 101 PRO V C   1 
ATOM   6653 O  O   . PRO H  2 101 ? -63.152 29.839 -50.551 1.00 34.80  ? 101 PRO V O   1 
ATOM   6654 C  CB  . PRO H  2 101 ? -64.256 32.781 -49.285 1.00 40.14  ? 101 PRO V CB  1 
ATOM   6655 C  CG  . PRO H  2 101 ? -65.076 32.630 -50.511 1.00 41.38  ? 101 PRO V CG  1 
ATOM   6656 C  CD  . PRO H  2 101 ? -64.125 32.780 -51.687 1.00 41.92  ? 101 PRO V CD  1 
ATOM   6657 N  N   . GLY H  2 102 ? -63.049 30.127 -48.290 1.00 35.30  ? 102 GLY V N   1 
ATOM   6658 C  CA  . GLY H  2 102 ? -63.258 28.740 -47.894 1.00 34.46  ? 102 GLY V CA  1 
ATOM   6659 C  C   . GLY H  2 102 ? -61.955 27.949 -47.724 1.00 32.83  ? 102 GLY V C   1 
ATOM   6660 O  O   . GLY H  2 102 ? -60.849 28.408 -48.126 1.00 32.03  ? 102 GLY V O   1 
ATOM   6661 N  N   . HIS H  2 103 ? -62.094 26.725 -47.204 1.00 31.42  ? 103 HIS V N   1 
ATOM   6662 C  CA  . HIS H  2 103 ? -60.925 25.834 -46.986 1.00 30.67  ? 103 HIS V CA  1 
ATOM   6663 C  C   . HIS H  2 103 ? -60.643 24.913 -48.157 1.00 31.27  ? 103 HIS V C   1 
ATOM   6664 O  O   . HIS H  2 103 ? -61.529 24.154 -48.564 1.00 33.06  ? 103 HIS V O   1 
ATOM   6665 C  CB  . HIS H  2 103 ? -61.087 24.972 -45.749 1.00 30.02  ? 103 HIS V CB  1 
ATOM   6666 C  CG  . HIS H  2 103 ? -59.827 24.201 -45.419 1.00 28.61  ? 103 HIS V CG  1 
ATOM   6667 N  ND1 . HIS H  2 103 ? -59.661 22.894 -45.767 1.00 28.40  ? 103 HIS V ND1 1 
ATOM   6668 C  CD2 . HIS H  2 103 ? -58.612 24.620 -44.831 1.00 27.59  ? 103 HIS V CD2 1 
ATOM   6669 C  CE1 . HIS H  2 103 ? -58.403 22.496 -45.393 1.00 28.25  ? 103 HIS V CE1 1 
ATOM   6670 N  NE2 . HIS H  2 103 ? -57.775 23.550 -44.802 1.00 25.59  ? 103 HIS V NE2 1 
ATOM   6671 N  N   . HIS H  2 104 ? -59.425 24.973 -48.710 1.00 31.82  ? 104 HIS V N   1 
ATOM   6672 C  CA  . HIS H  2 104 ? -59.051 24.136 -49.878 1.00 32.90  ? 104 HIS V CA  1 
ATOM   6673 C  C   . HIS H  2 104 ? -57.674 23.585 -49.668 1.00 30.71  ? 104 HIS V C   1 
ATOM   6674 O  O   . HIS H  2 104 ? -56.759 24.357 -49.316 1.00 28.81  ? 104 HIS V O   1 
ATOM   6675 C  CB  . HIS H  2 104 ? -59.015 24.935 -51.214 1.00 35.08  ? 104 HIS V CB  1 
ATOM   6676 C  CG  . HIS H  2 104 ? -60.030 26.048 -51.325 1.00 37.49  ? 104 HIS V CG  1 
ATOM   6677 N  ND1 . HIS H  2 104 ? -59.688 27.364 -51.253 1.00 38.67  ? 104 HIS V ND1 1 
ATOM   6678 C  CD2 . HIS H  2 104 ? -61.397 26.006 -51.541 1.00 40.70  ? 104 HIS V CD2 1 
ATOM   6679 C  CE1 . HIS H  2 104 ? -60.788 28.125 -51.370 1.00 43.43  ? 104 HIS V CE1 1 
ATOM   6680 N  NE2 . HIS H  2 104 ? -61.851 27.305 -51.580 1.00 43.98  ? 104 HIS V NE2 1 
ATOM   6681 N  N   . HIS H  2 105 ? -57.500 22.283 -49.966 1.00 31.14  ? 105 HIS V N   1 
ATOM   6682 C  CA  . HIS H  2 105 ? -56.153 21.660 -50.055 1.00 32.68  ? 105 HIS V CA  1 
ATOM   6683 C  C   . HIS H  2 105 ? -55.829 21.225 -51.462 1.00 35.36  ? 105 HIS V C   1 
ATOM   6684 O  O   . HIS H  2 105 ? -56.609 20.477 -52.093 1.00 36.61  ? 105 HIS V O   1 
ATOM   6685 C  CB  . HIS H  2 105 ? -56.018 20.441 -49.135 1.00 34.30  ? 105 HIS V CB  1 
ATOM   6686 C  CG  . HIS H  2 105 ? -55.783 20.775 -47.681 1.00 38.04  ? 105 HIS V CG  1 
ATOM   6687 N  ND1 . HIS H  2 105 ? -55.851 19.846 -46.700 1.00 33.68  ? 105 HIS V ND1 1 
ATOM   6688 C  CD2 . HIS H  2 105 ? -55.494 21.994 -47.054 1.00 36.66  ? 105 HIS V CD2 1 
ATOM   6689 C  CE1 . HIS H  2 105 ? -55.610 20.443 -45.506 1.00 31.04  ? 105 HIS V CE1 1 
ATOM   6690 N  NE2 . HIS H  2 105 ? -55.370 21.750 -45.730 1.00 33.69  ? 105 HIS V NE2 1 
ATOM   6691 N  N   . LYS H  2 106 ? -54.718 21.736 -51.981 1.00 32.49  ? 106 LYS V N   1 
ATOM   6692 C  CA  . LYS H  2 106 ? -54.048 21.192 -53.142 1.00 36.50  ? 106 LYS V CA  1 
ATOM   6693 C  C   . LYS H  2 106 ? -53.192 20.005 -52.672 1.00 34.22  ? 106 LYS V C   1 
ATOM   6694 O  O   . LYS H  2 106 ? -53.066 19.732 -51.459 1.00 30.10  ? 106 LYS V O   1 
ATOM   6695 C  CB  . LYS H  2 106 ? -53.160 22.261 -53.847 1.00 38.39  ? 106 LYS V CB  1 
ATOM   6696 C  CG  . LYS H  2 106 ? -53.867 23.531 -54.378 1.00 41.84  ? 106 LYS V CG  1 
ATOM   6697 C  CD  . LYS H  2 106 ? -52.833 24.436 -55.073 1.00 44.58  ? 106 LYS V CD  1 
ATOM   6698 C  CE  . LYS H  2 106 ? -53.378 25.600 -55.879 1.00 49.51  ? 106 LYS V CE  1 
ATOM   6699 N  NZ  . LYS H  2 106 ? -54.462 26.337 -55.172 1.00 51.57  ? 106 LYS V NZ  1 
ATOM   6700 N  N   . PRO H  2 107 ? -52.579 19.296 -53.614 1.00 33.77  ? 107 PRO V N   1 
ATOM   6701 C  CA  . PRO H  2 107 ? -51.622 18.281 -53.171 1.00 34.83  ? 107 PRO V CA  1 
ATOM   6702 C  C   . PRO H  2 107 ? -50.491 18.881 -52.333 1.00 33.99  ? 107 PRO V C   1 
ATOM   6703 O  O   . PRO H  2 107 ? -50.131 20.063 -52.481 1.00 32.36  ? 107 PRO V O   1 
ATOM   6704 C  CB  . PRO H  2 107 ? -51.083 17.705 -54.480 1.00 37.41  ? 107 PRO V CB  1 
ATOM   6705 C  CG  . PRO H  2 107 ? -52.119 18.027 -55.490 1.00 39.81  ? 107 PRO V CG  1 
ATOM   6706 C  CD  . PRO H  2 107 ? -52.728 19.323 -55.076 1.00 37.33  ? 107 PRO V CD  1 
ATOM   6707 N  N   . GLY H  2 108 ? -49.911 18.047 -51.491 1.00 35.18  ? 108 GLY V N   1 
ATOM   6708 C  CA  . GLY H  2 108 ? -48.838 18.489 -50.595 1.00 33.51  ? 108 GLY V CA  1 
ATOM   6709 C  C   . GLY H  2 108 ? -47.438 18.310 -51.148 1.00 32.12  ? 108 GLY V C   1 
ATOM   6710 O  O   . GLY H  2 108 ? -47.211 18.245 -52.375 1.00 31.76  ? 108 GLY V O   1 
ATOM   6711 N  N   . LEU H  2 109 ? -46.489 18.313 -50.220 1.00 29.00  ? 109 LEU V N   1 
ATOM   6712 C  CA  . LEU H  2 109 ? -45.079 18.132 -50.532 1.00 31.17  ? 109 LEU V CA  1 
ATOM   6713 C  C   . LEU H  2 109 ? -44.874 16.834 -51.300 1.00 33.45  ? 109 LEU V C   1 
ATOM   6714 O  O   . LEU H  2 109 ? -45.450 15.801 -50.950 1.00 31.60  ? 109 LEU V O   1 
ATOM   6715 C  CB  . LEU H  2 109 ? -44.208 18.089 -49.248 1.00 32.03  ? 109 LEU V CB  1 
ATOM   6716 C  CG  . LEU H  2 109 ? -43.483 19.307 -48.710 1.00 34.01  ? 109 LEU V CG  1 
ATOM   6717 C  CD1 . LEU H  2 109 ? -42.313 18.873 -47.825 1.00 33.61  ? 109 LEU V CD1 1 
ATOM   6718 C  CD2 . LEU H  2 109 ? -42.998 20.207 -49.841 1.00 35.33  ? 109 LEU V CD2 1 
ATOM   6719 N  N   . GLY H  2 110 ? -44.048 16.896 -52.342 1.00 36.88  ? 110 GLY V N   1 
ATOM   6720 C  CA  . GLY H  2 110 ? -43.627 15.705 -53.037 1.00 41.21  ? 110 GLY V CA  1 
ATOM   6721 C  C   . GLY H  2 110 ? -44.682 15.180 -53.982 1.00 46.43  ? 110 GLY V C   1 
ATOM   6722 O  O   . GLY H  2 110 ? -44.570 14.040 -54.464 1.00 48.33  ? 110 GLY V O   1 
ATOM   6723 N  N   . GLU H  2 111 ? -45.669 16.039 -54.261 1.00 47.70  ? 111 GLU V N   1 
ATOM   6724 C  CA  . GLU H  2 111 ? -46.876 15.726 -55.050 1.00 55.63  ? 111 GLU V CA  1 
ATOM   6725 C  C   . GLU H  2 111 ? -47.811 14.837 -54.202 1.00 57.05  ? 111 GLU V C   1 
ATOM   6726 O  O   . GLU H  2 111 ? -47.382 14.259 -53.207 1.00 60.15  ? 111 GLU V O   1 
ATOM   6727 C  CB  . GLU H  2 111 ? -46.496 15.094 -56.400 1.00 64.12  ? 111 GLU V CB  1 
ATOM   6728 C  CG  . GLU H  2 111 ? -47.333 15.552 -57.587 1.00 69.84  ? 111 GLU V CG  1 
ATOM   6729 C  CD  . GLU H  2 111 ? -47.140 17.025 -57.937 1.00 71.65  ? 111 GLU V CD  1 
ATOM   6730 O  OE1 . GLU H  2 111 ? -48.005 17.849 -57.540 1.00 70.58  ? 111 GLU V OE1 1 
ATOM   6731 O  OE2 . GLU H  2 111 ? -46.142 17.359 -58.619 1.00 74.89  ? 111 GLU V OE2 1 
ATOM   6732 N  N   . GLY H  2 112 ? -49.086 14.746 -54.570 1.00 62.33  ? 112 GLY V N   1 
ATOM   6733 C  CA  . GLY H  2 112 ? -50.051 13.914 -53.817 1.00 61.08  ? 112 GLY V CA  1 
ATOM   6734 C  C   . GLY H  2 112 ? -49.784 13.913 -52.320 1.00 56.43  ? 112 GLY V C   1 
ATOM   6735 O  O   . GLY H  2 112 ? -49.751 14.979 -51.697 1.00 50.64  ? 112 GLY V O   1 
HETATM 6736 CA CA  . CA  I  3 .   ? -5.139  23.194 1.154   1.00 15.63  ? 101 CA  A CA  1 
HETATM 6737 MN MN  . MN  J  4 .   ? 7.021   31.650 -1.922  1.00 19.99  ? 201 MN  C MN  1 
HETATM 6738 MN MN  . MN  K  4 .   ? -16.259 47.922 -14.980 0.40 17.78  ? 202 MN  C MN  1 
HETATM 6739 CA CA  . CA  L  3 .   ? -16.126 37.603 -23.363 1.00 17.75  ? 203 CA  C CA  1 
HETATM 6740 CA CA  . CA  M  3 .   ? -14.264 48.632 -24.704 1.00 18.64  ? 204 CA  C CA  1 
HETATM 6741 C  C1  . GOL N  5 .   ? 5.637   27.860 -5.758  1.00 37.33  ? 205 GOL C C1  1 
HETATM 6742 O  O1  . GOL N  5 .   ? 6.649   26.969 -6.256  1.00 39.37  ? 205 GOL C O1  1 
HETATM 6743 C  C2  . GOL N  5 .   ? 4.532   27.132 -4.998  1.00 34.95  ? 205 GOL C C2  1 
HETATM 6744 O  O2  . GOL N  5 .   ? 3.411   27.995 -4.748  1.00 25.04  ? 205 GOL C O2  1 
HETATM 6745 C  C3  . GOL N  5 .   ? 4.047   25.921 -5.783  1.00 39.38  ? 205 GOL C C3  1 
HETATM 6746 O  O3  . GOL N  5 .   ? 3.705   24.927 -4.810  1.00 42.90  ? 205 GOL C O3  1 
HETATM 6747 S  S   . SO4 O  6 .   ? -29.019 19.312 -11.619 1.00 58.06  ? 101 SO4 K S   1 
HETATM 6748 O  O1  . SO4 O  6 .   ? -28.846 19.299 -13.103 1.00 56.10  ? 101 SO4 K O1  1 
HETATM 6749 O  O2  . SO4 O  6 .   ? -30.474 19.237 -11.292 1.00 52.67  ? 101 SO4 K O2  1 
HETATM 6750 O  O3  . SO4 O  6 .   ? -28.295 18.100 -11.073 1.00 47.30  ? 101 SO4 K O3  1 
HETATM 6751 O  O4  . SO4 O  6 .   ? -28.539 20.598 -10.988 1.00 41.35  ? 101 SO4 K O4  1 
HETATM 6752 CA CA  . CA  P  3 .   ? -14.999 30.234 -14.662 1.00 14.93  ? 102 CA  K CA  1 
HETATM 6753 C  C1  . GOL Q  5 .   ? -13.922 27.163 -4.264  1.00 37.18  ? 103 GOL K C1  1 
HETATM 6754 O  O1  . GOL Q  5 .   ? -13.383 27.908 -3.222  1.00 27.56  ? 103 GOL K O1  1 
HETATM 6755 C  C2  . GOL Q  5 .   ? -15.098 26.450 -3.655  1.00 39.05  ? 103 GOL K C2  1 
HETATM 6756 O  O2  . GOL Q  5 .   ? -16.292 27.166 -3.919  1.00 45.43  ? 103 GOL K O2  1 
HETATM 6757 C  C3  . GOL Q  5 .   ? -15.133 25.095 -4.316  1.00 46.04  ? 103 GOL K C3  1 
HETATM 6758 O  O3  . GOL Q  5 .   ? -14.857 25.254 -5.712  1.00 37.09  ? 103 GOL K O3  1 
HETATM 6759 MN MN  . MN  R  4 .   ? -4.491  5.880  2.330   0.50 19.36  ? 201 MN  L MN  1 
HETATM 6760 MN MN  . MN  S  4 .   ? -6.267  22.401 -24.303 1.00 17.50  ? 202 MN  L MN  1 
HETATM 6761 S  S   . SO4 T  6 .   ? 8.724   6.887  8.882   1.00 46.41  ? 203 SO4 L S   1 
HETATM 6762 O  O1  . SO4 T  6 .   ? 9.657   7.866  8.300   1.00 43.53  ? 203 SO4 L O1  1 
HETATM 6763 O  O2  . SO4 T  6 .   ? 7.299   7.113  8.486   1.00 44.29  ? 203 SO4 L O2  1 
HETATM 6764 O  O3  . SO4 T  6 .   ? 9.255   5.553  8.484   1.00 51.84  ? 203 SO4 L O3  1 
HETATM 6765 O  O4  . SO4 T  6 .   ? 8.706   6.895  10.355  1.00 48.67  ? 203 SO4 L O4  1 
HETATM 6766 CA CA  . CA  U  3 .   ? 2.431   16.217 6.114   1.00 19.39  ? 204 CA  L CA  1 
HETATM 6767 CA CA  . CA  V  3 .   ? 5.193   5.311  4.669   1.00 19.47  ? 205 CA  L CA  1 
HETATM 6768 CA CA  . CA  W  3 .   ? -35.495 23.221 -28.503 1.00 16.06  ? 101 CA  S CA  1 
HETATM 6769 C  C1  . GOL X  5 .   ? -31.174 33.101 -13.751 1.00 49.60  ? 102 GOL S C1  1 
HETATM 6770 O  O1  . GOL X  5 .   ? -31.396 33.933 -14.881 1.00 54.11  ? 102 GOL S O1  1 
HETATM 6771 C  C2  . GOL X  5 .   ? -32.551 32.914 -13.153 1.00 47.18  ? 102 GOL S C2  1 
HETATM 6772 O  O2  . GOL X  5 .   ? -33.285 34.140 -13.212 1.00 55.45  ? 102 GOL S O2  1 
HETATM 6773 C  C3  . GOL X  5 .   ? -33.233 31.821 -13.955 1.00 41.30  ? 102 GOL S C3  1 
HETATM 6774 O  O3  . GOL X  5 .   ? -34.659 31.894 -13.856 1.00 44.21  ? 102 GOL S O3  1 
HETATM 6775 C  C1  . GOL Y  5 .   ? -30.374 21.388 -21.057 1.00 36.70  ? 103 GOL S C1  1 
HETATM 6776 O  O1  . GOL Y  5 .   ? -29.200 20.987 -21.673 1.00 33.41  ? 103 GOL S O1  1 
HETATM 6777 C  C2  . GOL Y  5 .   ? -29.959 21.844 -19.687 1.00 33.67  ? 103 GOL S C2  1 
HETATM 6778 O  O2  . GOL Y  5 .   ? -28.906 21.040 -19.088 1.00 34.45  ? 103 GOL S O2  1 
HETATM 6779 C  C3  . GOL Y  5 .   ? -29.313 23.144 -19.850 1.00 30.93  ? 103 GOL S C3  1 
HETATM 6780 O  O3  . GOL Y  5 .   ? -30.020 24.032 -20.561 1.00 34.55  ? 103 GOL S O3  1 
HETATM 6781 MN MN  . MN  Z  4 .   ? -29.697 31.495 -39.794 1.00 13.82  ? 201 MN  T MN  1 
HETATM 6782 MN MN  . MN  AA 4 .   ? -54.061 48.717 -30.478 0.49 24.90  ? 202 MN  T MN  1 
HETATM 6783 CA CA  . CA  BA 3 .   ? -60.246 49.623 -38.241 1.00 18.93  ? 203 CA  T CA  1 
HETATM 6784 CA CA  . CA  CA 3 .   ? -60.970 38.535 -35.815 1.00 20.37  ? 204 CA  T CA  1 
HETATM 6785 C  C1  . GOL DA 5 .   ? -34.120 27.852 -38.896 1.00 22.73  ? 205 GOL T C1  1 
HETATM 6786 O  O1  . GOL DA 5 .   ? -35.014 27.366 -37.921 1.00 39.86  ? 205 GOL T O1  1 
HETATM 6787 C  C2  . GOL DA 5 .   ? -34.125 26.828 -40.034 1.00 34.13  ? 205 GOL T C2  1 
HETATM 6788 O  O2  . GOL DA 5 .   ? -34.227 25.489 -39.489 1.00 37.88  ? 205 GOL T O2  1 
HETATM 6789 C  C3  . GOL DA 5 .   ? -32.902 26.906 -40.946 1.00 36.31  ? 205 GOL T C3  1 
HETATM 6790 O  O3  . GOL DA 5 .   ? -33.180 27.002 -42.355 1.00 34.67  ? 205 GOL T O3  1 
HETATM 6791 C  C1  . GOL EA 5 .   ? -65.036 47.774 -37.874 1.00 34.22  ? 206 GOL T C1  1 
HETATM 6792 O  O1  . GOL EA 5 .   ? -65.691 48.052 -36.627 1.00 41.41  ? 206 GOL T O1  1 
HETATM 6793 C  C2  . GOL EA 5 .   ? -65.948 47.849 -39.088 1.00 37.10  ? 206 GOL T C2  1 
HETATM 6794 O  O2  . GOL EA 5 .   ? -66.956 48.855 -39.050 1.00 45.85  ? 206 GOL T O2  1 
HETATM 6795 C  C3  . GOL EA 5 .   ? -65.062 48.118 -40.253 1.00 29.63  ? 206 GOL T C3  1 
HETATM 6796 O  O3  . GOL EA 5 .   ? -65.939 48.435 -41.319 1.00 41.80  ? 206 GOL T O3  1 
HETATM 6797 CA CA  . CA  FA 3 .   ? -53.793 30.977 -31.170 1.00 19.36  ? 101 CA  U CA  1 
HETATM 6798 MN MN  . MN  GA 4 .   ? -55.580 23.599 -44.287 1.00 23.68  ? 201 MN  V MN  1 
HETATM 6799 S  S   . SO4 HA 6 .   ? -21.390 6.332  -34.011 1.00 54.29  ? 202 SO4 V S   1 
HETATM 6800 O  O1  . SO4 HA 6 .   ? -21.524 6.853  -35.388 1.00 52.62  ? 202 SO4 V O1  1 
HETATM 6801 O  O2  . SO4 HA 6 .   ? -22.638 6.468  -33.189 1.00 52.61  ? 202 SO4 V O2  1 
HETATM 6802 O  O3  . SO4 HA 6 .   ? -20.964 4.921  -34.137 1.00 60.85  ? 202 SO4 V O3  1 
HETATM 6803 O  O4  . SO4 HA 6 .   ? -20.270 7.017  -33.314 1.00 60.26  ? 202 SO4 V O4  1 
HETATM 6804 CA CA  . CA  IA 3 .   ? -27.298 15.785 -31.005 1.00 19.46  ? 203 CA  V CA  1 
HETATM 6805 CA CA  . CA  JA 3 .   ? -27.138 4.889  -34.309 1.00 23.28  ? 204 CA  V CA  1 
HETATM 6806 O  O   . HOH KA 7 .   ? 5.495   44.851 -6.084  1.00 21.18  ? 201 HOH A O   1 
HETATM 6807 O  O   . HOH KA 7 .   ? 7.621   43.789 -7.628  1.00 25.79  ? 202 HOH A O   1 
HETATM 6808 O  O   . HOH KA 7 .   ? -2.747  22.984 0.749   1.00 19.35  ? 203 HOH A O   1 
HETATM 6809 O  O   . HOH KA 7 .   ? -16.853 37.529 -5.961  1.00 24.90  ? 204 HOH A O   1 
HETATM 6810 O  O   . HOH KA 7 .   ? -10.983 17.740 -0.339  1.00 23.80  ? 205 HOH A O   1 
HETATM 6811 O  O   . HOH KA 7 .   ? -18.369 34.108 -2.684  1.00 41.01  ? 206 HOH A O   1 
HETATM 6812 O  O   . HOH KA 7 .   ? -14.568 30.375 -2.416  1.00 26.40  ? 207 HOH A O   1 
HETATM 6813 O  O   . HOH KA 7 .   ? -1.918  18.219 6.121   1.00 20.47  ? 208 HOH A O   1 
HETATM 6814 O  O   . HOH KA 7 .   ? -17.018 42.034 -11.643 1.00 19.15  ? 209 HOH A O   1 
HETATM 6815 O  O   . HOH KA 7 .   ? -19.905 27.565 1.648   1.00 31.48  ? 210 HOH A O   1 
HETATM 6816 O  O   . HOH KA 7 .   ? -0.192  22.623 -0.797  1.00 24.21  ? 211 HOH A O   1 
HETATM 6817 O  O   . HOH KA 7 .   ? -13.060 42.841 -2.679  1.00 16.95  ? 212 HOH A O   1 
HETATM 6818 O  O   . HOH KA 7 .   ? -5.561  25.109 9.910   1.00 25.45  ? 213 HOH A O   1 
HETATM 6819 O  O   . HOH KA 7 .   ? -14.269 48.578 -5.523  1.00 28.86  ? 214 HOH A O   1 
HETATM 6820 O  O   . HOH KA 7 .   ? -13.948 25.888 8.440   1.00 25.95  ? 215 HOH A O   1 
HETATM 6821 O  O   . HOH KA 7 .   ? -18.149 53.789 -7.554  1.00 31.68  ? 216 HOH A O   1 
HETATM 6822 O  O   . HOH KA 7 .   ? -10.390 30.834 9.415   1.00 36.02  ? 217 HOH A O   1 
HETATM 6823 O  O   . HOH KA 7 .   ? -15.322 32.294 11.526  1.00 31.77  ? 218 HOH A O   1 
HETATM 6824 O  O   . HOH KA 7 .   ? 1.554   30.655 8.620   1.00 18.63  ? 219 HOH A O   1 
HETATM 6825 O  O   . HOH KA 7 .   ? -12.175 22.425 2.812   1.00 21.90  ? 220 HOH A O   1 
HETATM 6826 O  O   . HOH KA 7 .   ? 10.554  47.063 -10.582 1.00 30.59  ? 221 HOH A O   1 
HETATM 6827 O  O   . HOH KA 7 .   ? -14.406 47.326 -2.655  1.00 28.04  ? 222 HOH A O   1 
HETATM 6828 O  O   . HOH KA 7 .   ? -17.131 29.345 -6.466  1.00 27.09  ? 223 HOH A O   1 
HETATM 6829 O  O   . HOH KA 7 .   ? -13.983 36.809 7.983   1.00 38.78  ? 224 HOH A O   1 
HETATM 6830 O  O   . HOH KA 7 .   ? 3.052   51.690 -14.756 1.00 28.11  ? 225 HOH A O   1 
HETATM 6831 O  O   . HOH KA 7 .   ? 1.146   48.698 -7.894  1.00 22.87  ? 226 HOH A O   1 
HETATM 6832 O  O   . HOH KA 7 .   ? -1.893  21.593 7.623   1.00 28.84  ? 227 HOH A O   1 
HETATM 6833 O  O   . HOH KA 7 .   ? -3.839  31.666 16.932  1.00 38.65  ? 228 HOH A O   1 
HETATM 6834 O  O   . HOH KA 7 .   ? -17.170 36.641 -2.956  1.00 39.24  ? 229 HOH A O   1 
HETATM 6835 O  O   . HOH KA 7 .   ? -11.101 30.986 12.059  1.00 38.24  ? 230 HOH A O   1 
HETATM 6836 O  O   . HOH KA 7 .   ? -9.231  30.643 13.992  1.00 28.37  ? 231 HOH A O   1 
HETATM 6837 O  O   . HOH KA 7 .   ? -7.926  32.828 15.449  1.00 34.43  ? 232 HOH A O   1 
HETATM 6838 O  O   . HOH KA 7 .   ? 2.675   28.999 7.147   1.00 12.67  ? 233 HOH A O   1 
HETATM 6839 O  O   . HOH KA 7 .   ? -21.394 32.758 5.050   1.00 25.18  ? 234 HOH A O   1 
HETATM 6840 O  O   . HOH KA 7 .   ? -6.549  34.579 14.105  1.00 26.69  ? 235 HOH A O   1 
HETATM 6841 O  O   . HOH KA 7 .   ? -15.203 35.442 10.677  1.00 32.32  ? 236 HOH A O   1 
HETATM 6842 O  O   . HOH KA 7 .   ? -18.973 39.160 -6.853  1.00 27.23  ? 237 HOH A O   1 
HETATM 6843 O  O   . HOH KA 7 .   ? -21.973 46.422 -10.996 1.00 33.12  ? 238 HOH A O   1 
HETATM 6844 O  O   . HOH KA 7 .   ? -1.705  34.113 12.842  1.00 32.08  ? 239 HOH A O   1 
HETATM 6845 O  O   . HOH KA 7 .   ? 5.660   39.456 2.481   1.00 31.90  ? 240 HOH A O   1 
HETATM 6846 O  O   . HOH KA 7 .   ? -12.926 23.554 7.482   1.00 29.04  ? 241 HOH A O   1 
HETATM 6847 O  O   . HOH KA 7 .   ? -12.470 28.928 11.466  1.00 43.58  ? 242 HOH A O   1 
HETATM 6848 O  O   . HOH KA 7 .   ? -18.436 33.216 -5.443  1.00 31.90  ? 243 HOH A O   1 
HETATM 6849 O  O   . HOH KA 7 .   ? -19.666 43.151 -5.132  1.00 30.95  ? 244 HOH A O   1 
HETATM 6850 O  O   . HOH KA 7 .   ? 5.956   43.301 -3.788  1.00 39.12  ? 245 HOH A O   1 
HETATM 6851 O  O   . HOH KA 7 .   ? -17.949 35.412 -6.492  1.00 35.98  ? 246 HOH A O   1 
HETATM 6852 O  O   . HOH KA 7 .   ? -24.319 53.496 -4.676  1.00 53.45  ? 247 HOH A O   1 
HETATM 6853 O  O   . HOH KA 7 .   ? -15.370 25.317 10.692  1.00 33.97  ? 248 HOH A O   1 
HETATM 6854 O  O   . HOH KA 7 .   ? -20.213 40.369 -5.145  1.00 35.60  ? 249 HOH A O   1 
HETATM 6855 O  O   . HOH KA 7 .   ? 5.180   36.613 8.389   1.00 34.30  ? 250 HOH A O   1 
HETATM 6856 O  O   . HOH KA 7 .   ? -8.647  28.264 14.393  1.00 45.43  ? 251 HOH A O   1 
HETATM 6857 O  O   . HOH KA 7 .   ? -3.692  24.925 -9.518  1.00 41.37  ? 252 HOH A O   1 
HETATM 6858 O  O   . HOH KA 7 .   ? -6.182  27.990 -9.551  1.00 44.38  ? 253 HOH A O   1 
HETATM 6859 O  O   . HOH LA 7 .   ? 10.221  36.705 -17.222 1.00 38.03  ? 301 HOH C O   1 
HETATM 6860 O  O   . HOH LA 7 .   ? -3.975  54.999 -22.465 1.00 21.44  ? 302 HOH C O   1 
HETATM 6861 O  O   . HOH LA 7 .   ? -7.615  54.583 -7.415  1.00 22.03  ? 303 HOH C O   1 
HETATM 6862 O  O   . HOH LA 7 .   ? -11.155 33.898 -18.503 1.00 14.99  ? 304 HOH C O   1 
HETATM 6863 O  O   . HOH LA 7 .   ? -17.540 39.249 -22.408 1.00 21.16  ? 305 HOH C O   1 
HETATM 6864 O  O   . HOH LA 7 .   ? -1.422  53.608 -20.617 1.00 23.59  ? 306 HOH C O   1 
HETATM 6865 O  O   . HOH LA 7 .   ? 0.685   49.564 -15.136 1.00 21.77  ? 307 HOH C O   1 
HETATM 6866 O  O   . HOH LA 7 .   ? 1.548   27.158 -2.838  1.00 19.86  ? 308 HOH C O   1 
HETATM 6867 O  O   . HOH LA 7 .   ? -0.050  43.221 -26.935 1.00 20.62  ? 309 HOH C O   1 
HETATM 6868 O  O   . HOH LA 7 .   ? -10.561 52.964 -8.282  1.00 26.66  ? 310 HOH C O   1 
HETATM 6869 O  O   . HOH LA 7 .   ? 5.581   26.697 -13.126 1.00 27.60  ? 311 HOH C O   1 
HETATM 6870 O  O   . HOH LA 7 .   ? -10.408 45.722 -31.619 1.00 24.72  ? 312 HOH C O   1 
HETATM 6871 O  O   . HOH LA 7 .   ? -8.680  29.202 -20.081 1.00 24.84  ? 313 HOH C O   1 
HETATM 6872 O  O   . HOH LA 7 .   ? 3.413   24.184 -10.106 1.00 27.07  ? 314 HOH C O   1 
HETATM 6873 O  O   . HOH LA 7 .   ? -11.552 52.153 -12.039 1.00 20.09  ? 315 HOH C O   1 
HETATM 6874 O  O   . HOH LA 7 .   ? 8.839   40.012 -11.017 1.00 22.64  ? 316 HOH C O   1 
HETATM 6875 O  O   . HOH LA 7 .   ? 7.032   31.118 -14.311 1.00 19.52  ? 317 HOH C O   1 
HETATM 6876 O  O   . HOH LA 7 .   ? 17.773  27.196 -3.800  1.00 30.33  ? 318 HOH C O   1 
HETATM 6877 O  O   . HOH LA 7 .   ? -4.501  51.291 -5.717  1.00 25.13  ? 319 HOH C O   1 
HETATM 6878 O  O   . HOH LA 7 .   ? -11.081 29.648 -20.558 1.00 21.57  ? 320 HOH C O   1 
HETATM 6879 O  O   . HOH LA 7 .   ? 4.419   24.508 -14.361 1.00 30.27  ? 321 HOH C O   1 
HETATM 6880 O  O   . HOH LA 7 .   ? 7.377   44.019 -24.164 1.00 32.28  ? 322 HOH C O   1 
HETATM 6881 O  O   . HOH LA 7 .   ? -18.062 37.463 -18.087 1.00 23.28  ? 323 HOH C O   1 
HETATM 6882 O  O   . HOH LA 7 .   ? -10.080 46.902 -4.152  1.00 20.98  ? 324 HOH C O   1 
HETATM 6883 O  O   . HOH LA 7 .   ? 8.377   42.511 -25.970 1.00 27.07  ? 325 HOH C O   1 
HETATM 6884 O  O   . HOH LA 7 .   ? -11.384 48.690 -5.674  1.00 24.95  ? 326 HOH C O   1 
HETATM 6885 O  O   . HOH LA 7 .   ? -15.158 46.841 -26.117 1.00 22.13  ? 327 HOH C O   1 
HETATM 6886 O  O   . HOH LA 7 .   ? -3.837  47.932 -29.658 1.00 25.57  ? 328 HOH C O   1 
HETATM 6887 O  O   . HOH LA 7 .   ? 5.424   45.599 -25.125 1.00 27.19  ? 329 HOH C O   1 
HETATM 6888 O  O   . HOH LA 7 .   ? -1.152  48.365 -6.273  1.00 19.25  ? 330 HOH C O   1 
HETATM 6889 O  O   . HOH LA 7 .   ? -1.744  50.640 -14.076 1.00 27.27  ? 331 HOH C O   1 
HETATM 6890 O  O   . HOH LA 7 .   ? -16.591 43.564 -17.263 1.00 21.49  ? 332 HOH C O   1 
HETATM 6891 O  O   . HOH LA 7 .   ? -1.033  52.253 -17.077 1.00 35.07  ? 333 HOH C O   1 
HETATM 6892 O  O   . HOH LA 7 .   ? -12.564 42.440 -30.230 1.00 27.14  ? 334 HOH C O   1 
HETATM 6893 O  O   . HOH LA 7 .   ? -16.278 52.804 -30.252 1.00 31.54  ? 335 HOH C O   1 
HETATM 6894 O  O   . HOH LA 7 .   ? -6.341  53.740 -2.867  1.00 35.90  ? 336 HOH C O   1 
HETATM 6895 O  O   . HOH LA 7 .   ? -1.077  47.322 -29.069 1.00 30.68  ? 337 HOH C O   1 
HETATM 6896 O  O   . HOH LA 7 .   ? 5.496   45.350 -27.674 1.00 31.42  ? 338 HOH C O   1 
HETATM 6897 O  O   . HOH LA 7 .   ? -10.703 44.548 -2.621  1.00 30.33  ? 339 HOH C O   1 
HETATM 6898 O  O   . HOH LA 7 .   ? 8.852   37.939 -19.183 1.00 34.20  ? 340 HOH C O   1 
HETATM 6899 O  O   . HOH LA 7 .   ? -5.000  54.939 -5.893  1.00 46.42  ? 341 HOH C O   1 
HETATM 6900 O  O   . HOH LA 7 .   ? 5.062   29.090 -14.443 1.00 28.41  ? 342 HOH C O   1 
HETATM 6901 O  O   . HOH LA 7 .   ? -4.265  52.817 -10.512 1.00 33.35  ? 343 HOH C O   1 
HETATM 6902 O  O   . HOH LA 7 .   ? 11.442  38.087 -5.705  1.00 35.41  ? 344 HOH C O   1 
HETATM 6903 O  O   . HOH LA 7 .   ? -4.996  35.094 -34.573 1.00 33.92  ? 345 HOH C O   1 
HETATM 6904 O  O   . HOH LA 7 .   ? -0.275  42.622 -29.711 1.00 26.60  ? 346 HOH C O   1 
HETATM 6905 O  O   . HOH LA 7 .   ? 7.937   36.713 -21.484 1.00 34.08  ? 347 HOH C O   1 
HETATM 6906 O  O   . HOH LA 7 .   ? 8.406   26.733 -12.781 1.00 37.63  ? 348 HOH C O   1 
HETATM 6907 O  O   . HOH LA 7 .   ? 7.744   25.998 -4.171  1.00 34.42  ? 349 HOH C O   1 
HETATM 6908 O  O   . HOH LA 7 .   ? -18.975 33.785 -30.927 1.00 25.46  ? 350 HOH C O   1 
HETATM 6909 O  O   . HOH LA 7 .   ? -4.490  46.559 -32.101 1.00 36.81  ? 351 HOH C O   1 
HETATM 6910 O  O   . HOH LA 7 .   ? -15.719 46.960 -29.780 1.00 33.45  ? 352 HOH C O   1 
HETATM 6911 O  O   . HOH LA 7 .   ? 3.146   29.474 -7.261  1.00 26.80  ? 353 HOH C O   1 
HETATM 6912 O  O   . HOH LA 7 .   ? 13.588  30.191 -4.642  1.00 27.58  ? 354 HOH C O   1 
HETATM 6913 O  O   . HOH LA 7 .   ? -2.429  45.787 4.306   1.00 26.22  ? 355 HOH C O   1 
HETATM 6914 O  O   . HOH LA 7 .   ? -18.319 42.663 -15.261 1.00 24.85  ? 356 HOH C O   1 
HETATM 6915 O  O   . HOH LA 7 .   ? 11.619  28.100 -0.784  1.00 31.96  ? 357 HOH C O   1 
HETATM 6916 O  O   . HOH LA 7 .   ? -19.649 38.141 -11.691 1.00 26.56  ? 358 HOH C O   1 
HETATM 6917 O  O   . HOH LA 7 .   ? -6.431  44.197 -32.942 1.00 38.83  ? 359 HOH C O   1 
HETATM 6918 O  O   . HOH LA 7 .   ? 3.000   44.415 -28.375 1.00 30.29  ? 360 HOH C O   1 
HETATM 6919 O  O   . HOH LA 7 .   ? 12.403  23.197 -6.832  1.00 31.62  ? 361 HOH C O   1 
HETATM 6920 O  O   . HOH LA 7 .   ? 9.175   29.443 -13.632 1.00 31.98  ? 362 HOH C O   1 
HETATM 6921 O  O   . HOH LA 7 .   ? 0.318   54.029 -27.931 1.00 33.71  ? 363 HOH C O   1 
HETATM 6922 O  O   . HOH LA 7 .   ? 3.293   53.286 -27.380 1.00 34.51  ? 364 HOH C O   1 
HETATM 6923 O  O   . HOH LA 7 .   ? -11.959 47.362 -1.344  1.00 38.47  ? 365 HOH C O   1 
HETATM 6924 O  O   . HOH LA 7 .   ? 10.083  24.985 -6.896  1.00 31.33  ? 366 HOH C O   1 
HETATM 6925 O  O   . HOH LA 7 .   ? 7.471   43.484 -28.331 1.00 33.89  ? 367 HOH C O   1 
HETATM 6926 O  O   . HOH LA 7 .   ? -0.243  45.205 -30.437 1.00 32.65  ? 368 HOH C O   1 
HETATM 6927 O  O   . HOH LA 7 .   ? 14.378  34.533 -11.286 1.00 35.70  ? 369 HOH C O   1 
HETATM 6928 O  O   . HOH LA 7 .   ? 18.662  24.188 -8.729  1.00 36.41  ? 370 HOH C O   1 
HETATM 6929 O  O   . HOH LA 7 .   ? -6.119  29.816 -30.181 1.00 34.88  ? 371 HOH C O   1 
HETATM 6930 O  O   . HOH LA 7 .   ? 12.393  36.999 -17.023 1.00 42.67  ? 372 HOH C O   1 
HETATM 6931 O  O   . HOH LA 7 .   ? 5.049   49.689 -26.774 1.00 35.60  ? 373 HOH C O   1 
HETATM 6932 O  O   . HOH LA 7 .   ? 9.024   26.872 -9.971  1.00 34.68  ? 374 HOH C O   1 
HETATM 6933 O  O   . HOH LA 7 .   ? -9.662  47.015 5.212   1.00 44.61  ? 375 HOH C O   1 
HETATM 6934 O  O   . HOH LA 7 .   ? -12.624 35.330 -28.739 1.00 35.18  ? 376 HOH C O   1 
HETATM 6935 O  O   . HOH LA 7 .   ? 11.033  40.199 -7.619  1.00 41.28  ? 377 HOH C O   1 
HETATM 6936 O  O   . HOH LA 7 .   ? 3.899   40.099 -34.032 1.00 36.25  ? 378 HOH C O   1 
HETATM 6937 O  O   . HOH LA 7 .   ? -19.313 42.490 -18.812 1.00 33.29  ? 379 HOH C O   1 
HETATM 6938 O  O   . HOH LA 7 .   ? -16.648 50.069 -17.067 1.00 36.41  ? 380 HOH C O   1 
HETATM 6939 O  O   . HOH LA 7 .   ? -13.209 31.879 -27.199 1.00 34.65  ? 381 HOH C O   1 
HETATM 6940 O  O   . HOH LA 7 .   ? 21.425  24.122 -1.901  1.00 33.90  ? 382 HOH C O   1 
HETATM 6941 O  O   . HOH MA 7 .   ? -19.798 30.624 -9.032  1.00 22.16  ? 201 HOH K O   1 
HETATM 6942 O  O   . HOH MA 7 .   ? -26.628 18.887 -20.235 1.00 27.68  ? 202 HOH K O   1 
HETATM 6943 O  O   . HOH MA 7 .   ? -14.373 10.389 -6.403  1.00 18.59  ? 203 HOH K O   1 
HETATM 6944 O  O   . HOH MA 7 .   ? -19.332 31.748 -20.374 1.00 24.01  ? 204 HOH K O   1 
HETATM 6945 O  O   . HOH MA 7 .   ? -10.934 31.198 -18.133 1.00 18.97  ? 205 HOH K O   1 
HETATM 6946 O  O   . HOH MA 7 .   ? -19.829 23.346 -31.414 1.00 19.18  ? 206 HOH K O   1 
HETATM 6947 O  O   . HOH MA 7 .   ? -18.059 22.912 -24.425 1.00 14.11  ? 207 HOH K O   1 
HETATM 6948 O  O   . HOH MA 7 .   ? -24.397 26.494 -22.703 1.00 15.55  ? 208 HOH K O   1 
HETATM 6949 O  O   . HOH MA 7 .   ? -17.946 35.191 -19.566 1.00 18.20  ? 209 HOH K O   1 
HETATM 6950 O  O   . HOH MA 7 .   ? -26.210 19.577 -22.924 1.00 25.98  ? 210 HOH K O   1 
HETATM 6951 O  O   . HOH MA 7 .   ? -27.555 21.792 -23.722 1.00 29.22  ? 211 HOH K O   1 
HETATM 6952 O  O   . HOH MA 7 .   ? -8.204  26.822 -18.750 1.00 16.82  ? 212 HOH K O   1 
HETATM 6953 O  O   . HOH MA 7 .   ? -13.052 15.807 -1.202  1.00 27.55  ? 213 HOH K O   1 
HETATM 6954 O  O   . HOH MA 7 .   ? -2.847  5.265  -16.607 1.00 19.52  ? 214 HOH K O   1 
HETATM 6955 O  O   . HOH MA 7 .   ? -4.127  5.874  -18.916 1.00 39.67  ? 215 HOH K O   1 
HETATM 6956 O  O   . HOH MA 7 .   ? -2.709  9.337  -21.380 1.00 20.67  ? 216 HOH K O   1 
HETATM 6957 O  O   . HOH MA 7 .   ? -27.616 17.632 -24.361 1.00 32.21  ? 217 HOH K O   1 
HETATM 6958 O  O   . HOH MA 7 .   ? -16.490 35.462 -8.733  1.00 19.58  ? 218 HOH K O   1 
HETATM 6959 O  O   . HOH MA 7 .   ? -22.636 25.604 -4.826  1.00 28.15  ? 219 HOH K O   1 
HETATM 6960 O  O   . HOH MA 7 .   ? -10.511 14.519 -25.291 1.00 31.59  ? 220 HOH K O   1 
HETATM 6961 O  O   . HOH MA 7 .   ? -23.519 19.649 -23.621 1.00 20.86  ? 221 HOH K O   1 
HETATM 6962 O  O   . HOH MA 7 .   ? -21.636 31.477 -13.092 1.00 28.79  ? 222 HOH K O   1 
HETATM 6963 O  O   . HOH MA 7 .   ? -18.502 11.439 -22.579 1.00 40.78  ? 223 HOH K O   1 
HETATM 6964 O  O   . HOH MA 7 .   ? -29.468 19.845 -6.332  1.00 32.26  ? 224 HOH K O   1 
HETATM 6965 O  O   . HOH MA 7 .   ? -8.400  11.354 1.486   1.00 23.03  ? 225 HOH K O   1 
HETATM 6966 O  O   . HOH MA 7 .   ? 3.602   7.194  -23.666 1.00 34.07  ? 226 HOH K O   1 
HETATM 6967 O  O   . HOH MA 7 .   ? -13.430 23.512 -0.730  1.00 27.18  ? 227 HOH K O   1 
HETATM 6968 O  O   . HOH MA 7 .   ? -24.422 21.330 -26.159 1.00 24.87  ? 228 HOH K O   1 
HETATM 6969 O  O   . HOH MA 7 .   ? -24.215 29.383 -10.681 1.00 37.00  ? 229 HOH K O   1 
HETATM 6970 O  O   . HOH MA 7 .   ? -18.139 17.034 -29.195 1.00 25.74  ? 230 HOH K O   1 
HETATM 6971 O  O   . HOH MA 7 .   ? -11.417 29.199 -27.089 1.00 30.93  ? 231 HOH K O   1 
HETATM 6972 O  O   . HOH MA 7 .   ? -11.532 -0.554 0.594   1.00 32.96  ? 232 HOH K O   1 
HETATM 6973 O  O   . HOH MA 7 .   ? -27.886 20.282 -2.960  1.00 31.74  ? 233 HOH K O   1 
HETATM 6974 O  O   . HOH MA 7 .   ? -17.461 15.158 -31.447 1.00 53.26  ? 234 HOH K O   1 
HETATM 6975 O  O   . HOH MA 7 .   ? -15.855 17.199 -27.564 1.00 33.09  ? 235 HOH K O   1 
HETATM 6976 O  O   . HOH MA 7 .   ? -19.667 37.304 -15.735 1.00 32.16  ? 236 HOH K O   1 
HETATM 6977 O  O   . HOH MA 7 .   ? -14.809 6.236  -5.048  1.00 33.07  ? 237 HOH K O   1 
HETATM 6978 O  O   . HOH MA 7 .   ? -0.365  10.443 -22.359 1.00 25.77  ? 238 HOH K O   1 
HETATM 6979 O  O   . HOH MA 7 .   ? -27.288 28.890 -17.661 1.00 23.93  ? 239 HOH K O   1 
HETATM 6980 O  O   . HOH MA 7 .   ? -13.593 30.552 -16.455 1.00 16.57  ? 240 HOH K O   1 
HETATM 6981 O  O   . HOH MA 7 .   ? -16.368 24.652 -24.600 1.00 8.26   ? 241 HOH K O   1 
HETATM 6982 O  O   . HOH MA 7 .   ? 4.371   2.596  -15.252 1.00 27.43  ? 242 HOH K O   1 
HETATM 6983 O  O   . HOH MA 7 .   ? -22.923 28.267 -18.661 1.00 15.91  ? 243 HOH K O   1 
HETATM 6984 O  O   . HOH MA 7 .   ? -24.683 29.523 -16.856 1.00 22.95  ? 244 HOH K O   1 
HETATM 6985 O  O   . HOH MA 7 .   ? -28.023 21.261 -8.470  1.00 33.30  ? 245 HOH K O   1 
HETATM 6986 O  O   . HOH MA 7 .   ? -22.170 30.975 -10.275 1.00 27.60  ? 246 HOH K O   1 
HETATM 6987 O  O   . HOH MA 7 .   ? -4.226  10.938 -22.780 1.00 34.25  ? 247 HOH K O   1 
HETATM 6988 O  O   . HOH MA 7 .   ? -14.612 9.973  -21.037 1.00 30.44  ? 248 HOH K O   1 
HETATM 6989 O  O   . HOH MA 7 .   ? 1.284   8.690  -23.954 1.00 26.33  ? 249 HOH K O   1 
HETATM 6990 O  O   . HOH MA 7 .   ? -14.865 24.238 -27.903 1.00 25.83  ? 250 HOH K O   1 
HETATM 6991 O  O   . HOH MA 7 .   ? -18.594 15.077 -25.183 1.00 30.40  ? 251 HOH K O   1 
HETATM 6992 O  O   . HOH MA 7 .   ? -25.315 27.011 -10.383 1.00 38.78  ? 252 HOH K O   1 
HETATM 6993 O  O   . HOH MA 7 .   ? -21.438 5.597  -9.177  1.00 35.36  ? 253 HOH K O   1 
HETATM 6994 O  O   . HOH MA 7 .   ? -10.642 7.024  5.360   1.00 31.93  ? 254 HOH K O   1 
HETATM 6995 O  O   . HOH MA 7 .   ? -15.752 22.617 -5.023  1.00 37.43  ? 255 HOH K O   1 
HETATM 6996 O  O   . HOH MA 7 .   ? -20.362 32.102 -7.015  1.00 34.53  ? 256 HOH K O   1 
HETATM 6997 O  O   . HOH MA 7 .   ? -5.804  25.678 -8.693  1.00 37.38  ? 257 HOH K O   1 
HETATM 6998 O  O   . HOH NA 7 .   ? 10.378  11.911 5.876   1.00 25.27  ? 301 HOH L O   1 
HETATM 6999 O  O   . HOH NA 7 .   ? 3.315   4.634  -13.029 1.00 19.75  ? 302 HOH L O   1 
HETATM 7000 O  O   . HOH NA 7 .   ? 4.788   -1.659 -3.377  1.00 20.70  ? 303 HOH L O   1 
HETATM 7001 O  O   . HOH NA 7 .   ? -3.360  16.021 5.425   1.00 26.05  ? 304 HOH L O   1 
HETATM 7002 O  O   . HOH NA 7 .   ? 7.711   -0.792 -5.730  1.00 25.45  ? 305 HOH L O   1 
HETATM 7003 O  O   . HOH NA 7 .   ? -5.376  5.499  -15.323 1.00 16.56  ? 306 HOH L O   1 
HETATM 7004 O  O   . HOH NA 7 .   ? -3.045  9.963  3.505   1.00 22.50  ? 307 HOH L O   1 
HETATM 7005 O  O   . HOH NA 7 .   ? 14.254  6.740  -2.166  1.00 25.31  ? 308 HOH L O   1 
HETATM 7006 O  O   . HOH NA 7 .   ? 3.939   2.069  -10.383 1.00 35.67  ? 309 HOH L O   1 
HETATM 7007 O  O   . HOH NA 7 .   ? 1.442   27.443 -22.281 1.00 32.09  ? 310 HOH L O   1 
HETATM 7008 O  O   . HOH NA 7 .   ? -13.318 8.720  -8.448  1.00 28.67  ? 311 HOH L O   1 
HETATM 7009 O  O   . HOH NA 7 .   ? 13.332  11.478 -6.756  1.00 19.85  ? 312 HOH L O   1 
HETATM 7010 O  O   . HOH NA 7 .   ? 16.277  12.408 -14.599 1.00 24.37  ? 313 HOH L O   1 
HETATM 7011 O  O   . HOH NA 7 .   ? 1.338   3.404  -11.143 1.00 25.78  ? 314 HOH L O   1 
HETATM 7012 O  O   . HOH NA 7 .   ? 2.960   14.411 -21.976 1.00 22.63  ? 315 HOH L O   1 
HETATM 7013 O  O   . HOH NA 7 .   ? -7.002  2.520  -12.536 1.00 29.17  ? 316 HOH L O   1 
HETATM 7014 O  O   . HOH NA 7 .   ? 6.171   7.011  6.148   1.00 25.25  ? 317 HOH L O   1 
HETATM 7015 O  O   . HOH NA 7 .   ? 7.073   21.809 5.375   1.00 28.34  ? 318 HOH L O   1 
HETATM 7016 O  O   . HOH NA 7 .   ? -11.589 6.622  -8.408  1.00 24.73  ? 319 HOH L O   1 
HETATM 7017 O  O   . HOH NA 7 .   ? 8.670   18.961 5.545   1.00 35.16  ? 320 HOH L O   1 
HETATM 7018 O  O   . HOH NA 7 .   ? 1.855   24.189 0.468   1.00 26.04  ? 321 HOH L O   1 
HETATM 7019 O  O   . HOH NA 7 .   ? 12.811  8.844  4.509   1.00 27.92  ? 322 HOH L O   1 
HETATM 7020 O  O   . HOH NA 7 .   ? 0.220   19.981 -0.471  1.00 16.62  ? 323 HOH L O   1 
HETATM 7021 O  O   . HOH NA 7 .   ? 14.295  9.115  -12.660 1.00 26.15  ? 324 HOH L O   1 
HETATM 7022 O  O   . HOH NA 7 .   ? 4.599   23.430 -18.524 1.00 22.39  ? 325 HOH L O   1 
HETATM 7023 O  O   . HOH NA 7 .   ? -7.301  -0.761 -8.633  1.00 24.21  ? 326 HOH L O   1 
HETATM 7024 O  O   . HOH NA 7 .   ? 2.650   27.728 -17.728 1.00 30.59  ? 327 HOH L O   1 
HETATM 7025 O  O   . HOH NA 7 .   ? 3.752   25.317 -16.791 1.00 27.56  ? 328 HOH L O   1 
HETATM 7026 O  O   . HOH NA 7 .   ? 14.916  7.165  -5.003  1.00 34.30  ? 329 HOH L O   1 
HETATM 7027 O  O   . HOH NA 7 .   ? -0.476  16.032 -26.550 1.00 29.87  ? 330 HOH L O   1 
HETATM 7028 O  O   . HOH NA 7 .   ? -15.371 7.854  -19.179 1.00 30.06  ? 331 HOH L O   1 
HETATM 7029 O  O   . HOH NA 7 .   ? 16.280  8.137  -0.596  1.00 32.15  ? 332 HOH L O   1 
HETATM 7030 O  O   . HOH NA 7 .   ? 0.078   27.362 -32.725 1.00 35.11  ? 333 HOH L O   1 
HETATM 7031 O  O   . HOH NA 7 .   ? -19.364 6.116  -12.901 1.00 43.65  ? 334 HOH L O   1 
HETATM 7032 O  O   . HOH NA 7 .   ? 14.066  10.735 -14.741 1.00 25.82  ? 335 HOH L O   1 
HETATM 7033 O  O   . HOH NA 7 .   ? 11.752  17.826 -16.385 1.00 29.99  ? 336 HOH L O   1 
HETATM 7034 O  O   . HOH NA 7 .   ? 4.933   25.169 -20.839 1.00 30.98  ? 337 HOH L O   1 
HETATM 7035 O  O   . HOH NA 7 .   ? -10.659 4.844  -6.508  1.00 31.18  ? 338 HOH L O   1 
HETATM 7036 O  O   . HOH NA 7 .   ? 12.379  24.379 0.687   1.00 30.58  ? 339 HOH L O   1 
HETATM 7037 O  O   . HOH NA 7 .   ? 9.640   21.993 -11.258 1.00 42.05  ? 340 HOH L O   1 
HETATM 7038 O  O   . HOH NA 7 .   ? 9.752   1.046  8.650   1.00 39.61  ? 341 HOH L O   1 
HETATM 7039 O  O   . HOH NA 7 .   ? -6.838  6.272  -19.081 1.00 28.72  ? 342 HOH L O   1 
HETATM 7040 O  O   . HOH NA 7 .   ? -0.761  28.585 -20.743 1.00 38.94  ? 343 HOH L O   1 
HETATM 7041 O  O   . HOH NA 7 .   ? 12.257  17.649 2.099   1.00 36.67  ? 344 HOH L O   1 
HETATM 7042 O  O   . HOH NA 7 .   ? 16.520  9.503  -11.275 1.00 30.08  ? 345 HOH L O   1 
HETATM 7043 O  O   . HOH NA 7 .   ? -3.768  33.415 -32.675 1.00 29.61  ? 346 HOH L O   1 
HETATM 7044 O  O   . HOH NA 7 .   ? 10.904  -1.808 -3.078  1.00 39.00  ? 347 HOH L O   1 
HETATM 7045 O  O   . HOH NA 7 .   ? 17.931  9.313  -2.421  1.00 35.51  ? 348 HOH L O   1 
HETATM 7046 O  O   . HOH NA 7 .   ? 15.647  12.110 -5.409  1.00 28.84  ? 349 HOH L O   1 
HETATM 7047 O  O   . HOH NA 7 .   ? 5.363   20.509 -26.403 1.00 34.12  ? 350 HOH L O   1 
HETATM 7048 O  O   . HOH NA 7 .   ? -8.201  19.655 -30.149 1.00 38.36  ? 351 HOH L O   1 
HETATM 7049 O  O   . HOH NA 7 .   ? -5.741  26.078 -19.693 1.00 23.61  ? 352 HOH L O   1 
HETATM 7050 O  O   . HOH NA 7 .   ? -3.019  27.119 -21.657 1.00 40.75  ? 353 HOH L O   1 
HETATM 7051 O  O   . HOH NA 7 .   ? 1.019   14.513 6.875   1.00 26.11  ? 354 HOH L O   1 
HETATM 7052 O  O   . HOH NA 7 .   ? -3.610  24.637 -18.370 1.00 26.71  ? 355 HOH L O   1 
HETATM 7053 O  O   . HOH NA 7 .   ? -9.462  15.144 3.782   1.00 29.92  ? 356 HOH L O   1 
HETATM 7054 O  O   . HOH NA 7 .   ? -2.853  3.844  3.135   1.00 36.15  ? 357 HOH L O   1 
HETATM 7055 O  O   . HOH NA 7 .   ? 2.486   24.700 -1.822  1.00 25.43  ? 358 HOH L O   1 
HETATM 7056 O  O   . HOH NA 7 .   ? -0.880  24.259 -28.822 1.00 26.05  ? 359 HOH L O   1 
HETATM 7057 O  O   . HOH NA 7 .   ? -5.440  26.065 -28.939 1.00 31.57  ? 360 HOH L O   1 
HETATM 7058 O  O   . HOH NA 7 .   ? 21.250  14.943 -7.061  1.00 33.89  ? 361 HOH L O   1 
HETATM 7059 O  O   . HOH NA 7 .   ? -5.379  10.806 4.290   1.00 33.31  ? 362 HOH L O   1 
HETATM 7060 O  O   . HOH NA 7 .   ? 8.790   19.353 -14.845 1.00 34.05  ? 363 HOH L O   1 
HETATM 7061 O  O   . HOH NA 7 .   ? 0.133   31.244 -26.474 1.00 31.20  ? 364 HOH L O   1 
HETATM 7062 O  O   . HOH NA 7 .   ? -1.056  29.964 -17.138 1.00 30.26  ? 365 HOH L O   1 
HETATM 7063 O  O   . HOH NA 7 .   ? 16.444  9.493  -4.918  1.00 36.09  ? 366 HOH L O   1 
HETATM 7064 O  O   . HOH NA 7 .   ? 4.708   30.538 -31.173 1.00 35.67  ? 367 HOH L O   1 
HETATM 7065 O  O   . HOH NA 7 .   ? 17.527  12.934 -7.313  1.00 39.34  ? 368 HOH L O   1 
HETATM 7066 O  O   . HOH NA 7 .   ? 7.211   22.620 -5.049  1.00 32.78  ? 369 HOH L O   1 
HETATM 7067 O  O   . HOH NA 7 .   ? 7.925   12.099 9.898   1.00 37.50  ? 370 HOH L O   1 
HETATM 7068 O  O   . HOH NA 7 .   ? 9.001   18.122 -20.216 1.00 33.49  ? 371 HOH L O   1 
HETATM 7069 O  O   . HOH NA 7 .   ? 0.916   13.955 -25.142 1.00 40.37  ? 372 HOH L O   1 
HETATM 7070 O  O   . HOH NA 7 .   ? 10.258  16.824 -18.489 1.00 36.51  ? 373 HOH L O   1 
HETATM 7071 O  O   . HOH NA 7 .   ? 13.982  21.030 1.752   1.00 42.95  ? 374 HOH L O   1 
HETATM 7072 O  O   . HOH NA 7 .   ? 15.842  10.392 1.515   1.00 41.55  ? 375 HOH L O   1 
HETATM 7073 O  O   . HOH NA 7 .   ? 16.049  10.587 -9.143  1.00 38.01  ? 376 HOH L O   1 
HETATM 7074 O  O   . HOH OA 7 .   ? -28.811 24.791 -22.494 1.00 16.31  ? 201 HOH S O   1 
HETATM 7075 O  O   . HOH OA 7 .   ? -18.907 26.541 -30.936 1.00 21.05  ? 202 HOH S O   1 
HETATM 7076 O  O   . HOH OA 7 .   ? -33.433 44.727 -41.335 1.00 20.56  ? 203 HOH S O   1 
HETATM 7077 O  O   . HOH OA 7 .   ? -25.218 30.324 -28.962 1.00 13.60  ? 204 HOH S O   1 
HETATM 7078 O  O   . HOH OA 7 .   ? -23.766 33.570 -23.733 1.00 23.14  ? 205 HOH S O   1 
HETATM 7079 O  O   . HOH OA 7 .   ? -21.481 31.817 -23.653 1.00 20.55  ? 206 HOH S O   1 
HETATM 7080 O  O   . HOH OA 7 .   ? -21.988 31.271 -21.126 1.00 27.78  ? 207 HOH S O   1 
HETATM 7081 O  O   . HOH OA 7 .   ? -42.815 43.181 -25.100 1.00 20.79  ? 208 HOH S O   1 
HETATM 7082 O  O   . HOH OA 7 .   ? -25.855 33.745 -19.127 1.00 28.29  ? 209 HOH S O   1 
HETATM 7083 O  O   . HOH OA 7 .   ? -49.534 54.476 -24.212 1.00 30.31  ? 210 HOH S O   1 
HETATM 7084 O  O   . HOH OA 7 .   ? -18.045 29.860 -30.179 1.00 19.04  ? 211 HOH S O   1 
HETATM 7085 O  O   . HOH OA 7 .   ? -43.674 47.501 -23.913 1.00 27.28  ? 212 HOH S O   1 
HETATM 7086 O  O   . HOH OA 7 .   ? -23.147 36.418 -32.181 1.00 35.74  ? 213 HOH S O   1 
HETATM 7087 O  O   . HOH OA 7 .   ? -40.602 17.871 -25.369 1.00 25.13  ? 214 HOH S O   1 
HETATM 7088 O  O   . HOH OA 7 .   ? -28.479 21.467 -26.562 1.00 22.47  ? 215 HOH S O   1 
HETATM 7089 O  O   . HOH OA 7 .   ? -52.287 42.719 -27.806 1.00 23.28  ? 216 HOH S O   1 
HETATM 7090 O  O   . HOH OA 7 .   ? -33.849 22.546 -33.737 1.00 22.95  ? 217 HOH S O   1 
HETATM 7091 O  O   . HOH OA 7 .   ? -47.915 38.030 -24.058 1.00 29.24  ? 218 HOH S O   1 
HETATM 7092 O  O   . HOH OA 7 .   ? -38.970 22.469 -22.129 1.00 22.59  ? 219 HOH S O   1 
HETATM 7093 O  O   . HOH OA 7 .   ? -45.503 48.874 -25.666 1.00 28.84  ? 220 HOH S O   1 
HETATM 7094 O  O   . HOH OA 7 .   ? -37.535 48.897 -39.453 1.00 21.73  ? 221 HOH S O   1 
HETATM 7095 O  O   . HOH OA 7 .   ? -41.572 51.784 -45.349 1.00 25.22  ? 222 HOH S O   1 
HETATM 7096 O  O   . HOH OA 7 .   ? -48.929 29.941 -24.246 1.00 28.46  ? 223 HOH S O   1 
HETATM 7097 O  O   . HOH OA 7 .   ? -33.450 43.745 -44.070 1.00 25.14  ? 224 HOH S O   1 
HETATM 7098 O  O   . HOH OA 7 .   ? -37.748 47.501 -18.731 1.00 37.31  ? 225 HOH S O   1 
HETATM 7099 O  O   . HOH OA 7 .   ? -32.630 47.027 -41.096 1.00 39.20  ? 226 HOH S O   1 
HETATM 7100 O  O   . HOH OA 7 .   ? -23.625 33.648 -20.841 1.00 31.09  ? 227 HOH S O   1 
HETATM 7101 O  O   . HOH OA 7 .   ? -32.660 45.522 -45.952 1.00 28.85  ? 228 HOH S O   1 
HETATM 7102 O  O   . HOH OA 7 .   ? -27.033 39.295 -35.662 1.00 28.86  ? 229 HOH S O   1 
HETATM 7103 O  O   . HOH OA 7 .   ? -50.080 39.801 -23.143 1.00 31.04  ? 230 HOH S O   1 
HETATM 7104 O  O   . HOH OA 7 .   ? -33.538 46.841 -48.167 1.00 29.70  ? 231 HOH S O   1 
HETATM 7105 O  O   . HOH OA 7 .   ? -31.447 41.725 -43.832 1.00 34.10  ? 232 HOH S O   1 
HETATM 7106 O  O   . HOH OA 7 .   ? -27.943 24.087 -17.949 1.00 25.64  ? 233 HOH S O   1 
HETATM 7107 O  O   . HOH OA 7 .   ? -26.945 26.501 -18.805 1.00 20.24  ? 234 HOH S O   1 
HETATM 7108 O  O   . HOH OA 7 .   ? -34.367 23.049 -30.492 1.00 19.06  ? 235 HOH S O   1 
HETATM 7109 O  O   . HOH OA 7 .   ? -25.711 28.703 -30.675 1.00 7.71   ? 236 HOH S O   1 
HETATM 7110 O  O   . HOH OA 7 .   ? -26.739 26.577 -21.382 1.00 28.20  ? 237 HOH S O   1 
HETATM 7111 O  O   . HOH OA 7 .   ? -25.375 24.303 -36.332 1.00 22.75  ? 238 HOH S O   1 
HETATM 7112 O  O   . HOH OA 7 .   ? -36.459 31.296 -13.673 1.00 31.69  ? 239 HOH S O   1 
HETATM 7113 O  O   . HOH OA 7 .   ? -44.157 28.090 -24.948 1.00 25.80  ? 240 HOH S O   1 
HETATM 7114 O  O   . HOH OA 7 .   ? -35.799 25.548 -16.986 1.00 36.65  ? 241 HOH S O   1 
HETATM 7115 O  O   . HOH OA 7 .   ? -35.703 23.317 -18.559 1.00 36.04  ? 242 HOH S O   1 
HETATM 7116 O  O   . HOH OA 7 .   ? -21.927 35.603 -24.753 1.00 32.48  ? 243 HOH S O   1 
HETATM 7117 O  O   . HOH OA 7 .   ? -39.897 48.976 -51.098 1.00 32.70  ? 244 HOH S O   1 
HETATM 7118 O  O   . HOH OA 7 .   ? -44.058 30.701 -23.537 1.00 31.06  ? 245 HOH S O   1 
HETATM 7119 O  O   . HOH OA 7 .   ? -32.818 15.934 -25.099 1.00 32.32  ? 246 HOH S O   1 
HETATM 7120 O  O   . HOH OA 7 .   ? -31.791 24.511 -31.378 1.00 29.29  ? 247 HOH S O   1 
HETATM 7121 O  O   . HOH OA 7 .   ? -34.890 45.117 -19.420 1.00 42.96  ? 248 HOH S O   1 
HETATM 7122 O  O   . HOH OA 7 .   ? -31.624 43.049 -40.367 1.00 35.80  ? 249 HOH S O   1 
HETATM 7123 O  O   . HOH OA 7 .   ? -29.069 37.325 -39.412 1.00 34.83  ? 250 HOH S O   1 
HETATM 7124 O  O   . HOH OA 7 .   ? -41.304 44.846 -26.624 1.00 31.03  ? 251 HOH S O   1 
HETATM 7125 O  O   . HOH OA 7 .   ? -31.540 39.730 -41.332 1.00 34.51  ? 252 HOH S O   1 
HETATM 7126 O  O   . HOH OA 7 .   ? -23.223 29.157 -33.251 1.00 27.72  ? 253 HOH S O   1 
HETATM 7127 O  O   . HOH OA 7 .   ? -49.262 41.141 -21.016 1.00 38.61  ? 254 HOH S O   1 
HETATM 7128 O  O   . HOH OA 7 .   ? -34.252 26.974 -36.203 1.00 17.11  ? 255 HOH S O   1 
HETATM 7129 O  O   . HOH PA 7 .   ? -56.302 44.497 -31.536 1.00 23.11  ? 301 HOH T O   1 
HETATM 7130 O  O   . HOH PA 7 .   ? -53.891 30.013 -39.424 1.00 26.58  ? 302 HOH T O   1 
HETATM 7131 O  O   . HOH PA 7 .   ? -48.595 52.664 -32.264 1.00 17.50  ? 303 HOH T O   1 
HETATM 7132 O  O   . HOH PA 7 .   ? -43.232 49.751 -43.503 1.00 17.64  ? 304 HOH T O   1 
HETATM 7133 O  O   . HOH PA 7 .   ? -39.239 31.031 -47.609 1.00 22.93  ? 305 HOH T O   1 
HETATM 7134 O  O   . HOH PA 7 .   ? -37.768 48.481 -36.373 1.00 16.42  ? 306 HOH T O   1 
HETATM 7135 O  O   . HOH PA 7 .   ? -54.118 34.619 -36.502 1.00 20.18  ? 307 HOH T O   1 
HETATM 7136 O  O   . HOH PA 7 .   ? -30.629 45.514 -28.573 1.00 25.06  ? 308 HOH T O   1 
HETATM 7137 O  O   . HOH PA 7 .   ? -38.979 26.630 -45.863 1.00 35.61  ? 309 HOH T O   1 
HETATM 7138 O  O   . HOH PA 7 .   ? -35.195 39.890 -47.063 1.00 20.47  ? 310 HOH T O   1 
HETATM 7139 O  O   . HOH PA 7 .   ? -63.598 43.313 -43.166 1.00 23.15  ? 311 HOH T O   1 
HETATM 7140 O  O   . HOH PA 7 .   ? -44.149 50.991 -40.951 1.00 25.22  ? 312 HOH T O   1 
HETATM 7141 O  O   . HOH PA 7 .   ? -41.878 47.195 -28.204 1.00 21.70  ? 313 HOH T O   1 
HETATM 7142 O  O   . HOH PA 7 .   ? -39.310 51.361 -33.465 1.00 23.26  ? 314 HOH T O   1 
HETATM 7143 O  O   . HOH PA 7 .   ? -62.109 33.239 -40.744 1.00 28.38  ? 315 HOH T O   1 
HETATM 7144 O  O   . HOH PA 7 .   ? -29.823 38.019 -45.617 1.00 25.07  ? 316 HOH T O   1 
HETATM 7145 O  O   . HOH PA 7 .   ? -62.017 48.000 -38.669 1.00 24.48  ? 317 HOH T O   1 
HETATM 7146 O  O   . HOH PA 7 .   ? -24.845 35.802 -42.871 1.00 31.15  ? 318 HOH T O   1 
HETATM 7147 O  O   . HOH PA 7 .   ? -45.933 52.466 -42.669 1.00 31.89  ? 319 HOH T O   1 
HETATM 7148 O  O   . HOH PA 7 .   ? -55.898 43.533 -29.112 1.00 31.67  ? 320 HOH T O   1 
HETATM 7149 O  O   . HOH PA 7 .   ? -57.998 38.332 -31.028 1.00 27.43  ? 321 HOH T O   1 
HETATM 7150 O  O   . HOH PA 7 .   ? -53.053 43.675 -50.557 1.00 23.29  ? 322 HOH T O   1 
HETATM 7151 O  O   . HOH PA 7 .   ? -57.494 48.505 -49.319 1.00 25.04  ? 323 HOH T O   1 
HETATM 7152 O  O   . HOH PA 7 .   ? -19.852 22.906 -47.858 1.00 31.60  ? 324 HOH T O   1 
HETATM 7153 O  O   . HOH PA 7 .   ? -32.120 34.100 -51.385 1.00 25.83  ? 325 HOH T O   1 
HETATM 7154 O  O   . HOH PA 7 .   ? -36.390 29.534 -40.077 1.00 25.62  ? 326 HOH T O   1 
HETATM 7155 O  O   . HOH PA 7 .   ? -63.151 46.498 -45.611 1.00 25.55  ? 327 HOH T O   1 
HETATM 7156 O  O   . HOH PA 7 .   ? -34.453 26.851 -46.142 1.00 30.78  ? 328 HOH T O   1 
HETATM 7157 O  O   . HOH PA 7 .   ? -43.903 36.853 -52.982 1.00 25.89  ? 329 HOH T O   1 
HETATM 7158 O  O   . HOH PA 7 .   ? -55.194 47.859 -51.084 1.00 27.19  ? 330 HOH T O   1 
HETATM 7159 O  O   . HOH PA 7 .   ? -41.512 37.880 -52.499 1.00 33.39  ? 331 HOH T O   1 
HETATM 7160 O  O   . HOH PA 7 .   ? -35.937 50.339 -35.393 1.00 28.00  ? 332 HOH T O   1 
HETATM 7161 O  O   . HOH PA 7 .   ? -44.150 35.370 -49.660 1.00 30.18  ? 333 HOH T O   1 
HETATM 7162 O  O   . HOH PA 7 .   ? -59.069 44.006 -30.580 1.00 49.34  ? 334 HOH T O   1 
HETATM 7163 O  O   . HOH PA 7 .   ? -19.745 30.641 -40.377 1.00 30.89  ? 335 HOH T O   1 
HETATM 7164 O  O   . HOH PA 7 .   ? -20.052 23.678 -41.097 1.00 33.21  ? 336 HOH T O   1 
HETATM 7165 O  O   . HOH PA 7 .   ? -56.164 51.032 -50.278 1.00 35.41  ? 337 HOH T O   1 
HETATM 7166 O  O   . HOH PA 7 .   ? -52.513 32.305 -44.975 1.00 35.57  ? 338 HOH T O   1 
HETATM 7167 O  O   . HOH PA 7 .   ? -48.476 33.536 -48.263 1.00 44.19  ? 339 HOH T O   1 
HETATM 7168 O  O   . HOH PA 7 .   ? -50.501 31.765 -46.656 1.00 49.13  ? 340 HOH T O   1 
HETATM 7169 O  O   . HOH PA 7 .   ? -43.816 49.111 -28.065 1.00 27.04  ? 341 HOH T O   1 
HETATM 7170 O  O   . HOH PA 7 .   ? -55.202 43.191 -52.192 1.00 25.01  ? 342 HOH T O   1 
HETATM 7171 O  O   . HOH PA 7 .   ? -60.992 40.120 -33.937 1.00 26.09  ? 343 HOH T O   1 
HETATM 7172 O  O   . HOH PA 7 .   ? -59.719 31.013 -48.210 1.00 27.57  ? 344 HOH T O   1 
HETATM 7173 O  O   . HOH PA 7 .   ? -46.924 42.793 -56.404 1.00 25.61  ? 345 HOH T O   1 
HETATM 7174 O  O   . HOH PA 7 .   ? -47.927 45.867 -53.572 1.00 27.53  ? 346 HOH T O   1 
HETATM 7175 O  O   . HOH PA 7 .   ? -38.404 54.063 -30.640 1.00 28.32  ? 347 HOH T O   1 
HETATM 7176 O  O   . HOH PA 7 .   ? -62.103 45.002 -49.301 1.00 35.90  ? 348 HOH T O   1 
HETATM 7177 O  O   . HOH PA 7 .   ? -46.004 44.264 -54.281 1.00 26.94  ? 349 HOH T O   1 
HETATM 7178 O  O   . HOH PA 7 .   ? -39.113 36.336 -51.956 1.00 30.20  ? 350 HOH T O   1 
HETATM 7179 O  O   . HOH PA 7 .   ? -27.468 30.154 -46.769 1.00 24.05  ? 351 HOH T O   1 
HETATM 7180 O  O   . HOH PA 7 .   ? -31.076 40.167 -46.253 1.00 36.21  ? 352 HOH T O   1 
HETATM 7181 O  O   . HOH PA 7 .   ? -63.416 44.835 -33.929 1.00 29.63  ? 353 HOH T O   1 
HETATM 7182 O  O   . HOH PA 7 .   ? -24.125 34.875 -40.157 1.00 30.35  ? 354 HOH T O   1 
HETATM 7183 O  O   . HOH PA 7 .   ? -23.543 24.708 -42.590 1.00 30.43  ? 355 HOH T O   1 
HETATM 7184 O  O   . HOH PA 7 .   ? -32.710 31.520 -51.308 1.00 28.71  ? 356 HOH T O   1 
HETATM 7185 O  O   . HOH PA 7 .   ? -37.363 29.284 -48.807 1.00 29.60  ? 357 HOH T O   1 
HETATM 7186 O  O   . HOH PA 7 .   ? -54.345 42.632 -54.708 1.00 30.80  ? 358 HOH T O   1 
HETATM 7187 O  O   . HOH PA 7 .   ? -22.617 30.071 -47.812 1.00 27.97  ? 359 HOH T O   1 
HETATM 7188 O  O   . HOH PA 7 .   ? -52.136 44.774 -53.747 1.00 29.66  ? 360 HOH T O   1 
HETATM 7189 O  O   . HOH PA 7 .   ? -33.997 47.546 -36.729 1.00 28.44  ? 361 HOH T O   1 
HETATM 7190 O  O   . HOH PA 7 .   ? -65.518 54.149 -40.047 1.00 29.09  ? 362 HOH T O   1 
HETATM 7191 O  O   . HOH PA 7 .   ? -51.430 53.800 -53.344 1.00 44.57  ? 363 HOH T O   1 
HETATM 7192 O  O   . HOH PA 7 .   ? -61.175 37.575 -46.506 1.00 29.75  ? 364 HOH T O   1 
HETATM 7193 O  O   . HOH PA 7 .   ? -49.612 49.969 -54.564 1.00 30.57  ? 365 HOH T O   1 
HETATM 7194 O  O   . HOH PA 7 .   ? -29.021 38.161 -42.799 1.00 33.69  ? 366 HOH T O   1 
HETATM 7195 O  O   . HOH PA 7 .   ? -25.577 28.312 -43.015 1.00 30.56  ? 367 HOH T O   1 
HETATM 7196 O  O   . HOH PA 7 .   ? -51.791 29.622 -41.307 1.00 36.86  ? 368 HOH T O   1 
HETATM 7197 O  O   . HOH PA 7 .   ? -53.038 54.322 -51.447 1.00 34.88  ? 369 HOH T O   1 
HETATM 7198 O  O   . HOH PA 7 .   ? -55.724 50.874 -31.636 1.00 35.69  ? 370 HOH T O   1 
HETATM 7199 O  O   . HOH PA 7 .   ? -49.346 43.829 -57.170 1.00 29.56  ? 371 HOH T O   1 
HETATM 7200 O  O   . HOH PA 7 .   ? -50.083 45.635 -55.325 1.00 30.37  ? 372 HOH T O   1 
HETATM 7201 O  O   . HOH PA 7 .   ? -24.710 27.460 -49.923 1.00 32.24  ? 373 HOH T O   1 
HETATM 7202 O  O   . HOH PA 7 .   ? -59.679 47.366 -50.585 1.00 30.18  ? 374 HOH T O   1 
HETATM 7203 O  O   . HOH PA 7 .   ? -34.854 25.736 -44.061 1.00 36.05  ? 375 HOH T O   1 
HETATM 7204 O  O   . HOH PA 7 .   ? -53.617 29.127 -45.388 1.00 33.30  ? 376 HOH T O   1 
HETATM 7205 O  O   . HOH PA 7 .   ? -22.837 28.668 -45.549 1.00 34.78  ? 377 HOH T O   1 
HETATM 7206 O  O   . HOH QA 7 .   ? -51.429 10.445 -45.759 1.00 24.02  ? 201 HOH U O   1 
HETATM 7207 O  O   . HOH QA 7 .   ? -61.824 29.052 -27.599 1.00 27.31  ? 202 HOH U O   1 
HETATM 7208 O  O   . HOH QA 7 .   ? -52.575 27.631 -39.122 1.00 22.35  ? 203 HOH U O   1 
HETATM 7209 O  O   . HOH QA 7 .   ? -53.681 32.020 -36.615 1.00 26.17  ? 204 HOH U O   1 
HETATM 7210 O  O   . HOH QA 7 .   ? -52.609 31.212 -23.957 1.00 23.49  ? 205 HOH U O   1 
HETATM 7211 O  O   . HOH QA 7 .   ? -47.677 10.699 -27.008 1.00 27.91  ? 206 HOH U O   1 
HETATM 7212 O  O   . HOH QA 7 .   ? -38.025 11.163 -26.551 1.00 27.44  ? 207 HOH U O   1 
HETATM 7213 O  O   . HOH QA 7 .   ? -50.057 36.100 -26.142 1.00 22.42  ? 208 HOH U O   1 
HETATM 7214 O  O   . HOH QA 7 .   ? -47.037 23.050 -24.469 1.00 34.31  ? 209 HOH U O   1 
HETATM 7215 O  O   . HOH QA 7 .   ? -48.155 6.267  -42.571 1.00 28.44  ? 210 HOH U O   1 
HETATM 7216 O  O   . HOH QA 7 .   ? -54.147 38.769 -25.707 1.00 27.62  ? 211 HOH U O   1 
HETATM 7217 O  O   . HOH QA 7 .   ? -60.975 32.815 -31.487 1.00 30.03  ? 212 HOH U O   1 
HETATM 7218 O  O   . HOH QA 7 .   ? -59.441 36.241 -31.897 1.00 24.92  ? 213 HOH U O   1 
HETATM 7219 O  O   . HOH QA 7 .   ? -47.194 6.028  -26.126 1.00 45.06  ? 214 HOH U O   1 
HETATM 7220 O  O   . HOH QA 7 .   ? -63.047 32.544 -29.731 1.00 40.85  ? 215 HOH U O   1 
HETATM 7221 O  O   . HOH QA 7 .   ? -54.283 31.195 -33.388 1.00 21.52  ? 216 HOH U O   1 
HETATM 7222 O  O   . HOH QA 7 .   ? -62.417 25.882 -36.667 1.00 16.53  ? 217 HOH U O   1 
HETATM 7223 O  O   . HOH QA 7 .   ? -63.466 23.992 -35.222 1.00 24.50  ? 218 HOH U O   1 
HETATM 7224 O  O   . HOH QA 7 .   ? -42.322 23.868 -23.574 1.00 31.29  ? 219 HOH U O   1 
HETATM 7225 O  O   . HOH QA 7 .   ? -56.689 32.155 -25.249 1.00 34.63  ? 220 HOH U O   1 
HETATM 7226 O  O   . HOH QA 7 .   ? -50.656 11.580 -47.977 1.00 29.60  ? 221 HOH U O   1 
HETATM 7227 O  O   . HOH QA 7 .   ? -65.521 24.098 -41.702 1.00 33.60  ? 222 HOH U O   1 
HETATM 7228 O  O   . HOH QA 7 .   ? -56.016 17.569 -44.599 1.00 41.65  ? 223 HOH U O   1 
HETATM 7229 O  O   . HOH QA 7 .   ? -55.680 30.468 -37.937 1.00 35.06  ? 224 HOH U O   1 
HETATM 7230 O  O   . HOH QA 7 .   ? -46.702 25.764 -25.665 1.00 31.14  ? 225 HOH U O   1 
HETATM 7231 O  O   . HOH QA 7 .   ? -43.044 15.783 -24.109 1.00 38.26  ? 226 HOH U O   1 
HETATM 7232 O  O   . HOH QA 7 .   ? -65.447 19.483 -26.016 1.00 37.81  ? 227 HOH U O   1 
HETATM 7233 O  O   . HOH QA 7 .   ? -66.153 20.449 -31.070 1.00 42.76  ? 228 HOH U O   1 
HETATM 7234 O  O   . HOH QA 7 .   ? -61.566 30.214 -24.761 1.00 56.72  ? 229 HOH U O   1 
HETATM 7235 O  O   . HOH QA 7 .   ? -56.330 29.980 -35.148 1.00 29.62  ? 230 HOH U O   1 
HETATM 7236 O  O   . HOH QA 7 .   ? -52.608 7.226  -41.294 1.00 32.39  ? 231 HOH U O   1 
HETATM 7237 O  O   . HOH RA 7 .   ? -19.034 19.340 -30.667 1.00 19.89  ? 301 HOH V O   1 
HETATM 7238 O  O   . HOH RA 7 .   ? -33.013 24.673 -36.356 1.00 23.49  ? 302 HOH V O   1 
HETATM 7239 O  O   . HOH RA 7 .   ? -49.042 6.126  -39.877 1.00 26.01  ? 303 HOH V O   1 
HETATM 7240 O  O   . HOH RA 7 .   ? -48.821 28.444 -48.537 1.00 27.39  ? 304 HOH V O   1 
HETATM 7241 O  O   . HOH RA 7 .   ? -55.353 -0.019 -32.452 1.00 27.40  ? 305 HOH V O   1 
HETATM 7242 O  O   . HOH RA 7 .   ? -31.521 24.088 -34.467 1.00 27.28  ? 306 HOH V O   1 
HETATM 7243 O  O   . HOH RA 7 .   ? -31.322 15.744 -27.398 1.00 26.99  ? 307 HOH V O   1 
HETATM 7244 O  O   . HOH RA 7 .   ? -29.948 17.939 -27.835 1.00 19.56  ? 308 HOH V O   1 
HETATM 7245 O  O   . HOH RA 7 .   ? -45.118 5.036  -27.847 1.00 48.89  ? 309 HOH V O   1 
HETATM 7246 O  O   . HOH RA 7 .   ? -51.620 26.972 -41.682 1.00 25.82  ? 310 HOH V O   1 
HETATM 7247 O  O   . HOH RA 7 .   ? -49.253 29.325 -45.873 1.00 39.19  ? 311 HOH V O   1 
HETATM 7248 O  O   . HOH RA 7 .   ? -33.015 9.623  -29.011 1.00 20.52  ? 312 HOH V O   1 
HETATM 7249 O  O   . HOH RA 7 .   ? -23.512 17.915 -25.821 1.00 32.52  ? 313 HOH V O   1 
HETATM 7250 O  O   . HOH RA 7 .   ? -53.774 17.481 -50.384 1.00 41.09  ? 314 HOH V O   1 
HETATM 7251 O  O   . HOH RA 7 .   ? -61.579 21.133 -46.701 1.00 30.53  ? 315 HOH V O   1 
HETATM 7252 O  O   . HOH RA 7 .   ? -25.291 6.489  -34.074 1.00 26.32  ? 316 HOH V O   1 
HETATM 7253 O  O   . HOH RA 7 .   ? -46.669 2.853  -40.391 1.00 33.20  ? 317 HOH V O   1 
HETATM 7254 O  O   . HOH RA 7 .   ? -33.531 19.846 -33.784 1.00 17.50  ? 318 HOH V O   1 
HETATM 7255 O  O   . HOH RA 7 .   ? -44.007 24.231 -48.837 1.00 25.53  ? 319 HOH V O   1 
HETATM 7256 O  O   . HOH RA 7 .   ? -22.377 11.371 -37.288 1.00 26.31  ? 320 HOH V O   1 
HETATM 7257 O  O   . HOH RA 7 .   ? -32.895 -1.862 -38.833 1.00 22.51  ? 321 HOH V O   1 
HETATM 7258 O  O   . HOH RA 7 .   ? -35.101 -1.123 -35.342 1.00 27.53  ? 322 HOH V O   1 
HETATM 7259 O  O   . HOH RA 7 .   ? -58.341 5.850  -35.180 1.00 47.28  ? 323 HOH V O   1 
HETATM 7260 O  O   . HOH RA 7 .   ? -29.888 11.621 -47.853 1.00 27.45  ? 324 HOH V O   1 
HETATM 7261 O  O   . HOH RA 7 .   ? -64.296 21.758 -45.396 1.00 38.07  ? 325 HOH V O   1 
HETATM 7262 O  O   . HOH RA 7 .   ? -65.297 19.557 -43.629 1.00 39.13  ? 326 HOH V O   1 
HETATM 7263 O  O   . HOH RA 7 .   ? -27.928 14.073 -29.406 1.00 23.11  ? 327 HOH V O   1 
HETATM 7264 O  O   . HOH RA 7 .   ? -48.059 15.496 -49.999 1.00 30.71  ? 328 HOH V O   1 
HETATM 7265 O  O   . HOH RA 7 .   ? -48.959 25.199 -42.457 1.00 33.97  ? 329 HOH V O   1 
HETATM 7266 O  O   . HOH RA 7 .   ? -48.115 3.131  -36.738 1.00 28.11  ? 330 HOH V O   1 
HETATM 7267 O  O   . HOH RA 7 .   ? -30.415 25.892 -41.428 1.00 31.81  ? 331 HOH V O   1 
HETATM 7268 O  O   . HOH RA 7 .   ? -34.854 4.194  -31.626 1.00 33.65  ? 332 HOH V O   1 
HETATM 7269 O  O   . HOH RA 7 .   ? -20.003 15.631 -27.630 1.00 26.43  ? 333 HOH V O   1 
HETATM 7270 O  O   . HOH RA 7 .   ? -41.431 5.315  -44.840 1.00 26.97  ? 334 HOH V O   1 
HETATM 7271 O  O   . HOH RA 7 .   ? -55.404 25.542 -51.355 1.00 28.99  ? 335 HOH V O   1 
HETATM 7272 O  O   . HOH RA 7 .   ? -58.235 27.537 -47.846 1.00 26.46  ? 336 HOH V O   1 
HETATM 7273 O  O   . HOH RA 7 .   ? -24.549 21.387 -34.761 1.00 29.84  ? 337 HOH V O   1 
HETATM 7274 O  O   . HOH RA 7 .   ? -21.974 8.351  -39.923 1.00 30.02  ? 338 HOH V O   1 
HETATM 7275 O  O   . HOH RA 7 .   ? -58.282 8.727  -34.613 1.00 32.33  ? 339 HOH V O   1 
HETATM 7276 O  O   . HOH RA 7 .   ? -26.068 6.810  -45.723 1.00 31.03  ? 340 HOH V O   1 
HETATM 7277 O  O   . HOH RA 7 .   ? -50.109 32.009 -51.611 1.00 36.24  ? 341 HOH V O   1 
HETATM 7278 O  O   . HOH RA 7 .   ? -22.305 17.286 -27.196 1.00 36.44  ? 342 HOH V O   1 
HETATM 7279 O  O   . HOH RA 7 .   ? -33.697 13.311 -55.190 1.00 30.69  ? 343 HOH V O   1 
HETATM 7280 O  O   . HOH RA 7 .   ? -35.186 11.709 -53.675 1.00 33.79  ? 344 HOH V O   1 
HETATM 7281 O  O   . HOH RA 7 .   ? -21.405 9.907  -43.377 1.00 42.67  ? 345 HOH V O   1 
HETATM 7282 O  O   . HOH RA 7 .   ? -52.034 15.234 -50.640 1.00 41.47  ? 346 HOH V O   1 
HETATM 7283 O  O   . HOH RA 7 .   ? -38.696 20.051 -49.562 1.00 35.09  ? 347 HOH V O   1 
HETATM 7284 O  O   . HOH RA 7 .   ? -37.324 4.375  -30.975 1.00 43.65  ? 348 HOH V O   1 
HETATM 7285 O  O   . HOH RA 7 .   ? -43.224 25.920 -46.858 1.00 35.99  ? 349 HOH V O   1 
HETATM 7286 O  O   . HOH RA 7 .   ? -33.701 9.891  -52.635 1.00 32.46  ? 350 HOH V O   1 
HETATM 7287 O  O   . HOH RA 7 .   ? -56.700 26.121 -53.637 1.00 30.84  ? 351 HOH V O   1 
HETATM 7288 O  O   . HOH RA 7 .   ? -47.902 7.064  -30.426 1.00 30.52  ? 352 HOH V O   1 
HETATM 7289 O  O   . HOH RA 7 .   ? -24.670 15.044 -53.965 1.00 37.83  ? 353 HOH V O   1 
HETATM 7290 O  O   . HOH RA 7 .   ? -41.446 4.109  -42.499 1.00 32.94  ? 354 HOH V O   1 
HETATM 7291 O  O   . HOH RA 7 .   ? -29.231 14.062 -27.025 1.00 33.27  ? 355 HOH V O   1 
HETATM 7292 O  O   . HOH RA 7 .   ? -62.025 29.924 -52.820 1.00 45.77  ? 356 HOH V O   1 
HETATM 7293 O  O   . HOH RA 7 .   ? -58.061 28.319 -54.144 1.00 36.55  ? 357 HOH V O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . MET A  1   ? 0.3819 0.5105 0.4824 -0.1090 0.0283  -0.0544 1   MET A N   
2    C  CA  . MET A  1   ? 0.3707 0.4843 0.4605 -0.1015 0.0192  -0.0539 1   MET A CA  
3    C  C   . MET A  1   ? 0.3278 0.4281 0.4028 -0.0897 0.0192  -0.0477 1   MET A C   
4    O  O   . MET A  1   ? 0.3379 0.4277 0.4027 -0.0907 0.0260  -0.0422 1   MET A O   
5    C  CB  . MET A  1   ? 0.3946 0.4863 0.4733 -0.1108 0.0192  -0.0535 1   MET A CB  
6    C  CG  . MET A  1   ? 0.4231 0.4977 0.4892 -0.1027 0.0115  -0.0529 1   MET A CG  
7    S  SD  . MET A  1   ? 0.6909 0.7384 0.7427 -0.1124 0.0115  -0.0535 1   MET A SD  
8    C  CE  . MET A  1   ? 0.4958 0.5623 0.5642 -0.1219 0.0044  -0.0633 1   MET A CE  
9    N  N   . LEU A  2   ? 0.2814 0.3824 0.3548 -0.0790 0.0112  -0.0485 2   LEU A N   
10   C  CA  . LEU A  2   ? 0.2661 0.3548 0.3260 -0.0689 0.0102  -0.0428 2   LEU A CA  
11   C  C   . LEU A  2   ? 0.2518 0.3157 0.2953 -0.0702 0.0116  -0.0372 2   LEU A C   
12   O  O   . LEU A  2   ? 0.2520 0.3054 0.2926 -0.0764 0.0112  -0.0387 2   LEU A O   
13   C  CB  . LEU A  2   ? 0.2581 0.3529 0.3203 -0.0589 0.0017  -0.0454 2   LEU A CB  
14   C  CG  . LEU A  2   ? 0.2678 0.3780 0.3366 -0.0505 -0.0002 -0.0470 2   LEU A CG  
15   C  CD1 . LEU A  2   ? 0.2533 0.3776 0.3302 -0.0519 0.0064  -0.0478 2   LEU A CD1 
16   C  CD2 . LEU A  2   ? 0.2548 0.3726 0.3287 -0.0441 -0.0091 -0.0515 2   LEU A CD2 
17   N  N   . THR A  3   ? 0.2367 0.2906 0.2688 -0.0644 0.0132  -0.0307 3   THR A N   
18   C  CA  . THR A  3   ? 0.2416 0.2736 0.2591 -0.0631 0.0140  -0.0247 3   THR A CA  
19   C  C   . THR A  3   ? 0.2407 0.2665 0.2551 -0.0561 0.0075  -0.0256 3   THR A C   
20   O  O   . THR A  3   ? 0.2273 0.2643 0.2483 -0.0513 0.0022  -0.0295 3   THR A O   
21   C  CB  . THR A  3   ? 0.2399 0.2659 0.2474 -0.0586 0.0163  -0.0174 3   THR A CB  
22   O  OG1 . THR A  3   ? 0.2257 0.2586 0.2340 -0.0491 0.0108  -0.0168 3   THR A OG1 
23   C  CG2 . THR A  3   ? 0.2392 0.2732 0.2490 -0.0644 0.0228  -0.0173 3   THR A CG2 
24   N  N   . GLU A  4   ? 0.2542 0.2610 0.2573 -0.0548 0.0083  -0.0216 4   GLU A N   
25   C  CA  . GLU A  4   ? 0.2598 0.2595 0.2586 -0.0474 0.0036  -0.0219 4   GLU A CA  
26   C  C   . GLU A  4   ? 0.2333 0.2411 0.2328 -0.0376 -0.0001 -0.0190 4   GLU A C   
27   O  O   . GLU A  4   ? 0.2229 0.2344 0.2242 -0.0328 -0.0046 -0.0219 4   GLU A O   
28   C  CB  . GLU A  4   ? 0.3053 0.2827 0.2914 -0.0465 0.0065  -0.0174 4   GLU A CB  
29   C  CG  . GLU A  4   ? 0.3549 0.3199 0.3374 -0.0566 0.0097  -0.0209 4   GLU A CG  
30   C  CD  . GLU A  4   ? 0.4074 0.3789 0.3966 -0.0615 0.0055  -0.0297 4   GLU A CD  
31   O  OE1 . GLU A  4   ? 0.4896 0.4681 0.4860 -0.0724 0.0067  -0.0345 4   GLU A OE1 
32   O  OE2 . GLU A  4   ? 0.4508 0.4212 0.4381 -0.0550 0.0009  -0.0319 4   GLU A OE2 
33   N  N   . LEU A  5   ? 0.2188 0.2291 0.2162 -0.0358 0.0017  -0.0136 5   LEU A N   
34   C  CA  . LEU A  5   ? 0.1990 0.2169 0.1967 -0.0284 -0.0019 -0.0112 5   LEU A CA  
35   C  C   . LEU A  5   ? 0.1898 0.2226 0.1958 -0.0277 -0.0050 -0.0170 5   LEU A C   
36   O  O   . LEU A  5   ? 0.1844 0.2205 0.1908 -0.0219 -0.0095 -0.0182 5   LEU A O   
37   C  CB  . LEU A  5   ? 0.2012 0.2181 0.1936 -0.0278 -0.0001 -0.0047 5   LEU A CB  
38   C  CG  . LEU A  5   ? 0.1900 0.2137 0.1816 -0.0216 -0.0043 -0.0020 5   LEU A CG  
39   C  CD1 . LEU A  5   ? 0.1910 0.2110 0.1811 -0.0149 -0.0074 0.0006  5   LEU A CD1 
40   C  CD2 . LEU A  5   ? 0.1909 0.2130 0.1758 -0.0227 -0.0030 0.0040  5   LEU A CD2 
41   N  N   . GLU A  6   ? 0.1893 0.2308 0.2015 -0.0332 -0.0024 -0.0204 6   GLU A N   
42   C  CA  . GLU A  6   ? 0.1878 0.2444 0.2093 -0.0317 -0.0052 -0.0264 6   GLU A CA  
43   C  C   . GLU A  6   ? 0.1895 0.2487 0.2155 -0.0300 -0.0105 -0.0318 6   GLU A C   
44   O  O   . GLU A  6   ? 0.1838 0.2494 0.2116 -0.0242 -0.0152 -0.0341 6   GLU A O   
45   C  CB  . GLU A  6   ? 0.1902 0.2574 0.2195 -0.0378 -0.0003 -0.0292 6   GLU A CB  
46   C  CG  . GLU A  6   ? 0.1951 0.2598 0.2177 -0.0382 0.0043  -0.0244 6   GLU A CG  
47   C  CD  . GLU A  6   ? 0.2046 0.2754 0.2320 -0.0457 0.0115  -0.0259 6   GLU A CD  
48   O  OE1 . GLU A  6   ? 0.1979 0.2688 0.2198 -0.0453 0.0153  -0.0234 6   GLU A OE1 
49   O  OE2 . GLU A  6   ? 0.2108 0.2850 0.2459 -0.0528 0.0138  -0.0293 6   GLU A OE2 
50   N  N   . LYS A  7   ? 0.1949 0.2474 0.2209 -0.0354 -0.0099 -0.0338 7   LYS A N   
51   C  CA  . LYS A  7   ? 0.2028 0.2556 0.2305 -0.0345 -0.0153 -0.0391 7   LYS A CA  
52   C  C   . LYS A  7   ? 0.2015 0.2455 0.2200 -0.0262 -0.0187 -0.0365 7   LYS A C   
53   O  O   . LYS A  7   ? 0.1953 0.2428 0.2143 -0.0224 -0.0240 -0.0403 7   LYS A O   
54   C  CB  . LYS A  7   ? 0.2270 0.2699 0.2528 -0.0427 -0.0136 -0.0414 7   LYS A CB  
55   C  CG  . LYS A  7   ? 0.2421 0.2959 0.2787 -0.0526 -0.0110 -0.0453 7   LYS A CG  
56   C  CD  . LYS A  7   ? 0.2727 0.3123 0.3041 -0.0619 -0.0086 -0.0466 7   LYS A CD  
57   C  CE  . LYS A  7   ? 0.2924 0.3444 0.3358 -0.0733 -0.0058 -0.0505 7   LYS A CE  
58   N  NZ  . LYS A  7   ? 0.3295 0.3661 0.3666 -0.0839 -0.0038 -0.0523 7   LYS A NZ  
59   N  N   . ALA A  8   ? 0.1948 0.2278 0.2052 -0.0234 -0.0156 -0.0301 8   ALA A N   
60   C  CA  . ALA A  8   ? 0.1974 0.2244 0.2008 -0.0157 -0.0177 -0.0272 8   ALA A CA  
61   C  C   . ALA A  8   ? 0.1853 0.2221 0.1906 -0.0106 -0.0214 -0.0276 8   ALA A C   
62   O  O   . ALA A  8   ? 0.1939 0.2289 0.1954 -0.0058 -0.0247 -0.0287 8   ALA A O   
63   C  CB  . ALA A  8   ? 0.1933 0.2105 0.1904 -0.0133 -0.0139 -0.0198 8   ALA A CB  
64   N  N   . LEU A  9   ? 0.1875 0.2325 0.1965 -0.0116 -0.0203 -0.0263 9   LEU A N   
65   C  CA  . LEU A  9   ? 0.1790 0.2306 0.1878 -0.0071 -0.0232 -0.0265 9   LEU A CA  
66   C  C   . LEU A  9   ? 0.1773 0.2366 0.1910 -0.0054 -0.0276 -0.0332 9   LEU A C   
67   O  O   . LEU A  9   ? 0.1858 0.2443 0.1954 -0.0002 -0.0316 -0.0341 9   LEU A O   
68   C  CB  . LEU A  9   ? 0.1768 0.2331 0.1865 -0.0089 -0.0203 -0.0242 9   LEU A CB  
69   C  CG  . LEU A  9   ? 0.1799 0.2298 0.1840 -0.0106 -0.0170 -0.0172 9   LEU A CG  
70   C  CD1 . LEU A  9   ? 0.1796 0.2333 0.1816 -0.0117 -0.0154 -0.0157 9   LEU A CD1 
71   C  CD2 . LEU A  9   ? 0.1857 0.2298 0.1841 -0.0064 -0.0189 -0.0123 9   LEU A CD2 
72   N  N   . ASN A  10  ? 0.1806 0.2470 0.2028 -0.0101 -0.0273 -0.0379 10  ASN A N   
73   C  CA  . ASN A  10  ? 0.1793 0.2545 0.2072 -0.0081 -0.0328 -0.0439 10  ASN A CA  
74   C  C   . ASN A  10  ? 0.1882 0.2549 0.2094 -0.0061 -0.0373 -0.0458 10  ASN A C   
75   O  O   . ASN A  10  ? 0.1906 0.2607 0.2110 -0.0016 -0.0430 -0.0490 10  ASN A O   
76   C  CB  . ASN A  10  ? 0.1809 0.2689 0.2216 -0.0142 -0.0317 -0.0486 10  ASN A CB  
77   C  CG  . ASN A  10  ? 0.1787 0.2785 0.2267 -0.0136 -0.0281 -0.0485 10  ASN A CG  
78   O  OD1 . ASN A  10  ? 0.1872 0.2863 0.2304 -0.0073 -0.0285 -0.0466 10  ASN A OD1 
79   N  ND2 . ASN A  10  ? 0.1870 0.2977 0.2464 -0.0203 -0.0245 -0.0512 10  ASN A ND2 
80   N  N   . SER A  11  ? 0.1897 0.2445 0.2050 -0.0092 -0.0346 -0.0438 11  SER A N   
81   C  CA  . SER A  11  ? 0.1978 0.2416 0.2038 -0.0067 -0.0377 -0.0452 11  SER A CA  
82   C  C   . SER A  11  ? 0.1942 0.2331 0.1915 0.0008  -0.0390 -0.0421 11  SER A C   
83   O  O   . SER A  11  ? 0.1945 0.2289 0.1850 0.0042  -0.0432 -0.0447 11  SER A O   
84   C  CB  . SER A  11  ? 0.2043 0.2341 0.2043 -0.0104 -0.0333 -0.0435 11  SER A CB  
85   O  OG  . SER A  11  ? 0.2222 0.2403 0.2117 -0.0074 -0.0354 -0.0453 11  SER A OG  
86   N  N   . ILE A  12  ? 0.1903 0.2298 0.1869 0.0029  -0.0357 -0.0366 12  ILE A N   
87   C  CA  . ILE A  12  ? 0.1892 0.2252 0.1784 0.0084  -0.0367 -0.0334 12  ILE A CA  
88   C  C   . ILE A  12  ? 0.1973 0.2386 0.1859 0.0120  -0.0425 -0.0376 12  ILE A C   
89   O  O   . ILE A  12  ? 0.1883 0.2235 0.1681 0.0162  -0.0450 -0.0376 12  ILE A O   
90   C  CB  . ILE A  12  ? 0.1922 0.2288 0.1811 0.0085  -0.0329 -0.0269 12  ILE A CB  
91   C  CG1 . ILE A  12  ? 0.1926 0.2227 0.1804 0.0073  -0.0282 -0.0223 12  ILE A CG1 
92   C  CG2 . ILE A  12  ? 0.1873 0.2222 0.1694 0.0127  -0.0348 -0.0247 12  ILE A CG2 
93   C  CD1 . ILE A  12  ? 0.1895 0.2224 0.1792 0.0060  -0.0253 -0.0160 12  ILE A CD1 
94   N  N   . ILE A  13  ? 0.1905 0.2428 0.1880 0.0109  -0.0439 -0.0405 13  ILE A N   
95   C  CA  . ILE A  13  ? 0.1935 0.2513 0.1913 0.0158  -0.0496 -0.0444 13  ILE A CA  
96   C  C   . ILE A  13  ? 0.2045 0.2600 0.1993 0.0169  -0.0552 -0.0489 13  ILE A C   
97   O  O   . ILE A  13  ? 0.2111 0.2619 0.1973 0.0223  -0.0598 -0.0497 13  ILE A O   
98   C  CB  . ILE A  13  ? 0.1911 0.2631 0.2013 0.0149  -0.0492 -0.0472 13  ILE A CB  
99   C  CG1 . ILE A  13  ? 0.1903 0.2621 0.2001 0.0139  -0.0436 -0.0429 13  ILE A CG1 
100  C  CG2 . ILE A  13  ? 0.1946 0.2734 0.2066 0.0211  -0.0558 -0.0516 13  ILE A CG2 
101  C  CD1 . ILE A  13  ? 0.1812 0.2657 0.2022 0.0120  -0.0408 -0.0453 13  ILE A CD1 
102  N  N   A ASP A  14  ? 0.2114 0.2684 0.2114 0.0112  -0.0549 -0.0516 14  ASP A N   
103  N  N   B ASP A  14  ? 0.2069 0.2639 0.2070 0.0111  -0.0548 -0.0516 14  ASP A N   
104  C  CA  A ASP A  14  ? 0.2247 0.2785 0.2207 0.0107  -0.0607 -0.0564 14  ASP A CA  
105  C  CA  B ASP A  14  ? 0.2168 0.2705 0.2131 0.0103  -0.0604 -0.0564 14  ASP A CA  
106  C  C   A ASP A  14  ? 0.2299 0.2676 0.2094 0.0145  -0.0609 -0.0545 14  ASP A C   
107  C  C   B ASP A  14  ? 0.2263 0.2641 0.2061 0.0143  -0.0608 -0.0546 14  ASP A C   
108  O  O   A ASP A  14  ? 0.2384 0.2728 0.2100 0.0184  -0.0671 -0.0573 14  ASP A O   
109  O  O   B ASP A  14  ? 0.2358 0.2704 0.2079 0.0177  -0.0671 -0.0576 14  ASP A O   
110  C  CB  A ASP A  14  ? 0.2407 0.2956 0.2430 0.0023  -0.0591 -0.0592 14  ASP A CB  
111  C  CB  B ASP A  14  ? 0.2256 0.2795 0.2278 0.0018  -0.0581 -0.0587 14  ASP A CB  
112  C  CG  A ASP A  14  ? 0.2474 0.3204 0.2667 -0.0024 -0.0600 -0.0626 14  ASP A CG  
113  C  CG  B ASP A  14  ? 0.2403 0.2925 0.2396 -0.0009 -0.0648 -0.0647 14  ASP A CG  
114  O  OD1 A ASP A  14  ? 0.2526 0.3386 0.2794 0.0021  -0.0632 -0.0640 14  ASP A OD1 
115  O  OD1 B ASP A  14  ? 0.2514 0.3145 0.2556 0.0014  -0.0721 -0.0686 14  ASP A OD1 
116  O  OD2 A ASP A  14  ? 0.2742 0.3481 0.2992 -0.0106 -0.0572 -0.0641 14  ASP A OD2 
117  O  OD2 B ASP A  14  ? 0.2594 0.2990 0.2513 -0.0055 -0.0629 -0.0656 14  ASP A OD2 
118  N  N   . VAL A  15  ? 0.2271 0.2554 0.2014 0.0140  -0.0541 -0.0494 15  VAL A N   
119  C  CA  . VAL A  15  ? 0.2332 0.2476 0.1931 0.0177  -0.0525 -0.0471 15  VAL A CA  
120  C  C   . VAL A  15  ? 0.2290 0.2419 0.1809 0.0236  -0.0560 -0.0461 15  VAL A C   
121  O  O   . VAL A  15  ? 0.2324 0.2359 0.1716 0.0268  -0.0590 -0.0477 15  VAL A O   
122  C  CB  . VAL A  15  ? 0.2443 0.2532 0.2031 0.0174  -0.0445 -0.0409 15  VAL A CB  
123  C  CG1 . VAL A  15  ? 0.2717 0.2689 0.2170 0.0219  -0.0421 -0.0384 15  VAL A CG1 
124  C  CG2 . VAL A  15  ? 0.2679 0.2731 0.2303 0.0126  -0.0409 -0.0417 15  VAL A CG2 
125  N  N   . TYR A  16  ? 0.2135 0.2334 0.1705 0.0251  -0.0556 -0.0436 16  TYR A N   
126  C  CA  . TYR A  16  ? 0.2143 0.2303 0.1623 0.0303  -0.0582 -0.0422 16  TYR A CA  
127  C  C   . TYR A  16  ? 0.2340 0.2501 0.1775 0.0342  -0.0667 -0.0475 16  TYR A C   
128  O  O   . TYR A  16  ? 0.2391 0.2451 0.1685 0.0383  -0.0696 -0.0473 16  TYR A O   
129  C  CB  . TYR A  16  ? 0.2101 0.2328 0.1640 0.0306  -0.0568 -0.0397 16  TYR A CB  
130  C  CG  . TYR A  16  ? 0.2099 0.2263 0.1531 0.0358  -0.0599 -0.0389 16  TYR A CG  
131  C  CD1 . TYR A  16  ? 0.2114 0.2163 0.1418 0.0365  -0.0572 -0.0345 16  TYR A CD1 
132  C  CD2 . TYR A  16  ? 0.2106 0.2321 0.1559 0.0405  -0.0653 -0.0423 16  TYR A CD2 
133  C  CE1 . TYR A  16  ? 0.2186 0.2150 0.1371 0.0405  -0.0598 -0.0336 16  TYR A CE1 
134  C  CE2 . TYR A  16  ? 0.2193 0.2319 0.1524 0.0461  -0.0681 -0.0413 16  TYR A CE2 
135  C  CZ  . TYR A  16  ? 0.2240 0.2228 0.1426 0.0458  -0.0655 -0.0370 16  TYR A CZ  
136  O  OH  . TYR A  16  ? 0.2407 0.2281 0.1451 0.0508  -0.0682 -0.0360 16  TYR A OH  
137  N  N   . HIS A  17  ? 0.2341 0.2627 0.1899 0.0327  -0.0708 -0.0520 17  HIS A N   
138  C  CA  . HIS A  17  ? 0.2454 0.2789 0.2009 0.0369  -0.0799 -0.0569 17  HIS A CA  
139  C  C   . HIS A  17  ? 0.2717 0.2962 0.2163 0.0362  -0.0843 -0.0599 17  HIS A C   
140  O  O   . HIS A  17  ? 0.2793 0.3010 0.2154 0.0410  -0.0920 -0.0623 17  HIS A O   
141  C  CB  . HIS A  17  ? 0.2373 0.2905 0.2124 0.0351  -0.0821 -0.0605 17  HIS A CB  
142  C  CG  . HIS A  17  ? 0.2264 0.2865 0.2077 0.0388  -0.0795 -0.0584 17  HIS A CG  
143  N  ND1 . HIS A  17  ? 0.2123 0.2720 0.1970 0.0353  -0.0715 -0.0545 17  HIS A ND1 
144  C  CD2 . HIS A  17  ? 0.2230 0.2884 0.2052 0.0467  -0.0839 -0.0595 17  HIS A CD2 
145  C  CE1 . HIS A  17  ? 0.2171 0.2810 0.2041 0.0398  -0.0709 -0.0538 17  HIS A CE1 
146  N  NE2 . HIS A  17  ? 0.2185 0.2854 0.2039 0.0472  -0.0779 -0.0568 17  HIS A NE2 
147  N  N   . LYS A  18  ? 0.2714 0.2888 0.2136 0.0307  -0.0794 -0.0596 18  LYS A N   
148  C  CA  . LYS A  18  ? 0.2946 0.2989 0.2221 0.0303  -0.0824 -0.0624 18  LYS A CA  
149  C  C   . LYS A  18  ? 0.3009 0.2910 0.2090 0.0367  -0.0834 -0.0599 18  LYS A C   
150  O  O   . LYS A  18  ? 0.3231 0.3041 0.2174 0.0384  -0.0891 -0.0630 18  LYS A O   
151  C  CB  . LYS A  18  ? 0.3248 0.3198 0.2496 0.0252  -0.0749 -0.0614 18  LYS A CB  
152  C  CG  . LYS A  18  ? 0.3584 0.3620 0.2970 0.0178  -0.0747 -0.0646 18  LYS A CG  
153  C  CD  . LYS A  18  ? 0.4015 0.3907 0.3320 0.0134  -0.0696 -0.0654 18  LYS A CD  
154  C  CE  . LYS A  18  ? 0.4382 0.4121 0.3553 0.0178  -0.0614 -0.0603 18  LYS A CE  
155  N  NZ  . LYS A  18  ? 0.4751 0.4393 0.3913 0.0148  -0.0532 -0.0587 18  LYS A NZ  
156  N  N   . TYR A  19  ? 0.2906 0.2776 0.1962 0.0393  -0.0776 -0.0544 19  TYR A N   
157  C  CA  . TYR A  19  ? 0.2890 0.2621 0.1763 0.0441  -0.0770 -0.0513 19  TYR A CA  
158  C  C   . TYR A  19  ? 0.2923 0.2682 0.1780 0.0497  -0.0829 -0.0509 19  TYR A C   
159  O  O   . TYR A  19  ? 0.3086 0.2734 0.1781 0.0543  -0.0870 -0.0507 19  TYR A O   
160  C  CB  . TYR A  19  ? 0.2888 0.2554 0.1728 0.0425  -0.0665 -0.0453 19  TYR A CB  
161  C  CG  . TYR A  19  ? 0.2911 0.2547 0.1768 0.0387  -0.0612 -0.0461 19  TYR A CG  
162  C  CD1 . TYR A  19  ? 0.3237 0.2732 0.1933 0.0398  -0.0603 -0.0478 19  TYR A CD1 
163  C  CD2 . TYR A  19  ? 0.2911 0.2647 0.1933 0.0345  -0.0572 -0.0453 19  TYR A CD2 
164  C  CE1 . TYR A  19  ? 0.3319 0.2763 0.2014 0.0371  -0.0554 -0.0491 19  TYR A CE1 
165  C  CE2 . TYR A  19  ? 0.2981 0.2665 0.2002 0.0317  -0.0528 -0.0464 19  TYR A CE2 
166  C  CZ  . TYR A  19  ? 0.3207 0.2743 0.2064 0.0333  -0.0517 -0.0482 19  TYR A CZ  
167  O  OH  . TYR A  19  ? 0.3417 0.2873 0.2250 0.0313  -0.0470 -0.0496 19  TYR A OH  
168  N  N   . SER A  20  ? 0.2677 0.2567 0.1686 0.0497  -0.0828 -0.0505 20  SER A N   
169  C  CA  . SER A  20  ? 0.2726 0.2615 0.1701 0.0561  -0.0872 -0.0498 20  SER A CA  
170  C  C   . SER A  20  ? 0.2877 0.2811 0.1842 0.0620  -0.0983 -0.0546 20  SER A C   
171  O  O   . SER A  20  ? 0.3062 0.2926 0.1916 0.0694  -0.1032 -0.0539 20  SER A O   
172  C  CB  . SER A  20  ? 0.2652 0.2650 0.1770 0.0550  -0.0832 -0.0482 20  SER A CB  
173  O  OG  . SER A  20  ? 0.2519 0.2695 0.1825 0.0536  -0.0857 -0.0522 20  SER A OG  
174  N  N   . LEU A  21  ? 0.2889 0.2942 0.1972 0.0584  -0.1021 -0.0594 21  LEU A N   
175  C  CA  . LEU A  21  ? 0.2976 0.3114 0.2085 0.0626  -0.1136 -0.0643 21  LEU A CA  
176  C  C   . LEU A  21  ? 0.3262 0.3251 0.2167 0.0641  -0.1197 -0.0658 21  LEU A C   
177  O  O   . LEU A  21  ? 0.3310 0.3357 0.2212 0.0674  -0.1305 -0.0699 21  LEU A O   
178  C  CB  . LEU A  21  ? 0.2928 0.3275 0.2267 0.0564  -0.1150 -0.0688 21  LEU A CB  
179  C  CG  . LEU A  21  ? 0.2802 0.3309 0.2339 0.0558  -0.1098 -0.0679 21  LEU A CG  
180  C  CD1 . LEU A  21  ? 0.2766 0.3473 0.2519 0.0486  -0.1104 -0.0721 21  LEU A CD1 
181  C  CD2 . LEU A  21  ? 0.2964 0.3516 0.2507 0.0660  -0.1138 -0.0672 21  LEU A CD2 
182  N  N   . ILE A  22  ? 0.3338 0.3135 0.2061 0.0625  -0.1132 -0.0625 22  ILE A N   
183  C  CA  . ILE A  22  ? 0.3570 0.3200 0.2069 0.0642  -0.1177 -0.0637 22  ILE A CA  
184  C  C   . ILE A  22  ? 0.3765 0.3324 0.2118 0.0735  -0.1270 -0.0632 22  ILE A C   
185  O  O   . ILE A  22  ? 0.3934 0.3486 0.2209 0.0762  -0.1379 -0.0670 22  ILE A O   
186  C  CB  . ILE A  22  ? 0.3565 0.3014 0.1906 0.0612  -0.1075 -0.0600 22  ILE A CB  
187  C  CG1 . ILE A  22  ? 0.3463 0.2961 0.1918 0.0534  -0.1006 -0.0614 22  ILE A CG1 
188  C  CG2 . ILE A  22  ? 0.3804 0.3061 0.1879 0.0639  -0.1120 -0.0612 22  ILE A CG2 
189  C  CD1 . ILE A  22  ? 0.3556 0.2920 0.1910 0.0514  -0.0890 -0.0571 22  ILE A CD1 
190  N  N   . LYS A  23  ? 0.3773 0.3278 0.2087 0.0781  -0.1232 -0.0586 23  LYS A N   
191  C  CA  . LYS A  23  ? 0.3999 0.3398 0.2148 0.0876  -0.1308 -0.0572 23  LYS A CA  
192  C  C   . LYS A  23  ? 0.3872 0.3272 0.2058 0.0920  -0.1272 -0.0535 23  LYS A C   
193  O  O   . LYS A  23  ? 0.3448 0.2905 0.1755 0.0869  -0.1180 -0.0514 23  LYS A O   
194  C  CB  . LYS A  23  ? 0.4261 0.3405 0.2109 0.0884  -0.1293 -0.0546 23  LYS A CB  
195  C  CG  . LYS A  23  ? 0.4387 0.3410 0.2162 0.0828  -0.1156 -0.0495 23  LYS A CG  
196  C  CD  . LYS A  23  ? 0.4824 0.3593 0.2295 0.0843  -0.1133 -0.0463 23  LYS A CD  
197  C  CE  . LYS A  23  ? 0.4849 0.3531 0.2274 0.0784  -0.0993 -0.0410 23  LYS A CE  
198  N  NZ  . LYS A  23  ? 0.4862 0.3625 0.2404 0.0716  -0.0922 -0.0426 23  LYS A NZ  
199  N  N   . GLY A  24  ? 0.4134 0.3455 0.2196 0.1020  -0.1348 -0.0527 24  GLY A N   
200  C  CA  . GLY A  24  ? 0.4077 0.3329 0.2104 0.1072  -0.1317 -0.0491 24  GLY A CA  
201  C  C   . GLY A  24  ? 0.3868 0.3335 0.2160 0.1067  -0.1290 -0.0508 24  GLY A C   
202  O  O   . GLY A  24  ? 0.3791 0.3476 0.2288 0.1074  -0.1342 -0.0552 24  GLY A O   
203  N  N   . ASN A  25  ? 0.3648 0.3055 0.1937 0.1039  -0.1200 -0.0472 25  ASN A N   
204  C  CA  . ASN A  25  ? 0.3436 0.3000 0.1925 0.1038  -0.1163 -0.0483 25  ASN A CA  
205  C  C   . ASN A  25  ? 0.3245 0.2999 0.1953 0.0939  -0.1116 -0.0505 25  ASN A C   
206  O  O   . ASN A  25  ? 0.3261 0.2960 0.1930 0.0858  -0.1063 -0.0488 25  ASN A O   
207  C  CB  . ASN A  25  ? 0.3379 0.2774 0.1744 0.1028  -0.1088 -0.0437 25  ASN A CB  
208  C  CG  . ASN A  25  ? 0.3235 0.2761 0.1777 0.1005  -0.1031 -0.0443 25  ASN A CG  
209  O  OD1 . ASN A  25  ? 0.3139 0.2779 0.1821 0.0916  -0.0973 -0.0444 25  ASN A OD1 
210  N  ND2 . ASN A  25  ? 0.3332 0.2813 0.1838 0.1089  -0.1043 -0.0445 25  ASN A ND2 
211  N  N   . PHE A  26  ? 0.3091 0.3064 0.2022 0.0950  -0.1136 -0.0542 26  PHE A N   
212  C  CA  . PHE A  26  ? 0.2912 0.3060 0.2046 0.0856  -0.1093 -0.0563 26  PHE A CA  
213  C  C   . PHE A  26  ? 0.2704 0.2835 0.1881 0.0769  -0.0984 -0.0531 26  PHE A C   
214  O  O   . PHE A  26  ? 0.2598 0.2822 0.1893 0.0690  -0.0949 -0.0541 26  PHE A O   
215  C  CB  . PHE A  26  ? 0.2932 0.3322 0.2296 0.0885  -0.1128 -0.0607 26  PHE A CB  
216  C  CG  . PHE A  26  ? 0.2963 0.3369 0.2344 0.0975  -0.1122 -0.0601 26  PHE A CG  
217  C  CD1 . PHE A  26  ? 0.2902 0.3289 0.2311 0.0946  -0.1030 -0.0579 26  PHE A CD1 
218  C  CD2 . PHE A  26  ? 0.3134 0.3573 0.2499 0.1094  -0.1211 -0.0620 26  PHE A CD2 
219  C  CE1 . PHE A  26  ? 0.2968 0.3346 0.2370 0.1031  -0.1019 -0.0578 26  PHE A CE1 
220  C  CE2 . PHE A  26  ? 0.3235 0.3676 0.2610 0.1190  -0.1198 -0.0616 26  PHE A CE2 
221  C  CZ  . PHE A  26  ? 0.3145 0.3552 0.2536 0.1155  -0.1098 -0.0598 26  PHE A CZ  
222  N  N   . HIS A  27  ? 0.2674 0.2684 0.1750 0.0781  -0.0936 -0.0492 27  HIS A N   
223  C  CA  . HIS A  27  ? 0.2600 0.2572 0.1680 0.0699  -0.0846 -0.0454 27  HIS A CA  
224  C  C   . HIS A  27  ? 0.2712 0.2481 0.1589 0.0685  -0.0818 -0.0407 27  HIS A C   
225  O  O   . HIS A  27  ? 0.2767 0.2457 0.1585 0.0660  -0.0770 -0.0372 27  HIS A O   
226  C  CB  . HIS A  27  ? 0.2546 0.2576 0.1704 0.0708  -0.0810 -0.0452 27  HIS A CB  
227  C  CG  . HIS A  27  ? 0.2582 0.2826 0.1955 0.0709  -0.0814 -0.0493 27  HIS A CG  
228  N  ND1 . HIS A  27  ? 0.2590 0.2901 0.2027 0.0763  -0.0807 -0.0510 27  HIS A ND1 
229  C  CD2 . HIS A  27  ? 0.2481 0.2881 0.2016 0.0654  -0.0814 -0.0520 27  HIS A CD2 
230  C  CE1 . HIS A  27  ? 0.2597 0.3117 0.2240 0.0743  -0.0802 -0.0545 27  HIS A CE1 
231  N  NE2 . HIS A  27  ? 0.2414 0.2983 0.2113 0.0675  -0.0812 -0.0552 27  HIS A NE2 
232  N  N   . ALA A  28  ? 0.2731 0.2413 0.1492 0.0696  -0.0851 -0.0408 28  ALA A N   
233  C  CA  . ALA A  28  ? 0.2874 0.2372 0.1442 0.0675  -0.0818 -0.0366 28  ALA A CA  
234  C  C   . ALA A  28  ? 0.2945 0.2446 0.1507 0.0634  -0.0801 -0.0370 28  ALA A C   
235  O  O   . ALA A  28  ? 0.3004 0.2511 0.1539 0.0667  -0.0864 -0.0406 28  ALA A O   
236  C  CB  . ALA A  28  ? 0.3094 0.2422 0.1455 0.0754  -0.0874 -0.0361 28  ALA A CB  
237  N  N   . VAL A  29  ? 0.2863 0.2352 0.1438 0.0566  -0.0721 -0.0332 29  VAL A N   
238  C  CA  . VAL A  29  ? 0.2906 0.2349 0.1428 0.0536  -0.0685 -0.0326 29  VAL A CA  
239  C  C   . VAL A  29  ? 0.3131 0.2402 0.1453 0.0533  -0.0647 -0.0281 29  VAL A C   
240  O  O   . VAL A  29  ? 0.3084 0.2335 0.1401 0.0493  -0.0591 -0.0237 29  VAL A O   
241  C  CB  . VAL A  29  ? 0.2754 0.2313 0.1438 0.0472  -0.0614 -0.0310 29  VAL A CB  
242  C  CG1 . VAL A  29  ? 0.2769 0.2256 0.1376 0.0450  -0.0554 -0.0290 29  VAL A CG1 
243  C  CG2 . VAL A  29  ? 0.2652 0.2351 0.1501 0.0468  -0.0649 -0.0356 29  VAL A CG2 
244  N  N   . TYR A  30  ? 0.3393 0.2535 0.1540 0.0573  -0.0683 -0.0295 30  TYR A N   
245  C  CA  . TYR A  30  ? 0.3629 0.2587 0.1557 0.0571  -0.0647 -0.0255 30  TYR A CA  
246  C  C   . TYR A  30  ? 0.3748 0.2695 0.1666 0.0519  -0.0551 -0.0226 30  TYR A C   
247  O  O   . TYR A  30  ? 0.3676 0.2742 0.1743 0.0494  -0.0520 -0.0238 30  TYR A O   
248  C  CB  . TYR A  30  ? 0.3860 0.2673 0.1586 0.0641  -0.0727 -0.0278 30  TYR A CB  
249  C  CG  . TYR A  30  ? 0.3767 0.2608 0.1519 0.0708  -0.0821 -0.0303 30  TYR A CG  
250  C  CD1 . TYR A  30  ? 0.3973 0.2723 0.1650 0.0725  -0.0818 -0.0272 30  TYR A CD1 
251  C  CD2 . TYR A  30  ? 0.3814 0.2771 0.1666 0.0756  -0.0913 -0.0358 30  TYR A CD2 
252  C  CE1 . TYR A  30  ? 0.4000 0.2773 0.1703 0.0802  -0.0896 -0.0295 30  TYR A CE1 
253  C  CE2 . TYR A  30  ? 0.3801 0.2812 0.1702 0.0827  -0.0993 -0.0379 30  TYR A CE2 
254  C  CZ  . TYR A  30  ? 0.3951 0.2864 0.1772 0.0859  -0.0983 -0.0348 30  TYR A CZ  
255  O  OH  . TYR A  30  ? 0.3904 0.2870 0.1776 0.0945  -0.1056 -0.0370 30  TYR A OH  
256  N  N   . ARG A  31  ? 0.4096 0.2900 0.1840 0.0502  -0.0498 -0.0184 31  ARG A N   
257  C  CA  . ARG A  31  ? 0.4234 0.3054 0.1994 0.0450  -0.0388 -0.0147 31  ARG A CA  
258  C  C   . ARG A  31  ? 0.4133 0.2966 0.1898 0.0470  -0.0371 -0.0180 31  ARG A C   
259  O  O   . ARG A  31  ? 0.3953 0.2885 0.1847 0.0444  -0.0298 -0.0168 31  ARG A O   
260  C  CB  . ARG A  31  ? 0.4830 0.3485 0.2384 0.0429  -0.0338 -0.0100 31  ARG A CB  
261  C  CG  . ARG A  31  ? 0.5486 0.4138 0.3017 0.0389  -0.0223 -0.0064 31  ARG A CG  
262  C  CD  . ARG A  31  ? 0.5888 0.4341 0.3168 0.0372  -0.0183 -0.0027 31  ARG A CD  
263  N  NE  . ARG A  31  ? 0.6255 0.4671 0.3516 0.0328  -0.0194 0.0008  31  ARG A NE  
264  C  CZ  . ARG A  31  ? 0.6196 0.4737 0.3610 0.0252  -0.0140 0.0048  31  ARG A CZ  
265  N  NH1 . ARG A  31  ? 0.6282 0.5010 0.3894 0.0218  -0.0068 0.0065  31  ARG A NH1 
266  N  NH2 . ARG A  31  ? 0.6062 0.4529 0.3415 0.0211  -0.0160 0.0072  31  ARG A NH2 
267  N  N   . ASP A  32  ? 0.4071 0.2794 0.1686 0.0519  -0.0441 -0.0223 32  ASP A N   
268  C  CA  . ASP A  32  ? 0.4137 0.2836 0.1716 0.0533  -0.0433 -0.0261 32  ASP A CA  
269  C  C   . ASP A  32  ? 0.3810 0.2667 0.1601 0.0526  -0.0470 -0.0303 32  ASP A C   
270  O  O   . ASP A  32  ? 0.3808 0.2685 0.1646 0.0513  -0.0419 -0.0317 32  ASP A O   
271  C  CB  . ASP A  32  ? 0.4474 0.2996 0.1803 0.0580  -0.0506 -0.0296 32  ASP A CB  
272  C  CG  . ASP A  32  ? 0.4656 0.3191 0.1982 0.0623  -0.0638 -0.0327 32  ASP A CG  
273  O  OD1 . ASP A  32  ? 0.4737 0.3374 0.2201 0.0622  -0.0662 -0.0314 32  ASP A OD1 
274  O  OD2 . ASP A  32  ? 0.5306 0.3748 0.2483 0.0661  -0.0718 -0.0366 32  ASP A OD2 
275  N  N   . ASP A  33  ? 0.3742 0.2702 0.1657 0.0534  -0.0551 -0.0322 33  ASP A N   
276  C  CA  . ASP A  33  ? 0.3539 0.2657 0.1664 0.0516  -0.0579 -0.0356 33  ASP A CA  
277  C  C   . ASP A  33  ? 0.3296 0.2523 0.1590 0.0472  -0.0487 -0.0316 33  ASP A C   
278  O  O   . ASP A  33  ? 0.3217 0.2515 0.1627 0.0453  -0.0468 -0.0336 33  ASP A O   
279  C  CB  . ASP A  33  ? 0.3467 0.2685 0.1696 0.0536  -0.0666 -0.0376 33  ASP A CB  
280  C  CG  . ASP A  33  ? 0.3824 0.2963 0.1913 0.0593  -0.0771 -0.0410 33  ASP A CG  
281  O  OD1 . ASP A  33  ? 0.3909 0.2978 0.1889 0.0605  -0.0814 -0.0448 33  ASP A OD1 
282  O  OD2 . ASP A  33  ? 0.3893 0.3040 0.1980 0.0628  -0.0815 -0.0400 33  ASP A OD2 
283  N  N   . LEU A  34  ? 0.3158 0.2393 0.1460 0.0453  -0.0432 -0.0260 34  LEU A N   
284  C  CA  . LEU A  34  ? 0.3010 0.2362 0.1477 0.0412  -0.0353 -0.0220 34  LEU A CA  
285  C  C   . LEU A  34  ? 0.3094 0.2408 0.1527 0.0415  -0.0268 -0.0206 34  LEU A C   
286  O  O   . LEU A  34  ? 0.2977 0.2377 0.1542 0.0404  -0.0222 -0.0196 34  LEU A O   
287  C  CB  . LEU A  34  ? 0.2991 0.2371 0.1477 0.0379  -0.0321 -0.0164 34  LEU A CB  
288  C  CG  . LEU A  34  ? 0.2811 0.2325 0.1465 0.0337  -0.0255 -0.0118 34  LEU A CG  
289  C  CD1 . LEU A  34  ? 0.2727 0.2360 0.1544 0.0328  -0.0299 -0.0138 34  LEU A CD1 
290  C  CD2 . LEU A  34  ? 0.2923 0.2453 0.1572 0.0290  -0.0218 -0.0060 34  LEU A CD2 
291  N  N   . LYS A  35  ? 0.3338 0.2512 0.1581 0.0435  -0.0242 -0.0205 35  LYS A N   
292  C  CA  . LYS A  35  ? 0.3549 0.2676 0.1745 0.0447  -0.0152 -0.0197 35  LYS A CA  
293  C  C   . LYS A  35  ? 0.3562 0.2676 0.1787 0.0464  -0.0177 -0.0251 35  LYS A C   
294  O  O   . LYS A  35  ? 0.3600 0.2747 0.1902 0.0469  -0.0110 -0.0242 35  LYS A O   
295  C  CB  . LYS A  35  ? 0.3829 0.2786 0.1787 0.0466  -0.0122 -0.0192 35  LYS A CB  
296  C  CG  . LYS A  35  ? 0.4114 0.3003 0.1995 0.0487  -0.0016 -0.0186 35  LYS A CG  
297  C  CD  . LYS A  35  ? 0.4695 0.3392 0.2307 0.0506  0.0003  -0.0192 35  LYS A CD  
298  C  CE  . LYS A  35  ? 0.5155 0.3780 0.2683 0.0532  0.0119  -0.0189 35  LYS A CE  
299  N  NZ  . LYS A  35  ? 0.5522 0.4246 0.3139 0.0509  0.0233  -0.0117 35  LYS A NZ  
300  N  N   . LYS A  36  ? 0.3680 0.2744 0.1839 0.0472  -0.0276 -0.0308 36  LYS A N   
301  C  CA  A LYS A  36  ? 0.3711 0.2760 0.1892 0.0470  -0.0311 -0.0365 36  LYS A CA  
302  C  CA  B LYS A  36  ? 0.3710 0.2762 0.1894 0.0470  -0.0312 -0.0365 36  LYS A CA  
303  C  C   . LYS A  36  ? 0.3396 0.2602 0.1812 0.0440  -0.0304 -0.0356 36  LYS A C   
304  O  O   . LYS A  36  ? 0.3420 0.2611 0.1875 0.0434  -0.0271 -0.0373 36  LYS A O   
305  C  CB  A LYS A  36  ? 0.3834 0.2838 0.1924 0.0477  -0.0433 -0.0423 36  LYS A CB  
306  C  CB  B LYS A  36  ? 0.3816 0.2832 0.1923 0.0475  -0.0434 -0.0423 36  LYS A CB  
307  C  CG  A LYS A  36  ? 0.3993 0.2956 0.2060 0.0462  -0.0485 -0.0490 36  LYS A CG  
308  C  CG  B LYS A  36  ? 0.3915 0.2929 0.2057 0.0453  -0.0477 -0.0484 36  LYS A CG  
309  C  CD  A LYS A  36  ? 0.3919 0.2975 0.2055 0.0455  -0.0613 -0.0531 36  LYS A CD  
310  C  CD  B LYS A  36  ? 0.4125 0.2984 0.2122 0.0462  -0.0404 -0.0497 36  LYS A CD  
311  C  CE  A LYS A  36  ? 0.4117 0.3120 0.2181 0.0436  -0.0694 -0.0603 36  LYS A CE  
312  C  CE  B LYS A  36  ? 0.4402 0.3076 0.2132 0.0488  -0.0433 -0.0528 36  LYS A CE  
313  N  NZ  A LYS A  36  ? 0.3913 0.3073 0.2173 0.0392  -0.0761 -0.0642 36  LYS A NZ  
314  N  NZ  B LYS A  36  ? 0.4541 0.3074 0.2154 0.0480  -0.0407 -0.0576 36  LYS A NZ  
315  N  N   . LEU A  37  ? 0.3218 0.2551 0.1766 0.0423  -0.0333 -0.0330 37  LEU A N   
316  C  CA  . LEU A  37  ? 0.2927 0.2392 0.1668 0.0395  -0.0324 -0.0319 37  LEU A CA  
317  C  C   . LEU A  37  ? 0.2853 0.2342 0.1660 0.0396  -0.0226 -0.0269 37  LEU A C   
318  O  O   . LEU A  37  ? 0.2797 0.2308 0.1688 0.0388  -0.0204 -0.0276 37  LEU A O   
319  C  CB  . LEU A  37  ? 0.2832 0.2411 0.1677 0.0379  -0.0367 -0.0299 37  LEU A CB  
320  C  CG  . LEU A  37  ? 0.2685 0.2401 0.1716 0.0347  -0.0368 -0.0288 37  LEU A CG  
321  C  CD1 . LEU A  37  ? 0.2607 0.2393 0.1682 0.0344  -0.0427 -0.0295 37  LEU A CD1 
322  C  CD2 . LEU A  37  ? 0.2597 0.2369 0.1710 0.0333  -0.0289 -0.0225 37  LEU A CD2 
323  N  N   . LEU A  38  ? 0.2768 0.2260 0.1545 0.0406  -0.0166 -0.0217 38  LEU A N   
324  C  CA  . LEU A  38  ? 0.2807 0.2353 0.1667 0.0416  -0.0075 -0.0165 38  LEU A CA  
325  C  C   . LEU A  38  ? 0.3028 0.2467 0.1811 0.0454  -0.0018 -0.0186 38  LEU A C   
326  O  O   . LEU A  38  ? 0.3138 0.2613 0.2014 0.0469  0.0030  -0.0166 38  LEU A O   
327  C  CB  . LEU A  38  ? 0.2825 0.2403 0.1664 0.0411  -0.0023 -0.0108 38  LEU A CB  
328  C  CG  . LEU A  38  ? 0.2687 0.2366 0.1609 0.0367  -0.0064 -0.0077 38  LEU A CG  
329  C  CD1 . LEU A  38  ? 0.2847 0.2500 0.1683 0.0349  -0.0027 -0.0037 38  LEU A CD1 
330  C  CD2 . LEU A  38  ? 0.2549 0.2383 0.1663 0.0344  -0.0050 -0.0034 38  LEU A CD2 
331  N  N   . GLU A  39  ? 0.3222 0.2512 0.1818 0.0474  -0.0022 -0.0226 39  GLU A N   
332  C  CA  . GLU A  39  ? 0.3587 0.2742 0.2072 0.0511  0.0036  -0.0253 39  GLU A CA  
333  C  C   . GLU A  39  ? 0.3526 0.2646 0.2050 0.0497  -0.0002 -0.0300 39  GLU A C   
334  O  O   . GLU A  39  ? 0.3604 0.2654 0.2111 0.0526  0.0063  -0.0301 39  GLU A O   
335  C  CB  . GLU A  39  ? 0.4064 0.3049 0.2312 0.0525  0.0018  -0.0295 39  GLU A CB  
336  C  CG  . GLU A  39  ? 0.4395 0.3360 0.2556 0.0543  0.0091  -0.0249 39  GLU A CG  
337  C  CD  . GLU A  39  ? 0.5052 0.3838 0.2957 0.0554  0.0061  -0.0287 39  GLU A CD  
338  O  OE1 . GLU A  39  ? 0.5330 0.4038 0.3143 0.0544  -0.0041 -0.0346 39  GLU A OE1 
339  O  OE2 . GLU A  39  ? 0.5577 0.4311 0.3377 0.0570  0.0141  -0.0252 39  GLU A OE2 
340  N  N   . THR A  40  ? 0.3547 0.2711 0.2116 0.0454  -0.0102 -0.0338 40  THR A N   
341  C  CA  . THR A  40  ? 0.3584 0.2728 0.2195 0.0420  -0.0147 -0.0386 40  THR A CA  
342  C  C   . THR A  40  ? 0.3401 0.2670 0.2208 0.0398  -0.0130 -0.0351 40  THR A C   
343  O  O   . THR A  40  ? 0.3405 0.2608 0.2220 0.0389  -0.0108 -0.0368 40  THR A O   
344  C  CB  . THR A  40  ? 0.3728 0.2888 0.2313 0.0383  -0.0263 -0.0444 40  THR A CB  
345  O  OG1 . THR A  40  ? 0.4101 0.3130 0.2484 0.0408  -0.0286 -0.0474 40  THR A OG1 
346  C  CG2 . THR A  40  ? 0.3903 0.3050 0.2532 0.0334  -0.0309 -0.0498 40  THR A CG2 
347  N  N   . GLU A  41  ? 0.3212 0.2636 0.2153 0.0387  -0.0140 -0.0303 41  GLU A N   
348  C  CA  . GLU A  41  ? 0.3011 0.2551 0.2116 0.0357  -0.0145 -0.0277 41  GLU A CA  
349  C  C   . GLU A  41  ? 0.2980 0.2593 0.2180 0.0383  -0.0073 -0.0202 41  GLU A C   
350  O  O   . GLU A  41  ? 0.2798 0.2474 0.2106 0.0366  -0.0069 -0.0177 41  GLU A O   
351  C  CB  . GLU A  41  ? 0.3068 0.2732 0.2258 0.0322  -0.0214 -0.0281 41  GLU A CB  
352  C  CG  . GLU A  41  ? 0.3067 0.2704 0.2197 0.0304  -0.0297 -0.0349 41  GLU A CG  
353  C  CD  . GLU A  41  ? 0.3403 0.3017 0.2562 0.0262  -0.0326 -0.0402 41  GLU A CD  
354  O  OE1 . GLU A  41  ? 0.3356 0.2985 0.2595 0.0240  -0.0288 -0.0383 41  GLU A OE1 
355  O  OE2 . GLU A  41  ? 0.3632 0.3209 0.2725 0.0249  -0.0391 -0.0461 41  GLU A OE2 
356  N  N   . SER A  42  ? 0.2925 0.2540 0.2087 0.0422  -0.0020 -0.0163 42  SER A N   
357  C  CA  . SER A  42  ? 0.2908 0.2640 0.2190 0.0440  0.0035  -0.0087 42  SER A CA  
358  C  C   . SER A  42  ? 0.2904 0.2580 0.2157 0.0507  0.0128  -0.0060 42  SER A C   
359  O  O   . SER A  42  ? 0.3025 0.2569 0.2137 0.0539  0.0164  -0.0093 42  SER A O   
360  C  CB  . SER A  42  ? 0.2892 0.2731 0.2206 0.0416  0.0020  -0.0051 42  SER A CB  
361  O  OG  . SER A  42  ? 0.3136 0.2926 0.2355 0.0444  0.0070  -0.0041 42  SER A OG  
362  N  N   . PRO A  43  ? 0.2896 0.2668 0.2276 0.0534  0.0168  0.0002  43  PRO A N   
363  C  CA  . PRO A  43  ? 0.3076 0.2809 0.2447 0.0613  0.0261  0.0032  43  PRO A CA  
364  C  C   . PRO A  43  ? 0.3094 0.2903 0.2469 0.0642  0.0325  0.0070  43  PRO A C   
365  O  O   . PRO A  43  ? 0.2852 0.2758 0.2254 0.0592  0.0294  0.0086  43  PRO A O   
366  C  CB  . PRO A  43  ? 0.3050 0.2877 0.2564 0.0632  0.0265  0.0088  43  PRO A CB  
367  C  CG  . PRO A  43  ? 0.2815 0.2795 0.2435 0.0562  0.0194  0.0113  43  PRO A CG  
368  C  CD  . PRO A  43  ? 0.2744 0.2647 0.2267 0.0500  0.0129  0.0042  43  PRO A CD  
369  N  N   . GLN A  44  ? 0.3607 0.2457 0.2950 0.0633  0.0345  -0.0348 44  GLN A N   
370  C  CA  . GLN A  44  ? 0.3893 0.2754 0.3165 0.0750  0.0518  -0.0360 44  GLN A CA  
371  C  C   . GLN A  44  ? 0.3391 0.2711 0.3068 0.0775  0.0540  -0.0230 44  GLN A C   
372  O  O   . GLN A  44  ? 0.3404 0.2851 0.3089 0.0779  0.0601  -0.0225 44  GLN A O   
373  C  CB  . GLN A  44  ? 0.4626 0.3114 0.3731 0.0929  0.0746  -0.0385 44  GLN A CB  
374  C  CG  . GLN A  44  ? 0.5196 0.3623 0.4171 0.1072  0.1003  -0.0380 44  GLN A CG  
375  C  CD  . GLN A  44  ? 0.5870 0.4229 0.4478 0.0982  0.0940  -0.0464 44  GLN A CD  
376  O  OE1 . GLN A  44  ? 0.6814 0.4860 0.4989 0.0870  0.0751  -0.0592 44  GLN A OE1 
377  N  NE2 . GLN A  44  ? 0.5939 0.4597 0.4766 0.1022  0.1074  -0.0369 44  GLN A NE2 
378  N  N   . TYR A  45  ? 0.3118 0.2647 0.3093 0.0772  0.0459  -0.0121 45  TYR A N   
379  C  CA  . TYR A  45  ? 0.2841 0.2724 0.3152 0.0778  0.0412  0.0000  45  TYR A CA  
380  C  C   . TYR A  45  ? 0.2725 0.2765 0.2947 0.0652  0.0278  -0.0032 45  TYR A C   
381  O  O   . TYR A  45  ? 0.2845 0.3097 0.3269 0.0628  0.0226  0.0033  45  TYR A O   
382  C  CB  . TYR A  45  ? 0.2840 0.2845 0.3419 0.0819  0.0318  0.0139  45  TYR A CB  
383  C  CG  . TYR A  45  ? 0.2716 0.2645 0.3112 0.0742  0.0183  0.0143  45  TYR A CG  
384  C  CD1 . TYR A  45  ? 0.2674 0.2720 0.2958 0.0652  0.0039  0.0160  45  TYR A CD1 
385  C  CD2 . TYR A  45  ? 0.2882 0.2572 0.3196 0.0770  0.0226  0.0142  45  TYR A CD2 
386  C  CE1 . TYR A  45  ? 0.2671 0.2618 0.2763 0.0616  -0.0008 0.0193  45  TYR A CE1 
387  C  CE2 . TYR A  45  ? 0.2819 0.2451 0.3021 0.0702  0.0148  0.0186  45  TYR A CE2 
388  C  CZ  . TYR A  45  ? 0.2798 0.2571 0.2888 0.0636  0.0056  0.0220  45  TYR A CZ  
389  O  OH  . TYR A  45  ? 0.2851 0.2543 0.2809 0.0604  0.0050  0.0298  45  TYR A OH  
390  N  N   . ILE A  46  ? 0.2559 0.2485 0.2525 0.0571  0.0219  -0.0115 46  ILE A N   
391  C  CA  . ILE A  46  ? 0.2543 0.2563 0.2402 0.0488  0.0146  -0.0148 46  ILE A CA  
392  C  C   . ILE A  46  ? 0.2623 0.2570 0.2343 0.0484  0.0213  -0.0221 46  ILE A C   
393  O  O   . ILE A  46  ? 0.2673 0.2725 0.2417 0.0461  0.0211  -0.0211 46  ILE A O   
394  C  CB  . ILE A  46  ? 0.2447 0.2423 0.2210 0.0432  0.0089  -0.0148 46  ILE A CB  
395  C  CG1 . ILE A  46  ? 0.2501 0.2503 0.2308 0.0454  0.0055  -0.0053 46  ILE A CG1 
396  C  CG2 . ILE A  46  ? 0.2372 0.2414 0.2049 0.0388  0.0064  -0.0170 46  ILE A CG2 
397  C  CD1 . ILE A  46  ? 0.2609 0.2683 0.2340 0.0454  -0.0023 -0.0013 46  ILE A CD1 
398  N  N   . ARG A  47  ? 0.2945 0.2649 0.2462 0.0505  0.0261  -0.0292 47  ARG A N   
399  C  CA  . ARG A  47  ? 0.3307 0.2839 0.2548 0.0515  0.0313  -0.0358 47  ARG A CA  
400  C  C   . ARG A  47  ? 0.3283 0.2877 0.2604 0.0601  0.0497  -0.0306 47  ARG A C   
401  O  O   . ARG A  47  ? 0.3315 0.2907 0.2516 0.0585  0.0528  -0.0305 47  ARG A O   
402  C  CB  . ARG A  47  ? 0.3858 0.2983 0.2736 0.0530  0.0306  -0.0454 47  ARG A CB  
403  C  CG  . ARG A  47  ? 0.4113 0.3164 0.2973 0.0408  0.0092  -0.0482 47  ARG A CG  
404  C  CD  . ARG A  47  ? 0.4806 0.3375 0.3274 0.0381  0.0005  -0.0588 47  ARG A CD  
405  N  NE  . ARG A  47  ? 0.5657 0.3941 0.4015 0.0485  0.0153  -0.0623 47  ARG A NE  
406  C  CZ  . ARG A  47  ? 0.6459 0.4199 0.4398 0.0480  0.0100  -0.0734 47  ARG A CZ  
407  N  NH1 . ARG A  47  ? 0.7083 0.4514 0.4670 0.0347  -0.0155 -0.0819 47  ARG A NH1 
408  N  NH2 . ARG A  47  ? 0.7000 0.4458 0.4849 0.0610  0.0280  -0.0756 47  ARG A NH2 
409  N  N   . LYS A  48  ? 0.3203 0.2884 0.2802 0.0690  0.0619  -0.0227 48  LYS A N   
410  C  CA  . LYS A  48  ? 0.3340 0.3119 0.3161 0.0783  0.0835  -0.0125 48  LYS A CA  
411  C  C   . LYS A  48  ? 0.2991 0.3067 0.3105 0.0692  0.0770  -0.0039 48  LYS A C   
412  O  O   . LYS A  48  ? 0.2870 0.2999 0.3134 0.0737  0.0952  0.0052  48  LYS A O   
413  C  CB  . LYS A  48  ? 0.3592 0.3473 0.3805 0.0903  0.0955  -0.0011 48  LYS A CB  
414  C  CG  . LYS A  48  ? 0.3361 0.3587 0.4017 0.0822  0.0732  0.0090  48  LYS A CG  
415  C  CD  . LYS A  48  ? 0.3651 0.4000 0.4741 0.0942  0.0797  0.0234  48  LYS A CD  
416  C  CE  . LYS A  48  ? 0.3485 0.4092 0.4873 0.0848  0.0501  0.0330  48  LYS A CE  
417  N  NZ  . LYS A  48  ? 0.3906 0.4626 0.5741 0.0986  0.0554  0.0497  48  LYS A NZ  
418  N  N   . LYS A  49  ? 0.2764 0.2971 0.2911 0.0570  0.0533  -0.0063 49  LYS A N   
419  C  CA  . LYS A  49  ? 0.2717 0.3070 0.3007 0.0472  0.0445  -0.0019 49  LYS A CA  
420  C  C   . LYS A  49  ? 0.2626 0.2832 0.2635 0.0468  0.0544  -0.0057 49  LYS A C   
421  O  O   . LYS A  49  ? 0.2694 0.2978 0.2869 0.0419  0.0574  0.0017  49  LYS A O   
422  C  CB  . LYS A  49  ? 0.2857 0.3229 0.3053 0.0379  0.0212  -0.0064 49  LYS A CB  
423  C  CG  . LYS A  49  ? 0.3095 0.3498 0.3349 0.0280  0.0106  -0.0041 49  LYS A CG  
424  C  CD  . LYS A  49  ? 0.3296 0.3569 0.3264 0.0232  -0.0051 -0.0113 49  LYS A CD  
425  C  CE  . LYS A  49  ? 0.3487 0.3767 0.3518 0.0187  -0.0242 -0.0073 49  LYS A CE  
426  N  NZ  . LYS A  49  ? 0.3880 0.3931 0.3503 0.0179  -0.0349 -0.0138 49  LYS A NZ  
427  N  N   . GLY A  50  ? 0.2764 0.2735 0.2356 0.0505  0.0563  -0.0156 50  GLY A N   
428  C  CA  . GLY A  50  ? 0.2901 0.2688 0.2159 0.0512  0.0618  -0.0179 50  GLY A CA  
429  C  C   . GLY A  50  ? 0.2760 0.2547 0.1885 0.0437  0.0421  -0.0232 50  GLY A C   
430  O  O   . GLY A  50  ? 0.2499 0.2440 0.1822 0.0380  0.0319  -0.0219 50  GLY A O   
431  N  N   . ALA A  51  ? 0.2812 0.2396 0.1591 0.0446  0.0354  -0.0283 51  ALA A N   
432  C  CA  . ALA A  51  ? 0.2753 0.2385 0.1524 0.0398  0.0185  -0.0286 51  ALA A CA  
433  C  C   . ALA A  51  ? 0.2648 0.2333 0.1476 0.0389  0.0213  -0.0229 51  ALA A C   
434  O  O   . ALA A  51  ? 0.2635 0.2408 0.1581 0.0373  0.0134  -0.0215 51  ALA A O   
435  C  CB  . ALA A  51  ? 0.3158 0.2570 0.1608 0.0391  0.0047  -0.0317 51  ALA A CB  
436  N  N   . ASP A  52  ? 0.2869 0.2456 0.1594 0.0412  0.0353  -0.0181 52  ASP A N   
437  C  CA  . ASP A  52  ? 0.2850 0.2448 0.1657 0.0386  0.0389  -0.0113 52  ASP A CA  
438  C  C   . ASP A  52  ? 0.2575 0.2326 0.1709 0.0319  0.0344  -0.0110 52  ASP A C   
439  O  O   . ASP A  52  ? 0.2617 0.2312 0.1746 0.0295  0.0284  -0.0105 52  ASP A O   
440  C  CB  . ASP A  52  ? 0.3247 0.2706 0.1925 0.0420  0.0587  -0.0023 52  ASP A CB  
441  C  CG  . ASP A  52  ? 0.3381 0.2921 0.2274 0.0449  0.0786  0.0025  52  ASP A CG  
442  O  OD1 . ASP A  52  ? 0.3461 0.3137 0.2549 0.0450  0.0748  -0.0023 52  ASP A OD1 
443  O  OD2 . ASP A  52  ? 0.3838 0.3284 0.2694 0.0493  0.1013  0.0138  52  ASP A OD2 
444  N  N   . VAL A  53  ? 0.2453 0.2340 0.1823 0.0297  0.0361  -0.0108 53  VAL A N   
445  C  CA  . VAL A  53  ? 0.2346 0.2320 0.1958 0.0217  0.0251  -0.0101 53  VAL A CA  
446  C  C   . VAL A  53  ? 0.2293 0.2221 0.1743 0.0232  0.0132  -0.0181 53  VAL A C   
447  O  O   . VAL A  53  ? 0.2526 0.2336 0.1895 0.0198  0.0048  -0.0204 53  VAL A O   
448  C  CB  . VAL A  53  ? 0.2291 0.2444 0.2248 0.0200  0.0272  -0.0037 53  VAL A CB  
449  C  CG1 . VAL A  53  ? 0.2410 0.2606 0.2554 0.0099  0.0065  -0.0026 53  VAL A CG1 
450  C  CG2 . VAL A  53  ? 0.2433 0.2643 0.2618 0.0217  0.0478  0.0090  53  VAL A CG2 
451  N  N   . TRP A  54  ? 0.2228 0.2205 0.1616 0.0287  0.0139  -0.0214 54  TRP A N   
452  C  CA  . TRP A  54  ? 0.2283 0.2238 0.1582 0.0314  0.0083  -0.0244 54  TRP A CA  
453  C  C   . TRP A  54  ? 0.2353 0.2206 0.1532 0.0350  0.0096  -0.0238 54  TRP A C   
454  O  O   . TRP A  54  ? 0.2533 0.2277 0.1609 0.0383  0.0101  -0.0248 54  TRP A O   
455  C  CB  . TRP A  54  ? 0.2228 0.2249 0.1553 0.0343  0.0085  -0.0250 54  TRP A CB  
456  C  CG  . TRP A  54  ? 0.2315 0.2392 0.1738 0.0339  0.0071  -0.0248 54  TRP A CG  
457  C  CD1 . TRP A  54  ? 0.2318 0.2410 0.1811 0.0353  0.0105  -0.0251 54  TRP A CD1 
458  C  CD2 . TRP A  54  ? 0.2219 0.2284 0.1620 0.0340  0.0025  -0.0231 54  TRP A CD2 
459  N  NE1 . TRP A  54  ? 0.2146 0.2284 0.1743 0.0360  0.0078  -0.0224 54  TRP A NE1 
460  C  CE2 . TRP A  54  ? 0.2199 0.2323 0.1725 0.0347  0.0013  -0.0207 54  TRP A CE2 
461  C  CE3 . TRP A  54  ? 0.2372 0.2310 0.1585 0.0353  0.0004  -0.0233 54  TRP A CE3 
462  C  CZ2 . TRP A  54  ? 0.2363 0.2463 0.1855 0.0354  -0.0053 -0.0168 54  TRP A CZ2 
463  C  CZ3 . TRP A  54  ? 0.2527 0.2381 0.1611 0.0364  -0.0048 -0.0213 54  TRP A CZ3 
464  C  CH2 . TRP A  54  ? 0.2469 0.2423 0.1705 0.0358  -0.0092 -0.0173 54  TRP A CH2 
465  N  N   . PHE A  55  ? 0.2375 0.2214 0.1520 0.0368  0.0113  -0.0211 55  PHE A N   
466  C  CA  . PHE A  55  ? 0.2557 0.2321 0.1652 0.0425  0.0119  -0.0171 55  PHE A CA  
467  C  C   . PHE A  55  ? 0.2690 0.2265 0.1688 0.0418  0.0149  -0.0186 55  PHE A C   
468  O  O   . PHE A  55  ? 0.2835 0.2279 0.1749 0.0489  0.0189  -0.0186 55  PHE A O   
469  C  CB  . PHE A  55  ? 0.2655 0.2393 0.1678 0.0439  0.0086  -0.0121 55  PHE A CB  
470  C  CG  . PHE A  55  ? 0.2752 0.2467 0.1817 0.0516  0.0062  -0.0043 55  PHE A CG  
471  C  CD1 . PHE A  55  ? 0.2772 0.2639 0.2045 0.0559  -0.0004 0.0020  55  PHE A CD1 
472  C  CD2 . PHE A  55  ? 0.2936 0.2490 0.1911 0.0547  0.0114  -0.0010 55  PHE A CD2 
473  C  CE1 . PHE A  55  ? 0.2790 0.2692 0.2231 0.0654  -0.0007 0.0135  55  PHE A CE1 
474  C  CE2 . PHE A  55  ? 0.3101 0.2626 0.2156 0.0651  0.0114  0.0082  55  PHE A CE2 
475  C  CZ  . PHE A  55  ? 0.2971 0.2693 0.2283 0.0714  0.0060  0.0161  55  PHE A CZ  
476  N  N   . LYS A  56  ? 0.2719 0.2245 0.1736 0.0332  0.0139  -0.0190 56  LYS A N   
477  C  CA  . LYS A  56  ? 0.3049 0.2346 0.1990 0.0283  0.0117  -0.0199 56  LYS A CA  
478  C  C   . LYS A  56  ? 0.3057 0.2196 0.1844 0.0272  0.0043  -0.0275 56  LYS A C   
479  O  O   . LYS A  56  ? 0.3427 0.2243 0.1962 0.0299  0.0037  -0.0318 56  LYS A O   
480  C  CB  . LYS A  56  ? 0.3349 0.2678 0.2475 0.0165  0.0110  -0.0145 56  LYS A CB  
481  C  CG  . LYS A  56  ? 0.3969 0.3024 0.3059 0.0067  0.0029  -0.0151 56  LYS A CG  
482  C  CD  . LYS A  56  ? 0.4362 0.3397 0.3640 -0.0011 0.0093  -0.0040 56  LYS A CD  
483  C  CE  . LYS A  56  ? 0.5035 0.3725 0.4272 -0.0132 -0.0022 -0.0049 56  LYS A CE  
484  N  NZ  . LYS A  56  ? 0.5680 0.4274 0.4949 -0.0266 -0.0252 -0.0118 56  LYS A NZ  
485  N  N   . GLU A  57  ? 0.2831 0.2212 0.1975 0.0403  0.0161  0.0073  57  GLU A N   
486  C  CA  . GLU A  57  ? 0.2715 0.2196 0.2012 0.0338  0.0085  0.0059  57  GLU A CA  
487  C  C   . GLU A  57  ? 0.2596 0.2108 0.1802 0.0338  -0.0010 -0.0027 57  GLU A C   
488  O  O   . GLU A  57  ? 0.2712 0.2259 0.1973 0.0305  -0.0084 -0.0039 57  GLU A O   
489  C  CB  . GLU A  57  ? 0.2767 0.2323 0.2199 0.0318  0.0122  0.0082  57  GLU A CB  
490  C  CG  . GLU A  57  ? 0.2941 0.2508 0.2540 0.0310  0.0210  0.0188  57  GLU A CG  
491  C  CD  . GLU A  57  ? 0.3141 0.2790 0.2888 0.0294  0.0238  0.0211  57  GLU A CD  
492  O  OE1 . GLU A  57  ? 0.3509 0.3187 0.3418 0.0295  0.0318  0.0307  57  GLU A OE1 
493  O  OE2 . GLU A  57  ? 0.3367 0.3055 0.3083 0.0282  0.0185  0.0144  57  GLU A OE2 
494  N  N   . LEU A  58  ? 0.2540 0.2040 0.1618 0.0378  -0.0014 -0.0082 58  LEU A N   
495  C  CA  . LEU A  58  ? 0.2426 0.1990 0.1470 0.0378  -0.0093 -0.0145 58  LEU A CA  
496  C  C   . LEU A  58  ? 0.2480 0.2002 0.1413 0.0411  -0.0139 -0.0170 58  LEU A C   
497  O  O   . LEU A  58  ? 0.2393 0.1977 0.1329 0.0415  -0.0195 -0.0201 58  LEU A O   
498  C  CB  . LEU A  58  ? 0.2457 0.2032 0.1449 0.0395  -0.0101 -0.0186 58  LEU A CB  
499  C  CG  . LEU A  58  ? 0.2411 0.2012 0.1490 0.0371  -0.0064 -0.0171 58  LEU A CG  
500  C  CD1 . LEU A  58  ? 0.2466 0.2029 0.1462 0.0391  -0.0090 -0.0215 58  LEU A CD1 
501  C  CD2 . LEU A  58  ? 0.2205 0.1924 0.1435 0.0319  -0.0097 -0.0163 58  LEU A CD2 
502  N  N   . ASP A  59  ? 0.2554 0.1969 0.1378 0.0446  -0.0109 -0.0154 59  ASP A N   
503  C  CA  . ASP A  59  ? 0.2624 0.1982 0.1327 0.0486  -0.0152 -0.0176 59  ASP A CA  
504  C  C   . ASP A  59  ? 0.2613 0.1939 0.1362 0.0462  -0.0176 -0.0147 59  ASP A C   
505  O  O   . ASP A  59  ? 0.2734 0.1962 0.1456 0.0463  -0.0153 -0.0103 59  ASP A O   
506  C  CB  . ASP A  59  ? 0.2804 0.2044 0.1346 0.0540  -0.0118 -0.0173 59  ASP A CB  
507  C  CG  . ASP A  59  ? 0.2974 0.2155 0.1391 0.0585  -0.0168 -0.0197 59  ASP A CG  
508  O  OD1 . ASP A  59  ? 0.2818 0.2068 0.1263 0.0587  -0.0232 -0.0228 59  ASP A OD1 
509  O  OD2 . ASP A  59  ? 0.3136 0.2194 0.1414 0.0629  -0.0138 -0.0178 59  ASP A OD2 
510  N  N   A ILE A  60  ? 0.2522 0.1921 0.1334 0.0443  -0.0230 -0.0170 60  ILE A N   
511  N  N   B ILE A  60  ? 0.2503 0.1895 0.1309 0.0445  -0.0231 -0.0169 60  ILE A N   
512  C  CA  A ILE A  60  ? 0.2564 0.1918 0.1410 0.0419  -0.0281 -0.0154 60  ILE A CA  
513  C  CA  B ILE A  60  ? 0.2555 0.1890 0.1403 0.0415  -0.0270 -0.0143 60  ILE A CA  
514  C  C   A ILE A  60  ? 0.2714 0.1947 0.1432 0.0457  -0.0319 -0.0160 60  ILE A C   
515  C  C   B ILE A  60  ? 0.2712 0.1935 0.1427 0.0457  -0.0315 -0.0155 60  ILE A C   
516  O  O   A ILE A  60  ? 0.2865 0.1997 0.1602 0.0429  -0.0354 -0.0127 60  ILE A O   
517  O  O   B ILE A  60  ? 0.2877 0.1996 0.1605 0.0431  -0.0349 -0.0123 60  ILE A O   
518  C  CB  A ILE A  60  ? 0.2469 0.1909 0.1337 0.0423  -0.0327 -0.0189 60  ILE A CB  
519  C  CB  B ILE A  60  ? 0.2424 0.1833 0.1335 0.0397  -0.0316 -0.0163 60  ILE A CB  
520  C  CG1 A ILE A  60  ? 0.2348 0.1895 0.1349 0.0379  -0.0296 -0.0177 60  ILE A CG1 
521  C  CG1 B ILE A  60  ? 0.2408 0.1877 0.1227 0.0456  -0.0344 -0.0216 60  ILE A CG1 
522  C  CG2 A ILE A  60  ? 0.2543 0.1896 0.1382 0.0419  -0.0399 -0.0188 60  ILE A CG2 
523  C  CG2 B ILE A  60  ? 0.2374 0.1884 0.1423 0.0352  -0.0274 -0.0144 60  ILE A CG2 
524  C  CD1 A ILE A  60  ? 0.2303 0.1824 0.1432 0.0321  -0.0268 -0.0120 60  ILE A CD1 
525  C  CD1 B ILE A  60  ? 0.2307 0.1821 0.1148 0.0457  -0.0380 -0.0226 60  ILE A CD1 
526  N  N   . ASN A  61  ? 0.2746 0.1984 0.1342 0.0520  -0.0324 -0.0200 61  ASN A N   
527  C  CA  . ASN A  61  ? 0.2843 0.1964 0.1297 0.0572  -0.0361 -0.0211 61  ASN A CA  
528  C  C   . ASN A  61  ? 0.3106 0.2134 0.1479 0.0590  -0.0321 -0.0185 61  ASN A C   
529  O  O   . ASN A  61  ? 0.3286 0.2219 0.1535 0.0638  -0.0350 -0.0195 61  ASN A O   
530  C  CB  . ASN A  61  ? 0.2842 0.2022 0.1213 0.0644  -0.0401 -0.0264 61  ASN A CB  
531  C  CG  . ASN A  61  ? 0.2785 0.2069 0.1158 0.0674  -0.0383 -0.0286 61  ASN A CG  
532  O  OD1 . ASN A  61  ? 0.2681 0.2028 0.1133 0.0633  -0.0350 -0.0278 61  ASN A OD1 
533  N  ND2 . ASN A  61  ? 0.2713 0.2025 0.1015 0.0745  -0.0416 -0.0313 61  ASN A ND2 
534  N  N   A THR A  62  ? 0.3033 0.2080 0.1462 0.0563  -0.0252 -0.0151 62  THR A N   
535  N  N   B THR A  62  ? 0.3050 0.2094 0.1479 0.0562  -0.0251 -0.0149 62  THR A N   
536  C  CA  A THR A  62  ? 0.3259 0.2203 0.1591 0.0591  -0.0194 -0.0114 62  THR A CA  
537  C  CA  B THR A  62  ? 0.3251 0.2191 0.1582 0.0591  -0.0192 -0.0113 62  THR A CA  
538  C  C   A THR A  62  ? 0.3412 0.2305 0.1568 0.0666  -0.0234 -0.0161 62  THR A C   
539  C  C   B THR A  62  ? 0.3406 0.2296 0.1557 0.0667  -0.0226 -0.0158 62  THR A C   
540  O  O   A THR A  62  ? 0.3659 0.2425 0.1701 0.0699  -0.0233 -0.0138 62  THR A O   
541  O  O   B THR A  62  ? 0.3599 0.2359 0.1627 0.0703  -0.0209 -0.0131 62  THR A O   
542  C  CB  A THR A  62  ? 0.3388 0.2227 0.1774 0.0554  -0.0162 -0.0032 62  THR A CB  
543  C  CB  B THR A  62  ? 0.3363 0.2190 0.1735 0.0558  -0.0166 -0.0033 62  THR A CB  
544  O  OG1 A THR A  62  ? 0.3448 0.2226 0.1828 0.0542  -0.0246 -0.0043 62  THR A OG1 
545  O  OG1 B THR A  62  ? 0.3300 0.2183 0.1867 0.0483  -0.0171 0.0007  62  THR A OG1 
546  C  CG2 A THR A  62  ? 0.3289 0.2199 0.1880 0.0484  -0.0110 0.0029  62  THR A CG2 
547  C  CG2 B THR A  62  ? 0.3457 0.2207 0.1769 0.0584  -0.0065 0.0031  62  THR A CG2 
548  N  N   . ASP A  63  ? 0.3395 0.2389 0.1542 0.0692  -0.0272 -0.0219 63  ASP A N   
549  C  CA  . ASP A  63  ? 0.3492 0.2461 0.1501 0.0762  -0.0319 -0.0259 63  ASP A CA  
550  C  C   . ASP A  63  ? 0.3661 0.2601 0.1584 0.0788  -0.0312 -0.0275 63  ASP A C   
551  O  O   . ASP A  63  ? 0.3815 0.2732 0.1633 0.0842  -0.0371 -0.0309 63  ASP A O   
552  C  CB  . ASP A  63  ? 0.3357 0.2449 0.1419 0.0786  -0.0387 -0.0302 63  ASP A CB  
553  C  CG  . ASP A  63  ? 0.3217 0.2468 0.1415 0.0755  -0.0396 -0.0321 63  ASP A CG  
554  O  OD1 . ASP A  63  ? 0.3051 0.2311 0.1304 0.0707  -0.0356 -0.0308 63  ASP A OD1 
555  O  OD2 . ASP A  63  ? 0.3278 0.2648 0.1538 0.0780  -0.0437 -0.0340 63  ASP A OD2 
556  N  N   . GLY A  64  ? 0.3623 0.2550 0.1581 0.0755  -0.0247 -0.0250 64  GLY A N   
557  C  CA  . GLY A  64  ? 0.3570 0.2428 0.1410 0.0789  -0.0240 -0.0268 64  GLY A CA  
558  C  C   . GLY A  64  ? 0.3398 0.2354 0.1307 0.0770  -0.0302 -0.0317 64  GLY A C   
559  O  O   . GLY A  64  ? 0.3551 0.2409 0.1325 0.0805  -0.0325 -0.0342 64  GLY A O   
560  N  N   . ALA A  65  ? 0.3404 0.2529 0.1506 0.0718  -0.0329 -0.0325 65  ALA A N   
561  C  CA  . ALA A  65  ? 0.3302 0.2532 0.1507 0.0688  -0.0380 -0.0355 65  ALA A CA  
562  C  C   . ALA A  65  ? 0.3006 0.2376 0.1403 0.0627  -0.0349 -0.0336 65  ALA A C   
563  O  O   . ALA A  65  ? 0.3001 0.2398 0.1450 0.0613  -0.0319 -0.0313 65  ALA A O   
564  C  CB  . ALA A  65  ? 0.3394 0.2697 0.1616 0.0715  -0.0481 -0.0386 65  ALA A CB  
565  N  N   . VAL A  66  ? 0.2871 0.2307 0.1358 0.0591  -0.0369 -0.0349 66  VAL A N   
566  C  CA  . VAL A  66  ? 0.2658 0.2236 0.1327 0.0536  -0.0355 -0.0333 66  VAL A CA  
567  C  C   . VAL A  66  ? 0.2565 0.2290 0.1347 0.0533  -0.0426 -0.0344 66  VAL A C   
568  O  O   . VAL A  66  ? 0.2593 0.2331 0.1397 0.0526  -0.0490 -0.0361 66  VAL A O   
569  C  CB  . VAL A  66  ? 0.2634 0.2182 0.1335 0.0501  -0.0323 -0.0329 66  VAL A CB  
570  C  CG1 . VAL A  66  ? 0.2496 0.2184 0.1378 0.0445  -0.0319 -0.0313 66  VAL A CG1 
571  C  CG2 . VAL A  66  ? 0.2704 0.2124 0.1314 0.0517  -0.0236 -0.0301 66  VAL A CG2 
572  N  N   . ASN A  67  ? 0.2432 0.2260 0.1289 0.0540  -0.0415 -0.0327 67  ASN A N   
573  C  CA  . ASN A  67  ? 0.2347 0.2339 0.1334 0.0549  -0.0453 -0.0316 67  ASN A CA  
574  C  C   . ASN A  67  ? 0.2296 0.2402 0.1442 0.0493  -0.0432 -0.0291 67  ASN A C   
575  O  O   . ASN A  67  ? 0.2236 0.2281 0.1377 0.0451  -0.0401 -0.0292 67  ASN A O   
576  C  CB  . ASN A  67  ? 0.2384 0.2409 0.1335 0.0611  -0.0444 -0.0308 67  ASN A CB  
577  C  CG  . ASN A  67  ? 0.2343 0.2357 0.1281 0.0610  -0.0393 -0.0294 67  ASN A CG  
578  O  OD1 . ASN A  67  ? 0.2263 0.2300 0.1270 0.0560  -0.0365 -0.0281 67  ASN A OD1 
579  N  ND2 . ASN A  67  ? 0.2457 0.2414 0.1290 0.0670  -0.0393 -0.0300 67  ASN A ND2 
580  N  N   . PHE A  68  ? 0.2235 0.2505 0.1523 0.0500  -0.0439 -0.0259 68  PHE A N   
581  C  CA  . PHE A  68  ? 0.2208 0.2576 0.1645 0.0446  -0.0426 -0.0228 68  PHE A CA  
582  C  C   . PHE A  68  ? 0.2126 0.2472 0.1536 0.0436  -0.0361 -0.0218 68  PHE A C   
583  O  O   . PHE A  68  ? 0.2079 0.2420 0.1545 0.0382  -0.0346 -0.0209 68  PHE A O   
584  C  CB  . PHE A  68  ? 0.2138 0.2701 0.1760 0.0456  -0.0441 -0.0177 68  PHE A CB  
585  C  CG  . PHE A  68  ? 0.2071 0.2728 0.1856 0.0394  -0.0429 -0.0136 68  PHE A CG  
586  C  CD1 . PHE A  68  ? 0.2094 0.2679 0.1909 0.0326  -0.0481 -0.0155 68  PHE A CD1 
587  C  CD2 . PHE A  68  ? 0.2109 0.2893 0.1987 0.0409  -0.0365 -0.0079 68  PHE A CD2 
588  C  CE1 . PHE A  68  ? 0.2077 0.2719 0.2026 0.0265  -0.0478 -0.0121 68  PHE A CE1 
589  C  CE2 . PHE A  68  ? 0.2028 0.2886 0.2050 0.0350  -0.0352 -0.0036 68  PHE A CE2 
590  C  CZ  . PHE A  68  ? 0.1965 0.2754 0.2034 0.0272  -0.0414 -0.0057 68  PHE A CZ  
591  N  N   . GLN A  69  ? 0.2211 0.2529 0.1528 0.0489  -0.0336 -0.0219 69  GLN A N   
592  C  CA  . GLN A  69  ? 0.2412 0.2685 0.1689 0.0483  -0.0301 -0.0211 69  GLN A CA  
593  C  C   . GLN A  69  ? 0.2228 0.2374 0.1463 0.0433  -0.0297 -0.0229 69  GLN A C   
594  O  O   . GLN A  69  ? 0.2221 0.2359 0.1496 0.0397  -0.0279 -0.0214 69  GLN A O   
595  C  CB  . GLN A  69  ? 0.2639 0.2849 0.1784 0.0553  -0.0297 -0.0218 69  GLN A CB  
596  C  CG  . GLN A  69  ? 0.3362 0.3628 0.2460 0.0645  -0.0289 -0.0207 69  GLN A CG  
597  C  CD  . GLN A  69  ? 0.3381 0.3617 0.2414 0.0694  -0.0317 -0.0228 69  GLN A CD  
598  O  OE1 . GLN A  69  ? 0.2924 0.3030 0.1792 0.0757  -0.0333 -0.0253 69  GLN A OE1 
599  N  NE2 . GLN A  69  ? 0.3283 0.3620 0.2439 0.0668  -0.0337 -0.0219 69  GLN A NE2 
600  N  N   . GLU A  70  ? 0.2172 0.2218 0.1321 0.0442  -0.0308 -0.0251 70  GLU A N   
601  C  CA  . GLU A  70  ? 0.2183 0.2121 0.1303 0.0409  -0.0285 -0.0251 70  GLU A CA  
602  C  C   . GLU A  70  ? 0.2109 0.2070 0.1307 0.0365  -0.0271 -0.0247 70  GLU A C   
603  O  O   . GLU A  70  ? 0.2219 0.2145 0.1456 0.0333  -0.0237 -0.0229 70  GLU A O   
604  C  CB  . GLU A  70  ? 0.2288 0.2114 0.1285 0.0442  -0.0288 -0.0266 70  GLU A CB  
605  C  CG  . GLU A  70  ? 0.2361 0.2120 0.1273 0.0477  -0.0298 -0.0265 70  GLU A CG  
606  C  CD  . GLU A  70  ? 0.2457 0.2116 0.1243 0.0518  -0.0307 -0.0277 70  GLU A CD  
607  O  OE1 . GLU A  70  ? 0.2592 0.2264 0.1340 0.0544  -0.0330 -0.0298 70  GLU A OE1 
608  O  OE2 . GLU A  70  ? 0.2578 0.2134 0.1298 0.0527  -0.0302 -0.0263 70  GLU A OE2 
609  N  N   . PHE A  71  ? 0.1985 0.1993 0.1210 0.0365  -0.0305 -0.0260 71  PHE A N   
610  C  CA  . PHE A  71  ? 0.2050 0.2060 0.1339 0.0324  -0.0312 -0.0260 71  PHE A CA  
611  C  C   . PHE A  71  ? 0.2011 0.2105 0.1422 0.0284  -0.0286 -0.0230 71  PHE A C   
612  O  O   . PHE A  71  ? 0.2015 0.2072 0.1459 0.0253  -0.0268 -0.0225 71  PHE A O   
613  C  CB  . PHE A  71  ? 0.2114 0.2166 0.1437 0.0323  -0.0381 -0.0274 71  PHE A CB  
614  C  CG  . PHE A  71  ? 0.2122 0.2174 0.1523 0.0276  -0.0410 -0.0272 71  PHE A CG  
615  C  CD1 . PHE A  71  ? 0.2306 0.2203 0.1603 0.0276  -0.0409 -0.0299 71  PHE A CD1 
616  C  CD2 . PHE A  71  ? 0.2099 0.2293 0.1669 0.0239  -0.0438 -0.0239 71  PHE A CD2 
617  C  CE1 . PHE A  71  ? 0.2359 0.2227 0.1707 0.0238  -0.0450 -0.0302 71  PHE A CE1 
618  C  CE2 . PHE A  71  ? 0.2165 0.2346 0.1815 0.0189  -0.0478 -0.0233 71  PHE A CE2 
619  C  CZ  . PHE A  71  ? 0.2254 0.2265 0.1787 0.0187  -0.0489 -0.0270 71  PHE A CZ  
620  N  N   . LEU A  72  ? 0.2042 0.2237 0.1505 0.0294  -0.0285 -0.0209 72  LEU A N   
621  C  CA  . LEU A  72  ? 0.2004 0.2264 0.1557 0.0265  -0.0263 -0.0177 72  LEU A CA  
622  C  C   . LEU A  72  ? 0.2031 0.2212 0.1563 0.0248  -0.0236 -0.0172 72  LEU A C   
623  O  O   . LEU A  72  ? 0.1910 0.2113 0.1515 0.0216  -0.0224 -0.0150 72  LEU A O   
624  C  CB  . LEU A  72  ? 0.1969 0.2334 0.1548 0.0300  -0.0256 -0.0150 72  LEU A CB  
625  C  CG  . LEU A  72  ? 0.2056 0.2546 0.1736 0.0305  -0.0271 -0.0126 72  LEU A CG  
626  C  CD1 . LEU A  72  ? 0.2108 0.2701 0.1797 0.0364  -0.0238 -0.0086 72  LEU A CD1 
627  C  CD2 . LEU A  72  ? 0.2085 0.2621 0.1900 0.0241  -0.0285 -0.0103 72  LEU A CD2 
628  N  N   . ILE A  73  ? 0.2048 0.2138 0.1500 0.0266  -0.0231 -0.0184 73  ILE A N   
629  C  CA  . ILE A  73  ? 0.2050 0.2075 0.1530 0.0242  -0.0208 -0.0163 73  ILE A CA  
630  C  C   . ILE A  73  ? 0.1974 0.1979 0.1506 0.0218  -0.0174 -0.0155 73  ILE A C   
631  O  O   . ILE A  73  ? 0.1990 0.2007 0.1606 0.0192  -0.0158 -0.0128 73  ILE A O   
632  C  CB  . ILE A  73  ? 0.2099 0.2030 0.1511 0.0259  -0.0204 -0.0160 73  ILE A CB  
633  C  CG1 . ILE A  73  ? 0.2210 0.2128 0.1552 0.0287  -0.0247 -0.0170 73  ILE A CG1 
634  C  CG2 . ILE A  73  ? 0.2023 0.1915 0.1519 0.0228  -0.0177 -0.0119 73  ILE A CG2 
635  C  CD1 . ILE A  73  ? 0.2323 0.2142 0.1582 0.0308  -0.0252 -0.0173 73  ILE A CD1 
636  N  N   . LEU A  74  ? 0.2060 0.2014 0.1523 0.0237  -0.0169 -0.0179 74  LEU A N   
637  C  CA  . LEU A  74  ? 0.2030 0.1926 0.1493 0.0234  -0.0142 -0.0180 74  LEU A CA  
638  C  C   . LEU A  74  ? 0.1944 0.1907 0.1503 0.0197  -0.0165 -0.0175 74  LEU A C   
639  O  O   . LEU A  74  ? 0.1940 0.1881 0.1547 0.0184  -0.0137 -0.0159 74  LEU A O   
640  C  CB  . LEU A  74  ? 0.2203 0.2002 0.1527 0.0271  -0.0158 -0.0218 74  LEU A CB  
641  C  CG  . LEU A  74  ? 0.2349 0.2046 0.1612 0.0285  -0.0153 -0.0235 74  LEU A CG  
642  C  CD1 . LEU A  74  ? 0.2533 0.2162 0.1789 0.0311  -0.0061 -0.0199 74  LEU A CD1 
643  C  CD2 . LEU A  74  ? 0.2577 0.2157 0.1673 0.0326  -0.0201 -0.0280 74  LEU A CD2 
644  N  N   . VAL A  75  ? 0.1893 0.1945 0.1492 0.0182  -0.0210 -0.0180 75  VAL A N   
645  C  CA  . VAL A  75  ? 0.1796 0.1917 0.1498 0.0145  -0.0229 -0.0162 75  VAL A CA  
646  C  C   . VAL A  75  ? 0.1727 0.1883 0.1498 0.0127  -0.0199 -0.0128 75  VAL A C   
647  O  O   . VAL A  75  ? 0.1725 0.1870 0.1554 0.0103  -0.0191 -0.0112 75  VAL A O   
648  C  CB  . VAL A  75  ? 0.1800 0.2033 0.1559 0.0139  -0.0268 -0.0151 75  VAL A CB  
649  C  CG1 . VAL A  75  ? 0.1725 0.2035 0.1612 0.0096  -0.0276 -0.0113 75  VAL A CG1 
650  C  CG2 . VAL A  75  ? 0.1890 0.2084 0.1605 0.0149  -0.0321 -0.0183 75  VAL A CG2 
651  N  N   . ILE A  76  ? 0.1764 0.1952 0.1521 0.0143  -0.0194 -0.0116 76  ILE A N   
652  C  CA  . ILE A  76  ? 0.1711 0.1909 0.1515 0.0131  -0.0188 -0.0086 76  ILE A CA  
653  C  C   . ILE A  76  ? 0.1732 0.1870 0.1581 0.0118  -0.0161 -0.0073 76  ILE A C   
654  O  O   . ILE A  76  ? 0.1800 0.1951 0.1725 0.0097  -0.0156 -0.0049 76  ILE A O   
655  C  CB  . ILE A  76  ? 0.1691 0.1879 0.1432 0.0157  -0.0209 -0.0085 76  ILE A CB  
656  C  CG1 . ILE A  76  ? 0.1728 0.1985 0.1427 0.0187  -0.0218 -0.0083 76  ILE A CG1 
657  C  CG2 . ILE A  76  ? 0.1732 0.1888 0.1514 0.0141  -0.0228 -0.0059 76  ILE A CG2 
658  C  CD1 . ILE A  76  ? 0.1841 0.2055 0.1423 0.0236  -0.0241 -0.0096 76  ILE A CD1 
659  N  N   . LYS A  77  ? 0.1803 0.1878 0.1614 0.0136  -0.0137 -0.0080 77  LYS A N   
660  C  CA  . LYS A  77  ? 0.1854 0.1885 0.1728 0.0137  -0.0091 -0.0050 77  LYS A CA  
661  C  C   . LYS A  77  ? 0.1894 0.1890 0.1769 0.0142  -0.0065 -0.0057 77  LYS A C   
662  O  O   . LYS A  77  ? 0.1856 0.1849 0.1810 0.0139  -0.0037 -0.0026 77  LYS A O   
663  C  CB  . LYS A  77  ? 0.2011 0.1983 0.1849 0.0163  -0.0052 -0.0038 77  LYS A CB  
664  C  CG  . LYS A  77  ? 0.2100 0.2083 0.1964 0.0149  -0.0089 -0.0019 77  LYS A CG  
665  C  CD  . LYS A  77  ? 0.2246 0.2173 0.2104 0.0166  -0.0049 0.0010  77  LYS A CD  
666  C  CE  . LYS A  77  ? 0.2369 0.2293 0.2293 0.0137  -0.0106 0.0039  77  LYS A CE  
667  N  NZ  . LYS A  77  ? 0.2585 0.2464 0.2555 0.0141  -0.0062 0.0091  77  LYS A NZ  
668  N  N   . MET A  78  ? 0.1913 0.1868 0.1694 0.0153  -0.0082 -0.0098 78  MET A N   
669  C  CA  . MET A  78  ? 0.1959 0.1851 0.1725 0.0154  -0.0084 -0.0111 78  MET A CA  
670  C  C   . MET A  78  ? 0.1896 0.1854 0.1770 0.0112  -0.0108 -0.0088 78  MET A C   
671  O  O   . MET A  78  ? 0.1976 0.1886 0.1877 0.0114  -0.0091 -0.0076 78  MET A O   
672  C  CB  . MET A  78  ? 0.2058 0.1889 0.1717 0.0161  -0.0134 -0.0158 78  MET A CB  
673  C  CG  . MET A  78  ? 0.2237 0.1947 0.1746 0.0218  -0.0105 -0.0182 78  MET A CG  
674  S  SD  . MET A  78  ? 0.2718 0.2325 0.2083 0.0229  -0.0194 -0.0242 78  MET A SD  
675  C  CE  . MET A  78  ? 0.2504 0.2014 0.1873 0.0209  -0.0240 -0.0256 78  MET A CE  
676  N  N   . GLY A  79  ? 0.1811 0.1870 0.1733 0.0082  -0.0144 -0.0078 79  GLY A N   
677  C  CA  . GLY A  79  ? 0.1740 0.1865 0.1751 0.0050  -0.0159 -0.0045 79  GLY A CA  
678  C  C   . GLY A  79  ? 0.1714 0.1840 0.1788 0.0050  -0.0136 -0.0010 79  GLY A C   
679  O  O   . GLY A  79  ? 0.1769 0.1877 0.1897 0.0039  -0.0132 0.0010  79  GLY A O   
680  N  N   . VAL A  80  ? 0.1638 0.1780 0.1716 0.0063  -0.0133 0.0000  80  VAL A N   
681  C  CA  . VAL A  80  ? 0.1628 0.1771 0.1793 0.0060  -0.0129 0.0038  80  VAL A CA  
682  C  C   . VAL A  80  ? 0.1631 0.1727 0.1851 0.0077  -0.0080 0.0055  80  VAL A C   
683  O  O   . VAL A  80  ? 0.1755 0.1858 0.2060 0.0072  -0.0079 0.0088  80  VAL A O   
684  C  CB  . VAL A  80  ? 0.1606 0.1753 0.1776 0.0064  -0.0151 0.0048  80  VAL A CB  
685  C  CG1 . VAL A  80  ? 0.1652 0.1802 0.1950 0.0055  -0.0161 0.0098  80  VAL A CG1 
686  C  CG2 . VAL A  80  ? 0.1615 0.1787 0.1708 0.0063  -0.0203 0.0036  80  VAL A CG2 
687  N  N   . ALA A  81  ? 0.1717 0.1753 0.1873 0.0108  -0.0036 0.0035  81  ALA A N   
688  C  CA  . ALA A  81  ? 0.1876 0.1850 0.2052 0.0148  0.0028  0.0055  81  ALA A CA  
689  C  C   . ALA A  81  ? 0.1984 0.1900 0.2129 0.0149  0.0019  0.0038  81  ALA A C   
690  O  O   . ALA A  81  ? 0.2202 0.2095 0.2410 0.0172  0.0052  0.0070  81  ALA A O   
691  C  CB  . ALA A  81  ? 0.1932 0.1829 0.2000 0.0197  0.0082  0.0038  81  ALA A CB  
692  N  N   . ALA A  82  ? 0.2020 0.1907 0.2080 0.0127  -0.0029 -0.0005 82  ALA A N   
693  C  CA  . ALA A  82  ? 0.2058 0.1874 0.2096 0.0116  -0.0056 -0.0018 82  ALA A CA  
694  C  C   . ALA A  82  ? 0.2053 0.1937 0.2210 0.0080  -0.0075 0.0023  82  ALA A C   
695  O  O   . ALA A  82  ? 0.2170 0.1986 0.2339 0.0086  -0.0074 0.0033  82  ALA A O   
696  C  CB  . ALA A  82  ? 0.2054 0.1845 0.2019 0.0087  -0.0119 -0.0060 82  ALA A CB  
697  N  N   . HIS A  83  ? 0.1996 0.1991 0.2214 0.0049  -0.0097 0.0047  83  HIS A N   
698  C  CA  . HIS A  83  ? 0.1946 0.1990 0.2246 0.0027  -0.0116 0.0089  83  HIS A CA  
699  C  C   . HIS A  83  ? 0.2123 0.2155 0.2504 0.0054  -0.0089 0.0123  83  HIS A C   
700  O  O   . HIS A  83  ? 0.1994 0.2002 0.2422 0.0053  -0.0092 0.0149  83  HIS A O   
701  C  CB  . HIS A  83  ? 0.1884 0.2018 0.2185 0.0007  -0.0147 0.0104  83  HIS A CB  
702  C  CG  . HIS A  83  ? 0.1858 0.2018 0.2211 0.0000  -0.0169 0.0148  83  HIS A CG  
703  N  ND1 . HIS A  83  ? 0.1922 0.2090 0.2319 0.0013  -0.0187 0.0169  83  HIS A ND1 
704  C  CD2 . HIS A  83  ? 0.1933 0.2096 0.2301 -0.0017 -0.0181 0.0180  83  HIS A CD2 
705  C  CE1 . HIS A  83  ? 0.1925 0.2096 0.2343 0.0008  -0.0218 0.0206  83  HIS A CE1 
706  N  NE2 . HIS A  83  ? 0.1884 0.2051 0.2280 -0.0008 -0.0205 0.0214  83  HIS A NE2 
707  N  N   . LYS A  84  ? 0.2228 0.1608 0.2617 0.0238  0.0035  0.0278  84  LYS A N   
708  C  CA  . LYS A  84  ? 0.2469 0.1980 0.3676 -0.0005 0.0143  0.0608  84  LYS A CA  
709  C  C   . LYS A  84  ? 0.2404 0.2194 0.3639 0.0142  0.0630  0.0751  84  LYS A C   
710  O  O   . LYS A  84  ? 0.2412 0.2524 0.4109 0.0157  0.0703  0.0857  84  LYS A O   
711  C  CB  . LYS A  84  ? 0.3148 0.2255 0.4723 -0.0235 0.0087  0.0942  84  LYS A CB  
712  C  CG  . LYS A  84  ? 0.3542 0.3186 0.6392 -0.0561 0.0280  0.1453  84  LYS A CG  
713  C  CD  . LYS A  84  ? 0.4539 0.3738 0.7898 -0.0985 0.0238  0.1930  84  LYS A CD  
714  C  CE  . LYS A  84  ? 0.5293 0.4777 0.8799 -0.0885 0.1129  0.2589  84  LYS A CE  
715  N  NZ  . LYS A  84  ? 0.5064 0.5371 0.8489 -0.0352 0.1831  0.2687  84  LYS A NZ  
716  N  N   . LYS A  85  ? 0.2763 0.2268 0.3289 0.0385  0.0870  0.0702  85  LYS A N   
717  C  CA  . LYS A  85  ? 0.3190 0.2549 0.3265 0.0711  0.1206  0.0730  85  LYS A CA  
718  C  C   . LYS A  85  ? 0.2992 0.2254 0.2899 0.0650  0.0994  0.0455  85  LYS A C   
719  O  O   . LYS A  85  ? 0.3516 0.2524 0.3172 0.0926  0.1178  0.0509  85  LYS A O   
720  C  CB  . LYS A  85  ? 0.4140 0.2942 0.3144 0.1077  0.1265  0.0591  85  LYS A CB  
721  C  CG  . LYS A  85  ? 0.5013 0.3580 0.3772 0.1240  0.1549  0.0941  85  LYS A CG  
722  C  CD  . LYS A  85  ? 0.5588 0.4492 0.4961 0.1305  0.2190  0.1587  85  LYS A CD  
723  C  CE  . LYS A  85  ? 0.6752 0.5200 0.5437 0.1638  0.2701  0.2069  85  LYS A CE  
724  N  NZ  . LYS A  85  ? 0.7373 0.6502 0.6874 0.1728  0.3514  0.2865  85  LYS A NZ  
725  N  N   . SER A  86  ? 0.2620 0.2046 0.2616 0.0347  0.0659  0.0233  86  SER A N   
726  C  CA  . SER A  86  ? 0.2717 0.1983 0.2611 0.0151  0.0519  0.0132  86  SER A CA  
727  C  C   . SER A  86  ? 0.2637 0.1852 0.2778 0.0219  0.0603  0.0323  86  SER A C   
728  O  O   . SER A  86  ? 0.3051 0.1722 0.2818 0.0210  0.0563  0.0318  86  SER A O   
729  C  CB  . SER A  86  ? 0.2391 0.2171 0.2504 -0.0149 0.0329  0.0048  86  SER A CB  
730  O  OG  . SER A  86  ? 0.2084 0.2203 0.2427 -0.0112 0.0333  0.0156  86  SER A OG  
731  N  N   . HIS A  87  ? 0.2233 0.1899 0.2981 0.0291  0.0620  0.0491  87  HIS A N   
732  C  CA  . HIS A  87  ? 0.2380 0.2206 0.3528 0.0437  0.0556  0.0647  87  HIS A CA  
733  C  C   . HIS A  87  ? 0.2653 0.2856 0.4330 0.0780  0.0851  0.0911  87  HIS A C   
734  O  O   . HIS A  87  ? 0.2555 0.3208 0.4853 0.0966  0.0750  0.1068  87  HIS A O   
735  C  CB  . HIS A  87  ? 0.2049 0.2160 0.3585 0.0293  0.0166  0.0618  87  HIS A CB  
736  C  CG  . HIS A  87  ? 0.2201 0.2082 0.3068 0.0229  0.0033  0.0459  87  HIS A CG  
737  N  ND1 . HIS A  87  ? 0.2511 0.2080 0.2855 0.0250  0.0134  0.0530  87  HIS A ND1 
738  C  CD2 . HIS A  87  ? 0.2190 0.2144 0.2787 0.0226  -0.0120 0.0310  87  HIS A CD2 
739  C  CE1 . HIS A  87  ? 0.2741 0.2448 0.2694 0.0212  0.0159  0.0519  87  HIS A CE1 
740  N  NE2 . HIS A  87  ? 0.2581 0.2571 0.2647 0.0285  0.0006  0.0342  87  HIS A NE2 
741  N  N   . GLU A  88  ? 0.3153 0.3252 0.4527 0.0992  0.1241  0.0992  88  GLU A N   
742  C  CA  . GLU A  88  ? 0.4037 0.4656 0.5804 0.1494  0.1747  0.1366  88  GLU A CA  
743  C  C   . GLU A  88  ? 0.5381 0.5164 0.5898 0.2181  0.1957  0.1210  88  GLU A C   
744  O  O   . GLU A  88  ? 0.6229 0.4941 0.5582 0.2126  0.1736  0.0842  88  GLU A O   
745  C  CB  . GLU A  88  ? 0.4234 0.5110 0.6176 0.1440  0.2137  0.1661  88  GLU A CB  
746  C  CG  . GLU A  88  ? 0.3941 0.5295 0.7002 0.0772  0.1831  0.1836  88  GLU A CG  
747  C  CD  . GLU A  88  ? 0.4503 0.5872 0.7698 0.0648  0.2215  0.2250  88  GLU A CD  
748  O  OE1 . GLU A  88  ? 0.4677 0.6196 0.8778 0.0068  0.1888  0.2438  88  GLU A OE1 
749  O  OE2 . GLU A  88  ? 0.5492 0.6545 0.7755 0.1165  0.2785  0.2404  88  GLU A OE2 
750  N  N   . GLU A  89  ? 0.6469 0.6676 0.7189 0.2870  0.2287  0.1460  89  GLU A N   
751  C  CA  . GLU A  89  ? 0.6071 0.7876 0.8547 0.2900  0.2445  0.1932  89  GLU A CA  
752  C  C   . GLU A  89  ? 0.7142 0.9092 0.9458 0.3774  0.2535  0.1986  89  GLU A C   
753  O  O   . GLU A  89  ? 0.8845 0.9588 0.9542 0.4530  0.2683  0.1759  89  GLU A O   
754  C  CB  . GLU A  89  ? 0.6064 0.9015 0.9522 0.2941  0.3118  0.2529  89  GLU A CB  
755  N  N   . LYS B  4   ? 0.9812 0.4262 0.5367 0.1044  0.0043  -0.1297 4   LYS C N   
756  C  CA  . LYS B  4   ? 0.9355 0.4575 0.5137 0.1457  0.0421  -0.1212 4   LYS C CA  
757  C  C   . LYS B  4   ? 0.7376 0.3842 0.4217 0.1153  0.0362  -0.0968 4   LYS C C   
758  O  O   . LYS B  4   ? 0.7455 0.4355 0.4344 0.1073  0.0400  -0.0942 4   LYS C O   
759  C  CB  . LYS B  4   ? 0.9918 0.5206 0.5796 0.2128  0.0857  -0.1105 4   LYS C CB  
760  C  CG  . LYS B  4   ? 1.0765 0.6295 0.6343 0.2640  0.1346  -0.1112 4   LYS C CG  
761  C  CD  . LYS B  4   ? 1.0288 0.6754 0.6271 0.2396  0.1461  -0.0967 4   LYS C CD  
762  C  CE  . LYS B  4   ? 0.9299 0.7111 0.6629 0.2166  0.1481  -0.0642 4   LYS C CE  
763  N  NZ  . LYS B  4   ? 0.9301 0.7709 0.7406 0.2499  0.1616  -0.0458 4   LYS C NZ  
764  N  N   . MET B  5   ? 0.6309 0.3173 0.3816 0.1003  0.0258  -0.0796 5   MET C N   
765  C  CA  . MET B  5   ? 0.4915 0.2754 0.3220 0.0766  0.0202  -0.0617 5   MET C CA  
766  C  C   . MET B  5   ? 0.4368 0.2372 0.2679 0.0396  -0.0021 -0.0672 5   MET C C   
767  O  O   . MET B  5   ? 0.4707 0.2343 0.2767 0.0130  -0.0264 -0.0773 5   MET C O   
768  C  CB  . MET B  5   ? 0.4546 0.2599 0.3280 0.0686  0.0098  -0.0453 5   MET C CB  
769  C  CG  . MET B  5   ? 0.4737 0.2917 0.3664 0.1116  0.0241  -0.0320 5   MET C CG  
770  S  SD  . MET B  5   ? 0.5042 0.3154 0.4093 0.1054  0.0043  -0.0117 5   MET C SD  
771  C  CE  . MET B  5   ? 0.3346 0.2406 0.2960 0.0730  -0.0075 -0.0057 5   MET C CE  
772  N  N   . SER B  6   ? 0.3648 0.2225 0.2277 0.0380  0.0049  -0.0582 6   SER C N   
773  C  CA  . SER B  6   ? 0.3485 0.2265 0.2153 0.0177  -0.0143 -0.0589 6   SER C CA  
774  C  C   . SER B  6   ? 0.3010 0.2143 0.2128 -0.0028 -0.0286 -0.0523 6   SER C C   
775  O  O   . SER B  6   ? 0.2791 0.2006 0.2145 -0.0042 -0.0228 -0.0446 6   SER C O   
776  C  CB  . SER B  6   ? 0.3247 0.2286 0.1973 0.0257  -0.0001 -0.0486 6   SER C CB  
777  O  OG  . SER B  6   ? 0.2747 0.2154 0.1969 0.0200  0.0066  -0.0377 6   SER C OG  
778  N  N   . GLN B  7   ? 0.2957 0.2365 0.2177 -0.0127 -0.0453 -0.0520 7   GLN C N   
779  C  CA  . GLN B  7   ? 0.2578 0.2484 0.2271 -0.0232 -0.0476 -0.0423 7   GLN C CA  
780  C  C   . GLN B  7   ? 0.2193 0.2199 0.1996 -0.0099 -0.0299 -0.0358 7   GLN C C   
781  O  O   . GLN B  7   ? 0.2132 0.2242 0.2056 -0.0149 -0.0234 -0.0295 7   GLN C O   
782  C  CB  . GLN B  7   ? 0.2696 0.3048 0.2572 -0.0202 -0.0644 -0.0397 7   GLN C CB  
783  C  CG  . GLN B  7   ? 0.2446 0.3451 0.2836 -0.0181 -0.0577 -0.0278 7   GLN C CG  
784  C  CD  . GLN B  7   ? 0.2697 0.4299 0.3375 -0.0025 -0.0762 -0.0221 7   GLN C CD  
785  O  OE1 . GLN B  7   ? 0.3148 0.4582 0.3537 0.0019  -0.1015 -0.0274 7   GLN C OE1 
786  N  NE2 . GLN B  7   ? 0.2474 0.4805 0.3672 0.0133  -0.0625 -0.0090 7   GLN C NE2 
787  N  N   . LEU B  8   ? 0.2167 0.2055 0.1831 0.0030  -0.0243 -0.0365 8   LEU C N   
788  C  CA  . LEU B  8   ? 0.2140 0.1992 0.1828 0.0051  -0.0172 -0.0345 8   LEU C CA  
789  C  C   . LEU B  8   ? 0.2060 0.1947 0.1863 -0.0009 -0.0161 -0.0320 8   LEU C C   
790  O  O   . LEU B  8   ? 0.2018 0.1943 0.1804 -0.0027 -0.0204 -0.0311 8   LEU C O   
791  C  CB  . LEU B  8   ? 0.2408 0.2008 0.1913 0.0078  -0.0129 -0.0322 8   LEU C CB  
792  C  CG  . LEU B  8   ? 0.2612 0.2002 0.2059 -0.0019 -0.0138 -0.0329 8   LEU C CG  
793  C  CD1 . LEU B  8   ? 0.2766 0.2051 0.2026 0.0107  -0.0179 -0.0411 8   LEU C CD1 
794  C  CD2 . LEU B  8   ? 0.2929 0.1896 0.2140 -0.0093 -0.0081 -0.0256 8   LEU C CD2 
795  N  N   . GLU B  9   ? 0.2057 0.1908 0.1901 0.0031  -0.0106 -0.0304 9   GLU C N   
796  C  CA  . GLU B  9   ? 0.2111 0.2071 0.2122 0.0102  -0.0110 -0.0239 9   GLU C CA  
797  C  C   . GLU B  9   ? 0.2130 0.1925 0.2010 0.0093  -0.0182 -0.0200 9   GLU C C   
798  O  O   . GLU B  9   ? 0.2108 0.1992 0.2013 0.0143  -0.0263 -0.0116 9   GLU C O   
799  C  CB  . GLU B  9   ? 0.2328 0.2235 0.2337 0.0288  0.0040  -0.0228 9   GLU C CB  
800  C  CG  . GLU B  9   ? 0.2464 0.2638 0.2638 0.0291  0.0214  -0.0176 9   GLU C CG  
801  C  CD  . GLU B  9   ? 0.2946 0.3042 0.2978 0.0587  0.0468  -0.0170 9   GLU C CD  
802  O  OE1 . GLU B  9   ? 0.3540 0.3079 0.2977 0.0692  0.0519  -0.0299 9   GLU C OE1 
803  O  OE2 . GLU B  9   ? 0.3201 0.3805 0.3698 0.0758  0.0594  -0.0043 9   GLU C OE2 
804  N  N   . ARG B  10  ? 0.2293 0.1864 0.2022 -0.0010 -0.0178 -0.0230 10  ARG C N   
805  C  CA  . ARG B  10  ? 0.2591 0.1965 0.2209 -0.0124 -0.0188 -0.0129 10  ARG C CA  
806  C  C   . ARG B  10  ? 0.2262 0.1945 0.1901 -0.0160 -0.0146 -0.0049 10  ARG C C   
807  O  O   . ARG B  10  ? 0.2623 0.2186 0.2054 -0.0151 -0.0118 0.0090  10  ARG C O   
808  C  CB  . ARG B  10  ? 0.3098 0.2259 0.2667 -0.0368 -0.0236 -0.0168 10  ARG C CB  
809  C  CG  . ARG B  10  ? 0.4091 0.2584 0.3295 -0.0309 -0.0287 -0.0282 10  ARG C CG  
810  C  CD  . ARG B  10  ? 0.5170 0.3239 0.4200 -0.0685 -0.0440 -0.0326 10  ARG C CD  
811  N  NE  . ARG B  10  ? 0.5427 0.4175 0.4859 -0.0934 -0.0562 -0.0337 10  ARG C NE  
812  C  CZ  . ARG B  10  ? 0.5832 0.4656 0.5172 -0.0966 -0.0758 -0.0494 10  ARG C CZ  
813  N  NH1 . ARG B  10  ? 0.7024 0.5192 0.5754 -0.0791 -0.0807 -0.0685 10  ARG C NH1 
814  N  NH2 . ARG B  10  ? 0.5681 0.5274 0.5498 -0.1109 -0.0893 -0.0441 10  ARG C NH2 
815  N  N   . ASN B  11  ? 0.2178 0.2093 0.1868 -0.0016 -0.0010 -0.0255 11  ASN C N   
816  C  CA  . ASN B  11  ? 0.2021 0.1982 0.1820 -0.0040 -0.0030 -0.0234 11  ASN C CA  
817  C  C   . ASN B  11  ? 0.1922 0.1880 0.1779 -0.0042 0.0011  -0.0182 11  ASN C C   
818  O  O   . ASN B  11  ? 0.1760 0.1721 0.1690 -0.0065 0.0010  -0.0182 11  ASN C O   
819  C  CB  . ASN B  11  ? 0.2069 0.2060 0.1853 -0.0022 -0.0079 -0.0219 11  ASN C CB  
820  C  CG  . ASN B  11  ? 0.2178 0.2191 0.1929 -0.0019 -0.0140 -0.0271 11  ASN C CG  
821  O  OD1 . ASN B  11  ? 0.2448 0.2475 0.2237 -0.0051 -0.0154 -0.0324 11  ASN C OD1 
822  N  ND2 . ASN B  11  ? 0.2067 0.2076 0.1751 0.0013  -0.0184 -0.0254 11  ASN C ND2 
823  N  N   . ILE B  12  ? 0.1912 0.1869 0.1735 -0.0021 0.0046  -0.0138 12  ILE C N   
824  C  CA  . ILE B  12  ? 0.1980 0.1951 0.1880 -0.0029 0.0077  -0.0090 12  ILE C CA  
825  C  C   . ILE B  12  ? 0.1906 0.1859 0.1851 -0.0028 0.0097  -0.0114 12  ILE C C   
826  O  O   . ILE B  12  ? 0.1900 0.1849 0.1916 -0.0045 0.0089  -0.0095 12  ILE C O   
827  C  CB  . ILE B  12  ? 0.2094 0.2091 0.1969 -0.0018 0.0117  -0.0035 12  ILE C CB  
828  C  CG1 . ILE B  12  ? 0.2269 0.2247 0.2104 -0.0030 0.0079  0.0004  12  ILE C CG1 
829  C  CG2 . ILE B  12  ? 0.1960 0.1998 0.1941 -0.0027 0.0150  0.0006  12  ILE C CG2 
830  C  CD1 . ILE B  12  ? 0.2531 0.2514 0.2287 -0.0027 0.0115  0.0058  12  ILE C CD1 
831  N  N   . GLU B  13  ? 0.2029 0.1951 0.1916 -0.0007 0.0114  -0.0158 13  GLU C N   
832  C  CA  . GLU B  13  ? 0.2161 0.2033 0.2073 0.0001  0.0124  -0.0181 13  GLU C CA  
833  C  C   . GLU B  13  ? 0.1985 0.1817 0.1929 -0.0045 0.0088  -0.0195 13  GLU C C   
834  O  O   . GLU B  13  ? 0.1985 0.1781 0.1968 -0.0050 0.0087  -0.0180 13  GLU C O   
835  C  CB  . GLU B  13  ? 0.2406 0.2223 0.2225 0.0035  0.0140  -0.0236 13  GLU C CB  
836  C  CG  . GLU B  13  ? 0.2694 0.2429 0.2518 0.0056  0.0144  -0.0264 13  GLU C CG  
837  C  CD  . GLU B  13  ? 0.3112 0.2759 0.2823 0.0090  0.0147  -0.0331 13  GLU C CD  
838  O  OE1 . GLU B  13  ? 0.3372 0.2975 0.3080 0.0145  0.0174  -0.0346 13  GLU C OE1 
839  O  OE2 . GLU B  13  ? 0.3798 0.3413 0.3423 0.0066  0.0115  -0.0373 13  GLU C OE2 
840  N  N   . THR B  14  ? 0.2002 0.1848 0.1930 -0.0076 0.0059  -0.0221 14  THR C N   
841  C  CA  . THR B  14  ? 0.2029 0.1865 0.1994 -0.0124 0.0041  -0.0230 14  THR C CA  
842  C  C   . THR B  14  ? 0.1943 0.1798 0.1958 -0.0130 0.0043  -0.0186 14  THR C C   
843  O  O   . THR B  14  ? 0.1950 0.1761 0.1971 -0.0156 0.0045  -0.0178 14  THR C O   
844  C  CB  . THR B  14  ? 0.2141 0.2032 0.2114 -0.0150 0.0012  -0.0265 14  THR C CB  
845  O  OG1 . THR B  14  ? 0.2263 0.2116 0.2180 -0.0154 -0.0005 -0.0311 14  THR C OG1 
846  C  CG2 . THR B  14  ? 0.2165 0.2080 0.2193 -0.0202 0.0012  -0.0271 14  THR C CG2 
847  N  N   . ILE B  15  ? 0.1901 0.1802 0.1932 -0.0108 0.0038  -0.0156 15  ILE C N   
848  C  CA  . ILE B  15  ? 0.1868 0.1768 0.1933 -0.0113 0.0028  -0.0121 15  ILE C CA  
849  C  C   . ILE B  15  ? 0.1764 0.1626 0.1852 -0.0109 0.0034  -0.0093 15  ILE C C   
850  O  O   . ILE B  15  ? 0.1900 0.1722 0.1988 -0.0126 0.0019  -0.0082 15  ILE C O   
851  C  CB  . ILE B  15  ? 0.1873 0.1800 0.1944 -0.0097 0.0012  -0.0090 15  ILE C CB  
852  C  CG1 . ILE B  15  ? 0.1945 0.1900 0.1995 -0.0088 -0.0010 -0.0117 15  ILE C CG1 
853  C  CG2 . ILE B  15  ? 0.1938 0.1838 0.2037 -0.0107 -0.0009 -0.0056 15  ILE C CG2 
854  C  CD1 . ILE B  15  ? 0.2120 0.2069 0.2148 -0.0069 -0.0032 -0.0083 15  ILE C CD1 
855  N  N   . ILE B  16  ? 0.1840 0.1718 0.1942 -0.0081 0.0055  -0.0082 16  ILE C N   
856  C  CA  . ILE B  16  ? 0.1830 0.1697 0.1981 -0.0061 0.0057  -0.0059 16  ILE C CA  
857  C  C   . ILE B  16  ? 0.1899 0.1675 0.2014 -0.0066 0.0045  -0.0079 16  ILE C C   
858  O  O   . ILE B  16  ? 0.1834 0.1569 0.1965 -0.0069 0.0018  -0.0055 16  ILE C O   
859  C  CB  . ILE B  16  ? 0.1853 0.1777 0.2034 -0.0019 0.0097  -0.0052 16  ILE C CB  
860  C  CG1 . ILE B  16  ? 0.1817 0.1821 0.2032 -0.0029 0.0110  -0.0009 16  ILE C CG1 
861  C  CG2 . ILE B  16  ? 0.1968 0.1891 0.2218 0.0018  0.0097  -0.0040 16  ILE C CG2 
862  C  CD1 . ILE B  16  ? 0.1939 0.2013 0.2154 0.0005  0.0169  -0.0001 16  ILE C CD1 
863  N  N   . ASN B  17  ? 0.1980 0.1711 0.2037 -0.0072 0.0057  -0.0121 17  ASN C N   
864  C  CA  . ASN B  17  ? 0.2108 0.1727 0.2118 -0.0088 0.0045  -0.0136 17  ASN C CA  
865  C  C   . ASN B  17  ? 0.2061 0.1649 0.2049 -0.0140 0.0029  -0.0117 17  ASN C C   
866  O  O   . ASN B  17  ? 0.2210 0.1707 0.2163 -0.0149 0.0012  -0.0097 17  ASN C O   
867  C  CB  . ASN B  17  ? 0.2189 0.1764 0.2142 -0.0105 0.0052  -0.0187 17  ASN C CB  
868  C  CG  . ASN B  17  ? 0.2254 0.1810 0.2184 -0.0046 0.0068  -0.0217 17  ASN C CG  
869  O  OD1 . ASN B  17  ? 0.2429 0.2003 0.2398 0.0011  0.0082  -0.0198 17  ASN C OD1 
870  N  ND2 . ASN B  17  ? 0.2372 0.1896 0.2238 -0.0055 0.0066  -0.0269 17  ASN C ND2 
871  N  N   . THR B  18  ? 0.1966 0.1625 0.1963 -0.0168 0.0036  -0.0125 18  THR C N   
872  C  CA  . THR B  18  ? 0.2000 0.1646 0.1968 -0.0210 0.0035  -0.0116 18  THR C CA  
873  C  C   . THR B  18  ? 0.2037 0.1650 0.1995 -0.0194 0.0009  -0.0078 18  THR C C   
874  O  O   . THR B  18  ? 0.2120 0.1654 0.2010 -0.0218 0.0002  -0.0061 18  THR C O   
875  C  CB  . THR B  18  ? 0.2050 0.1791 0.2043 -0.0224 0.0048  -0.0142 18  THR C CB  
876  O  OG1 . THR B  18  ? 0.2189 0.1966 0.2199 -0.0239 0.0056  -0.0178 18  THR C OG1 
877  C  CG2 . THR B  18  ? 0.2138 0.1876 0.2096 -0.0262 0.0066  -0.0141 18  THR C CG2 
878  N  N   . PHE B  19  ? 0.1939 0.1607 0.1953 -0.0161 -0.0008 -0.0062 19  PHE C N   
879  C  CA  . PHE B  19  ? 0.2033 0.1676 0.2059 -0.0150 -0.0049 -0.0027 19  PHE C CA  
880  C  C   . PHE B  19  ? 0.2162 0.1727 0.2172 -0.0137 -0.0072 -0.0007 19  PHE C C   
881  O  O   . PHE B  19  ? 0.2175 0.1660 0.2118 -0.0150 -0.0105 0.0012  19  PHE C O   
882  C  CB  . PHE B  19  ? 0.2049 0.1769 0.2159 -0.0131 -0.0061 -0.0008 19  PHE C CB  
883  C  CG  . PHE B  19  ? 0.2050 0.1759 0.2200 -0.0130 -0.0114 0.0028  19  PHE C CG  
884  C  CD1 . PHE B  19  ? 0.1974 0.1709 0.2205 -0.0104 -0.0130 0.0052  19  PHE C CD1 
885  C  CD2 . PHE B  19  ? 0.2080 0.1760 0.2200 -0.0149 -0.0153 0.0033  19  PHE C CD2 
886  C  CE1 . PHE B  19  ? 0.2082 0.1833 0.2380 -0.0106 -0.0189 0.0085  19  PHE C CE1 
887  C  CE2 . PHE B  19  ? 0.2130 0.1797 0.2291 -0.0156 -0.0217 0.0063  19  PHE C CE2 
888  C  CZ  . PHE B  19  ? 0.2142 0.1853 0.2401 -0.0139 -0.0238 0.0091  19  PHE C CZ  
889  N  N   . HIS B  20  ? 0.2102 0.1675 0.2155 -0.0105 -0.0058 -0.0013 20  HIS C N   
890  C  CA  . HIS B  20  ? 0.2135 0.1630 0.2185 -0.0073 -0.0087 0.0003  20  HIS C CA  
891  C  C   . HIS B  20  ? 0.2242 0.1590 0.2173 -0.0101 -0.0099 0.0006  20  HIS C C   
892  O  O   . HIS B  20  ? 0.2385 0.1644 0.2282 -0.0084 -0.0147 0.0036  20  HIS C O   
893  C  CB  . HIS B  20  ? 0.2117 0.1647 0.2229 -0.0019 -0.0061 -0.0017 20  HIS C CB  
894  C  CG  . HIS B  20  ? 0.2049 0.1718 0.2291 0.0020  -0.0053 0.0000  20  HIS C CG  
895  N  ND1 . HIS B  20  ? 0.2013 0.1756 0.2295 0.0055  -0.0002 -0.0022 20  HIS C ND1 
896  C  CD2 . HIS B  20  ? 0.2025 0.1768 0.2363 0.0023  -0.0090 0.0038  20  HIS C CD2 
897  C  CE1 . HIS B  20  ? 0.2081 0.1955 0.2488 0.0078  0.0007  0.0007  20  HIS C CE1 
898  N  NE2 . HIS B  20  ? 0.2096 0.1974 0.2550 0.0054  -0.0052 0.0044  20  HIS C NE2 
899  N  N   A GLN B  21  ? 0.2268 0.1591 0.2136 -0.0152 -0.0060 -0.0018 21  GLN C N   
900  N  N   B GLN B  21  ? 0.2232 0.1552 0.2100 -0.0150 -0.0060 -0.0019 21  GLN C N   
901  C  CA  A GLN B  21  ? 0.2450 0.1631 0.2205 -0.0196 -0.0061 -0.0007 21  GLN C CA  
902  C  CA  B GLN B  21  ? 0.2358 0.1539 0.2111 -0.0198 -0.0061 -0.0007 21  GLN C CA  
903  C  C   A GLN B  21  ? 0.2487 0.1612 0.2149 -0.0228 -0.0080 0.0029  21  GLN C C   
904  C  C   B GLN B  21  ? 0.2442 0.1566 0.2109 -0.0220 -0.0087 0.0032  21  GLN C C   
905  O  O   A GLN B  21  ? 0.2717 0.1702 0.2265 -0.0256 -0.0094 0.0058  21  GLN C O   
906  O  O   B GLN B  21  ? 0.2630 0.1609 0.2193 -0.0231 -0.0115 0.0065  21  GLN C O   
907  C  CB  A GLN B  21  ? 0.2512 0.1707 0.2252 -0.0254 -0.0015 -0.0041 21  GLN C CB  
908  C  CB  B GLN B  21  ? 0.2316 0.1528 0.2050 -0.0263 -0.0012 -0.0037 21  GLN C CB  
909  C  CG  A GLN B  21  ? 0.2550 0.1837 0.2286 -0.0306 0.0022  -0.0050 21  GLN C CG  
910  C  CG  B GLN B  21  ? 0.2272 0.1507 0.2054 -0.0248 0.0001  -0.0079 21  GLN C CG  
911  C  CD  A GLN B  21  ? 0.2558 0.1905 0.2328 -0.0356 0.0057  -0.0090 21  GLN C CD  
912  C  CD  B GLN B  21  ? 0.2216 0.1542 0.2024 -0.0302 0.0035  -0.0114 21  GLN C CD  
913  O  OE1 A GLN B  21  ? 0.2522 0.1850 0.2317 -0.0344 0.0048  -0.0118 21  GLN C OE1 
914  O  OE1 B GLN B  21  ? 0.2184 0.1579 0.1994 -0.0340 0.0057  -0.0109 21  GLN C OE1 
915  N  NE2 A GLN B  21  ? 0.2651 0.2075 0.2424 -0.0408 0.0094  -0.0096 21  GLN C NE2 
916  N  NE2 B GLN B  21  ? 0.2225 0.1554 0.2051 -0.0298 0.0034  -0.0155 21  GLN C NE2 
917  N  N   . TYR B  22  ? 0.2389 0.1609 0.2082 -0.0222 -0.0084 0.0027  22  TYR C N   
918  C  CA  . TYR B  22  ? 0.2476 0.1638 0.2068 -0.0235 -0.0113 0.0053  22  TYR C CA  
919  C  C   . TYR B  22  ? 0.2436 0.1580 0.2062 -0.0187 -0.0193 0.0080  22  TYR C C   
920  O  O   . TYR B  22  ? 0.2745 0.1774 0.2257 -0.0189 -0.0245 0.0111  22  TYR C O   
921  C  CB  . TYR B  22  ? 0.2432 0.1676 0.2007 -0.0259 -0.0073 0.0026  22  TYR C CB  
922  C  CG  . TYR B  22  ? 0.2483 0.1765 0.2044 -0.0309 0.0001  0.0002  22  TYR C CG  
923  C  CD1 . TYR B  22  ? 0.2683 0.1878 0.2121 -0.0365 0.0035  0.0023  22  TYR C CD1 
924  C  CD2 . TYR B  22  ? 0.2403 0.1805 0.2074 -0.0305 0.0031  -0.0035 22  TYR C CD2 
925  C  CE1 . TYR B  22  ? 0.2701 0.1955 0.2157 -0.0424 0.0104  0.0004  22  TYR C CE1 
926  C  CE2 . TYR B  22  ? 0.2420 0.1879 0.2106 -0.0353 0.0087  -0.0059 22  TYR C CE2 
927  C  CZ  . TYR B  22  ? 0.2548 0.1945 0.2144 -0.0415 0.0124  -0.0040 22  TYR C CZ  
928  O  OH  . TYR B  22  ? 0.2640 0.2119 0.2284 -0.0472 0.0177  -0.0063 22  TYR C OH  
929  N  N   . SER B  23  ? 0.2373 0.1629 0.2151 -0.0148 -0.0208 0.0072  23  SER C N   
930  C  CA  . SER B  23  ? 0.2368 0.1645 0.2214 -0.0116 -0.0286 0.0098  23  SER C CA  
931  C  C   . SER B  23  ? 0.2486 0.1671 0.2318 -0.0078 -0.0343 0.0127  23  SER C C   
932  O  O   . SER B  23  ? 0.2516 0.1654 0.2325 -0.0064 -0.0426 0.0155  23  SER C O   
933  C  CB  . SER B  23  ? 0.2273 0.1703 0.2294 -0.0095 -0.0276 0.0093  23  SER C CB  
934  O  OG  . SER B  23  ? 0.2197 0.1679 0.2309 -0.0055 -0.0242 0.0086  23  SER C OG  
935  N  N   . VAL B  24  ? 0.2553 0.1693 0.2381 -0.0059 -0.0309 0.0119  24  VAL C N   
936  C  CA  . VAL B  24  ? 0.2751 0.1784 0.2565 -0.0008 -0.0365 0.0142  24  VAL C CA  
937  C  C   . VAL B  24  ? 0.2910 0.1748 0.2529 -0.0032 -0.0420 0.0181  24  VAL C C   
938  O  O   . VAL B  24  ? 0.3184 0.1919 0.2781 0.0018  -0.0494 0.0209  24  VAL C O   
939  C  CB  . VAL B  24  ? 0.2925 0.1928 0.2762 0.0020  -0.0315 0.0114  24  VAL C CB  
940  C  CG1 . VAL B  24  ? 0.2963 0.1836 0.2643 -0.0050 -0.0270 0.0108  24  VAL C CG1 
941  C  CG2 . VAL B  24  ? 0.3201 0.2129 0.3078 0.0106  -0.0374 0.0126  24  VAL C CG2 
942  N  N   . LYS B  25  ? 0.2865 0.1651 0.2339 -0.0101 -0.0383 0.0183  25  LYS C N   
943  C  CA  . LYS B  25  ? 0.3171 0.1762 0.2428 -0.0137 -0.0406 0.0222  25  LYS C CA  
944  C  C   . LYS B  25  ? 0.3374 0.1871 0.2545 -0.0105 -0.0518 0.0262  25  LYS C C   
945  O  O   . LYS B  25  ? 0.3776 0.2092 0.2825 -0.0083 -0.0585 0.0307  25  LYS C O   
946  C  CB  . LYS B  25  ? 0.3199 0.1787 0.2328 -0.0220 -0.0318 0.0212  25  LYS C CB  
947  C  CG  . LYS B  25  ? 0.3170 0.1801 0.2349 -0.0262 -0.0228 0.0184  25  LYS C CG  
948  C  CD  . LYS B  25  ? 0.3216 0.1866 0.2298 -0.0343 -0.0142 0.0177  25  LYS C CD  
949  C  CE  . LYS B  25  ? 0.3148 0.1857 0.2305 -0.0393 -0.0068 0.0148  25  LYS C CE  
950  N  NZ  . LYS B  25  ? 0.3176 0.1883 0.2228 -0.0483 0.0012  0.0158  25  LYS C NZ  
951  N  N   . LEU B  26  ? 0.3459 0.2057 0.2676 -0.0105 -0.0549 0.0248  26  LEU C N   
952  C  CA  . LEU B  26  ? 0.3683 0.2195 0.2800 -0.0088 -0.0662 0.0277  26  LEU C CA  
953  C  C   . LEU B  26  ? 0.3457 0.2123 0.2781 -0.0051 -0.0736 0.0263  26  LEU C C   
954  O  O   . LEU B  26  ? 0.3105 0.1931 0.2587 -0.0062 -0.0684 0.0231  26  LEU C O   
955  C  CB  . LEU B  26  ? 0.4066 0.2486 0.2948 -0.0144 -0.0636 0.0275  26  LEU C CB  
956  C  CG  . LEU B  26  ? 0.4337 0.2619 0.3008 -0.0198 -0.0552 0.0298  26  LEU C CG  
957  C  CD1 . LEU B  26  ? 0.4763 0.2992 0.3218 -0.0242 -0.0514 0.0288  26  LEU C CD1 
958  C  CD2 . LEU B  26  ? 0.4531 0.2623 0.3085 -0.0177 -0.0624 0.0356  26  LEU C CD2 
959  N  N   . GLY B  27  ? 0.3652 0.2267 0.2976 -0.0013 -0.0867 0.0293  27  GLY C N   
960  C  CA  . GLY B  27  ? 0.3561 0.2331 0.3088 0.0002  -0.0945 0.0283  27  GLY C CA  
961  C  C   . GLY B  27  ? 0.3277 0.2256 0.3093 0.0033  -0.0892 0.0268  27  GLY C C   
962  O  O   . GLY B  27  ? 0.3316 0.2302 0.3202 0.0084  -0.0862 0.0273  27  GLY C O   
963  N  N   . HIS B  28  ? 0.3117 0.2255 0.3093 0.0004  -0.0882 0.0251  28  HIS C N   
964  C  CA  . HIS B  28  ? 0.3014 0.2356 0.3250 0.0027  -0.0825 0.0244  28  HIS C CA  
965  C  C   . HIS B  28  ? 0.2831 0.2168 0.3022 0.0028  -0.0691 0.0219  28  HIS C C   
966  O  O   . HIS B  28  ? 0.2739 0.2012 0.2786 -0.0021 -0.0628 0.0199  28  HIS C O   
967  C  CB  . HIS B  28  ? 0.3068 0.2552 0.3445 -0.0023 -0.0829 0.0238  28  HIS C CB  
968  C  CG  . HIS B  28  ? 0.3240 0.2951 0.3902 -0.0001 -0.0790 0.0247  28  HIS C CG  
969  N  ND1 . HIS B  28  ? 0.3040 0.2834 0.3757 0.0012  -0.0666 0.0231  28  HIS C ND1 
970  C  CD2 . HIS B  28  ? 0.3493 0.3374 0.4404 0.0014  -0.0860 0.0273  28  HIS C CD2 
971  C  CE1 . HIS B  28  ? 0.3251 0.3250 0.4217 0.0035  -0.0645 0.0246  28  HIS C CE1 
972  N  NE2 . HIS B  28  ? 0.3575 0.3643 0.4677 0.0032  -0.0760 0.0273  28  HIS C NE2 
973  N  N   . PRO B  29  ? 0.2826 0.2233 0.3143 0.0087  -0.0651 0.0215  29  PRO C N   
974  C  CA  . PRO B  29  ? 0.2796 0.2179 0.3055 0.0086  -0.0538 0.0186  29  PRO C CA  
975  C  C   . PRO B  29  ? 0.2715 0.2234 0.3052 0.0052  -0.0444 0.0161  29  PRO C C   
976  O  O   . PRO B  29  ? 0.2654 0.2138 0.2917 0.0041  -0.0365 0.0134  29  PRO C O   
977  C  CB  . PRO B  29  ? 0.2881 0.2275 0.3234 0.0173  -0.0538 0.0183  29  PRO C CB  
978  C  CG  . PRO B  29  ? 0.2792 0.2344 0.3359 0.0217  -0.0607 0.0203  29  PRO C CG  
979  C  CD  . PRO B  29  ? 0.2866 0.2359 0.3362 0.0167  -0.0710 0.0231  29  PRO C CD  
980  N  N   A ASP B  30  ? 0.2629 0.2291 0.3109 0.0032  -0.0460 0.0173  30  ASP C N   
981  N  N   B ASP B  30  ? 0.2592 0.2251 0.3068 0.0031  -0.0460 0.0173  30  ASP C N   
982  C  CA  A ASP B  30  ? 0.2533 0.2303 0.3069 -0.0003 -0.0382 0.0161  30  ASP C CA  
983  C  CA  B ASP B  30  ? 0.2480 0.2243 0.3007 -0.0003 -0.0382 0.0160  30  ASP C CA  
984  C  C   A ASP B  30  ? 0.2450 0.2180 0.2907 -0.0068 -0.0406 0.0161  30  ASP C C   
985  C  C   B ASP B  30  ? 0.2412 0.2146 0.2879 -0.0068 -0.0412 0.0163  30  ASP C C   
986  O  O   A ASP B  30  ? 0.2385 0.2189 0.2892 -0.0096 -0.0365 0.0159  30  ASP C O   
987  O  O   B ASP B  30  ? 0.2330 0.2153 0.2873 -0.0097 -0.0384 0.0168  30  ASP C O   
988  C  CB  A ASP B  30  ? 0.2597 0.2564 0.3359 0.0019  -0.0361 0.0179  30  ASP C CB  
989  C  CB  B ASP B  30  ? 0.2496 0.2448 0.3240 0.0025  -0.0352 0.0174  30  ASP C CB  
990  C  CG  A ASP B  30  ? 0.2482 0.2538 0.3268 -0.0005 -0.0264 0.0170  30  ASP C CG  
991  C  CG  B ASP B  30  ? 0.2404 0.2429 0.3153 0.0017  -0.0246 0.0157  30  ASP C CG  
992  O  OD1 A ASP B  30  ? 0.2680 0.2671 0.3347 0.0000  -0.0202 0.0138  30  ASP C OD1 
993  O  OD1 B ASP B  30  ? 0.2434 0.2368 0.3045 0.0018  -0.0198 0.0123  30  ASP C OD1 
994  O  OD2 A ASP B  30  ? 0.2618 0.2809 0.3543 -0.0032 -0.0253 0.0199  30  ASP C OD2 
995  O  OD2 B ASP B  30  ? 0.2367 0.2543 0.3259 0.0008  -0.0214 0.0178  30  ASP C OD2 
996  N  N   . THR B  31  ? 0.2472 0.2067 0.2786 -0.0087 -0.0472 0.0161  31  THR C N   
997  C  CA  . THR B  31  ? 0.2473 0.2006 0.2681 -0.0135 -0.0488 0.0146  31  THR C CA  
998  C  C   . THR B  31  ? 0.2478 0.1862 0.2463 -0.0142 -0.0471 0.0124  31  THR C C   
999  O  O   . THR B  31  ? 0.2414 0.1718 0.2322 -0.0123 -0.0481 0.0135  31  THR C O   
1000 C  CB  . THR B  31  ? 0.2635 0.2159 0.2882 -0.0161 -0.0597 0.0164  31  THR C CB  
1001 O  OG1 . THR B  31  ? 0.2776 0.2195 0.2931 -0.0145 -0.0687 0.0175  31  THR C OG1 
1002 C  CG2 . THR B  31  ? 0.2598 0.2290 0.3088 -0.0167 -0.0613 0.0195  31  THR C CG2 
1003 N  N   . LEU B  32  ? 0.2406 0.1762 0.2302 -0.0166 -0.0436 0.0095  32  LEU C N   
1004 C  CA  . LEU B  32  ? 0.2511 0.1763 0.2216 -0.0176 -0.0402 0.0071  32  LEU C CA  
1005 C  C   . LEU B  32  ? 0.2685 0.1826 0.2252 -0.0185 -0.0478 0.0067  32  LEU C C   
1006 O  O   . LEU B  32  ? 0.2676 0.1819 0.2265 -0.0193 -0.0520 0.0051  32  LEU C O   
1007 C  CB  . LEU B  32  ? 0.2438 0.1739 0.2130 -0.0184 -0.0320 0.0034  32  LEU C CB  
1008 C  CG  . LEU B  32  ? 0.2249 0.1652 0.2049 -0.0179 -0.0247 0.0028  32  LEU C CG  
1009 C  CD1 . LEU B  32  ? 0.2223 0.1686 0.2036 -0.0179 -0.0199 -0.0007 32  LEU C CD1 
1010 C  CD2 . LEU B  32  ? 0.2264 0.1626 0.2001 -0.0187 -0.0201 0.0029  32  LEU C CD2 
1011 N  N   . ASN B  33  ? 0.2825 0.1849 0.2235 -0.0184 -0.0501 0.0080  33  ASN C N   
1012 C  CA  . ASN B  33  ? 0.3069 0.1963 0.2288 -0.0190 -0.0563 0.0068  33  ASN C CA  
1013 C  C   . ASN B  33  ? 0.3122 0.1991 0.2196 -0.0196 -0.0469 0.0025  33  ASN C C   
1014 O  O   . ASN B  33  ? 0.2985 0.1947 0.2133 -0.0200 -0.0375 0.0010  33  ASN C O   
1015 C  CB  . ASN B  33  ? 0.3257 0.2026 0.2349 -0.0183 -0.0642 0.0107  33  ASN C CB  
1016 C  CG  . ASN B  33  ? 0.3355 0.2050 0.2310 -0.0191 -0.0568 0.0127  33  ASN C CG  
1017 O  OD1 . ASN B  33  ? 0.3235 0.1971 0.2168 -0.0211 -0.0456 0.0107  33  ASN C OD1 
1018 N  ND2 . ASN B  33  ? 0.3646 0.2225 0.2508 -0.0180 -0.0640 0.0172  33  ASN C ND2 
1019 N  N   . GLN B  34  ? 0.3440 0.2189 0.2308 -0.0193 -0.0497 0.0001  34  GLN C N   
1020 C  CA  . GLN B  34  ? 0.3668 0.2421 0.2423 -0.0186 -0.0401 -0.0048 34  GLN C CA  
1021 C  C   . GLN B  34  ? 0.3549 0.2348 0.2267 -0.0208 -0.0279 -0.0036 34  GLN C C   
1022 O  O   . GLN B  34  ? 0.3310 0.2217 0.2092 -0.0206 -0.0185 -0.0069 34  GLN C O   
1023 C  CB  . GLN B  34  ? 0.4210 0.2815 0.2716 -0.0171 -0.0443 -0.0082 34  GLN C CB  
1024 C  CG  . GLN B  34  ? 0.4431 0.3070 0.2873 -0.0143 -0.0350 -0.0148 34  GLN C CG  
1025 C  CD  . GLN B  34  ? 0.5130 0.3620 0.3341 -0.0113 -0.0398 -0.0198 34  GLN C CD  
1026 O  OE1 . GLN B  34  ? 0.6246 0.4706 0.4480 -0.0083 -0.0448 -0.0248 34  GLN C OE1 
1027 N  NE2 . GLN B  34  ? 0.5121 0.3501 0.3094 -0.0119 -0.0384 -0.0187 34  GLN C NE2 
1028 N  N   . GLY B  35  ? 0.3584 0.2291 0.2193 -0.0231 -0.0292 0.0014  35  GLY C N   
1029 C  CA  . GLY B  35  ? 0.3560 0.2276 0.2116 -0.0269 -0.0189 0.0037  35  GLY C CA  
1030 C  C   . GLY B  35  ? 0.3303 0.2160 0.2086 -0.0282 -0.0136 0.0037  35  GLY C C   
1031 O  O   . GLY B  35  ? 0.3464 0.2399 0.2269 -0.0313 -0.0034 0.0024  35  GLY C O   
1032 N  N   . GLU B  36  ? 0.3106 0.1994 0.2050 -0.0260 -0.0207 0.0053  36  GLU C N   
1033 C  CA  . GLU B  36  ? 0.2866 0.1868 0.2003 -0.0262 -0.0168 0.0050  36  GLU C CA  
1034 C  C   . GLU B  36  ? 0.2719 0.1862 0.1966 -0.0254 -0.0112 0.0001  36  GLU C C   
1035 O  O   . GLU B  36  ? 0.2589 0.1818 0.1909 -0.0273 -0.0042 -0.0015 36  GLU C O   
1036 C  CB  . GLU B  36  ? 0.2800 0.1818 0.2078 -0.0231 -0.0246 0.0074  36  GLU C CB  
1037 C  CG  . GLU B  36  ? 0.3013 0.1906 0.2220 -0.0223 -0.0307 0.0122  36  GLU C CG  
1038 C  CD  . GLU B  36  ? 0.3079 0.2009 0.2434 -0.0178 -0.0396 0.0140  36  GLU C CD  
1039 O  OE1 . GLU B  36  ? 0.3033 0.2060 0.2508 -0.0165 -0.0429 0.0125  36  GLU C OE1 
1040 O  OE2 . GLU B  36  ? 0.3078 0.1936 0.2430 -0.0155 -0.0437 0.0172  36  GLU C OE2 
1041 N  N   . PHE B  37  ? 0.2686 0.1838 0.1936 -0.0226 -0.0152 -0.0025 37  PHE C N   
1042 C  CA  . PHE B  37  ? 0.2536 0.1792 0.1868 -0.0207 -0.0113 -0.0070 37  PHE C CA  
1043 C  C   . PHE B  37  ? 0.2559 0.1859 0.1818 -0.0214 -0.0021 -0.0106 37  PHE C C   
1044 O  O   . PHE B  37  ? 0.2608 0.2028 0.1975 -0.0213 0.0035  -0.0131 37  PHE C O   
1045 C  CB  . PHE B  37  ? 0.2553 0.1761 0.1868 -0.0178 -0.0189 -0.0088 37  PHE C CB  
1046 C  CG  . PHE B  37  ? 0.2508 0.1783 0.1880 -0.0148 -0.0163 -0.0133 37  PHE C CG  
1047 C  CD1 . PHE B  37  ? 0.2355 0.1728 0.1883 -0.0143 -0.0153 -0.0128 37  PHE C CD1 
1048 C  CD2 . PHE B  37  ? 0.2645 0.1872 0.1900 -0.0116 -0.0153 -0.0183 37  PHE C CD2 
1049 C  CE1 . PHE B  37  ? 0.2406 0.1823 0.1977 -0.0110 -0.0144 -0.0163 37  PHE C CE1 
1050 C  CE2 . PHE B  37  ? 0.2655 0.1930 0.1965 -0.0074 -0.0141 -0.0225 37  PHE C CE2 
1051 C  CZ  . PHE B  37  ? 0.2464 0.1832 0.1934 -0.0072 -0.0140 -0.0212 37  PHE C CZ  
1052 N  N   . LYS B  38  ? 0.2790 0.1999 0.1866 -0.0221 -0.0006 -0.0108 38  LYS C N   
1053 C  CA  . LYS B  38  ? 0.2896 0.2164 0.1902 -0.0231 0.0098  -0.0137 38  LYS C CA  
1054 C  C   . LYS B  38  ? 0.2844 0.2198 0.1929 -0.0288 0.0174  -0.0115 38  LYS C C   
1055 O  O   . LYS B  38  ? 0.2886 0.2381 0.2056 -0.0292 0.0251  -0.0149 38  LYS C O   
1056 C  CB  . LYS B  38  ? 0.3185 0.2330 0.1952 -0.0234 0.0110  -0.0135 38  LYS C CB  
1057 C  CG  . LYS B  38  ? 0.3302 0.2370 0.1962 -0.0174 0.0055  -0.0184 38  LYS C CG  
1058 C  CD  . LYS B  38  ? 0.3671 0.2593 0.2060 -0.0178 0.0060  -0.0178 38  LYS C CD  
1059 C  CE  . LYS B  38  ? 0.3792 0.2628 0.2050 -0.0115 0.0014  -0.0242 38  LYS C CE  
1060 N  NZ  . LYS B  38  ? 0.4149 0.2820 0.2104 -0.0117 0.0008  -0.0238 38  LYS C NZ  
1061 N  N   . GLU B  39  ? 0.2857 0.2132 0.1934 -0.0328 0.0144  -0.0062 39  GLU C N   
1062 C  CA  . GLU B  39  ? 0.2915 0.2241 0.2067 -0.0387 0.0199  -0.0042 39  GLU C CA  
1063 C  C   . GLU B  39  ? 0.2690 0.2158 0.2045 -0.0375 0.0203  -0.0075 39  GLU C C   
1064 O  O   . GLU B  39  ? 0.2785 0.2372 0.2226 -0.0410 0.0267  -0.0095 39  GLU C O   
1065 C  CB  . GLU B  39  ? 0.3018 0.2192 0.2103 -0.0418 0.0151  0.0017  39  GLU C CB  
1066 C  CG  . GLU B  39  ? 0.3150 0.2326 0.2246 -0.0497 0.0215  0.0040  39  GLU C CG  
1067 C  CD  . GLU B  39  ? 0.3367 0.2379 0.2411 -0.0518 0.0162  0.0092  39  GLU C CD  
1068 O  OE1 . GLU B  39  ? 0.3434 0.2410 0.2467 -0.0592 0.0205  0.0114  39  GLU C OE1 
1069 O  OE2 . GLU B  39  ? 0.3486 0.2406 0.2504 -0.0464 0.0077  0.0109  39  GLU C OE2 
1070 N  N   . LEU B  40  ? 0.2578 0.2043 0.2015 -0.0327 0.0132  -0.0079 40  LEU C N   
1071 C  CA  . LEU B  40  ? 0.2335 0.1920 0.1933 -0.0308 0.0131  -0.0107 40  LEU C CA  
1072 C  C   . LEU B  40  ? 0.2307 0.2026 0.1962 -0.0289 0.0177  -0.0157 40  LEU C C   
1073 O  O   . LEU B  40  ? 0.2162 0.1999 0.1928 -0.0303 0.0207  -0.0180 40  LEU C O   
1074 C  CB  . LEU B  40  ? 0.2261 0.1821 0.1914 -0.0261 0.0058  -0.0097 40  LEU C CB  
1075 C  CG  . LEU B  40  ? 0.2138 0.1787 0.1921 -0.0240 0.0049  -0.0112 40  LEU C CG  
1076 C  CD1 . LEU B  40  ? 0.2349 0.1960 0.2173 -0.0214 -0.0007 -0.0082 40  LEU C CD1 
1077 C  CD2 . LEU B  40  ? 0.2277 0.2023 0.2112 -0.0209 0.0060  -0.0152 40  LEU C CD2 
1078 N  N   . VAL B  41  ? 0.2439 0.2138 0.2025 -0.0247 0.0171  -0.0177 41  VAL C N   
1079 C  CA  . VAL B  41  ? 0.2487 0.2303 0.2131 -0.0204 0.0203  -0.0231 41  VAL C CA  
1080 C  C   . VAL B  41  ? 0.2541 0.2475 0.2204 -0.0241 0.0299  -0.0250 41  VAL C C   
1081 O  O   . VAL B  41  ? 0.2405 0.2497 0.2206 -0.0229 0.0326  -0.0286 41  VAL C O   
1082 C  CB  . VAL B  41  ? 0.2581 0.2313 0.2117 -0.0145 0.0171  -0.0255 41  VAL C CB  
1083 C  CG1 . VAL B  41  ? 0.2689 0.2536 0.2261 -0.0091 0.0223  -0.0318 41  VAL C CG1 
1084 C  CG2 . VAL B  41  ? 0.2616 0.2265 0.2178 -0.0117 0.0076  -0.0238 41  VAL C CG2 
1085 N  N   . ARG B  42  ? 0.2723 0.2585 0.2259 -0.0294 0.0343  -0.0218 42  ARG C N   
1086 C  CA  . ARG B  42  ? 0.2848 0.2814 0.2385 -0.0352 0.0447  -0.0221 42  ARG C CA  
1087 C  C   . ARG B  42  ? 0.2684 0.2759 0.2380 -0.0419 0.0465  -0.0213 42  ARG C C   
1088 O  O   . ARG B  42  ? 0.2729 0.2986 0.2546 -0.0446 0.0533  -0.0241 42  ARG C O   
1089 C  CB  . ARG B  42  ? 0.3061 0.2882 0.2391 -0.0406 0.0481  -0.0171 42  ARG C CB  
1090 C  CG  . ARG B  42  ? 0.3277 0.3196 0.2594 -0.0484 0.0600  -0.0159 42  ARG C CG  
1091 C  CD  . ARG B  42  ? 0.3443 0.3200 0.2507 -0.0519 0.0634  -0.0111 42  ARG C CD  
1092 N  NE  . ARG B  42  ? 0.3502 0.3041 0.2447 -0.0554 0.0554  -0.0045 42  ARG C NE  
1093 C  CZ  . ARG B  42  ? 0.3669 0.3141 0.2604 -0.0646 0.0566  0.0012  42  ARG C CZ  
1094 N  NH1 . ARG B  42  ? 0.3881 0.3146 0.2707 -0.0653 0.0482  0.0065  42  ARG C NH1 
1095 N  NH2 . ARG B  42  ? 0.3724 0.3334 0.2778 -0.0728 0.0649  0.0015  42  ARG C NH2 
1096 N  N   . LYS B  43  ? 0.2701 0.2665 0.2398 -0.0447 0.0402  -0.0177 43  LYS C N   
1097 C  CA  . LYS B  43  ? 0.2728 0.2746 0.2541 -0.0514 0.0404  -0.0172 43  LYS C CA  
1098 C  C   . LYS B  43  ? 0.2620 0.2740 0.2585 -0.0469 0.0353  -0.0212 43  LYS C C   
1099 O  O   . LYS B  43  ? 0.2670 0.2948 0.2770 -0.0493 0.0376  -0.0244 43  LYS C O   
1100 C  CB  . LYS B  43  ? 0.2776 0.2608 0.2494 -0.0562 0.0368  -0.0119 43  LYS C CB  
1101 C  CG  . LYS B  43  ? 0.3016 0.2729 0.2566 -0.0621 0.0414  -0.0069 43  LYS C CG  
1102 C  CD  . LYS B  43  ? 0.3110 0.2616 0.2563 -0.0656 0.0364  -0.0016 43  LYS C CD  
1103 C  CE  . LYS B  43  ? 0.3362 0.2753 0.2647 -0.0735 0.0417  0.0042  43  LYS C CE  
1104 N  NZ  . LYS B  43  ? 0.3451 0.2600 0.2603 -0.0758 0.0357  0.0101  43  LYS C NZ  
1105 N  N   . ASP B  44  ? 0.2456 0.2495 0.2403 -0.0406 0.0282  -0.0209 44  ASP C N   
1106 C  CA  . ASP B  44  ? 0.2385 0.2490 0.2441 -0.0372 0.0234  -0.0235 44  ASP C CA  
1107 C  C   . ASP B  44  ? 0.2197 0.2418 0.2326 -0.0299 0.0221  -0.0275 44  ASP C C   
1108 O  O   . ASP B  44  ? 0.2239 0.2523 0.2450 -0.0274 0.0182  -0.0296 44  ASP C O   
1109 C  CB  . ASP B  44  ? 0.2489 0.2463 0.2497 -0.0349 0.0178  -0.0207 44  ASP C CB  
1110 C  CG  . ASP B  44  ? 0.2858 0.2716 0.2807 -0.0407 0.0182  -0.0177 44  ASP C CG  
1111 O  OD1 . ASP B  44  ? 0.2857 0.2744 0.2855 -0.0458 0.0190  -0.0192 44  ASP C OD1 
1112 O  OD2 . ASP B  44  ? 0.3250 0.2986 0.3098 -0.0405 0.0174  -0.0140 44  ASP C OD2 
1113 N  N   . LEU B  45  ? 0.2143 0.2366 0.2219 -0.0260 0.0246  -0.0286 45  LEU C N   
1114 C  CA  . LEU B  45  ? 0.2214 0.2526 0.2346 -0.0181 0.0235  -0.0329 45  LEU C CA  
1115 C  C   . LEU B  45  ? 0.2213 0.2659 0.2379 -0.0180 0.0315  -0.0365 45  LEU C C   
1116 O  O   . LEU B  45  ? 0.2298 0.2783 0.2461 -0.0105 0.0323  -0.0405 45  LEU C O   
1117 C  CB  . LEU B  45  ? 0.2222 0.2403 0.2264 -0.0117 0.0180  -0.0321 45  LEU C CB  
1118 C  CG  . LEU B  45  ? 0.2194 0.2288 0.2237 -0.0118 0.0113  -0.0284 45  LEU C CG  
1119 C  CD1 . LEU B  45  ? 0.2396 0.2357 0.2354 -0.0084 0.0063  -0.0263 45  LEU C CD1 
1120 C  CD2 . LEU B  45  ? 0.2209 0.2385 0.2349 -0.0093 0.0079  -0.0299 45  LEU C CD2 
1121 N  N   . GLN B  46  ? 0.2299 0.2823 0.2505 -0.0266 0.0378  -0.0354 46  GLN C N   
1122 C  CA  . GLN B  46  ? 0.2395 0.3083 0.2656 -0.0277 0.0472  -0.0383 46  GLN C CA  
1123 C  C   . GLN B  46  ? 0.2358 0.3257 0.2796 -0.0204 0.0471  -0.0445 46  GLN C C   
1124 O  O   . GLN B  46  ? 0.2489 0.3514 0.2958 -0.0166 0.0543  -0.0482 46  GLN C O   
1125 C  CB  . GLN B  46  ? 0.2534 0.3272 0.2827 -0.0402 0.0535  -0.0350 46  GLN C CB  
1126 C  CG  . GLN B  46  ? 0.2450 0.3281 0.2905 -0.0456 0.0492  -0.0356 46  GLN C CG  
1127 C  CD  . GLN B  46  ? 0.2751 0.3591 0.3221 -0.0591 0.0545  -0.0320 46  GLN C CD  
1128 O  OE1 . GLN B  46  ? 0.2835 0.3871 0.3432 -0.0647 0.0619  -0.0333 46  GLN C OE1 
1129 N  NE2 . GLN B  46  ? 0.2830 0.3459 0.3169 -0.0646 0.0513  -0.0271 46  GLN C NE2 
1130 N  N   . ASN B  47  ? 0.2242 0.3183 0.2791 -0.0178 0.0390  -0.0459 47  ASN C N   
1131 C  CA  . ASN B  47  ? 0.2209 0.3333 0.2918 -0.0099 0.0371  -0.0514 47  ASN C CA  
1132 C  C   . ASN B  47  ? 0.2228 0.3246 0.2868 0.0024  0.0302  -0.0534 47  ASN C C   
1133 O  O   . ASN B  47  ? 0.2373 0.3478 0.3057 0.0115  0.0320  -0.0584 47  ASN C O   
1134 C  CB  . ASN B  47  ? 0.2027 0.3264 0.2890 -0.0142 0.0315  -0.0519 47  ASN C CB  
1135 C  CG  . ASN B  47  ? 0.2119 0.3436 0.3046 -0.0275 0.0373  -0.0499 47  ASN C CG  
1136 O  OD1 . ASN B  47  ? 0.2181 0.3681 0.3213 -0.0308 0.0460  -0.0516 47  ASN C OD1 
1137 N  ND2 . ASN B  47  ? 0.2045 0.3221 0.2904 -0.0352 0.0333  -0.0461 47  ASN C ND2 
1138 N  N   . PHE B  48  ? 0.2295 0.3124 0.2831 0.0025  0.0226  -0.0496 48  PHE C N   
1139 C  CA  . PHE B  48  ? 0.2204 0.2911 0.2673 0.0121  0.0152  -0.0502 48  PHE C CA  
1140 C  C   . PHE B  48  ? 0.2411 0.3018 0.2756 0.0176  0.0181  -0.0521 48  PHE C C   
1141 O  O   . PHE B  48  ? 0.2570 0.3134 0.2898 0.0274  0.0140  -0.0555 48  PHE C O   
1142 C  CB  . PHE B  48  ? 0.2145 0.2687 0.2532 0.0091  0.0081  -0.0447 48  PHE C CB  
1143 C  CG  . PHE B  48  ? 0.2058 0.2652 0.2522 0.0094  0.0019  -0.0443 48  PHE C CG  
1144 C  CD1 . PHE B  48  ? 0.2061 0.2839 0.2669 0.0082  0.0020  -0.0476 48  PHE C CD1 
1145 C  CD2 . PHE B  48  ? 0.2058 0.2513 0.2440 0.0103  -0.0043 -0.0402 48  PHE C CD2 
1146 C  CE1 . PHE B  48  ? 0.1930 0.2729 0.2576 0.0087  -0.0051 -0.0473 48  PHE C CE1 
1147 C  CE2 . PHE B  48  ? 0.2011 0.2492 0.2423 0.0108  -0.0100 -0.0395 48  PHE C CE2 
1148 C  CZ  . PHE B  48  ? 0.1957 0.2599 0.2489 0.0105  -0.0109 -0.0433 48  PHE C CZ  
1149 N  N   . LEU B  49  ? 0.2376 0.2925 0.2619 0.0113  0.0244  -0.0500 49  LEU C N   
1150 C  CA  . LEU B  49  ? 0.2531 0.2978 0.2628 0.0152  0.0276  -0.0521 49  LEU C CA  
1151 C  C   . LEU B  49  ? 0.2635 0.3225 0.2740 0.0133  0.0394  -0.0550 49  LEU C C   
1152 O  O   . LEU B  49  ? 0.2709 0.3203 0.2658 0.0106  0.0439  -0.0538 49  LEU C O   
1153 C  CB  . LEU B  49  ? 0.2466 0.2696 0.2400 0.0104  0.0235  -0.0468 49  LEU C CB  
1154 C  CG  . LEU B  49  ? 0.2556 0.2646 0.2471 0.0130  0.0130  -0.0442 49  LEU C CG  
1155 C  CD1 . LEU B  49  ? 0.2546 0.2481 0.2360 0.0069  0.0093  -0.0384 49  LEU C CD1 
1156 C  CD2 . LEU B  49  ? 0.2792 0.2806 0.2659 0.0230  0.0085  -0.0489 49  LEU C CD2 
1157 N  N   . LYS B  50  ? 0.2349 0.4408 0.2834 -0.0334 0.0458  -0.0974 50  LYS C N   
1158 C  CA  . LYS B  50  ? 0.2595 0.4534 0.3223 -0.0379 0.0647  -0.1100 50  LYS C CA  
1159 C  C   . LYS B  50  ? 0.2669 0.4254 0.3181 -0.0269 0.0699  -0.0987 50  LYS C C   
1160 O  O   . LYS B  50  ? 0.2919 0.4182 0.3303 -0.0322 0.0868  -0.1008 50  LYS C O   
1161 C  CB  . LYS B  50  ? 0.2693 0.5195 0.3685 -0.0431 0.0646  -0.1266 50  LYS C CB  
1162 C  CG  . LYS B  50  ? 0.3001 0.5417 0.4204 -0.0505 0.0877  -0.1432 50  LYS C CG  
1163 C  CD  . LYS B  50  ? 0.3140 0.6179 0.4760 -0.0551 0.0850  -0.1609 50  LYS C CD  
1164 C  CE  . LYS B  50  ? 0.3395 0.6724 0.5248 -0.0764 0.0975  -0.1911 50  LYS C CE  
1165 N  NZ  . LYS B  50  ? 0.3835 0.7420 0.5606 -0.0871 0.0880  -0.2010 50  LYS C NZ  
1166 N  N   . LYS B  51  ? 0.2716 0.4402 0.3315 -0.0132 0.0570  -0.0873 51  LYS C N   
1167 C  CA  . LYS B  51  ? 0.3055 0.4475 0.3659 -0.0054 0.0663  -0.0866 51  LYS C CA  
1168 C  C   . LYS B  51  ? 0.2934 0.3905 0.3130 -0.0063 0.0676  -0.0790 51  LYS C C   
1169 O  O   . LYS B  51  ? 0.3154 0.3881 0.3156 -0.0113 0.0823  -0.0848 51  LYS C O   
1170 C  CB  . LYS B  51  ? 0.3293 0.4926 0.4255 0.0102  0.0539  -0.0764 51  LYS C CB  
1171 C  CG  . LYS B  51  ? 0.3821 0.5169 0.4870 0.0168  0.0665  -0.0827 51  LYS C CG  
1172 C  CD  . LYS B  51  ? 0.4159 0.5668 0.5769 0.0333  0.0606  -0.0749 51  LYS C CD  
1173 C  CE  . LYS B  51  ? 0.4516 0.5764 0.6257 0.0332  0.0835  -0.0970 51  LYS C CE  
1174 N  NZ  . LYS B  51  ? 0.4916 0.6303 0.7389 0.0476  0.0882  -0.0999 51  LYS C NZ  
1175 N  N   . GLU B  52  ? 0.2786 0.3708 0.2838 -0.0035 0.0520  -0.0662 52  GLU C N   
1176 C  CA  . GLU B  52  ? 0.2783 0.3352 0.2511 -0.0035 0.0490  -0.0584 52  GLU C CA  
1177 C  C   . GLU B  52  ? 0.2870 0.3225 0.2348 -0.0147 0.0598  -0.0589 52  GLU C C   
1178 O  O   . GLU B  52  ? 0.3092 0.3214 0.2295 -0.0173 0.0637  -0.0548 52  GLU C O   
1179 C  CB  . GLU B  52  ? 0.2658 0.3272 0.2352 0.0003  0.0316  -0.0457 52  GLU C CB  
1180 C  CG  . GLU B  52  ? 0.2714 0.3500 0.2640 0.0116  0.0195  -0.0339 52  GLU C CG  
1181 C  CD  . GLU B  52  ? 0.2683 0.3957 0.2869 0.0125  0.0114  -0.0291 52  GLU C CD  
1182 O  OE1 . GLU B  52  ? 0.2725 0.4232 0.2974 0.0041  0.0177  -0.0428 52  GLU C OE1 
1183 O  OE2 . GLU B  52  ? 0.2821 0.4288 0.3188 0.0211  -0.0014 -0.0100 52  GLU C OE2 
1184 N  N   . ASN B  53  ? 0.2836 0.3313 0.2454 -0.0226 0.0661  -0.0640 53  ASN C N   
1185 C  CA  . ASN B  53  ? 0.2961 0.3237 0.2506 -0.0327 0.0791  -0.0601 53  ASN C CA  
1186 C  C   . ASN B  53  ? 0.3268 0.3437 0.2671 -0.0381 0.0957  -0.0592 53  ASN C C   
1187 O  O   . ASN B  53  ? 0.3562 0.3534 0.2802 -0.0450 0.1037  -0.0451 53  ASN C O   
1188 C  CB  . ASN B  53  ? 0.2897 0.3343 0.2769 -0.0421 0.0878  -0.0725 53  ASN C CB  
1189 C  CG  . ASN B  53  ? 0.2819 0.3213 0.2763 -0.0441 0.0808  -0.0707 53  ASN C CG  
1190 O  OD1 . ASN B  53  ? 0.3139 0.3241 0.2974 -0.0427 0.0793  -0.0546 53  ASN C OD1 
1191 N  ND2 . ASN B  53  ? 0.2557 0.3294 0.2718 -0.0488 0.0773  -0.0885 53  ASN C ND2 
1192 N  N   . LYS B  54  ? 0.3367 0.3695 0.2867 -0.0356 0.1019  -0.0725 54  LYS C N   
1193 C  CA  . LYS B  54  ? 0.3666 0.3945 0.3023 -0.0434 0.1213  -0.0769 54  LYS C CA  
1194 C  C   . LYS B  54  ? 0.3892 0.4018 0.2839 -0.0444 0.1187  -0.0706 54  LYS C C   
1195 O  O   . LYS B  54  ? 0.4239 0.4362 0.2944 -0.0553 0.1348  -0.0719 54  LYS C O   
1196 C  CB  . LYS B  54  ? 0.3791 0.4314 0.3470 -0.0402 0.1303  -0.0976 54  LYS C CB  
1197 C  CG  . LYS B  54  ? 0.3923 0.4698 0.4001 -0.0439 0.1373  -0.1085 54  LYS C CG  
1198 C  CD  . LYS B  54  ? 0.4181 0.5246 0.4654 -0.0373 0.1414  -0.1259 54  LYS C CD  
1199 C  CE  . LYS B  54  ? 0.4264 0.5667 0.5161 -0.0431 0.1484  -0.1400 54  LYS C CE  
1200 N  NZ  . LYS B  54  ? 0.4844 0.6279 0.5872 -0.0538 0.1764  -0.1555 54  LYS C NZ  
1201 N  N   . ASN B  55  ? 0.3755 0.3809 0.2627 -0.0353 0.0997  -0.0661 55  ASN C N   
1202 C  CA  . ASN B  55  ? 0.3964 0.3940 0.2516 -0.0372 0.0958  -0.0674 55  ASN C CA  
1203 C  C   . ASN B  55  ? 0.3899 0.3734 0.2239 -0.0353 0.0771  -0.0471 55  ASN C C   
1204 O  O   . ASN B  55  ? 0.3519 0.3315 0.2007 -0.0257 0.0616  -0.0454 55  ASN C O   
1205 C  CB  . ASN B  55  ? 0.3974 0.4008 0.2790 -0.0276 0.0933  -0.0861 55  ASN C CB  
1206 C  CG  . ASN B  55  ? 0.4357 0.4359 0.2944 -0.0331 0.0954  -0.0992 55  ASN C CG  
1207 O  OD1 . ASN B  55  ? 0.4775 0.4731 0.2958 -0.0409 0.0878  -0.0887 55  ASN C OD1 
1208 N  ND2 . ASN B  55  ? 0.4554 0.4623 0.3444 -0.0308 0.1074  -0.1246 55  ASN C ND2 
1209 N  N   . GLU B  56  ? 0.4070 0.3855 0.2104 -0.0447 0.0786  -0.0286 56  GLU C N   
1210 C  CA  . GLU B  56  ? 0.4206 0.3887 0.2141 -0.0420 0.0608  -0.0069 56  GLU C CA  
1211 C  C   . GLU B  56  ? 0.4131 0.3817 0.1967 -0.0370 0.0445  -0.0158 56  GLU C C   
1212 O  O   . GLU B  56  ? 0.3940 0.3544 0.1888 -0.0301 0.0289  -0.0064 56  GLU C O   
1213 C  CB  . GLU B  56  ? 0.4615 0.4301 0.2262 -0.0522 0.0630  0.0205  56  GLU C CB  
1214 C  CG  . GLU B  56  ? 0.4630 0.4205 0.2367 -0.0471 0.0459  0.0485  56  GLU C CG  
1215 C  CD  . GLU B  56  ? 0.5122 0.4683 0.2786 -0.0545 0.0508  0.0853  56  GLU C CD  
1216 O  OE1 . GLU B  56  ? 0.5722 0.5374 0.3177 -0.0658 0.0680  0.0893  56  GLU C OE1 
1217 O  OE2 . GLU B  56  ? 0.5119 0.4593 0.2962 -0.0496 0.0383  0.1130  56  GLU C OE2 
1218 N  N   . LYS B  57  ? 0.4365 0.4154 0.2060 -0.0417 0.0506  -0.0373 57  LYS C N   
1219 C  CA  . LYS B  57  ? 0.4379 0.4171 0.2060 -0.0392 0.0385  -0.0500 57  LYS C CA  
1220 C  C   . LYS B  57  ? 0.3855 0.3540 0.1949 -0.0255 0.0328  -0.0558 57  LYS C C   
1221 O  O   . LYS B  57  ? 0.3628 0.3254 0.1785 -0.0215 0.0197  -0.0548 57  LYS C O   
1222 C  CB  . LYS B  57  ? 0.4890 0.4847 0.2383 -0.0511 0.0506  -0.0778 57  LYS C CB  
1223 C  CG  . LYS B  57  ? 0.5572 0.5739 0.2540 -0.0674 0.0471  -0.0674 57  LYS C CG  
1224 C  CD  . LYS B  57  ? 0.6255 0.6666 0.2972 -0.0846 0.0690  -0.0919 57  LYS C CD  
1225 C  CE  . LYS B  57  ? 0.6359 0.6787 0.3413 -0.0848 0.0854  -0.1375 57  LYS C CE  
1226 N  NZ  . LYS B  57  ? 0.6736 0.7361 0.3703 -0.0989 0.1135  -0.1613 57  LYS C NZ  
1227 N  N   . VAL B  58  ? 0.3608 0.3313 0.1990 -0.0194 0.0417  -0.0591 58  VAL C N   
1228 C  CA  . VAL B  58  ? 0.3192 0.2886 0.1928 -0.0075 0.0335  -0.0549 58  VAL C CA  
1229 C  C   . VAL B  58  ? 0.3082 0.2738 0.1788 -0.0056 0.0200  -0.0372 58  VAL C C   
1230 O  O   . VAL B  58  ? 0.3031 0.2655 0.1845 -0.0006 0.0092  -0.0324 58  VAL C O   
1231 C  CB  . VAL B  58  ? 0.3151 0.2986 0.2213 -0.0022 0.0429  -0.0601 58  VAL C CB  
1232 C  CG1 . VAL B  58  ? 0.2841 0.2779 0.2185 0.0074  0.0307  -0.0473 58  VAL C CG1 
1233 C  CG2 . VAL B  58  ? 0.3280 0.3142 0.2580 -0.0002 0.0559  -0.0800 58  VAL C CG2 
1234 N  N   . ILE B  59  ? 0.3071 0.2733 0.1704 -0.0105 0.0234  -0.0287 59  ILE C N   
1235 C  CA  . ILE B  59  ? 0.2790 0.2415 0.1489 -0.0103 0.0149  -0.0173 59  ILE C CA  
1236 C  C   . ILE B  59  ? 0.2910 0.2427 0.1472 -0.0098 0.0017  -0.0090 59  ILE C C   
1237 O  O   . ILE B  59  ? 0.2857 0.2367 0.1559 -0.0069 -0.0069 -0.0061 59  ILE C O   
1238 C  CB  . ILE B  59  ? 0.2869 0.2475 0.1628 -0.0164 0.0248  -0.0108 59  ILE C CB  
1239 C  CG1 . ILE B  59  ? 0.2825 0.2582 0.1754 -0.0187 0.0382  -0.0231 59  ILE C CG1 
1240 C  CG2 . ILE B  59  ? 0.2844 0.2396 0.1800 -0.0168 0.0198  -0.0032 59  ILE C CG2 
1241 C  CD1 . ILE B  59  ? 0.2643 0.2618 0.1786 -0.0142 0.0325  -0.0324 59  ILE C CD1 
1242 N  N   . GLU B  60  ? 0.3259 0.2757 0.1556 -0.0145 0.0003  -0.0072 60  GLU C N   
1243 C  CA  . GLU B  60  ? 0.3355 0.2838 0.1536 -0.0154 -0.0148 -0.0016 60  GLU C CA  
1244 C  C   . GLU B  60  ? 0.3268 0.2732 0.1593 -0.0111 -0.0202 -0.0156 60  GLU C C   
1245 O  O   . GLU B  60  ? 0.3336 0.2774 0.1746 -0.0093 -0.0314 -0.0114 60  GLU C O   
1246 C  CB  . GLU B  60  ? 0.3791 0.3382 0.1616 -0.0247 -0.0159 0.0015  60  GLU C CB  
1247 C  CG  . GLU B  60  ? 0.3982 0.3587 0.1704 -0.0287 -0.0141 0.0284  60  GLU C CG  
1248 C  CD  . GLU B  60  ? 0.4482 0.4281 0.1781 -0.0410 -0.0120 0.0347  60  GLU C CD  
1249 O  OE1 . GLU B  60  ? 0.4758 0.4713 0.1828 -0.0483 -0.0120 0.0115  60  GLU C OE1 
1250 O  OE2 . GLU B  60  ? 0.4590 0.4419 0.1793 -0.0455 -0.0090 0.0629  60  GLU C OE2 
1251 N  N   . HIS B  61  ? 0.3295 0.2767 0.1728 -0.0089 -0.0107 -0.0303 61  HIS C N   
1252 C  CA  . HIS B  61  ? 0.3242 0.2668 0.1905 -0.0046 -0.0127 -0.0390 61  HIS C CA  
1253 C  C   . HIS B  61  ? 0.2923 0.2352 0.1799 0.0018  -0.0178 -0.0253 61  HIS C C   
1254 O  O   . HIS B  61  ? 0.2768 0.2154 0.1778 0.0031  -0.0240 -0.0230 61  HIS C O   
1255 C  CB  . HIS B  61  ? 0.3461 0.2892 0.2329 -0.0024 0.0008  -0.0553 61  HIS C CB  
1256 C  CG  . HIS B  61  ? 0.3619 0.2980 0.2906 0.0057  0.0005  -0.0533 61  HIS C CG  
1257 N  ND1 . HIS B  61  ? 0.4017 0.3286 0.3457 0.0031  0.0001  -0.0652 61  HIS C ND1 
1258 C  CD2 . HIS B  61  ? 0.3602 0.3011 0.3196 0.0154  -0.0003 -0.0360 61  HIS C CD2 
1259 C  CE1 . HIS B  61  ? 0.3860 0.3061 0.3723 0.0114  0.0013  -0.0534 61  HIS C CE1 
1260 N  NE2 . HIS B  61  ? 0.3782 0.3093 0.3711 0.0192  -0.0005 -0.0325 61  HIS C NE2 
1261 N  N   . ILE B  62  ? 0.2792 0.2317 0.1713 0.0034  -0.0138 -0.0184 62  ILE C N   
1262 C  CA  . ILE B  62  ? 0.2642 0.2287 0.1713 0.0050  -0.0175 -0.0093 62  ILE C CA  
1263 C  C   . ILE B  62  ? 0.2599 0.2189 0.1638 0.0014  -0.0245 -0.0062 62  ILE C C   
1264 O  O   . ILE B  62  ? 0.2512 0.2143 0.1659 0.0013  -0.0284 -0.0023 62  ILE C O   
1265 C  CB  . ILE B  62  ? 0.2432 0.2277 0.1560 0.0033  -0.0117 -0.0096 62  ILE C CB  
1266 C  CG1 . ILE B  62  ? 0.2514 0.2468 0.1781 0.0089  -0.0073 -0.0102 62  ILE C CG1 
1267 C  CG2 . ILE B  62  ? 0.2359 0.2426 0.1580 -0.0008 -0.0146 -0.0063 62  ILE C CG2 
1268 C  CD1 . ILE B  62  ? 0.2550 0.2711 0.1866 0.0057  -0.0004 -0.0158 62  ILE C CD1 
1269 N  N   . MET B  63  ? 0.2716 0.2233 0.1652 -0.0016 -0.0254 -0.0054 63  MET C N   
1270 C  CA  A MET B  63  ? 0.2654 0.2135 0.1681 -0.0031 -0.0326 -0.0010 63  MET C CA  
1271 C  CA  B MET B  63  ? 0.2720 0.2198 0.1743 -0.0031 -0.0326 -0.0009 63  MET C CA  
1272 C  C   . MET B  63  ? 0.2716 0.2143 0.1736 -0.0025 -0.0426 -0.0024 63  MET C C   
1273 O  O   . MET B  63  ? 0.2589 0.2039 0.1779 -0.0033 -0.0460 -0.0022 63  MET C O   
1274 C  CB  A MET B  63  ? 0.2792 0.2214 0.1805 -0.0045 -0.0335 0.0077  63  MET C CB  
1275 C  CB  B MET B  63  ? 0.2967 0.2385 0.1957 -0.0046 -0.0334 0.0082  63  MET C CB  
1276 C  CG  A MET B  63  ? 0.2791 0.2194 0.2014 -0.0038 -0.0422 0.0133  63  MET C CG  
1277 C  CG  B MET B  63  ? 0.3175 0.2563 0.2286 -0.0037 -0.0452 0.0170  63  MET C CG  
1278 S  SD  A MET B  63  ? 0.3363 0.2715 0.2878 -0.0039 -0.0368 0.0252  63  MET C SD  
1279 S  SD  B MET B  63  ? 0.3467 0.2803 0.2737 -0.0034 -0.0439 0.0370  63  MET C SD  
1280 C  CE  A MET B  63  ? 0.2797 0.2144 0.2520 0.0001  -0.0544 0.0409  63  MET C CE  
1281 C  CE  B MET B  63  ? 0.3175 0.2517 0.2969 -0.0034 -0.0360 0.0266  63  MET C CE  
1282 N  N   . GLU B  64  ? 0.2855 0.2243 0.1721 -0.0032 -0.0446 -0.0081 64  GLU C N   
1283 C  CA  . GLU B  64  ? 0.2985 0.2353 0.1898 -0.0053 -0.0520 -0.0160 64  GLU C CA  
1284 C  C   . GLU B  64  ? 0.2801 0.2131 0.1958 -0.0030 -0.0476 -0.0168 64  GLU C C   
1285 O  O   . GLU B  64  ? 0.2681 0.2001 0.1989 -0.0051 -0.0524 -0.0176 64  GLU C O   
1286 C  CB  . GLU B  64  ? 0.3424 0.2816 0.2163 -0.0101 -0.0502 -0.0308 64  GLU C CB  
1287 C  CG  . GLU B  64  ? 0.3997 0.3415 0.2828 -0.0155 -0.0565 -0.0459 64  GLU C CG  
1288 C  CD  . GLU B  64  ? 0.4512 0.4036 0.3175 -0.0247 -0.0523 -0.0690 64  GLU C CD  
1289 O  OE1 . GLU B  64  ? 0.5344 0.4981 0.4033 -0.0334 -0.0584 -0.0871 64  GLU C OE1 
1290 O  OE2 . GLU B  64  ? 0.4980 0.4516 0.3499 -0.0251 -0.0416 -0.0724 64  GLU C OE2 
1291 N  N   . ASP B  65  ? 0.2668 0.2012 0.1894 0.0009  -0.0388 -0.0129 65  ASP C N   
1292 C  CA  . ASP B  65  ? 0.2670 0.2033 0.2134 0.0034  -0.0354 -0.0034 65  ASP C CA  
1293 C  C   . ASP B  65  ? 0.2329 0.1811 0.1822 -0.0004 -0.0378 0.0054  65  ASP C C   
1294 O  O   . ASP B  65  ? 0.2324 0.1807 0.1977 -0.0028 -0.0373 0.0112  65  ASP C O   
1295 C  CB  . ASP B  65  ? 0.2747 0.2197 0.2293 0.0092  -0.0289 0.0049  65  ASP C CB  
1296 C  CG  . ASP B  65  ? 0.3101 0.2618 0.2918 0.0128  -0.0273 0.0241  65  ASP C CG  
1297 O  OD1 . ASP B  65  ? 0.3657 0.3038 0.3706 0.0130  -0.0253 0.0266  65  ASP C OD1 
1298 O  OD2 . ASP B  65  ? 0.3623 0.3375 0.3440 0.0144  -0.0280 0.0389  65  ASP C OD2 
1299 N  N   . LEU B  66  ? 0.2170 0.1765 0.1559 -0.0027 -0.0374 0.0041  66  LEU C N   
1300 C  CA  . LEU B  66  ? 0.2033 0.1802 0.1499 -0.0089 -0.0347 0.0051  66  LEU C CA  
1301 C  C   . LEU B  66  ? 0.1994 0.1685 0.1580 -0.0118 -0.0387 -0.0012 66  LEU C C   
1302 O  O   . LEU B  66  ? 0.2017 0.1844 0.1736 -0.0183 -0.0342 -0.0037 66  LEU C O   
1303 C  CB  . LEU B  66  ? 0.2096 0.2020 0.1525 -0.0122 -0.0291 -0.0015 66  LEU C CB  
1304 C  CG  . LEU B  66  ? 0.1944 0.2076 0.1304 -0.0118 -0.0254 0.0023  66  LEU C CG  
1305 C  CD1 . LEU B  66  ? 0.1936 0.2136 0.1308 -0.0156 -0.0187 -0.0104 66  LEU C CD1 
1306 C  CD2 . LEU B  66  ? 0.2080 0.2529 0.1459 -0.0180 -0.0242 0.0113  66  LEU C CD2 
1307 N  N   . ASP B  67  ? 0.2107 0.1643 0.1658 -0.0084 -0.0471 -0.0043 67  ASP C N   
1308 C  CA  . ASP B  67  ? 0.2153 0.1671 0.1867 -0.0097 -0.0549 -0.0074 67  ASP C CA  
1309 C  C   . ASP B  67  ? 0.2179 0.1674 0.2026 -0.0127 -0.0577 -0.0112 67  ASP C C   
1310 O  O   . ASP B  67  ? 0.2387 0.1830 0.2218 -0.0127 -0.0666 -0.0166 67  ASP C O   
1311 C  CB  . ASP B  67  ? 0.2299 0.1765 0.1894 -0.0066 -0.0654 -0.0042 67  ASP C CB  
1312 C  CG  . ASP B  67  ? 0.2366 0.1880 0.2175 -0.0063 -0.0776 -0.0015 67  ASP C CG  
1313 O  OD1 . ASP B  67  ? 0.2261 0.1824 0.2386 -0.0078 -0.0744 -0.0053 67  ASP C OD1 
1314 O  OD2 . ASP B  67  ? 0.2604 0.2161 0.2278 -0.0054 -0.0907 0.0045  67  ASP C OD2 
1315 N  N   A THR B  68  ? 0.2157 0.1735 0.2150 -0.0177 -0.0491 -0.0100 68  THR C N   
1316 N  N   B THR B  68  ? 0.2152 0.1738 0.2140 -0.0177 -0.0487 -0.0099 68  THR C N   
1317 C  CA  A THR B  68  ? 0.2250 0.1786 0.2404 -0.0217 -0.0474 -0.0103 68  THR C CA  
1318 C  CA  B THR B  68  ? 0.2247 0.1820 0.2400 -0.0224 -0.0456 -0.0094 68  THR C CA  
1319 C  C   A THR B  68  ? 0.2341 0.1881 0.2721 -0.0244 -0.0556 -0.0210 68  THR C C   
1320 C  C   B THR B  68  ? 0.2345 0.1887 0.2706 -0.0242 -0.0548 -0.0201 68  THR C C   
1321 O  O   A THR B  68  ? 0.2488 0.1966 0.3005 -0.0276 -0.0574 -0.0271 68  THR C O   
1322 O  O   B THR B  68  ? 0.2563 0.2027 0.3024 -0.0265 -0.0563 -0.0251 68  THR C O   
1323 C  CB  A THR B  68  ? 0.2232 0.1911 0.2446 -0.0285 -0.0346 -0.0002 68  THR C CB  
1324 C  CB  B THR B  68  ? 0.2170 0.1941 0.2391 -0.0307 -0.0329 -0.0042 68  THR C CB  
1325 O  OG1 A THR B  68  ? 0.2136 0.2012 0.2397 -0.0345 -0.0289 -0.0075 68  THR C OG1 
1326 O  OG1 B THR B  68  ? 0.2144 0.2053 0.2160 -0.0306 -0.0274 0.0066  68  THR C OG1 
1327 C  CG2 A THR B  68  ? 0.2267 0.1992 0.2311 -0.0250 -0.0305 0.0153  68  THR C CG2 
1328 C  CG2 B THR B  68  ? 0.2227 0.1982 0.2623 -0.0368 -0.0272 0.0019  68  THR C CG2 
1329 N  N   . ASN B  69  ? 0.2332 0.1958 0.2834 -0.0234 -0.0606 -0.0243 69  ASN C N   
1330 C  CA  . ASN B  69  ? 0.2493 0.2174 0.3266 -0.0243 -0.0724 -0.0317 69  ASN C CA  
1331 C  C   . ASN B  69  ? 0.2701 0.2408 0.3353 -0.0192 -0.0915 -0.0294 69  ASN C C   
1332 O  O   . ASN B  69  ? 0.2860 0.2701 0.3744 -0.0190 -0.1059 -0.0310 69  ASN C O   
1333 C  CB  . ASN B  69  ? 0.2448 0.2250 0.3584 -0.0263 -0.0670 -0.0360 69  ASN C CB  
1334 C  CG  . ASN B  69  ? 0.2475 0.2292 0.3686 -0.0198 -0.0689 -0.0308 69  ASN C CG  
1335 O  OD1 . ASN B  69  ? 0.2489 0.2229 0.3430 -0.0143 -0.0741 -0.0210 69  ASN C OD1 
1336 N  ND2 . ASN B  69  ? 0.2769 0.2684 0.4428 -0.0214 -0.0615 -0.0388 69  ASN C ND2 
1337 N  N   . ALA B  70  ? 0.2735 0.2371 0.3034 -0.0161 -0.0920 -0.0241 70  ALA C N   
1338 C  CA  . ALA B  70  ? 0.3082 0.2800 0.3147 -0.0157 -0.1072 -0.0227 70  ALA C CA  
1339 C  C   . ALA B  70  ? 0.3234 0.3112 0.3399 -0.0112 -0.1247 -0.0067 70  ALA C C   
1340 O  O   . ALA B  70  ? 0.3500 0.3593 0.3563 -0.0139 -0.1436 -0.0040 70  ALA C O   
1341 C  CB  . ALA B  70  ? 0.3088 0.2873 0.3150 -0.0237 -0.1120 -0.0420 70  ALA C CB  
1342 N  N   . ASP B  71  ? 0.3995 0.2469 0.3186 0.0232  -0.1498 -0.0113 71  ASP C N   
1343 C  CA  . ASP B  71  ? 0.4138 0.2545 0.3260 0.0209  -0.1523 -0.0052 71  ASP C CA  
1344 C  C   . ASP B  71  ? 0.4369 0.2829 0.3184 0.0208  -0.1401 -0.0010 71  ASP C C   
1345 O  O   . ASP B  71  ? 0.4606 0.3023 0.3380 0.0172  -0.1403 0.0067  71  ASP C O   
1346 C  CB  . ASP B  71  ? 0.4035 0.2492 0.3497 0.0133  -0.1492 0.0022  71  ASP C CB  
1347 C  CG  . ASP B  71  ? 0.3907 0.2534 0.3458 0.0079  -0.1300 0.0057  71  ASP C CG  
1348 O  OD1 . ASP B  71  ? 0.3669 0.2378 0.3060 0.0085  -0.1190 0.0034  71  ASP C OD1 
1349 O  OD2 . ASP B  71  ? 0.3871 0.2557 0.3657 0.0044  -0.1266 0.0098  71  ASP C OD2 
1350 N  N   . LYS B  72  ? 0.4276 0.2841 0.2906 0.0244  -0.1296 -0.0048 72  LYS C N   
1351 C  CA  . LYS B  72  ? 0.4346 0.3016 0.2729 0.0238  -0.1160 0.0014  72  LYS C CA  
1352 C  C   . LYS B  72  ? 0.4043 0.2803 0.2588 0.0127  -0.1027 0.0116  72  LYS C C   
1353 O  O   . LYS B  72  ? 0.4247 0.3058 0.2653 0.0096  -0.0953 0.0209  72  LYS C O   
1354 C  CB  . LYS B  72  ? 0.4890 0.3472 0.2963 0.0297  -0.1243 0.0051  72  LYS C CB  
1355 C  CG  . LYS B  72  ? 0.5468 0.3891 0.3435 0.0406  -0.1446 -0.0061 72  LYS C CG  
1356 C  CD  . LYS B  72  ? 0.5682 0.4154 0.3500 0.0519  -0.1455 -0.0192 72  LYS C CD  
1357 C  CE  . LYS B  72  ? 0.6418 0.4707 0.4037 0.0654  -0.1690 -0.0308 72  LYS C CE  
1358 N  NZ  . LYS B  72  ? 0.6978 0.5318 0.4281 0.0817  -0.1705 -0.0442 72  LYS C NZ  
1359 N  N   A GLN B  73  ? 0.3610 0.2397 0.2451 0.0076  -0.1004 0.0101  73  GLN C N   
1360 N  N   B GLN B  73  ? 0.3655 0.2437 0.2499 0.0076  -0.1008 0.0102  73  GLN C N   
1361 C  CA  A GLN B  73  ? 0.3343 0.2209 0.2343 -0.0002 -0.0901 0.0156  73  GLN C CA  
1362 C  CA  B GLN B  73  ? 0.3572 0.2429 0.2592 -0.0004 -0.0909 0.0156  73  GLN C CA  
1363 C  C   A GLN B  73  ? 0.3022 0.2003 0.2214 -0.0010 -0.0826 0.0103  73  GLN C C   
1364 C  C   B GLN B  73  ? 0.3131 0.2115 0.2304 -0.0007 -0.0822 0.0102  73  GLN C C   
1365 O  O   A GLN B  73  ? 0.2934 0.1904 0.2241 0.0022  -0.0881 0.0057  73  GLN C O   
1366 O  O   B GLN B  73  ? 0.3056 0.2037 0.2295 0.0033  -0.0869 0.0046  73  GLN C O   
1367 C  CB  A GLN B  73  ? 0.3281 0.2045 0.2448 -0.0035 -0.0980 0.0196  73  GLN C CB  
1368 C  CB  B GLN B  73  ? 0.3593 0.2358 0.2823 -0.0030 -0.0992 0.0180  73  GLN C CB  
1369 C  CG  A GLN B  73  ? 0.3498 0.2135 0.2509 -0.0041 -0.1066 0.0271  73  GLN C CG  
1370 C  CG  B GLN B  73  ? 0.4009 0.2617 0.3143 -0.0024 -0.1118 0.0232  73  GLN C CG  
1371 C  CD  A GLN B  73  ? 0.3447 0.1987 0.2669 -0.0068 -0.1150 0.0297  73  GLN C CD  
1372 C  CD  B GLN B  73  ? 0.4258 0.2848 0.3265 -0.0073 -0.1083 0.0334  73  GLN C CD  
1373 O  OE1 A GLN B  73  ? 0.3234 0.1806 0.2700 -0.0057 -0.1163 0.0245  73  GLN C OE1 
1374 O  OE1 B GLN B  73  ? 0.4580 0.3097 0.3359 -0.0057 -0.1139 0.0399  73  GLN C OE1 
1375 N  NE2 A GLN B  73  ? 0.3640 0.2079 0.2779 -0.0097 -0.1207 0.0387  73  GLN C NE2 
1376 N  NE2 B GLN B  73  ? 0.4057 0.2715 0.3215 -0.0131 -0.1000 0.0357  73  GLN C NE2 
1377 N  N   . LEU B  74  ? 0.2876 0.1963 0.2119 -0.0053 -0.0714 0.0121  74  LEU C N   
1378 C  CA  . LEU B  74  ? 0.2515 0.1721 0.1919 -0.0055 -0.0643 0.0076  74  LEU C CA  
1379 C  C   . LEU B  74  ? 0.2442 0.1658 0.2051 -0.0072 -0.0644 0.0078  74  LEU C C   
1380 O  O   . LEU B  74  ? 0.2539 0.1737 0.2174 -0.0105 -0.0634 0.0098  74  LEU C O   
1381 C  CB  . LEU B  74  ? 0.2443 0.1774 0.1780 -0.0069 -0.0534 0.0068  74  LEU C CB  
1382 C  CG  . LEU B  74  ? 0.2584 0.1959 0.1725 -0.0030 -0.0507 0.0053  74  LEU C CG  
1383 C  CD1 . LEU B  74  ? 0.2567 0.2097 0.1718 -0.0050 -0.0394 0.0052  74  LEU C CD1 
1384 C  CD2 . LEU B  74  ? 0.2552 0.1884 0.1676 0.0041  -0.0580 -0.0018 74  LEU C CD2 
1385 N  N   . SER B  75  ? 0.2280 0.1543 0.2049 -0.0041 -0.0659 0.0058  75  SER C N   
1386 C  CA  . SER B  75  ? 0.2180 0.1527 0.2130 -0.0025 -0.0628 0.0046  75  SER C CA  
1387 C  C   . SER B  75  ? 0.2072 0.1541 0.2007 -0.0023 -0.0532 0.0011  75  SER C C   
1388 O  O   . SER B  75  ? 0.2083 0.1588 0.1915 -0.0036 -0.0490 0.0004  75  SER C O   
1389 C  CB  . SER B  75  ? 0.2114 0.1528 0.2245 0.0008  -0.0652 0.0068  75  SER C CB  
1390 O  OG  . SER B  75  ? 0.2082 0.1562 0.2213 0.0011  -0.0627 0.0077  75  SER C OG  
1391 N  N   . PHE B  76  ? 0.2038 0.1583 0.2081 0.0010  -0.0506 -0.0023 76  PHE C N   
1392 C  CA  . PHE B  76  ? 0.1929 0.1595 0.1961 0.0031  -0.0434 -0.0069 76  PHE C CA  
1393 C  C   . PHE B  76  ? 0.1849 0.1643 0.1890 0.0051  -0.0378 -0.0045 76  PHE C C   
1394 O  O   . PHE B  76  ? 0.1738 0.1583 0.1709 0.0041  -0.0335 -0.0064 76  PHE C O   
1395 C  CB  . PHE B  76  ? 0.2017 0.1753 0.2141 0.0097  -0.0430 -0.0132 76  PHE C CB  
1396 C  CG  . PHE B  76  ? 0.1958 0.1795 0.2040 0.0128  -0.0382 -0.0194 76  PHE C CG  
1397 C  CD1 . PHE B  76  ? 0.2101 0.1862 0.2146 0.0086  -0.0413 -0.0234 76  PHE C CD1 
1398 C  CD2 . PHE B  76  ? 0.2021 0.2030 0.2110 0.0187  -0.0314 -0.0192 76  PHE C CD2 
1399 C  CE1 . PHE B  76  ? 0.2076 0.1916 0.2095 0.0108  -0.0391 -0.0292 76  PHE C CE1 
1400 C  CE2 . PHE B  76  ? 0.1949 0.2041 0.1979 0.0222  -0.0285 -0.0252 76  PHE C CE2 
1401 C  CZ  . PHE B  76  ? 0.2018 0.2021 0.2014 0.0184  -0.0330 -0.0312 76  PHE C CZ  
1402 N  N   . GLU B  77  ? 0.1857 0.1701 0.2017 0.0073  -0.0390 0.0008  77  GLU C N   
1403 C  CA  . GLU B  77  ? 0.1787 0.1724 0.2003 0.0078  -0.0367 0.0063  77  GLU C CA  
1404 C  C   . GLU B  77  ? 0.1839 0.1683 0.1941 0.0043  -0.0397 0.0051  77  GLU C C   
1405 O  O   . GLU B  77  ? 0.1841 0.1760 0.1925 0.0051  -0.0362 0.0053  77  GLU C O   
1406 C  CB  . GLU B  77  ? 0.1837 0.1810 0.2243 0.0085  -0.0407 0.0146  77  GLU C CB  
1407 C  CG  . GLU B  77  ? 0.1924 0.2083 0.2469 0.0146  -0.0343 0.0174  77  GLU C CG  
1408 C  CD  . GLU B  77  ? 0.2123 0.2221 0.2691 0.0173  -0.0376 0.0119  77  GLU C CD  
1409 O  OE1 . GLU B  77  ? 0.2163 0.2062 0.2634 0.0132  -0.0450 0.0073  77  GLU C OE1 
1410 O  OE2 . GLU B  77  ? 0.2235 0.2507 0.2935 0.0244  -0.0328 0.0136  77  GLU C OE2 
1411 N  N   . GLU B  78  ? 0.1898 0.1591 0.1907 0.0019  -0.0463 0.0035  78  GLU C N   
1412 C  CA  . GLU B  78  ? 0.1986 0.1609 0.1863 0.0016  -0.0492 0.0008  78  GLU C CA  
1413 C  C   . GLU B  78  ? 0.2047 0.1732 0.1804 0.0006  -0.0411 -0.0033 78  GLU C C   
1414 O  O   . GLU B  78  ? 0.2083 0.1819 0.1800 0.0021  -0.0387 -0.0057 78  GLU C O   
1415 C  CB  . GLU B  78  ? 0.2156 0.1628 0.1930 0.0016  -0.0580 0.0000  78  GLU C CB  
1416 C  CG  . GLU B  78  ? 0.2196 0.1592 0.2106 0.0027  -0.0694 0.0030  78  GLU C CG  
1417 C  CD  . GLU B  78  ? 0.2562 0.1802 0.2383 0.0033  -0.0798 0.0022  78  GLU C CD  
1418 O  OE1 . GLU B  78  ? 0.2504 0.1705 0.2185 0.0019  -0.0773 0.0022  78  GLU C OE1 
1419 O  OE2 . GLU B  78  ? 0.2592 0.1740 0.2497 0.0050  -0.0924 0.0026  78  GLU C OE2 
1420 N  N   . PHE B  79  ? 0.1996 0.1675 0.1731 -0.0020 -0.0383 -0.0037 79  PHE C N   
1421 C  CA  . PHE B  79  ? 0.2061 0.1793 0.1734 -0.0045 -0.0326 -0.0057 79  PHE C CA  
1422 C  C   . PHE B  79  ? 0.1946 0.1803 0.1673 -0.0025 -0.0275 -0.0091 79  PHE C C   
1423 O  O   . PHE B  79  ? 0.2129 0.2048 0.1818 -0.0034 -0.0237 -0.0110 79  PHE C O   
1424 C  CB  . PHE B  79  ? 0.2084 0.1759 0.1786 -0.0082 -0.0343 -0.0043 79  PHE C CB  
1425 C  CG  . PHE B  79  ? 0.2123 0.1849 0.1833 -0.0124 -0.0308 -0.0046 79  PHE C CG  
1426 C  CD1 . PHE B  79  ? 0.2293 0.2042 0.1921 -0.0164 -0.0276 0.0006  79  PHE C CD1 
1427 C  CD2 . PHE B  79  ? 0.2130 0.1895 0.1941 -0.0114 -0.0314 -0.0096 79  PHE C CD2 
1428 C  CE1 . PHE B  79  ? 0.2367 0.2182 0.2067 -0.0215 -0.0250 0.0028  79  PHE C CE1 
1429 C  CE2 . PHE B  79  ? 0.2240 0.2038 0.2104 -0.0157 -0.0311 -0.0100 79  PHE C CE2 
1430 C  CZ  . PHE B  79  ? 0.2244 0.2071 0.2075 -0.0218 -0.0278 -0.0026 79  PHE C CZ  
1431 N  N   . ILE B  80  ? 0.1919 0.1834 0.1736 0.0009  -0.0271 -0.0093 80  ILE C N   
1432 C  CA  . ILE B  80  ? 0.1839 0.1876 0.1676 0.0039  -0.0229 -0.0123 80  ILE C CA  
1433 C  C   . ILE B  80  ? 0.1864 0.1950 0.1679 0.0048  -0.0215 -0.0113 80  ILE C C   
1434 O  O   . ILE B  80  ? 0.1882 0.2054 0.1691 0.0063  -0.0189 -0.0142 80  ILE C O   
1435 C  CB  . ILE B  80  ? 0.1883 0.2014 0.1790 0.0098  -0.0213 -0.0119 80  ILE C CB  
1436 C  CG1 . ILE B  80  ? 0.2045 0.2291 0.1922 0.0144  -0.0184 -0.0173 80  ILE C CG1 
1437 C  CG2 . ILE B  80  ? 0.1840 0.2016 0.1829 0.0113  -0.0214 -0.0034 80  ILE C CG2 
1438 C  CD1 . ILE B  80  ? 0.2336 0.2674 0.2223 0.0227  -0.0174 -0.0215 80  ILE C CD1 
1439 N  N   A MET B  81  ? 0.1901 0.1924 0.1716 0.0047  -0.0254 -0.0082 81  MET C N   
1440 N  N   B MET B  81  ? 0.1832 0.1854 0.1646 0.0047  -0.0254 -0.0083 81  MET C N   
1441 C  CA  A MET B  81  ? 0.1889 0.1930 0.1692 0.0066  -0.0268 -0.0092 81  MET C CA  
1442 C  CA  B MET B  81  ? 0.1791 0.1828 0.1591 0.0066  -0.0270 -0.0093 81  MET C CA  
1443 C  C   A MET B  81  ? 0.1893 0.1966 0.1607 0.0061  -0.0232 -0.0148 81  MET C C   
1444 C  C   B MET B  81  ? 0.1824 0.1887 0.1531 0.0064  -0.0238 -0.0149 81  MET C C   
1445 O  O   A MET B  81  ? 0.1929 0.2080 0.1660 0.0082  -0.0216 -0.0171 81  MET C O   
1446 O  O   B MET B  81  ? 0.1849 0.1963 0.1557 0.0091  -0.0235 -0.0177 81  MET C O   
1447 C  CB  A MET B  81  ? 0.1959 0.1892 0.1786 0.0077  -0.0352 -0.0071 81  MET C CB  
1448 C  CB  B MET B  81  ? 0.1821 0.1750 0.1646 0.0078  -0.0355 -0.0072 81  MET C CB  
1449 C  CG  A MET B  81  ? 0.1898 0.1836 0.1876 0.0070  -0.0385 0.0011  81  MET C CG  
1450 C  CG  B MET B  81  ? 0.1762 0.1712 0.1755 0.0080  -0.0396 0.0012  81  MET C CG  
1451 S  SD  A MET B  81  ? 0.1761 0.1875 0.1849 0.0086  -0.0326 0.0086  81  MET C SD  
1452 S  SD  B MET B  81  ? 0.2578 0.2638 0.2668 0.0098  -0.0391 0.0067  81  MET C SD  
1453 C  CE  A MET B  81  ? 0.1936 0.2012 0.2174 0.0086  -0.0423 0.0164  81  MET C CE  
1454 C  CE  B MET B  81  ? 0.1652 0.1753 0.1968 0.0080  -0.0430 0.0218  81  MET C CE  
1455 N  N   . LEU B  82  ? 0.1903 0.1937 0.1546 0.0032  -0.0216 -0.0154 82  LEU C N   
1456 C  CA  . LEU B  82  ? 0.1949 0.2056 0.1543 0.0021  -0.0166 -0.0173 82  LEU C CA  
1457 C  C   . LEU B  82  ? 0.1829 0.2031 0.1510 0.0001  -0.0135 -0.0189 82  LEU C C   
1458 O  O   . LEU B  82  ? 0.1905 0.2209 0.1609 0.0011  -0.0105 -0.0215 82  LEU C O   
1459 C  CB  . LEU B  82  ? 0.2038 0.2107 0.1558 -0.0017 -0.0151 -0.0133 82  LEU C CB  
1460 C  CG  . LEU B  82  ? 0.2083 0.2279 0.1589 -0.0036 -0.0082 -0.0115 82  LEU C CG  
1461 C  CD1 . LEU B  82  ? 0.2087 0.2373 0.1512 0.0040  -0.0056 -0.0163 82  LEU C CD1 
1462 C  CD2 . LEU B  82  ? 0.2218 0.2388 0.1674 -0.0088 -0.0067 -0.0032 82  LEU C CD2 
1463 N  N   . MET B  83  ? 0.1846 0.2021 0.1580 -0.0013 -0.0153 -0.0187 83  MET C N   
1464 C  CA  . MET B  83  ? 0.1802 0.2048 0.1603 -0.0014 -0.0153 -0.0226 83  MET C CA  
1465 C  C   . MET B  83  ? 0.1887 0.2219 0.1694 0.0038  -0.0150 -0.0250 83  MET C C   
1466 O  O   . MET B  83  ? 0.1717 0.2124 0.1561 0.0040  -0.0148 -0.0283 83  MET C O   
1467 C  CB  . MET B  83  ? 0.1952 0.2151 0.1787 -0.0006 -0.0188 -0.0246 83  MET C CB  
1468 C  CG  . MET B  83  ? 0.2034 0.2130 0.1888 -0.0056 -0.0215 -0.0219 83  MET C CG  
1469 S  SD  . MET B  83  ? 0.2191 0.2295 0.2132 -0.0140 -0.0225 -0.0191 83  MET C SD  
1470 C  CE  . MET B  83  ? 0.2136 0.2280 0.1983 -0.0169 -0.0155 -0.0109 83  MET C CE  
1471 N  N   . ALA B  84  ? 0.1873 0.2192 0.1664 0.0074  -0.0158 -0.0216 84  ALA C N   
1472 C  CA  . ALA B  84  ? 0.1880 0.2270 0.1686 0.0115  -0.0165 -0.0206 84  ALA C CA  
1473 C  C   . ALA B  84  ? 0.1853 0.2260 0.1663 0.0119  -0.0169 -0.0233 84  ALA C C   
1474 O  O   . ALA B  84  ? 0.1801 0.2284 0.1637 0.0142  -0.0175 -0.0257 84  ALA C O   
1475 C  CB  . ALA B  84  ? 0.2041 0.2414 0.1878 0.0135  -0.0182 -0.0129 84  ALA C CB  
1476 N  N   A ARG B  85  ? 0.1798 0.2143 0.1573 0.0111  -0.0172 -0.0236 85  ARG C N   
1477 N  N   B ARG B  85  ? 0.1887 0.2232 0.1662 0.0111  -0.0172 -0.0236 85  ARG C N   
1478 C  CA  A ARG B  85  ? 0.1898 0.2280 0.1663 0.0145  -0.0173 -0.0279 85  ARG C CA  
1479 C  CA  B ARG B  85  ? 0.2059 0.2441 0.1824 0.0144  -0.0173 -0.0279 85  ARG C CA  
1480 C  C   A ARG B  85  ? 0.1907 0.2413 0.1709 0.0130  -0.0123 -0.0312 85  ARG C C   
1481 C  C   B ARG B  85  ? 0.1995 0.2500 0.1796 0.0130  -0.0123 -0.0312 85  ARG C C   
1482 O  O   A ARG B  85  ? 0.1871 0.2459 0.1717 0.0168  -0.0127 -0.0349 85  ARG C O   
1483 O  O   B ARG B  85  ? 0.1938 0.2525 0.1784 0.0168  -0.0127 -0.0348 85  ARG C O   
1484 C  CB  A ARG B  85  ? 0.2058 0.2363 0.1741 0.0164  -0.0189 -0.0291 85  ARG C CB  
1485 C  CB  B ARG B  85  ? 0.2395 0.2701 0.2075 0.0163  -0.0187 -0.0291 85  ARG C CB  
1486 C  CG  A ARG B  85  ? 0.2206 0.2385 0.1906 0.0186  -0.0275 -0.0268 85  ARG C CG  
1487 C  CG  B ARG B  85  ? 0.2792 0.2980 0.2487 0.0199  -0.0277 -0.0283 85  ARG C CG  
1488 C  CD  A ARG B  85  ? 0.2437 0.2520 0.2036 0.0220  -0.0318 -0.0302 85  ARG C CD  
1489 C  CD  B ARG B  85  ? 0.3246 0.3332 0.2840 0.0227  -0.0320 -0.0310 85  ARG C CD  
1490 N  NE  A ARG B  85  ? 0.2453 0.2401 0.2108 0.0220  -0.0417 -0.0269 85  ARG C NE  
1491 N  NE  B ARG B  85  ? 0.3585 0.3733 0.3064 0.0289  -0.0289 -0.0381 85  ARG C NE  
1492 C  CZ  A ARG B  85  ? 0.2576 0.2406 0.2157 0.0248  -0.0489 -0.0295 85  ARG C CZ  
1493 C  CZ  B ARG B  85  ? 0.3712 0.4015 0.3174 0.0277  -0.0188 -0.0384 85  ARG C CZ  
1494 N  NH1 A ARG B  85  ? 0.2573 0.2288 0.2260 0.0239  -0.0593 -0.0255 85  ARG C NH1 
1495 N  NH1 B ARG B  85  ? 0.3981 0.4356 0.3536 0.0204  -0.0133 -0.0337 85  ARG C NH1 
1496 N  NH2 A ARG B  85  ? 0.2716 0.2562 0.2125 0.0289  -0.0458 -0.0353 85  ARG C NH2 
1497 N  NH2 B ARG B  85  ? 0.3849 0.4245 0.3212 0.0346  -0.0150 -0.0434 85  ARG C NH2 
1498 N  N   . LEU B  86  ? 0.1919 0.2437 0.1732 0.0072  -0.0089 -0.0291 86  LEU C N   
1499 C  CA  . LEU B  86  ? 0.1960 0.2596 0.1863 0.0038  -0.0054 -0.0296 86  LEU C CA  
1500 C  C   . LEU B  86  ? 0.1857 0.2540 0.1849 0.0043  -0.0093 -0.0332 86  LEU C C   
1501 O  O   . LEU B  86  ? 0.1900 0.2698 0.1991 0.0043  -0.0086 -0.0352 86  LEU C O   
1502 C  CB  . LEU B  86  ? 0.2030 0.2647 0.1952 -0.0035 -0.0030 -0.0240 86  LEU C CB  
1503 C  CG  . LEU B  86  ? 0.2125 0.2745 0.1943 -0.0032 0.0019  -0.0194 86  LEU C CG  
1504 C  CD1 . LEU B  86  ? 0.2199 0.2770 0.2045 -0.0113 0.0022  -0.0114 86  LEU C CD1 
1505 C  CD2 . LEU B  86  ? 0.2324 0.3114 0.2135 0.0012  0.0088  -0.0197 86  LEU C CD2 
1506 N  N   . THR B  87  ? 0.1771 0.2384 0.1726 0.0059  -0.0134 -0.0339 87  THR C N   
1507 C  CA  . THR B  87  ? 0.1685 0.2344 0.1674 0.0088  -0.0180 -0.0380 87  THR C CA  
1508 C  C   . THR B  87  ? 0.1647 0.2367 0.1641 0.0138  -0.0190 -0.0387 87  THR C C   
1509 O  O   . THR B  87  ? 0.1712 0.2513 0.1778 0.0152  -0.0220 -0.0426 87  THR C O   
1510 C  CB  . THR B  87  ? 0.1745 0.2353 0.1658 0.0123  -0.0206 -0.0382 87  THR C CB  
1511 O  OG1 . THR B  87  ? 0.1922 0.2458 0.1847 0.0087  -0.0214 -0.0389 87  THR C OG1 
1512 C  CG2 . THR B  87  ? 0.1751 0.2418 0.1655 0.0177  -0.0258 -0.0434 87  THR C CG2 
1513 N  N   . TRP B  88  ? 0.1566 0.2238 0.1504 0.0167  -0.0188 -0.0351 88  TRP C N   
1514 C  CA  . TRP B  88  ? 0.1673 0.2373 0.1638 0.0216  -0.0220 -0.0355 88  TRP C CA  
1515 C  C   . TRP B  88  ? 0.1700 0.2490 0.1741 0.0225  -0.0200 -0.0409 88  TRP C C   
1516 O  O   . TRP B  88  ? 0.1864 0.2728 0.1975 0.0258  -0.0231 -0.0439 88  TRP C O   
1517 C  CB  . TRP B  88  ? 0.1882 0.2484 0.1817 0.0234  -0.0243 -0.0311 88  TRP C CB  
1518 C  CG  . TRP B  88  ? 0.2147 0.2737 0.2133 0.0286  -0.0305 -0.0318 88  TRP C CG  
1519 C  CD1 . TRP B  88  ? 0.2321 0.2884 0.2322 0.0331  -0.0331 -0.0376 88  TRP C CD1 
1520 C  CD2 . TRP B  88  ? 0.2355 0.2960 0.2384 0.0315  -0.0365 -0.0268 88  TRP C CD2 
1521 N  NE1 . TRP B  88  ? 0.2417 0.2958 0.2491 0.0383  -0.0416 -0.0377 88  TRP C NE1 
1522 C  CE2 . TRP B  88  ? 0.2418 0.2983 0.2519 0.0366  -0.0439 -0.0300 88  TRP C CE2 
1523 C  CE3 . TRP B  88  ? 0.2560 0.3221 0.2564 0.0316  -0.0369 -0.0202 88  TRP C CE3 
1524 C  CZ2 . TRP B  88  ? 0.2863 0.3418 0.3036 0.0398  -0.0524 -0.0248 88  TRP C CZ2 
1525 C  CZ3 . TRP B  88  ? 0.2721 0.3399 0.2767 0.0352  -0.0437 -0.0141 88  TRP C CZ3 
1526 C  CH2 . TRP B  88  ? 0.3000 0.3617 0.3144 0.0383  -0.0517 -0.0156 88  TRP C CH2 
1527 N  N   . ALA B  89  ? 0.1711 0.2509 0.1735 0.0207  -0.0147 -0.0413 89  ALA C N   
1528 C  CA  . ALA B  89  ? 0.1708 0.2644 0.1801 0.0229  -0.0101 -0.0449 89  ALA C CA  
1529 C  C   . ALA B  89  ? 0.1798 0.2874 0.2046 0.0193  -0.0092 -0.0456 89  ALA C C   
1530 O  O   . ALA B  89  ? 0.1916 0.3125 0.2272 0.0232  -0.0088 -0.0492 89  ALA C O   
1531 C  CB  . ALA B  89  ? 0.1766 0.2718 0.1783 0.0220  -0.0031 -0.0429 89  ALA C CB  
1532 N  N   . SER B  90  ? 0.1723 0.2764 0.2000 0.0124  -0.0105 -0.0431 90  SER C N   
1533 C  CA  . SER B  90  ? 0.1731 0.2866 0.2175 0.0085  -0.0135 -0.0442 90  SER C CA  
1534 C  C   . SER B  90  ? 0.1728 0.2881 0.2198 0.0143  -0.0213 -0.0497 90  SER C C   
1535 O  O   . SER B  90  ? 0.1820 0.3101 0.2449 0.0150  -0.0232 -0.0522 90  SER C O   
1536 C  CB  . SER B  90  ? 0.1754 0.2810 0.2230 0.0014  -0.0172 -0.0424 90  SER C CB  
1537 O  OG  . SER B  90  ? 0.1733 0.2886 0.2429 -0.0036 -0.0214 -0.0427 90  SER C OG  
1538 N  N   . HIS B  91  ? 0.1868 0.2911 0.2195 0.0186  -0.0257 -0.0500 91  HIS C N   
1539 C  CA  . HIS B  91  ? 0.1836 0.2893 0.2155 0.0244  -0.0334 -0.0526 91  HIS C CA  
1540 C  C   . HIS B  91  ? 0.1962 0.3085 0.2351 0.0295  -0.0339 -0.0540 91  HIS C C   
1541 O  O   . HIS B  91  ? 0.1833 0.3030 0.2318 0.0327  -0.0399 -0.0575 91  HIS C O   
1542 C  CB  . HIS B  91  ? 0.1914 0.2877 0.2071 0.0278  -0.0357 -0.0487 91  HIS C CB  
1543 C  CG  . HIS B  91  ? 0.1992 0.2985 0.2112 0.0341  -0.0436 -0.0490 91  HIS C CG  
1544 N  ND1 . HIS B  91  ? 0.2130 0.3098 0.2189 0.0384  -0.0456 -0.0422 91  HIS C ND1 
1545 C  CD2 . HIS B  91  ? 0.2126 0.3171 0.2272 0.0369  -0.0514 -0.0548 91  HIS C CD2 
1546 C  CE1 . HIS B  91  ? 0.2192 0.3205 0.2213 0.0438  -0.0530 -0.0422 91  HIS C CE1 
1547 N  NE2 . HIS B  91  ? 0.2146 0.3203 0.2209 0.0435  -0.0568 -0.0512 91  HIS C NE2 
1548 N  N   . GLU B  92  ? 0.2088 0.3175 0.2432 0.0313  -0.0294 -0.0526 92  GLU C N   
1549 C  CA  . GLU B  92  ? 0.2241 0.3385 0.2654 0.0384  -0.0309 -0.0568 92  GLU C CA  
1550 C  C   . GLU B  92  ? 0.2283 0.3619 0.2868 0.0386  -0.0268 -0.0611 92  GLU C C   
1551 O  O   . GLU B  92  ? 0.2276 0.3695 0.2975 0.0447  -0.0316 -0.0656 92  GLU C O   
1552 C  CB  . GLU B  92  ? 0.2270 0.3342 0.2598 0.0418  -0.0280 -0.0573 92  GLU C CB  
1553 C  CG  . GLU B  92  ? 0.2503 0.3397 0.2730 0.0420  -0.0340 -0.0520 92  GLU C CG  
1554 C  CD  . GLU B  92  ? 0.2893 0.3733 0.3170 0.0473  -0.0447 -0.0505 92  GLU C CD  
1555 O  OE1 . GLU B  92  ? 0.3235 0.4044 0.3561 0.0545  -0.0503 -0.0559 92  GLU C OE1 
1556 O  OE2 . GLU B  92  ? 0.3308 0.4137 0.3570 0.0453  -0.0483 -0.0439 92  GLU C OE2 
1557 N  N   . LYS B  93  ? 0.2171 0.3586 0.2801 0.0318  -0.0188 -0.0583 93  LYS C N   
1558 C  CA  . LYS B  93  ? 0.2171 0.3805 0.3009 0.0301  -0.0135 -0.0584 93  LYS C CA  
1559 C  C   . LYS B  93  ? 0.2026 0.3705 0.3026 0.0286  -0.0228 -0.0609 93  LYS C C   
1560 O  O   . LYS B  93  ? 0.1969 0.3821 0.3163 0.0318  -0.0232 -0.0636 93  LYS C O   
1561 C  CB  . LYS B  93  ? 0.2340 0.4032 0.3213 0.0210  -0.0047 -0.0509 93  LYS C CB  
1562 C  CG  . LYS B  93  ? 0.2584 0.4529 0.3725 0.0164  0.0013  -0.0460 93  LYS C CG  
1563 C  CD  . LYS B  93  ? 0.2945 0.5116 0.4117 0.0224  0.0142  -0.0439 93  LYS C CD  
1564 C  CE  . LYS B  93  ? 0.3220 0.5641 0.4633 0.0132  0.0239  -0.0312 93  LYS C CE  
1565 N  NZ  . LYS B  93  ? 0.3090 0.5564 0.4817 0.0017  0.0163  -0.0258 93  LYS C NZ  
1566 N  N   . MET B  94  ? 0.2029 0.3565 0.2947 0.0251  -0.0308 -0.0607 94  MET C N   
1567 C  CA  . MET B  94  ? 0.1975 0.3529 0.3003 0.0252  -0.0422 -0.0646 94  MET C CA  
1568 C  C   . MET B  94  ? 0.2001 0.3580 0.3039 0.0341  -0.0491 -0.0686 94  MET C C   
1569 O  O   . MET B  94  ? 0.1978 0.3629 0.3166 0.0355  -0.0582 -0.0725 94  MET C O   
1570 C  CB  . MET B  94  ? 0.1979 0.3377 0.2856 0.0236  -0.0496 -0.0655 94  MET C CB  
1571 C  CG  . MET B  94  ? 0.1971 0.3333 0.2886 0.0149  -0.0462 -0.0626 94  MET C CG  
1572 S  SD  . MET B  94  ? 0.2127 0.3316 0.2852 0.0169  -0.0555 -0.0668 94  MET C SD  
1573 C  CE  . MET B  94  ? 0.2150 0.3288 0.2965 0.0067  -0.0519 -0.0629 94  MET C CE  
1574 N  N   . HIS B  95  ? 0.2044 0.3551 0.2947 0.0401  -0.0471 -0.0678 95  HIS C N   
1575 C  CA  . HIS B  95  ? 0.2078 0.3576 0.2999 0.0486  -0.0555 -0.0703 95  HIS C CA  
1576 C  C   . HIS B  95  ? 0.2237 0.3836 0.3270 0.0553  -0.0519 -0.0746 95  HIS C C   
1577 O  O   . HIS B  95  ? 0.2423 0.3978 0.3467 0.0632  -0.0599 -0.0770 95  HIS C O   
1578 C  CB  . HIS B  95  ? 0.2036 0.3361 0.2752 0.0510  -0.0607 -0.0649 95  HIS C CB  
1579 C  CG  . HIS B  95  ? 0.2019 0.3292 0.2618 0.0497  -0.0670 -0.0621 95  HIS C CG  
1580 N  ND1 . HIS B  95  ? 0.2182 0.3484 0.2807 0.0542  -0.0781 -0.0640 95  HIS C ND1 
1581 C  CD2 . HIS B  95  ? 0.2076 0.3275 0.2512 0.0463  -0.0641 -0.0586 95  HIS C CD2 
1582 C  CE1 . HIS B  95  ? 0.2189 0.3444 0.2647 0.0546  -0.0817 -0.0621 95  HIS C CE1 
1583 N  NE2 . HIS B  95  ? 0.2109 0.3306 0.2458 0.0501  -0.0728 -0.0591 95  HIS C NE2 
1584 N  N   . GLU B  96  ? 0.2359 0.4106 0.3485 0.0533  -0.0406 -0.0755 96  GLU C N   
1585 C  CA  . GLU B  96  ? 0.2604 0.4469 0.3785 0.0627  -0.0349 -0.0810 96  GLU C CA  
1586 C  C   . GLU B  96  ? 0.2423 0.4438 0.3826 0.0701  -0.0415 -0.0872 96  GLU C C   
1587 O  O   . GLU B  96  ? 0.2334 0.4487 0.3926 0.0653  -0.0422 -0.0859 96  GLU C O   
1588 C  CB  . GLU B  96  ? 0.3024 0.5069 0.4246 0.0596  -0.0196 -0.0783 96  GLU C CB  
1589 C  CG  . GLU B  96  ? 0.3468 0.5635 0.4669 0.0724  -0.0130 -0.0852 96  GLU C CG  
1590 C  CD  . GLU B  96  ? 0.4141 0.6549 0.5376 0.0709  0.0038  -0.0804 96  GLU C CD  
1591 O  OE1 . GLU B  96  ? 0.4909 0.7384 0.6024 0.0824  0.0101  -0.0860 96  GLU C OE1 
1592 O  OE2 . GLU B  96  ? 0.4176 0.6701 0.5551 0.0590  0.0098  -0.0706 96  GLU C OE2 
1593 N  N   . GLY B  97  ? 0.2382 0.4341 0.3777 0.0815  -0.0491 -0.0937 97  GLY C N   
1594 C  CA  . GLY B  97  ? 0.2374 0.4454 0.3980 0.0900  -0.0573 -0.1002 97  GLY C CA  
1595 C  C   . GLY B  97  ? 0.2363 0.4376 0.4034 0.0863  -0.0709 -0.0974 97  GLY C C   
1596 O  O   . GLY B  97  ? 0.2343 0.4500 0.4235 0.0906  -0.0769 -0.1017 97  GLY C O   
1597 N  N   . ASP B  98  ? 0.2388 0.4202 0.3863 0.0793  -0.0757 -0.0902 98  ASP C N   
1598 C  CA  . ASP B  98  ? 0.2377 0.4126 0.3839 0.0771  -0.0882 -0.0871 98  ASP C CA  
1599 C  C   . ASP B  98  ? 0.2525 0.4219 0.4043 0.0867  -0.1023 -0.0890 98  ASP C C   
1600 O  O   . ASP B  98  ? 0.2582 0.4137 0.4015 0.0917  -0.1060 -0.0872 98  ASP C O   
1601 C  CB  . ASP B  98  ? 0.2455 0.4021 0.3653 0.0710  -0.0881 -0.0788 98  ASP C CB  
1602 C  CG  . ASP B  98  ? 0.2545 0.4076 0.3670 0.0690  -0.0978 -0.0765 98  ASP C CG  
1603 O  OD1 . ASP B  98  ? 0.2626 0.4226 0.3882 0.0727  -0.1082 -0.0804 98  ASP C OD1 
1604 O  OD2 . ASP B  98  ? 0.2664 0.4097 0.3585 0.0651  -0.0951 -0.0711 98  ASP C OD2 
1605 N  N   . GLU B  99  ? 0.2426 0.4222 0.4116 0.0892  -0.1118 -0.0926 99  GLU C N   
1606 C  CA  . GLU B  99  ? 0.2629 0.4380 0.4398 0.0982  -0.1277 -0.0939 99  GLU C CA  
1607 C  C   . GLU B  99  ? 0.2764 0.4390 0.4374 0.0968  -0.1410 -0.0864 99  GLU C C   
1608 O  O   . GLU B  99  ? 0.3063 0.4632 0.4704 0.1033  -0.1554 -0.0845 99  GLU C O   
1609 C  CB  . GLU B  99  ? 0.2616 0.4592 0.4708 0.1040  -0.1297 -0.1036 99  GLU C CB  
1610 C  CG  . GLU B  99  ? 0.2607 0.4744 0.4833 0.1093  -0.1161 -0.1109 99  GLU C CG  
1611 C  CD  . GLU B  99  ? 0.2656 0.5064 0.5224 0.1167  -0.1165 -0.1195 99  GLU C CD  
1612 O  OE1 . GLU B  99  ? 0.2694 0.5130 0.5410 0.1175  -0.1299 -0.1202 99  GLU C OE1 
1613 O  OE2 . GLU B  99  ? 0.2688 0.5296 0.5374 0.1228  -0.1034 -0.1254 99  GLU C OE2 
1614 N  N   . GLY B  100 ? 0.2843 0.4432 0.4274 0.0895  -0.1368 -0.0821 100 GLY C N   
1615 C  CA  . GLY B  100 ? 0.2958 0.4451 0.4181 0.0907  -0.1482 -0.0753 100 GLY C CA  
1616 C  C   . GLY B  100 ? 0.2993 0.4561 0.4355 0.0955  -0.1636 -0.0813 100 GLY C C   
1617 O  O   . GLY B  100 ? 0.2994 0.4706 0.4643 0.0955  -0.1638 -0.0904 100 GLY C O   
1618 N  N   . PRO B  101 ? 0.3162 0.4652 0.4334 0.1002  -0.1769 -0.0753 101 PRO C N   
1619 C  CA  . PRO B  101 ? 0.3312 0.4685 0.4161 0.1013  -0.1767 -0.0619 101 PRO C CA  
1620 C  C   . PRO B  101 ? 0.3343 0.4722 0.3988 0.0977  -0.1697 -0.0639 101 PRO C C   
1621 O  O   . PRO B  101 ? 0.3218 0.4662 0.3985 0.0944  -0.1692 -0.0756 101 PRO C O   
1622 C  CB  . PRO B  101 ? 0.3499 0.4847 0.4267 0.1094  -0.1950 -0.0569 101 PRO C CB  
1623 C  CG  . PRO B  101 ? 0.3501 0.4946 0.4466 0.1115  -0.2054 -0.0716 101 PRO C CG  
1624 C  CD  . PRO B  101 ? 0.3231 0.4777 0.4523 0.1058  -0.1943 -0.0816 101 PRO C CD  
1625 N  N   . GLY B  102 ? 0.3539 0.4856 0.3900 0.0984  -0.1649 -0.0519 102 GLY C N   
1626 C  CA  . GLY B  102 ? 0.3615 0.4941 0.3753 0.0980  -0.1597 -0.0547 102 GLY C CA  
1627 C  C   . GLY B  102 ? 0.3348 0.4680 0.3611 0.0890  -0.1457 -0.0617 102 GLY C C   
1628 O  O   . GLY B  102 ? 0.3431 0.4758 0.3867 0.0840  -0.1374 -0.0603 102 GLY C O   
1629 N  N   . HIS B  103 ? 0.3281 0.4620 0.3460 0.0881  -0.1449 -0.0700 103 HIS C N   
1630 C  CA  . HIS B  103 ? 0.2989 0.4315 0.3225 0.0796  -0.1315 -0.0733 103 HIS C CA  
1631 C  C   . HIS B  103 ? 0.3066 0.4433 0.3546 0.0738  -0.1344 -0.0856 103 HIS C C   
1632 O  O   . HIS B  103 ? 0.3166 0.4537 0.3660 0.0774  -0.1482 -0.0949 103 HIS C O   
1633 C  CB  . HIS B  103 ? 0.2985 0.4273 0.2935 0.0826  -0.1269 -0.0706 103 HIS C CB  
1634 C  CG  . HIS B  103 ? 0.2768 0.4024 0.2760 0.0743  -0.1136 -0.0714 103 HIS C CG  
1635 N  ND1 . HIS B  103 ? 0.2720 0.3960 0.2781 0.0709  -0.1155 -0.0820 103 HIS C ND1 
1636 C  CD2 . HIS B  103 ? 0.2606 0.3833 0.2602 0.0687  -0.1000 -0.0622 103 HIS C CD2 
1637 C  CE1 . HIS B  103 ? 0.2559 0.3766 0.2645 0.0635  -0.1023 -0.0783 103 HIS C CE1 
1638 N  NE2 . HIS B  103 ? 0.2435 0.3637 0.2474 0.0625  -0.0930 -0.0670 103 HIS C NE2 
1639 N  N   . HIS B  104 ? 0.2928 0.4331 0.3610 0.0650  -0.1228 -0.0852 104 HIS C N   
1640 C  CA  . HIS B  104 ? 0.3006 0.4464 0.3939 0.0571  -0.1228 -0.0921 104 HIS C CA  
1641 C  C   . HIS B  104 ? 0.2805 0.4276 0.3797 0.0488  -0.1059 -0.0869 104 HIS C C   
1642 O  O   . HIS B  104 ? 0.2581 0.4051 0.3517 0.0497  -0.0960 -0.0809 104 HIS C O   
1643 C  CB  . HIS B  104 ? 0.3354 0.4936 0.4610 0.0568  -0.1320 -0.0970 104 HIS C CB  
1644 C  CG  . HIS B  104 ? 0.3608 0.5319 0.5217 0.0468  -0.1261 -0.0975 104 HIS C CG  
1645 N  ND1 . HIS B  104 ? 0.3876 0.5591 0.5670 0.0408  -0.1355 -0.1021 104 HIS C ND1 
1646 C  CD2 . HIS B  104 ? 0.3785 0.5651 0.5617 0.0428  -0.1126 -0.0929 104 HIS C CD2 
1647 C  CE1 . HIS B  104 ? 0.3817 0.5690 0.5952 0.0314  -0.1270 -0.0972 104 HIS C CE1 
1648 N  NE2 . HIS B  104 ? 0.3928 0.5909 0.6063 0.0335  -0.1117 -0.0918 104 HIS C NE2 
1649 N  N   . HIS B  105 ? 0.2530 0.3991 0.3614 0.0415  -0.1045 -0.0891 105 HIS C N   
1650 C  CA  . HIS B  105 ? 0.2472 0.3966 0.3645 0.0330  -0.0899 -0.0834 105 HIS C CA  
1651 C  C   . HIS B  105 ? 0.2503 0.4153 0.4029 0.0254  -0.0883 -0.0824 105 HIS C C   
1652 O  O   . HIS B  105 ? 0.2758 0.4422 0.4481 0.0215  -0.1002 -0.0863 105 HIS C O   
1653 C  CB  . HIS B  105 ? 0.2364 0.3736 0.3399 0.0292  -0.0882 -0.0833 105 HIS C CB  
1654 C  CG  . HIS B  105 ? 0.2263 0.3523 0.2969 0.0354  -0.0844 -0.0809 105 HIS C CG  
1655 N  ND1 . HIS B  105 ? 0.2213 0.3372 0.2751 0.0369  -0.0865 -0.0834 105 HIS C ND1 
1656 C  CD2 . HIS B  105 ? 0.2272 0.3520 0.2818 0.0407  -0.0789 -0.0750 105 HIS C CD2 
1657 C  CE1 . HIS B  105 ? 0.2138 0.3256 0.2431 0.0425  -0.0805 -0.0782 105 HIS C CE1 
1658 N  NE2 . HIS B  105 ? 0.2138 0.3301 0.2445 0.0439  -0.0765 -0.0721 105 HIS C NE2 
1659 N  N   . LYS B  106 ? 0.2343 0.4116 0.3956 0.0238  -0.0742 -0.0767 106 LYS C N   
1660 C  CA  . LYS B  106 ? 0.2476 0.4429 0.4384 0.0153  -0.0661 -0.0709 106 LYS C CA  
1661 C  C   . LYS B  106 ? 0.2424 0.4297 0.4274 0.0065  -0.0593 -0.0645 106 LYS C C   
1662 O  O   . LYS B  106 ? 0.2260 0.3944 0.3838 0.0082  -0.0603 -0.0663 106 LYS C O   
1663 C  CB  . LYS B  106 ? 0.2627 0.4751 0.4579 0.0204  -0.0525 -0.0683 106 LYS C CB  
1664 C  CG  . LYS B  106 ? 0.2950 0.5161 0.5001 0.0295  -0.0595 -0.0745 106 LYS C CG  
1665 C  CD  . LYS B  106 ? 0.3211 0.5657 0.5411 0.0346  -0.0467 -0.0732 106 LYS C CD  
1666 C  CE  . LYS B  106 ? 0.3409 0.5759 0.5352 0.0447  -0.0419 -0.0768 106 LYS C CE  
1667 N  NZ  . LYS B  106 ? 0.3860 0.6451 0.5987 0.0544  -0.0359 -0.0808 106 LYS C NZ  
1668 N  N   . PRO B  107 ? 0.2381 0.4411 0.4495 -0.0027 -0.0523 -0.0557 107 PRO C N   
1669 C  CA  . PRO B  107 ? 0.2286 0.4248 0.4341 -0.0110 -0.0448 -0.0474 107 PRO C CA  
1670 C  C   . PRO B  107 ? 0.2191 0.4070 0.3917 -0.0057 -0.0324 -0.0464 107 PRO C C   
1671 O  O   . PRO B  107 ? 0.2204 0.4155 0.3834 0.0028  -0.0256 -0.0489 107 PRO C O   
1672 C  CB  . PRO B  107 ? 0.2363 0.4582 0.4773 -0.0203 -0.0364 -0.0345 107 PRO C CB  
1673 C  CG  . PRO B  107 ? 0.2349 0.4701 0.5082 -0.0203 -0.0479 -0.0382 107 PRO C CG  
1674 C  CD  . PRO B  107 ? 0.2369 0.4660 0.4885 -0.0070 -0.0520 -0.0509 107 PRO C CD  
1675 N  N   . GLY B  108 ? 0.2079 0.3790 0.3647 -0.0099 -0.0320 -0.0437 108 GLY C N   
1676 C  CA  . GLY B  108 ? 0.1971 0.3585 0.3250 -0.0058 -0.0224 -0.0425 108 GLY C CA  
1677 C  C   . GLY B  108 ? 0.1998 0.3723 0.3298 -0.0104 -0.0087 -0.0318 108 GLY C C   
1678 O  O   . GLY B  108 ? 0.1939 0.3890 0.3465 -0.0140 -0.0020 -0.0244 108 GLY C O   
1679 N  N   . LEU B  109 ? 0.2027 0.3614 0.3086 -0.0092 -0.0041 -0.0303 109 LEU C N   
1680 C  CA  . LEU B  109 ? 0.2213 0.3889 0.3229 -0.0117 0.0080  -0.0207 109 LEU C CA  
1681 C  C   . LEU B  109 ? 0.2325 0.4082 0.3568 -0.0240 0.0091  -0.0079 109 LEU C C   
1682 O  O   . LEU B  109 ? 0.2343 0.3974 0.3704 -0.0313 -0.0020 -0.0079 109 LEU C O   
1683 C  CB  . LEU B  109 ? 0.2265 0.3748 0.3002 -0.0091 0.0093  -0.0215 109 LEU C CB  
1684 C  CG  . LEU B  109 ? 0.2413 0.3839 0.2925 0.0017  0.0117  -0.0282 109 LEU C CG  
1685 C  CD1 . LEU B  109 ? 0.2308 0.3541 0.2622 0.0001  0.0111  -0.0255 109 LEU C CD1 
1686 C  CD2 . LEU B  109 ? 0.2394 0.4024 0.2906 0.0095  0.0210  -0.0287 109 LEU C CD2 
1687 N  N   . GLY B  110 ? 0.2514 0.4505 0.3838 -0.0254 0.0219  0.0033  110 GLY C N   
1688 C  CA  . GLY B  110 ? 0.2713 0.4814 0.4255 -0.0377 0.0253  0.0205  110 GLY C CA  
1689 C  C   . GLY B  110 ? 0.2852 0.5115 0.4801 -0.0462 0.0197  0.0264  110 GLY C C   
1690 O  O   . GLY B  110 ? 0.2906 0.5237 0.5105 -0.0587 0.0189  0.0423  110 GLY C O   
1691 N  N   . GLU B  111 ? 0.2843 0.5151 0.4878 -0.0400 0.0138  0.0143  111 GLU C N   
1692 C  CA  . GLU B  111 ? 0.3176 0.5637 0.5615 -0.0466 0.0061  0.0175  111 GLU C CA  
1693 C  C   . GLU B  111 ? 0.3325 0.6099 0.5868 -0.0382 0.0174  0.0169  111 GLU C C   
1694 O  O   . GLU B  111 ? 0.4250 0.7329 0.7108 -0.0439 0.0258  0.0314  111 GLU C O   
1695 C  CB  . GLU B  111 ? 0.3222 0.5448 0.5673 -0.0452 -0.0141 0.0019  111 GLU C CB  
1696 C  CG  . GLU B  111 ? 0.3474 0.5389 0.5785 -0.0493 -0.0261 -0.0018 111 GLU C CG  
1697 C  CD  . GLU B  111 ? 0.3712 0.5441 0.6034 -0.0456 -0.0461 -0.0176 111 GLU C CD  
1698 O  OE1 . GLU B  111 ? 0.4343 0.6081 0.6994 -0.0531 -0.0602 -0.0163 111 GLU C OE1 
1699 O  OE2 . GLU B  111 ? 0.3647 0.5230 0.5660 -0.0350 -0.0485 -0.0305 111 GLU C OE2 
1700 N  N   . MET C  1   ? 0.4877 0.5668 0.4058 0.1417  -0.0040 -0.0662 1   MET K N   
1701 C  CA  . MET C  1   ? 0.4475 0.5047 0.3620 0.1312  -0.0143 -0.0694 1   MET K CA  
1702 C  C   . MET C  1   ? 0.3917 0.4451 0.3233 0.1129  -0.0141 -0.0599 1   MET K C   
1703 O  O   . MET C  1   ? 0.3810 0.4377 0.3266 0.1092  -0.0135 -0.0570 1   MET K O   
1704 C  CB  . MET C  1   ? 0.4750 0.5107 0.3857 0.1373  -0.0298 -0.0832 1   MET K CB  
1705 C  CG  . MET C  1   ? 0.4781 0.4933 0.3868 0.1290  -0.0408 -0.0855 1   MET K CG  
1706 S  SD  . MET C  1   ? 0.9122 0.9032 0.8191 0.1393  -0.0615 -0.1016 1   MET K SD  
1707 C  CE  . MET C  1   ? 0.5564 0.5513 0.4353 0.1610  -0.0625 -0.1141 1   MET K CE  
1708 N  N   . LEU C  2   ? 0.3435 0.3900 0.2733 0.1026  -0.0153 -0.0556 2   LEU K N   
1709 C  CA  . LEU C  2   ? 0.3108 0.3518 0.2537 0.0879  -0.0170 -0.0485 2   LEU K CA  
1710 C  C   . LEU C  2   ? 0.2944 0.3195 0.2433 0.0858  -0.0273 -0.0529 2   LEU K C   
1711 O  O   . LEU C  2   ? 0.3062 0.3195 0.2503 0.0922  -0.0359 -0.0611 2   LEU K O   
1712 C  CB  . LEU C  2   ? 0.3110 0.3474 0.2488 0.0797  -0.0168 -0.0442 2   LEU K CB  
1713 C  CG  . LEU C  2   ? 0.3289 0.3785 0.2699 0.0740  -0.0083 -0.0345 2   LEU K CG  
1714 C  CD1 . LEU C  2   ? 0.3230 0.3936 0.2722 0.0781  0.0012  -0.0276 2   LEU K CD1 
1715 C  CD2 . LEU C  2   ? 0.3230 0.3683 0.2533 0.0716  -0.0085 -0.0335 2   LEU K CD2 
1716 N  N   . THR C  3   ? 0.2644 0.2890 0.2246 0.0774  -0.0277 -0.0469 3   THR K N   
1717 C  CA  . THR C  3   ? 0.2588 0.2714 0.2258 0.0748  -0.0360 -0.0471 3   THR K CA  
1718 C  C   . THR C  3   ? 0.2572 0.2580 0.2222 0.0693  -0.0414 -0.0446 3   THR K C   
1719 O  O   . THR C  3   ? 0.2491 0.2513 0.2073 0.0658  -0.0381 -0.0426 3   THR K O   
1720 C  CB  . THR C  3   ? 0.2428 0.2602 0.2194 0.0696  -0.0344 -0.0409 3   THR K CB  
1721 O  OG1 . THR C  3   ? 0.2405 0.2589 0.2152 0.0623  -0.0321 -0.0349 3   THR K OG1 
1722 C  CG2 . THR C  3   ? 0.2415 0.2723 0.2242 0.0730  -0.0290 -0.0409 3   THR K CG2 
1723 N  N   . GLU C  4   ? 0.2611 0.2518 0.2346 0.0679  -0.0496 -0.0427 4   GLU K N   
1724 C  CA  . GLU C  4   ? 0.2708 0.2523 0.2478 0.0625  -0.0549 -0.0374 4   GLU K CA  
1725 C  C   . GLU C  4   ? 0.2419 0.2300 0.2170 0.0556  -0.0481 -0.0286 4   GLU K C   
1726 O  O   . GLU C  4   ? 0.2364 0.2218 0.2088 0.0519  -0.0481 -0.0259 4   GLU K O   
1727 C  CB  . GLU C  4   ? 0.3048 0.2768 0.2968 0.0624  -0.0650 -0.0335 4   GLU K CB  
1728 C  CG  . GLU C  4   ? 0.3561 0.3177 0.3507 0.0704  -0.0756 -0.0443 4   GLU K CG  
1729 C  CD  . GLU C  4   ? 0.4094 0.3626 0.3943 0.0751  -0.0813 -0.0538 4   GLU K CD  
1730 O  OE1 . GLU C  4   ? 0.5051 0.4588 0.4779 0.0854  -0.0819 -0.0660 4   GLU K OE1 
1731 O  OE2 . GLU C  4   ? 0.4293 0.3756 0.4180 0.0702  -0.0860 -0.0495 4   GLU K OE2 
1732 N  N   . LEU C  5   ? 0.2280 0.2240 0.2047 0.0547  -0.0437 -0.0249 5   LEU K N   
1733 C  CA  . LEU C  5   ? 0.2109 0.2127 0.1836 0.0507  -0.0389 -0.0193 5   LEU K CA  
1734 C  C   . LEU C  5   ? 0.2118 0.2174 0.1770 0.0485  -0.0342 -0.0222 5   LEU K C   
1735 O  O   . LEU C  5   ? 0.2042 0.2087 0.1658 0.0450  -0.0333 -0.0190 5   LEU K O   
1736 C  CB  . LEU C  5   ? 0.2036 0.2118 0.1782 0.0524  -0.0377 -0.0172 5   LEU K CB  
1737 C  CG  . LEU C  5   ? 0.1990 0.2115 0.1681 0.0510  -0.0356 -0.0139 5   LEU K CG  
1738 C  CD1 . LEU C  5   ? 0.2053 0.2162 0.1727 0.0507  -0.0358 -0.0059 5   LEU K CD1 
1739 C  CD2 . LEU C  5   ? 0.1912 0.2081 0.1616 0.0546  -0.0373 -0.0143 5   LEU K CD2 
1740 N  N   . GLU C  6   ? 0.2171 0.2281 0.1810 0.0512  -0.0312 -0.0272 6   GLU K N   
1741 C  CA  . GLU C  6   ? 0.2134 0.2303 0.1727 0.0495  -0.0263 -0.0273 6   GLU K CA  
1742 C  C   . GLU C  6   ? 0.2192 0.2296 0.1706 0.0491  -0.0277 -0.0289 6   GLU K C   
1743 O  O   . GLU C  6   ? 0.2114 0.2229 0.1591 0.0452  -0.0255 -0.0263 6   GLU K O   
1744 C  CB  . GLU C  6   ? 0.2177 0.2452 0.1798 0.0542  -0.0219 -0.0294 6   GLU K CB  
1745 C  CG  . GLU C  6   ? 0.2161 0.2506 0.1891 0.0530  -0.0214 -0.0268 6   GLU K CG  
1746 C  CD  . GLU C  6   ? 0.2287 0.2744 0.2084 0.0584  -0.0174 -0.0275 6   GLU K CD  
1747 O  OE1 . GLU C  6   ? 0.2135 0.2673 0.2053 0.0567  -0.0168 -0.0238 6   GLU K OE1 
1748 O  OE2 . GLU C  6   ? 0.2375 0.2846 0.2110 0.0655  -0.0155 -0.0318 6   GLU K OE2 
1749 N  N   . LYS C  7   ? 0.2255 0.2278 0.1754 0.0537  -0.0330 -0.0337 7   LYS K N   
1750 C  CA  . LYS C  7   ? 0.2409 0.2344 0.1846 0.0541  -0.0375 -0.0364 7   LYS K CA  
1751 C  C   . LYS C  7   ? 0.2289 0.2168 0.1770 0.0469  -0.0399 -0.0295 7   LYS K C   
1752 O  O   . LYS C  7   ? 0.2366 0.2216 0.1799 0.0445  -0.0404 -0.0290 7   LYS K O   
1753 C  CB  . LYS C  7   ? 0.2644 0.2477 0.2091 0.0612  -0.0467 -0.0438 7   LYS K CB  
1754 C  CG  . LYS C  7   ? 0.2902 0.2791 0.2252 0.0719  -0.0446 -0.0524 7   LYS K CG  
1755 C  CD  . LYS C  7   ? 0.3138 0.2899 0.2489 0.0809  -0.0567 -0.0623 7   LYS K CD  
1756 C  CE  . LYS C  7   ? 0.3362 0.3183 0.2581 0.0953  -0.0553 -0.0724 7   LYS K CE  
1757 N  NZ  . LYS C  7   ? 0.3762 0.3449 0.3010 0.1048  -0.0689 -0.0831 7   LYS K NZ  
1758 N  N   . ALA C  8   ? 0.2167 0.2047 0.1740 0.0444  -0.0410 -0.0235 8   ALA K N   
1759 C  CA  . ALA C  8   ? 0.2107 0.1974 0.1728 0.0398  -0.0416 -0.0148 8   ALA K CA  
1760 C  C   . ALA C  8   ? 0.2081 0.2009 0.1628 0.0366  -0.0356 -0.0131 8   ALA K C   
1761 O  O   . ALA C  8   ? 0.2133 0.2040 0.1675 0.0336  -0.0359 -0.0095 8   ALA K O   
1762 C  CB  . ALA C  8   ? 0.2121 0.2022 0.1824 0.0406  -0.0417 -0.0076 8   ALA K CB  
1763 N  N   . LEU C  9   ? 0.2023 0.2023 0.1540 0.0374  -0.0314 -0.0154 9   LEU K N   
1764 C  CA  . LEU C  9   ? 0.2027 0.2074 0.1508 0.0346  -0.0282 -0.0143 9   LEU K CA  
1765 C  C   . LEU C  9   ? 0.2104 0.2141 0.1534 0.0324  -0.0269 -0.0161 9   LEU K C   
1766 O  O   . LEU C  9   ? 0.2118 0.2144 0.1527 0.0292  -0.0267 -0.0137 9   LEU K O   
1767 C  CB  . LEU C  9   ? 0.2035 0.2149 0.1546 0.0357  -0.0270 -0.0155 9   LEU K CB  
1768 C  CG  . LEU C  9   ? 0.2064 0.2189 0.1603 0.0392  -0.0291 -0.0145 9   LEU K CG  
1769 C  CD1 . LEU C  9   ? 0.2099 0.2274 0.1680 0.0401  -0.0305 -0.0166 9   LEU K CD1 
1770 C  CD2 . LEU C  9   ? 0.2079 0.2191 0.1587 0.0410  -0.0302 -0.0094 9   LEU K CD2 
1771 N  N   . ASN C  10  ? 0.2135 0.2183 0.1537 0.0356  -0.0260 -0.0202 10  ASN K N   
1772 C  CA  . ASN C  10  ? 0.2201 0.2249 0.1527 0.0358  -0.0247 -0.0214 10  ASN K CA  
1773 C  C   . ASN C  10  ? 0.2302 0.2242 0.1598 0.0345  -0.0302 -0.0221 10  ASN K C   
1774 O  O   . ASN C  10  ? 0.2502 0.2429 0.1746 0.0324  -0.0300 -0.0212 10  ASN K O   
1775 C  CB  . ASN C  10  ? 0.2322 0.2427 0.1591 0.0428  -0.0220 -0.0255 10  ASN K CB  
1776 C  CG  . ASN C  10  ? 0.2258 0.2505 0.1584 0.0429  -0.0151 -0.0212 10  ASN K CG  
1777 O  OD1 . ASN C  10  ? 0.2193 0.2480 0.1594 0.0369  -0.0139 -0.0158 10  ASN K OD1 
1778 N  ND2 . ASN C  10  ? 0.2280 0.2607 0.1588 0.0505  -0.0117 -0.0234 10  ASN K ND2 
1779 N  N   . SER C  11  ? 0.2284 0.2148 0.1638 0.0356  -0.0360 -0.0226 11  SER K N   
1780 C  CA  . SER C  11  ? 0.2338 0.2101 0.1727 0.0336  -0.0429 -0.0210 11  SER K CA  
1781 C  C   . SER C  11  ? 0.2233 0.2019 0.1660 0.0278  -0.0404 -0.0132 11  SER K C   
1782 O  O   . SER C  11  ? 0.2282 0.2019 0.1712 0.0253  -0.0435 -0.0116 11  SER K O   
1783 C  CB  . SER C  11  ? 0.2371 0.2060 0.1876 0.0354  -0.0507 -0.0203 11  SER K CB  
1784 O  OG  . SER C  11  ? 0.2416 0.2013 0.2014 0.0326  -0.0589 -0.0164 11  SER K OG  
1785 N  N   . ILE C  12  ? 0.2122 0.1984 0.1569 0.0270  -0.0354 -0.0091 12  ILE K N   
1786 C  CA  . ILE C  12  ? 0.2046 0.1942 0.1496 0.0244  -0.0330 -0.0035 12  ILE K CA  
1787 C  C   . ILE C  12  ? 0.2131 0.2030 0.1514 0.0216  -0.0314 -0.0057 12  ILE K C   
1788 O  O   . ILE C  12  ? 0.2130 0.2006 0.1518 0.0191  -0.0325 -0.0028 12  ILE K O   
1789 C  CB  . ILE C  12  ? 0.2012 0.1981 0.1468 0.0272  -0.0300 -0.0011 12  ILE K CB  
1790 C  CG1 . ILE C  12  ? 0.2045 0.2023 0.1579 0.0301  -0.0312 0.0049  12  ILE K CG1 
1791 C  CG2 . ILE C  12  ? 0.1984 0.1987 0.1411 0.0275  -0.0284 0.0018  12  ILE K CG2 
1792 C  CD1 . ILE C  12  ? 0.2034 0.2083 0.1547 0.0351  -0.0290 0.0062  12  ILE K CD1 
1793 N  N   . ILE C  13  ? 0.2139 0.2070 0.1475 0.0220  -0.0292 -0.0099 13  ILE K N   
1794 C  CA  . ILE C  13  ? 0.2130 0.2076 0.1420 0.0196  -0.0277 -0.0099 13  ILE K CA  
1795 C  C   . ILE C  13  ? 0.2180 0.2052 0.1418 0.0197  -0.0313 -0.0115 13  ILE K C   
1796 O  O   . ILE C  13  ? 0.2186 0.2035 0.1409 0.0165  -0.0323 -0.0093 13  ILE K O   
1797 C  CB  . ILE C  13  ? 0.2199 0.2228 0.1480 0.0212  -0.0237 -0.0109 13  ILE K CB  
1798 C  CG1 . ILE C  13  ? 0.2124 0.2210 0.1487 0.0208  -0.0229 -0.0097 13  ILE K CG1 
1799 C  CG2 . ILE C  13  ? 0.2321 0.2383 0.1567 0.0192  -0.0218 -0.0082 13  ILE K CG2 
1800 C  CD1 . ILE C  13  ? 0.2118 0.2303 0.1530 0.0225  -0.0192 -0.0086 13  ILE K CD1 
1801 N  N   A ASP C  14  ? 0.2289 0.2110 0.1504 0.0239  -0.0350 -0.0159 14  ASP K N   
1802 N  N   B ASP C  14  ? 0.2267 0.2089 0.1484 0.0239  -0.0349 -0.0159 14  ASP K N   
1803 C  CA  A ASP C  14  ? 0.2437 0.2165 0.1603 0.0256  -0.0416 -0.0192 14  ASP K CA  
1804 C  CA  B ASP C  14  ? 0.2411 0.2138 0.1581 0.0260  -0.0418 -0.0195 14  ASP K CA  
1805 C  C   A ASP C  14  ? 0.2370 0.2033 0.1631 0.0207  -0.0464 -0.0142 14  ASP K C   
1806 C  C   B ASP C  14  ? 0.2359 0.2018 0.1619 0.0211  -0.0467 -0.0146 14  ASP K C   
1807 O  O   A ASP C  14  ? 0.2389 0.2006 0.1623 0.0188  -0.0496 -0.0138 14  ASP K O   
1808 O  O   B ASP C  14  ? 0.2393 0.2002 0.1621 0.0197  -0.0503 -0.0149 14  ASP K O   
1809 C  CB  A ASP C  14  ? 0.2666 0.2327 0.1805 0.0327  -0.0480 -0.0266 14  ASP K CB  
1810 C  CB  B ASP C  14  ? 0.2590 0.2258 0.1749 0.0328  -0.0477 -0.0264 14  ASP K CB  
1811 C  CG  A ASP C  14  ? 0.2834 0.2580 0.1865 0.0399  -0.0426 -0.0312 14  ASP K CG  
1812 C  CG  B ASP C  14  ? 0.2809 0.2360 0.1904 0.0374  -0.0578 -0.0328 14  ASP K CG  
1813 O  OD1 A ASP C  14  ? 0.2850 0.2700 0.1823 0.0394  -0.0349 -0.0280 14  ASP K OD1 
1814 O  OD1 B ASP C  14  ? 0.2968 0.2532 0.1935 0.0399  -0.0566 -0.0349 14  ASP K OD1 
1815 O  OD2 A ASP C  14  ? 0.3117 0.2835 0.2141 0.0465  -0.0462 -0.0372 14  ASP K OD2 
1816 O  OD2 B ASP C  14  ? 0.2941 0.2382 0.2125 0.0391  -0.0683 -0.0356 14  ASP K OD2 
1817 N  N   . VAL C  15  ? 0.2230 0.1904 0.1609 0.0192  -0.0464 -0.0089 15  VAL K N   
1818 C  CA  . VAL C  15  ? 0.2183 0.1834 0.1683 0.0157  -0.0495 -0.0010 15  VAL K CA  
1819 C  C   . VAL C  15  ? 0.2137 0.1825 0.1594 0.0125  -0.0455 0.0016  15  VAL K C   
1820 O  O   . VAL C  15  ? 0.2149 0.1787 0.1643 0.0101  -0.0498 0.0039  15  VAL K O   
1821 C  CB  . VAL C  15  ? 0.2107 0.1820 0.1723 0.0163  -0.0469 0.0071  15  VAL K CB  
1822 C  CG1 . VAL C  15  ? 0.2124 0.1870 0.1861 0.0140  -0.0468 0.0182  15  VAL K CG1 
1823 C  CG2 . VAL C  15  ? 0.2204 0.1856 0.1920 0.0183  -0.0539 0.0066  15  VAL K CG2 
1824 N  N   . TYR C  16  ? 0.2093 0.1858 0.1489 0.0127  -0.0390 0.0010  16  TYR K N   
1825 C  CA  . TYR C  16  ? 0.2046 0.1839 0.1416 0.0103  -0.0368 0.0028  16  TYR K CA  
1826 C  C   . TYR C  16  ? 0.2111 0.1850 0.1420 0.0079  -0.0396 0.0002  16  TYR K C   
1827 O  O   . TYR C  16  ? 0.2153 0.1866 0.1483 0.0052  -0.0417 0.0029  16  TYR K O   
1828 C  CB  . TYR C  16  ? 0.1983 0.1842 0.1321 0.0113  -0.0329 0.0012  16  TYR K CB  
1829 C  CG  . TYR C  16  ? 0.1935 0.1803 0.1261 0.0092  -0.0331 0.0018  16  TYR K CG  
1830 C  CD1 . TYR C  16  ? 0.1960 0.1843 0.1312 0.0109  -0.0335 0.0047  16  TYR K CD1 
1831 C  CD2 . TYR C  16  ? 0.1972 0.1844 0.1270 0.0062  -0.0332 0.0004  16  TYR K CD2 
1832 C  CE1 . TYR C  16  ? 0.1980 0.1860 0.1326 0.0098  -0.0352 0.0041  16  TYR K CE1 
1833 C  CE2 . TYR C  16  ? 0.1971 0.1841 0.1286 0.0037  -0.0350 0.0017  16  TYR K CE2 
1834 C  CZ  . TYR C  16  ? 0.1920 0.1783 0.1258 0.0056  -0.0367 0.0024  16  TYR K CZ  
1835 O  OH  . TYR C  16  ? 0.1945 0.1794 0.1304 0.0039  -0.0400 0.0026  16  TYR K OH  
1836 N  N   . HIS C  17  ? 0.2243 0.1976 0.1470 0.0100  -0.0395 -0.0047 17  HIS K N   
1837 C  CA  . HIS C  17  ? 0.2417 0.2121 0.1555 0.0100  -0.0414 -0.0067 17  HIS K CA  
1838 C  C   . HIS C  17  ? 0.2596 0.2193 0.1734 0.0108  -0.0498 -0.0087 17  HIS K C   
1839 O  O   . HIS C  17  ? 0.2610 0.2175 0.1680 0.0103  -0.0524 -0.0092 17  HIS K O   
1840 C  CB  . HIS C  17  ? 0.2451 0.2216 0.1489 0.0148  -0.0376 -0.0098 17  HIS K CB  
1841 C  CG  . HIS C  17  ? 0.2384 0.2260 0.1458 0.0126  -0.0308 -0.0055 17  HIS K CG  
1842 N  ND1 . HIS C  17  ? 0.2235 0.2154 0.1391 0.0119  -0.0285 -0.0050 17  HIS K ND1 
1843 C  CD2 . HIS C  17  ? 0.2374 0.2326 0.1443 0.0106  -0.0273 -0.0005 17  HIS K CD2 
1844 C  CE1 . HIS C  17  ? 0.2245 0.2246 0.1452 0.0097  -0.0253 -0.0010 17  HIS K CE1 
1845 N  NE2 . HIS C  17  ? 0.2354 0.2379 0.1525 0.0083  -0.0244 0.0027  17  HIS K NE2 
1846 N  N   . LYS C  18  ? 0.2593 0.2128 0.1823 0.0118  -0.0556 -0.0091 18  LYS K N   
1847 C  CA  . LYS C  18  ? 0.2815 0.2234 0.2107 0.0114  -0.0665 -0.0096 18  LYS K CA  
1848 C  C   . LYS C  18  ? 0.2624 0.2050 0.1985 0.0059  -0.0661 -0.0029 18  LYS K C   
1849 O  O   . LYS C  18  ? 0.2783 0.2124 0.2157 0.0052  -0.0744 -0.0038 18  LYS K O   
1850 C  CB  . LYS C  18  ? 0.3122 0.2481 0.2580 0.0118  -0.0740 -0.0075 18  LYS K CB  
1851 C  CG  . LYS C  18  ? 0.3613 0.2952 0.3006 0.0181  -0.0758 -0.0153 18  LYS K CG  
1852 C  CD  . LYS C  18  ? 0.4166 0.3426 0.3740 0.0188  -0.0859 -0.0138 18  LYS K CD  
1853 C  CE  . LYS C  18  ? 0.4651 0.3829 0.4119 0.0277  -0.0936 -0.0264 18  LYS K CE  
1854 N  NZ  . LYS C  18  ? 0.5204 0.4311 0.4844 0.0293  -0.1031 -0.0261 18  LYS K NZ  
1855 N  N   . TYR C  19  ? 0.2426 0.1949 0.1838 0.0032  -0.0578 0.0034  19  TYR K N   
1856 C  CA  . TYR C  19  ? 0.2319 0.1864 0.1799 -0.0003 -0.0569 0.0096  19  TYR K CA  
1857 C  C   . TYR C  19  ? 0.2300 0.1878 0.1669 -0.0018 -0.0527 0.0076  19  TYR K C   
1858 O  O   . TYR C  19  ? 0.2317 0.1868 0.1692 -0.0044 -0.0553 0.0093  19  TYR K O   
1859 C  CB  . TYR C  19  ? 0.2200 0.1835 0.1806 0.0005  -0.0519 0.0181  19  TYR K CB  
1860 C  CG  . TYR C  19  ? 0.2229 0.1841 0.1980 0.0012  -0.0566 0.0228  19  TYR K CG  
1861 C  CD1 . TYR C  19  ? 0.2344 0.1893 0.2261 -0.0014 -0.0652 0.0286  19  TYR K CD1 
1862 C  CD2 . TYR C  19  ? 0.2204 0.1839 0.1947 0.0039  -0.0546 0.0212  19  TYR K CD2 
1863 C  CE1 . TYR C  19  ? 0.2387 0.1893 0.2476 -0.0014 -0.0727 0.0331  19  TYR K CE1 
1864 C  CE2 . TYR C  19  ? 0.2315 0.1913 0.2210 0.0042  -0.0608 0.0255  19  TYR K CE2 
1865 C  CZ  . TYR C  19  ? 0.2447 0.1984 0.2529 0.0014  -0.0699 0.0323  19  TYR K CZ  
1866 O  OH  . TYR C  19  ? 0.2660 0.2145 0.2933 0.0013  -0.0787 0.0369  19  TYR K OH  
1867 N  N   . SER C  20  ? 0.2266 0.1905 0.1564 -0.0005 -0.0471 0.0050  20  SER K N   
1868 C  CA  . SER C  20  ? 0.2253 0.1927 0.1496 -0.0026 -0.0446 0.0051  20  SER K CA  
1869 C  C   . SER C  20  ? 0.2360 0.2000 0.1509 -0.0030 -0.0470 0.0038  20  SER K C   
1870 O  O   . SER C  20  ? 0.2609 0.2262 0.1748 -0.0058 -0.0470 0.0065  20  SER K O   
1871 C  CB  . SER C  20  ? 0.2177 0.1925 0.1417 -0.0015 -0.0399 0.0043  20  SER K CB  
1872 O  OG  . SER C  20  ? 0.2172 0.1945 0.1349 0.0007  -0.0378 0.0021  20  SER K OG  
1873 N  N   . LEU C  21  ? 0.2376 0.1975 0.1445 0.0011  -0.0499 -0.0004 21  LEU K N   
1874 C  CA  . LEU C  21  ? 0.2490 0.2067 0.1428 0.0041  -0.0525 -0.0023 21  LEU K CA  
1875 C  C   . LEU C  21  ? 0.2500 0.1965 0.1437 0.0035  -0.0617 -0.0037 21  LEU K C   
1876 O  O   . LEU C  21  ? 0.2662 0.2094 0.1467 0.0075  -0.0656 -0.0063 21  LEU K O   
1877 C  CB  . LEU C  21  ? 0.2638 0.2233 0.1453 0.0123  -0.0517 -0.0078 21  LEU K CB  
1878 C  CG  . LEU C  21  ? 0.2572 0.2292 0.1410 0.0126  -0.0424 -0.0050 21  LEU K CG  
1879 C  CD1 . LEU C  21  ? 0.2796 0.2549 0.1521 0.0221  -0.0411 -0.0102 21  LEU K CD1 
1880 C  CD2 . LEU C  21  ? 0.2589 0.2411 0.1447 0.0090  -0.0367 0.0029  21  LEU K CD2 
1881 N  N   . ILE C  22  ? 0.2410 0.1831 0.1495 -0.0009 -0.0653 -0.0010 22  ILE K N   
1882 C  CA  . ILE C  22  ? 0.2479 0.1801 0.1615 -0.0025 -0.0747 -0.0005 22  ILE K CA  
1883 C  C   . ILE C  22  ? 0.2453 0.1786 0.1513 -0.0047 -0.0741 0.0017  22  ILE K C   
1884 O  O   . ILE C  22  ? 0.2558 0.1821 0.1515 -0.0018 -0.0810 -0.0015 22  ILE K O   
1885 C  CB  . ILE C  22  ? 0.2419 0.1740 0.1769 -0.0066 -0.0762 0.0060  22  ILE K CB  
1886 C  CG1 . ILE C  22  ? 0.2441 0.1746 0.1891 -0.0045 -0.0788 0.0059  22  ILE K CG1 
1887 C  CG2 . ILE C  22  ? 0.2538 0.1778 0.1970 -0.0092 -0.0853 0.0083  22  ILE K CG2 
1888 C  CD1 . ILE C  22  ? 0.2471 0.1832 0.2140 -0.0073 -0.0769 0.0161  22  ILE K CD1 
1889 N  N   . LYS C  23  ? 0.2399 0.1814 0.1502 -0.0087 -0.0668 0.0066  23  LYS K N   
1890 C  CA  . LYS C  23  ? 0.2348 0.1772 0.1423 -0.0116 -0.0670 0.0100  23  LYS K CA  
1891 C  C   . LYS C  23  ? 0.2212 0.1725 0.1336 -0.0145 -0.0605 0.0139  23  LYS K C   
1892 O  O   . LYS C  23  ? 0.2070 0.1632 0.1260 -0.0143 -0.0563 0.0136  23  LYS K O   
1893 C  CB  . LYS C  23  ? 0.2326 0.1682 0.1504 -0.0149 -0.0735 0.0121  23  LYS K CB  
1894 C  CG  . LYS C  23  ? 0.2243 0.1638 0.1584 -0.0166 -0.0708 0.0157  23  LYS K CG  
1895 C  CD  . LYS C  23  ? 0.2270 0.1629 0.1729 -0.0191 -0.0759 0.0197  23  LYS K CD  
1896 C  CE  . LYS C  23  ? 0.2263 0.1699 0.1875 -0.0181 -0.0716 0.0251  23  LYS K CE  
1897 N  NZ  . LYS C  23  ? 0.2350 0.1798 0.2070 -0.0164 -0.0721 0.0282  23  LYS K NZ  
1898 N  N   . GLY C  24  ? 0.2307 0.1832 0.1415 -0.0171 -0.0613 0.0178  24  GLY K N   
1899 C  CA  . GLY C  24  ? 0.2161 0.1747 0.1354 -0.0204 -0.0587 0.0218  24  GLY K CA  
1900 C  C   . GLY C  24  ? 0.2193 0.1866 0.1393 -0.0193 -0.0533 0.0234  24  GLY K C   
1901 O  O   . GLY C  24  ? 0.2267 0.1982 0.1373 -0.0159 -0.0499 0.0238  24  GLY K O   
1902 N  N   . ASN C  25  ? 0.2115 0.1809 0.1426 -0.0206 -0.0534 0.0230  25  ASN K N   
1903 C  CA  . ASN C  25  ? 0.2106 0.1876 0.1473 -0.0203 -0.0503 0.0247  25  ASN K CA  
1904 C  C   . ASN C  25  ? 0.2099 0.1886 0.1387 -0.0159 -0.0457 0.0201  25  ASN K C   
1905 O  O   . ASN C  25  ? 0.2091 0.1830 0.1357 -0.0137 -0.0464 0.0153  25  ASN K O   
1906 C  CB  . ASN C  25  ? 0.2105 0.1860 0.1599 -0.0210 -0.0550 0.0226  25  ASN K CB  
1907 C  CG  . ASN C  25  ? 0.2126 0.1940 0.1710 -0.0207 -0.0547 0.0236  25  ASN K CG  
1908 O  OD1 . ASN C  25  ? 0.2183 0.2020 0.1723 -0.0174 -0.0508 0.0200  25  ASN K OD1 
1909 N  ND2 . ASN C  25  ? 0.2211 0.2047 0.1949 -0.0246 -0.0599 0.0294  25  ASN K ND2 
1910 N  N   A PHE C  26  ? 0.2160 0.2028 0.1423 -0.0142 -0.0411 0.0232  26  PHE K N   
1911 N  N   B PHE C  26  ? 0.2134 0.2002 0.1396 -0.0142 -0.0411 0.0232  26  PHE K N   
1912 C  CA  A PHE C  26  ? 0.2183 0.2071 0.1364 -0.0091 -0.0371 0.0188  26  PHE K CA  
1913 C  CA  B PHE C  26  ? 0.2150 0.2035 0.1330 -0.0091 -0.0372 0.0187  26  PHE K CA  
1914 C  C   A PHE C  26  ? 0.2126 0.2009 0.1373 -0.0083 -0.0369 0.0144  26  PHE K C   
1915 C  C   B PHE C  26  ? 0.2106 0.1982 0.1351 -0.0083 -0.0372 0.0142  26  PHE K C   
1916 O  O   A PHE C  26  ? 0.2141 0.2013 0.1337 -0.0045 -0.0352 0.0100  26  PHE K O   
1917 O  O   B PHE C  26  ? 0.2106 0.1962 0.1298 -0.0047 -0.0360 0.0096  26  PHE K O   
1918 C  CB  A PHE C  26  ? 0.2289 0.2290 0.1422 -0.0057 -0.0313 0.0241  26  PHE K CB  
1919 C  CB  B PHE C  26  ? 0.2204 0.2205 0.1352 -0.0061 -0.0314 0.0240  26  PHE K CB  
1920 C  CG  A PHE C  26  ? 0.2294 0.2400 0.1575 -0.0097 -0.0295 0.0345  26  PHE K CG  
1921 C  CG  B PHE C  26  ? 0.2323 0.2360 0.1363 -0.0035 -0.0301 0.0291  26  PHE K CG  
1922 C  CD1 A PHE C  26  ? 0.2234 0.2364 0.1673 -0.0125 -0.0309 0.0349  26  PHE K CD1 
1923 C  CD1 B PHE C  26  ? 0.2427 0.2371 0.1318 0.0003  -0.0341 0.0231  26  PHE K CD1 
1924 C  CD2 A PHE C  26  ? 0.2459 0.2647 0.1738 -0.0103 -0.0274 0.0450  26  PHE K CD2 
1925 C  CD2 B PHE C  26  ? 0.2367 0.2536 0.1465 -0.0042 -0.0257 0.0409  26  PHE K CD2 
1926 C  CE1 A PHE C  26  ? 0.2206 0.2421 0.1835 -0.0168 -0.0321 0.0452  26  PHE K CE1 
1927 C  CE1 B PHE C  26  ? 0.2536 0.2510 0.1300 0.0045  -0.0339 0.0269  26  PHE K CE1 
1928 C  CE2 A PHE C  26  ? 0.2421 0.2717 0.1894 -0.0148 -0.0267 0.0575  26  PHE K CE2 
1929 C  CE2 B PHE C  26  ? 0.2499 0.2723 0.1478 -0.0001 -0.0236 0.0469  26  PHE K CE2 
1930 C  CZ  A PHE C  26  ? 0.2281 0.2582 0.1944 -0.0186 -0.0299 0.0574  26  PHE K CZ  
1931 C  CZ  B PHE C  26  ? 0.2573 0.2694 0.1365 0.0049  -0.0278 0.0390  26  PHE K CZ  
1932 N  N   . HIS C  27  ? 0.2134 0.2019 0.1493 -0.0108 -0.0398 0.0152  27  HIS K N   
1933 C  CA  . HIS C  27  ? 0.2081 0.1956 0.1481 -0.0082 -0.0410 0.0105  27  HIS K CA  
1934 C  C   . HIS C  27  ? 0.2139 0.1962 0.1559 -0.0068 -0.0453 0.0078  27  HIS K C   
1935 O  O   . HIS C  27  ? 0.2065 0.1886 0.1537 -0.0040 -0.0492 0.0049  27  HIS K O   
1936 C  CB  . HIS C  27  ? 0.2259 0.2191 0.1761 -0.0082 -0.0418 0.0116  27  HIS K CB  
1937 C  CG  . HIS C  27  ? 0.2378 0.2394 0.1875 -0.0080 -0.0361 0.0156  27  HIS K CG  
1938 N  ND1 . HIS C  27  ? 0.2587 0.2686 0.2215 -0.0107 -0.0361 0.0231  27  HIS K ND1 
1939 C  CD2 . HIS C  27  ? 0.2501 0.2538 0.1891 -0.0041 -0.0307 0.0136  27  HIS K CD2 
1940 C  CE1 . HIS C  27  ? 0.2698 0.2893 0.2283 -0.0078 -0.0287 0.0265  27  HIS K CE1 
1941 N  NE2 . HIS C  27  ? 0.2564 0.2708 0.1987 -0.0033 -0.0261 0.0193  27  HIS K NE2 
1942 N  N   . ALA C  28  ? 0.2082 0.1864 0.1456 -0.0074 -0.0452 0.0085  28  ALA K N   
1943 C  CA  . ALA C  28  ? 0.2057 0.1815 0.1451 -0.0050 -0.0476 0.0076  28  ALA K CA  
1944 C  C   . ALA C  28  ? 0.2045 0.1789 0.1418 -0.0038 -0.0455 0.0092  28  ALA K C   
1945 O  O   . ALA C  28  ? 0.2317 0.2021 0.1666 -0.0069 -0.0465 0.0106  28  ALA K O   
1946 C  CB  . ALA C  28  ? 0.2121 0.1845 0.1552 -0.0080 -0.0523 0.0092  28  ALA K CB  
1947 N  N   . VAL C  29  ? 0.2109 0.1891 0.1504 0.0016  -0.0434 0.0097  29  VAL K N   
1948 C  CA  . VAL C  29  ? 0.1993 0.1784 0.1436 0.0028  -0.0422 0.0147  29  VAL K CA  
1949 C  C   . VAL C  29  ? 0.1955 0.1776 0.1439 0.0061  -0.0427 0.0175  29  VAL K C   
1950 O  O   . VAL C  29  ? 0.2044 0.1926 0.1512 0.0135  -0.0412 0.0164  29  VAL K O   
1951 C  CB  . VAL C  29  ? 0.1977 0.1816 0.1439 0.0069  -0.0387 0.0167  29  VAL K CB  
1952 C  CG1 . VAL C  29  ? 0.2000 0.1878 0.1572 0.0087  -0.0376 0.0256  29  VAL K CG1 
1953 C  CG2 . VAL C  29  ? 0.2118 0.1917 0.1541 0.0041  -0.0392 0.0130  29  VAL K CG2 
1954 N  N   . TYR C  30  ? 0.1955 0.1737 0.1488 0.0021  -0.0454 0.0207  30  TYR K N   
1955 C  CA  . TYR C  30  ? 0.1991 0.1804 0.1572 0.0052  -0.0460 0.0236  30  TYR K CA  
1956 C  C   . TYR C  30  ? 0.2004 0.1921 0.1681 0.0113  -0.0413 0.0326  30  TYR K C   
1957 O  O   . TYR C  30  ? 0.1995 0.1937 0.1715 0.0113  -0.0390 0.0368  30  TYR K O   
1958 C  CB  . TYR C  30  ? 0.2031 0.1764 0.1635 -0.0017 -0.0512 0.0242  30  TYR K CB  
1959 C  CG  . TYR C  30  ? 0.1998 0.1668 0.1522 -0.0065 -0.0544 0.0188  30  TYR K CG  
1960 C  CD1 . TYR C  30  ? 0.2046 0.1718 0.1563 -0.0050 -0.0568 0.0154  30  TYR K CD1 
1961 C  CD2 . TYR C  30  ? 0.2021 0.1640 0.1488 -0.0113 -0.0557 0.0177  30  TYR K CD2 
1962 C  CE1 . TYR C  30  ? 0.2099 0.1734 0.1594 -0.0099 -0.0598 0.0139  30  TYR K CE1 
1963 C  CE2 . TYR C  30  ? 0.2066 0.1669 0.1478 -0.0144 -0.0568 0.0161  30  TYR K CE2 
1964 C  CZ  . TYR C  30  ? 0.2050 0.1666 0.1497 -0.0146 -0.0588 0.0156  30  TYR K CZ  
1965 O  OH  . TYR C  30  ? 0.2202 0.1819 0.1643 -0.0185 -0.0601 0.0172  30  TYR K OH  
1966 N  N   . ARG C  31  ? 0.2117 0.2104 0.1837 0.0173  -0.0397 0.0366  31  ARG K N   
1967 C  CA  . ARG C  31  ? 0.2337 0.2473 0.2153 0.0257  -0.0332 0.0478  31  ARG K CA  
1968 C  C   . ARG C  31  ? 0.2271 0.2401 0.2267 0.0186  -0.0343 0.0588  31  ARG K C   
1969 O  O   . ARG C  31  ? 0.2275 0.2506 0.2370 0.0222  -0.0297 0.0689  31  ARG K O   
1970 C  CB  . ARG C  31  ? 0.2557 0.2780 0.2392 0.0343  -0.0314 0.0505  31  ARG K CB  
1971 C  CG  . ARG C  31  ? 0.2928 0.3353 0.2863 0.0458  -0.0227 0.0647  31  ARG K CG  
1972 C  CD  . ARG C  31  ? 0.3314 0.3807 0.3279 0.0530  -0.0221 0.0667  31  ARG K CD  
1973 N  NE  . ARG C  31  ? 0.3783 0.4261 0.3562 0.0637  -0.0245 0.0533  31  ARG K NE  
1974 C  CZ  . ARG C  31  ? 0.4502 0.5106 0.4156 0.0811  -0.0199 0.0513  31  ARG K CZ  
1975 N  NH1 . ARG C  31  ? 0.4560 0.5347 0.4247 0.0904  -0.0101 0.0641  31  ARG K NH1 
1976 N  NH2 . ARG C  31  ? 0.4829 0.5375 0.4326 0.0906  -0.0264 0.0365  31  ARG K NH2 
1977 N  N   . ASP C  32  ? 0.2341 0.2091 0.2454 0.0232  -0.0498 0.0571  32  ASP K N   
1978 C  CA  . ASP C  32  ? 0.2300 0.2268 0.2602 0.0147  -0.0614 0.0620  32  ASP K CA  
1979 C  C   . ASP C  32  ? 0.2366 0.2252 0.2530 0.0020  -0.0680 0.0515  32  ASP K C   
1980 O  O   . ASP C  32  ? 0.2271 0.2240 0.2530 -0.0049 -0.0721 0.0519  32  ASP K O   
1981 C  CB  . ASP C  32  ? 0.2399 0.2486 0.2809 0.0150  -0.0736 0.0722  32  ASP K CB  
1982 C  CG  . ASP C  32  ? 0.2606 0.2499 0.2765 0.0132  -0.0787 0.0677  32  ASP K CG  
1983 O  OD1 . ASP C  32  ? 0.2690 0.2384 0.2647 0.0135  -0.0709 0.0588  32  ASP K OD1 
1984 O  OD2 . ASP C  32  ? 0.2785 0.2738 0.2957 0.0112  -0.0909 0.0753  32  ASP K OD2 
1985 N  N   . ASP C  33  ? 0.2391 0.2106 0.2339 -0.0001 -0.0675 0.0435  33  ASP K N   
1986 C  CA  . ASP C  33  ? 0.2375 0.2017 0.2209 -0.0073 -0.0690 0.0352  33  ASP K CA  
1987 C  C   . ASP C  33  ? 0.2249 0.1900 0.2125 -0.0077 -0.0630 0.0322  33  ASP K C   
1988 O  O   . ASP C  33  ? 0.2310 0.1955 0.2189 -0.0121 -0.0654 0.0292  33  ASP K O   
1989 C  CB  . ASP C  33  ? 0.2499 0.2017 0.2157 -0.0080 -0.0659 0.0309  33  ASP K CB  
1990 C  CG  . ASP C  33  ? 0.2539 0.2009 0.2095 -0.0077 -0.0708 0.0346  33  ASP K CG  
1991 O  OD1 . ASP C  33  ? 0.2646 0.2148 0.2193 -0.0102 -0.0805 0.0377  33  ASP K OD1 
1992 O  OD2 . ASP C  33  ? 0.2575 0.1952 0.2033 -0.0065 -0.0662 0.0353  33  ASP K OD2 
1993 N  N   . LEU C  34  ? 0.2311 0.1930 0.2172 -0.0029 -0.0554 0.0329  34  LEU K N   
1994 C  CA  . LEU C  34  ? 0.2300 0.1905 0.2144 -0.0042 -0.0513 0.0308  34  LEU K CA  
1995 C  C   . LEU C  34  ? 0.2314 0.2039 0.2311 -0.0050 -0.0514 0.0359  34  LEU K C   
1996 O  O   . LEU C  34  ? 0.2176 0.1893 0.2172 -0.0086 -0.0519 0.0349  34  LEU K O   
1997 C  CB  . LEU C  34  ? 0.2492 0.1972 0.2200 0.0002  -0.0438 0.0301  34  LEU K CB  
1998 C  CG  . LEU C  34  ? 0.2541 0.1966 0.2149 -0.0032 -0.0425 0.0280  34  LEU K CG  
1999 C  CD1 . LEU C  34  ? 0.2758 0.2181 0.2336 -0.0109 -0.0496 0.0250  34  LEU K CD1 
2000 C  CD2 . LEU C  34  ? 0.2844 0.2073 0.2229 0.0011  -0.0348 0.0266  34  LEU K CD2 
2001 N  N   . LYS C  35  ? 0.2282 0.2132 0.2436 -0.0024 -0.0516 0.0434  35  LYS K N   
2002 C  CA  . LYS C  35  ? 0.2299 0.2297 0.2645 -0.0067 -0.0534 0.0509  35  LYS K CA  
2003 C  C   . LYS C  35  ? 0.2261 0.2198 0.2577 -0.0174 -0.0644 0.0466  35  LYS K C   
2004 O  O   . LYS C  35  ? 0.2283 0.2209 0.2637 -0.0224 -0.0645 0.0483  35  LYS K O   
2005 C  CB  . LYS C  35  ? 0.2593 0.2803 0.3184 -0.0034 -0.0539 0.0631  35  LYS K CB  
2006 C  CG  . LYS C  35  ? 0.2906 0.3312 0.3745 -0.0097 -0.0543 0.0742  35  LYS K CG  
2007 C  CD  . LYS C  35  ? 0.3305 0.4008 0.4473 -0.0041 -0.0518 0.0909  35  LYS K CD  
2008 C  CE  . LYS C  35  ? 0.3749 0.4697 0.5219 -0.0133 -0.0526 0.1051  35  LYS K CE  
2009 N  NZ  . LYS C  35  ? 0.3948 0.5201 0.5739 -0.0003 -0.0372 0.1230  35  LYS K NZ  
2010 N  N   . LYS C  36  ? 0.2293 0.2147 0.2504 -0.0204 -0.0726 0.0416  36  LYS K N   
2011 C  CA  . LYS C  36  ? 0.2554 0.2268 0.2655 -0.0280 -0.0802 0.0360  36  LYS K CA  
2012 C  C   . LYS C  36  ? 0.2336 0.1921 0.2322 -0.0247 -0.0736 0.0294  36  LYS K C   
2013 O  O   . LYS C  36  ? 0.2443 0.1919 0.2397 -0.0284 -0.0757 0.0280  36  LYS K O   
2014 C  CB  . LYS C  36  ? 0.2891 0.2496 0.2821 -0.0303 -0.0877 0.0314  36  LYS K CB  
2015 C  CG  . LYS C  36  ? 0.3513 0.3240 0.3542 -0.0352 -0.0990 0.0395  36  LYS K CG  
2016 C  CD  . LYS C  36  ? 0.4355 0.3888 0.4113 -0.0411 -0.1095 0.0336  36  LYS K CD  
2017 C  CE  . LYS C  36  ? 0.4982 0.4467 0.4717 -0.0563 -0.1279 0.0371  36  LYS K CE  
2018 N  NZ  . LYS C  36  ? 0.5582 0.5317 0.5538 -0.0606 -0.1406 0.0509  36  LYS K NZ  
2019 N  N   . LEU C  37  ? 0.2267 0.1857 0.2195 -0.0184 -0.0670 0.0266  37  LEU K N   
2020 C  CA  . LEU C  37  ? 0.2277 0.1824 0.2170 -0.0154 -0.0623 0.0244  37  LEU K CA  
2021 C  C   . LEU C  37  ? 0.2228 0.1795 0.2191 -0.0165 -0.0611 0.0290  37  LEU K C   
2022 O  O   . LEU C  37  ? 0.2350 0.1840 0.2301 -0.0160 -0.0616 0.0291  37  LEU K O   
2023 C  CB  . LEU C  37  ? 0.2211 0.1795 0.2066 -0.0127 -0.0584 0.0237  37  LEU K CB  
2024 C  CG  . LEU C  37  ? 0.2181 0.1785 0.2046 -0.0112 -0.0566 0.0243  37  LEU K CG  
2025 C  CD1 . LEU C  37  ? 0.2192 0.1831 0.2028 -0.0127 -0.0555 0.0244  37  LEU K CD1 
2026 C  CD2 . LEU C  37  ? 0.2308 0.1935 0.2192 -0.0122 -0.0576 0.0281  37  LEU K CD2 
2027 N  N   . LEU C  38  ? 0.2232 0.1880 0.2245 -0.0162 -0.0579 0.0337  38  LEU K N   
2028 C  CA  . LEU C  38  ? 0.2261 0.1921 0.2297 -0.0170 -0.0546 0.0393  38  LEU K CA  
2029 C  C   . LEU C  38  ? 0.2457 0.2100 0.2588 -0.0231 -0.0583 0.0438  38  LEU K C   
2030 O  O   . LEU C  38  ? 0.2551 0.2120 0.2662 -0.0243 -0.0583 0.0468  38  LEU K O   
2031 C  CB  . LEU C  38  ? 0.2214 0.1934 0.2240 -0.0134 -0.0465 0.0437  38  LEU K CB  
2032 C  CG  . LEU C  38  ? 0.2284 0.1916 0.2122 -0.0096 -0.0434 0.0391  38  LEU K CG  
2033 C  CD1 . LEU C  38  ? 0.2420 0.2045 0.2218 -0.0030 -0.0335 0.0413  38  LEU K CD1 
2034 C  CD2 . LEU C  38  ? 0.2463 0.2017 0.2157 -0.0117 -0.0455 0.0395  38  LEU K CD2 
2035 N  N   . GLU C  39  ? 0.2556 0.2258 0.2788 -0.0282 -0.0631 0.0457  39  GLU K N   
2036 C  CA  . GLU C  39  ? 0.2864 0.2526 0.3178 -0.0387 -0.0702 0.0505  39  GLU K CA  
2037 C  C   . GLU C  39  ? 0.2879 0.2280 0.3034 -0.0410 -0.0754 0.0437  39  GLU K C   
2038 O  O   . GLU C  39  ? 0.2978 0.2264 0.3141 -0.0477 -0.0781 0.0477  39  GLU K O   
2039 C  CB  . GLU C  39  ? 0.3254 0.3028 0.3689 -0.0460 -0.0791 0.0541  39  GLU K CB  
2040 C  CG  . GLU C  39  ? 0.3758 0.3816 0.4436 -0.0433 -0.0726 0.0663  39  GLU K CG  
2041 C  CD  . GLU C  39  ? 0.4298 0.4533 0.5168 -0.0504 -0.0836 0.0741  39  GLU K CD  
2042 O  OE1 . GLU C  39  ? 0.5016 0.5137 0.5751 -0.0542 -0.0953 0.0672  39  GLU K OE1 
2043 O  OE2 . GLU C  39  ? 0.5187 0.5689 0.6347 -0.0519 -0.0801 0.0890  39  GLU K OE2 
2044 N  N   . THR C  40  ? 0.2824 0.2117 0.2833 -0.0351 -0.0755 0.0343  40  THR K N   
2045 C  CA  . THR C  40  ? 0.3121 0.2145 0.2953 -0.0326 -0.0762 0.0275  40  THR K CA  
2046 C  C   . THR C  40  ? 0.3013 0.2015 0.2844 -0.0219 -0.0683 0.0287  40  THR K C   
2047 O  O   . THR C  40  ? 0.3340 0.2123 0.3093 -0.0193 -0.0676 0.0285  40  THR K O   
2048 C  CB  . THR C  40  ? 0.3266 0.2200 0.2932 -0.0294 -0.0767 0.0188  40  THR K CB  
2049 O  OG1 . THR C  40  ? 0.3901 0.2855 0.3555 -0.0400 -0.0871 0.0192  40  THR K OG1 
2050 C  CG2 . THR C  40  ? 0.3563 0.2180 0.3000 -0.0242 -0.0737 0.0113  40  THR K CG2 
2051 N  N   . GLU C  41  ? 0.2730 0.1929 0.2635 -0.0163 -0.0639 0.0308  41  GLU K N   
2052 C  CA  . GLU C  41  ? 0.2658 0.1882 0.2585 -0.0074 -0.0599 0.0338  41  GLU K CA  
2053 C  C   . GLU C  41  ? 0.2873 0.2169 0.2851 -0.0080 -0.0605 0.0423  41  GLU K C   
2054 O  O   . GLU C  41  ? 0.2986 0.2282 0.2991 -0.0014 -0.0603 0.0472  41  GLU K O   
2055 C  CB  . GLU C  41  ? 0.2572 0.1944 0.2524 -0.0029 -0.0571 0.0318  41  GLU K CB  
2056 C  CG  . GLU C  41  ? 0.2551 0.1856 0.2422 -0.0006 -0.0542 0.0249  41  GLU K CG  
2057 C  CD  . GLU C  41  ? 0.2962 0.2068 0.2737 0.0077  -0.0486 0.0216  41  GLU K CD  
2058 O  OE1 . GLU C  41  ? 0.3086 0.2141 0.2912 0.0154  -0.0454 0.0261  41  GLU K OE1 
2059 O  OE2 . GLU C  41  ? 0.3208 0.2185 0.2825 0.0081  -0.0463 0.0147  41  GLU K OE2 
2060 N  N   . SER C  42  ? 0.2710 0.2082 0.2697 -0.0142 -0.0605 0.0456  42  SER K N   
2061 C  CA  A SER C  42  ? 0.2863 0.2276 0.2817 -0.0145 -0.0597 0.0533  42  SER K CA  
2062 C  CA  B SER C  42  ? 0.2840 0.2258 0.2793 -0.0147 -0.0595 0.0532  42  SER K CA  
2063 C  C   . SER C  42  ? 0.3012 0.2351 0.2984 -0.0196 -0.0584 0.0606  42  SER K C   
2064 O  O   . SER C  42  ? 0.3064 0.2386 0.3107 -0.0260 -0.0588 0.0603  42  SER K O   
2065 C  CB  A SER C  42  ? 0.2866 0.2375 0.2745 -0.0154 -0.0568 0.0521  42  SER K CB  
2066 C  CB  B SER C  42  ? 0.2808 0.2321 0.2696 -0.0160 -0.0559 0.0519  42  SER K CB  
2067 O  OG  A SER C  42  ? 0.2958 0.2510 0.2878 -0.0180 -0.0515 0.0529  42  SER K OG  
2068 O  OG  B SER C  42  ? 0.2814 0.2366 0.2655 -0.0142 -0.0582 0.0468  42  SER K OG  
2069 N  N   . PRO C  43  ? 0.3136 0.2433 0.3049 -0.0185 -0.0585 0.0691  43  PRO K N   
2070 C  CA  . PRO C  43  ? 0.3385 0.2604 0.3307 -0.0242 -0.0564 0.0783  43  PRO K CA  
2071 C  C   . PRO C  43  ? 0.3340 0.2692 0.3268 -0.0287 -0.0483 0.0827  43  PRO K C   
2072 O  O   . PRO C  43  ? 0.3117 0.2561 0.2973 -0.0249 -0.0441 0.0785  43  PRO K O   
2073 C  CB  . PRO C  43  ? 0.3564 0.2709 0.3389 -0.0198 -0.0590 0.0869  43  PRO K CB  
2074 C  CG  . PRO C  43  ? 0.3420 0.2669 0.3179 -0.0147 -0.0625 0.0837  43  PRO K CG  
2075 C  CD  . PRO C  43  ? 0.3208 0.2531 0.3053 -0.0130 -0.0625 0.0723  43  PRO K CD  
2076 N  N   . GLN C  44  ? 0.3610 0.2952 0.3614 -0.0360 -0.0448 0.0925  44  GLN K N   
2077 C  CA  . GLN C  44  ? 0.3784 0.3297 0.3862 -0.0386 -0.0339 0.0997  44  GLN K CA  
2078 C  C   . GLN C  44  ? 0.3650 0.3175 0.3501 -0.0310 -0.0236 0.1018  44  GLN K C   
2079 O  O   . GLN C  44  ? 0.3484 0.3123 0.3335 -0.0264 -0.0129 0.1011  44  GLN K O   
2080 C  CB  . GLN C  44  ? 0.4404 0.3927 0.4633 -0.0499 -0.0318 0.1138  44  GLN K CB  
2081 C  CG  . GLN C  44  ? 0.4811 0.4588 0.5221 -0.0526 -0.0184 0.1256  44  GLN K CG  
2082 C  CD  . GLN C  44  ? 0.5289 0.5283 0.5867 -0.0481 -0.0160 0.1207  44  GLN K CD  
2083 O  OE1 . GLN C  44  ? 0.5591 0.5591 0.6274 -0.0520 -0.0284 0.1126  44  GLN K OE1 
2084 N  NE2 . GLN C  44  ? 0.5798 0.5952 0.6377 -0.0388 0.0014  0.1268  44  GLN K NE2 
2085 N  N   . TYR C  45  ? 0.3667 0.3053 0.3300 -0.0289 -0.0274 0.1040  45  TYR K N   
2086 C  CA  . TYR C  45  ? 0.3923 0.3253 0.3245 -0.0243 -0.0197 0.1056  45  TYR K CA  
2087 C  C   . TYR C  45  ? 0.3894 0.3216 0.3092 -0.0193 -0.0219 0.0924  45  TYR K C   
2088 O  O   . TYR C  45  ? 0.4082 0.3328 0.3022 -0.0154 -0.0124 0.0907  45  TYR K O   
2089 C  CB  . TYR C  45  ? 0.4226 0.3406 0.3312 -0.0253 -0.0262 0.1136  45  TYR K CB  
2090 C  CG  . TYR C  45  ? 0.4177 0.3314 0.3270 -0.0238 -0.0435 0.1097  45  TYR K CG  
2091 C  CD1 . TYR C  45  ? 0.4332 0.3456 0.3246 -0.0224 -0.0517 0.1029  45  TYR K CD1 
2092 C  CD2 . TYR C  45  ? 0.4140 0.3242 0.3430 -0.0237 -0.0511 0.1139  45  TYR K CD2 
2093 C  CE1 . TYR C  45  ? 0.4379 0.3543 0.3387 -0.0211 -0.0668 0.1027  45  TYR K CE1 
2094 C  CE2 . TYR C  45  ? 0.4048 0.3143 0.3386 -0.0188 -0.0634 0.1131  45  TYR K CE2 
2095 C  CZ  . TYR C  45  ? 0.4202 0.3371 0.3439 -0.0175 -0.0713 0.1087  45  TYR K CZ  
2096 O  OH  . TYR C  45  ? 0.4195 0.3433 0.3568 -0.0125 -0.0827 0.1111  45  TYR K OH  
2097 N  N   . ILE C  46  ? 0.3586 0.2957 0.2950 -0.0194 -0.0323 0.0834  46  ILE K N   
2098 C  CA  . ILE C  46  ? 0.3605 0.2972 0.2897 -0.0167 -0.0350 0.0722  46  ILE K CA  
2099 C  C   . ILE C  46  ? 0.3614 0.3080 0.3056 -0.0135 -0.0252 0.0692  46  ILE K C   
2100 O  O   . ILE C  46  ? 0.4080 0.3486 0.3356 -0.0085 -0.0171 0.0654  46  ILE K O   
2101 C  CB  . ILE C  46  ? 0.3533 0.2929 0.2938 -0.0177 -0.0487 0.0668  46  ILE K CB  
2102 C  CG1 . ILE C  46  ? 0.3834 0.3180 0.3117 -0.0192 -0.0591 0.0728  46  ILE K CG1 
2103 C  CG2 . ILE C  46  ? 0.3582 0.2994 0.2970 -0.0168 -0.0500 0.0569  46  ILE K CG2 
2104 C  CD1 . ILE C  46  ? 0.3977 0.3225 0.2944 -0.0226 -0.0639 0.0714  46  ILE K CD1 
2105 N  N   . ARG C  47  ? 0.4302 0.2816 0.5025 -0.0473 -0.0143 0.0579  47  ARG K N   
2106 C  CA  . ARG C  47  ? 0.4355 0.3034 0.5095 -0.0525 -0.0104 0.0459  47  ARG K CA  
2107 C  C   . ARG C  47  ? 0.4258 0.3105 0.4977 -0.0590 -0.0017 0.0541  47  ARG K C   
2108 O  O   . ARG C  47  ? 0.3959 0.3001 0.4755 -0.0582 0.0015  0.0481  47  ARG K O   
2109 C  CB  . ARG C  47  ? 0.4712 0.3268 0.5602 -0.0628 -0.0116 0.0387  47  ARG K CB  
2110 C  CG  . ARG C  47  ? 0.5020 0.3364 0.5930 -0.0620 -0.0118 0.0231  47  ARG K CG  
2111 C  CD  . ARG C  47  ? 0.5423 0.3633 0.6363 -0.0790 -0.0125 0.0123  47  ARG K CD  
2112 N  NE  . ARG C  47  ? 0.5950 0.4048 0.7052 -0.0879 -0.0115 0.0227  47  ARG K NE  
2113 C  CZ  . ARG C  47  ? 0.6203 0.4003 0.7446 -0.0898 -0.0065 0.0214  47  ARG K CZ  
2114 N  NH1 . ARG C  47  ? 0.6532 0.4111 0.7843 -0.0818 0.0010  0.0092  47  ARG K NH1 
2115 N  NH2 . ARG C  47  ? 0.6609 0.4323 0.7991 -0.0997 -0.0071 0.0328  47  ARG K NH2 
2116 N  N   . LYS C  48  ? 0.4333 0.3093 0.4988 -0.0670 0.0038  0.0683  48  LYS K N   
2117 C  CA  . LYS C  48  ? 0.4491 0.3375 0.5198 -0.0775 0.0190  0.0729  48  LYS K CA  
2118 C  C   . LYS C  48  ? 0.4354 0.3404 0.4972 -0.0755 0.0346  0.0678  48  LYS K C   
2119 O  O   . LYS C  48  ? 0.4278 0.3491 0.5154 -0.0798 0.0489  0.0652  48  LYS K O   
2120 C  CB  . LYS C  48  ? 0.4932 0.3650 0.5516 -0.0903 0.0233  0.0894  48  LYS K CB  
2121 C  CG  . LYS C  48  ? 0.5377 0.3967 0.5556 -0.0945 0.0227  0.1014  48  LYS K CG  
2122 C  CD  . LYS C  48  ? 0.5976 0.4350 0.6015 -0.1099 0.0186  0.1233  48  LYS K CD  
2123 C  CE  . LYS C  48  ? 0.6282 0.4694 0.6333 -0.1269 0.0397  0.1269  48  LYS K CE  
2124 N  NZ  . LYS C  48  ? 0.6624 0.5100 0.6347 -0.1379 0.0644  0.1223  48  LYS K NZ  
2125 N  N   . LYS C  49  ? 0.4563 0.3548 0.4860 -0.0708 0.0329  0.0673  49  LYS K N   
2126 C  CA  . LYS C  49  ? 0.4718 0.3809 0.4917 -0.0655 0.0437  0.0572  49  LYS K CA  
2127 C  C   . LYS C  49  ? 0.4224 0.3546 0.4849 -0.0569 0.0460  0.0466  49  LYS K C   
2128 O  O   . LYS C  49  ? 0.4327 0.3776 0.5158 -0.0577 0.0658  0.0416  49  LYS K O   
2129 C  CB  . LYS C  49  ? 0.4866 0.3877 0.4823 -0.0566 0.0268  0.0566  49  LYS K CB  
2130 C  CG  . LYS C  49  ? 0.5065 0.4040 0.4679 -0.0588 0.0343  0.0528  49  LYS K CG  
2131 C  CD  . LYS C  49  ? 0.5024 0.3984 0.4559 -0.0481 0.0149  0.0518  49  LYS K CD  
2132 C  CE  . LYS C  49  ? 0.5382 0.4206 0.4461 -0.0581 0.0118  0.0578  49  LYS K CE  
2133 N  NZ  . LYS C  49  ? 0.5497 0.4295 0.4590 -0.0508 -0.0120 0.0653  49  LYS K NZ  
2134 N  N   . GLY C  50  ? 0.3756 0.3107 0.4529 -0.0510 0.0262  0.0441  50  GLY K N   
2135 C  CA  . GLY C  50  ? 0.3410 0.2949 0.4539 -0.0486 0.0193  0.0399  50  GLY K CA  
2136 C  C   . GLY C  50  ? 0.3066 0.2604 0.4066 -0.0401 0.0048  0.0330  50  GLY K C   
2137 O  O   . GLY C  50  ? 0.2928 0.2406 0.3677 -0.0328 0.0076  0.0296  50  GLY K O   
2138 N  N   . ALA C  51  ? 0.2866 0.2462 0.4011 -0.0442 -0.0113 0.0315  51  ALA K N   
2139 C  CA  . ALA C  51  ? 0.2743 0.2320 0.3722 -0.0404 -0.0236 0.0251  51  ALA K CA  
2140 C  C   . ALA C  51  ? 0.2624 0.2341 0.3711 -0.0315 -0.0209 0.0255  51  ALA K C   
2141 O  O   . ALA C  51  ? 0.2594 0.2256 0.3448 -0.0247 -0.0231 0.0199  51  ALA K O   
2142 C  CB  . ALA C  51  ? 0.2839 0.2396 0.3830 -0.0543 -0.0419 0.0239  51  ALA K CB  
2143 N  N   . ASP C  52  ? 0.2506 0.2394 0.3998 -0.0312 -0.0140 0.0316  52  ASP K N   
2144 C  CA  . ASP C  52  ? 0.2515 0.2498 0.4184 -0.0220 -0.0080 0.0308  52  ASP K CA  
2145 C  C   . ASP C  52  ? 0.2475 0.2327 0.3810 -0.0150 0.0133  0.0217  52  ASP K C   
2146 O  O   . ASP C  52  ? 0.2400 0.2226 0.3619 -0.0082 0.0144  0.0166  52  ASP K O   
2147 C  CB  . ASP C  52  ? 0.2609 0.2798 0.4939 -0.0225 -0.0025 0.0397  52  ASP K CB  
2148 C  CG  . ASP C  52  ? 0.2803 0.3141 0.5484 -0.0320 -0.0337 0.0542  52  ASP K CG  
2149 O  OD1 . ASP C  52  ? 0.2944 0.3200 0.5268 -0.0393 -0.0566 0.0543  52  ASP K OD1 
2150 O  OD2 . ASP C  52  ? 0.2980 0.3510 0.6309 -0.0344 -0.0346 0.0664  52  ASP K OD2 
2151 N  N   . VAL C  53  ? 0.2531 0.2283 0.3680 -0.0200 0.0280  0.0213  53  VAL K N   
2152 C  CA  . VAL C  53  ? 0.2654 0.2247 0.3386 -0.0208 0.0423  0.0161  53  VAL K CA  
2153 C  C   . VAL C  53  ? 0.2610 0.2095 0.2971 -0.0169 0.0245  0.0156  53  VAL K C   
2154 O  O   . VAL C  53  ? 0.2677 0.2096 0.2800 -0.0147 0.0268  0.0109  53  VAL K O   
2155 C  CB  . VAL C  53  ? 0.2942 0.2424 0.3488 -0.0324 0.0581  0.0199  53  VAL K CB  
2156 C  CG1 . VAL C  53  ? 0.3183 0.2463 0.3180 -0.0398 0.0663  0.0179  53  VAL K CG1 
2157 C  CG2 . VAL C  53  ? 0.3017 0.2612 0.3982 -0.0371 0.0827  0.0188  53  VAL K CG2 
2158 N  N   . TRP C  54  ? 0.2394 0.1844 0.2735 -0.0173 0.0089  0.0195  54  TRP K N   
2159 C  CA  . TRP C  54  ? 0.2299 0.1669 0.2452 -0.0125 -0.0043 0.0184  54  TRP K CA  
2160 C  C   . TRP C  54  ? 0.2158 0.1611 0.2349 -0.0062 -0.0104 0.0120  54  TRP K C   
2161 O  O   . TRP C  54  ? 0.2121 0.1538 0.2155 -0.0021 -0.0138 0.0102  54  TRP K O   
2162 C  CB  . TRP C  54  ? 0.2335 0.1631 0.2557 -0.0146 -0.0126 0.0196  54  TRP K CB  
2163 C  CG  . TRP C  54  ? 0.2516 0.1669 0.2665 -0.0178 -0.0129 0.0286  54  TRP K CG  
2164 C  CD1 . TRP C  54  ? 0.2700 0.1783 0.2936 -0.0251 -0.0103 0.0348  54  TRP K CD1 
2165 C  CD2 . TRP C  54  ? 0.2591 0.1644 0.2596 -0.0160 -0.0196 0.0374  54  TRP K CD2 
2166 N  NE1 . TRP C  54  ? 0.2859 0.1793 0.3010 -0.0275 -0.0148 0.0475  54  TRP K NE1 
2167 C  CE2 . TRP C  54  ? 0.2859 0.1778 0.2893 -0.0225 -0.0224 0.0507  54  TRP K CE2 
2168 C  CE3 . TRP C  54  ? 0.2575 0.1639 0.2476 -0.0113 -0.0262 0.0380  54  TRP K CE3 
2169 C  CZ2 . TRP C  54  ? 0.3006 0.1813 0.2987 -0.0247 -0.0346 0.0670  54  TRP K CZ2 
2170 C  CZ3 . TRP C  54  ? 0.2764 0.1729 0.2611 -0.0142 -0.0379 0.0531  54  TRP K CZ3 
2171 C  CH2 . TRP C  54  ? 0.2961 0.1806 0.2861 -0.0207 -0.0433 0.0684  54  TRP K CH2 
2172 N  N   . PHE C  55  ? 0.2102 0.1670 0.2526 -0.0073 -0.0141 0.0113  55  PHE K N   
2173 C  CA  . PHE C  55  ? 0.2137 0.1763 0.2580 -0.0044 -0.0232 0.0088  55  PHE K CA  
2174 C  C   . PHE C  55  ? 0.2112 0.1750 0.2535 0.0021  -0.0146 0.0063  55  PHE K C   
2175 O  O   . PHE C  55  ? 0.2136 0.1748 0.2416 0.0055  -0.0200 0.0034  55  PHE K O   
2176 C  CB  . PHE C  55  ? 0.2236 0.1980 0.2953 -0.0112 -0.0347 0.0146  55  PHE K CB  
2177 C  CG  . PHE C  55  ? 0.2317 0.2090 0.2993 -0.0129 -0.0482 0.0158  55  PHE K CG  
2178 C  CD1 . PHE C  55  ? 0.2519 0.2199 0.2912 -0.0222 -0.0581 0.0116  55  PHE K CD1 
2179 C  CD2 . PHE C  55  ? 0.2456 0.2318 0.3369 -0.0071 -0.0484 0.0204  55  PHE K CD2 
2180 C  CE1 . PHE C  55  ? 0.2698 0.2379 0.2971 -0.0279 -0.0693 0.0134  55  PHE K CE1 
2181 C  CE2 . PHE C  55  ? 0.2488 0.2359 0.3342 -0.0106 -0.0631 0.0244  55  PHE K CE2 
2182 C  CZ  . PHE C  55  ? 0.2654 0.2440 0.3160 -0.0219 -0.0740 0.0216  55  PHE K CZ  
2183 N  N   . LYS C  56  ? 0.2245 0.1897 0.2807 0.0020  0.0019  0.0057  56  LYS K N   
2184 C  CA  . LYS C  56  ? 0.2443 0.2044 0.2956 0.0050  0.0156  -0.0008 56  LYS K CA  
2185 C  C   . LYS C  56  ? 0.2534 0.1981 0.2567 0.0020  0.0144  -0.0040 56  LYS K C   
2186 O  O   . LYS C  56  ? 0.2587 0.1981 0.2480 0.0036  0.0135  -0.0087 56  LYS K O   
2187 C  CB  . LYS C  56  ? 0.2728 0.2323 0.3460 0.0022  0.0417  -0.0048 56  LYS K CB  
2188 C  CG  . LYS C  56  ? 0.3032 0.2526 0.3745 0.0035  0.0615  -0.0161 56  LYS K CG  
2189 C  CD  . LYS C  56  ? 0.3449 0.2921 0.4473 0.0004  0.0953  -0.0237 56  LYS K CD  
2190 C  CE  . LYS C  56  ? 0.3870 0.3183 0.4862 0.0003  0.1185  -0.0390 56  LYS K CE  
2191 N  NZ  . LYS C  56  ? 0.4316 0.3606 0.5756 -0.0015 0.1578  -0.0490 56  LYS K NZ  
2192 N  N   . GLU C  57  ? 0.2625 0.2001 0.2448 -0.0036 0.0111  0.0014  57  GLU K N   
2193 C  CA  . GLU C  57  ? 0.2857 0.2107 0.2320 -0.0086 0.0029  0.0052  57  GLU K CA  
2194 C  C   . GLU C  57  ? 0.2679 0.1977 0.2190 -0.0013 -0.0145 0.0067  57  GLU K C   
2195 O  O   . GLU C  57  ? 0.2948 0.2193 0.2275 -0.0034 -0.0213 0.0077  57  GLU K O   
2196 C  CB  . GLU C  57  ? 0.3097 0.2264 0.2432 -0.0165 0.0000  0.0156  57  GLU K CB  
2197 C  CG  . GLU C  57  ? 0.3732 0.2794 0.2849 -0.0298 0.0192  0.0147  57  GLU K CG  
2198 C  CD  . GLU C  57  ? 0.4060 0.3009 0.2982 -0.0412 0.0130  0.0289  57  GLU K CD  
2199 O  OE1 . GLU C  57  ? 0.4422 0.3290 0.3180 -0.0539 0.0317  0.0281  57  GLU K OE1 
2200 O  OE2 . GLU C  57  ? 0.3936 0.2871 0.2924 -0.0381 -0.0082 0.0413  57  GLU K OE2 
2201 N  N   . LEU C  58  ? 0.2324 0.1703 0.2056 0.0042  -0.0205 0.0063  58  LEU K N   
2202 C  CA  . LEU C  58  ? 0.2196 0.1590 0.1973 0.0085  -0.0302 0.0056  58  LEU K CA  
2203 C  C   . LEU C  58  ? 0.2113 0.1572 0.1910 0.0113  -0.0321 0.0000  58  LEU K C   
2204 O  O   . LEU C  58  ? 0.2054 0.1518 0.1844 0.0132  -0.0370 -0.0007 58  LEU K O   
2205 C  CB  . LEU C  58  ? 0.2141 0.1518 0.2060 0.0083  -0.0309 0.0040  58  LEU K CB  
2206 C  CG  . LEU C  58  ? 0.2184 0.1472 0.2157 0.0061  -0.0304 0.0108  58  LEU K CG  
2207 C  CD1 . LEU C  58  ? 0.2285 0.1519 0.2386 0.0036  -0.0272 0.0044  58  LEU K CD1 
2208 C  CD2 . LEU C  58  ? 0.2269 0.1501 0.2258 0.0078  -0.0384 0.0214  58  LEU K CD2 
2209 N  N   . ASP C  59  ? 0.2067 0.1581 0.1959 0.0111  -0.0287 -0.0019 59  ASP K N   
2210 C  CA  . ASP C  59  ? 0.2016 0.1582 0.1972 0.0124  -0.0336 -0.0033 59  ASP K CA  
2211 C  C   . ASP C  59  ? 0.2270 0.1786 0.2143 0.0146  -0.0289 -0.0062 59  ASP K C   
2212 O  O   . ASP C  59  ? 0.2263 0.1769 0.2267 0.0159  -0.0206 -0.0086 59  ASP K O   
2213 C  CB  . ASP C  59  ? 0.1988 0.1636 0.2184 0.0099  -0.0376 0.0012  59  ASP K CB  
2214 C  CG  . ASP C  59  ? 0.1973 0.1657 0.2243 0.0087  -0.0472 0.0049  59  ASP K CG  
2215 O  OD1 . ASP C  59  ? 0.2092 0.1739 0.2180 0.0087  -0.0496 0.0018  59  ASP K OD1 
2216 O  OD2 . ASP C  59  ? 0.1894 0.1649 0.2454 0.0070  -0.0532 0.0130  59  ASP K OD2 
2217 N  N   A ILE C  60  ? 0.2202 0.1676 0.1902 0.0138  -0.0336 -0.0062 60  ILE K N   
2218 N  N   B ILE C  60  ? 0.2215 0.1687 0.1913 0.0138  -0.0335 -0.0063 60  ILE K N   
2219 C  CA  A ILE C  60  ? 0.2312 0.1701 0.1836 0.0108  -0.0327 -0.0086 60  ILE K CA  
2220 C  CA  B ILE C  60  ? 0.2346 0.1727 0.1868 0.0105  -0.0311 -0.0092 60  ILE K CA  
2221 C  C   A ILE C  60  ? 0.2299 0.1681 0.1909 0.0127  -0.0304 -0.0131 60  ILE K C   
2222 C  C   B ILE C  60  ? 0.2319 0.1697 0.1922 0.0125  -0.0303 -0.0133 60  ILE K C   
2223 O  O   A ILE C  60  ? 0.2451 0.1721 0.1982 0.0096  -0.0201 -0.0197 60  ILE K O   
2224 O  O   B ILE C  60  ? 0.2366 0.1628 0.1866 0.0090  -0.0218 -0.0198 60  ILE K O   
2225 C  CB  A ILE C  60  ? 0.2295 0.1692 0.1752 0.0090  -0.0446 -0.0031 60  ILE K CB  
2226 C  CB  B ILE C  60  ? 0.2472 0.1820 0.1838 0.0061  -0.0421 -0.0034 60  ILE K CB  
2227 C  CG1 A ILE C  60  ? 0.2305 0.1711 0.1826 0.0091  -0.0484 0.0041  60  ILE K CG1 
2228 C  CG1 B ILE C  60  ? 0.2311 0.1756 0.1848 0.0105  -0.0504 -0.0011 60  ILE K CG1 
2229 C  CG2 A ILE C  60  ? 0.2560 0.1845 0.1763 -0.0002 -0.0486 -0.0026 60  ILE K CG2 
2230 C  CG2 B ILE C  60  ? 0.2603 0.1910 0.1902 0.0021  -0.0444 0.0044  60  ILE K CG2 
2231 C  CD1 A ILE C  60  ? 0.2579 0.1875 0.1874 0.0001  -0.0505 0.0107  60  ILE K CD1 
2232 C  CD1 B ILE C  60  ? 0.2329 0.1778 0.1890 0.0070  -0.0625 0.0079  60  ILE K CD1 
2233 N  N   . ASN C  61  ? 0.2144 0.1614 0.1894 0.0153  -0.0385 -0.0099 61  ASN K N   
2234 C  CA  . ASN C  61  ? 0.2089 0.1553 0.1961 0.0161  -0.0406 -0.0096 61  ASN K CA  
2235 C  C   . ASN C  61  ? 0.2031 0.1539 0.2210 0.0183  -0.0402 -0.0046 61  ASN K C   
2236 O  O   . ASN C  61  ? 0.2090 0.1596 0.2450 0.0187  -0.0455 0.0002  61  ASN K O   
2237 C  CB  . ASN C  61  ? 0.2026 0.1539 0.1848 0.0133  -0.0506 -0.0060 61  ASN K CB  
2238 C  CG  . ASN C  61  ? 0.2086 0.1665 0.1912 0.0091  -0.0554 -0.0021 61  ASN K CG  
2239 O  OD1 . ASN C  61  ? 0.2057 0.1651 0.1887 0.0090  -0.0530 -0.0028 61  ASN K OD1 
2240 N  ND2 . ASN C  61  ? 0.2018 0.1608 0.1791 0.0019  -0.0616 0.0017  61  ASN K ND2 
2241 N  N   . THR C  62  ? 0.2031 0.1578 0.2332 0.0193  -0.0346 -0.0038 62  THR K N   
2242 C  CA  . THR C  62  ? 0.2052 0.1667 0.2770 0.0212  -0.0345 0.0034  62  THR K CA  
2243 C  C   . THR C  62  ? 0.1885 0.1571 0.2750 0.0164  -0.0554 0.0173  62  THR K C   
2244 O  O   . THR C  62  ? 0.1933 0.1643 0.3209 0.0183  -0.0606 0.0271  62  THR K O   
2245 C  CB  . THR C  62  ? 0.2298 0.1831 0.3291 0.0266  -0.0131 -0.0043 62  THR K CB  
2246 O  OG1 . THR C  62  ? 0.2670 0.2076 0.3550 0.0272  -0.0094 -0.0111 62  THR K OG1 
2247 C  CG2 . THR C  62  ? 0.2666 0.2120 0.3431 0.0242  0.0067  -0.0154 62  THR K CG2 
2248 N  N   . ASP C  63  ? 0.2457 0.1886 0.2181 0.0320  -0.0145 0.0095  63  ASP K N   
2249 C  CA  . ASP C  63  ? 0.2246 0.1796 0.2092 0.0279  -0.0219 0.0090  63  ASP K CA  
2250 C  C   . ASP C  63  ? 0.2189 0.1868 0.2260 0.0262  -0.0282 0.0127  63  ASP K C   
2251 O  O   . ASP C  63  ? 0.2248 0.1961 0.2335 0.0249  -0.0369 0.0114  63  ASP K O   
2252 C  CB  . ASP C  63  ? 0.2290 0.1846 0.2039 0.0234  -0.0295 0.0042  63  ASP K CB  
2253 C  CG  . ASP C  63  ? 0.2263 0.1877 0.2015 0.0214  -0.0337 0.0021  63  ASP K CG  
2254 O  OD1 . ASP C  63  ? 0.2159 0.1780 0.1957 0.0218  -0.0325 0.0022  63  ASP K OD1 
2255 O  OD2 . ASP C  63  ? 0.2337 0.1989 0.2064 0.0209  -0.0366 0.0026  63  ASP K OD2 
2256 N  N   . GLY C  64  ? 0.2090 0.1801 0.2314 0.0269  -0.0255 0.0182  64  GLY K N   
2257 C  CA  . GLY C  64  ? 0.2062 0.1855 0.2552 0.0236  -0.0363 0.0240  64  GLY K CA  
2258 C  C   . GLY C  64  ? 0.2047 0.1801 0.2459 0.0193  -0.0500 0.0169  64  GLY K C   
2259 O  O   . GLY C  64  ? 0.2115 0.1853 0.2678 0.0159  -0.0657 0.0196  64  GLY K O   
2260 N  N   . ALA C  65  ? 0.2022 0.1733 0.2209 0.0198  -0.0459 0.0093  65  ALA K N   
2261 C  CA  . ALA C  65  ? 0.2075 0.1730 0.2166 0.0185  -0.0554 0.0041  65  ALA K CA  
2262 C  C   . ALA C  65  ? 0.2084 0.1738 0.2059 0.0189  -0.0471 0.0012  65  ALA K C   
2263 O  O   . ALA C  65  ? 0.1952 0.1610 0.1855 0.0198  -0.0382 0.0012  65  ALA K O   
2264 C  CB  . ALA C  65  ? 0.2357 0.1922 0.2231 0.0220  -0.0642 -0.0012 65  ALA K CB  
2265 N  N   . VAL C  66  ? 0.2065 0.1675 0.2011 0.0183  -0.0531 -0.0010 66  VAL K N   
2266 C  CA  . VAL C  66  ? 0.2017 0.1626 0.1857 0.0189  -0.0474 -0.0033 66  VAL K CA  
2267 C  C   . VAL C  66  ? 0.2096 0.1658 0.1736 0.0231  -0.0494 -0.0066 66  VAL K C   
2268 O  O   . VAL C  66  ? 0.2193 0.1634 0.1710 0.0273  -0.0578 -0.0091 66  VAL K O   
2269 C  CB  . VAL C  66  ? 0.2059 0.1648 0.2019 0.0171  -0.0502 -0.0011 66  VAL K CB  
2270 C  CG1 . VAL C  66  ? 0.2088 0.1667 0.1922 0.0184  -0.0451 -0.0035 66  VAL K CG1 
2271 C  CG2 . VAL C  66  ? 0.2029 0.1685 0.2233 0.0165  -0.0425 0.0080  66  VAL K CG2 
2272 N  N   . ASN C  67  ? 0.2073 0.1695 0.1670 0.0238  -0.0426 -0.0046 67  ASN K N   
2273 C  CA  . ASN C  67  ? 0.2107 0.1731 0.1602 0.0297  -0.0396 -0.0014 67  ASN K CA  
2274 C  C   . ASN C  67  ? 0.2166 0.1792 0.1631 0.0314  -0.0369 0.0000  67  ASN K C   
2275 O  O   . ASN C  67  ? 0.2063 0.1674 0.1562 0.0276  -0.0388 -0.0032 67  ASN K O   
2276 C  CB  . ASN C  67  ? 0.2142 0.1849 0.1709 0.0291  -0.0356 0.0050  67  ASN K CB  
2277 C  CG  . ASN C  67  ? 0.2097 0.1852 0.1766 0.0221  -0.0367 0.0078  67  ASN K CG  
2278 O  OD1 . ASN C  67  ? 0.2136 0.1874 0.1790 0.0201  -0.0377 0.0059  67  ASN K OD1 
2279 N  ND2 . ASN C  67  ? 0.2131 0.1908 0.1888 0.0186  -0.0389 0.0128  67  ASN K ND2 
2280 N  N   . PHE C  68  ? 0.2275 0.1920 0.1689 0.0389  -0.0308 0.0070  68  PHE K N   
2281 C  CA  . PHE C  68  ? 0.2299 0.1936 0.1679 0.0423  -0.0276 0.0092  68  PHE K CA  
2282 C  C   . PHE C  68  ? 0.2193 0.1932 0.1731 0.0332  -0.0292 0.0110  68  PHE K C   
2283 O  O   . PHE C  68  ? 0.2255 0.1962 0.1762 0.0322  -0.0299 0.0078  68  PHE K O   
2284 C  CB  . PHE C  68  ? 0.2459 0.2094 0.1766 0.0559  -0.0168 0.0207  68  PHE K CB  
2285 C  CG  . PHE C  68  ? 0.2517 0.2109 0.1750 0.0620  -0.0122 0.0232  68  PHE K CG  
2286 C  CD1 . PHE C  68  ? 0.2683 0.2074 0.1697 0.0645  -0.0182 0.0125  68  PHE K CD1 
2287 C  CD2 . PHE C  68  ? 0.2500 0.2250 0.1927 0.0638  -0.0043 0.0374  68  PHE K CD2 
2288 C  CE1 . PHE C  68  ? 0.2825 0.2144 0.1743 0.0708  -0.0141 0.0142  68  PHE K CE1 
2289 C  CE2 . PHE C  68  ? 0.2592 0.2302 0.1951 0.0704  0.0010  0.0404  68  PHE K CE2 
2290 C  CZ  . PHE C  68  ? 0.2750 0.2239 0.1832 0.0743  -0.0029 0.0280  68  PHE K CZ  
2291 N  N   A GLN C  69  ? 0.2164 0.1981 0.1838 0.0271  -0.0319 0.0158  69  GLN K N   
2292 N  N   B GLN C  69  ? 0.2135 0.1952 0.1809 0.0271  -0.0320 0.0158  69  GLN K N   
2293 C  CA  A GLN C  69  ? 0.2166 0.1985 0.1903 0.0197  -0.0385 0.0168  69  GLN K CA  
2294 C  CA  B GLN C  69  ? 0.2119 0.1937 0.1855 0.0196  -0.0386 0.0167  69  GLN K CA  
2295 C  C   A GLN C  69  ? 0.2175 0.1879 0.1786 0.0170  -0.0404 0.0066  69  GLN K C   
2296 C  C   B GLN C  69  ? 0.2144 0.1848 0.1754 0.0171  -0.0402 0.0065  69  GLN K C   
2297 O  O   A GLN C  69  ? 0.2204 0.1855 0.1760 0.0161  -0.0419 0.0055  69  GLN K O   
2298 O  O   B GLN C  69  ? 0.2174 0.1826 0.1730 0.0162  -0.0417 0.0054  69  GLN K O   
2299 C  CB  A GLN C  69  ? 0.2270 0.2124 0.2163 0.0137  -0.0467 0.0255  69  GLN K CB  
2300 C  CB  B GLN C  69  ? 0.2179 0.2022 0.2055 0.0135  -0.0467 0.0242  69  GLN K CB  
2301 C  CG  A GLN C  69  ? 0.2366 0.2162 0.2241 0.0105  -0.0502 0.0221  69  GLN K CG  
2302 C  CG  B GLN C  69  ? 0.2209 0.2208 0.2329 0.0166  -0.0431 0.0415  69  GLN K CG  
2303 C  CD  A GLN C  69  ? 0.2455 0.2361 0.2465 0.0146  -0.0440 0.0312  69  GLN K CD  
2304 C  CD  B GLN C  69  ? 0.2274 0.2311 0.2337 0.0279  -0.0295 0.0442  69  GLN K CD  
2305 O  OE1 A GLN C  69  ? 0.2581 0.2534 0.2540 0.0244  -0.0331 0.0336  69  GLN K OE1 
2306 O  OE1 B GLN C  69  ? 0.2343 0.2328 0.2319 0.0284  -0.0292 0.0379  69  GLN K OE1 
2307 N  NE2 A GLN C  69  ? 0.2260 0.2152 0.2392 0.0087  -0.0516 0.0363  69  GLN K NE2 
2308 N  NE2 B GLN C  69  ? 0.2290 0.2374 0.2350 0.0395  -0.0178 0.0538  69  GLN K NE2 
2309 N  N   . GLU C  70  ? 0.2082 0.1749 0.1662 0.0175  -0.0385 0.0017  70  GLU K N   
2310 C  CA  . GLU C  70  ? 0.2142 0.1731 0.1675 0.0180  -0.0356 -0.0025 70  GLU K CA  
2311 C  C   . GLU C  70  ? 0.2063 0.1663 0.1630 0.0198  -0.0329 -0.0031 70  GLU K C   
2312 O  O   . GLU C  70  ? 0.2309 0.1863 0.1860 0.0212  -0.0289 -0.0023 70  GLU K O   
2313 C  CB  . GLU C  70  ? 0.2119 0.1698 0.1691 0.0185  -0.0339 -0.0034 70  GLU K CB  
2314 C  CG  . GLU C  70  ? 0.2170 0.1686 0.1677 0.0172  -0.0364 -0.0032 70  GLU K CG  
2315 C  CD  . GLU C  70  ? 0.2155 0.1688 0.1716 0.0181  -0.0344 -0.0031 70  GLU K CD  
2316 O  OE1 . GLU C  70  ? 0.2169 0.1786 0.1818 0.0184  -0.0357 -0.0030 70  GLU K OE1 
2317 O  OE2 . GLU C  70  ? 0.2207 0.1637 0.1689 0.0196  -0.0328 -0.0031 70  GLU K OE2 
2318 N  N   . PHE C  71  ? 0.2027 0.1647 0.1607 0.0215  -0.0352 -0.0039 71  PHE K N   
2319 C  CA  . PHE C  71  ? 0.2029 0.1604 0.1613 0.0229  -0.0364 -0.0049 71  PHE K CA  
2320 C  C   . PHE C  71  ? 0.2049 0.1641 0.1597 0.0238  -0.0326 -0.0029 71  PHE K C   
2321 O  O   . PHE C  71  ? 0.2017 0.1578 0.1596 0.0239  -0.0316 -0.0028 71  PHE K O   
2322 C  CB  . PHE C  71  ? 0.2169 0.1649 0.1644 0.0276  -0.0423 -0.0073 71  PHE K CB  
2323 C  CG  . PHE C  71  ? 0.2285 0.1644 0.1673 0.0310  -0.0458 -0.0090 71  PHE K CG  
2324 C  CD1 . PHE C  71  ? 0.2349 0.1629 0.1852 0.0265  -0.0543 -0.0100 71  PHE K CD1 
2325 C  CD2 . PHE C  71  ? 0.2352 0.1667 0.1570 0.0395  -0.0403 -0.0071 71  PHE K CD2 
2326 C  CE1 . PHE C  71  ? 0.2507 0.1632 0.1920 0.0290  -0.0603 -0.0118 71  PHE K CE1 
2327 C  CE2 . PHE C  71  ? 0.2553 0.1709 0.1641 0.0443  -0.0432 -0.0091 71  PHE K CE2 
2328 C  CZ  . PHE C  71  ? 0.2621 0.1669 0.1790 0.0382  -0.0544 -0.0127 71  PHE K CZ  
2329 N  N   . LEU C  72  ? 0.2099 0.1745 0.1620 0.0243  -0.0320 0.0006  72  LEU K N   
2330 C  CA  . LEU C  72  ? 0.2185 0.1851 0.1700 0.0246  -0.0312 0.0041  72  LEU K CA  
2331 C  C   . LEU C  72  ? 0.2267 0.1861 0.1728 0.0228  -0.0312 0.0023  72  LEU K C   
2332 O  O   . LEU C  72  ? 0.2194 0.1768 0.1620 0.0243  -0.0300 0.0039  72  LEU K O   
2333 C  CB  . LEU C  72  ? 0.2326 0.2080 0.1916 0.0244  -0.0333 0.0126  72  LEU K CB  
2334 C  CG  . LEU C  72  ? 0.2428 0.2236 0.2042 0.0322  -0.0267 0.0192  72  LEU K CG  
2335 C  CD1 . LEU C  72  ? 0.2558 0.2505 0.2371 0.0328  -0.0261 0.0345  72  LEU K CD1 
2336 C  CD2 . LEU C  72  ? 0.2543 0.2293 0.2060 0.0391  -0.0213 0.0186  72  LEU K CD2 
2337 N  N   . ILE C  73  ? 0.2244 0.1769 0.1660 0.0224  -0.0307 0.0002  73  ILE K N   
2338 C  CA  . ILE C  73  ? 0.2456 0.1847 0.1740 0.0268  -0.0258 0.0006  73  ILE K CA  
2339 C  C   . ILE C  73  ? 0.2336 0.1758 0.1728 0.0298  -0.0171 0.0034  73  ILE K C   
2340 O  O   . ILE C  73  ? 0.2495 0.1849 0.1804 0.0344  -0.0121 0.0061  73  ILE K O   
2341 C  CB  . ILE C  73  ? 0.2547 0.1822 0.1732 0.0302  -0.0225 0.0001  73  ILE K CB  
2342 C  CG1 . ILE C  73  ? 0.2736 0.1954 0.1834 0.0257  -0.0342 -0.0023 73  ILE K CG1 
2343 C  CG2 . ILE C  73  ? 0.2852 0.1933 0.1829 0.0407  -0.0126 0.0033  73  ILE K CG2 
2344 C  CD1 . ILE C  73  ? 0.2890 0.1974 0.1872 0.0291  -0.0321 -0.0036 73  ILE K CD1 
2345 N  N   . LEU C  74  ? 0.2237 0.1737 0.1820 0.0272  -0.0174 0.0039  74  LEU K N   
2346 C  CA  . LEU C  74  ? 0.2180 0.1699 0.1943 0.0275  -0.0143 0.0086  74  LEU K CA  
2347 C  C   . LEU C  74  ? 0.2170 0.1683 0.1885 0.0273  -0.0167 0.0069  74  LEU K C   
2348 O  O   . LEU C  74  ? 0.2323 0.1819 0.2098 0.0298  -0.0110 0.0118  74  LEU K O   
2349 C  CB  . LEU C  74  ? 0.2135 0.1683 0.2100 0.0229  -0.0225 0.0091  74  LEU K CB  
2350 C  CG  . LEU C  74  ? 0.2152 0.1682 0.2351 0.0202  -0.0276 0.0146  74  LEU K CG  
2351 C  CD1 . LEU C  74  ? 0.2178 0.1761 0.2624 0.0239  -0.0144 0.0289  74  LEU K CD1 
2352 C  CD2 . LEU C  74  ? 0.2184 0.1661 0.2484 0.0149  -0.0442 0.0122  74  LEU K CD2 
2353 N  N   . VAL C  75  ? 0.2090 0.1615 0.1709 0.0263  -0.0230 0.0023  75  VAL K N   
2354 C  CA  . VAL C  75  ? 0.2092 0.1603 0.1652 0.0286  -0.0230 0.0024  75  VAL K CA  
2355 C  C   . VAL C  75  ? 0.2110 0.1631 0.1611 0.0306  -0.0179 0.0058  75  VAL K C   
2356 O  O   . VAL C  75  ? 0.2190 0.1689 0.1707 0.0326  -0.0147 0.0080  75  VAL K O   
2357 C  CB  . VAL C  75  ? 0.2118 0.1646 0.1587 0.0314  -0.0251 0.0019  75  VAL K CB  
2358 C  CG1 . VAL C  75  ? 0.2256 0.1775 0.1666 0.0365  -0.0216 0.0052  75  VAL K CG1 
2359 C  CG2 . VAL C  75  ? 0.2189 0.1620 0.1609 0.0330  -0.0308 -0.0022 75  VAL K CG2 
2360 N  N   . ILE C  76  ? 0.2146 0.1661 0.1552 0.0301  -0.0200 0.0061  76  ILE K N   
2361 C  CA  . ILE C  76  ? 0.2247 0.1684 0.1511 0.0329  -0.0205 0.0085  76  ILE K CA  
2362 C  C   . ILE C  76  ? 0.2413 0.1751 0.1618 0.0394  -0.0102 0.0110  76  ILE K C   
2363 O  O   . ILE C  76  ? 0.2369 0.1679 0.1535 0.0431  -0.0064 0.0140  76  ILE K O   
2364 C  CB  . ILE C  76  ? 0.2306 0.1650 0.1428 0.0312  -0.0304 0.0076  76  ILE K CB  
2365 C  CG1 . ILE C  76  ? 0.2248 0.1717 0.1510 0.0254  -0.0406 0.0115  76  ILE K CG1 
2366 C  CG2 . ILE C  76  ? 0.2575 0.1705 0.1427 0.0367  -0.0345 0.0083  76  ILE K CG2 
2367 C  CD1 . ILE C  76  ? 0.2324 0.1725 0.1557 0.0206  -0.0533 0.0120  76  ILE K CD1 
2368 N  N   . LYS C  77  ? 0.2493 0.1804 0.1748 0.0416  -0.0034 0.0125  77  LYS K N   
2369 C  CA  . LYS C  77  ? 0.2683 0.1926 0.1956 0.0505  0.0110  0.0207  77  LYS K CA  
2370 C  C   . LYS C  77  ? 0.2557 0.1897 0.2096 0.0487  0.0152  0.0265  77  LYS K C   
2371 O  O   . LYS C  77  ? 0.2633 0.1925 0.2157 0.0560  0.0256  0.0340  77  LYS K O   
2372 C  CB  . LYS C  77  ? 0.2831 0.2052 0.2169 0.0543  0.0188  0.0252  77  LYS K CB  
2373 C  CG  . LYS C  77  ? 0.3259 0.2282 0.2235 0.0600  0.0162  0.0203  77  LYS K CG  
2374 C  CD  . LYS C  77  ? 0.3605 0.2530 0.2539 0.0702  0.0299  0.0273  77  LYS K CD  
2375 C  CE  . LYS C  77  ? 0.4077 0.2658 0.2492 0.0810  0.0275  0.0225  77  LYS K CE  
2376 N  NZ  . LYS C  77  ? 0.4552 0.2994 0.2869 0.0952  0.0446  0.0307  77  LYS K NZ  
2377 N  N   . MET C  78  ? 0.2382 0.1815 0.2129 0.0398  0.0058  0.0231  78  MET K N   
2378 C  CA  . MET C  78  ? 0.2331 0.1783 0.2283 0.0368  0.0034  0.0265  78  MET K CA  
2379 C  C   . MET C  78  ? 0.2317 0.1742 0.2119 0.0395  0.0045  0.0247  78  MET K C   
2380 O  O   . MET C  78  ? 0.2412 0.1822 0.2331 0.0415  0.0096  0.0312  78  MET K O   
2381 C  CB  . MET C  78  ? 0.2276 0.1714 0.2326 0.0292  -0.0117 0.0205  78  MET K CB  
2382 C  CG  . MET C  78  ? 0.2252 0.1716 0.2559 0.0253  -0.0155 0.0260  78  MET K CG  
2383 S  SD  . MET C  78  ? 0.2741 0.2089 0.3082 0.0178  -0.0385 0.0186  78  MET K SD  
2384 C  CE  . MET C  78  ? 0.2564 0.1761 0.2938 0.0165  -0.0474 0.0192  78  MET K CE  
2385 N  N   . GLY C  79  ? 0.2329 0.1760 0.1922 0.0394  -0.0005 0.0182  79  GLY K N   
2386 C  CA  . GLY C  79  ? 0.2302 0.1730 0.1792 0.0420  -0.0003 0.0187  79  GLY K CA  
2387 C  C   . GLY C  79  ? 0.2410 0.1774 0.1782 0.0487  0.0075  0.0240  79  GLY K C   
2388 O  O   . GLY C  79  ? 0.2432 0.1785 0.1831 0.0517  0.0121  0.0279  79  GLY K O   
2389 N  N   . VAL C  80  ? 0.2471 0.1748 0.1668 0.0527  0.0087  0.0240  80  VAL K N   
2390 C  CA  . VAL C  80  ? 0.2690 0.1808 0.1644 0.0632  0.0152  0.0285  80  VAL K CA  
2391 C  C   . VAL C  80  ? 0.2768 0.1888 0.1881 0.0704  0.0326  0.0388  80  VAL K C   
2392 O  O   . VAL C  80  ? 0.2930 0.1984 0.1955 0.0782  0.0402  0.0446  80  VAL K O   
2393 C  CB  . VAL C  80  ? 0.2898 0.1820 0.1543 0.0689  0.0120  0.0259  80  VAL K CB  
2394 C  CG1 . VAL C  80  ? 0.3312 0.1968 0.1607 0.0856  0.0226  0.0316  80  VAL K CG1 
2395 C  CG2 . VAL C  80  ? 0.2878 0.1799 0.1437 0.0602  -0.0087 0.0193  80  VAL K CG2 
2396 N  N   . ALA C  81  ? 0.2694 0.1896 0.2085 0.0679  0.0383  0.0436  81  ALA K N   
2397 C  CA  . ALA C  81  ? 0.2744 0.1979 0.2415 0.0739  0.0540  0.0589  81  ALA K CA  
2398 C  C   . ALA C  81  ? 0.2656 0.1964 0.2561 0.0679  0.0505  0.0614  81  ALA K C   
2399 O  O   . ALA C  81  ? 0.2792 0.2076 0.2761 0.0757  0.0630  0.0728  81  ALA K O   
2400 C  CB  . ALA C  81  ? 0.2639 0.1969 0.2646 0.0697  0.0557  0.0658  81  ALA K CB  
2401 N  N   . ALA C  82  ? 0.2512 0.1871 0.2490 0.0560  0.0339  0.0508  82  ALA K N   
2402 C  CA  . ALA C  82  ? 0.2544 0.1896 0.2647 0.0518  0.0284  0.0509  82  ALA K CA  
2403 C  C   . ALA C  82  ? 0.2634 0.1952 0.2514 0.0585  0.0338  0.0505  82  ALA K C   
2404 O  O   . ALA C  82  ? 0.2750 0.2050 0.2751 0.0601  0.0380  0.0570  82  ALA K O   
2405 C  CB  . ALA C  82  ? 0.2504 0.1829 0.2589 0.0430  0.0110  0.0392  82  ALA K CB  
2406 N  N   . HIS C  83  ? 0.2729 0.2030 0.2308 0.0614  0.0312  0.0439  83  HIS K N   
2407 C  CA  . HIS C  83  ? 0.2831 0.2092 0.2207 0.0671  0.0326  0.0447  83  HIS K CA  
2408 C  C   . HIS C  83  ? 0.3127 0.2291 0.2422 0.0792  0.0479  0.0554  83  HIS K C   
2409 O  O   . HIS C  83  ? 0.3117 0.2263 0.2409 0.0838  0.0534  0.0607  83  HIS K O   
2410 C  CB  . HIS C  83  ? 0.2884 0.2130 0.2018 0.0662  0.0214  0.0385  83  HIS K CB  
2411 C  CG  . HIS C  83  ? 0.3107 0.2269 0.2020 0.0729  0.0196  0.0419  83  HIS K CG  
2412 N  ND1 . HIS C  83  ? 0.3496 0.2463 0.2103 0.0823  0.0206  0.0437  83  HIS K ND1 
2413 C  CD2 . HIS C  83  ? 0.3189 0.2404 0.2132 0.0731  0.0173  0.0448  83  HIS K CD2 
2414 C  CE1 . HIS C  83  ? 0.3652 0.2545 0.2092 0.0870  0.0156  0.0467  83  HIS K CE1 
2415 N  NE2 . HIS C  83  ? 0.3435 0.2513 0.2123 0.0807  0.0145  0.0482  83  HIS K NE2 
2416 N  N   . LYS C  84  ? 0.3356 0.2439 0.2568 0.0870  0.0574  0.0604  84  LYS K N   
2417 C  CA  . LYS C  84  ? 0.3726 0.2678 0.2822 0.1038  0.0772  0.0740  84  LYS K CA  
2418 C  C   . LYS C  84  ? 0.3632 0.2704 0.3168 0.1031  0.0892  0.0884  84  LYS K C   
2419 O  O   . LYS C  84  ? 0.3727 0.2740 0.3215 0.1135  0.1016  0.0983  84  LYS K O   
2420 C  CB  . LYS C  84  ? 0.4152 0.2972 0.3079 0.1151  0.0881  0.0789  84  LYS K CB  
2421 C  CG  . LYS C  84  ? 0.4894 0.3533 0.3648 0.1384  0.1142  0.0964  84  LYS K CG  
2422 C  CD  . LYS C  84  ? 0.5327 0.3778 0.3806 0.1517  0.1237  0.0990  84  LYS K CD  
2423 C  CE  . LYS C  84  ? 0.5992 0.4326 0.4471 0.1768  0.1572  0.1234  84  LYS K CE  
2424 N  NZ  . LYS C  84  ? 0.6636 0.4849 0.4969 0.1866  0.1660  0.1264  84  LYS K NZ  
2425 N  N   . LYS C  85  ? 0.3323 0.2536 0.3286 0.0904  0.0828  0.0899  85  LYS K N   
2426 C  CA  . LYS C  85  ? 0.3416 0.2710 0.3855 0.0870  0.0878  0.1049  85  LYS K CA  
2427 C  C   . LYS C  85  ? 0.3278 0.2559 0.3731 0.0814  0.0792  0.0999  85  LYS K C   
2428 O  O   . LYS C  85  ? 0.3316 0.2611 0.4066 0.0831  0.0869  0.1144  85  LYS K O   
2429 C  CB  . LYS C  85  ? 0.3463 0.2851 0.4334 0.0735  0.0756  0.1073  85  LYS K CB  
2430 C  CG  . LYS C  85  ? 0.3847 0.3287 0.4911 0.0825  0.0925  0.1243  85  LYS K CG  
2431 C  CD  . LYS C  85  ? 0.3898 0.3444 0.5463 0.0690  0.0792  0.1308  85  LYS K CD  
2432 C  CE  . LYS C  85  ? 0.4014 0.3616 0.5678 0.0784  0.0951  0.1439  85  LYS K CE  
2433 N  NZ  . LYS C  85  ? 0.4337 0.4029 0.6479 0.0903  0.1194  0.1772  85  LYS K NZ  
2434 N  N   . SER C  86  ? 0.3139 0.2393 0.3301 0.0761  0.0651  0.0824  86  SER K N   
2435 C  CA  . SER C  86  ? 0.3239 0.2463 0.3371 0.0737  0.0594  0.0786  86  SER K CA  
2436 C  C   . SER C  86  ? 0.3418 0.2606 0.3414 0.0862  0.0746  0.0882  86  SER K C   
2437 O  O   . SER C  86  ? 0.3440 0.2608 0.3505 0.0861  0.0749  0.0908  86  SER K O   
2438 C  CB  . SER C  86  ? 0.3240 0.2461 0.3114 0.0689  0.0453  0.0626  86  SER K CB  
2439 O  OG  . SER C  86  ? 0.3304 0.2531 0.2874 0.0758  0.0478  0.0605  86  SER K OG  
2440 N  N   . HIS C  87  ? 0.3580 0.2713 0.3337 0.0987  0.0869  0.0934  87  HIS K N   
2441 C  CA  . HIS C  87  ? 0.3951 0.2985 0.3489 0.1140  0.1013  0.1028  87  HIS K CA  
2442 C  C   . HIS C  87  ? 0.4278 0.3289 0.4024 0.1272  0.1255  0.1247  87  HIS K C   
2443 O  O   . HIS C  87  ? 0.4661 0.3542 0.4151 0.1449  0.1417  0.1346  87  HIS K O   
2444 C  CB  . HIS C  87  ? 0.4101 0.2986 0.3113 0.1221  0.0953  0.0938  87  HIS K CB  
2445 C  CG  . HIS C  87  ? 0.3942 0.2881 0.2844 0.1112  0.0743  0.0799  87  HIS K CG  
2446 N  ND1 . HIS C  87  ? 0.3865 0.2855 0.2812 0.1093  0.0711  0.0804  87  HIS K ND1 
2447 C  CD2 . HIS C  87  ? 0.3794 0.2751 0.2572 0.1031  0.0572  0.0686  87  HIS K CD2 
2448 C  CE1 . HIS C  87  ? 0.3727 0.2780 0.2608 0.1015  0.0544  0.0717  87  HIS K CE1 
2449 N  NE2 . HIS C  87  ? 0.3744 0.2783 0.2539 0.0973  0.0456  0.0650  87  HIS K NE2 
2450 N  N   . GLU C  88  ? 0.4405 0.3536 0.4637 0.1197  0.1278  0.1347  88  GLU K N   
2451 C  CA  . GLU C  88  ? 0.4984 0.4150 0.5581 0.1321  0.1528  0.1627  88  GLU K CA  
2452 C  C   . GLU C  88  ? 0.5118 0.4397 0.6313 0.1204  0.1484  0.1755  88  GLU K C   
2453 O  O   . GLU C  88  ? 0.5160 0.4467 0.6526 0.1012  0.1236  0.1620  88  GLU K O   
2454 C  CB  . GLU C  88  ? 0.5043 0.4256 0.5810 0.1345  0.1598  0.1711  88  GLU K CB  
2455 C  CG  . GLU C  88  ? 0.5376 0.4401 0.5501 0.1486  0.1646  0.1599  88  GLU K CG  
2456 C  CD  . GLU C  88  ? 0.5684 0.4744 0.5916 0.1486  0.1672  0.1627  88  GLU K CD  
2457 O  OE1 . GLU C  88  ? 0.5432 0.4692 0.6237 0.1328  0.1584  0.1686  88  GLU K OE1 
2458 O  OE2 . GLU C  88  ? 0.6101 0.4951 0.5807 0.1644  0.1751  0.1582  88  GLU K OE2 
2459 N  N   . GLU C  89  ? 0.5909 0.5208 0.7381 0.1336  0.1718  0.2020  89  GLU K N   
2460 C  CA  . GLU C  89  ? 0.6023 0.5405 0.8111 0.1227  0.1669  0.2179  89  GLU K CA  
2461 C  C   . GLU C  89  ? 0.6196 0.5726 0.9036 0.1143  0.1662  0.2419  89  GLU K C   
2462 O  O   . GLU C  89  ? 0.6247 0.5807 0.9236 0.0978  0.1432  0.2306  89  GLU K O   
2463 C  CB  . GLU C  89  ? 0.6358 0.5701 0.8424 0.1406  0.1918  0.2370  89  GLU K CB  
2464 N  N   . LYS D  4   ? 0.5982 0.4821 0.8060 -0.0567 -0.2238 0.0729  4   LYS L N   
2465 C  CA  . LYS D  4   ? 0.5464 0.4753 0.7806 -0.0588 -0.1950 0.0872  4   LYS L CA  
2466 C  C   . LYS D  4   ? 0.4597 0.3964 0.6551 -0.0432 -0.1712 0.0708  4   LYS L C   
2467 O  O   . LYS D  4   ? 0.4745 0.4225 0.6734 -0.0395 -0.1682 0.0682  4   LYS L O   
2468 C  CB  . LYS D  4   ? 0.5692 0.5255 0.8311 -0.0674 -0.1760 0.1089  4   LYS L CB  
2469 C  CG  . LYS D  4   ? 0.6273 0.5866 0.9391 -0.0862 -0.1958 0.1333  4   LYS L CG  
2470 C  CD  . LYS D  4   ? 0.6334 0.6202 0.9956 -0.0953 -0.2019 0.1499  4   LYS L CD  
2471 C  CE  . LYS D  4   ? 0.6838 0.6360 1.0527 -0.1006 -0.2422 0.1418  4   LYS L CE  
2472 N  NZ  . LYS D  4   ? 0.6860 0.6627 1.0928 -0.1042 -0.2467 0.1504  4   LYS L NZ  
2473 N  N   . MET D  5   ? 0.4170 0.3462 0.5777 -0.0348 -0.1573 0.0606  5   MET L N   
2474 C  CA  . MET D  5   ? 0.3536 0.2952 0.4859 -0.0229 -0.1332 0.0502  5   MET L CA  
2475 C  C   . MET D  5   ? 0.3344 0.2649 0.4413 -0.0144 -0.1398 0.0356  5   MET L C   
2476 O  O   . MET D  5   ? 0.3395 0.2440 0.4212 -0.0096 -0.1573 0.0235  5   MET L O   
2477 C  CB  . MET D  5   ? 0.3595 0.2941 0.4621 -0.0163 -0.1206 0.0427  5   MET L CB  
2478 C  CG  . MET D  5   ? 0.3597 0.3116 0.4832 -0.0229 -0.1072 0.0586  5   MET L CG  
2479 S  SD  . MET D  5   ? 0.6179 0.5601 0.7098 -0.0160 -0.0958 0.0513  5   MET L SD  
2480 C  CE  . MET D  5   ? 0.3550 0.3110 0.4214 -0.0037 -0.0744 0.0391  5   MET L CE  
2481 N  N   . SER D  6   ? 0.2918 0.2429 0.4022 -0.0107 -0.1242 0.0369  6   SER L N   
2482 C  CA  . SER D  6   ? 0.2869 0.2301 0.3719 -0.0031 -0.1271 0.0261  6   SER L CA  
2483 C  C   . SER D  6   ? 0.2826 0.2169 0.3266 0.0062  -0.1170 0.0142  6   SER L C   
2484 O  O   . SER D  6   ? 0.2676 0.2055 0.3053 0.0075  -0.1045 0.0139  6   SER L O   
2485 C  CB  . SER D  6   ? 0.2642 0.2306 0.3664 -0.0017 -0.1138 0.0318  6   SER L CB  
2486 O  OG  . SER D  6   ? 0.2381 0.2178 0.3311 0.0032  -0.0912 0.0311  6   SER L OG  
2487 N  N   . GLN D  7   ? 0.2913 0.2173 0.3094 0.0126  -0.1216 0.0064  7   GLN L N   
2488 C  CA  . GLN D  7   ? 0.2889 0.2136 0.2730 0.0211  -0.1106 -0.0013 7   GLN L CA  
2489 C  C   . GLN D  7   ? 0.2592 0.2028 0.2501 0.0207  -0.0886 0.0031  7   GLN L C   
2490 O  O   . GLN D  7   ? 0.2525 0.1976 0.2291 0.0243  -0.0785 -0.0004 7   GLN L O   
2491 C  CB  . GLN D  7   ? 0.3126 0.2317 0.2741 0.0263  -0.1175 -0.0049 7   GLN L CB  
2492 C  CG  . GLN D  7   ? 0.3245 0.2475 0.2539 0.0344  -0.1060 -0.0090 7   GLN L CG  
2493 C  CD  . GLN D  7   ? 0.3604 0.2796 0.2665 0.0390  -0.1131 -0.0090 7   GLN L CD  
2494 O  OE1 . GLN D  7   ? 0.4051 0.3143 0.3159 0.0370  -0.1294 -0.0081 7   GLN L OE1 
2495 N  NE2 . GLN D  7   ? 0.3698 0.2994 0.2534 0.0442  -0.1004 -0.0074 7   GLN L NE2 
2496 N  N   . LEU D  8   ? 0.2401 0.1971 0.2526 0.0176  -0.0831 0.0098  8   LEU L N   
2497 C  CA  . LEU D  8   ? 0.2240 0.1942 0.2389 0.0195  -0.0662 0.0117  8   LEU L CA  
2498 C  C   . LEU D  8   ? 0.2194 0.1955 0.2423 0.0186  -0.0566 0.0137  8   LEU L C   
2499 O  O   . LEU D  8   ? 0.2215 0.1999 0.2324 0.0216  -0.0460 0.0112  8   LEU L O   
2500 C  CB  . LEU D  8   ? 0.2115 0.1924 0.2473 0.0195  -0.0649 0.0165  8   LEU L CB  
2501 C  CG  . LEU D  8   ? 0.2045 0.1942 0.2398 0.0240  -0.0513 0.0160  8   LEU L CG  
2502 C  CD1 . LEU D  8   ? 0.2063 0.1896 0.2174 0.0256  -0.0480 0.0125  8   LEU L CD1 
2503 C  CD2 . LEU D  8   ? 0.1963 0.1933 0.2510 0.0269  -0.0537 0.0187  8   LEU L CD2 
2504 N  N   . GLU D  9   ? 0.2267 0.2050 0.2716 0.0134  -0.0623 0.0200  9   GLU L N   
2505 C  CA  . GLU D  9   ? 0.2346 0.2189 0.2883 0.0112  -0.0544 0.0255  9   GLU L CA  
2506 C  C   . GLU D  9   ? 0.2345 0.2036 0.2649 0.0130  -0.0565 0.0187  9   GLU L C   
2507 O  O   . GLU D  9   ? 0.2276 0.2006 0.2520 0.0150  -0.0457 0.0193  9   GLU L O   
2508 C  CB  . GLU D  9   ? 0.2497 0.2404 0.3350 0.0031  -0.0620 0.0373  9   GLU L CB  
2509 C  CG  . GLU D  9   ? 0.2583 0.2737 0.3733 0.0029  -0.0539 0.0473  9   GLU L CG  
2510 C  CD  . GLU D  9   ? 0.2939 0.3192 0.4460 -0.0070 -0.0632 0.0621  9   GLU L CD  
2511 O  OE1 . GLU D  9   ? 0.3165 0.3296 0.4792 -0.0129 -0.0833 0.0622  9   GLU L OE1 
2512 O  OE2 . GLU D  9   ? 0.3285 0.3749 0.5000 -0.0090 -0.0509 0.0752  9   GLU L OE2 
2513 N  N   . ARG D  10  ? 0.2611 0.2126 0.2764 0.0145  -0.0711 0.0113  10  ARG L N   
2514 C  CA  . ARG D  10  ? 0.2809 0.2184 0.2727 0.0198  -0.0739 0.0028  10  ARG L CA  
2515 C  C   . ARG D  10  ? 0.2586 0.2046 0.2311 0.0266  -0.0593 -0.0023 10  ARG L C   
2516 O  O   . ARG D  10  ? 0.2524 0.1969 0.2149 0.0302  -0.0541 -0.0054 10  ARG L O   
2517 C  CB  . ARG D  10  ? 0.3326 0.2498 0.3076 0.0242  -0.0930 -0.0064 10  ARG L CB  
2518 C  CG  . ARG D  10  ? 0.3821 0.2847 0.3764 0.0170  -0.1138 -0.0023 10  ARG L CG  
2519 C  CD  . ARG D  10  ? 0.4707 0.3454 0.4422 0.0243  -0.1369 -0.0149 10  ARG L CD  
2520 N  NE  . ARG D  10  ? 0.5279 0.4007 0.4739 0.0332  -0.1394 -0.0234 10  ARG L NE  
2521 C  CZ  . ARG D  10  ? 0.5664 0.4340 0.5167 0.0308  -0.1529 -0.0224 10  ARG L CZ  
2522 N  NH1 . ARG D  10  ? 0.5947 0.4600 0.5786 0.0192  -0.1664 -0.0131 10  ARG L NH1 
2523 N  NH2 . ARG D  10  ? 0.6051 0.4718 0.5266 0.0401  -0.1528 -0.0291 10  ARG L NH2 
2524 N  N   . ASN D  11  ? 0.2425 0.1969 0.2114 0.0278  -0.0545 -0.0021 11  ASN L N   
2525 C  CA  . ASN D  11  ? 0.2291 0.1924 0.1850 0.0318  -0.0431 -0.0039 11  ASN L CA  
2526 C  C   . ASN D  11  ? 0.2126 0.1840 0.1774 0.0307  -0.0318 -0.0008 11  ASN L C   
2527 O  O   . ASN D  11  ? 0.2171 0.1905 0.1720 0.0339  -0.0260 -0.0034 11  ASN L O   
2528 C  CB  . ASN D  11  ? 0.2294 0.1974 0.1815 0.0317  -0.0434 -0.0018 11  ASN L CB  
2529 C  CG  . ASN D  11  ? 0.2453 0.2052 0.1807 0.0351  -0.0542 -0.0052 11  ASN L CG  
2530 O  OD1 . ASN D  11  ? 0.2739 0.2254 0.1917 0.0417  -0.0596 -0.0123 11  ASN L OD1 
2531 N  ND2 . ASN D  11  ? 0.2332 0.1938 0.1712 0.0328  -0.0589 -0.0012 11  ASN L ND2 
2532 N  N   . ILE D  12  ? 0.2028 0.1799 0.1856 0.0276  -0.0293 0.0047  12  ILE L N   
2533 C  CA  . ILE D  12  ? 0.2024 0.1868 0.1898 0.0292  -0.0190 0.0071  12  ILE L CA  
2534 C  C   . ILE D  12  ? 0.2043 0.1842 0.1878 0.0288  -0.0180 0.0079  12  ILE L C   
2535 O  O   . ILE D  12  ? 0.1988 0.1796 0.1735 0.0320  -0.0114 0.0064  12  ILE L O   
2536 C  CB  . ILE D  12  ? 0.2032 0.1981 0.2096 0.0290  -0.0157 0.0129  12  ILE L CB  
2537 C  CG1 . ILE D  12  ? 0.2135 0.2095 0.2205 0.0313  -0.0176 0.0104  12  ILE L CG1 
2538 C  CG2 . ILE D  12  ? 0.2062 0.2094 0.2136 0.0328  -0.0046 0.0161  12  ILE L CG2 
2539 C  CD1 . ILE D  12  ? 0.2236 0.2304 0.2509 0.0332  -0.0165 0.0146  12  ILE L CD1 
2540 N  N   . GLU D  13  ? 0.2193 0.1923 0.2103 0.0246  -0.0267 0.0110  13  GLU L N   
2541 C  CA  . GLU D  13  ? 0.2452 0.2096 0.2331 0.0235  -0.0296 0.0126  13  GLU L CA  
2542 C  C   . GLU D  13  ? 0.2424 0.1992 0.2090 0.0301  -0.0297 0.0029  13  GLU L C   
2543 O  O   . GLU D  13  ? 0.2343 0.1897 0.1957 0.0319  -0.0257 0.0036  13  GLU L O   
2544 C  CB  . GLU D  13  ? 0.2845 0.2378 0.2840 0.0177  -0.0442 0.0163  13  GLU L CB  
2545 C  CG  . GLU D  13  ? 0.3296 0.2695 0.3274 0.0159  -0.0512 0.0189  13  GLU L CG  
2546 C  CD  . GLU D  13  ? 0.3827 0.3080 0.3962 0.0083  -0.0700 0.0246  13  GLU L CD  
2547 O  OE1 . GLU D  13  ? 0.4172 0.3424 0.4467 0.0005  -0.0722 0.0379  13  GLU L OE1 
2548 O  OE2 . GLU D  13  ? 0.4641 0.3769 0.4731 0.0100  -0.0842 0.0164  13  GLU L OE2 
2549 N  N   . THR D  14  ? 0.2392 0.1939 0.1943 0.0343  -0.0334 -0.0047 14  THR L N   
2550 C  CA  . THR D  14  ? 0.2417 0.1967 0.1803 0.0418  -0.0312 -0.0120 14  THR L CA  
2551 C  C   . THR D  14  ? 0.2280 0.1938 0.1668 0.0424  -0.0206 -0.0102 14  THR L C   
2552 O  O   . THR D  14  ? 0.2257 0.1912 0.1584 0.0466  -0.0192 -0.0131 14  THR L O   
2553 C  CB  . THR D  14  ? 0.2572 0.2139 0.1827 0.0474  -0.0344 -0.0177 14  THR L CB  
2554 O  OG1 . THR D  14  ? 0.2651 0.2069 0.1860 0.0491  -0.0480 -0.0219 14  THR L OG1 
2555 C  CG2 . THR D  14  ? 0.2654 0.2300 0.1773 0.0566  -0.0296 -0.0230 14  THR L CG2 
2556 N  N   . ILE D  15  ? 0.2133 0.1869 0.1592 0.0392  -0.0156 -0.0064 15  ILE L N   
2557 C  CA  . ILE D  15  ? 0.1960 0.1755 0.1417 0.0402  -0.0096 -0.0058 15  ILE L CA  
2558 C  C   . ILE D  15  ? 0.2057 0.1814 0.1502 0.0414  -0.0067 -0.0044 15  ILE L C   
2559 O  O   . ILE D  15  ? 0.2065 0.1817 0.1448 0.0443  -0.0058 -0.0065 15  ILE L O   
2560 C  CB  . ILE D  15  ? 0.1923 0.1759 0.1447 0.0382  -0.0083 -0.0034 15  ILE L CB  
2561 C  CG1 . ILE D  15  ? 0.1915 0.1788 0.1426 0.0364  -0.0117 -0.0025 15  ILE L CG1 
2562 C  CG2 . ILE D  15  ? 0.1974 0.1809 0.1482 0.0407  -0.0059 -0.0044 15  ILE L CG2 
2563 C  CD1 . ILE D  15  ? 0.1909 0.1785 0.1503 0.0340  -0.0140 0.0006  15  ILE L CD1 
2564 N  N   . ILE D  16  ? 0.2139 0.1889 0.1654 0.0390  -0.0055 0.0010  16  ILE L N   
2565 C  CA  . ILE D  16  ? 0.2205 0.1945 0.1694 0.0401  -0.0016 0.0053  16  ILE L CA  
2566 C  C   . ILE D  16  ? 0.2291 0.1932 0.1710 0.0406  -0.0069 0.0041  16  ILE L C   
2567 O  O   . ILE D  16  ? 0.2371 0.1987 0.1702 0.0439  -0.0051 0.0041  16  ILE L O   
2568 C  CB  . ILE D  16  ? 0.2191 0.1998 0.1814 0.0364  0.0018  0.0154  16  ILE L CB  
2569 C  CG1 . ILE D  16  ? 0.2123 0.2044 0.1810 0.0395  0.0080  0.0156  16  ILE L CG1 
2570 C  CG2 . ILE D  16  ? 0.2352 0.2168 0.1950 0.0363  0.0061  0.0241  16  ILE L CG2 
2571 C  CD1 . ILE D  16  ? 0.2085 0.2130 0.1967 0.0363  0.0112  0.0258  16  ILE L CD1 
2572 N  N   . ASN D  17  ? 0.2257 0.1823 0.1701 0.0390  -0.0151 0.0021  17  ASN L N   
2573 C  CA  . ASN D  17  ? 0.2406 0.1849 0.1783 0.0417  -0.0229 -0.0009 17  ASN L CA  
2574 C  C   . ASN D  17  ? 0.2367 0.1841 0.1643 0.0490  -0.0212 -0.0087 17  ASN L C   
2575 O  O   . ASN D  17  ? 0.2513 0.1926 0.1737 0.0520  -0.0236 -0.0091 17  ASN L O   
2576 C  CB  . ASN D  17  ? 0.2458 0.1784 0.1847 0.0418  -0.0350 -0.0049 17  ASN L CB  
2577 C  CG  . ASN D  17  ? 0.2570 0.1825 0.2105 0.0330  -0.0421 0.0051  17  ASN L CG  
2578 O  OD1 . ASN D  17  ? 0.2755 0.2063 0.2381 0.0272  -0.0368 0.0171  17  ASN L OD1 
2579 N  ND2 . ASN D  17  ? 0.2619 0.1764 0.2177 0.0323  -0.0548 0.0012  17  ASN L ND2 
2580 N  N   . THR D  18  ? 0.2233 0.1816 0.1504 0.0510  -0.0174 -0.0128 18  THR L N   
2581 C  CA  . THR D  18  ? 0.2337 0.2002 0.1574 0.0566  -0.0159 -0.0173 18  THR L CA  
2582 C  C   . THR D  18  ? 0.2308 0.1985 0.1547 0.0557  -0.0132 -0.0147 18  THR L C   
2583 O  O   . THR D  18  ? 0.2425 0.2099 0.1643 0.0599  -0.0157 -0.0169 18  THR L O   
2584 C  CB  . THR D  18  ? 0.2343 0.2147 0.1601 0.0571  -0.0126 -0.0180 18  THR L CB  
2585 O  OG1 . THR D  18  ? 0.2516 0.2280 0.1723 0.0593  -0.0163 -0.0210 18  THR L OG1 
2586 C  CG2 . THR D  18  ? 0.2357 0.2303 0.1631 0.0624  -0.0105 -0.0193 18  THR L CG2 
2587 N  N   . PHE D  19  ? 0.2203 0.1887 0.1457 0.0520  -0.0096 -0.0112 19  PHE L N   
2588 C  CA  . PHE D  19  ? 0.2299 0.1952 0.1497 0.0537  -0.0089 -0.0104 19  PHE L CA  
2589 C  C   . PHE D  19  ? 0.2489 0.2052 0.1605 0.0560  -0.0109 -0.0084 19  PHE L C   
2590 O  O   . PHE D  19  ? 0.2472 0.2002 0.1534 0.0596  -0.0148 -0.0106 19  PHE L O   
2591 C  CB  . PHE D  19  ? 0.2316 0.1976 0.1507 0.0531  -0.0045 -0.0081 19  PHE L CB  
2592 C  CG  . PHE D  19  ? 0.2463 0.2074 0.1541 0.0583  -0.0048 -0.0094 19  PHE L CG  
2593 C  CD1 . PHE D  19  ? 0.2482 0.2068 0.1551 0.0604  -0.0106 -0.0143 19  PHE L CD1 
2594 C  CD2 . PHE D  19  ? 0.2594 0.2179 0.1569 0.0615  -0.0001 -0.0048 19  PHE L CD2 
2595 C  CE1 . PHE D  19  ? 0.2669 0.2166 0.1591 0.0674  -0.0139 -0.0177 19  PHE L CE1 
2596 C  CE2 . PHE D  19  ? 0.2811 0.2345 0.1623 0.0691  -0.0004 -0.0068 19  PHE L CE2 
2597 C  CZ  . PHE D  19  ? 0.2875 0.2348 0.1644 0.0730  -0.0081 -0.0149 19  PHE L CZ  
2598 N  N   . HIS D  20  ? 0.2485 0.2003 0.1609 0.0532  -0.0098 -0.0028 20  HIS L N   
2599 C  CA  . HIS D  20  ? 0.2571 0.1995 0.1628 0.0535  -0.0124 0.0029  20  HIS L CA  
2600 C  C   . HIS D  20  ? 0.2626 0.1960 0.1662 0.0569  -0.0213 -0.0017 20  HIS L C   
2601 O  O   . HIS D  20  ? 0.2731 0.1985 0.1684 0.0592  -0.0248 0.0009  20  HIS L O   
2602 C  CB  . HIS D  20  ? 0.2646 0.2058 0.1779 0.0472  -0.0112 0.0131  20  HIS L CB  
2603 C  CG  . HIS D  20  ? 0.2684 0.2210 0.1822 0.0464  -0.0006 0.0215  20  HIS L CG  
2604 N  ND1 . HIS D  20  ? 0.2705 0.2311 0.1987 0.0407  0.0027  0.0301  20  HIS L ND1 
2605 C  CD2 . HIS D  20  ? 0.2873 0.2450 0.1872 0.0530  0.0067  0.0220  20  HIS L CD2 
2606 C  CE1 . HIS D  20  ? 0.2781 0.2522 0.2038 0.0441  0.0139  0.0366  20  HIS L CE1 
2607 N  NE2 . HIS D  20  ? 0.2894 0.2604 0.1952 0.0526  0.0163  0.0307  20  HIS L NE2 
2608 N  N   A GLN D  21  ? 0.2503 0.1854 0.1597 0.0591  -0.0251 -0.0087 21  GLN L N   
2609 N  N   B GLN D  21  ? 0.2506 0.1856 0.1599 0.0592  -0.0252 -0.0087 21  GLN L N   
2610 C  CA  A GLN D  21  ? 0.2588 0.1878 0.1665 0.0661  -0.0333 -0.0151 21  GLN L CA  
2611 C  CA  B GLN D  21  ? 0.2613 0.1891 0.1686 0.0661  -0.0338 -0.0148 21  GLN L CA  
2612 C  C   A GLN D  21  ? 0.2617 0.1956 0.1671 0.0709  -0.0338 -0.0175 21  GLN L C   
2613 C  C   B GLN D  21  ? 0.2621 0.1972 0.1684 0.0716  -0.0340 -0.0185 21  GLN L C   
2614 O  O   A GLN D  21  ? 0.2707 0.1956 0.1727 0.0757  -0.0412 -0.0187 21  GLN L O   
2615 O  O   B GLN D  21  ? 0.2669 0.1969 0.1724 0.0783  -0.0411 -0.0224 21  GLN L O   
2616 C  CB  A GLN D  21  ? 0.2561 0.1914 0.1668 0.0712  -0.0345 -0.0232 21  GLN L CB  
2617 C  CB  B GLN D  21  ? 0.2631 0.1920 0.1726 0.0712  -0.0377 -0.0228 21  GLN L CB  
2618 C  CG  A GLN D  21  ? 0.2604 0.1834 0.1714 0.0680  -0.0405 -0.0225 21  GLN L CG  
2619 C  CG  B GLN D  21  ? 0.2470 0.1961 0.1600 0.0747  -0.0305 -0.0273 21  GLN L CG  
2620 C  CD  A GLN D  21  ? 0.2576 0.1879 0.1671 0.0724  -0.0400 -0.0295 21  GLN L CD  
2621 C  CD  B GLN D  21  ? 0.2512 0.2031 0.1611 0.0812  -0.0324 -0.0340 21  GLN L CD  
2622 O  OE1 A GLN D  21  ? 0.2456 0.1930 0.1546 0.0776  -0.0333 -0.0331 21  GLN L OE1 
2623 O  OE1 B GLN D  21  ? 0.2540 0.1915 0.1604 0.0799  -0.0391 -0.0353 21  GLN L OE1 
2624 N  NE2 A GLN D  21  ? 0.2716 0.1895 0.1810 0.0699  -0.0479 -0.0300 21  GLN L NE2 
2625 N  NE2 B GLN D  21  ? 0.2561 0.2272 0.1673 0.0889  -0.0274 -0.0378 21  GLN L NE2 
2626 N  N   . TYR D  22  ? 0.2502 0.1965 0.1589 0.0692  -0.0283 -0.0177 22  TYR L N   
2627 C  CA  . TYR D  22  ? 0.2580 0.2085 0.1678 0.0721  -0.0317 -0.0192 22  TYR L CA  
2628 C  C   . TYR D  22  ? 0.2736 0.2133 0.1706 0.0712  -0.0331 -0.0157 22  TYR L C   
2629 O  O   . TYR D  22  ? 0.2939 0.2277 0.1860 0.0751  -0.0404 -0.0167 22  TYR L O   
2630 C  CB  . TYR D  22  ? 0.2451 0.2129 0.1674 0.0706  -0.0290 -0.0203 22  TYR L CB  
2631 C  CG  . TYR D  22  ? 0.2363 0.2189 0.1678 0.0743  -0.0261 -0.0228 22  TYR L CG  
2632 C  CD1 . TYR D  22  ? 0.2491 0.2410 0.1871 0.0826  -0.0291 -0.0260 22  TYR L CD1 
2633 C  CD2 . TYR D  22  ? 0.2355 0.2226 0.1667 0.0719  -0.0207 -0.0225 22  TYR L CD2 
2634 C  CE1 . TYR D  22  ? 0.2556 0.2630 0.1979 0.0898  -0.0251 -0.0291 22  TYR L CE1 
2635 C  CE2 . TYR D  22  ? 0.2414 0.2414 0.1751 0.0781  -0.0181 -0.0254 22  TYR L CE2 
2636 C  CZ  . TYR D  22  ? 0.2484 0.2595 0.1866 0.0878  -0.0194 -0.0289 22  TYR L CZ  
2637 O  OH  . TYR D  22  ? 0.2606 0.2867 0.1974 0.0973  -0.0153 -0.0325 22  TYR L OH  
2638 N  N   . SER D  23  ? 0.2724 0.2101 0.1624 0.0679  -0.0267 -0.0119 23  SER L N   
2639 C  CA  . SER D  23  ? 0.2885 0.2183 0.1618 0.0709  -0.0270 -0.0098 23  SER L CA  
2640 C  C   . SER D  23  ? 0.3013 0.2196 0.1615 0.0732  -0.0307 -0.0045 23  SER L C   
2641 O  O   . SER D  23  ? 0.3158 0.2258 0.1591 0.0782  -0.0350 -0.0042 23  SER L O   
2642 C  CB  . SER D  23  ? 0.2863 0.2199 0.1542 0.0701  -0.0176 -0.0065 23  SER L CB  
2643 O  OG  . SER D  23  ? 0.2889 0.2246 0.1595 0.0662  -0.0110 0.0022  23  SER L OG  
2644 N  N   . VAL D  24  ? 0.3048 0.2200 0.1709 0.0698  -0.0308 0.0004  24  VAL L N   
2645 C  CA  . VAL D  24  ? 0.3271 0.2295 0.1833 0.0699  -0.0356 0.0087  24  VAL L CA  
2646 C  C   . VAL D  24  ? 0.3367 0.2298 0.1903 0.0754  -0.0476 0.0037  24  VAL L C   
2647 O  O   . VAL D  24  ? 0.3532 0.2334 0.1951 0.0766  -0.0537 0.0106  24  VAL L O   
2648 C  CB  . VAL D  24  ? 0.3328 0.2308 0.1998 0.0636  -0.0367 0.0156  24  VAL L CB  
2649 C  CG1 . VAL D  24  ? 0.3277 0.2214 0.2059 0.0668  -0.0461 0.0054  24  VAL L CG1 
2650 C  CG2 . VAL D  24  ? 0.3747 0.2616 0.2317 0.0605  -0.0395 0.0306  24  VAL L CG2 
2651 N  N   . LYS D  25  ? 0.3206 0.2217 0.1861 0.0790  -0.0514 -0.0064 25  LYS L N   
2652 C  CA  . LYS D  25  ? 0.3360 0.2322 0.2053 0.0852  -0.0629 -0.0108 25  LYS L CA  
2653 C  C   . LYS D  25  ? 0.3583 0.2441 0.2122 0.0888  -0.0711 -0.0089 25  LYS L C   
2654 O  O   . LYS D  25  ? 0.3579 0.2302 0.2049 0.0919  -0.0803 -0.0059 25  LYS L O   
2655 C  CB  . LYS D  25  ? 0.3243 0.2384 0.2138 0.0886  -0.0629 -0.0194 25  LYS L CB  
2656 C  CG  . LYS D  25  ? 0.3220 0.2426 0.2207 0.0889  -0.0578 -0.0224 25  LYS L CG  
2657 C  CD  . LYS D  25  ? 0.3222 0.2645 0.2381 0.0948  -0.0559 -0.0291 25  LYS L CD  
2658 C  CE  . LYS D  25  ? 0.3301 0.2755 0.2477 0.0984  -0.0524 -0.0336 25  LYS L CE  
2659 N  NZ  . LYS D  25  ? 0.3312 0.2977 0.2610 0.1096  -0.0513 -0.0401 25  LYS L NZ  
2660 N  N   . LEU D  26  ? 0.3624 0.2515 0.2091 0.0890  -0.0694 -0.0109 26  LEU L N   
2661 C  CA  . LEU D  26  ? 0.3935 0.2725 0.2265 0.0941  -0.0807 -0.0126 26  LEU L CA  
2662 C  C   . LEU D  26  ? 0.4110 0.2834 0.2184 0.0960  -0.0762 -0.0109 26  LEU L C   
2663 O  O   . LEU D  26  ? 0.3946 0.2753 0.2040 0.0938  -0.0665 -0.0123 26  LEU L O   
2664 C  CB  . LEU D  26  ? 0.3964 0.2865 0.2510 0.0950  -0.0894 -0.0202 26  LEU L CB  
2665 C  CG  . LEU D  26  ? 0.3960 0.3010 0.2788 0.0966  -0.0923 -0.0228 26  LEU L CG  
2666 C  CD1 . LEU D  26  ? 0.4070 0.3290 0.3136 0.0951  -0.0979 -0.0256 26  LEU L CD1 
2667 C  CD2 . LEU D  26  ? 0.4270 0.3208 0.3063 0.1029  -0.1032 -0.0223 26  LEU L CD2 
2668 N  N   . GLY D  27  ? 0.4476 0.3049 0.2287 0.1022  -0.0839 -0.0088 27  GLY L N   
2669 C  CA  . GLY D  27  ? 0.4714 0.3232 0.2244 0.1083  -0.0803 -0.0095 27  GLY L CA  
2670 C  C   . GLY D  27  ? 0.4680 0.3294 0.2136 0.1066  -0.0616 -0.0015 27  GLY L C   
2671 O  O   . GLY D  27  ? 0.4633 0.3281 0.2127 0.1012  -0.0538 0.0103  27  GLY L O   
2672 N  N   . HIS D  28  ? 0.4772 0.3432 0.2156 0.1111  -0.0557 -0.0074 28  HIS L N   
2673 C  CA  . HIS D  28  ? 0.4793 0.3585 0.2146 0.1107  -0.0376 0.0002  28  HIS L CA  
2674 C  C   . HIS D  28  ? 0.4397 0.3316 0.2079 0.0985  -0.0307 0.0044  28  HIS L C   
2675 O  O   . HIS D  28  ? 0.3998 0.2949 0.1899 0.0941  -0.0355 -0.0040 28  HIS L O   
2676 C  CB  . HIS D  28  ? 0.4995 0.3807 0.2229 0.1198  -0.0344 -0.0089 28  HIS L CB  
2677 C  CG  . HIS D  28  ? 0.5254 0.4222 0.2389 0.1243  -0.0150 0.0004  28  HIS L CG  
2678 N  ND1 . HIS D  28  ? 0.4920 0.4060 0.2314 0.1153  -0.0027 0.0072  28  HIS L ND1 
2679 C  CD2 . HIS D  28  ? 0.5765 0.4769 0.2565 0.1379  -0.0055 0.0059  28  HIS L CD2 
2680 C  CE1 . HIS D  28  ? 0.5214 0.4508 0.2499 0.1215  0.0133  0.0169  28  HIS L CE1 
2681 N  NE2 . HIS D  28  ? 0.5745 0.4974 0.2657 0.1365  0.0130  0.0160  28  HIS L NE2 
2682 N  N   . PRO D  29  ? 0.4485 0.3479 0.2205 0.0930  -0.0201 0.0184  29  PRO L N   
2683 C  CA  . PRO D  29  ? 0.4280 0.3350 0.2291 0.0821  -0.0172 0.0216  29  PRO L CA  
2684 C  C   . PRO D  29  ? 0.4094 0.3300 0.2263 0.0794  -0.0084 0.0182  29  PRO L C   
2685 O  O   . PRO D  29  ? 0.3893 0.3132 0.2277 0.0719  -0.0096 0.0172  29  PRO L O   
2686 C  CB  . PRO D  29  ? 0.4459 0.3533 0.2460 0.0765  -0.0126 0.0398  29  PRO L CB  
2687 C  CG  . PRO D  29  ? 0.4710 0.3835 0.2438 0.0849  -0.0034 0.0480  29  PRO L CG  
2688 C  CD  . PRO D  29  ? 0.4806 0.3804 0.2309 0.0959  -0.0131 0.0338  29  PRO L CD  
2689 N  N   A ASP D  30  ? 0.4053 0.3326 0.2101 0.0869  -0.0010 0.0155  30  ASP L N   
2690 N  N   B ASP D  30  ? 0.4111 0.3387 0.2161 0.0868  -0.0006 0.0158  30  ASP L N   
2691 C  CA  A ASP D  30  ? 0.3909 0.3301 0.2104 0.0856  0.0060  0.0121  30  ASP L CA  
2692 C  CA  B ASP D  30  ? 0.4011 0.3407 0.2209 0.0856  0.0063  0.0121  30  ASP L CA  
2693 C  C   A ASP D  30  ? 0.3769 0.3103 0.1945 0.0909  -0.0017 -0.0028 30  ASP L C   
2694 C  C   B ASP D  30  ? 0.3817 0.3151 0.1995 0.0908  -0.0017 -0.0028 30  ASP L C   
2695 O  O   A ASP D  30  ? 0.3671 0.3073 0.1917 0.0924  0.0025  -0.0063 30  ASP L O   
2696 O  O   B ASP D  30  ? 0.3712 0.3113 0.1964 0.0923  0.0022  -0.0065 30  ASP L O   
2697 C  CB  A ASP D  30  ? 0.4128 0.3676 0.2264 0.0903  0.0211  0.0223  30  ASP L CB  
2698 C  CB  B ASP D  30  ? 0.4282 0.3838 0.2424 0.0905  0.0215  0.0219  30  ASP L CB  
2699 C  CG  A ASP D  30  ? 0.3940 0.3632 0.2316 0.0855  0.0279  0.0229  30  ASP L CG  
2700 C  CG  B ASP D  30  ? 0.4154 0.3852 0.2528 0.0867  0.0281  0.0213  30  ASP L CG  
2701 O  OD1 A ASP D  30  ? 0.3854 0.3530 0.2446 0.0749  0.0226  0.0220  30  ASP L OD1 
2702 O  OD1 B ASP D  30  ? 0.4090 0.3748 0.2614 0.0818  0.0212  0.0122  30  ASP L OD1 
2703 O  OD2 A ASP D  30  ? 0.3980 0.3807 0.2313 0.0942  0.0382  0.0243  30  ASP L OD2 
2704 O  OD2 B ASP D  30  ? 0.4186 0.4063 0.2597 0.0895  0.0409  0.0312  30  ASP L OD2 
2705 N  N   . THR D  31  ? 0.3729 0.2934 0.1841 0.0929  -0.0147 -0.0102 31  THR L N   
2706 C  CA  . THR D  31  ? 0.3599 0.2748 0.1782 0.0935  -0.0257 -0.0212 31  THR L CA  
2707 C  C   . THR D  31  ? 0.3389 0.2530 0.1751 0.0864  -0.0359 -0.0227 31  THR L C   
2708 O  O   . THR D  31  ? 0.3414 0.2529 0.1758 0.0855  -0.0383 -0.0193 31  THR L O   
2709 C  CB  . THR D  31  ? 0.3911 0.2915 0.1841 0.1062  -0.0348 -0.0301 31  THR L CB  
2710 O  OG1 . THR D  31  ? 0.4033 0.2915 0.1772 0.1111  -0.0436 -0.0305 31  THR L OG1 
2711 C  CG2 . THR D  31  ? 0.4078 0.3132 0.1822 0.1174  -0.0228 -0.0299 31  THR L CG2 
2712 N  N   . LEU D  32  ? 0.3130 0.2307 0.1673 0.0818  -0.0419 -0.0266 32  LEU L N   
2713 C  CA  . LEU D  32  ? 0.3043 0.2275 0.1788 0.0761  -0.0503 -0.0265 32  LEU L CA  
2714 C  C   . LEU D  32  ? 0.3155 0.2266 0.1862 0.0794  -0.0675 -0.0315 32  LEU L C   
2715 O  O   . LEU D  32  ? 0.3238 0.2258 0.1918 0.0810  -0.0760 -0.0361 32  LEU L O   
2716 C  CB  . LEU D  32  ? 0.2863 0.2230 0.1841 0.0684  -0.0479 -0.0244 32  LEU L CB  
2717 C  CG  . LEU D  32  ? 0.2668 0.2145 0.1706 0.0647  -0.0348 -0.0206 32  LEU L CG  
2718 C  CD1 . LEU D  32  ? 0.2625 0.2201 0.1829 0.0587  -0.0341 -0.0187 32  LEU L CD1 
2719 C  CD2 . LEU D  32  ? 0.2624 0.2162 0.1706 0.0645  -0.0314 -0.0186 32  LEU L CD2 
2720 N  N   . ASN D  33  ? 0.3232 0.2338 0.1976 0.0798  -0.0749 -0.0307 33  ASN L N   
2721 C  CA  . ASN D  33  ? 0.3417 0.2438 0.2217 0.0805  -0.0941 -0.0339 33  ASN L CA  
2722 C  C   . ASN D  33  ? 0.3201 0.2421 0.2375 0.0707  -0.0975 -0.0286 33  ASN L C   
2723 O  O   . ASN D  33  ? 0.2970 0.2368 0.2288 0.0658  -0.0845 -0.0239 33  ASN L O   
2724 C  CB  . ASN D  33  ? 0.3601 0.2510 0.2258 0.0867  -0.1037 -0.0354 33  ASN L CB  
2725 C  CG  . ASN D  33  ? 0.3494 0.2547 0.2320 0.0846  -0.0991 -0.0305 33  ASN L CG  
2726 O  OD1 . ASN D  33  ? 0.3158 0.2414 0.2237 0.0792  -0.0914 -0.0270 33  ASN L OD1 
2727 N  ND2 . ASN D  33  ? 0.3703 0.2642 0.2365 0.0905  -0.1042 -0.0306 33  ASN L ND2 
2728 N  N   . GLN D  34  ? 0.3400 0.2592 0.2732 0.0678  -0.1162 -0.0282 34  GLN L N   
2729 C  CA  . GLN D  34  ? 0.3284 0.2704 0.3001 0.0575  -0.1191 -0.0192 34  GLN L CA  
2730 C  C   . GLN D  34  ? 0.2963 0.2683 0.2881 0.0566  -0.1044 -0.0126 34  GLN L C   
2731 O  O   . GLN D  34  ? 0.2644 0.2599 0.2764 0.0508  -0.0939 -0.0050 34  GLN L O   
2732 C  CB  . GLN D  34  ? 0.3790 0.3142 0.3691 0.0534  -0.1439 -0.0176 34  GLN L CB  
2733 C  CG  . GLN D  34  ? 0.3896 0.3504 0.4223 0.0405  -0.1467 -0.0042 34  GLN L CG  
2734 C  CD  . GLN D  34  ? 0.4370 0.3849 0.4894 0.0333  -0.1748 -0.0011 34  GLN L CD  
2735 O  OE1 . GLN D  34  ? 0.5354 0.4684 0.5884 0.0281  -0.1849 -0.0009 34  GLN L OE1 
2736 N  NE2 . GLN D  34  ? 0.4354 0.3890 0.5069 0.0324  -0.1893 0.0020  34  GLN L NE2 
2737 N  N   . GLY D  35  ? 0.2871 0.2569 0.2708 0.0639  -0.1048 -0.0159 35  GLY L N   
2738 C  CA  . GLY D  35  ? 0.2762 0.2694 0.2748 0.0674  -0.0943 -0.0129 35  GLY L CA  
2739 C  C   . GLY D  35  ? 0.2603 0.2586 0.2474 0.0689  -0.0756 -0.0140 35  GLY L C   
2740 O  O   . GLY D  35  ? 0.2612 0.2836 0.2645 0.0693  -0.0657 -0.0102 35  GLY L O   
2741 N  N   . GLU D  36  ? 0.2688 0.2451 0.2278 0.0706  -0.0717 -0.0186 36  GLU L N   
2742 C  CA  . GLU D  36  ? 0.2568 0.2342 0.2057 0.0708  -0.0575 -0.0191 36  GLU L CA  
2743 C  C   . GLU D  36  ? 0.2450 0.2364 0.2064 0.0642  -0.0507 -0.0151 36  GLU L C   
2744 O  O   . GLU D  36  ? 0.2450 0.2495 0.2108 0.0647  -0.0410 -0.0138 36  GLU L O   
2745 C  CB  . GLU D  36  ? 0.2739 0.2289 0.1952 0.0727  -0.0550 -0.0215 36  GLU L CB  
2746 C  CG  . GLU D  36  ? 0.2858 0.2260 0.1911 0.0785  -0.0603 -0.0224 36  GLU L CG  
2747 C  CD  . GLU D  36  ? 0.3116 0.2339 0.1897 0.0803  -0.0579 -0.0210 36  GLU L CD  
2748 O  OE1 . GLU D  36  ? 0.3089 0.2276 0.1787 0.0801  -0.0567 -0.0224 36  GLU L OE1 
2749 O  OE2 . GLU D  36  ? 0.3195 0.2321 0.1848 0.0828  -0.0575 -0.0177 36  GLU L OE2 
2750 N  N   . PHE D  37  ? 0.2479 0.2337 0.2131 0.0588  -0.0581 -0.0135 37  PHE L N   
2751 C  CA  . PHE D  37  ? 0.2357 0.2317 0.2129 0.0517  -0.0544 -0.0083 37  PHE L CA  
2752 C  C   . PHE D  37  ? 0.2274 0.2534 0.2320 0.0481  -0.0512 0.0008  37  PHE L C   
2753 O  O   . PHE D  37  ? 0.2198 0.2611 0.2288 0.0463  -0.0409 0.0054  37  PHE L O   
2754 C  CB  . PHE D  37  ? 0.2476 0.2278 0.2246 0.0476  -0.0677 -0.0089 37  PHE L CB  
2755 C  CG  . PHE D  37  ? 0.2406 0.2277 0.2318 0.0393  -0.0677 -0.0022 37  PHE L CG  
2756 C  CD1 . PHE D  37  ? 0.2430 0.2279 0.2239 0.0394  -0.0576 -0.0033 37  PHE L CD1 
2757 C  CD2 . PHE D  37  ? 0.2450 0.2412 0.2627 0.0304  -0.0798 0.0072  37  PHE L CD2 
2758 C  CE1 . PHE D  37  ? 0.2437 0.2329 0.2366 0.0320  -0.0595 0.0034  37  PHE L CE1 
2759 C  CE2 . PHE D  37  ? 0.2422 0.2434 0.2733 0.0216  -0.0815 0.0159  37  PHE L CE2 
2760 C  CZ  . PHE D  37  ? 0.2391 0.2359 0.2564 0.0229  -0.0713 0.0135  37  PHE L CZ  
2761 N  N   . LYS D  38  ? 0.2458 0.2394 0.2039 0.0772  -0.0717 -0.0206 38  LYS L N   
2762 C  CA  . LYS D  38  ? 0.2460 0.2537 0.2230 0.0757  -0.0701 -0.0225 38  LYS L CA  
2763 C  C   . LYS D  38  ? 0.2513 0.2571 0.2273 0.0764  -0.0610 -0.0224 38  LYS L C   
2764 O  O   . LYS D  38  ? 0.2376 0.2528 0.2230 0.0714  -0.0550 -0.0234 38  LYS L O   
2765 C  CB  . LYS D  38  ? 0.2542 0.2700 0.2430 0.0822  -0.0792 -0.0249 38  LYS L CB  
2766 C  CG  . LYS D  38  ? 0.2491 0.2727 0.2476 0.0786  -0.0871 -0.0273 38  LYS L CG  
2767 C  CD  . LYS D  38  ? 0.2534 0.2857 0.2632 0.0856  -0.0977 -0.0306 38  LYS L CD  
2768 C  CE  . LYS D  38  ? 0.2587 0.2996 0.2811 0.0808  -0.1058 -0.0346 38  LYS L CE  
2769 N  NZ  . LYS D  38  ? 0.2721 0.3225 0.3050 0.0877  -0.1186 -0.0391 38  LYS L NZ  
2770 N  N   . GLU D  39  ? 0.2679 0.2610 0.2322 0.0825  -0.0597 -0.0213 39  GLU L N   
2771 C  CA  . GLU D  39  ? 0.2706 0.2594 0.2337 0.0829  -0.0510 -0.0224 39  GLU L CA  
2772 C  C   . GLU D  39  ? 0.2540 0.2413 0.2108 0.0741  -0.0436 -0.0229 39  GLU L C   
2773 O  O   . GLU D  39  ? 0.2470 0.2407 0.2090 0.0707  -0.0372 -0.0255 39  GLU L O   
2774 C  CB  . GLU D  39  ? 0.2914 0.2642 0.2434 0.0909  -0.0506 -0.0205 39  GLU L CB  
2775 C  CG  . GLU D  39  ? 0.3096 0.2779 0.2644 0.0928  -0.0424 -0.0229 39  GLU L CG  
2776 C  CD  . GLU D  39  ? 0.3454 0.2939 0.2885 0.0992  -0.0396 -0.0204 39  GLU L CD  
2777 O  OE1 . GLU D  39  ? 0.3623 0.3000 0.2931 0.1029  -0.0438 -0.0156 39  GLU L OE1 
2778 O  OE2 . GLU D  39  ? 0.3676 0.3104 0.3134 0.1005  -0.0326 -0.0231 39  GLU L OE2 
2779 N  N   . LEU D  40  ? 0.2504 0.2301 0.1957 0.0709  -0.0445 -0.0206 40  LEU L N   
2780 C  CA  . LEU D  40  ? 0.2465 0.2268 0.1873 0.0628  -0.0391 -0.0210 40  LEU L CA  
2781 C  C   . LEU D  40  ? 0.2308 0.2258 0.1812 0.0571  -0.0383 -0.0215 40  LEU L C   
2782 O  O   . LEU D  40  ? 0.2268 0.2262 0.1766 0.0527  -0.0326 -0.0232 40  LEU L O   
2783 C  CB  . LEU D  40  ? 0.2520 0.2246 0.1826 0.0609  -0.0410 -0.0184 40  LEU L CB  
2784 C  CG  . LEU D  40  ? 0.2467 0.2197 0.1732 0.0538  -0.0369 -0.0184 40  LEU L CG  
2785 C  CD1 . LEU D  40  ? 0.2592 0.2220 0.1761 0.0547  -0.0375 -0.0161 40  LEU L CD1 
2786 C  CD2 . LEU D  40  ? 0.2456 0.2311 0.1787 0.0484  -0.0382 -0.0176 40  LEU L CD2 
2787 N  N   . VAL D  41  ? 0.2235 0.2257 0.1821 0.0570  -0.0438 -0.0199 41  VAL L N   
2788 C  CA  . VAL D  41  ? 0.2270 0.2414 0.1950 0.0514  -0.0423 -0.0189 41  VAL L CA  
2789 C  C   . VAL D  41  ? 0.2175 0.2417 0.1948 0.0517  -0.0367 -0.0212 41  VAL L C   
2790 O  O   . VAL D  41  ? 0.2238 0.2549 0.2011 0.0468  -0.0311 -0.0207 41  VAL L O   
2791 C  CB  . VAL D  41  ? 0.2273 0.2457 0.2041 0.0508  -0.0490 -0.0175 41  VAL L CB  
2792 C  CG1 . VAL D  41  ? 0.2365 0.2668 0.2254 0.0453  -0.0461 -0.0157 41  VAL L CG1 
2793 C  CG2 . VAL D  41  ? 0.2198 0.2290 0.1866 0.0498  -0.0528 -0.0157 41  VAL L CG2 
2794 N  N   . ARG D  42  ? 0.2344 0.2594 0.2190 0.0581  -0.0380 -0.0236 42  ARG L N   
2795 C  CA  . ARG D  42  ? 0.2444 0.2790 0.2403 0.0600  -0.0325 -0.0265 42  ARG L CA  
2796 C  C   . ARG D  42  ? 0.2516 0.2819 0.2376 0.0588  -0.0241 -0.0296 42  ARG L C   
2797 O  O   . ARG D  42  ? 0.2479 0.2872 0.2382 0.0566  -0.0173 -0.0316 42  ARG L O   
2798 C  CB  . ARG D  42  ? 0.2734 0.3083 0.2789 0.0688  -0.0374 -0.0284 42  ARG L CB  
2799 C  CG  . ARG D  42  ? 0.2965 0.3397 0.3142 0.0729  -0.0317 -0.0320 42  ARG L CG  
2800 C  CD  . ARG D  42  ? 0.3109 0.3574 0.3415 0.0821  -0.0389 -0.0329 42  ARG L CD  
2801 N  NE  . ARG D  42  ? 0.3281 0.3588 0.3469 0.0901  -0.0428 -0.0320 42  ARG L NE  
2802 C  CZ  . ARG D  42  ? 0.3612 0.3820 0.3748 0.0951  -0.0368 -0.0339 42  ARG L CZ  
2803 N  NH1 . ARG D  42  ? 0.3857 0.3908 0.3888 0.1024  -0.0401 -0.0317 42  ARG L NH1 
2804 N  NH2 . ARG D  42  ? 0.3607 0.3864 0.3790 0.0931  -0.0269 -0.0380 42  ARG L NH2 
2805 N  N   . LYS D  43  ? 0.2503 0.2667 0.2234 0.0601  -0.0243 -0.0304 43  LYS L N   
2806 C  CA  . LYS D  43  ? 0.2608 0.2715 0.2254 0.0587  -0.0172 -0.0348 43  LYS L CA  
2807 C  C   . LYS D  43  ? 0.2642 0.2760 0.2184 0.0508  -0.0154 -0.0345 43  LYS L C   
2808 O  O   . LYS D  43  ? 0.2619 0.2810 0.2139 0.0471  -0.0100 -0.0373 43  LYS L O   
2809 C  CB  . LYS D  43  ? 0.2805 0.2752 0.2395 0.0643  -0.0175 -0.0360 43  LYS L CB  
2810 C  CG  . LYS D  43  ? 0.2956 0.2896 0.2647 0.0737  -0.0183 -0.0370 43  LYS L CG  
2811 C  CD  . LYS D  43  ? 0.3306 0.3060 0.2922 0.0794  -0.0172 -0.0372 43  LYS L CD  
2812 C  CE  . LYS D  43  ? 0.3610 0.3350 0.3325 0.0901  -0.0182 -0.0376 43  LYS L CE  
2813 N  NZ  . LYS D  43  ? 0.3922 0.3460 0.3552 0.0970  -0.0187 -0.0349 43  LYS L NZ  
2814 N  N   . ASP D  44  ? 0.2543 0.2592 0.2018 0.0488  -0.0198 -0.0312 44  ASP L N   
2815 C  CA  . ASP D  44  ? 0.2587 0.2644 0.1974 0.0422  -0.0189 -0.0313 44  ASP L CA  
2816 C  C   . ASP D  44  ? 0.2436 0.2603 0.1836 0.0377  -0.0211 -0.0266 44  ASP L C   
2817 O  O   . ASP D  44  ? 0.2490 0.2691 0.1823 0.0331  -0.0204 -0.0267 44  ASP L O   
2818 C  CB  . ASP D  44  ? 0.2776 0.2714 0.2099 0.0420  -0.0209 -0.0306 44  ASP L CB  
2819 C  CG  . ASP D  44  ? 0.3052 0.2871 0.2348 0.0448  -0.0168 -0.0350 44  ASP L CG  
2820 O  OD1 . ASP D  44  ? 0.3216 0.3039 0.2495 0.0426  -0.0118 -0.0408 44  ASP L OD1 
2821 O  OD2 . ASP D  44  ? 0.3420 0.3137 0.2709 0.0498  -0.0183 -0.0326 44  ASP L OD2 
2822 N  N   . LEU D  45  ? 0.2310 0.2537 0.1803 0.0390  -0.0234 -0.0230 45  LEU L N   
2823 C  CA  . LEU D  45  ? 0.2271 0.2587 0.1790 0.0347  -0.0242 -0.0179 45  LEU L CA  
2824 C  C   . LEU D  45  ? 0.2240 0.2660 0.1855 0.0347  -0.0196 -0.0177 45  LEU L C   
2825 O  O   . LEU D  45  ? 0.2247 0.2728 0.1945 0.0324  -0.0204 -0.0131 45  LEU L O   
2826 C  CB  . LEU D  45  ? 0.2261 0.2540 0.1814 0.0347  -0.0307 -0.0135 45  LEU L CB  
2827 C  CG  . LEU D  45  ? 0.2276 0.2468 0.1743 0.0346  -0.0338 -0.0132 45  LEU L CG  
2828 C  CD1 . LEU D  45  ? 0.2406 0.2548 0.1906 0.0362  -0.0396 -0.0106 45  LEU L CD1 
2829 C  CD2 . LEU D  45  ? 0.2322 0.2561 0.1723 0.0301  -0.0323 -0.0114 45  LEU L CD2 
2830 N  N   . GLN D  46  ? 0.2375 0.2812 0.1997 0.0372  -0.0142 -0.0231 46  GLN L N   
2831 C  CA  . GLN D  46  ? 0.2338 0.2885 0.2069 0.0378  -0.0086 -0.0237 46  GLN L CA  
2832 C  C   . GLN D  46  ? 0.2377 0.3022 0.2082 0.0322  -0.0034 -0.0191 46  GLN L C   
2833 O  O   . GLN D  46  ? 0.2443 0.3184 0.2271 0.0312  0.0007  -0.0167 46  GLN L O   
2834 C  CB  . GLN D  46  ? 0.2438 0.2978 0.2167 0.0422  -0.0025 -0.0311 46  GLN L CB  
2835 C  CG  . GLN D  46  ? 0.2609 0.3121 0.2185 0.0399  0.0025  -0.0358 46  GLN L CG  
2836 C  CD  . GLN D  46  ? 0.2877 0.3356 0.2474 0.0450  0.0082  -0.0440 46  GLN L CD  
2837 O  OE1 . GLN D  46  ? 0.3268 0.3626 0.2856 0.0489  0.0059  -0.0472 46  GLN L OE1 
2838 N  NE2 . GLN D  46  ? 0.2900 0.3478 0.2527 0.0453  0.0165  -0.0471 46  GLN L NE2 
2839 N  N   . ASN D  47  ? 0.2410 0.3038 0.1960 0.0287  -0.0033 -0.0176 47  ASN L N   
2840 C  CA  . ASN D  47  ? 0.2471 0.3176 0.1963 0.0241  0.0006  -0.0115 47  ASN L CA  
2841 C  C   . ASN D  47  ? 0.2393 0.3080 0.1907 0.0213  -0.0047 -0.0028 47  ASN L C   
2842 O  O   . ASN D  47  ? 0.2477 0.3218 0.2055 0.0185  -0.0015 0.0039  47  ASN L O   
2843 C  CB  . ASN D  47  ? 0.2579 0.3295 0.1880 0.0225  0.0034  -0.0149 47  ASN L CB  
2844 C  CG  . ASN D  47  ? 0.2692 0.3407 0.1972 0.0253  0.0092  -0.0249 47  ASN L CG  
2845 O  OD1 . ASN D  47  ? 0.2911 0.3698 0.2252 0.0266  0.0171  -0.0264 47  ASN L OD1 
2846 N  ND2 . ASN D  47  ? 0.2664 0.3295 0.1873 0.0264  0.0063  -0.0320 47  ASN L ND2 
2847 N  N   . PHE D  48  ? 0.2305 0.2911 0.1775 0.0219  -0.0121 -0.0028 48  PHE L N   
2848 C  CA  . PHE D  48  ? 0.2311 0.2885 0.1799 0.0201  -0.0174 0.0046  48  PHE L CA  
2849 C  C   . PHE D  48  ? 0.2350 0.2914 0.2008 0.0201  -0.0193 0.0070  48  PHE L C   
2850 O  O   . PHE D  48  ? 0.2522 0.3084 0.2229 0.0173  -0.0200 0.0140  48  PHE L O   
2851 C  CB  . PHE D  48  ? 0.2238 0.2732 0.1666 0.0216  -0.0239 0.0024  48  PHE L CB  
2852 C  CG  . PHE D  48  ? 0.2256 0.2772 0.1548 0.0200  -0.0249 0.0031  48  PHE L CG  
2853 C  CD1 . PHE D  48  ? 0.2415 0.3001 0.1603 0.0184  -0.0205 0.0014  48  PHE L CD1 
2854 C  CD2 . PHE D  48  ? 0.2247 0.2721 0.1522 0.0203  -0.0306 0.0045  48  PHE L CD2 
2855 C  CE1 . PHE D  48  ? 0.2458 0.3079 0.1521 0.0170  -0.0231 0.0012  48  PHE L CE1 
2856 C  CE2 . PHE D  48  ? 0.2266 0.2781 0.1442 0.0191  -0.0328 0.0043  48  PHE L CE2 
2857 C  CZ  . PHE D  48  ? 0.2410 0.2999 0.1481 0.0174  -0.0298 0.0027  48  PHE L CZ  
2858 N  N   . LEU D  49  ? 0.2225 0.2779 0.1973 0.0233  -0.0207 0.0012  49  LEU L N   
2859 C  CA  . LEU D  49  ? 0.2257 0.2823 0.2175 0.0235  -0.0236 0.0015  49  LEU L CA  
2860 C  C   . LEU D  49  ? 0.2326 0.2995 0.2379 0.0242  -0.0181 -0.0013 49  LEU L C   
2861 O  O   . LEU D  49  ? 0.2173 0.2861 0.2361 0.0272  -0.0220 -0.0053 49  LEU L O   
2862 C  CB  . LEU D  49  ? 0.2219 0.2696 0.2137 0.0278  -0.0317 -0.0027 49  LEU L CB  
2863 C  CG  . LEU D  49  ? 0.2259 0.2645 0.2098 0.0271  -0.0369 0.0002  49  LEU L CG  
2864 C  CD1 . LEU D  49  ? 0.2169 0.2466 0.1975 0.0316  -0.0431 -0.0040 49  LEU L CD1 
2865 C  CD2 . LEU D  49  ? 0.2371 0.2758 0.2298 0.0232  -0.0382 0.0056  49  LEU L CD2 
2866 N  N   . LYS D  50  ? 0.2426 0.3173 0.2445 0.0218  -0.0092 0.0005  50  LYS L N   
2867 C  CA  . LYS D  50  ? 0.2764 0.3618 0.2905 0.0228  -0.0021 -0.0027 50  LYS L CA  
2868 C  C   . LYS D  50  ? 0.2755 0.3681 0.3129 0.0201  -0.0026 -0.0005 50  LYS L C   
2869 O  O   . LYS D  50  ? 0.2789 0.3780 0.3327 0.0234  -0.0039 -0.0056 50  LYS L O   
2870 C  CB  . LYS D  50  ? 0.3144 0.4064 0.3181 0.0203  0.0086  -0.0006 50  LYS L CB  
2871 C  CG  . LYS D  50  ? 0.3437 0.4479 0.3612 0.0214  0.0179  -0.0041 50  LYS L CG  
2872 C  CD  . LYS D  50  ? 0.3966 0.5049 0.3992 0.0223  0.0278  -0.0073 50  LYS L CD  
2873 C  CE  . LYS D  50  ? 0.4423 0.5519 0.4283 0.0171  0.0331  0.0005  50  LYS L CE  
2874 N  NZ  . LYS D  50  ? 0.5024 0.6183 0.4744 0.0178  0.0441  -0.0033 50  LYS L NZ  
2875 N  N   . LYS D  51  ? 0.2774 0.3687 0.3173 0.0144  -0.0021 0.0069  51  LYS L N   
2876 C  CA  . LYS D  51  ? 0.2984 0.3958 0.3623 0.0104  -0.0024 0.0085  51  LYS L CA  
2877 C  C   . LYS D  51  ? 0.2790 0.3724 0.3538 0.0136  -0.0146 0.0025  51  LYS L C   
2878 O  O   . LYS D  51  ? 0.2673 0.3698 0.3628 0.0146  -0.0168 -0.0022 51  LYS L O   
2879 C  CB  . LYS D  51  ? 0.3312 0.4247 0.3950 0.0036  0.0006  0.0180  51  LYS L CB  
2880 C  CG  . LYS D  51  ? 0.3624 0.4613 0.4532 -0.0018 0.0010  0.0190  51  LYS L CG  
2881 C  CD  . LYS D  51  ? 0.4034 0.4978 0.4972 -0.0093 0.0065  0.0295  51  LYS L CD  
2882 C  CE  . LYS D  51  ? 0.4201 0.5220 0.5452 -0.0153 0.0079  0.0282  51  LYS L CE  
2883 N  NZ  . LYS D  51  ? 0.4651 0.5643 0.5983 -0.0237 0.0168  0.0389  51  LYS L NZ  
2884 N  N   . GLU D  52  ? 0.2651 0.3457 0.3260 0.0155  -0.0226 0.0025  52  GLU L N   
2885 C  CA  . GLU D  52  ? 0.2609 0.3360 0.3266 0.0188  -0.0338 -0.0027 52  GLU L CA  
2886 C  C   . GLU D  52  ? 0.2454 0.3247 0.3144 0.0260  -0.0375 -0.0098 52  GLU L C   
2887 O  O   . GLU D  52  ? 0.2345 0.3167 0.3165 0.0282  -0.0453 -0.0143 52  GLU L O   
2888 C  CB  . GLU D  52  ? 0.2727 0.3335 0.3195 0.0204  -0.0392 -0.0013 52  GLU L CB  
2889 C  CG  . GLU D  52  ? 0.2808 0.3356 0.3254 0.0150  -0.0376 0.0058  52  GLU L CG  
2890 C  CD  . GLU D  52  ? 0.2939 0.3498 0.3253 0.0128  -0.0294 0.0127  52  GLU L CD  
2891 O  OE1 . GLU D  52  ? 0.3022 0.3651 0.3277 0.0140  -0.0232 0.0118  52  GLU L OE1 
2892 O  OE2 . GLU D  52  ? 0.3383 0.3876 0.3642 0.0104  -0.0295 0.0191  52  GLU L OE2 
2893 N  N   . ASN D  53  ? 0.2389 0.3179 0.2957 0.0299  -0.0324 -0.0109 53  ASN L N   
2894 C  CA  . ASN D  53  ? 0.2462 0.3277 0.3061 0.0375  -0.0344 -0.0168 53  ASN L CA  
2895 C  C   . ASN D  53  ? 0.2412 0.3384 0.3264 0.0386  -0.0333 -0.0198 53  ASN L C   
2896 O  O   . ASN D  53  ? 0.2507 0.3503 0.3424 0.0457  -0.0386 -0.0243 53  ASN L O   
2897 C  CB  . ASN D  53  ? 0.2461 0.3240 0.2903 0.0405  -0.0271 -0.0180 53  ASN L CB  
2898 C  CG  . ASN D  53  ? 0.2533 0.3162 0.2779 0.0438  -0.0317 -0.0187 53  ASN L CG  
2899 O  OD1 . ASN D  53  ? 0.2834 0.3403 0.3075 0.0491  -0.0393 -0.0208 53  ASN L OD1 
2900 N  ND2 . ASN D  53  ? 0.2436 0.3013 0.2522 0.0407  -0.0272 -0.0169 53  ASN L ND2 
2901 N  N   . LYS D  54  ? 0.2515 0.3593 0.3515 0.0317  -0.0266 -0.0169 54  LYS L N   
2902 C  CA  . LYS D  54  ? 0.2590 0.3837 0.3872 0.0316  -0.0253 -0.0200 54  LYS L CA  
2903 C  C   . LYS D  54  ? 0.2473 0.3749 0.3929 0.0312  -0.0376 -0.0233 54  LYS L C   
2904 O  O   . LYS D  54  ? 0.2376 0.3798 0.4077 0.0326  -0.0398 -0.0275 54  LYS L O   
2905 C  CB  . LYS D  54  ? 0.2877 0.4225 0.4265 0.0237  -0.0126 -0.0153 54  LYS L CB  
2906 C  CG  . LYS D  54  ? 0.3237 0.4570 0.4439 0.0245  -0.0009 -0.0132 54  LYS L CG  
2907 C  CD  . LYS D  54  ? 0.3536 0.4985 0.4835 0.0181  0.0129  -0.0086 54  LYS L CD  
2908 C  CE  . LYS D  54  ? 0.3957 0.5377 0.5020 0.0188  0.0234  -0.0068 54  LYS L CE  
2909 N  NZ  . LYS D  54  ? 0.4379 0.5913 0.5523 0.0126  0.0378  -0.0016 54  LYS L NZ  
2910 N  N   . ASN D  55  ? 0.2437 0.3582 0.3771 0.0297  -0.0459 -0.0224 55  ASN L N   
2911 C  CA  . ASN D  55  ? 0.2527 0.3687 0.4003 0.0283  -0.0573 -0.0264 55  ASN L CA  
2912 C  C   . ASN D  55  ? 0.2447 0.3470 0.3722 0.0354  -0.0685 -0.0293 55  ASN L C   
2913 O  O   . ASN D  55  ? 0.2358 0.3236 0.3440 0.0339  -0.0694 -0.0266 55  ASN L O   
2914 C  CB  . ASN D  55  ? 0.2619 0.3749 0.4168 0.0179  -0.0543 -0.0224 55  ASN L CB  
2915 C  CG  . ASN D  55  ? 0.2736 0.3892 0.4472 0.0148  -0.0654 -0.0281 55  ASN L CG  
2916 O  OD1 . ASN D  55  ? 0.2953 0.4106 0.4676 0.0210  -0.0775 -0.0347 55  ASN L OD1 
2917 N  ND2 . ASN D  55  ? 0.2868 0.4042 0.4769 0.0051  -0.0613 -0.0256 55  ASN L ND2 
2918 N  N   . GLU D  56  ? 0.2513 0.3585 0.3831 0.0437  -0.0768 -0.0344 56  GLU L N   
2919 C  CA  . GLU D  56  ? 0.2625 0.3564 0.3726 0.0516  -0.0859 -0.0361 56  GLU L CA  
2920 C  C   . GLU D  56  ? 0.2612 0.3458 0.3649 0.0484  -0.0948 -0.0381 56  GLU L C   
2921 O  O   . GLU D  56  ? 0.2717 0.3414 0.3521 0.0518  -0.0976 -0.0372 56  GLU L O   
2922 C  CB  . GLU D  56  ? 0.2918 0.3934 0.4093 0.0615  -0.0940 -0.0403 56  GLU L CB  
2923 C  CG  . GLU D  56  ? 0.3215 0.4085 0.4144 0.0708  -0.1018 -0.0403 56  GLU L CG  
2924 C  CD  . GLU D  56  ? 0.3585 0.4512 0.4561 0.0823  -0.1077 -0.0422 56  GLU L CD  
2925 O  OE1 . GLU D  56  ? 0.3788 0.4889 0.5015 0.0834  -0.1075 -0.0447 56  GLU L OE1 
2926 O  OE2 . GLU D  56  ? 0.3997 0.4797 0.4766 0.0906  -0.1126 -0.0408 56  GLU L OE2 
2927 N  N   . LYS D  57  ? 0.2494 0.3425 0.3745 0.0416  -0.0983 -0.0413 57  LYS L N   
2928 C  CA  . LYS D  57  ? 0.2543 0.3387 0.3760 0.0382  -0.1066 -0.0448 57  LYS L CA  
2929 C  C   . LYS D  57  ? 0.2344 0.3048 0.3419 0.0326  -0.0990 -0.0392 57  LYS L C   
2930 O  O   . LYS D  57  ? 0.2301 0.2879 0.3233 0.0335  -0.1039 -0.0410 57  LYS L O   
2931 C  CB  . LYS D  57  ? 0.2750 0.3724 0.4265 0.0319  -0.1128 -0.0509 57  LYS L CB  
2932 C  CG  . LYS D  57  ? 0.3119 0.4219 0.4761 0.0383  -0.1270 -0.0595 57  LYS L CG  
2933 C  CD  . LYS D  57  ? 0.3442 0.4550 0.4940 0.0507  -0.1304 -0.0587 57  LYS L CD  
2934 C  CE  . LYS D  57  ? 0.3675 0.4843 0.5185 0.0592  -0.1474 -0.0662 57  LYS L CE  
2935 N  NZ  . LYS D  57  ? 0.3984 0.4985 0.5190 0.0654  -0.1565 -0.0681 57  LYS L NZ  
2936 N  N   . VAL D  58  ? 0.2178 0.2907 0.3283 0.0277  -0.0867 -0.0323 58  VAL L N   
2937 C  CA  . VAL D  58  ? 0.2220 0.2820 0.3164 0.0242  -0.0800 -0.0258 58  VAL L CA  
2938 C  C   . VAL D  58  ? 0.2259 0.2743 0.2933 0.0313  -0.0809 -0.0250 58  VAL L C   
2939 O  O   . VAL D  58  ? 0.2242 0.2602 0.2776 0.0312  -0.0821 -0.0239 58  VAL L O   
2940 C  CB  . VAL D  58  ? 0.2227 0.2889 0.3228 0.0187  -0.0673 -0.0184 58  VAL L CB  
2941 C  CG1 . VAL D  58  ? 0.2280 0.2834 0.3078 0.0178  -0.0610 -0.0114 58  VAL L CG1 
2942 C  CG2 . VAL D  58  ? 0.2202 0.2932 0.3453 0.0098  -0.0650 -0.0174 58  VAL L CG2 
2943 N  N   . ILE D  59  ? 0.2271 0.2793 0.2886 0.0373  -0.0793 -0.0254 59  ILE L N   
2944 C  CA  . ILE D  59  ? 0.2261 0.2669 0.2637 0.0434  -0.0791 -0.0244 59  ILE L CA  
2945 C  C   . ILE D  59  ? 0.2397 0.2711 0.2666 0.0481  -0.0890 -0.0287 59  ILE L C   
2946 O  O   . ILE D  59  ? 0.2407 0.2602 0.2497 0.0495  -0.0880 -0.0272 59  ILE L O   
2947 C  CB  . ILE D  59  ? 0.2268 0.2716 0.2618 0.0491  -0.0755 -0.0245 59  ILE L CB  
2948 C  CG1 . ILE D  59  ? 0.2215 0.2753 0.2646 0.0445  -0.0649 -0.0213 59  ILE L CG1 
2949 C  CG2 . ILE D  59  ? 0.2432 0.2749 0.2555 0.0544  -0.0748 -0.0234 59  ILE L CG2 
2950 C  CD1 . ILE D  59  ? 0.2209 0.2697 0.2537 0.0387  -0.0577 -0.0161 59  ILE L CD1 
2951 N  N   . GLU D  60  ? 0.2526 0.2902 0.2908 0.0502  -0.0983 -0.0342 60  GLU L N   
2952 C  CA  . GLU D  60  ? 0.2719 0.3015 0.2989 0.0547  -0.1086 -0.0393 60  GLU L CA  
2953 C  C   . GLU D  60  ? 0.2803 0.3004 0.3030 0.0497  -0.1088 -0.0403 60  GLU L C   
2954 O  O   . GLU D  60  ? 0.2962 0.3043 0.2997 0.0534  -0.1112 -0.0417 60  GLU L O   
2955 C  CB  . GLU D  60  ? 0.2836 0.3245 0.3262 0.0574  -0.1200 -0.0461 60  GLU L CB  
2956 C  CG  . GLU D  60  ? 0.2900 0.3376 0.3328 0.0655  -0.1210 -0.0449 60  GLU L CG  
2957 C  CD  . GLU D  60  ? 0.3032 0.3662 0.3663 0.0685  -0.1318 -0.0510 60  GLU L CD  
2958 O  OE1 . GLU D  60  ? 0.3319 0.4009 0.4100 0.0630  -0.1385 -0.0567 60  GLU L OE1 
2959 O  OE2 . GLU D  60  ? 0.3094 0.3788 0.3752 0.0763  -0.1339 -0.0503 60  GLU L OE2 
2960 N  N   . HIS D  61  ? 0.2853 0.3099 0.3256 0.0415  -0.1054 -0.0391 61  HIS L N   
2961 C  CA  . HIS D  61  ? 0.2841 0.2986 0.3226 0.0370  -0.1051 -0.0396 61  HIS L CA  
2962 C  C   . HIS D  61  ? 0.2715 0.2760 0.2919 0.0382  -0.0972 -0.0334 61  HIS L C   
2963 O  O   . HIS D  61  ? 0.2762 0.2697 0.2855 0.0394  -0.0984 -0.0349 61  HIS L O   
2964 C  CB  . HIS D  61  ? 0.2812 0.3010 0.3430 0.0279  -0.1021 -0.0382 61  HIS L CB  
2965 C  CG  . HIS D  61  ? 0.3011 0.3087 0.3601 0.0237  -0.0985 -0.0353 61  HIS L CG  
2966 N  ND1 . HIS D  61  ? 0.3117 0.3098 0.3705 0.0233  -0.1048 -0.0420 61  HIS L ND1 
2967 C  CD2 . HIS D  61  ? 0.2987 0.3020 0.3542 0.0208  -0.0892 -0.0264 61  HIS L CD2 
2968 C  CE1 . HIS D  61  ? 0.3221 0.3097 0.3782 0.0208  -0.0993 -0.0372 61  HIS L CE1 
2969 N  NE2 . HIS D  61  ? 0.3237 0.3150 0.3779 0.0194  -0.0902 -0.0271 61  HIS L NE2 
2970 N  N   . ILE D  62  ? 0.2549 0.2637 0.2731 0.0376  -0.0892 -0.0270 62  ILE L N   
2971 C  CA  . ILE D  62  ? 0.2526 0.2543 0.2558 0.0383  -0.0826 -0.0218 62  ILE L CA  
2972 C  C   . ILE D  62  ? 0.2634 0.2563 0.2477 0.0449  -0.0852 -0.0245 62  ILE L C   
2973 O  O   . ILE D  62  ? 0.2675 0.2517 0.2417 0.0456  -0.0836 -0.0239 62  ILE L O   
2974 C  CB  . ILE D  62  ? 0.2461 0.2548 0.2492 0.0367  -0.0745 -0.0162 62  ILE L CB  
2975 C  CG1 . ILE D  62  ? 0.2398 0.2560 0.2585 0.0300  -0.0701 -0.0120 62  ILE L CG1 
2976 C  CG2 . ILE D  62  ? 0.2429 0.2451 0.2298 0.0381  -0.0698 -0.0127 62  ILE L CG2 
2977 C  CD1 . ILE D  62  ? 0.2500 0.2750 0.2692 0.0285  -0.0623 -0.0079 62  ILE L CD1 
2978 N  N   . MET D  63  ? 0.2656 0.2603 0.2455 0.0501  -0.0892 -0.0274 63  MET L N   
2979 C  CA  . MET D  63  ? 0.2757 0.2606 0.2360 0.0566  -0.0910 -0.0289 63  MET L CA  
2980 C  C   . MET D  63  ? 0.2771 0.2543 0.2309 0.0581  -0.0970 -0.0342 63  MET L C   
2981 O  O   . MET D  63  ? 0.2754 0.2431 0.2143 0.0604  -0.0941 -0.0338 63  MET L O   
2982 C  CB  . MET D  63  ? 0.2984 0.2854 0.2543 0.0630  -0.0947 -0.0300 63  MET L CB  
2983 C  CG  . MET D  63  ? 0.3185 0.2937 0.2525 0.0697  -0.0968 -0.0309 63  MET L CG  
2984 S  SD  . MET D  63  ? 0.4557 0.4279 0.3787 0.0774  -0.0960 -0.0279 63  MET L SD  
2985 C  CE  . MET D  63  ? 0.3542 0.3107 0.2493 0.0842  -0.0963 -0.0272 63  MET L CE  
2986 N  N   . GLU D  64  ? 0.2770 0.2585 0.2431 0.0565  -0.1049 -0.0397 64  GLU L N   
2987 C  CA  . GLU D  64  ? 0.2939 0.2680 0.2546 0.0575  -0.1112 -0.0466 64  GLU L CA  
2988 C  C   . GLU D  64  ? 0.2939 0.2597 0.2536 0.0540  -0.1053 -0.0451 64  GLU L C   
2989 O  O   . GLU D  64  ? 0.2898 0.2459 0.2358 0.0573  -0.1056 -0.0484 64  GLU L O   
2990 C  CB  . GLU D  64  ? 0.3124 0.2942 0.2920 0.0541  -0.1204 -0.0535 64  GLU L CB  
2991 C  CG  . GLU D  64  ? 0.3502 0.3248 0.3224 0.0561  -0.1292 -0.0631 64  GLU L CG  
2992 C  CD  . GLU D  64  ? 0.3872 0.3708 0.3808 0.0519  -0.1391 -0.0711 64  GLU L CD  
2993 O  OE1 . GLU D  64  ? 0.4281 0.4239 0.4436 0.0471  -0.1379 -0.0683 64  GLU L OE1 
2994 O  OE2 . GLU D  64  ? 0.3983 0.3771 0.3877 0.0529  -0.1473 -0.0805 64  GLU L OE2 
2995 N  N   . ASP D  65  ? 0.2667 0.2368 0.2410 0.0479  -0.0996 -0.0395 65  ASP L N   
2996 C  CA  . ASP D  65  ? 0.2766 0.2397 0.2520 0.0452  -0.0942 -0.0365 65  ASP L CA  
2997 C  C   . ASP D  65  ? 0.2657 0.2234 0.2239 0.0495  -0.0881 -0.0331 65  ASP L C   
2998 O  O   . ASP D  65  ? 0.2806 0.2303 0.2336 0.0511  -0.0864 -0.0346 65  ASP L O   
2999 C  CB  . ASP D  65  ? 0.2837 0.2537 0.2753 0.0388  -0.0892 -0.0292 65  ASP L CB  
3000 C  CG  . ASP D  65  ? 0.3104 0.2743 0.3046 0.0367  -0.0844 -0.0244 65  ASP L CG  
3001 O  OD1 . ASP D  65  ? 0.3345 0.2893 0.3299 0.0372  -0.0866 -0.0284 65  ASP L OD1 
3002 O  OD2 . ASP D  65  ? 0.3383 0.3065 0.3327 0.0351  -0.0786 -0.0167 65  ASP L OD2 
3003 N  N   . LEU D  66  ? 0.2641 0.2263 0.2154 0.0511  -0.0844 -0.0290 66  LEU L N   
3004 C  CA  . LEU D  66  ? 0.2625 0.2209 0.2007 0.0537  -0.0780 -0.0258 66  LEU L CA  
3005 C  C   . LEU D  66  ? 0.2722 0.2219 0.1929 0.0597  -0.0791 -0.0301 66  LEU L C   
3006 O  O   . LEU D  66  ? 0.2833 0.2283 0.1951 0.0615  -0.0733 -0.0286 66  LEU L O   
3007 C  CB  . LEU D  66  ? 0.2571 0.2219 0.1943 0.0530  -0.0738 -0.0212 66  LEU L CB  
3008 C  CG  . LEU D  66  ? 0.2525 0.2256 0.2017 0.0476  -0.0704 -0.0162 66  LEU L CG  
3009 C  CD1 . LEU D  66  ? 0.2566 0.2358 0.2049 0.0473  -0.0675 -0.0144 66  LEU L CD1 
3010 C  CD2 . LEU D  66  ? 0.2545 0.2269 0.2038 0.0458  -0.0658 -0.0123 66  LEU L CD2 
3011 N  N   . ASP D  67  ? 0.2818 0.2300 0.1976 0.0630  -0.0864 -0.0351 67  ASP L N   
3012 C  CA  . ASP D  67  ? 0.2900 0.2301 0.1857 0.0696  -0.0880 -0.0385 67  ASP L CA  
3013 C  C   . ASP D  67  ? 0.3127 0.2447 0.2019 0.0712  -0.0888 -0.0444 67  ASP L C   
3014 O  O   . ASP D  67  ? 0.3145 0.2443 0.2015 0.0729  -0.0968 -0.0517 67  ASP L O   
3015 C  CB  . ASP D  67  ? 0.2921 0.2352 0.1850 0.0732  -0.0969 -0.0415 67  ASP L CB  
3016 C  CG  . ASP D  67  ? 0.3161 0.2505 0.1853 0.0809  -0.0995 -0.0440 67  ASP L CG  
3017 O  OD1 . ASP D  67  ? 0.3224 0.2483 0.1759 0.0834  -0.0920 -0.0417 67  ASP L OD1 
3018 O  OD2 . ASP D  67  ? 0.3314 0.2683 0.1978 0.0847  -0.1094 -0.0481 67  ASP L OD2 
3019 N  N   A THR D  68  ? 0.3240 0.2522 0.2104 0.0709  -0.0805 -0.0419 68  THR L N   
3020 N  N   B THR D  68  ? 0.3139 0.2424 0.2018 0.0705  -0.0805 -0.0418 68  THR L N   
3021 C  CA  A THR D  68  ? 0.3318 0.2536 0.2182 0.0717  -0.0800 -0.0472 68  THR L CA  
3022 C  CA  B THR D  68  ? 0.3226 0.2443 0.2096 0.0716  -0.0799 -0.0473 68  THR L CA  
3023 C  C   A THR D  68  ? 0.3502 0.2633 0.2158 0.0780  -0.0823 -0.0542 68  THR L C   
3024 C  C   B THR D  68  ? 0.3439 0.2565 0.2091 0.0781  -0.0811 -0.0539 68  THR L C   
3025 O  O   A THR D  68  ? 0.3790 0.2870 0.2444 0.0788  -0.0865 -0.0621 68  THR L O   
3026 O  O   B THR D  68  ? 0.3621 0.2687 0.2261 0.0793  -0.0833 -0.0613 68  THR L O   
3027 C  CB  A THR D  68  ? 0.3359 0.2581 0.2277 0.0704  -0.0708 -0.0424 68  THR L CB  
3028 C  CB  B THR D  68  ? 0.3197 0.2423 0.2154 0.0696  -0.0714 -0.0426 68  THR L CB  
3029 O  OG1 A THR D  68  ? 0.3368 0.2580 0.2158 0.0730  -0.0634 -0.0388 68  THR L OG1 
3030 O  OG1 B THR D  68  ? 0.3299 0.2451 0.2145 0.0741  -0.0659 -0.0461 68  THR L OG1 
3031 C  CG2 A THR D  68  ? 0.3057 0.2368 0.2158 0.0647  -0.0700 -0.0359 68  THR L CG2 
3032 C  CG2 B THR D  68  ? 0.2902 0.2200 0.1886 0.0672  -0.0658 -0.0346 68  THR L CG2 
3033 N  N   . ASN D  69  ? 0.3505 0.2610 0.1976 0.0824  -0.0796 -0.0513 69  ASN L N   
3034 C  CA  . ASN D  69  ? 0.3698 0.2716 0.1931 0.0891  -0.0816 -0.0571 69  ASN L CA  
3035 C  C   . ASN D  69  ? 0.3835 0.2870 0.2004 0.0920  -0.0942 -0.0614 69  ASN L C   
3036 O  O   . ASN D  69  ? 0.3938 0.2907 0.1875 0.0985  -0.0979 -0.0659 69  ASN L O   
3037 C  CB  . ASN D  69  ? 0.3891 0.2852 0.1937 0.0930  -0.0708 -0.0515 69  ASN L CB  
3038 C  CG  . ASN D  69  ? 0.4018 0.2986 0.1984 0.0948  -0.0710 -0.0444 69  ASN L CG  
3039 O  OD1 . ASN D  69  ? 0.3787 0.2827 0.1888 0.0921  -0.0766 -0.0422 69  ASN L OD1 
3040 N  ND2 . ASN D  69  ? 0.4482 0.3367 0.2223 0.1000  -0.0647 -0.0410 69  ASN L ND2 
3041 N  N   . ALA D  70  ? 0.3705 0.2834 0.2071 0.0876  -0.1010 -0.0606 70  ALA L N   
3042 C  CA  . ALA D  70  ? 0.3839 0.3019 0.2222 0.0893  -0.1141 -0.0658 70  ALA L CA  
3043 C  C   . ALA D  70  ? 0.3963 0.3113 0.2110 0.0976  -0.1179 -0.0637 70  ALA L C   
3044 O  O   . ALA D  70  ? 0.4185 0.3332 0.2220 0.1025  -0.1291 -0.0706 70  ALA L O   
3045 C  CB  . ALA D  70  ? 0.4114 0.3278 0.2551 0.0876  -0.1228 -0.0776 70  ALA L CB  
3046 N  N   . ASP D  71  ? 0.3969 0.3095 0.2042 0.0995  -0.1092 -0.0540 71  ASP L N   
3047 C  CA  . ASP D  71  ? 0.4232 0.3313 0.2095 0.1076  -0.1116 -0.0497 71  ASP L CA  
3048 C  C   . ASP D  71  ? 0.4039 0.3202 0.2030 0.1081  -0.1154 -0.0443 71  ASP L C   
3049 O  O   . ASP D  71  ? 0.4099 0.3212 0.1937 0.1149  -0.1156 -0.0387 71  ASP L O   
3050 C  CB  . ASP D  71  ? 0.4384 0.3348 0.2036 0.1106  -0.0982 -0.0428 71  ASP L CB  
3051 C  CG  . ASP D  71  ? 0.4067 0.3047 0.1861 0.1047  -0.0862 -0.0350 71  ASP L CG  
3052 O  OD1 . ASP D  71  ? 0.3889 0.2967 0.1926 0.0984  -0.0872 -0.0345 71  ASP L OD1 
3053 O  OD2 . ASP D  71  ? 0.4167 0.3062 0.1823 0.1061  -0.0751 -0.0296 71  ASP L OD2 
3054 N  N   . LYS D  72  ? 0.3866 0.3142 0.2134 0.1011  -0.1170 -0.0452 72  LYS L N   
3055 C  CA  . LYS D  72  ? 0.3857 0.3227 0.2281 0.1011  -0.1198 -0.0415 72  LYS L CA  
3056 C  C   . LYS D  72  ? 0.3736 0.3060 0.2129 0.1014  -0.1085 -0.0323 72  LYS L C   
3057 O  O   . LYS D  72  ? 0.3959 0.3320 0.2409 0.1043  -0.1100 -0.0288 72  LYS L O   
3058 C  CB  . LYS D  72  ? 0.4083 0.3501 0.2467 0.1086  -0.1335 -0.0448 72  LYS L CB  
3059 C  CG  . LYS D  72  ? 0.4332 0.3823 0.2805 0.1066  -0.1459 -0.0557 72  LYS L CG  
3060 C  CD  . LYS D  72  ? 0.4807 0.4369 0.3248 0.1146  -0.1612 -0.0594 72  LYS L CD  
3061 C  CE  . LYS D  72  ? 0.4944 0.4594 0.3514 0.1111  -0.1740 -0.0717 72  LYS L CE  
3062 N  NZ  . LYS D  72  ? 0.5400 0.5160 0.3996 0.1179  -0.1903 -0.0763 72  LYS L NZ  
3063 N  N   . GLN D  73  ? 0.3659 0.2913 0.1996 0.0977  -0.0972 -0.0293 73  GLN L N   
3064 C  CA  . GLN D  73  ? 0.3648 0.2853 0.1966 0.0963  -0.0859 -0.0220 73  GLN L CA  
3065 C  C   . GLN D  73  ? 0.3343 0.2587 0.1790 0.0880  -0.0786 -0.0224 73  GLN L C   
3066 O  O   . GLN D  73  ? 0.3149 0.2391 0.1601 0.0859  -0.0793 -0.0265 73  GLN L O   
3067 C  CB  . GLN D  73  ? 0.3973 0.3034 0.2039 0.1017  -0.0793 -0.0175 73  GLN L CB  
3068 C  CG  . GLN D  73  ? 0.4461 0.3459 0.2343 0.1115  -0.0863 -0.0156 73  GLN L CG  
3069 C  CD  . GLN D  73  ? 0.4558 0.3555 0.2489 0.1151  -0.0870 -0.0102 73  GLN L CD  
3070 O  OE1 . GLN D  73  ? 0.4632 0.3605 0.2637 0.1113  -0.0775 -0.0059 73  GLN L OE1 
3071 N  NE2 . GLN D  73  ? 0.4633 0.3650 0.2515 0.1232  -0.0983 -0.0107 73  GLN L NE2 
3072 N  N   . LEU D  74  ? 0.3072 0.2349 0.1622 0.0835  -0.0717 -0.0186 74  LEU L N   
3073 C  CA  . LEU D  74  ? 0.2942 0.2253 0.1587 0.0765  -0.0646 -0.0180 74  LEU L CA  
3074 C  C   . LEU D  74  ? 0.2906 0.2141 0.1457 0.0760  -0.0543 -0.0140 74  LEU L C   
3075 O  O   . LEU D  74  ? 0.2975 0.2174 0.1502 0.0767  -0.0502 -0.0107 74  LEU L O   
3076 C  CB  . LEU D  74  ? 0.2803 0.2225 0.1637 0.0707  -0.0644 -0.0173 74  LEU L CB  
3077 C  CG  . LEU D  74  ? 0.2674 0.2189 0.1652 0.0689  -0.0722 -0.0204 74  LEU L CG  
3078 C  CD1 . LEU D  74  ? 0.2593 0.2205 0.1724 0.0629  -0.0687 -0.0183 74  LEU L CD1 
3079 C  CD2 . LEU D  74  ? 0.2732 0.2234 0.1722 0.0680  -0.0763 -0.0243 74  LEU L CD2 
3080 N  N   . SER D  75  ? 0.2952 0.2162 0.1466 0.0748  -0.0495 -0.0147 75  SER L N   
3081 C  CA  . SER D  75  ? 0.2965 0.2127 0.1435 0.0729  -0.0390 -0.0117 75  SER L CA  
3082 C  C   . SER D  75  ? 0.2776 0.2038 0.1421 0.0658  -0.0362 -0.0112 75  SER L C   
3083 O  O   . SER D  75  ? 0.2694 0.2047 0.1464 0.0632  -0.0419 -0.0127 75  SER L O   
3084 C  CB  . SER D  75  ? 0.3057 0.2180 0.1451 0.0744  -0.0347 -0.0134 75  SER L CB  
3085 O  OG  . SER D  75  ? 0.3001 0.2202 0.1524 0.0719  -0.0385 -0.0170 75  SER L OG  
3086 N  N   . PHE D  76  ? 0.2794 0.2043 0.1452 0.0624  -0.0275 -0.0092 76  PHE L N   
3087 C  CA  . PHE D  76  ? 0.2499 0.1856 0.1314 0.0558  -0.0260 -0.0096 76  PHE L CA  
3088 C  C   . PHE D  76  ? 0.2478 0.1923 0.1392 0.0544  -0.0292 -0.0111 76  PHE L C   
3089 O  O   . PHE D  76  ? 0.2298 0.1839 0.1326 0.0509  -0.0329 -0.0111 76  PHE L O   
3090 C  CB  . PHE D  76  ? 0.2559 0.1900 0.1393 0.0517  -0.0168 -0.0086 76  PHE L CB  
3091 C  CG  . PHE D  76  ? 0.2456 0.1915 0.1436 0.0453  -0.0169 -0.0100 76  PHE L CG  
3092 C  CD1 . PHE D  76  ? 0.2489 0.1970 0.1496 0.0433  -0.0192 -0.0108 76  PHE L CD1 
3093 C  CD2 . PHE D  76  ? 0.2443 0.1993 0.1522 0.0424  -0.0156 -0.0108 76  PHE L CD2 
3094 C  CE1 . PHE D  76  ? 0.2375 0.1967 0.1489 0.0378  -0.0202 -0.0127 76  PHE L CE1 
3095 C  CE2 . PHE D  76  ? 0.2321 0.1993 0.1522 0.0372  -0.0175 -0.0121 76  PHE L CE2 
3096 C  CZ  . PHE D  76  ? 0.2457 0.2146 0.1661 0.0348  -0.0199 -0.0131 76  PHE L CZ  
3097 N  N   . GLU D  77  ? 0.2543 0.1946 0.1404 0.0575  -0.0270 -0.0122 77  GLU L N   
3098 C  CA  . GLU D  77  ? 0.2637 0.2098 0.1591 0.0574  -0.0290 -0.0136 77  GLU L CA  
3099 C  C   . GLU D  77  ? 0.2566 0.2052 0.1571 0.0576  -0.0379 -0.0146 77  GLU L C   
3100 O  O   . GLU D  77  ? 0.2569 0.2133 0.1700 0.0550  -0.0406 -0.0135 77  GLU L O   
3101 C  CB  . GLU D  77  ? 0.2914 0.2301 0.1774 0.0620  -0.0249 -0.0158 77  GLU L CB  
3102 C  CG  . GLU D  77  ? 0.3192 0.2587 0.2063 0.0606  -0.0145 -0.0146 77  GLU L CG  
3103 C  CD  . GLU D  77  ? 0.3487 0.2779 0.2204 0.0617  -0.0077 -0.0125 77  GLU L CD  
3104 O  OE1 . GLU D  77  ? 0.3425 0.2646 0.2030 0.0639  -0.0116 -0.0112 77  GLU L OE1 
3105 O  OE2 . GLU D  77  ? 0.4029 0.3313 0.2749 0.0606  0.0023  -0.0115 77  GLU L OE2 
3106 N  N   . GLU D  78  ? 0.2529 0.1956 0.1447 0.0608  -0.0426 -0.0163 78  GLU L N   
3107 C  CA  . GLU D  78  ? 0.2500 0.1961 0.1493 0.0601  -0.0506 -0.0177 78  GLU L CA  
3108 C  C   . GLU D  78  ? 0.2378 0.1926 0.1476 0.0556  -0.0519 -0.0148 78  GLU L C   
3109 O  O   . GLU D  78  ? 0.2390 0.1995 0.1598 0.0528  -0.0547 -0.0138 78  GLU L O   
3110 C  CB  . GLU D  78  ? 0.2647 0.2045 0.1538 0.0645  -0.0563 -0.0210 78  GLU L CB  
3111 C  CG  . GLU D  78  ? 0.2840 0.2150 0.1601 0.0694  -0.0564 -0.0251 78  GLU L CG  
3112 C  CD  . GLU D  78  ? 0.3124 0.2373 0.1740 0.0747  -0.0624 -0.0281 78  GLU L CD  
3113 O  OE1 . GLU D  78  ? 0.3319 0.2571 0.1895 0.0763  -0.0644 -0.0257 78  GLU L OE1 
3114 O  OE2 . GLU D  78  ? 0.3075 0.2263 0.1591 0.0784  -0.0650 -0.0332 78  GLU L OE2 
3115 N  N   . PHE D  79  ? 0.2394 0.1944 0.1452 0.0551  -0.0488 -0.0134 79  PHE L N   
3116 C  CA  . PHE D  79  ? 0.2318 0.1944 0.1454 0.0514  -0.0489 -0.0118 79  PHE L CA  
3117 C  C   . PHE D  79  ? 0.2275 0.1986 0.1497 0.0467  -0.0467 -0.0097 79  PHE L C   
3118 O  O   . PHE D  79  ? 0.2301 0.2085 0.1594 0.0438  -0.0486 -0.0082 79  PHE L O   
3119 C  CB  . PHE D  79  ? 0.2328 0.1912 0.1394 0.0525  -0.0452 -0.0116 79  PHE L CB  
3120 C  CG  . PHE D  79  ? 0.2373 0.2025 0.1503 0.0490  -0.0439 -0.0114 79  PHE L CG  
3121 C  CD1 . PHE D  79  ? 0.2429 0.2124 0.1610 0.0499  -0.0475 -0.0119 79  PHE L CD1 
3122 C  CD2 . PHE D  79  ? 0.2429 0.2108 0.1573 0.0450  -0.0388 -0.0114 79  PHE L CD2 
3123 C  CE1 . PHE D  79  ? 0.2400 0.2149 0.1623 0.0476  -0.0450 -0.0124 79  PHE L CE1 
3124 C  CE2 . PHE D  79  ? 0.2428 0.2163 0.1609 0.0420  -0.0373 -0.0125 79  PHE L CE2 
3125 C  CZ  . PHE D  79  ? 0.2486 0.2253 0.1701 0.0436  -0.0400 -0.0129 79  PHE L CZ  
3126 N  N   . ILE D  80  ? 0.2190 0.1902 0.1409 0.0460  -0.0428 -0.0094 80  ILE L N   
3127 C  CA  . ILE D  80  ? 0.2200 0.2009 0.1502 0.0421  -0.0421 -0.0075 80  ILE L CA  
3128 C  C   . ILE D  80  ? 0.2167 0.2024 0.1548 0.0418  -0.0467 -0.0047 80  ILE L C   
3129 O  O   . ILE D  80  ? 0.2101 0.2043 0.1533 0.0390  -0.0476 -0.0019 80  ILE L O   
3130 C  CB  . ILE D  80  ? 0.2260 0.2084 0.1576 0.0413  -0.0374 -0.0082 80  ILE L CB  
3131 C  CG1 . ILE D  80  ? 0.2311 0.2253 0.1703 0.0370  -0.0377 -0.0073 80  ILE L CG1 
3132 C  CG2 . ILE D  80  ? 0.2319 0.2108 0.1648 0.0451  -0.0370 -0.0083 80  ILE L CG2 
3133 C  CD1 . ILE D  80  ? 0.2462 0.2443 0.1897 0.0347  -0.0332 -0.0092 80  ILE L CD1 
3134 N  N   A MET D  81  ? 0.2176 0.1973 0.1563 0.0445  -0.0496 -0.0054 81  MET L N   
3135 N  N   B MET D  81  ? 0.2193 0.1989 0.1578 0.0446  -0.0494 -0.0055 81  MET L N   
3136 C  CA  A MET D  81  ? 0.2183 0.2002 0.1655 0.0437  -0.0531 -0.0024 81  MET L CA  
3137 C  CA  B MET D  81  ? 0.2202 0.2017 0.1670 0.0438  -0.0531 -0.0026 81  MET L CA  
3138 C  C   A MET D  81  ? 0.2174 0.2047 0.1679 0.0403  -0.0546 0.0000  81  MET L C   
3139 C  C   B MET D  81  ? 0.2178 0.2053 0.1677 0.0403  -0.0543 0.0000  81  MET L C   
3140 O  O   A MET D  81  ? 0.2196 0.2112 0.1762 0.0382  -0.0555 0.0047  81  MET L O   
3141 O  O   B MET D  81  ? 0.2187 0.2116 0.1740 0.0382  -0.0548 0.0048  81  MET L O   
3142 C  CB  A MET D  81  ? 0.2230 0.1960 0.1708 0.0467  -0.0558 -0.0053 81  MET L CB  
3143 C  CB  B MET D  81  ? 0.2268 0.1996 0.1742 0.0467  -0.0560 -0.0056 81  MET L CB  
3144 C  CG  A MET D  81  ? 0.2294 0.1972 0.1729 0.0505  -0.0530 -0.0081 81  MET L CG  
3145 C  CG  B MET D  81  ? 0.2341 0.2027 0.1829 0.0499  -0.0546 -0.0066 81  MET L CG  
3146 S  SD  A MET D  81  ? 0.2632 0.2384 0.2150 0.0506  -0.0501 -0.0043 81  MET L SD  
3147 S  SD  B MET D  81  ? 0.2614 0.2353 0.2224 0.0494  -0.0552 -0.0004 81  MET L SD  
3148 C  CE  A MET D  81  ? 0.2385 0.2061 0.1974 0.0542  -0.0525 -0.0050 81  MET L CE  
3149 C  CE  B MET D  81  ? 0.2517 0.2234 0.2134 0.0543  -0.0514 -0.0032 81  MET L CE  
3150 N  N   . LEU D  82  ? 0.2217 0.2085 0.1680 0.0403  -0.0542 -0.0026 82  LEU L N   
3151 C  CA  . LEU D  82  ? 0.2151 0.2088 0.1654 0.0373  -0.0539 -0.0008 82  LEU L CA  
3152 C  C   . LEU D  82  ? 0.2127 0.2142 0.1610 0.0345  -0.0509 0.0017  82  LEU L C   
3153 O  O   . LEU D  82  ? 0.2097 0.2175 0.1611 0.0319  -0.0504 0.0055  82  LEU L O   
3154 C  CB  . LEU D  82  ? 0.2246 0.2169 0.1727 0.0389  -0.0542 -0.0045 82  LEU L CB  
3155 C  CG  . LEU D  82  ? 0.2142 0.2142 0.1680 0.0365  -0.0530 -0.0035 82  LEU L CG  
3156 C  CD1 . LEU D  82  ? 0.2211 0.2246 0.1860 0.0339  -0.0548 -0.0008 82  LEU L CD1 
3157 C  CD2 . LEU D  82  ? 0.2269 0.2257 0.1791 0.0396  -0.0531 -0.0074 82  LEU L CD2 
3158 N  N   . MET D  83  ? 0.2095 0.2047 0.1665 0.0443  -0.0541 -0.0087 83  MET L N   
3159 C  CA  . MET D  83  ? 0.1971 0.1960 0.1581 0.0434  -0.0460 -0.0076 83  MET L CA  
3160 C  C   . MET D  83  ? 0.1993 0.2023 0.1641 0.0385  -0.0418 -0.0061 83  MET L C   
3161 O  O   . MET D  83  ? 0.1972 0.2088 0.1699 0.0357  -0.0387 -0.0056 83  MET L O   
3162 C  CB  . MET D  83  ? 0.2129 0.2001 0.1607 0.0450  -0.0432 -0.0056 83  MET L CB  
3163 C  CG  . MET D  83  ? 0.2280 0.2062 0.1684 0.0515  -0.0464 -0.0058 83  MET L CG  
3164 S  SD  . MET D  83  ? 0.2289 0.2100 0.1757 0.0582  -0.0442 -0.0069 83  MET L SD  
3165 C  CE  . MET D  83  ? 0.2661 0.2704 0.2329 0.0625  -0.0522 -0.0052 83  MET L CE  
3166 N  N   . ALA D  84  ? 0.2113 0.2061 0.1677 0.0395  -0.0407 -0.0049 84  ALA L N   
3167 C  CA  . ALA D  84  ? 0.2045 0.2007 0.1626 0.0387  -0.0357 -0.0016 84  ALA L CA  
3168 C  C   . ALA D  84  ? 0.2000 0.1984 0.1657 0.0336  -0.0382 -0.0034 84  ALA L C   
3169 O  O   . ALA D  84  ? 0.2026 0.2089 0.1753 0.0314  -0.0344 -0.0004 84  ALA L O   
3170 C  CB  . ALA D  84  ? 0.2223 0.2039 0.1651 0.0454  -0.0314 0.0008  84  ALA L CB  
3171 N  N   . ARG D  85  ? 0.2056 0.1989 0.1702 0.0300  -0.0455 -0.0069 85  ARG L N   
3172 C  CA  . ARG D  85  ? 0.2206 0.2184 0.1947 0.0216  -0.0487 -0.0066 85  ARG L CA  
3173 C  C   . ARG D  85  ? 0.1985 0.2194 0.1925 0.0204  -0.0454 -0.0040 85  ARG L C   
3174 O  O   . ARG D  85  ? 0.2006 0.2268 0.2018 0.0151  -0.0421 -0.0011 85  ARG L O   
3175 C  CB  . ARG D  85  ? 0.2447 0.2379 0.2158 0.0147  -0.0605 -0.0090 85  ARG L CB  
3176 C  CG  . ARG D  85  ? 0.3149 0.2754 0.2575 0.0133  -0.0635 -0.0125 85  ARG L CG  
3177 C  CD  . ARG D  85  ? 0.3560 0.3108 0.2904 0.0048  -0.0784 -0.0152 85  ARG L CD  
3178 N  NE  . ARG D  85  ? 0.4128 0.3296 0.3096 0.0071  -0.0804 -0.0201 85  ARG L NE  
3179 C  CZ  . ARG D  85  ? 0.4476 0.3494 0.3251 -0.0011 -0.0948 -0.0235 85  ARG L CZ  
3180 N  NH1 . ARG D  85  ? 0.4961 0.3568 0.3318 0.0028  -0.0941 -0.0288 85  ARG L NH1 
3181 N  NH2 . ARG D  85  ? 0.4414 0.3711 0.3410 -0.0120 -0.1095 -0.0204 85  ARG L NH2 
3182 N  N   . LEU D  86  ? 0.1915 0.2224 0.1906 0.0262  -0.0449 -0.0048 86  LEU L N   
3183 C  CA  . LEU D  86  ? 0.1853 0.2321 0.1963 0.0288  -0.0388 -0.0028 86  LEU L CA  
3184 C  C   . LEU D  86  ? 0.1820 0.2239 0.1841 0.0291  -0.0312 -0.0025 86  LEU L C   
3185 O  O   . LEU D  86  ? 0.1931 0.2433 0.1997 0.0284  -0.0252 -0.0003 86  LEU L O   
3186 C  CB  . LEU D  86  ? 0.2022 0.2530 0.2145 0.0382  -0.0388 -0.0033 86  LEU L CB  
3187 C  CG  . LEU D  86  ? 0.2441 0.3163 0.2758 0.0412  -0.0431 0.0012  86  LEU L CG  
3188 C  CD1 . LEU D  86  ? 0.2412 0.3312 0.2911 0.0295  -0.0491 0.0058  86  LEU L CD1 
3189 C  CD2 . LEU D  86  ? 0.2348 0.3050 0.2630 0.0505  -0.0485 0.0017  86  LEU L CD2 
3190 N  N   . THR D  87  ? 0.1952 0.2261 0.1850 0.0292  -0.0319 -0.0031 87  THR L N   
3191 C  CA  . THR D  87  ? 0.1882 0.2187 0.1706 0.0266  -0.0286 -0.0008 87  THR L CA  
3192 C  C   . THR D  87  ? 0.1923 0.2272 0.1793 0.0238  -0.0264 0.0036  87  THR L C   
3193 O  O   . THR D  87  ? 0.1923 0.2316 0.1771 0.0216  -0.0231 0.0060  87  THR L O   
3194 C  CB  . THR D  87  ? 0.1882 0.2143 0.1632 0.0260  -0.0306 0.0015  87  THR L CB  
3195 O  OG1 . THR D  87  ? 0.1969 0.2144 0.1649 0.0274  -0.0323 -0.0019 87  THR L OG1 
3196 C  CG2 . THR D  87  ? 0.2068 0.2391 0.1776 0.0203  -0.0306 0.0066  87  THR L CG2 
3197 N  N   A TRP D  88  ? 0.1946 0.2228 0.1823 0.0245  -0.0280 0.0047  88  TRP L N   
3198 N  N   B TRP D  88  ? 0.1955 0.2238 0.1832 0.0244  -0.0280 0.0048  88  TRP L N   
3199 C  CA  A TRP D  88  ? 0.2017 0.2252 0.1893 0.0223  -0.0256 0.0089  88  TRP L CA  
3200 C  CA  B TRP D  88  ? 0.2023 0.2263 0.1901 0.0223  -0.0255 0.0090  88  TRP L CA  
3201 C  C   A TRP D  88  ? 0.1962 0.2282 0.1934 0.0164  -0.0238 0.0096  88  TRP L C   
3202 C  C   B TRP D  88  ? 0.1964 0.2285 0.1936 0.0164  -0.0237 0.0096  88  TRP L C   
3203 O  O   A TRP D  88  ? 0.2006 0.2355 0.1969 0.0148  -0.0192 0.0145  88  TRP L O   
3204 O  O   B TRP D  88  ? 0.1998 0.2348 0.1962 0.0147  -0.0191 0.0145  88  TRP L O   
3205 C  CB  A TRP D  88  ? 0.2173 0.2216 0.1960 0.0234  -0.0279 0.0074  88  TRP L CB  
3206 C  CB  B TRP D  88  ? 0.2192 0.2241 0.1981 0.0236  -0.0276 0.0077  88  TRP L CB  
3207 C  CG  A TRP D  88  ? 0.2497 0.2386 0.2217 0.0209  -0.0251 0.0113  88  TRP L CG  
3208 C  CG  B TRP D  88  ? 0.2527 0.2429 0.2257 0.0204  -0.0251 0.0114  88  TRP L CG  
3209 C  CD1 A TRP D  88  ? 0.2688 0.2463 0.2399 0.0104  -0.0287 0.0101  88  TRP L CD1 
3210 C  CD1 B TRP D  88  ? 0.2684 0.2505 0.2335 0.0267  -0.0189 0.0185  88  TRP L CD1 
3211 C  CD2 A TRP D  88  ? 0.2658 0.2483 0.2304 0.0280  -0.0184 0.0191  88  TRP L CD2 
3212 C  CD2 B TRP D  88  ? 0.2748 0.2551 0.2483 0.0091  -0.0294 0.0098  88  TRP L CD2 
3213 N  NE1 A TRP D  88  ? 0.2914 0.2497 0.2513 0.0100  -0.0240 0.0153  88  TRP L NE1 
3214 N  NE1 B TRP D  88  ? 0.2966 0.2584 0.2535 0.0211  -0.0178 0.0205  88  TRP L NE1 
3215 C  CE2 A TRP D  88  ? 0.2934 0.2537 0.2488 0.0225  -0.0171 0.0211  88  TRP L CE2 
3216 C  CE2 B TRP D  88  ? 0.2990 0.2588 0.2606 0.0083  -0.0245 0.0152  88  TRP L CE2 
3217 C  CE3 A TRP D  88  ? 0.2637 0.2577 0.2292 0.0376  -0.0143 0.0264  88  TRP L CE3 
3218 C  CE3 B TRP D  88  ? 0.2777 0.2668 0.2619 -0.0010 -0.0371 0.0067  88  TRP L CE3 
3219 C  CZ2 A TRP D  88  ? 0.3165 0.2626 0.2611 0.0298  -0.0102 0.0294  88  TRP L CZ2 
3220 C  CZ2 B TRP D  88  ? 0.3278 0.2711 0.2851 -0.0052 -0.0276 0.0161  88  TRP L CZ2 
3221 C  CZ3 A TRP D  88  ? 0.2847 0.2722 0.2441 0.0452  -0.0085 0.0361  88  TRP L CZ3 
3222 C  CZ3 B TRP D  88  ? 0.2999 0.2805 0.2848 -0.0154 -0.0415 0.0090  88  TRP L CZ3 
3223 C  CH2 A TRP D  88  ? 0.3026 0.2645 0.2504 0.0429  -0.0057 0.0372  88  TRP L CH2 
3224 C  CH2 B TRP D  88  ? 0.3250 0.2806 0.2953 -0.0190 -0.0370 0.0129  88  TRP L CH2 
3225 N  N   . ALA D  89  ? 0.1876 0.2264 0.1949 0.0137  -0.0272 0.0068  89  ALA L N   
3226 C  CA  . ALA D  89  ? 0.1852 0.2407 0.2077 0.0088  -0.0239 0.0106  89  ALA L CA  
3227 C  C   . ALA D  89  ? 0.1802 0.2452 0.2012 0.0139  -0.0147 0.0122  89  ALA L C   
3228 O  O   . ALA D  89  ? 0.2023 0.2754 0.2280 0.0110  -0.0081 0.0175  89  ALA L O   
3229 C  CB  . ALA D  89  ? 0.1730 0.2431 0.2115 0.0069  -0.0300 0.0103  89  ALA L CB  
3230 N  N   . SER D  90  ? 0.1796 0.2399 0.1895 0.0207  -0.0139 0.0079  90  SER L N   
3231 C  CA  . SER D  90  ? 0.1910 0.2511 0.1896 0.0248  -0.0059 0.0078  90  SER L CA  
3232 C  C   . SER D  90  ? 0.1960 0.2505 0.1819 0.0202  -0.0047 0.0115  90  SER L C   
3233 O  O   . SER D  90  ? 0.2038 0.2609 0.1835 0.0203  0.0030  0.0149  90  SER L O   
3234 C  CB  . SER D  90  ? 0.1955 0.2429 0.1782 0.0302  -0.0068 0.0018  90  SER L CB  
3235 O  OG  . SER D  90  ? 0.2049 0.2450 0.1704 0.0354  0.0023  0.0005  90  SER L OG  
3236 N  N   . HIS D  91  ? 0.1994 0.2483 0.1818 0.0177  -0.0114 0.0126  91  HIS L N   
3237 C  CA  . HIS D  91  ? 0.1985 0.2468 0.1724 0.0154  -0.0116 0.0192  91  HIS L CA  
3238 C  C   . HIS D  91  ? 0.2164 0.2655 0.1960 0.0134  -0.0065 0.0252  91  HIS L C   
3239 O  O   . HIS D  91  ? 0.2180 0.2676 0.1884 0.0123  -0.0027 0.0309  91  HIS L O   
3240 C  CB  . HIS D  91  ? 0.1880 0.2360 0.1619 0.0166  -0.0176 0.0227  91  HIS L CB  
3241 C  CG  . HIS D  91  ? 0.1831 0.2371 0.1502 0.0162  -0.0191 0.0325  91  HIS L CG  
3242 N  ND1 . HIS D  91  ? 0.1931 0.2470 0.1645 0.0217  -0.0179 0.0410  91  HIS L ND1 
3243 C  CD2 . HIS D  91  ? 0.1895 0.2482 0.1427 0.0115  -0.0219 0.0357  91  HIS L CD2 
3244 C  CE1 . HIS D  91  ? 0.2036 0.2673 0.1694 0.0219  -0.0201 0.0511  91  HIS L CE1 
3245 N  NE2 . HIS D  91  ? 0.1895 0.2570 0.1438 0.0140  -0.0239 0.0478  91  HIS L NE2 
3246 N  N   . GLU D  92  ? 0.2078 0.2545 0.1997 0.0111  -0.0071 0.0248  92  GLU L N   
3247 C  CA  . GLU D  92  ? 0.2309 0.2747 0.2277 0.0049  -0.0031 0.0311  92  GLU L CA  
3248 C  C   . GLU D  92  ? 0.2386 0.2970 0.2409 0.0028  0.0056  0.0345  92  GLU L C   
3249 O  O   . GLU D  92  ? 0.2550 0.3117 0.2515 0.0002  0.0118  0.0420  92  GLU L O   
3250 C  CB  . GLU D  92  ? 0.2481 0.2836 0.2532 -0.0016 -0.0084 0.0292  92  GLU L CB  
3251 C  CG  . GLU D  92  ? 0.2677 0.2810 0.2602 0.0024  -0.0134 0.0267  92  GLU L CG  
3252 C  CD  . GLU D  92  ? 0.3299 0.3230 0.3084 0.0044  -0.0094 0.0339  92  GLU L CD  
3253 O  OE1 . GLU D  92  ? 0.3852 0.3598 0.3590 -0.0045 -0.0092 0.0365  92  GLU L OE1 
3254 O  OE2 . GLU D  92  ? 0.3620 0.3575 0.3338 0.0144  -0.0070 0.0385  92  GLU L OE2 
3255 N  N   . LYS D  93  ? 0.2323 0.3039 0.2429 0.0065  0.0078  0.0303  93  LYS L N   
3256 C  CA  . LYS D  93  ? 0.2409 0.3272 0.2553 0.0096  0.0196  0.0343  93  LYS L CA  
3257 C  C   . LYS D  93  ? 0.2542 0.3300 0.2420 0.0137  0.0257  0.0351  93  LYS L C   
3258 O  O   . LYS D  93  ? 0.2698 0.3502 0.2538 0.0131  0.0361  0.0423  93  LYS L O   
3259 C  CB  . LYS D  93  ? 0.2564 0.3556 0.2812 0.0181  0.0222  0.0305  93  LYS L CB  
3260 C  CG  . LYS D  93  ? 0.2941 0.4098 0.3231 0.0263  0.0382  0.0364  93  LYS L CG  
3261 C  CD  . LYS D  93  ? 0.3261 0.4728 0.3887 0.0203  0.0430  0.0481  93  LYS L CD  
3262 C  CE  . LYS D  93  ? 0.3489 0.5177 0.4190 0.0354  0.0616  0.0550  93  LYS L CE  
3263 N  NZ  . LYS D  93  ? 0.3672 0.5105 0.4001 0.0528  0.0716  0.0464  93  LYS L NZ  
3264 N  N   . MET D  94  ? 0.2409 0.3032 0.2096 0.0159  0.0184  0.0291  94  MET L N   
3265 C  CA  . MET D  94  ? 0.2632 0.3150 0.2032 0.0162  0.0197  0.0303  94  MET L CA  
3266 C  C   . MET D  94  ? 0.2744 0.3260 0.2110 0.0121  0.0202  0.0403  94  MET L C   
3267 O  O   . MET D  94  ? 0.2978 0.3435 0.2104 0.0123  0.0235  0.0438  94  MET L O   
3268 C  CB  . MET D  94  ? 0.2672 0.3090 0.1916 0.0145  0.0080  0.0246  94  MET L CB  
3269 C  CG  . MET D  94  ? 0.2788 0.3112 0.1949 0.0183  0.0081  0.0149  94  MET L CG  
3270 S  SD  . MET D  94  ? 0.2748 0.2984 0.1799 0.0110  -0.0071 0.0111  94  MET L SD  
3271 C  CE  . MET D  94  ? 0.2626 0.2741 0.1672 0.0178  -0.0040 0.0014  94  MET L CE  
3272 N  N   . HIS D  95  ? 0.2610 0.3138 0.2154 0.0088  0.0169  0.0450  95  HIS L N   
3273 C  CA  . HIS D  95  ? 0.2919 0.3383 0.2404 0.0067  0.0182  0.0558  95  HIS L CA  
3274 C  C   . HIS D  95  ? 0.3070 0.3536 0.2683 0.0004  0.0264  0.0622  95  HIS L C   
3275 O  O   . HIS D  95  ? 0.3214 0.3560 0.2777 -0.0023 0.0276  0.0711  95  HIS L O   
3276 C  CB  . HIS D  95  ? 0.2721 0.3111 0.2219 0.0096  0.0091  0.0582  95  HIS L CB  
3277 C  CG  . HIS D  95  ? 0.2666 0.3118 0.2046 0.0131  0.0009  0.0590  95  HIS L CG  
3278 N  ND1 . HIS D  95  ? 0.2836 0.3309 0.2044 0.0136  -0.0008 0.0680  95  HIS L ND1 
3279 C  CD2 . HIS D  95  ? 0.2457 0.2972 0.1867 0.0138  -0.0072 0.0535  95  HIS L CD2 
3280 C  CE1 . HIS D  95  ? 0.2884 0.3456 0.2034 0.0128  -0.0116 0.0683  95  HIS L CE1 
3281 N  NE2 . HIS D  95  ? 0.2577 0.3173 0.1856 0.0125  -0.0148 0.0597  95  HIS L NE2 
3282 N  N   . GLU D  96  ? 0.3237 0.3845 0.3019 -0.0023 0.0322  0.0597  96  GLU L N   
3283 C  CA  . GLU D  96  ? 0.3513 0.4198 0.3485 -0.0127 0.0382  0.0680  96  GLU L CA  
3284 C  C   . GLU D  96  ? 0.3563 0.4228 0.3405 -0.0143 0.0499  0.0795  96  GLU L C   
3285 O  O   . GLU D  96  ? 0.3394 0.4120 0.3093 -0.0064 0.0587  0.0796  96  GLU L O   
3286 C  CB  . GLU D  96  ? 0.3718 0.4666 0.3940 -0.0129 0.0422  0.0663  96  GLU L CB  
3287 C  CG  . GLU D  96  ? 0.4287 0.5418 0.4770 -0.0268 0.0469  0.0777  96  GLU L CG  
3288 C  CD  . GLU D  96  ? 0.4588 0.6088 0.5371 -0.0240 0.0521  0.0806  96  GLU L CD  
3289 O  OE1 . GLU D  96  ? 0.5092 0.6800 0.6157 -0.0389 0.0499  0.0901  96  GLU L OE1 
3290 O  OE2 . GLU D  96  ? 0.4652 0.6240 0.5391 -0.0075 0.0587  0.0752  96  GLU L OE2 
3291 N  N   . GLY D  97  ? 0.3564 0.4086 0.3398 -0.0240 0.0504  0.0890  97  GLY L N   
3292 C  CA  . GLY D  97  ? 0.3778 0.4254 0.3469 -0.0257 0.0614  0.1014  97  GLY L CA  
3293 C  C   . GLY D  97  ? 0.3855 0.4198 0.3232 -0.0147 0.0605  0.1031  97  GLY L C   
3294 O  O   . GLY D  97  ? 0.4184 0.4511 0.3397 -0.0140 0.0704  0.1128  97  GLY L O   
3295 N  N   . ASP D  98  ? 0.3764 0.4031 0.3060 -0.0072 0.0482  0.0959  98  ASP L N   
3296 C  CA  . ASP D  98  ? 0.3930 0.4155 0.2966 0.0014  0.0433  0.0987  98  ASP L CA  
3297 C  C   . ASP D  98  ? 0.4291 0.4355 0.3180 0.0023  0.0457  0.1136  98  ASP L C   
3298 O  O   . ASP D  98  ? 0.4453 0.4348 0.3399 0.0017  0.0439  0.1183  98  ASP L O   
3299 C  CB  . ASP D  98  ? 0.3821 0.4069 0.2889 0.0070  0.0294  0.0908  98  ASP L CB  
3300 C  CG  . ASP D  98  ? 0.3781 0.4078 0.2630 0.0117  0.0209  0.0935  98  ASP L CG  
3301 O  OD1 . ASP D  98  ? 0.4265 0.4535 0.2887 0.0120  0.0237  0.1016  98  ASP L OD1 
3302 O  OD2 . ASP D  98  ? 0.3713 0.4087 0.2617 0.0138  0.0099  0.0883  98  ASP L OD2 
3303 N  N   . GLU D  99  ? 0.4520 0.4587 0.3168 0.0046  0.0505  0.1214  99  GLU L N   
3304 C  CA  . GLU D  99  ? 0.4825 0.4740 0.3295 0.0071  0.0530  0.1374  99  GLU L CA  
3305 C  C   . GLU D  99  ? 0.4984 0.4939 0.3239 0.0162  0.0408  0.1427  99  GLU L C   
3306 O  O   . GLU D  99  ? 0.5352 0.5218 0.3406 0.0206  0.0417  0.1577  99  GLU L O   
3307 C  CB  . GLU D  99  ? 0.5168 0.5063 0.3516 0.0015  0.0689  0.1461  99  GLU L CB  
3308 C  CG  . GLU D  99  ? 0.5222 0.5175 0.3833 -0.0099 0.0805  0.1448  99  GLU L CG  
3309 C  CD  . GLU D  99  ? 0.5542 0.5529 0.4072 -0.0152 0.0985  0.1569  99  GLU L CD  
3310 O  OE1 . GLU D  99  ? 0.5906 0.5786 0.4133 -0.0105 0.1029  0.1675  99  GLU L OE1 
3311 O  OE2 . GLU D  99  ? 0.5820 0.5971 0.4602 -0.0243 0.1088  0.1578  99  GLU L OE2 
3312 N  N   . GLY D  100 ? 0.4722 0.4825 0.3013 0.0177  0.0289  0.1323  100 GLY L N   
3313 C  CA  . GLY D  100 ? 0.5009 0.5217 0.3115 0.0213  0.0146  0.1379  100 GLY L CA  
3314 C  C   . GLY D  100 ? 0.5309 0.5470 0.3048 0.0177  0.0172  0.1405  100 GLY L C   
3315 O  O   . GLY D  100 ? 0.5598 0.5677 0.3257 0.0144  0.0318  0.1349  100 GLY L O   
3316 N  N   . PRO D  101 ? 0.5756 0.5979 0.3260 0.0190  0.0035  0.1506  101 PRO L N   
3317 C  CA  . PRO D  101 ? 0.5494 0.5892 0.3127 0.0251  -0.0125 0.1629  101 PRO L CA  
3318 C  C   . PRO D  101 ? 0.5307 0.5894 0.3110 0.0197  -0.0265 0.1520  101 PRO L C   
3319 O  O   . PRO D  101 ? 0.5324 0.5860 0.3008 0.0099  -0.0279 0.1361  101 PRO L O   
3320 C  CB  . PRO D  101 ? 0.5960 0.6387 0.3237 0.0248  -0.0226 0.1779  101 PRO L CB  
3321 C  CG  . PRO D  101 ? 0.6305 0.6581 0.3218 0.0144  -0.0189 0.1649  101 PRO L CG  
3322 C  CD  . PRO D  101 ? 0.6009 0.6154 0.3073 0.0135  0.0012  0.1495  101 PRO L CD  
3323 N  N   . GLY D  102 ? 0.4895 0.5670 0.2968 0.0276  -0.0344 0.1612  102 GLY L N   
3324 C  CA  . GLY D  102 ? 0.4668 0.5660 0.2905 0.0215  -0.0477 0.1548  102 GLY L CA  
3325 C  C   . GLY D  102 ? 0.4308 0.5177 0.2651 0.0152  -0.0401 0.1329  102 GLY L C   
3326 O  O   . GLY D  102 ? 0.4614 0.5327 0.3090 0.0206  -0.0252 0.1271  102 GLY L O   
3327 N  N   . HIS D  103 ? 0.3885 0.8623 0.2436 0.0904  -0.0428 0.1919  103 HIS L N   
3328 C  CA  . HIS D  103 ? 0.3438 0.7542 0.2095 0.0671  -0.0410 0.1460  103 HIS L CA  
3329 C  C   . HIS D  103 ? 0.3515 0.7989 0.1940 0.0678  -0.0445 0.1060  103 HIS L C   
3330 O  O   . HIS D  103 ? 0.3487 0.8513 0.1749 0.0794  -0.0622 0.0675  103 HIS L O   
3331 C  CB  . HIS D  103 ? 0.3023 0.6754 0.1962 0.0586  -0.0504 0.1112  103 HIS L CB  
3332 C  CG  . HIS D  103 ? 0.2658 0.5690 0.1701 0.0397  -0.0430 0.0811  103 HIS L CG  
3333 N  ND1 . HIS D  103 ? 0.2604 0.5718 0.1651 0.0329  -0.0500 0.0356  103 HIS L ND1 
3334 C  CD2 . HIS D  103 ? 0.2578 0.4825 0.1668 0.0299  -0.0298 0.0928  103 HIS L CD2 
3335 C  CE1 . HIS D  103 ? 0.2326 0.4783 0.1445 0.0206  -0.0389 0.0261  103 HIS L CE1 
3336 N  NE2 . HIS D  103 ? 0.2291 0.4249 0.1405 0.0191  -0.0284 0.0589  103 HIS L NE2 
3337 N  N   . HIS D  104 ? 0.3553 0.7709 0.1988 0.0566  -0.0298 0.1115  104 HIS L N   
3338 C  CA  . HIS D  104 ? 0.3618 0.8036 0.1874 0.0614  -0.0278 0.0753  104 HIS L CA  
3339 C  C   . HIS D  104 ? 0.3246 0.6969 0.1735 0.0409  -0.0185 0.0726  104 HIS L C   
3340 O  O   . HIS D  104 ? 0.3148 0.6459 0.1824 0.0272  -0.0123 0.1090  104 HIS L O   
3341 C  CB  . HIS D  104 ? 0.4300 0.9564 0.2251 0.0842  -0.0155 0.1048  104 HIS L CB  
3342 C  CG  . HIS D  104 ? 0.5031 1.1070 0.2659 0.1105  -0.0248 0.1170  104 HIS L CG  
3343 N  ND1 . HIS D  104 ? 0.5378 1.2031 0.2597 0.1345  -0.0424 0.0671  104 HIS L ND1 
3344 C  CD2 . HIS D  104 ? 0.5409 1.1735 0.3050 0.1200  -0.0206 0.1766  104 HIS L CD2 
3345 C  CE1 . HIS D  104 ? 0.6019 1.3383 0.2965 0.1581  -0.0514 0.0930  104 HIS L CE1 
3346 N  NE2 . HIS D  104 ? 0.5899 1.3071 0.3120 0.1503  -0.0356 0.1644  104 HIS L NE2 
3347 N  N   . HIS D  105 ? 0.2973 0.6539 0.1458 0.0406  -0.0203 0.0279  105 HIS L N   
3348 C  CA  . HIS D  105 ? 0.2690 0.5815 0.1332 0.0295  -0.0123 0.0256  105 HIS L CA  
3349 C  C   . HIS D  105 ? 0.2767 0.6420 0.1313 0.0441  -0.0010 0.0252  105 HIS L C   
3350 O  O   . HIS D  105 ? 0.3093 0.7169 0.1392 0.0663  -0.0022 -0.0098 105 HIS L O   
3351 C  CB  . HIS D  105 ? 0.2475 0.5066 0.1234 0.0248  -0.0182 -0.0174 105 HIS L CB  
3352 C  CG  . HIS D  105 ? 0.2255 0.4290 0.1174 0.0123  -0.0217 -0.0107 105 HIS L CG  
3353 N  ND1 . HIS D  105 ? 0.2260 0.3965 0.1364 0.0091  -0.0245 -0.0381 105 HIS L ND1 
3354 C  CD2 . HIS D  105 ? 0.2267 0.4032 0.1206 0.0056  -0.0203 0.0236  105 HIS L CD2 
3355 C  CE1 . HIS D  105 ? 0.2202 0.3492 0.1410 0.0033  -0.0208 -0.0185 105 HIS L CE1 
3356 N  NE2 . HIS D  105 ? 0.2217 0.3525 0.1277 0.0032  -0.0197 0.0150  105 HIS L NE2 
3357 N  N   . LYS D  106 ? 0.2714 0.6412 0.1468 0.0342  0.0088  0.0635  106 LYS L N   
3358 C  CA  . LYS D  106 ? 0.2847 0.7000 0.1667 0.0467  0.0222  0.0661  106 LYS L CA  
3359 C  C   . LYS D  106 ? 0.2704 0.6310 0.1604 0.0463  0.0170  0.0252  106 LYS L C   
3360 O  O   . LYS D  106 ? 0.2550 0.5476 0.1478 0.0333  0.0057  0.0069  106 LYS L O   
3361 C  CB  . LYS D  106 ? 0.2943 0.7300 0.2158 0.0284  0.0297  0.1241  106 LYS L CB  
3362 C  CG  . LYS D  106 ? 0.3325 0.8185 0.2587 0.0283  0.0398  0.1783  106 LYS L CG  
3363 C  CD  . LYS D  106 ? 0.3437 0.8290 0.3298 -0.0005 0.0424  0.2362  106 LYS L CD  
3364 C  CE  . LYS D  106 ? 0.3850 0.9067 0.3826 -0.0008 0.0543  0.2968  106 LYS L CE  
3365 N  NZ  . LYS D  106 ? 0.4027 0.9325 0.4742 -0.0305 0.0595  0.3609  106 LYS L NZ  
3366 N  N   . PRO D  107 ? 0.2774 0.6706 0.1738 0.0640  0.0283  0.0176  107 PRO L N   
3367 C  CA  . PRO D  107 ? 0.2743 0.6173 0.1877 0.0639  0.0251  -0.0037 107 PRO L CA  
3368 C  C   . PRO D  107 ? 0.2547 0.5425 0.1898 0.0360  0.0120  0.0180  107 PRO L C   
3369 O  O   . PRO D  107 ? 0.2450 0.5452 0.1974 0.0159  0.0069  0.0550  107 PRO L O   
3370 C  CB  . PRO D  107 ? 0.2807 0.6889 0.2078 0.0872  0.0417  0.0070  107 PRO L CB  
3371 C  CG  . PRO D  107 ? 0.3109 0.7939 0.2083 0.1117  0.0559  0.0079  107 PRO L CG  
3372 C  CD  . PRO D  107 ? 0.2974 0.7807 0.1897 0.0885  0.0479  0.0379  107 PRO L CD  
3373 N  N   . GLY D  108 ? 0.2498 0.4745 0.1833 0.0364  0.0062  -0.0048 108 GLY L N   
3374 C  CA  . GLY D  108 ? 0.2517 0.4251 0.1902 0.0198  -0.0064 0.0087  108 GLY L CA  
3375 C  C   . GLY D  108 ? 0.2469 0.4367 0.2065 0.0232  -0.0114 0.0216  108 GLY L C   
3376 O  O   . GLY D  108 ? 0.2367 0.4896 0.2182 0.0332  -0.0034 0.0327  108 GLY L O   
3377 N  N   . LEU D  109 ? 0.2547 0.3954 0.2067 0.0196  -0.0241 0.0216  109 LEU L N   
3378 C  CA  . LEU D  109 ? 0.2709 0.4269 0.2393 0.0237  -0.0366 0.0331  109 LEU L CA  
3379 C  C   . LEU D  109 ? 0.2756 0.4621 0.2597 0.0527  -0.0209 0.0270  109 LEU L C   
3380 O  O   . LEU D  109 ? 0.2726 0.4278 0.2448 0.0707  -0.0047 0.0056  109 LEU L O   
3381 C  CB  . LEU D  109 ? 0.3033 0.3998 0.2428 0.0258  -0.0508 0.0287  109 LEU L CB  
3382 C  CG  . LEU D  109 ? 0.3429 0.4212 0.2736 0.0055  -0.0806 0.0349  109 LEU L CG  
3383 C  CD1 . LEU D  109 ? 0.3671 0.4168 0.2669 0.0236  -0.0949 0.0304  109 LEU L CD1 
3384 C  CD2 . LEU D  109 ? 0.3421 0.4772 0.3215 -0.0184 -0.0983 0.0533  109 LEU L CD2 
3385 N  N   . GLY D  110 ? 0.2778 0.5253 0.2961 0.0567  -0.0263 0.0462  110 GLY L N   
3386 C  CA  . GLY D  110 ? 0.3038 0.5844 0.3412 0.0905  -0.0115 0.0448  110 GLY L CA  
3387 C  C   . GLY D  110 ? 0.3291 0.6443 0.3683 0.1136  0.0156  0.0296  110 GLY L C   
3388 O  O   . GLY D  110 ? 0.3529 0.6808 0.4024 0.1479  0.0307  0.0208  110 GLY L O   
3389 N  N   . GLU D  111 ? 0.3504 0.6836 0.3770 0.0990  0.0208  0.0272  111 GLU L N   
3390 C  CA  . GLU D  111 ? 0.4245 0.7894 0.4331 0.1222  0.0422  0.0055  111 GLU L CA  
3391 C  C   . GLU D  111 ? 0.4619 0.7606 0.4363 0.1276  0.0432  -0.0387 111 GLU L C   
3392 O  O   . GLU D  111 ? 0.5034 0.7318 0.4768 0.1233  0.0369  -0.0521 111 GLU L O   
3393 C  CB  . GLU D  111 ? 0.4635 0.8944 0.4905 0.1620  0.0632  0.0070  111 GLU L CB  
3394 C  CG  . GLU D  111 ? 0.4762 1.0128 0.5277 0.1642  0.0772  0.0456  111 GLU L CG  
3395 C  CD  . GLU D  111 ? 0.4743 1.0224 0.5245 0.1262  0.0681  0.0727  111 GLU L CD  
3396 O  OE1 . GLU D  111 ? 0.5207 1.1415 0.5684 0.1356  0.0869  0.0944  111 GLU L OE1 
3397 O  OE2 . GLU D  111 ? 0.4513 0.9353 0.5016 0.0912  0.0441  0.0747  111 GLU L OE2 
3398 N  N   . GLY D  112 ? 0.5334 0.8610 0.4828 0.1383  0.0508  -0.0599 112 GLY L N   
3399 C  CA  . GLY D  112 ? 0.5333 0.8066 0.4604 0.1404  0.0449  -0.1066 112 GLY L CA  
3400 C  C   . GLY D  112 ? 0.5034 0.6983 0.4446 0.1155  0.0333  -0.1026 112 GLY L C   
3401 O  O   . GLY D  112 ? 0.4802 0.6663 0.4183 0.0883  0.0236  -0.0781 112 GLY L O   
3402 N  N   . MET E  1   ? 0.5310 0.6067 0.3546 0.0835  0.1302  0.1729  1   MET S N   
3403 C  CA  . MET E  1   ? 0.4511 0.5193 0.3566 0.0235  0.1086  0.1342  1   MET S CA  
3404 C  C   . MET E  1   ? 0.3810 0.4328 0.2834 0.0477  0.0543  0.1081  1   MET S C   
3405 O  O   . MET E  1   ? 0.4197 0.4367 0.2730 0.0872  0.0453  0.1184  1   MET S O   
3406 C  CB  . MET E  1   ? 0.5365 0.5163 0.4632 -0.0334 0.1603  0.1501  1   MET S CB  
3407 C  CG  . MET E  1   ? 0.4800 0.5048 0.5000 -0.0909 0.1404  0.0907  1   MET S CG  
3408 S  SD  . MET E  1   ? 0.8942 0.8443 0.9806 -0.1795 0.2139  0.0705  1   MET S SD  
3409 C  CE  . MET E  1   ? 0.6944 0.6800 0.8043 -0.2260 0.3039  0.0922  1   MET S CE  
3410 N  N   A LEU E  2   ? 0.3060 0.3895 0.2564 0.0304  0.0243  0.0736  2   LEU S N   
3411 N  N   B LEU E  2   ? 0.2961 0.3793 0.2463 0.0306  0.0241  0.0736  2   LEU S N   
3412 C  CA  A LEU E  2   ? 0.2712 0.3275 0.2240 0.0375  -0.0058 0.0544  2   LEU S CA  
3413 C  CA  B LEU E  2   ? 0.2572 0.3126 0.2087 0.0383  -0.0057 0.0548  2   LEU S CA  
3414 C  C   A LEU E  2   ? 0.2822 0.2848 0.2303 0.0206  -0.0026 0.0608  2   LEU S C   
3415 C  C   B LEU E  2   ? 0.2759 0.2771 0.2216 0.0222  -0.0018 0.0620  2   LEU S C   
3416 O  O   A LEU E  2   ? 0.3041 0.2817 0.2670 -0.0090 0.0206  0.0676  2   LEU S O   
3417 O  O   B LEU E  2   ? 0.3048 0.2760 0.2605 -0.0052 0.0239  0.0725  2   LEU S O   
3418 C  CB  A LEU E  2   ? 0.2465 0.3228 0.2228 0.0371  -0.0199 0.0381  2   LEU S CB  
3419 C  CB  B LEU E  2   ? 0.2201 0.2932 0.1952 0.0369  -0.0200 0.0382  2   LEU S CB  
3420 C  CG  A LEU E  2   ? 0.2551 0.3535 0.2290 0.0689  -0.0242 0.0253  2   LEU S CG  
3421 C  CG  B LEU E  2   ? 0.2206 0.3272 0.1956 0.0666  -0.0227 0.0270  2   LEU S CG  
3422 C  CD1 A LEU E  2   ? 0.2643 0.4313 0.2414 0.0778  -0.0134 0.0259  2   LEU S CD1 
3423 C  CD1 B LEU E  2   ? 0.2389 0.3395 0.2085 0.0938  -0.0300 0.0238  2   LEU S CD1 
3424 C  CD2 A LEU E  2   ? 0.2810 0.3751 0.2482 0.0947  -0.0304 0.0253  2   LEU S CD2 
3425 C  CD2 B LEU E  2   ? 0.2183 0.3111 0.1861 0.0835  -0.0258 0.0044  2   LEU S CD2 
3426 N  N   . THR E  3   ? 0.2637 0.2555 0.2033 0.0350  -0.0208 0.0455  3   THR S N   
3427 C  CA  . THR E  3   ? 0.2725 0.2282 0.2065 0.0316  -0.0238 0.0417  3   THR S CA  
3428 C  C   . THR E  3   ? 0.2450 0.2122 0.2106 0.0013  -0.0292 0.0275  3   THR S C   
3429 O  O   . THR E  3   ? 0.2299 0.2334 0.2071 -0.0009 -0.0329 0.0257  3   THR S O   
3430 C  CB  . THR E  3   ? 0.2516 0.2379 0.1820 0.0555  -0.0410 0.0130  3   THR S CB  
3431 O  OG1 . THR E  3   ? 0.2138 0.2197 0.1781 0.0280  -0.0397 -0.0067 3   THR S OG1 
3432 C  CG2 . THR E  3   ? 0.2818 0.3203 0.1854 0.1065  -0.0493 -0.0017 3   THR S CG2 
3433 N  N   . GLU E  4   ? 0.2610 0.2059 0.2302 -0.0052 -0.0310 0.0137  4   GLU S N   
3434 C  CA  . GLU E  4   ? 0.2444 0.2335 0.2372 -0.0186 -0.0415 -0.0129 4   GLU S CA  
3435 C  C   . GLU E  4   ? 0.2131 0.2340 0.1838 0.0002  -0.0473 -0.0037 4   GLU S C   
3436 O  O   . GLU E  4   ? 0.2141 0.2789 0.1745 0.0158  -0.0511 -0.0033 4   GLU S O   
3437 C  CB  . GLU E  4   ? 0.3025 0.2682 0.3055 -0.0237 -0.0438 -0.0435 4   GLU S CB  
3438 C  CG  . GLU E  4   ? 0.3997 0.3187 0.4403 -0.0588 -0.0185 -0.0644 4   GLU S CG  
3439 C  CD  . GLU E  4   ? 0.4187 0.4420 0.5236 -0.0908 -0.0235 -0.1186 4   GLU S CD  
3440 O  OE1 . GLU E  4   ? 0.4546 0.5039 0.5919 -0.1178 -0.0034 -0.1183 4   GLU S OE1 
3441 O  OE2 . GLU E  4   ? 0.4659 0.5739 0.5896 -0.0806 -0.0490 -0.1708 4   GLU S OE2 
3442 N  N   . LEU E  5   ? 0.2252 0.2088 0.1910 0.0162  -0.0391 0.0225  5   LEU S N   
3443 C  CA  . LEU E  5   ? 0.2164 0.2065 0.1867 0.0173  -0.0373 0.0232  5   LEU S CA  
3444 C  C   . LEU E  5   ? 0.2155 0.2070 0.1847 0.0131  -0.0383 0.0213  5   LEU S C   
3445 O  O   . LEU E  5   ? 0.2009 0.1945 0.1710 0.0133  -0.0366 0.0200  5   LEU S O   
3446 C  CB  . LEU E  5   ? 0.2088 0.2051 0.1884 0.0183  -0.0386 0.0285  5   LEU S CB  
3447 C  CG  . LEU E  5   ? 0.2024 0.2070 0.1928 0.0183  -0.0380 0.0327  5   LEU S CG  
3448 C  CD1 . LEU E  5   ? 0.2006 0.2079 0.1895 0.0249  -0.0308 0.0338  5   LEU S CD1 
3449 C  CD2 . LEU E  5   ? 0.1989 0.2102 0.2045 0.0178  -0.0420 0.0404  5   LEU S CD2 
3450 N  N   . GLU E  6   ? 0.2100 0.1997 0.1752 0.0111  -0.0410 0.0212  6   GLU S N   
3451 C  CA  . GLU E  6   ? 0.2163 0.2051 0.1761 0.0100  -0.0419 0.0190  6   GLU S CA  
3452 C  C   . GLU E  6   ? 0.2110 0.2004 0.1695 0.0093  -0.0379 0.0175  6   GLU S C   
3453 O  O   . GLU E  6   ? 0.1985 0.1889 0.1566 0.0089  -0.0375 0.0154  6   GLU S O   
3454 C  CB  . GLU E  6   ? 0.2260 0.2105 0.1761 0.0120  -0.0445 0.0198  6   GLU S CB  
3455 C  CG  . GLU E  6   ? 0.2356 0.2167 0.1863 0.0124  -0.0524 0.0204  6   GLU S CG  
3456 C  CD  . GLU E  6   ? 0.2541 0.2282 0.1918 0.0163  -0.0557 0.0209  6   GLU S CD  
3457 O  OE1 . GLU E  6   ? 0.2683 0.2359 0.2035 0.0172  -0.0654 0.0203  6   GLU S OE1 
3458 O  OE2 . GLU E  6   ? 0.2703 0.2452 0.2015 0.0186  -0.0497 0.0232  6   GLU S OE2 
3459 N  N   . LYS E  7   ? 0.2156 0.2036 0.1756 0.0088  -0.0364 0.0192  7   LYS S N   
3460 C  CA  . LYS E  7   ? 0.2154 0.2030 0.1786 0.0072  -0.0355 0.0191  7   LYS S CA  
3461 C  C   . LYS E  7   ? 0.2031 0.1886 0.1664 0.0079  -0.0363 0.0152  7   LYS S C   
3462 O  O   . LYS E  7   ? 0.2066 0.1926 0.1709 0.0069  -0.0361 0.0138  7   LYS S O   
3463 C  CB  . LYS E  7   ? 0.2290 0.2132 0.1975 0.0056  -0.0374 0.0231  7   LYS S CB  
3464 C  CG  . LYS E  7   ? 0.2451 0.2340 0.2151 0.0056  -0.0344 0.0301  7   LYS S CG  
3465 C  CD  . LYS E  7   ? 0.2716 0.2579 0.2517 0.0029  -0.0374 0.0365  7   LYS S CD  
3466 C  CE  . LYS E  7   ? 0.2820 0.2754 0.2663 0.0037  -0.0326 0.0469  7   LYS S CE  
3467 N  NZ  . LYS E  7   ? 0.3229 0.3128 0.3206 -0.0001 -0.0376 0.0544  7   LYS S NZ  
3468 N  N   . ALA E  8   ? 0.1927 0.1764 0.1545 0.0112  -0.0365 0.0142  8   ALA S N   
3469 C  CA  . ALA E  8   ? 0.1864 0.1683 0.1453 0.0152  -0.0355 0.0120  8   ALA S CA  
3470 C  C   . ALA E  8   ? 0.1819 0.1707 0.1436 0.0138  -0.0333 0.0123  8   ALA S C   
3471 O  O   . ALA E  8   ? 0.1790 0.1662 0.1382 0.0148  -0.0329 0.0102  8   ALA S O   
3472 C  CB  . ALA E  8   ? 0.1872 0.1681 0.1438 0.0218  -0.0337 0.0136  8   ALA S CB  
3473 N  N   . LEU E  9   ? 0.1847 0.1784 0.1510 0.0116  -0.0341 0.0146  9   LEU S N   
3474 C  CA  . LEU E  9   ? 0.1833 0.1804 0.1531 0.0097  -0.0353 0.0150  9   LEU S CA  
3475 C  C   . LEU E  9   ? 0.1866 0.1813 0.1511 0.0079  -0.0356 0.0112  9   LEU S C   
3476 O  O   . LEU E  9   ? 0.1938 0.1894 0.1590 0.0077  -0.0350 0.0100  9   LEU S O   
3477 C  CB  . LEU E  9   ? 0.1866 0.1851 0.1620 0.0080  -0.0403 0.0180  9   LEU S CB  
3478 C  CG  . LEU E  9   ? 0.1897 0.1934 0.1751 0.0098  -0.0398 0.0241  9   LEU S CG  
3479 C  CD1 . LEU E  9   ? 0.2028 0.2063 0.1969 0.0068  -0.0485 0.0276  9   LEU S CD1 
3480 C  CD2 . LEU E  9   ? 0.1952 0.2057 0.1872 0.0140  -0.0338 0.0290  9   LEU S CD2 
3481 N  N   . ASN E  10  ? 0.1962 0.1892 0.1565 0.0075  -0.0353 0.0108  10  ASN S N   
3482 C  CA  . ASN E  10  ? 0.2030 0.1966 0.1609 0.0075  -0.0338 0.0099  10  ASN S CA  
3483 C  C   . ASN E  10  ? 0.1961 0.1895 0.1580 0.0062  -0.0330 0.0092  10  ASN S C   
3484 O  O   . ASN E  10  ? 0.1872 0.1820 0.1497 0.0060  -0.0324 0.0084  10  ASN S O   
3485 C  CB  . ASN E  10  ? 0.2153 0.2096 0.1695 0.0094  -0.0317 0.0130  10  ASN S CB  
3486 C  CG  . ASN E  10  ? 0.2383 0.2287 0.1814 0.0136  -0.0340 0.0119  10  ASN S CG  
3487 O  OD1 . ASN E  10  ? 0.2497 0.2358 0.1896 0.0139  -0.0391 0.0084  10  ASN S OD1 
3488 N  ND2 . ASN E  10  ? 0.2711 0.2614 0.2079 0.0175  -0.0315 0.0154  10  ASN S ND2 
3489 N  N   . SER E  11  ? 0.1979 0.1876 0.1613 0.0063  -0.0345 0.0094  11  SER S N   
3490 C  CA  . SER E  11  ? 0.2007 0.1851 0.1646 0.0064  -0.0375 0.0076  11  SER S CA  
3491 C  C   . SER E  11  ? 0.2032 0.1869 0.1625 0.0091  -0.0367 0.0046  11  SER S C   
3492 O  O   . SER E  11  ? 0.1961 0.1767 0.1549 0.0089  -0.0390 0.0028  11  SER S O   
3493 C  CB  . SER E  11  ? 0.2096 0.1851 0.1719 0.0080  -0.0421 0.0073  11  SER S CB  
3494 O  OG  . SER E  11  ? 0.2229 0.1882 0.1810 0.0101  -0.0480 0.0040  11  SER S OG  
3495 N  N   . ILE E  12  ? 0.1995 0.1869 0.1577 0.0114  -0.0337 0.0057  12  ILE S N   
3496 C  CA  . ILE E  12  ? 0.2033 0.1929 0.1605 0.0139  -0.0317 0.0061  12  ILE S CA  
3497 C  C   . ILE E  12  ? 0.1967 0.1889 0.1566 0.0102  -0.0325 0.0048  12  ILE S C   
3498 O  O   . ILE E  12  ? 0.2039 0.1946 0.1616 0.0115  -0.0325 0.0036  12  ILE S O   
3499 C  CB  . ILE E  12  ? 0.2045 0.2005 0.1669 0.0162  -0.0287 0.0115  12  ILE S CB  
3500 C  CG1 . ILE E  12  ? 0.2103 0.2034 0.1675 0.0230  -0.0264 0.0130  12  ILE S CG1 
3501 C  CG2 . ILE E  12  ? 0.1948 0.1958 0.1613 0.0177  -0.0264 0.0152  12  ILE S CG2 
3502 C  CD1 . ILE E  12  ? 0.2037 0.2056 0.1699 0.0259  -0.0226 0.0207  12  ILE S CD1 
3503 N  N   . ILE E  13  ? 0.1844 0.1786 0.1464 0.0074  -0.0335 0.0049  13  ILE S N   
3504 C  CA  . ILE E  13  ? 0.1927 0.1874 0.1539 0.0064  -0.0342 0.0032  13  ILE S CA  
3505 C  C   . ILE E  13  ? 0.1943 0.1886 0.1567 0.0060  -0.0338 0.0025  13  ILE S C   
3506 O  O   . ILE E  13  ? 0.1963 0.1905 0.1589 0.0060  -0.0343 0.0011  13  ILE S O   
3507 C  CB  . ILE E  13  ? 0.1948 0.1889 0.1521 0.0074  -0.0351 0.0033  13  ILE S CB  
3508 C  CG1 . ILE E  13  ? 0.2023 0.1938 0.1596 0.0072  -0.0398 0.0038  13  ILE S CG1 
3509 C  CG2 . ILE E  13  ? 0.1988 0.1921 0.1515 0.0099  -0.0347 0.0018  13  ILE S CG2 
3510 C  CD1 . ILE E  13  ? 0.2115 0.1981 0.1605 0.0099  -0.0429 0.0031  13  ILE S CD1 
3511 N  N   A ASP E  14  ? 0.1928 0.1866 0.1582 0.0051  -0.0341 0.0044  14  ASP S N   
3512 N  N   B ASP E  14  ? 0.1922 0.1859 0.1575 0.0051  -0.0341 0.0044  14  ASP S N   
3513 C  CA  A ASP E  14  ? 0.2009 0.1940 0.1729 0.0035  -0.0366 0.0059  14  ASP S CA  
3514 C  CA  B ASP E  14  ? 0.1982 0.1913 0.1702 0.0035  -0.0366 0.0060  14  ASP S CA  
3515 C  C   A ASP E  14  ? 0.1979 0.1839 0.1661 0.0044  -0.0410 0.0022  14  ASP S C   
3516 C  C   B ASP E  14  ? 0.1971 0.1828 0.1658 0.0043  -0.0413 0.0023  14  ASP S C   
3517 O  O   A ASP E  14  ? 0.2041 0.1901 0.1756 0.0036  -0.0431 0.0018  14  ASP S O   
3518 O  O   B ASP E  14  ? 0.2049 0.1900 0.1779 0.0032  -0.0442 0.0024  14  ASP S O   
3519 C  CB  A ASP E  14  ? 0.2090 0.2011 0.1886 0.0014  -0.0391 0.0103  14  ASP S CB  
3520 C  CB  B ASP E  14  ? 0.2052 0.1975 0.1840 0.0016  -0.0386 0.0103  14  ASP S CB  
3521 C  CG  A ASP E  14  ? 0.2294 0.2294 0.2123 0.0020  -0.0337 0.0161  14  ASP S CG  
3522 C  CG  B ASP E  14  ? 0.2202 0.2124 0.2121 -0.0015 -0.0436 0.0148  14  ASP S CG  
3523 O  OD1 A ASP E  14  ? 0.2418 0.2467 0.2201 0.0051  -0.0289 0.0163  14  ASP S OD1 
3524 O  OD1 B ASP E  14  ? 0.2307 0.2308 0.2305 -0.0018 -0.0408 0.0189  14  ASP S OD1 
3525 O  OD2 A ASP E  14  ? 0.2440 0.2437 0.2319 0.0007  -0.0347 0.0204  14  ASP S OD2 
3526 O  OD2 B ASP E  14  ? 0.2489 0.2324 0.2444 -0.0033 -0.0515 0.0153  14  ASP S OD2 
3527 N  N   . VAL E  15  ? 0.1974 0.1770 0.1573 0.0078  -0.0420 -0.0002 15  VAL S N   
3528 C  CA  . VAL E  15  ? 0.2027 0.1733 0.1536 0.0122  -0.0456 -0.0034 15  VAL S CA  
3529 C  C   . VAL E  15  ? 0.2004 0.1753 0.1504 0.0126  -0.0428 -0.0039 15  VAL S C   
3530 O  O   . VAL E  15  ? 0.2000 0.1694 0.1472 0.0137  -0.0470 -0.0060 15  VAL S O   
3531 C  CB  . VAL E  15  ? 0.2057 0.1707 0.1446 0.0197  -0.0437 -0.0042 15  VAL S CB  
3532 C  CG1 . VAL E  15  ? 0.2248 0.1808 0.1497 0.0277  -0.0452 -0.0067 15  VAL S CG1 
3533 C  CG2 . VAL E  15  ? 0.2214 0.1770 0.1574 0.0211  -0.0491 -0.0052 15  VAL S CG2 
3534 N  N   . TYR E  16  ? 0.1921 0.1751 0.1448 0.0118  -0.0374 -0.0019 16  TYR S N   
3535 C  CA  . TYR E  16  ? 0.1866 0.1729 0.1405 0.0115  -0.0362 -0.0016 16  TYR S CA  
3536 C  C   . TYR E  16  ? 0.1835 0.1702 0.1416 0.0086  -0.0388 -0.0033 16  TYR S C   
3537 O  O   . TYR E  16  ? 0.1942 0.1783 0.1504 0.0097  -0.0407 -0.0046 16  TYR S O   
3538 C  CB  . TYR E  16  ? 0.1810 0.1732 0.1401 0.0096  -0.0341 0.0011  16  TYR S CB  
3539 C  CG  . TYR E  16  ? 0.1833 0.1768 0.1448 0.0088  -0.0350 0.0017  16  TYR S CG  
3540 C  CD1 . TYR E  16  ? 0.1900 0.1845 0.1513 0.0115  -0.0333 0.0051  16  TYR S CD1 
3541 C  CD2 . TYR E  16  ? 0.1891 0.1823 0.1518 0.0068  -0.0374 -0.0006 16  TYR S CD2 
3542 C  CE1 . TYR E  16  ? 0.1890 0.1844 0.1545 0.0100  -0.0350 0.0067  16  TYR S CE1 
3543 C  CE2 . TYR E  16  ? 0.1899 0.1819 0.1539 0.0065  -0.0397 -0.0007 16  TYR S CE2 
3544 C  CZ  . TYR E  16  ? 0.1899 0.1831 0.1564 0.0071  -0.0390 0.0029  16  TYR S CZ  
3545 O  OH  . TYR E  16  ? 0.2007 0.1924 0.1701 0.0062  -0.0421 0.0036  16  TYR S OH  
3546 N  N   . HIS E  17  ? 0.1825 0.1728 0.1465 0.0062  -0.0384 -0.0021 17  HIS S N   
3547 C  CA  . HIS E  17  ? 0.1832 0.1776 0.1538 0.0053  -0.0384 -0.0007 17  HIS S CA  
3548 C  C   . HIS E  17  ? 0.1957 0.1872 0.1730 0.0036  -0.0438 0.0004  17  HIS S C   
3549 O  O   . HIS E  17  ? 0.1983 0.1927 0.1821 0.0032  -0.0449 0.0018  17  HIS S O   
3550 C  CB  . HIS E  17  ? 0.1790 0.1795 0.1524 0.0061  -0.0343 0.0027  17  HIS S CB  
3551 C  CG  . HIS E  17  ? 0.1737 0.1733 0.1384 0.0090  -0.0325 0.0006  17  HIS S CG  
3552 N  ND1 . HIS E  17  ? 0.1723 0.1688 0.1326 0.0084  -0.0337 -0.0006 17  HIS S ND1 
3553 C  CD2 . HIS E  17  ? 0.1750 0.1742 0.1344 0.0131  -0.0317 -0.0006 17  HIS S CD2 
3554 C  CE1 . HIS E  17  ? 0.1724 0.1655 0.1266 0.0108  -0.0358 -0.0024 17  HIS S CE1 
3555 N  NE2 . HIS E  17  ? 0.1833 0.1765 0.1348 0.0143  -0.0348 -0.0033 17  HIS S NE2 
3556 N  N   . LYS E  18  ? 0.2104 0.1938 0.1854 0.0034  -0.0491 -0.0006 18  LYS S N   
3557 C  CA  . LYS E  18  ? 0.2341 0.2086 0.2127 0.0025  -0.0590 -0.0010 18  LYS S CA  
3558 C  C   . LYS E  18  ? 0.2256 0.1955 0.1971 0.0049  -0.0615 -0.0046 18  LYS S C   
3559 O  O   . LYS E  18  ? 0.2277 0.1932 0.2060 0.0034  -0.0699 -0.0039 18  LYS S O   
3560 C  CB  . LYS E  18  ? 0.2637 0.2242 0.2334 0.0048  -0.0665 -0.0038 18  LYS S CB  
3561 C  CG  . LYS E  18  ? 0.3038 0.2671 0.2850 0.0009  -0.0677 0.0011  18  LYS S CG  
3562 C  CD  . LYS E  18  ? 0.3578 0.3034 0.3333 0.0026  -0.0798 -0.0015 18  LYS S CD  
3563 C  CE  . LYS E  18  ? 0.4123 0.3430 0.3621 0.0121  -0.0814 -0.0094 18  LYS S CE  
3564 N  NZ  . LYS E  18  ? 0.4577 0.3696 0.3974 0.0164  -0.0921 -0.0125 18  LYS S NZ  
3565 N  N   . TYR E  19  ? 0.2162 0.1867 0.1757 0.0088  -0.0554 -0.0072 19  TYR S N   
3566 C  CA  . TYR E  19  ? 0.2171 0.1835 0.1682 0.0122  -0.0564 -0.0094 19  TYR S CA  
3567 C  C   . TYR E  19  ? 0.2057 0.1819 0.1632 0.0101  -0.0511 -0.0080 19  TYR S C   
3568 O  O   . TYR E  19  ? 0.2053 0.1803 0.1641 0.0102  -0.0540 -0.0087 19  TYR S O   
3569 C  CB  . TYR E  19  ? 0.2277 0.1878 0.1620 0.0197  -0.0534 -0.0106 19  TYR S CB  
3570 C  CG  . TYR E  19  ? 0.2427 0.1894 0.1666 0.0242  -0.0601 -0.0133 19  TYR S CG  
3571 C  CD1 . TYR E  19  ? 0.2696 0.1993 0.1819 0.0290  -0.0714 -0.0175 19  TYR S CD1 
3572 C  CD2 . TYR E  19  ? 0.2520 0.2000 0.1771 0.0239  -0.0578 -0.0123 19  TYR S CD2 
3573 C  CE1 . TYR E  19  ? 0.2955 0.2082 0.1966 0.0338  -0.0811 -0.0210 19  TYR S CE1 
3574 C  CE2 . TYR E  19  ? 0.2574 0.1906 0.1728 0.0283  -0.0660 -0.0153 19  TYR S CE2 
3575 C  CZ  . TYR E  19  ? 0.2861 0.2005 0.1885 0.0336  -0.0781 -0.0200 19  TYR S CZ  
3576 O  OH  . TYR E  19  ? 0.3358 0.2319 0.2272 0.0385  -0.0887 -0.0236 19  TYR S OH  
3577 N  N   . SER E  20  ? 0.1906 0.1744 0.1516 0.0086  -0.0453 -0.0064 20  SER S N   
3578 C  CA  . SER E  20  ? 0.1883 0.1768 0.1517 0.0082  -0.0428 -0.0062 20  SER S CA  
3579 C  C   . SER E  20  ? 0.1907 0.1840 0.1622 0.0078  -0.0430 -0.0050 20  SER S C   
3580 O  O   . SER E  20  ? 0.1943 0.1887 0.1658 0.0092  -0.0425 -0.0056 20  SER S O   
3581 C  CB  . SER E  20  ? 0.1853 0.1764 0.1478 0.0080  -0.0399 -0.0054 20  SER S CB  
3582 O  OG  . SER E  20  ? 0.1827 0.1769 0.1472 0.0081  -0.0381 -0.0046 20  SER S OG  
3583 N  N   . LEU E  21  ? 0.1778 0.1747 0.1577 0.0065  -0.0431 -0.0017 21  LEU S N   
3584 C  CA  . LEU E  21  ? 0.1809 0.1859 0.1731 0.0071  -0.0417 0.0034  21  LEU S CA  
3585 C  C   . LEU E  21  ? 0.1839 0.1876 0.1864 0.0049  -0.0485 0.0052  21  LEU S C   
3586 O  O   . LEU E  21  ? 0.1946 0.2073 0.2123 0.0052  -0.0475 0.0119  21  LEU S O   
3587 C  CB  . LEU E  21  ? 0.1786 0.1912 0.1789 0.0074  -0.0374 0.0097  21  LEU S CB  
3588 C  CG  . LEU E  21  ? 0.1836 0.1961 0.1722 0.0109  -0.0319 0.0080  21  LEU S CG  
3589 C  CD1 . LEU E  21  ? 0.1811 0.2012 0.1774 0.0121  -0.0273 0.0156  21  LEU S CD1 
3590 C  CD2 . LEU E  21  ? 0.1905 0.2024 0.1692 0.0172  -0.0286 0.0054  21  LEU S CD2 
3591 N  N   . ILE E  22  ? 0.1864 0.1790 0.1805 0.0040  -0.0554 0.0003  22  ILE S N   
3592 C  CA  . ILE E  22  ? 0.1947 0.1826 0.1955 0.0028  -0.0645 0.0008  22  ILE S CA  
3593 C  C   . ILE E  22  ? 0.1890 0.1835 0.1952 0.0042  -0.0619 0.0023  22  ILE S C   
3594 O  O   . ILE E  22  ? 0.1986 0.1991 0.2225 0.0027  -0.0656 0.0082  22  ILE S O   
3595 C  CB  . ILE E  22  ? 0.2048 0.1766 0.1890 0.0050  -0.0723 -0.0054 22  ILE S CB  
3596 C  CG1 . ILE E  22  ? 0.2191 0.1823 0.1985 0.0050  -0.0770 -0.0064 22  ILE S CG1 
3597 C  CG2 . ILE E  22  ? 0.2171 0.1797 0.2040 0.0049  -0.0846 -0.0061 22  ILE S CG2 
3598 C  CD1 . ILE E  22  ? 0.2375 0.1851 0.1930 0.0118  -0.0803 -0.0126 22  ILE S CD1 
3599 N  N   . LYS E  23  ? 0.1817 0.1753 0.1755 0.0071  -0.0568 -0.0019 23  LYS S N   
3600 C  CA  . LYS E  23  ? 0.1823 0.1794 0.1786 0.0094  -0.0554 -0.0016 23  LYS S CA  
3601 C  C   . LYS E  23  ? 0.1795 0.1751 0.1643 0.0122  -0.0505 -0.0051 23  LYS S C   
3602 O  O   . LYS E  23  ? 0.1841 0.1754 0.1596 0.0116  -0.0493 -0.0073 23  LYS S O   
3603 C  CB  . LYS E  23  ? 0.1875 0.1764 0.1820 0.0087  -0.0640 -0.0036 23  LYS S CB  
3604 C  CG  . LYS E  23  ? 0.2035 0.1811 0.1797 0.0105  -0.0659 -0.0085 23  LYS S CG  
3605 C  CD  . LYS E  23  ? 0.2195 0.1874 0.1897 0.0124  -0.0741 -0.0104 23  LYS S CD  
3606 C  CE  . LYS E  23  ? 0.2336 0.1917 0.1833 0.0175  -0.0733 -0.0129 23  LYS S CE  
3607 N  NZ  . LYS E  23  ? 0.2505 0.1992 0.1889 0.0205  -0.0764 -0.0147 23  LYS S NZ  
3608 N  N   . GLY E  24  ? 0.1779 0.1764 0.1644 0.0157  -0.0488 -0.0047 24  GLY S N   
3609 C  CA  . GLY E  24  ? 0.1838 0.1767 0.1596 0.0182  -0.0482 -0.0083 24  GLY S CA  
3610 C  C   . GLY E  24  ? 0.1939 0.1857 0.1630 0.0203  -0.0453 -0.0094 24  GLY S C   
3611 O  O   . GLY E  24  ? 0.2071 0.2046 0.1780 0.0235  -0.0407 -0.0068 24  GLY S O   
3612 N  N   . ASN E  25  ? 0.1895 0.1738 0.1517 0.0189  -0.0486 -0.0117 25  ASN S N   
3613 C  CA  . ASN E  25  ? 0.1969 0.1768 0.1523 0.0207  -0.0492 -0.0132 25  ASN S CA  
3614 C  C   . ASN E  25  ? 0.1897 0.1751 0.1476 0.0183  -0.0453 -0.0112 25  ASN S C   
3615 O  O   . ASN E  25  ? 0.1818 0.1695 0.1439 0.0138  -0.0449 -0.0096 25  ASN S O   
3616 C  CB  . ASN E  25  ? 0.2048 0.1761 0.1589 0.0179  -0.0561 -0.0137 25  ASN S CB  
3617 C  CG  . ASN E  25  ? 0.2157 0.1801 0.1651 0.0184  -0.0607 -0.0147 25  ASN S CG  
3618 O  OD1 . ASN E  25  ? 0.2278 0.1962 0.1796 0.0156  -0.0583 -0.0128 25  ASN S OD1 
3619 N  ND2 . ASN E  25  ? 0.2250 0.1765 0.1686 0.0212  -0.0701 -0.0174 25  ASN S ND2 
3620 N  N   A PHE E  26  ? 0.1937 0.1794 0.1462 0.0229  -0.0427 -0.0113 26  PHE S N   
3621 N  N   B PHE E  26  ? 0.1923 0.1782 0.1450 0.0229  -0.0426 -0.0113 26  PHE S N   
3622 C  CA  A PHE E  26  ? 0.1917 0.1824 0.1465 0.0213  -0.0390 -0.0089 26  PHE S CA  
3623 C  CA  B PHE E  26  ? 0.1902 0.1814 0.1456 0.0211  -0.0388 -0.0087 26  PHE S CA  
3624 C  C   A PHE E  26  ? 0.1873 0.1749 0.1420 0.0161  -0.0417 -0.0093 26  PHE S C   
3625 C  C   B PHE E  26  ? 0.1864 0.1740 0.1410 0.0162  -0.0417 -0.0093 26  PHE S C   
3626 O  O   A PHE E  26  ? 0.1846 0.1762 0.1427 0.0138  -0.0391 -0.0073 26  PHE S O   
3627 O  O   B PHE E  26  ? 0.1842 0.1756 0.1418 0.0139  -0.0391 -0.0074 26  PHE S O   
3628 C  CB  A PHE E  26  ? 0.2019 0.1917 0.1472 0.0296  -0.0357 -0.0086 26  PHE S CB  
3629 C  CB  B PHE E  26  ? 0.1974 0.1911 0.1465 0.0293  -0.0337 -0.0068 26  PHE S CB  
3630 C  CG  A PHE E  26  ? 0.2098 0.2058 0.1558 0.0376  -0.0301 -0.0052 26  PHE S CG  
3631 C  CG  B PHE E  26  ? 0.2166 0.1988 0.1485 0.0381  -0.0371 -0.0113 26  PHE S CG  
3632 C  CD1 A PHE E  26  ? 0.2031 0.2110 0.1660 0.0344  -0.0263 0.0009  26  PHE S CD1 
3633 C  CD1 B PHE E  26  ? 0.2258 0.1961 0.1496 0.0363  -0.0454 -0.0156 26  PHE S CD1 
3634 C  CD2 A PHE E  26  ? 0.2289 0.2182 0.1588 0.0496  -0.0291 -0.0073 26  PHE S CD2 
3635 C  CD2 B PHE E  26  ? 0.2346 0.2169 0.1585 0.0492  -0.0332 -0.0106 26  PHE S CD2 
3636 C  CE1 A PHE E  26  ? 0.2065 0.2236 0.1752 0.0420  -0.0201 0.0072  26  PHE S CE1 
3637 C  CE1 B PHE E  26  ? 0.2480 0.2025 0.1539 0.0451  -0.0529 -0.0207 26  PHE S CE1 
3638 C  CE2 A PHE E  26  ? 0.2341 0.2315 0.1650 0.0596  -0.0215 -0.0021 26  PHE S CE2 
3639 C  CE2 B PHE E  26  ? 0.2575 0.2246 0.1602 0.0600  -0.0383 -0.0161 26  PHE S CE2 
3640 C  CZ  A PHE E  26  ? 0.2231 0.2364 0.1759 0.0552  -0.0162 0.0062  26  PHE S CZ  
3641 C  CZ  B PHE E  26  ? 0.2612 0.2126 0.1542 0.0576  -0.0496 -0.0219 26  PHE S CZ  
3642 N  N   . HIS E  27  ? 0.1940 0.1748 0.1467 0.0147  -0.0474 -0.0106 27  HIS S N   
3643 C  CA  . HIS E  27  ? 0.1923 0.1726 0.1496 0.0103  -0.0497 -0.0079 27  HIS S CA  
3644 C  C   . HIS E  27  ? 0.1989 0.1805 0.1629 0.0074  -0.0507 -0.0044 27  HIS S C   
3645 O  O   . HIS E  27  ? 0.2148 0.1946 0.1851 0.0051  -0.0551 -0.0004 27  HIS S O   
3646 C  CB  . HIS E  27  ? 0.2053 0.1774 0.1584 0.0114  -0.0567 -0.0091 27  HIS S CB  
3647 C  CG  . HIS E  27  ? 0.2107 0.1813 0.1539 0.0163  -0.0544 -0.0116 27  HIS S CG  
3648 N  ND1 . HIS E  27  ? 0.2349 0.1941 0.1652 0.0226  -0.0605 -0.0154 27  HIS S ND1 
3649 C  CD2 . HIS E  27  ? 0.2037 0.1819 0.1475 0.0166  -0.0471 -0.0099 27  HIS S CD2 
3650 C  CE1 . HIS E  27  ? 0.2424 0.2033 0.1641 0.0278  -0.0555 -0.0155 27  HIS S CE1 
3651 N  NE2 . HIS E  27  ? 0.2223 0.1958 0.1543 0.0233  -0.0472 -0.0115 27  HIS S NE2 
3652 N  N   . ALA E  28  ? 0.1874 0.1717 0.1507 0.0082  -0.0474 -0.0050 28  ALA S N   
3653 C  CA  . ALA E  28  ? 0.1935 0.1789 0.1590 0.0079  -0.0467 -0.0016 28  ALA S CA  
3654 C  C   . ALA E  28  ? 0.2029 0.1892 0.1635 0.0099  -0.0433 -0.0022 28  ALA S C   
3655 O  O   . ALA E  28  ? 0.2067 0.1920 0.1661 0.0103  -0.0444 -0.0056 28  ALA S O   
3656 C  CB  . ALA E  28  ? 0.1918 0.1738 0.1572 0.0085  -0.0500 -0.0030 28  ALA S CB  
3657 N  N   . VAL E  29  ? 0.2022 0.1897 0.1607 0.0122  -0.0402 0.0020  29  VAL S N   
3658 C  CA  . VAL E  29  ? 0.2093 0.1925 0.1575 0.0172  -0.0392 0.0011  29  VAL S CA  
3659 C  C   . VAL E  29  ? 0.2135 0.1958 0.1580 0.0211  -0.0380 0.0052  29  VAL S C   
3660 O  O   . VAL E  29  ? 0.2195 0.2071 0.1681 0.0231  -0.0336 0.0132  29  VAL S O   
3661 C  CB  . VAL E  29  ? 0.2126 0.1961 0.1562 0.0209  -0.0356 0.0033  29  VAL S CB  
3662 C  CG1 . VAL E  29  ? 0.2224 0.1970 0.1494 0.0299  -0.0356 0.0022  29  VAL S CG1 
3663 C  CG2 . VAL E  29  ? 0.2032 0.1873 0.1510 0.0165  -0.0373 -0.0004 29  VAL S CG2 
3664 N  N   . TYR E  30  ? 0.2232 0.1995 0.1618 0.0224  -0.0420 0.0011  30  TYR S N   
3665 C  CA  . TYR E  30  ? 0.2271 0.2017 0.1606 0.0267  -0.0412 0.0048  30  TYR S CA  
3666 C  C   . TYR E  30  ? 0.2471 0.2160 0.1633 0.0373  -0.0378 0.0074  30  TYR S C   
3667 O  O   . TYR E  30  ? 0.2554 0.2201 0.1636 0.0409  -0.0377 0.0049  30  TYR S O   
3668 C  CB  . TYR E  30  ? 0.2247 0.1942 0.1580 0.0247  -0.0478 -0.0007 30  TYR S CB  
3669 C  CG  . TYR E  30  ? 0.2040 0.1787 0.1507 0.0180  -0.0494 -0.0024 30  TYR S CG  
3670 C  CD1 . TYR E  30  ? 0.2062 0.1836 0.1597 0.0160  -0.0491 0.0014  30  TYR S CD1 
3671 C  CD2 . TYR E  30  ? 0.2018 0.1781 0.1540 0.0150  -0.0514 -0.0066 30  TYR S CD2 
3672 C  CE1 . TYR E  30  ? 0.2012 0.1790 0.1617 0.0127  -0.0520 -0.0014 30  TYR S CE1 
3673 C  CE2 . TYR E  30  ? 0.1886 0.1686 0.1483 0.0127  -0.0515 -0.0077 30  TYR S CE2 
3674 C  CZ  . TYR E  30  ? 0.1947 0.1737 0.1561 0.0124  -0.0524 -0.0063 30  TYR S CZ  
3675 O  OH  . TYR E  30  ? 0.1971 0.1756 0.1604 0.0131  -0.0538 -0.0090 30  TYR S OH  
3676 N  N   . ARG E  31  ? 0.2671 0.2351 0.1758 0.0440  -0.0348 0.0130  31  ARG S N   
3677 C  CA  . ARG E  31  ? 0.3027 0.2651 0.1909 0.0582  -0.0296 0.0173  31  ARG S CA  
3678 C  C   . ARG E  31  ? 0.3174 0.2615 0.1835 0.0648  -0.0382 0.0066  31  ARG S C   
3679 O  O   . ARG E  31  ? 0.3299 0.2675 0.1802 0.0746  -0.0360 0.0064  31  ARG S O   
3680 C  CB  . ARG E  31  ? 0.3280 0.2911 0.2098 0.0653  -0.0256 0.0252  31  ARG S CB  
3681 C  CG  . ARG E  31  ? 0.3827 0.3406 0.2394 0.0841  -0.0176 0.0320  31  ARG S CG  
3682 C  CD  . ARG E  31  ? 0.4327 0.3898 0.2818 0.0912  -0.0148 0.0391  31  ARG S CD  
3683 N  NE  . ARG E  31  ? 0.4463 0.4220 0.3222 0.0841  -0.0076 0.0537  31  ARG S NE  
3684 C  CZ  . ARG E  31  ? 0.4870 0.4779 0.3728 0.0908  0.0053  0.0720  31  ARG S CZ  
3685 N  NH1 . ARG E  31  ? 0.5031 0.4946 0.3720 0.1066  0.0153  0.0781  31  ARG S NH1 
3686 N  NH2 . ARG E  31  ? 0.5085 0.5143 0.4234 0.0818  0.0076  0.0856  31  ARG S NH2 
3687 N  N   . ASP E  32  ? 0.2588 0.2212 0.1905 0.0315  -0.0638 -0.0032 32  ASP S N   
3688 C  CA  . ASP E  32  ? 0.2697 0.2270 0.2076 0.0320  -0.0814 -0.0048 32  ASP S CA  
3689 C  C   . ASP E  32  ? 0.2605 0.2282 0.2148 0.0271  -0.0781 -0.0059 32  ASP S C   
3690 O  O   . ASP E  32  ? 0.2755 0.2357 0.2241 0.0276  -0.0884 -0.0095 32  ASP S O   
3691 C  CB  . ASP E  32  ? 0.2742 0.2315 0.2358 0.0330  -0.0956 -0.0016 32  ASP S CB  
3692 C  CG  . ASP E  32  ? 0.2528 0.2275 0.2498 0.0291  -0.0838 0.0044  32  ASP S CG  
3693 O  OD1 . ASP E  32  ? 0.2429 0.2271 0.2415 0.0267  -0.0661 0.0052  32  ASP S OD1 
3694 O  OD2 . ASP E  32  ? 0.2672 0.2433 0.2891 0.0302  -0.0937 0.0081  32  ASP S OD2 
3695 N  N   . ASP E  33  ? 0.2389 0.2204 0.2107 0.0241  -0.0643 -0.0028 33  ASP S N   
3696 C  CA  . ASP E  33  ? 0.2295 0.2180 0.2096 0.0223  -0.0573 -0.0023 33  ASP S CA  
3697 C  C   . ASP E  33  ? 0.2340 0.2187 0.1899 0.0227  -0.0553 -0.0079 33  ASP S C   
3698 O  O   . ASP E  33  ? 0.2306 0.2147 0.1886 0.0221  -0.0576 -0.0086 33  ASP S O   
3699 C  CB  . ASP E  33  ? 0.2258 0.2224 0.2138 0.0236  -0.0415 0.0012  33  ASP S CB  
3700 C  CG  . ASP E  33  ? 0.2284 0.2288 0.2413 0.0248  -0.0378 0.0081  33  ASP S CG  
3701 O  OD1 . ASP E  33  ? 0.2515 0.2534 0.2928 0.0233  -0.0458 0.0129  33  ASP S OD1 
3702 O  OD2 . ASP E  33  ? 0.2108 0.2119 0.2180 0.0277  -0.0273 0.0085  33  ASP S OD2 
3703 N  N   . LEU E  34  ? 0.2411 0.2231 0.1790 0.0240  -0.0502 -0.0109 34  LEU S N   
3704 C  CA  . LEU E  34  ? 0.2526 0.2324 0.1755 0.0250  -0.0465 -0.0147 34  LEU S CA  
3705 C  C   . LEU E  34  ? 0.2668 0.2332 0.1738 0.0278  -0.0554 -0.0165 34  LEU S C   
3706 O  O   . LEU E  34  ? 0.2578 0.2231 0.1594 0.0284  -0.0545 -0.0189 34  LEU S O   
3707 C  CB  . LEU E  34  ? 0.2542 0.2338 0.1714 0.0259  -0.0373 -0.0159 34  LEU S CB  
3708 C  CG  . LEU E  34  ? 0.2494 0.2304 0.1637 0.0267  -0.0318 -0.0189 34  LEU S CG  
3709 C  CD1 . LEU E  34  ? 0.2555 0.2468 0.1797 0.0253  -0.0325 -0.0223 34  LEU S CD1 
3710 C  CD2 . LEU E  34  ? 0.2648 0.2432 0.1820 0.0280  -0.0214 -0.0177 34  LEU S CD2 
3711 N  N   . LYS E  35  ? 0.2985 0.2521 0.1952 0.0312  -0.0652 -0.0161 35  LYS S N   
3712 C  CA  . LYS E  35  ? 0.3299 0.2649 0.2060 0.0364  -0.0777 -0.0198 35  LYS S CA  
3713 C  C   . LYS E  35  ? 0.3265 0.2654 0.2226 0.0322  -0.0877 -0.0218 35  LYS S C   
3714 O  O   . LYS E  35  ? 0.3360 0.2653 0.2188 0.0346  -0.0909 -0.0257 35  LYS S O   
3715 C  CB  . LYS E  35  ? 0.3740 0.2906 0.2325 0.0431  -0.0915 -0.0202 35  LYS S CB  
3716 C  CG  . LYS E  35  ? 0.4441 0.3349 0.2750 0.0512  -0.1097 -0.0264 35  LYS S CG  
3717 C  CD  . LYS E  35  ? 0.5156 0.3832 0.3198 0.0614  -0.1247 -0.0272 35  LYS S CD  
3718 C  CE  . LYS E  35  ? 0.6141 0.4453 0.3695 0.0757  -0.1402 -0.0344 35  LYS S CE  
3719 N  NZ  . LYS E  35  ? 0.6719 0.4949 0.4418 0.0738  -0.1685 -0.0436 35  LYS S NZ  
3720 N  N   . LYS E  36  ? 0.2948 0.2468 0.2250 0.0267  -0.0900 -0.0179 36  LYS S N   
3721 C  CA  . LYS E  36  ? 0.3024 0.2582 0.2594 0.0229  -0.0952 -0.0168 36  LYS S CA  
3722 C  C   . LYS E  36  ? 0.2692 0.2329 0.2235 0.0219  -0.0807 -0.0156 36  LYS S C   
3723 O  O   . LYS E  36  ? 0.2733 0.2320 0.2323 0.0214  -0.0852 -0.0169 36  LYS S O   
3724 C  CB  . LYS E  36  ? 0.3176 0.2852 0.3146 0.0191  -0.0941 -0.0096 36  LYS S CB  
3725 C  CG  . LYS E  36  ? 0.3943 0.3551 0.4094 0.0195  -0.1142 -0.0105 36  LYS S CG  
3726 C  CD  . LYS E  36  ? 0.4429 0.4147 0.5156 0.0149  -0.1150 -0.0026 36  LYS S CD  
3727 C  CE  . LYS E  36  ? 0.4518 0.4340 0.5410 0.0129  -0.0933 0.0052  36  LYS S CE  
3728 N  NZ  . LYS E  36  ? 0.5258 0.5155 0.6750 0.0101  -0.0907 0.0155  36  LYS S NZ  
3729 N  N   . LEU E  37  ? 0.2413 0.2145 0.1864 0.0226  -0.0662 -0.0142 37  LEU S N   
3730 C  CA  . LEU E  37  ? 0.2491 0.2282 0.1891 0.0237  -0.0559 -0.0141 37  LEU S CA  
3731 C  C   . LEU E  37  ? 0.2581 0.2285 0.1783 0.0260  -0.0588 -0.0194 37  LEU S C   
3732 O  O   . LEU E  37  ? 0.2596 0.2279 0.1810 0.0267  -0.0592 -0.0197 37  LEU S O   
3733 C  CB  . LEU E  37  ? 0.2395 0.2271 0.1744 0.0250  -0.0455 -0.0142 37  LEU S CB  
3734 C  CG  . LEU E  37  ? 0.2463 0.2378 0.1742 0.0282  -0.0396 -0.0158 37  LEU S CG  
3735 C  CD1 . LEU E  37  ? 0.2438 0.2389 0.1693 0.0313  -0.0342 -0.0164 37  LEU S CD1 
3736 C  CD2 . LEU E  37  ? 0.2441 0.2347 0.1621 0.0291  -0.0408 -0.0210 37  LEU S CD2 
3737 N  N   . LEU E  38  ? 0.2819 0.2445 0.1837 0.0287  -0.0591 -0.0223 38  LEU S N   
3738 C  CA  . LEU E  38  ? 0.2981 0.2508 0.1803 0.0333  -0.0566 -0.0256 38  LEU S CA  
3739 C  C   . LEU E  38  ? 0.3344 0.2714 0.2085 0.0355  -0.0688 -0.0289 38  LEU S C   
3740 O  O   . LEU E  38  ? 0.3341 0.2660 0.2012 0.0381  -0.0670 -0.0310 38  LEU S O   
3741 C  CB  . LEU E  38  ? 0.3199 0.2625 0.1823 0.0386  -0.0501 -0.0253 38  LEU S CB  
3742 C  CG  . LEU E  38  ? 0.3113 0.2678 0.1869 0.0365  -0.0371 -0.0229 38  LEU S CG  
3743 C  CD1 . LEU E  38  ? 0.3336 0.2808 0.1981 0.0407  -0.0290 -0.0196 38  LEU S CD1 
3744 C  CD2 . LEU E  38  ? 0.3543 0.3187 0.2391 0.0373  -0.0289 -0.0240 38  LEU S CD2 
3745 N  N   . GLU E  39  ? 0.3398 0.2663 0.2149 0.0354  -0.0836 -0.0304 39  GLU S N   
3746 C  CA  . GLU E  39  ? 0.3938 0.3019 0.2646 0.0376  -0.1012 -0.0358 39  GLU S CA  
3747 C  C   . GLU E  39  ? 0.3607 0.2767 0.2605 0.0321  -0.1025 -0.0342 39  GLU S C   
3748 O  O   . GLU E  39  ? 0.3841 0.2851 0.2766 0.0346  -0.1112 -0.0393 39  GLU S O   
3749 C  CB  . GLU E  39  ? 0.4340 0.3312 0.3102 0.0382  -0.1215 -0.0383 39  GLU S CB  
3750 C  CG  . GLU E  39  ? 0.5148 0.3935 0.3512 0.0478  -0.1239 -0.0407 39  GLU S CG  
3751 C  CD  . GLU E  39  ? 0.6013 0.4659 0.4402 0.0504  -0.1489 -0.0444 39  GLU S CD  
3752 O  OE1 . GLU E  39  ? 0.6727 0.5498 0.5572 0.0421  -0.1608 -0.0432 39  GLU S OE1 
3753 O  OE2 . GLU E  39  ? 0.6924 0.5325 0.4891 0.0621  -0.1555 -0.0475 39  GLU S OE2 
3754 N  N   . THR E  40  ? 0.3178 0.2539 0.2468 0.0263  -0.0922 -0.0267 40  THR S N   
3755 C  CA  . THR E  40  ? 0.3107 0.2518 0.2667 0.0231  -0.0894 -0.0220 40  THR S CA  
3756 C  C   . THR E  40  ? 0.3020 0.2492 0.2461 0.0258  -0.0749 -0.0200 40  THR S C   
3757 O  O   . THR E  40  ? 0.3084 0.2511 0.2600 0.0262  -0.0746 -0.0188 40  THR S O   
3758 C  CB  . THR E  40  ? 0.3124 0.2674 0.3026 0.0192  -0.0821 -0.0126 40  THR S CB  
3759 O  OG1 . THR E  40  ? 0.3307 0.2817 0.3379 0.0168  -0.0973 -0.0143 40  THR S OG1 
3760 C  CG2 . THR E  40  ? 0.3038 0.2607 0.3254 0.0176  -0.0755 -0.0045 40  THR S CG2 
3761 N  N   . GLU E  41  ? 0.2805 0.2370 0.2088 0.0279  -0.0647 -0.0200 41  GLU S N   
3762 C  CA  . GLU E  41  ? 0.2731 0.2375 0.1963 0.0311  -0.0540 -0.0179 41  GLU S CA  
3763 C  C   . GLU E  41  ? 0.2794 0.2407 0.1846 0.0349  -0.0524 -0.0232 41  GLU S C   
3764 O  O   . GLU E  41  ? 0.2701 0.2352 0.1742 0.0382  -0.0479 -0.0225 41  GLU S O   
3765 C  CB  . GLU E  41  ? 0.2692 0.2454 0.1931 0.0324  -0.0456 -0.0148 41  GLU S CB  
3766 C  CG  . GLU E  41  ? 0.2701 0.2488 0.2109 0.0312  -0.0415 -0.0075 41  GLU S CG  
3767 C  CD  . GLU E  41  ? 0.2811 0.2561 0.2358 0.0334  -0.0351 0.0008  41  GLU S CD  
3768 O  OE1 . GLU E  41  ? 0.2855 0.2569 0.2311 0.0374  -0.0329 0.0012  41  GLU S OE1 
3769 O  OE2 . GLU E  41  ? 0.2977 0.2733 0.2746 0.0323  -0.0301 0.0086  41  GLU S OE2 
3770 N  N   . SER E  42  ? 0.2897 0.2426 0.1805 0.0363  -0.0546 -0.0274 42  SER S N   
3771 C  CA  A SER E  42  ? 0.3000 0.2509 0.1787 0.0414  -0.0470 -0.0296 42  SER S CA  
3772 C  CA  B SER E  42  ? 0.2980 0.2489 0.1764 0.0414  -0.0469 -0.0296 42  SER S CA  
3773 C  C   . SER E  42  ? 0.3290 0.2590 0.1870 0.0472  -0.0498 -0.0333 42  SER S C   
3774 O  O   . SER E  42  ? 0.3502 0.2636 0.1957 0.0482  -0.0606 -0.0364 42  SER S O   
3775 C  CB  A SER E  42  ? 0.3023 0.2592 0.1807 0.0417  -0.0396 -0.0290 42  SER S CB  
3776 C  CB  B SER E  42  ? 0.2956 0.2507 0.1720 0.0416  -0.0403 -0.0290 42  SER S CB  
3777 O  OG  A SER E  42  ? 0.3238 0.2654 0.1836 0.0446  -0.0409 -0.0296 42  SER S OG  
3778 O  OG  B SER E  42  ? 0.2760 0.2480 0.1696 0.0379  -0.0383 -0.0277 42  SER S OG  
3779 N  N   . PRO E  43  ? 0.3417 0.2702 0.1957 0.0525  -0.0414 -0.0336 43  PRO S N   
3780 C  CA  . PRO E  43  ? 0.3865 0.2917 0.2162 0.0605  -0.0415 -0.0371 43  PRO S CA  
3781 C  C   . PRO E  43  ? 0.4273 0.3141 0.2286 0.0686  -0.0354 -0.0376 43  PRO S C   
3782 O  O   . PRO E  43  ? 0.4045 0.3007 0.2115 0.0674  -0.0268 -0.0336 43  PRO S O   
3783 C  CB  . PRO E  43  ? 0.3814 0.2942 0.2210 0.0643  -0.0311 -0.0353 43  PRO S CB  
3784 C  CG  . PRO E  43  ? 0.3615 0.2975 0.2249 0.0608  -0.0239 -0.0316 43  PRO S CG  
3785 C  CD  . PRO E  43  ? 0.3349 0.2815 0.2073 0.05