data_4GKH
# 
_entry.id   4GKH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GKH         
RCSB  RCSB074296   
WWPDB D_1000074296 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         4EJ7     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, ATP-bound
;
unspecified 
PDB         4FEU     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor anthrapyrazolone SP600125
;
unspecified 
PDB         4FEV     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor pyrazolopyrimidine PP1
;
unspecified 
PDB         4FEW     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor pyrazolopyrimidine PP2
;
unspecified 
PDB         4FEX     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor tyrphostin AG1478
;
unspecified 
PDB         4GKI     . unspecified 
TargetTrack IDP91191 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4GKH 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stogios, P.J.'                                                 1  
'Evdokimova, E.'                                                2  
'Wawrzak, Z.'                                                   3  
'Minasov, G.'                                                   4  
'Egorova, O.'                                                   5  
'Di Leo, R.'                                                    6  
'Shakya, T.'                                                    7  
'Spanogiannopoulos, P.'                                         8  
'Todorovic, N.'                                                 9  
'Capretta, A.'                                                  10 
'Wright, G.D.'                                                  11 
'Savchenko, A.'                                                 12 
'Anderson, W.F.'                                                13 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 14 
# 
_citation.id                        primary 
_citation.title                     
'Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.' 
_citation.journal_abbrev            Biochem.J. 
_citation.journal_volume            454 
_citation.page_first                191 
_citation.page_last                 200 
_citation.year                      2013 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0264-6021 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23758273 
_citation.pdbx_database_id_DOI      10.1042/BJ20130317 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stogios, P.J.'         1 
primary 'Spanogiannopoulos, P.' 2 
primary 'Evdokimova, E.'        3 
primary 'Egorova, O.'           4 
primary 'Shakya, T.'            5 
primary 'Todorovic, N.'         6 
primary 'Capretta, A.'          7 
primary 'Wright, G.D.'          8 
primary 'Savchenko, A.'         9 
# 
_cell.entry_id           4GKH 
_cell.length_a           97.185 
_cell.length_b           97.298 
_cell.length_c           112.738 
_cell.angle_alpha        102.97 
_cell.angle_beta         106.21 
_cell.angle_gamma        112.66 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4GKH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;Aminoglycoside 3'-phosphotransferase AphA1-IAB
;
31350.404 12   2.7.1.95 ? ? ? 
2 non-polymer syn 'KANAMYCIN A'                                                          484.499   12   ?        ? ? ? 
3 non-polymer syn '1-tert-butyl-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine' 317.388   12   ?        ? ? ? 
4 non-polymer syn 'SODIUM ION'                                                           22.990    14   ?        ? ? ? 
5 non-polymer syn 'ACETATE ION'                                                          59.044    36   ?        ? ? ? 
6 non-polymer syn 'CHLORIDE ION'                                                         35.453    2    ?        ? ? ? 
7 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                106.120   3    ?        ? ? ? 
8 water       nat water                                                                  18.015    2870 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;G(MSE)SHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDE(MSE)VR
LNWLTAF(MSE)PLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVF
RLAQAQSR(MSE)NNGLVDASDFDDERNGWPVEQVWKE(MSE)HKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGR
VGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPD(MSE)NKLQFHL(MSE)LDEFF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFM
PLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNG
LVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEF
SPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         IDP91191 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MSE n 
1 3   SER n 
1 4   HIS n 
1 5   ILE n 
1 6   GLN n 
1 7   ARG n 
1 8   GLU n 
1 9   THR n 
1 10  SER n 
1 11  CYS n 
1 12  SER n 
1 13  ARG n 
1 14  PRO n 
1 15  ARG n 
1 16  LEU n 
1 17  ASN n 
1 18  SER n 
1 19  ASN n 
1 20  LEU n 
1 21  ASP n 
1 22  ALA n 
1 23  ASP n 
1 24  LEU n 
1 25  TYR n 
1 26  GLY n 
1 27  TYR n 
1 28  ARG n 
1 29  TRP n 
1 30  ALA n 
1 31  ARG n 
1 32  ASP n 
1 33  ASN n 
1 34  VAL n 
1 35  GLY n 
1 36  GLN n 
1 37  SER n 
1 38  GLY n 
1 39  ALA n 
1 40  THR n 
1 41  ILE n 
1 42  TYR n 
1 43  ARG n 
1 44  LEU n 
1 45  TYR n 
1 46  GLY n 
1 47  LYS n 
1 48  PRO n 
1 49  ASN n 
1 50  ALA n 
1 51  PRO n 
1 52  GLU n 
1 53  LEU n 
1 54  PHE n 
1 55  LEU n 
1 56  LYS n 
1 57  HIS n 
1 58  GLY n 
1 59  LYS n 
1 60  GLY n 
1 61  SER n 
1 62  VAL n 
1 63  ALA n 
1 64  ASN n 
1 65  ASP n 
1 66  VAL n 
1 67  THR n 
1 68  ASP n 
1 69  GLU n 
1 70  MSE n 
1 71  VAL n 
1 72  ARG n 
1 73  LEU n 
1 74  ASN n 
1 75  TRP n 
1 76  LEU n 
1 77  THR n 
1 78  ALA n 
1 79  PHE n 
1 80  MSE n 
1 81  PRO n 
1 82  LEU n 
1 83  PRO n 
1 84  THR n 
1 85  ILE n 
1 86  LYS n 
1 87  HIS n 
1 88  PHE n 
1 89  ILE n 
1 90  ARG n 
1 91  THR n 
1 92  PRO n 
1 93  ASP n 
1 94  ASP n 
1 95  ALA n 
1 96  TRP n 
1 97  LEU n 
1 98  LEU n 
1 99  THR n 
1 100 THR n 
1 101 ALA n 
1 102 ILE n 
1 103 PRO n 
1 104 GLY n 
1 105 LYS n 
1 106 THR n 
1 107 ALA n 
1 108 PHE n 
1 109 GLN n 
1 110 VAL n 
1 111 LEU n 
1 112 GLU n 
1 113 GLU n 
1 114 TYR n 
1 115 PRO n 
1 116 ASP n 
1 117 SER n 
1 118 GLY n 
1 119 GLU n 
1 120 ASN n 
1 121 ILE n 
1 122 VAL n 
1 123 ASP n 
1 124 ALA n 
1 125 LEU n 
1 126 ALA n 
1 127 VAL n 
1 128 PHE n 
1 129 LEU n 
1 130 ARG n 
1 131 ARG n 
1 132 LEU n 
1 133 HIS n 
1 134 SER n 
1 135 ILE n 
1 136 PRO n 
1 137 VAL n 
1 138 CYS n 
1 139 ASN n 
1 140 CYS n 
1 141 PRO n 
1 142 PHE n 
1 143 ASN n 
1 144 SER n 
1 145 ASP n 
1 146 ARG n 
1 147 VAL n 
1 148 PHE n 
1 149 ARG n 
1 150 LEU n 
1 151 ALA n 
1 152 GLN n 
1 153 ALA n 
1 154 GLN n 
1 155 SER n 
1 156 ARG n 
1 157 MSE n 
1 158 ASN n 
1 159 ASN n 
1 160 GLY n 
1 161 LEU n 
1 162 VAL n 
1 163 ASP n 
1 164 ALA n 
1 165 SER n 
1 166 ASP n 
1 167 PHE n 
1 168 ASP n 
1 169 ASP n 
1 170 GLU n 
1 171 ARG n 
1 172 ASN n 
1 173 GLY n 
1 174 TRP n 
1 175 PRO n 
1 176 VAL n 
1 177 GLU n 
1 178 GLN n 
1 179 VAL n 
1 180 TRP n 
1 181 LYS n 
1 182 GLU n 
1 183 MSE n 
1 184 HIS n 
1 185 LYS n 
1 186 LEU n 
1 187 LEU n 
1 188 PRO n 
1 189 PHE n 
1 190 SER n 
1 191 PRO n 
1 192 ASP n 
1 193 SER n 
1 194 VAL n 
1 195 VAL n 
1 196 THR n 
1 197 HIS n 
1 198 GLY n 
1 199 ASP n 
1 200 PHE n 
1 201 SER n 
1 202 LEU n 
1 203 ASP n 
1 204 ASN n 
1 205 LEU n 
1 206 ILE n 
1 207 PHE n 
1 208 ASP n 
1 209 GLU n 
1 210 GLY n 
1 211 LYS n 
1 212 LEU n 
1 213 ILE n 
1 214 GLY n 
1 215 CYS n 
1 216 ILE n 
1 217 ASP n 
1 218 VAL n 
1 219 GLY n 
1 220 ARG n 
1 221 VAL n 
1 222 GLY n 
1 223 ILE n 
1 224 ALA n 
1 225 ASP n 
1 226 ARG n 
1 227 TYR n 
1 228 GLN n 
1 229 ASP n 
1 230 LEU n 
1 231 ALA n 
1 232 ILE n 
1 233 LEU n 
1 234 TRP n 
1 235 ASN n 
1 236 CYS n 
1 237 LEU n 
1 238 GLY n 
1 239 GLU n 
1 240 PHE n 
1 241 SER n 
1 242 PRO n 
1 243 SER n 
1 244 LEU n 
1 245 GLN n 
1 246 LYS n 
1 247 ARG n 
1 248 LEU n 
1 249 PHE n 
1 250 GLN n 
1 251 LYS n 
1 252 TYR n 
1 253 GLY n 
1 254 ILE n 
1 255 ASP n 
1 256 ASN n 
1 257 PRO n 
1 258 ASP n 
1 259 MSE n 
1 260 ASN n 
1 261 LYS n 
1 262 LEU n 
1 263 GLN n 
1 264 PHE n 
1 265 HIS n 
1 266 LEU n 
1 267 MSE n 
1 268 LEU n 
1 269 ASP n 
1 270 GLU n 
1 271 PHE n 
1 272 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ABAYE3578, APHA1-IAB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    AYE 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Acinetobacter baumannii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     509173 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'P15TV LIC' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B0VD92_ACIBY 
_struct_ref.pdbx_db_accession          B0VD92 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMP
LPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGL
VDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFS
PSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4GKH A 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
2  1 4GKH B 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
3  1 4GKH C 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
4  1 4GKH D 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
5  1 4GKH E 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
6  1 4GKH F 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
7  1 4GKH G 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
8  1 4GKH H 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
9  1 4GKH I 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
10 1 4GKH J 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
11 1 4GKH K 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
12 1 4GKH L 2 ? 272 ? B0VD92 1 ? 271 ? 1 271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4GKH GLY A 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 1  
2  4GKH GLY B 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 2  
3  4GKH GLY C 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 3  
4  4GKH GLY D 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 4  
5  4GKH GLY E 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 5  
6  4GKH GLY F 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 6  
7  4GKH GLY G 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 7  
8  4GKH GLY H 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 8  
9  4GKH GLY I 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 9  
10 4GKH GLY J 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 10 
11 4GKH GLY K 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 11 
12 4GKH GLY L 1 ? UNP B0VD92 ? ? 'EXPRESSION TAG' 0 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0J9 non-polymer         . '1-tert-butyl-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine' ? 'C19 H19 N5'     317.388 
ACT non-polymer         . 'ACETATE ION'                                                          ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                                                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                         ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                             ? 'C6 H13 N O2'    131.173 
KAN non-polymer         . 'KANAMYCIN A'                                                          ? 'C18 H36 N4 O11' 484.499 
LEU 'L-peptide linking' y LEUCINE                                                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE                                                       ? 'C5 H11 N O2 Se' 196.106 
NA  non-polymer         . 'SODIUM ION'                                                           ? 'Na 1'           22.990  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                                                ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE                                                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4GKH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M SODIUM ACETATE pH 4.5, 7% PEG3350, 3% DMSO, 2 MM KANAMYCIN, 3 mM 1-NA-PP1, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-04-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4GKH 
_reflns.observed_criterion_sigma_I   -2 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             80.87 
_reflns.d_resolution_high            1.86 
_reflns.number_obs                   275562 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.96 
_reflns_shell.percent_possible_all   96.5 
_reflns_shell.Rmerge_I_obs           0.401 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4GKH 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     262197 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.779 
_refine.ls_d_res_high                            1.863 
_refine.ls_percent_reflns_obs                    94.60 
_refine.ls_R_factor_obs                          0.1665 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1639 
_refine.ls_R_factor_R_free                       0.2159 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  13290 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4EJ7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.19 
_refine.pdbx_overall_phase_error                 23.78 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        25478 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         865 
_refine_hist.number_atoms_solvent             2870 
_refine_hist.number_atoms_total               29213 
_refine_hist.d_res_high                       1.863 
_refine_hist.d_res_low                        54.779 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 27382 'X-RAY DIFFRACTION' ? 
f_angle_d          1.173  ? ? 37201 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.470 ? ? 10115 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 4030  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 4827  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.8631 1.8843  17014 0.2579 95.00 0.2891 . . 907 . . . . 
'X-RAY DIFFRACTION' . 1.8843 1.9064  17171 0.2475 95.00 0.2941 . . 910 . . . . 
'X-RAY DIFFRACTION' . 1.9064 1.9297  16884 0.2454 95.00 0.2856 . . 958 . . . . 
'X-RAY DIFFRACTION' . 1.9297 1.9541  17102 0.2251 95.00 0.2776 . . 974 . . . . 
'X-RAY DIFFRACTION' . 1.9541 1.9798  17273 0.2192 96.00 0.2709 . . 898 . . . . 
'X-RAY DIFFRACTION' . 1.9798 2.0070  16940 0.2092 95.00 0.2549 . . 883 . . . . 
'X-RAY DIFFRACTION' . 2.0070 2.0356  17172 0.2054 96.00 0.2586 . . 917 . . . . 
'X-RAY DIFFRACTION' . 2.0356 2.0660  17142 0.1977 96.00 0.2579 . . 997 . . . . 
'X-RAY DIFFRACTION' . 2.0660 2.0983  16889 0.1907 95.00 0.2473 . . 965 . . . . 
'X-RAY DIFFRACTION' . 2.0983 2.1327  17156 0.1822 96.00 0.2429 . . 968 . . . . 
'X-RAY DIFFRACTION' . 2.1327 2.1695  17218 0.1797 96.00 0.2272 . . 931 . . . . 
'X-RAY DIFFRACTION' . 2.1695 2.2089  17161 0.1771 96.00 0.2391 . . 962 . . . . 
'X-RAY DIFFRACTION' . 2.2089 2.2514  17038 0.1764 95.00 0.2363 . . 928 . . . . 
'X-RAY DIFFRACTION' . 2.2514 2.2974  17097 0.1775 95.00 0.2330 . . 925 . . . . 
'X-RAY DIFFRACTION' . 2.2974 2.3473  17193 0.1747 96.00 0.2339 . . 933 . . . . 
'X-RAY DIFFRACTION' . 2.3473 2.4019  17061 0.1606 96.00 0.2190 . . 986 . . . . 
'X-RAY DIFFRACTION' . 2.4019 2.4620  17017 0.1617 95.00 0.2193 . . 926 . . . . 
'X-RAY DIFFRACTION' . 2.4620 2.5286  17139 0.1615 96.00 0.2270 . . 923 . . . . 
'X-RAY DIFFRACTION' . 2.5286 2.6030  17138 0.1655 95.00 0.2308 . . 909 . . . . 
'X-RAY DIFFRACTION' . 2.6030 2.6870  17193 0.1609 95.00 0.2226 . . 796 . . . . 
'X-RAY DIFFRACTION' . 2.6870 2.7830  16947 0.1698 95.00 0.2591 . . 871 . . . . 
'X-RAY DIFFRACTION' . 2.7830 2.8944  16924 0.1654 94.00 0.2316 . . 879 . . . . 
'X-RAY DIFFRACTION' . 2.8944 3.0262  16902 0.1658 94.00 0.2228 . . 856 . . . . 
'X-RAY DIFFRACTION' . 3.0262 3.1857  16722 0.1652 93.00 0.2256 . . 782 . . . . 
'X-RAY DIFFRACTION' . 3.1857 3.3853  16734 0.1475 93.00 0.2003 . . 876 . . . . 
'X-RAY DIFFRACTION' . 3.3853 3.6466  16662 0.1454 92.00 0.1902 . . 833 . . . . 
'X-RAY DIFFRACTION' . 3.6466 4.0135  16730 0.1259 93.00 0.1661 . . 876 . . . . 
'X-RAY DIFFRACTION' . 4.0135 4.5940  16774 0.1195 93.00 0.1519 . . 845 . . . . 
'X-RAY DIFFRACTION' . 4.5940 5.7869  16858 0.1420 94.00 0.1830 . . 919 . . . . 
'X-RAY DIFFRACTION' . 5.7869 54.8030 16087 0.1712 89.00 0.2009 . . 812 . . . . 
# 
_struct.entry_id                  4GKH 
_struct.title                     
;Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor 1-NA-PP1
;
_struct.pdbx_descriptor           
;Aminoglycoside 3'-phosphotransferase AphA1-IAB (E.C.2.7.1.95)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GKH 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
;PYRAZOLOPYRIMIDINE, 1-NA-PP1, BUMPED KINASE INHIBITOR, BKI, PROTEIN KINASE INHIBITOR, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, NIAID, NATIONAL INSTITUTE OF ALLERGY AND INFECTIOUS DISEASES, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX, EUKARYOTIC PROTEIN KINASE-LIKE FOLD, ALPHA/BETA PROTEIN, TRANSFERASE, PHOSPHOTRANSFERASE, AMINOGLYCOSIDE PHOSPHOTRANSFERASE, ANTIBIOTIC RESISTANCE, AMINOGLYCOSIDES, KANAMYCIN, GTP, INTRACELLULAR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 6 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 2 ? 
HA N N 5 ? 
IA N N 7 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 7 ? 
NA N N 2 ? 
OA N N 3 ? 
PA N N 4 ? 
QA N N 5 ? 
RA N N 5 ? 
SA N N 5 ? 
TA N N 2 ? 
UA N N 3 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 5 ? 
YA N N 5 ? 
ZA N N 5 ? 
AB N N 5 ? 
BB N N 2 ? 
CB N N 3 ? 
DB N N 4 ? 
EB N N 4 ? 
FB N N 5 ? 
GB N N 5 ? 
HB N N 5 ? 
IB N N 4 ? 
JB N N 5 ? 
KB N N 2 ? 
LB N N 7 ? 
MB N N 3 ? 
NB N N 5 ? 
OB N N 2 ? 
PB N N 3 ? 
QB N N 4 ? 
RB N N 6 ? 
SB N N 5 ? 
TB N N 5 ? 
UB N N 5 ? 
VB N N 2 ? 
WB N N 3 ? 
XB N N 5 ? 
YB N N 4 ? 
ZB N N 2 ? 
AC N N 5 ? 
BC N N 3 ? 
CC N N 4 ? 
DC N N 5 ? 
EC N N 5 ? 
FC N N 2 ? 
GC N N 3 ? 
HC N N 4 ? 
IC N N 5 ? 
JC N N 5 ? 
KC N N 5 ? 
LC N N 5 ? 
MC N N 5 ? 
NC N N 8 ? 
OC N N 8 ? 
PC N N 8 ? 
QC N N 8 ? 
RC N N 8 ? 
SC N N 8 ? 
TC N N 8 ? 
UC N N 8 ? 
VC N N 8 ? 
WC N N 8 ? 
XC N N 8 ? 
YC N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASN A 19  ? TYR A 25  ? ASN A 18  TYR A 24  1 ? 7  
HELX_P HELX_P2   2   GLY A 60  ? THR A 77  ? GLY A 59  THR A 76  1 ? 18 
HELX_P HELX_P3   3   ALA A 107 ? TYR A 114 ? ALA A 106 TYR A 113 1 ? 8  
HELX_P HELX_P4   4   SER A 117 ? SER A 134 ? SER A 116 SER A 133 1 ? 18 
HELX_P HELX_P5   5   ILE A 135 ? CYS A 140 ? ILE A 134 CYS A 139 5 ? 6  
HELX_P HELX_P6   6   ASP A 145 ? ASN A 159 ? ASP A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7   7   ASP A 163 ? PHE A 167 ? ASP A 162 PHE A 166 5 ? 5  
HELX_P HELX_P8   8   ASP A 168 ? ASN A 172 ? ASP A 167 ASN A 171 5 ? 5  
HELX_P HELX_P9   9   PRO A 175 ? LYS A 185 ? PRO A 174 LYS A 184 1 ? 11 
HELX_P HELX_P10  10  ARG A 226 ? GLY A 238 ? ARG A 225 GLY A 237 1 ? 13 
HELX_P HELX_P11  11  SER A 241 ? GLY A 253 ? SER A 240 GLY A 252 1 ? 13 
HELX_P HELX_P12  12  ASP A 258 ? GLU A 270 ? ASP A 257 GLU A 269 1 ? 13 
HELX_P HELX_P13  13  ASN B 19  ? LEU B 24  ? ASN B 18  LEU B 23  1 ? 6  
HELX_P HELX_P14  14  GLY B 60  ? THR B 77  ? GLY B 59  THR B 76  1 ? 18 
HELX_P HELX_P15  15  ALA B 107 ? TYR B 114 ? ALA B 106 TYR B 113 1 ? 8  
HELX_P HELX_P16  16  SER B 117 ? HIS B 133 ? SER B 116 HIS B 132 1 ? 17 
HELX_P HELX_P17  17  SER B 134 ? ILE B 135 ? SER B 133 ILE B 134 5 ? 2  
HELX_P HELX_P18  18  PRO B 136 ? CYS B 140 ? PRO B 135 CYS B 139 5 ? 5  
HELX_P HELX_P19  19  ASP B 145 ? ASN B 159 ? ASP B 144 ASN B 158 1 ? 15 
HELX_P HELX_P20  20  ASP B 163 ? PHE B 167 ? ASP B 162 PHE B 166 5 ? 5  
HELX_P HELX_P21  21  ASP B 168 ? ASN B 172 ? ASP B 167 ASN B 171 5 ? 5  
HELX_P HELX_P22  22  PRO B 175 ? LYS B 185 ? PRO B 174 LYS B 184 1 ? 11 
HELX_P HELX_P23  23  ARG B 226 ? GLY B 238 ? ARG B 225 GLY B 237 1 ? 13 
HELX_P HELX_P24  24  SER B 241 ? GLY B 253 ? SER B 240 GLY B 252 1 ? 13 
HELX_P HELX_P25  25  ASP B 258 ? GLU B 270 ? ASP B 257 GLU B 269 1 ? 13 
HELX_P HELX_P26  26  ASN C 19  ? LEU C 24  ? ASN C 18  LEU C 23  1 ? 6  
HELX_P HELX_P27  27  GLY C 60  ? THR C 77  ? GLY C 59  THR C 76  1 ? 18 
HELX_P HELX_P28  28  ALA C 107 ? TYR C 114 ? ALA C 106 TYR C 113 1 ? 8  
HELX_P HELX_P29  29  SER C 117 ? SER C 134 ? SER C 116 SER C 133 1 ? 18 
HELX_P HELX_P30  30  ILE C 135 ? CYS C 140 ? ILE C 134 CYS C 139 5 ? 6  
HELX_P HELX_P31  31  ASP C 145 ? ASN C 159 ? ASP C 144 ASN C 158 1 ? 15 
HELX_P HELX_P32  32  ASP C 163 ? PHE C 167 ? ASP C 162 PHE C 166 5 ? 5  
HELX_P HELX_P33  33  ASP C 168 ? ASN C 172 ? ASP C 167 ASN C 171 5 ? 5  
HELX_P HELX_P34  34  PRO C 175 ? LYS C 185 ? PRO C 174 LYS C 184 1 ? 11 
HELX_P HELX_P35  35  ARG C 226 ? GLY C 238 ? ARG C 225 GLY C 237 1 ? 13 
HELX_P HELX_P36  36  SER C 241 ? GLY C 253 ? SER C 240 GLY C 252 1 ? 13 
HELX_P HELX_P37  37  ASP C 258 ? GLU C 270 ? ASP C 257 GLU C 269 1 ? 13 
HELX_P HELX_P38  38  GLY D 60  ? THR D 77  ? GLY D 59  THR D 76  1 ? 18 
HELX_P HELX_P39  39  ALA D 107 ? TYR D 114 ? ALA D 106 TYR D 113 1 ? 8  
HELX_P HELX_P40  40  SER D 117 ? SER D 134 ? SER D 116 SER D 133 1 ? 18 
HELX_P HELX_P41  41  ILE D 135 ? CYS D 140 ? ILE D 134 CYS D 139 5 ? 6  
HELX_P HELX_P42  42  ASP D 145 ? ASN D 159 ? ASP D 144 ASN D 158 1 ? 15 
HELX_P HELX_P43  43  ASP D 163 ? PHE D 167 ? ASP D 162 PHE D 166 5 ? 5  
HELX_P HELX_P44  44  ASP D 168 ? ASN D 172 ? ASP D 167 ASN D 171 5 ? 5  
HELX_P HELX_P45  45  PRO D 175 ? LYS D 185 ? PRO D 174 LYS D 184 1 ? 11 
HELX_P HELX_P46  46  ARG D 226 ? GLY D 238 ? ARG D 225 GLY D 237 1 ? 13 
HELX_P HELX_P47  47  SER D 241 ? GLY D 253 ? SER D 240 GLY D 252 1 ? 13 
HELX_P HELX_P48  48  ASP D 258 ? GLU D 270 ? ASP D 257 GLU D 269 1 ? 13 
HELX_P HELX_P49  49  ASN E 19  ? TYR E 25  ? ASN E 18  TYR E 24  5 ? 7  
HELX_P HELX_P50  50  GLY E 60  ? THR E 77  ? GLY E 59  THR E 76  1 ? 18 
HELX_P HELX_P51  51  ALA E 107 ? TYR E 114 ? ALA E 106 TYR E 113 1 ? 8  
HELX_P HELX_P52  52  SER E 117 ? HIS E 133 ? SER E 116 HIS E 132 1 ? 17 
HELX_P HELX_P53  53  SER E 134 ? ILE E 135 ? SER E 133 ILE E 134 5 ? 2  
HELX_P HELX_P54  54  PRO E 136 ? CYS E 140 ? PRO E 135 CYS E 139 5 ? 5  
HELX_P HELX_P55  55  ASP E 145 ? ASN E 159 ? ASP E 144 ASN E 158 1 ? 15 
HELX_P HELX_P56  56  ASP E 163 ? PHE E 167 ? ASP E 162 PHE E 166 5 ? 5  
HELX_P HELX_P57  57  ASP E 168 ? ASN E 172 ? ASP E 167 ASN E 171 5 ? 5  
HELX_P HELX_P58  58  PRO E 175 ? LEU E 186 ? PRO E 174 LEU E 185 1 ? 12 
HELX_P HELX_P59  59  ARG E 226 ? GLY E 238 ? ARG E 225 GLY E 237 1 ? 13 
HELX_P HELX_P60  60  SER E 241 ? GLY E 253 ? SER E 240 GLY E 252 1 ? 13 
HELX_P HELX_P61  61  ASP E 258 ? GLU E 270 ? ASP E 257 GLU E 269 1 ? 13 
HELX_P HELX_P62  62  ASN F 19  ? LEU F 24  ? ASN F 18  LEU F 23  1 ? 6  
HELX_P HELX_P63  63  GLY F 60  ? THR F 77  ? GLY F 59  THR F 76  1 ? 18 
HELX_P HELX_P64  64  ALA F 107 ? TYR F 114 ? ALA F 106 TYR F 113 1 ? 8  
HELX_P HELX_P65  65  SER F 117 ? SER F 134 ? SER F 116 SER F 133 1 ? 18 
HELX_P HELX_P66  66  ILE F 135 ? CYS F 140 ? ILE F 134 CYS F 139 5 ? 6  
HELX_P HELX_P67  67  ASP F 145 ? ASN F 159 ? ASP F 144 ASN F 158 1 ? 15 
HELX_P HELX_P68  68  ASP F 163 ? PHE F 167 ? ASP F 162 PHE F 166 5 ? 5  
HELX_P HELX_P69  69  ASP F 168 ? ASN F 172 ? ASP F 167 ASN F 171 5 ? 5  
HELX_P HELX_P70  70  PRO F 175 ? LYS F 185 ? PRO F 174 LYS F 184 1 ? 11 
HELX_P HELX_P71  71  ARG F 226 ? GLY F 238 ? ARG F 225 GLY F 237 1 ? 13 
HELX_P HELX_P72  72  SER F 241 ? GLY F 253 ? SER F 240 GLY F 252 1 ? 13 
HELX_P HELX_P73  73  ASP F 258 ? GLU F 270 ? ASP F 257 GLU F 269 1 ? 13 
HELX_P HELX_P74  74  ASN G 19  ? LEU G 24  ? ASN G 18  LEU G 23  1 ? 6  
HELX_P HELX_P75  75  GLY G 60  ? THR G 77  ? GLY G 59  THR G 76  1 ? 18 
HELX_P HELX_P76  76  ALA G 107 ? TYR G 114 ? ALA G 106 TYR G 113 1 ? 8  
HELX_P HELX_P77  77  SER G 117 ? SER G 134 ? SER G 116 SER G 133 1 ? 18 
HELX_P HELX_P78  78  ILE G 135 ? CYS G 140 ? ILE G 134 CYS G 139 5 ? 6  
HELX_P HELX_P79  79  ASP G 145 ? ASN G 159 ? ASP G 144 ASN G 158 1 ? 15 
HELX_P HELX_P80  80  ASP G 163 ? PHE G 167 ? ASP G 162 PHE G 166 5 ? 5  
HELX_P HELX_P81  81  ASP G 168 ? ASN G 172 ? ASP G 167 ASN G 171 5 ? 5  
HELX_P HELX_P82  82  PRO G 175 ? LYS G 185 ? PRO G 174 LYS G 184 1 ? 11 
HELX_P HELX_P83  83  ARG G 226 ? GLY G 238 ? ARG G 225 GLY G 237 1 ? 13 
HELX_P HELX_P84  84  SER G 241 ? GLY G 253 ? SER G 240 GLY G 252 1 ? 13 
HELX_P HELX_P85  85  ASP G 258 ? GLU G 270 ? ASP G 257 GLU G 269 1 ? 13 
HELX_P HELX_P86  86  ASN H 19  ? TYR H 25  ? ASN H 18  TYR H 24  1 ? 7  
HELX_P HELX_P87  87  GLY H 60  ? THR H 77  ? GLY H 59  THR H 76  1 ? 18 
HELX_P HELX_P88  88  ALA H 107 ? TYR H 114 ? ALA H 106 TYR H 113 1 ? 8  
HELX_P HELX_P89  89  SER H 117 ? SER H 134 ? SER H 116 SER H 133 1 ? 18 
HELX_P HELX_P90  90  PRO H 136 ? CYS H 140 ? PRO H 135 CYS H 139 5 ? 5  
HELX_P HELX_P91  91  ASP H 145 ? ASN H 159 ? ASP H 144 ASN H 158 1 ? 15 
HELX_P HELX_P92  92  ASP H 163 ? PHE H 167 ? ASP H 162 PHE H 166 5 ? 5  
HELX_P HELX_P93  93  ASP H 168 ? ASN H 172 ? ASP H 167 ASN H 171 5 ? 5  
HELX_P HELX_P94  94  PRO H 175 ? LYS H 185 ? PRO H 174 LYS H 184 1 ? 11 
HELX_P HELX_P95  95  ARG H 226 ? GLY H 238 ? ARG H 225 GLY H 237 1 ? 13 
HELX_P HELX_P96  96  SER H 241 ? GLY H 253 ? SER H 240 GLY H 252 1 ? 13 
HELX_P HELX_P97  97  ASP H 258 ? GLU H 270 ? ASP H 257 GLU H 269 1 ? 13 
HELX_P HELX_P98  98  ASN I 19  ? TYR I 25  ? ASN I 18  TYR I 24  5 ? 7  
HELX_P HELX_P99  99  GLY I 60  ? THR I 77  ? GLY I 59  THR I 76  1 ? 18 
HELX_P HELX_P100 100 ALA I 107 ? TYR I 114 ? ALA I 106 TYR I 113 1 ? 8  
HELX_P HELX_P101 101 SER I 117 ? SER I 134 ? SER I 116 SER I 133 1 ? 18 
HELX_P HELX_P102 102 PRO I 136 ? CYS I 140 ? PRO I 135 CYS I 139 5 ? 5  
HELX_P HELX_P103 103 ASP I 145 ? ASN I 159 ? ASP I 144 ASN I 158 1 ? 15 
HELX_P HELX_P104 104 ASP I 163 ? PHE I 167 ? ASP I 162 PHE I 166 5 ? 5  
HELX_P HELX_P105 105 ASP I 168 ? ASN I 172 ? ASP I 167 ASN I 171 5 ? 5  
HELX_P HELX_P106 106 PRO I 175 ? LYS I 185 ? PRO I 174 LYS I 184 1 ? 11 
HELX_P HELX_P107 107 ARG I 226 ? GLY I 238 ? ARG I 225 GLY I 237 1 ? 13 
HELX_P HELX_P108 108 SER I 241 ? GLY I 253 ? SER I 240 GLY I 252 1 ? 13 
HELX_P HELX_P109 109 ASP I 258 ? GLU I 270 ? ASP I 257 GLU I 269 1 ? 13 
HELX_P HELX_P110 110 ASP J 21  ? TYR J 25  ? ASP J 20  TYR J 24  5 ? 5  
HELX_P HELX_P111 111 GLY J 60  ? THR J 77  ? GLY J 59  THR J 76  1 ? 18 
HELX_P HELX_P112 112 ALA J 107 ? TYR J 114 ? ALA J 106 TYR J 113 1 ? 8  
HELX_P HELX_P113 113 SER J 117 ? SER J 134 ? SER J 116 SER J 133 1 ? 18 
HELX_P HELX_P114 114 ILE J 135 ? CYS J 140 ? ILE J 134 CYS J 139 5 ? 6  
HELX_P HELX_P115 115 ASP J 145 ? ASN J 159 ? ASP J 144 ASN J 158 1 ? 15 
HELX_P HELX_P116 116 ASP J 163 ? PHE J 167 ? ASP J 162 PHE J 166 5 ? 5  
HELX_P HELX_P117 117 ASP J 168 ? ASN J 172 ? ASP J 167 ASN J 171 5 ? 5  
HELX_P HELX_P118 118 PRO J 175 ? HIS J 184 ? PRO J 174 HIS J 183 1 ? 10 
HELX_P HELX_P119 119 LYS J 185 ? LEU J 187 ? LYS J 184 LEU J 186 5 ? 3  
HELX_P HELX_P120 120 ARG J 226 ? GLY J 238 ? ARG J 225 GLY J 237 1 ? 13 
HELX_P HELX_P121 121 SER J 241 ? GLY J 253 ? SER J 240 GLY J 252 1 ? 13 
HELX_P HELX_P122 122 ASP J 258 ? GLU J 270 ? ASP J 257 GLU J 269 1 ? 13 
HELX_P HELX_P123 123 ASN K 19  ? ASP K 23  ? ASN K 18  ASP K 22  5 ? 5  
HELX_P HELX_P124 124 GLY K 60  ? THR K 77  ? GLY K 59  THR K 76  1 ? 18 
HELX_P HELX_P125 125 ALA K 107 ? TYR K 114 ? ALA K 106 TYR K 113 1 ? 8  
HELX_P HELX_P126 126 SER K 117 ? SER K 134 ? SER K 116 SER K 133 1 ? 18 
HELX_P HELX_P127 127 ILE K 135 ? CYS K 140 ? ILE K 134 CYS K 139 5 ? 6  
HELX_P HELX_P128 128 ASP K 145 ? ASN K 159 ? ASP K 144 ASN K 158 1 ? 15 
HELX_P HELX_P129 129 ASP K 163 ? PHE K 167 ? ASP K 162 PHE K 166 5 ? 5  
HELX_P HELX_P130 130 ASP K 168 ? ASN K 172 ? ASP K 167 ASN K 171 5 ? 5  
HELX_P HELX_P131 131 PRO K 175 ? LYS K 185 ? PRO K 174 LYS K 184 1 ? 11 
HELX_P HELX_P132 132 ARG K 226 ? GLY K 238 ? ARG K 225 GLY K 237 1 ? 13 
HELX_P HELX_P133 133 SER K 241 ? GLY K 253 ? SER K 240 GLY K 252 1 ? 13 
HELX_P HELX_P134 134 ASP K 258 ? GLU K 270 ? ASP K 257 GLU K 269 1 ? 13 
HELX_P HELX_P135 135 LEU L 20  ? TYR L 25  ? LEU L 19  TYR L 24  1 ? 6  
HELX_P HELX_P136 136 GLY L 60  ? THR L 77  ? GLY L 59  THR L 76  1 ? 18 
HELX_P HELX_P137 137 ALA L 107 ? TYR L 114 ? ALA L 106 TYR L 113 1 ? 8  
HELX_P HELX_P138 138 SER L 117 ? SER L 134 ? SER L 116 SER L 133 1 ? 18 
HELX_P HELX_P139 139 PRO L 136 ? CYS L 140 ? PRO L 135 CYS L 139 5 ? 5  
HELX_P HELX_P140 140 ASP L 145 ? ASN L 159 ? ASP L 144 ASN L 158 1 ? 15 
HELX_P HELX_P141 141 ASP L 163 ? PHE L 167 ? ASP L 162 PHE L 166 5 ? 5  
HELX_P HELX_P142 142 ASP L 168 ? ASN L 172 ? ASP L 167 ASN L 171 5 ? 5  
HELX_P HELX_P143 143 PRO L 175 ? LEU L 186 ? PRO L 174 LEU L 185 1 ? 12 
HELX_P HELX_P144 144 ARG L 226 ? GLY L 238 ? ARG L 225 GLY L 237 1 ? 13 
HELX_P HELX_P145 145 SER L 241 ? GLY L 253 ? SER L 240 GLY L 252 1 ? 13 
HELX_P HELX_P146 146 ASP L 258 ? GLU L 270 ? ASP L 257 GLU L 269 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? A  GLU 69  C   ? ? ? 1_555 A  MSE 70  N  ? ? A GLU 68  A MSE 69  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2   covale ? ? A  MSE 70  C   ? ? ? 1_555 A  VAL 71  N  ? ? A MSE 69  A VAL 70  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3   covale ? ? A  PHE 79  C   ? ? ? 1_555 A  MSE 80  N  ? ? A PHE 78  A MSE 79  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4   covale ? ? A  MSE 80  C   ? ? ? 1_555 A  PRO 81  N  ? ? A MSE 79  A PRO 80  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale5   covale ? ? A  ARG 156 C   ? ? ? 1_555 A  MSE 157 N  ? ? A ARG 155 A MSE 156 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale6   covale ? ? A  MSE 157 C   ? ? ? 1_555 A  ASN 158 N  ? ? A MSE 156 A ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale7   covale ? ? A  GLU 182 C   ? ? ? 1_555 A  MSE 183 N  ? ? A GLU 181 A MSE 182 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale8   covale ? ? A  MSE 183 C   ? ? ? 1_555 A  HIS 184 N  ? ? A MSE 182 A HIS 183 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale9   covale ? ? A  ASP 258 C   ? ? ? 1_555 A  MSE 259 N  ? ? A ASP 257 A MSE 258 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale10  covale ? ? A  MSE 259 C   ? ? ? 1_555 A  ASN 260 N  ? ? A MSE 258 A ASN 259 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale11  covale ? ? A  LEU 266 C   ? ? ? 1_555 A  MSE 267 N  ? ? A LEU 265 A MSE 266 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale12  covale ? ? A  MSE 267 C   ? ? ? 1_555 A  LEU 268 N  ? ? A MSE 266 A LEU 267 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale13  covale ? ? B  MSE 2   C   ? ? ? 1_555 B  SER 3   N  ? ? B MSE 1   B SER 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale14  covale ? ? B  GLU 69  C   ? ? ? 1_555 B  MSE 70  N  ? ? B GLU 68  B MSE 69  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale15  covale ? ? B  MSE 70  C   ? ? ? 1_555 B  VAL 71  N  ? ? B MSE 69  B VAL 70  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale16  covale ? ? B  PHE 79  C   ? ? ? 1_555 B  MSE 80  N  ? ? B PHE 78  B MSE 79  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale17  covale ? ? B  MSE 80  C   ? ? ? 1_555 B  PRO 81  N  ? ? B MSE 79  B PRO 80  1_555 ? ? ? ? ? ? ? 1.343 ? 
covale18  covale ? ? B  ARG 156 C   ? ? ? 1_555 B  MSE 157 N  ? ? B ARG 155 B MSE 156 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19  covale ? ? B  MSE 157 C   ? ? ? 1_555 B  ASN 158 N  ? ? B MSE 156 B ASN 157 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale20  covale ? ? B  GLU 182 C   ? ? ? 1_555 B  MSE 183 N  ? ? B GLU 181 B MSE 182 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale21  covale ? ? B  MSE 183 C   ? ? ? 1_555 B  HIS 184 N  ? ? B MSE 182 B HIS 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale22  covale ? ? B  ASP 258 C   ? ? ? 1_555 B  MSE 259 N  ? ? B ASP 257 B MSE 258 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale23  covale ? ? B  MSE 259 C   ? ? ? 1_555 B  ASN 260 N  ? ? B MSE 258 B ASN 259 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale24  covale ? ? B  LEU 266 C   ? ? ? 1_555 B  MSE 267 N  ? ? B LEU 265 B MSE 266 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale25  covale ? ? B  MSE 267 C   ? ? ? 1_555 B  LEU 268 N  ? ? B MSE 266 B LEU 267 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale26  covale ? ? C  GLU 69  C   ? ? ? 1_555 C  MSE 70  N  ? ? C GLU 68  C MSE 69  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale27  covale ? ? C  MSE 70  C   ? ? ? 1_555 C  VAL 71  N  ? ? C MSE 69  C VAL 70  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale28  covale ? ? C  PHE 79  C   ? ? ? 1_555 C  MSE 80  N  ? ? C PHE 78  C MSE 79  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale29  covale ? ? C  MSE 80  C   ? ? ? 1_555 C  PRO 81  N  ? ? C MSE 79  C PRO 80  1_555 ? ? ? ? ? ? ? 1.343 ? 
covale30  covale ? ? C  ARG 156 C   ? ? ? 1_555 C  MSE 157 N  ? ? C ARG 155 C MSE 156 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale31  covale ? ? C  MSE 157 C   ? ? ? 1_555 C  ASN 158 N  ? ? C MSE 156 C ASN 157 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale32  covale ? ? C  GLU 182 C   ? ? ? 1_555 C  MSE 183 N  ? ? C GLU 181 C MSE 182 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale33  covale ? ? C  MSE 183 C   ? ? ? 1_555 C  HIS 184 N  ? ? C MSE 182 C HIS 183 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale34  covale ? ? C  ASP 258 C   ? ? ? 1_555 C  MSE 259 N  ? ? C ASP 257 C MSE 258 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale35  covale ? ? C  MSE 259 C   ? ? ? 1_555 C  ASN 260 N  ? ? C MSE 258 C ASN 259 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale36  covale ? ? C  LEU 266 C   ? ? ? 1_555 C  MSE 267 N  ? ? C LEU 265 C MSE 266 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale37  covale ? ? C  MSE 267 C   ? ? ? 1_555 C  LEU 268 N  ? ? C MSE 266 C LEU 267 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale38  covale ? ? D  GLU 69  C   ? ? ? 1_555 D  MSE 70  N  ? ? D GLU 68  D MSE 69  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale39  covale ? ? D  MSE 70  C   ? ? ? 1_555 D  VAL 71  N  ? ? D MSE 69  D VAL 70  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale40  covale ? ? D  PHE 79  C   ? ? ? 1_555 D  MSE 80  N  ? ? D PHE 78  D MSE 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale41  covale ? ? D  MSE 80  C   ? ? ? 1_555 D  PRO 81  N  ? ? D MSE 79  D PRO 80  1_555 ? ? ? ? ? ? ? 1.345 ? 
covale42  covale ? ? D  ARG 156 C   ? ? ? 1_555 D  MSE 157 N  ? ? D ARG 155 D MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale43  covale ? ? D  MSE 157 C   ? ? ? 1_555 D  ASN 158 N  ? ? D MSE 156 D ASN 157 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale44  covale ? ? D  GLU 182 C   ? ? ? 1_555 D  MSE 183 N  ? ? D GLU 181 D MSE 182 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale45  covale ? ? D  MSE 183 C   ? ? ? 1_555 D  HIS 184 N  ? ? D MSE 182 D HIS 183 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale46  covale ? ? D  ASP 258 C   ? ? ? 1_555 D  MSE 259 N  ? ? D ASP 257 D MSE 258 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale47  covale ? ? D  MSE 259 C   ? ? ? 1_555 D  ASN 260 N  ? ? D MSE 258 D ASN 259 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale48  covale ? ? D  LEU 266 C   ? ? ? 1_555 D  MSE 267 N  ? ? D LEU 265 D MSE 266 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale49  covale ? ? D  MSE 267 C   ? ? ? 1_555 D  LEU 268 N  ? ? D MSE 266 D LEU 267 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale50  covale ? ? E  GLU 69  C   ? ? ? 1_555 E  MSE 70  N  ? ? E GLU 68  E MSE 69  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale51  covale ? ? E  MSE 70  C   ? ? ? 1_555 E  VAL 71  N  ? ? E MSE 69  E VAL 70  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale52  covale ? ? E  PHE 79  C   ? ? ? 1_555 E  MSE 80  N  ? ? E PHE 78  E MSE 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale53  covale ? ? E  MSE 80  C   ? ? ? 1_555 E  PRO 81  N  ? ? E MSE 79  E PRO 80  1_555 ? ? ? ? ? ? ? 1.347 ? 
covale54  covale ? ? E  ARG 156 C   ? ? ? 1_555 E  MSE 157 N  ? ? E ARG 155 E MSE 156 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale55  covale ? ? E  MSE 157 C   ? ? ? 1_555 E  ASN 158 N  ? ? E MSE 156 E ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale56  covale ? ? E  GLU 182 C   ? ? ? 1_555 E  MSE 183 N  ? ? E GLU 181 E MSE 182 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale57  covale ? ? E  MSE 183 C   ? ? ? 1_555 E  HIS 184 N  ? ? E MSE 182 E HIS 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale58  covale ? ? E  ASP 258 C   ? ? ? 1_555 E  MSE 259 N  ? ? E ASP 257 E MSE 258 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale59  covale ? ? E  MSE 259 C   ? ? ? 1_555 E  ASN 260 N  ? ? E MSE 258 E ASN 259 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale60  covale ? ? E  LEU 266 C   ? ? ? 1_555 E  MSE 267 N  ? ? E LEU 265 E MSE 266 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale61  covale ? ? E  MSE 267 C   ? ? ? 1_555 E  LEU 268 N  ? ? E MSE 266 E LEU 267 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale62  covale ? ? F  MSE 2   C   ? ? ? 1_555 F  SER 3   N  ? ? F MSE 1   F SER 2   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale63  covale ? ? F  GLU 69  C   ? ? ? 1_555 F  MSE 70  N  ? ? F GLU 68  F MSE 69  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale64  covale ? ? F  MSE 70  C   ? ? ? 1_555 F  VAL 71  N  ? ? F MSE 69  F VAL 70  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale65  covale ? ? F  PHE 79  C   ? ? ? 1_555 F  MSE 80  N  ? ? F PHE 78  F MSE 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale66  covale ? ? F  MSE 80  C   ? ? ? 1_555 F  PRO 81  N  ? ? F MSE 79  F PRO 80  1_555 ? ? ? ? ? ? ? 1.344 ? 
covale67  covale ? ? F  ARG 156 C   ? ? ? 1_555 F  MSE 157 N  ? ? F ARG 155 F MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale68  covale ? ? F  MSE 157 C   ? ? ? 1_555 F  ASN 158 N  ? ? F MSE 156 F ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale69  covale ? ? F  GLU 182 C   ? ? ? 1_555 F  MSE 183 N  ? ? F GLU 181 F MSE 182 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale70  covale ? ? F  MSE 183 C   ? ? ? 1_555 F  HIS 184 N  ? ? F MSE 182 F HIS 183 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale71  covale ? ? F  ASP 258 C   ? ? ? 1_555 F  MSE 259 N  ? ? F ASP 257 F MSE 258 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale72  covale ? ? F  MSE 259 C   ? ? ? 1_555 F  ASN 260 N  ? ? F MSE 258 F ASN 259 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale73  covale ? ? F  LEU 266 C   ? ? ? 1_555 F  MSE 267 N  ? ? F LEU 265 F MSE 266 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale74  covale ? ? F  MSE 267 C   ? ? ? 1_555 F  LEU 268 N  ? ? F MSE 266 F LEU 267 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale75  covale ? ? G  MSE 2   C   ? ? ? 1_555 G  SER 3   N  ? ? G MSE 1   G SER 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale76  covale ? ? G  GLU 69  C   ? ? ? 1_555 G  MSE 70  N  ? ? G GLU 68  G MSE 69  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale77  covale ? ? G  MSE 70  C   ? ? ? 1_555 G  VAL 71  N  ? ? G MSE 69  G VAL 70  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale78  covale ? ? G  PHE 79  C   ? ? ? 1_555 G  MSE 80  N  ? ? G PHE 78  G MSE 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale79  covale ? ? G  MSE 80  C   ? ? ? 1_555 G  PRO 81  N  ? ? G MSE 79  G PRO 80  1_555 ? ? ? ? ? ? ? 1.348 ? 
covale80  covale ? ? G  ARG 156 C   ? ? ? 1_555 G  MSE 157 N  ? ? G ARG 155 G MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale81  covale ? ? G  MSE 157 C   ? ? ? 1_555 G  ASN 158 N  ? ? G MSE 156 G ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale82  covale ? ? G  GLU 182 C   ? ? ? 1_555 G  MSE 183 N  ? ? G GLU 181 G MSE 182 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale83  covale ? ? G  MSE 183 C   ? ? ? 1_555 G  HIS 184 N  ? ? G MSE 182 G HIS 183 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale84  covale ? ? G  ASP 258 C   ? ? ? 1_555 G  MSE 259 N  ? ? G ASP 257 G MSE 258 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale85  covale ? ? G  MSE 259 C   ? ? ? 1_555 G  ASN 260 N  ? ? G MSE 258 G ASN 259 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale86  covale ? ? G  LEU 266 C   ? ? ? 1_555 G  MSE 267 N  ? ? G LEU 265 G MSE 266 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale87  covale ? ? G  MSE 267 C   ? ? ? 1_555 G  LEU 268 N  ? ? G MSE 266 G LEU 267 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale88  covale ? ? H  GLU 69  C   ? ? ? 1_555 H  MSE 70  N  ? ? H GLU 68  H MSE 69  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale89  covale ? ? H  MSE 70  C   ? ? ? 1_555 H  VAL 71  N  ? ? H MSE 69  H VAL 70  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale90  covale ? ? H  PHE 79  C   ? ? ? 1_555 H  MSE 80  N  ? ? H PHE 78  H MSE 79  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale91  covale ? ? H  MSE 80  C   ? ? ? 1_555 H  PRO 81  N  ? ? H MSE 79  H PRO 80  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale92  covale ? ? H  ARG 156 C   ? ? ? 1_555 H  MSE 157 N  ? ? H ARG 155 H MSE 156 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale93  covale ? ? H  MSE 157 C   ? ? ? 1_555 H  ASN 158 N  ? ? H MSE 156 H ASN 157 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale94  covale ? ? H  GLU 182 C   ? ? ? 1_555 H  MSE 183 N  ? ? H GLU 181 H MSE 182 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale95  covale ? ? H  MSE 183 C   ? ? ? 1_555 H  HIS 184 N  ? ? H MSE 182 H HIS 183 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale96  covale ? ? H  ASP 258 C   ? ? ? 1_555 H  MSE 259 N  ? ? H ASP 257 H MSE 258 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale97  covale ? ? H  MSE 259 C   ? ? ? 1_555 H  ASN 260 N  ? ? H MSE 258 H ASN 259 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale98  covale ? ? H  LEU 266 C   ? ? ? 1_555 H  MSE 267 N  ? ? H LEU 265 H MSE 266 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale99  covale ? ? H  MSE 267 C   ? ? ? 1_555 H  LEU 268 N  ? ? H MSE 266 H LEU 267 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale100 covale ? ? I  GLU 69  C   ? ? ? 1_555 I  MSE 70  N  ? ? I GLU 68  I MSE 69  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale101 covale ? ? I  MSE 70  C   ? ? ? 1_555 I  VAL 71  N  ? ? I MSE 69  I VAL 70  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale102 covale ? ? I  PHE 79  C   ? ? ? 1_555 I  MSE 80  N  ? ? I PHE 78  I MSE 79  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale103 covale ? ? I  MSE 80  C   ? ? ? 1_555 I  PRO 81  N  ? ? I MSE 79  I PRO 80  1_555 ? ? ? ? ? ? ? 1.346 ? 
covale104 covale ? ? I  ARG 156 C   ? ? ? 1_555 I  MSE 157 N  ? ? I ARG 155 I MSE 156 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale105 covale ? ? I  MSE 157 C   ? ? ? 1_555 I  ASN 158 N  ? ? I MSE 156 I ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale106 covale ? ? I  GLU 182 C   ? ? ? 1_555 I  MSE 183 N  ? ? I GLU 181 I MSE 182 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale107 covale ? ? I  MSE 183 C   ? ? ? 1_555 I  HIS 184 N  ? ? I MSE 182 I HIS 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale108 covale ? ? I  ASP 258 C   ? ? ? 1_555 I  MSE 259 N  ? ? I ASP 257 I MSE 258 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale109 covale ? ? I  MSE 259 C   ? ? ? 1_555 I  ASN 260 N  ? ? I MSE 258 I ASN 259 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale110 covale ? ? I  LEU 266 C   ? ? ? 1_555 I  MSE 267 N  ? ? I LEU 265 I MSE 266 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale111 covale ? ? I  MSE 267 C   ? ? ? 1_555 I  LEU 268 N  ? ? I MSE 266 I LEU 267 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale112 covale ? ? J  MSE 2   C   ? ? ? 1_555 J  SER 3   N  ? ? J MSE 1   J SER 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale113 covale ? ? J  GLU 69  C   ? ? ? 1_555 J  MSE 70  N  ? ? J GLU 68  J MSE 69  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale114 covale ? ? J  MSE 70  C   ? ? ? 1_555 J  VAL 71  N  ? ? J MSE 69  J VAL 70  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale115 covale ? ? J  PHE 79  C   ? ? ? 1_555 J  MSE 80  N  ? ? J PHE 78  J MSE 79  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale116 covale ? ? J  MSE 80  C   ? ? ? 1_555 J  PRO 81  N  ? ? J MSE 79  J PRO 80  1_555 ? ? ? ? ? ? ? 1.347 ? 
covale117 covale ? ? J  ARG 156 C   ? ? ? 1_555 J  MSE 157 N  ? ? J ARG 155 J MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale118 covale ? ? J  MSE 157 C   ? ? ? 1_555 J  ASN 158 N  ? ? J MSE 156 J ASN 157 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale119 covale ? ? J  GLU 182 C   ? ? ? 1_555 J  MSE 183 N  ? ? J GLU 181 J MSE 182 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale120 covale ? ? J  MSE 183 C   ? ? ? 1_555 J  HIS 184 N  ? ? J MSE 182 J HIS 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale121 covale ? ? J  ASP 258 C   ? ? ? 1_555 J  MSE 259 N  ? ? J ASP 257 J MSE 258 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale122 covale ? ? J  MSE 259 C   ? ? ? 1_555 J  ASN 260 N  ? ? J MSE 258 J ASN 259 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale123 covale ? ? J  LEU 266 C   ? ? ? 1_555 J  MSE 267 N  ? ? J LEU 265 J MSE 266 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale124 covale ? ? J  MSE 267 C   ? ? ? 1_555 J  LEU 268 N  ? ? J MSE 266 J LEU 267 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale125 covale ? ? K  MSE 2   C   ? ? ? 1_555 K  SER 3   N  ? ? K MSE 1   K SER 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale126 covale ? ? K  GLU 69  C   ? ? ? 1_555 K  MSE 70  N  ? ? K GLU 68  K MSE 69  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale127 covale ? ? K  MSE 70  C   ? ? ? 1_555 K  VAL 71  N  ? ? K MSE 69  K VAL 70  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale128 covale ? ? K  PHE 79  C   ? ? ? 1_555 K  MSE 80  N  ? ? K PHE 78  K MSE 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale129 covale ? ? K  MSE 80  C   ? ? ? 1_555 K  PRO 81  N  ? ? K MSE 79  K PRO 80  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale130 covale ? ? K  ARG 156 C   ? ? ? 1_555 K  MSE 157 N  ? ? K ARG 155 K MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale131 covale ? ? K  MSE 157 C   ? ? ? 1_555 K  ASN 158 N  ? ? K MSE 156 K ASN 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale132 covale ? ? K  GLU 182 C   ? ? ? 1_555 K  MSE 183 N  ? ? K GLU 181 K MSE 182 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale133 covale ? ? K  MSE 183 C   ? ? ? 1_555 K  HIS 184 N  ? ? K MSE 182 K HIS 183 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale134 covale ? ? K  ASP 258 C   ? ? ? 1_555 K  MSE 259 N  ? ? K ASP 257 K MSE 258 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale135 covale ? ? K  MSE 259 C   ? ? ? 1_555 K  ASN 260 N  ? ? K MSE 258 K ASN 259 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale136 covale ? ? K  LEU 266 C   ? ? ? 1_555 K  MSE 267 N  ? ? K LEU 265 K MSE 266 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale137 covale ? ? K  MSE 267 C   ? ? ? 1_555 K  LEU 268 N  ? ? K MSE 266 K LEU 267 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale138 covale ? ? L  GLU 69  C   ? ? ? 1_555 L  MSE 70  N  ? ? L GLU 68  L MSE 69  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale139 covale ? ? L  MSE 70  C   ? ? ? 1_555 L  VAL 71  N  ? ? L MSE 69  L VAL 70  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale140 covale ? ? L  PHE 79  C   ? ? ? 1_555 L  MSE 80  N  ? ? L PHE 78  L MSE 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale141 covale ? ? L  MSE 80  C   ? ? ? 1_555 L  PRO 81  N  ? ? L MSE 79  L PRO 80  1_555 ? ? ? ? ? ? ? 1.348 ? 
covale142 covale ? ? L  ARG 156 C   ? ? ? 1_555 L  MSE 157 N  ? ? L ARG 155 L MSE 156 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale143 covale ? ? L  MSE 157 C   ? ? ? 1_555 L  ASN 158 N  ? ? L MSE 156 L ASN 157 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale144 covale ? ? L  GLU 182 C   ? ? ? 1_555 L  MSE 183 N  ? ? L GLU 181 L MSE 182 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale145 covale ? ? L  MSE 183 C   ? ? ? 1_555 L  HIS 184 N  ? ? L MSE 182 L HIS 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale146 covale ? ? L  ASP 258 C   ? ? ? 1_555 L  MSE 259 N  ? ? L ASP 257 L MSE 258 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale147 covale ? ? L  MSE 259 C   ? ? ? 1_555 L  ASN 260 N  ? ? L MSE 258 L ASN 259 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale148 covale ? ? L  LEU 266 C   ? ? ? 1_555 L  MSE 267 N  ? ? L LEU 265 L MSE 266 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale149 covale ? ? L  MSE 267 C   ? ? ? 1_555 L  LEU 268 N  ? ? L MSE 266 L LEU 267 1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc1   metalc ? ? HC NA  .   NA  ? ? ? 1_555 YC HOH .   O  ? ? L NA  303 L HOH 527 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc2   metalc ? ? L  THR 77  O   ? ? ? 1_555 HC NA  .   NA ? ? L THR 76  L NA  303 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc3   metalc ? ? F  THR 77  O   ? ? ? 1_555 VA NA  .   NA ? ? F THR 76  F NA  303 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc4   metalc ? ? IB NA  .   NA  ? ? ? 1_555 JB ACT .   O  ? ? H NA  303 H ACT 305 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc5   metalc ? ? CC NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  303 K HOH 481 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc6   metalc ? ? G  ASN 235 OD1 ? ? ? 1_555 EB NA  .   NA ? ? G ASN 234 G NA  304 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc7   metalc ? ? U  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  303 B HOH 528 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc8   metalc ? ? B  ASN 235 OD1 ? ? ? 1_555 V  NA  .   NA ? ? B ASN 234 B NA  304 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc9   metalc ? ? F  ASN 235 OD1 ? ? ? 1_555 WA NA  .   NA ? ? F ASN 234 F NA  304 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc10  metalc ? ? BA NA  .   NA  ? ? ? 1_555 EA ACT .   O  ? ? C NA  304 C ACT 307 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc11  metalc ? ? C  THR 77  O   ? ? ? 1_555 BA NA  .   NA ? ? C THR 76  C NA  304 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc12  metalc ? ? HC NA  .   NA  ? ? ? 1_555 JC ACT .   O  ? ? L NA  303 L ACT 305 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc13  metalc ? ? K  THR 77  O   ? ? ? 1_555 CC NA  .   NA ? ? K THR 76  K NA  303 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc14  metalc ? ? G  THR 77  O   ? ? ? 1_555 DB NA  .   NA ? ? G THR 76  G NA  303 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc15  metalc ? ? BA NA  .   NA  ? ? ? 1_555 PC HOH .   O  ? ? C NA  304 C HOH 449 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc16  metalc ? ? K  ASN 235 OD1 ? ? ? 1_555 YB NA  .   NA ? ? K ASN 234 K NA  304 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc17  metalc ? ? YB NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  304 K HOH 459 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc18  metalc ? ? QB NA  .   NA  ? ? ? 1_555 VC HOH .   O  ? ? I NA  303 I HOH 456 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc19  metalc ? ? DB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  303 G HOH 539 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc20  metalc ? ? VA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  303 F HOH 486 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc21  metalc ? ? B  MSE 80  O   ? ? ? 1_555 U  NA  .   NA ? ? B MSE 79  B NA  303 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc22  metalc ? ? G  MSE 80  O   ? ? ? 1_555 DB NA  .   NA ? ? G MSE 79  G NA  303 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc23  metalc ? ? IB NA  .   NA  ? ? ? 1_555 UC HOH .   O  ? ? H NA  303 H HOH 529 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc24  metalc ? ? IB NA  .   NA  ? ? ? 1_555 UC HOH .   O  ? ? H NA  303 H HOH 530 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc25  metalc ? ? QB NA  .   NA  ? ? ? 1_555 SB ACT .   O  ? ? I NA  303 I ACT 305 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc26  metalc ? ? U  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  303 B HOH 647 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc27  metalc ? ? WA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  304 F HOH 453 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc28  metalc ? ? F  MSE 80  O   ? ? ? 1_555 VA NA  .   NA ? ? F MSE 79  F NA  303 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc29  metalc ? ? K  MSE 80  O   ? ? ? 1_555 CC NA  .   NA ? ? K MSE 79  K NA  303 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc30  metalc ? ? B  THR 77  O   ? ? ? 1_555 U  NA  .   NA ? ? B THR 76  B NA  303 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc31  metalc ? ? I  THR 77  O   ? ? ? 1_555 QB NA  .   NA ? ? I THR 76  I NA  303 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc32  metalc ? ? EB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  304 G HOH 467 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc33  metalc ? ? VA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  303 F HOH 623 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc34  metalc ? ? L  MSE 80  O   ? ? ? 1_555 HC NA  .   NA ? ? L MSE 79  L NA  303 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc35  metalc ? ? H  THR 77  O   ? ? ? 1_555 IB NA  .   NA ? ? H THR 76  H NA  303 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc36  metalc ? ? BA NA  .   NA  ? ? ? 1_555 PC HOH .   O  ? ? C NA  304 C HOH 533 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc37  metalc ? ? CC NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  303 K HOH 601 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc38  metalc ? ? PA NA  .   NA  ? ? ? 1_555 RC HOH .   O  ? ? E NA  303 E HOH 482 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc39  metalc ? ? EB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  304 G HOH 421 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc40  metalc ? ? VA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  303 F HOH 643 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc41  metalc ? ? EB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  304 G HOH 453 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc42  metalc ? ? F  THR 77  OG1 ? ? ? 1_555 VA NA  .   NA ? ? F THR 76  F NA  303 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc43  metalc ? ? V  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  304 B HOH 486 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc44  metalc ? ? I  THR 77  OG1 ? ? ? 1_555 QB NA  .   NA ? ? I THR 76  I NA  303 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc45  metalc ? ? QB NA  .   NA  ? ? ? 1_555 VC HOH .   O  ? ? I NA  303 I HOH 492 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc46  metalc ? ? U  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  303 B HOH 631 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc47  metalc ? ? PA NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? E NA  303 G HOH 413 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc48  metalc ? ? YB NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  304 K HOH 424 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc49  metalc ? ? V  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  304 B HOH 458 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc50  metalc ? ? DB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  303 G HOH 575 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc51  metalc ? ? V  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  304 B HOH 432 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc52  metalc ? ? YB NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  304 K HOH 485 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc53  metalc ? ? E  GLY 160 O   ? ? ? 1_555 PA NA  .   NA ? ? E GLY 159 E NA  303 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc54  metalc ? ? WA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  304 F HOH 409 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc55  metalc ? ? V  NA  .   NA  ? ? ? 1_555 OC HOH .   O  ? ? B NA  304 B HOH 474 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc56  metalc ? ? G  THR 77  OG1 ? ? ? 1_555 DB NA  .   NA ? ? G THR 76  G NA  303 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc57  metalc ? ? H  MSE 80  O   ? ? ? 1_555 IB NA  .   NA ? ? H MSE 79  H NA  303 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc58  metalc ? ? WA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  304 F HOH 419 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc59  metalc ? ? PA NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? E NA  303 G HOH 473 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc60  metalc ? ? O  NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? A NA  303 K HOH 605 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc61  metalc ? ? HC NA  .   NA  ? ? ? 1_555 YC HOH .   O  ? ? L NA  303 L HOH 530 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc62  metalc ? ? I  MSE 80  O   ? ? ? 1_555 QB NA  .   NA ? ? I MSE 79  I NA  303 1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc63  metalc ? ? WA NA  .   NA  ? ? ? 1_555 SC HOH .   O  ? ? F NA  304 F HOH 462 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc64  metalc ? ? EB NA  .   NA  ? ? ? 1_555 TC HOH .   O  ? ? G NA  304 G HOH 411 1_555 ? ? ? ? ? ? ? 2.517 ? 
metalc65  metalc ? ? B  THR 77  OG1 ? ? ? 1_555 U  NA  .   NA ? ? B THR 76  B NA  303 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc66  metalc ? ? H  THR 77  OG1 ? ? ? 1_555 IB NA  .   NA ? ? H THR 76  H NA  303 1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc67  metalc ? ? O  NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? A NA  303 K HOH 474 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc68  metalc ? ? O  NA  .   NA  ? ? ? 1_555 PC HOH .   O  ? ? A NA  303 C HOH 536 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc69  metalc ? ? K  THR 77  OG1 ? ? ? 1_555 CC NA  .   NA ? ? K THR 76  K NA  303 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc70  metalc ? ? YB NA  .   NA  ? ? ? 1_555 PC HOH .   O  ? ? K NA  304 C HOH 403 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc71  metalc ? ? CC NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? K NA  303 K HOH 658 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc72  metalc ? ? C  MSE 80  O   ? ? ? 1_555 BA NA  .   NA ? ? C MSE 79  C NA  304 1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc73  metalc ? ? DB NA  .   NA  ? ? ? 1_555 GB ACT .   O  ? ? G NA  303 G ACT 306 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc74  metalc ? ? O  NA  .   NA  ? ? ? 1_555 NC HOH .   O  ? ? A NA  303 A HOH 456 1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc75  metalc ? ? O  NA  .   NA  ? ? ? 1_555 XC HOH .   O  ? ? A NA  303 K HOH 426 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc76  metalc ? ? L  THR 77  OG1 ? ? ? 1_555 HC NA  .   NA ? ? L THR 76  L NA  303 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc77  metalc ? ? C  THR 77  OG1 ? ? ? 1_555 BA NA  .   NA ? ? C THR 76  C NA  304 1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc78  metalc ? ? A  GLY 160 O   ? ? ? 1_555 O  NA  .   NA ? ? A GLY 159 A NA  303 1_555 ? ? ? ? ? ? ? 2.571 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 187 A . ? LEU 186 A PRO 188 A ? PRO 187 A 1 3.53  
2  LEU 187 B . ? LEU 186 B PRO 188 B ? PRO 187 B 1 0.25  
3  ARG 15  C . ? ARG 14  C LEU 16  C ? LEU 15  C 1 18.94 
4  LEU 187 C . ? LEU 186 C PRO 188 C ? PRO 187 C 1 3.17  
5  LEU 187 D . ? LEU 186 D PRO 188 D ? PRO 187 D 1 0.08  
6  LEU 187 F . ? LEU 186 F PRO 188 F ? PRO 187 F 1 5.99  
7  LEU 187 G . ? LEU 186 G PRO 188 G ? PRO 187 G 1 -0.51 
8  LEU 187 H . ? LEU 186 H PRO 188 H ? PRO 187 H 1 4.02  
9  VAL 34  I . ? VAL 33  I GLY 35  I ? GLY 34  I 1 8.04  
10 LEU 187 I . ? LEU 186 I PRO 188 I ? PRO 187 I 1 0.97  
11 LEU 187 J . ? LEU 186 J PRO 188 J ? PRO 187 J 1 -0.23 
12 LEU 187 K . ? LEU 186 K PRO 188 K ? PRO 187 K 1 2.65  
13 LEU 187 L . ? LEU 186 L PRO 188 L ? PRO 187 L 1 -0.64 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 11 ? 
B  ? 3  ? 
C  ? 2  ? 
D  ? 3  ? 
E  ? 2  ? 
F  ? 12 ? 
G  ? 3  ? 
H  ? 2  ? 
I  ? 3  ? 
J  ? 2  ? 
K  ? 11 ? 
L  ? 3  ? 
M  ? 2  ? 
N  ? 3  ? 
O  ? 2  ? 
P  ? 11 ? 
Q  ? 3  ? 
R  ? 2  ? 
S  ? 3  ? 
T  ? 2  ? 
U  ? 12 ? 
V  ? 3  ? 
W  ? 2  ? 
X  ? 3  ? 
Y  ? 2  ? 
Z  ? 10 ? 
AA ? 3  ? 
AB ? 2  ? 
AC ? 3  ? 
AD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? anti-parallel 
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
A  7  8  ? anti-parallel 
A  8  9  ? anti-parallel 
A  9  10 ? anti-parallel 
A  10 11 ? anti-parallel 
B  1  2  ? anti-parallel 
B  2  3  ? anti-parallel 
C  1  2  ? anti-parallel 
D  1  2  ? anti-parallel 
D  2  3  ? anti-parallel 
E  1  2  ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
F  4  5  ? anti-parallel 
F  5  6  ? anti-parallel 
F  6  7  ? anti-parallel 
F  7  8  ? anti-parallel 
F  8  9  ? anti-parallel 
F  9  10 ? anti-parallel 
F  10 11 ? anti-parallel 
F  11 12 ? anti-parallel 
G  1  2  ? anti-parallel 
G  2  3  ? anti-parallel 
H  1  2  ? anti-parallel 
I  1  2  ? anti-parallel 
I  2  3  ? anti-parallel 
J  1  2  ? anti-parallel 
K  1  2  ? anti-parallel 
K  2  3  ? anti-parallel 
K  3  4  ? anti-parallel 
K  4  5  ? anti-parallel 
K  5  6  ? anti-parallel 
K  6  7  ? anti-parallel 
K  7  8  ? anti-parallel 
K  8  9  ? anti-parallel 
K  9  10 ? anti-parallel 
K  10 11 ? anti-parallel 
L  1  2  ? anti-parallel 
L  2  3  ? anti-parallel 
M  1  2  ? anti-parallel 
N  1  2  ? anti-parallel 
N  2  3  ? anti-parallel 
O  1  2  ? anti-parallel 
P  1  2  ? anti-parallel 
P  2  3  ? anti-parallel 
P  3  4  ? anti-parallel 
P  4  5  ? anti-parallel 
P  5  6  ? anti-parallel 
P  6  7  ? anti-parallel 
P  7  8  ? anti-parallel 
P  8  9  ? anti-parallel 
P  9  10 ? anti-parallel 
P  10 11 ? anti-parallel 
Q  1  2  ? anti-parallel 
Q  2  3  ? anti-parallel 
R  1  2  ? anti-parallel 
S  1  2  ? anti-parallel 
S  2  3  ? anti-parallel 
T  1  2  ? anti-parallel 
U  1  2  ? anti-parallel 
U  2  3  ? anti-parallel 
U  3  4  ? anti-parallel 
U  4  5  ? anti-parallel 
U  5  6  ? anti-parallel 
U  6  7  ? anti-parallel 
U  7  8  ? anti-parallel 
U  8  9  ? anti-parallel 
U  9  10 ? anti-parallel 
U  10 11 ? anti-parallel 
U  11 12 ? anti-parallel 
V  1  2  ? anti-parallel 
V  2  3  ? anti-parallel 
W  1  2  ? anti-parallel 
X  1  2  ? anti-parallel 
X  2  3  ? anti-parallel 
Y  1  2  ? anti-parallel 
Z  1  2  ? anti-parallel 
Z  2  3  ? anti-parallel 
Z  3  4  ? anti-parallel 
Z  4  5  ? anti-parallel 
Z  5  6  ? anti-parallel 
Z  6  7  ? anti-parallel 
Z  7  8  ? anti-parallel 
Z  8  9  ? anti-parallel 
Z  9  10 ? anti-parallel 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AB 1  2  ? anti-parallel 
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
AD 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  ARG B 7   ? SER B 10  ? ARG B 6   SER B 9   
A  2  ARG A 28  ? ASN A 33  ? ARG A 27  ASN A 32  
A  3  THR A 40  ? TYR A 45  ? THR A 39  TYR A 44  
A  4  LEU A 53  ? LYS A 59  ? LEU A 52  LYS A 58  
A  5  ASP A 94  ? THR A 100 ? ASP A 93  THR A 99  
A  6  ILE A 85  ? THR A 91  ? ILE A 84  THR A 90  
A  7  ILE B 85  ? ARG B 90  ? ILE B 84  ARG B 89  
A  8  ASP B 94  ? THR B 100 ? ASP B 93  THR B 99  
A  9  LEU B 53  ? LYS B 59  ? LEU B 52  LYS B 58  
A  10 THR B 40  ? TYR B 45  ? THR B 39  TYR B 44  
A  11 ARG B 28  ? ALA B 30  ? ARG B 27  ALA B 29  
B  1  LYS A 105 ? THR A 106 ? LYS A 104 THR A 105 
B  2  LEU A 205 ? ASP A 208 ? LEU A 204 ASP A 207 
B  3  LYS A 211 ? CYS A 215 ? LYS A 210 CYS A 214 
C  1  SER A 193 ? THR A 196 ? SER A 192 THR A 195 
C  2  GLY A 222 ? ASP A 225 ? GLY A 221 ASP A 224 
D  1  LYS B 105 ? THR B 106 ? LYS B 104 THR B 105 
D  2  LEU B 205 ? ASP B 208 ? LEU B 204 ASP B 207 
D  3  LYS B 211 ? CYS B 215 ? LYS B 210 CYS B 214 
E  1  SER B 193 ? THR B 196 ? SER B 192 THR B 195 
E  2  GLY B 222 ? ASP B 225 ? GLY B 221 ASP B 224 
F  1  GLU C 8   ? CYS C 11  ? GLU C 7   CYS C 10  
F  2  TRP D 29  ? ASP D 32  ? TRP D 28  ASP D 31  
F  3  THR D 40  ? LEU D 44  ? THR D 39  LEU D 43  
F  4  LEU D 53  ? LYS D 59  ? LEU D 52  LYS D 58  
F  5  ASP D 94  ? THR D 100 ? ASP D 93  THR D 99  
F  6  ILE D 85  ? ARG D 90  ? ILE D 84  ARG D 89  
F  7  ILE C 85  ? THR C 91  ? ILE C 84  THR C 90  
F  8  ASP C 94  ? THR C 100 ? ASP C 93  THR C 99  
F  9  LEU C 53  ? LYS C 59  ? LEU C 52  LYS C 58  
F  10 THR C 40  ? TYR C 45  ? THR C 39  TYR C 44  
F  11 ARG C 28  ? ARG C 31  ? ARG C 27  ARG C 30  
F  12 THR D 9   ? SER D 10  ? THR D 8   SER D 9   
G  1  LYS C 105 ? THR C 106 ? LYS C 104 THR C 105 
G  2  LEU C 205 ? ASP C 208 ? LEU C 204 ASP C 207 
G  3  LYS C 211 ? CYS C 215 ? LYS C 210 CYS C 214 
H  1  VAL C 194 ? THR C 196 ? VAL C 193 THR C 195 
H  2  GLY C 222 ? ALA C 224 ? GLY C 221 ALA C 223 
I  1  LYS D 105 ? THR D 106 ? LYS D 104 THR D 105 
I  2  LEU D 205 ? ASP D 208 ? LEU D 204 ASP D 207 
I  3  LYS D 211 ? CYS D 215 ? LYS D 210 CYS D 214 
J  1  SER D 193 ? THR D 196 ? SER D 192 THR D 195 
J  2  GLY D 222 ? ASP D 225 ? GLY D 221 ASP D 224 
K  1  ARG F 7   ? SER F 10  ? ARG F 6   SER F 9   
K  2  ARG E 28  ? ASN E 33  ? ARG E 27  ASN E 32  
K  3  THR E 40  ? TYR E 45  ? THR E 39  TYR E 44  
K  4  LEU E 53  ? LYS E 59  ? LEU E 52  LYS E 58  
K  5  ASP E 94  ? THR E 100 ? ASP E 93  THR E 99  
K  6  ILE E 85  ? THR E 91  ? ILE E 84  THR E 90  
K  7  ILE F 85  ? THR F 91  ? ILE F 84  THR F 90  
K  8  ASP F 94  ? THR F 100 ? ASP F 93  THR F 99  
K  9  LEU F 53  ? LYS F 59  ? LEU F 52  LYS F 58  
K  10 THR F 40  ? TYR F 45  ? THR F 39  TYR F 44  
K  11 ARG F 28  ? ASP F 32  ? ARG F 27  ASP F 31  
L  1  LYS E 105 ? THR E 106 ? LYS E 104 THR E 105 
L  2  LEU E 205 ? ASP E 208 ? LEU E 204 ASP E 207 
L  3  LYS E 211 ? CYS E 215 ? LYS E 210 CYS E 214 
M  1  SER E 193 ? THR E 196 ? SER E 192 THR E 195 
M  2  GLY E 222 ? ASP E 225 ? GLY E 221 ASP E 224 
N  1  LYS F 105 ? THR F 106 ? LYS F 104 THR F 105 
N  2  LEU F 205 ? ASP F 208 ? LEU F 204 ASP F 207 
N  3  LYS F 211 ? CYS F 215 ? LYS F 210 CYS F 214 
O  1  SER F 193 ? THR F 196 ? SER F 192 THR F 195 
O  2  GLY F 222 ? ASP F 225 ? GLY F 221 ASP F 224 
P  1  ARG G 7   ? SER G 10  ? ARG G 6   SER G 9   
P  2  ARG H 28  ? ASN H 33  ? ARG H 27  ASN H 32  
P  3  THR H 40  ? TYR H 45  ? THR H 39  TYR H 44  
P  4  LEU H 53  ? LYS H 59  ? LEU H 52  LYS H 58  
P  5  ASP H 94  ? THR H 100 ? ASP H 93  THR H 99  
P  6  ILE H 85  ? THR H 91  ? ILE H 84  THR H 90  
P  7  ILE G 85  ? ARG G 90  ? ILE G 84  ARG G 89  
P  8  ASP G 94  ? THR G 100 ? ASP G 93  THR G 99  
P  9  LEU G 53  ? LYS G 59  ? LEU G 52  LYS G 58  
P  10 THR G 40  ? LEU G 44  ? THR G 39  LEU G 43  
P  11 TRP G 29  ? ASP G 32  ? TRP G 28  ASP G 31  
Q  1  LYS G 105 ? THR G 106 ? LYS G 104 THR G 105 
Q  2  LEU G 205 ? ASP G 208 ? LEU G 204 ASP G 207 
Q  3  LYS G 211 ? CYS G 215 ? LYS G 210 CYS G 214 
R  1  SER G 193 ? THR G 196 ? SER G 192 THR G 195 
R  2  GLY G 222 ? ASP G 225 ? GLY G 221 ASP G 224 
S  1  LYS H 105 ? THR H 106 ? LYS H 104 THR H 105 
S  2  LEU H 205 ? ASP H 208 ? LEU H 204 ASP H 207 
S  3  LYS H 211 ? CYS H 215 ? LYS H 210 CYS H 214 
T  1  SER H 193 ? THR H 196 ? SER H 192 THR H 195 
T  2  GLY H 222 ? ASP H 225 ? GLY H 221 ASP H 224 
U  1  THR I 9   ? SER I 10  ? THR I 8   SER I 9   
U  2  ARG J 28  ? ASP J 32  ? ARG J 27  ASP J 31  
U  3  THR J 40  ? TYR J 45  ? THR J 39  TYR J 44  
U  4  LEU J 53  ? LYS J 59  ? LEU J 52  LYS J 58  
U  5  ASP J 94  ? THR J 100 ? ASP J 93  THR J 99  
U  6  ILE J 85  ? THR J 91  ? ILE J 84  THR J 90  
U  7  ILE I 85  ? THR I 91  ? ILE I 84  THR I 90  
U  8  ASP I 94  ? THR I 100 ? ASP I 93  THR I 99  
U  9  LEU I 53  ? LYS I 59  ? LEU I 52  LYS I 58  
U  10 THR I 40  ? TYR I 45  ? THR I 39  TYR I 44  
U  11 ARG I 28  ? ASP I 32  ? ARG I 27  ASP I 31  
U  12 GLU J 8   ? SER J 10  ? GLU J 7   SER J 9   
V  1  LYS I 105 ? THR I 106 ? LYS I 104 THR I 105 
V  2  LEU I 205 ? ASP I 208 ? LEU I 204 ASP I 207 
V  3  LYS I 211 ? CYS I 215 ? LYS I 210 CYS I 214 
W  1  VAL I 194 ? THR I 196 ? VAL I 193 THR I 195 
W  2  GLY I 222 ? ALA I 224 ? GLY I 221 ALA I 223 
X  1  LYS J 105 ? THR J 106 ? LYS J 104 THR J 105 
X  2  LEU J 205 ? ASP J 208 ? LEU J 204 ASP J 207 
X  3  LYS J 211 ? CYS J 215 ? LYS J 210 CYS J 214 
Y  1  SER J 193 ? THR J 196 ? SER J 192 THR J 195 
Y  2  GLY J 222 ? ASP J 225 ? GLY J 221 ASP J 224 
Z  1  ARG K 7   ? SER K 10  ? ARG K 6   SER K 9   
Z  2  ARG L 28  ? ASN L 33  ? ARG L 27  ASN L 32  
Z  3  THR L 40  ? TYR L 45  ? THR L 39  TYR L 44  
Z  4  LEU L 53  ? LYS L 59  ? LEU L 52  LYS L 58  
Z  5  ASP L 94  ? THR L 100 ? ASP L 93  THR L 99  
Z  6  ILE L 85  ? ARG L 90  ? ILE L 84  ARG L 89  
Z  7  ILE K 85  ? ARG K 90  ? ILE K 84  ARG K 89  
Z  8  ASP K 94  ? THR K 100 ? ASP K 93  THR K 99  
Z  9  LEU K 53  ? LYS K 59  ? LEU K 52  LYS K 58  
Z  10 THR K 40  ? LEU K 44  ? THR K 39  LEU K 43  
AA 1  LYS K 105 ? THR K 106 ? LYS K 104 THR K 105 
AA 2  LEU K 205 ? ASP K 208 ? LEU K 204 ASP K 207 
AA 3  LYS K 211 ? CYS K 215 ? LYS K 210 CYS K 214 
AB 1  SER K 193 ? THR K 196 ? SER K 192 THR K 195 
AB 2  GLY K 222 ? ASP K 225 ? GLY K 221 ASP K 224 
AC 1  LYS L 105 ? THR L 106 ? LYS L 104 THR L 105 
AC 2  LEU L 205 ? ASP L 208 ? LEU L 204 ASP L 207 
AC 3  LYS L 211 ? CYS L 215 ? LYS L 210 CYS L 214 
AD 1  VAL L 194 ? THR L 196 ? VAL L 193 THR L 195 
AD 2  GLY L 222 ? ALA L 224 ? GLY L 221 ALA L 223 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O ARG B 7   ? O ARG B 6   N ASN A 33  ? N ASN A 32  
A  2  3  N ARG A 28  ? N ARG A 27  O TYR A 45  ? O TYR A 44  
A  3  4  N THR A 40  ? N THR A 39  O HIS A 57  ? O HIS A 56  
A  4  5  N PHE A 54  ? N PHE A 53  O THR A 99  ? O THR A 98  
A  5  6  O LEU A 98  ? O LEU A 97  N LYS A 86  ? N LYS A 85  
A  6  7  N PHE A 88  ? N PHE A 87  O ARG B 90  ? O ARG B 89  
A  7  8  N HIS B 87  ? N HIS B 86  O LEU B 98  ? O LEU B 97  
A  8  9  O THR B 99  ? O THR B 98  N PHE B 54  ? N PHE B 53  
A  9  10 O LEU B 55  ? O LEU B 54  N TYR B 42  ? N TYR B 41  
A  10 11 O TYR B 45  ? O TYR B 44  N ARG B 28  ? N ARG B 27  
B  1  2  N LYS A 105 ? N LYS A 104 O PHE A 207 ? O PHE A 206 
B  2  3  N ILE A 206 ? N ILE A 205 O GLY A 214 ? O GLY A 213 
C  1  2  N VAL A 194 ? N VAL A 193 O ALA A 224 ? O ALA A 223 
D  1  2  N LYS B 105 ? N LYS B 104 O PHE B 207 ? O PHE B 206 
D  2  3  N ILE B 206 ? N ILE B 205 O GLY B 214 ? O GLY B 213 
E  1  2  N VAL B 194 ? N VAL B 193 O ALA B 224 ? O ALA B 223 
F  1  2  N THR C 9   ? N THR C 8   O ARG D 31  ? O ARG D 30  
F  2  3  N ASP D 32  ? N ASP D 31  O ILE D 41  ? O ILE D 40  
F  3  4  N LEU D 44  ? N LEU D 43  O LEU D 53  ? O LEU D 52  
F  4  5  N LYS D 56  ? N LYS D 55  O LEU D 97  ? O LEU D 96  
F  5  6  O LEU D 98  ? O LEU D 97  N HIS D 87  ? N HIS D 86  
F  6  7  O PHE D 88  ? O PHE D 87  N ARG C 90  ? N ARG C 89  
F  7  8  N HIS C 87  ? N HIS C 86  O LEU C 98  ? O LEU C 97  
F  8  9  O LEU C 97  ? O LEU C 96  N LYS C 56  ? N LYS C 55  
F  9  10 O LEU C 55  ? O LEU C 54  N TYR C 42  ? N TYR C 41  
F  10 11 O TYR C 45  ? O TYR C 44  N ARG C 28  ? N ARG C 27  
F  11 12 N ARG C 31  ? N ARG C 30  O THR D 9   ? O THR D 8   
G  1  2  N LYS C 105 ? N LYS C 104 O PHE C 207 ? O PHE C 206 
G  2  3  N ASP C 208 ? N ASP C 207 O LYS C 211 ? O LYS C 210 
H  1  2  N VAL C 194 ? N VAL C 193 O ALA C 224 ? O ALA C 223 
I  1  2  N LYS D 105 ? N LYS D 104 O PHE D 207 ? O PHE D 206 
I  2  3  N ILE D 206 ? N ILE D 205 O GLY D 214 ? O GLY D 213 
J  1  2  N VAL D 194 ? N VAL D 193 O ALA D 224 ? O ALA D 223 
K  1  2  O ARG F 7   ? O ARG F 6   N ASN E 33  ? N ASN E 32  
K  2  3  N ARG E 28  ? N ARG E 27  O TYR E 45  ? O TYR E 44  
K  3  4  N TYR E 42  ? N TYR E 41  O LEU E 55  ? O LEU E 54  
K  4  5  N LYS E 56  ? N LYS E 55  O LEU E 97  ? O LEU E 96  
K  5  6  O LEU E 98  ? O LEU E 97  N LYS E 86  ? N LYS E 85  
K  6  7  N PHE E 88  ? N PHE E 87  O ARG F 90  ? O ARG F 89  
K  7  8  N HIS F 87  ? N HIS F 86  O LEU F 98  ? O LEU F 97  
K  8  9  O LEU F 97  ? O LEU F 96  N LYS F 56  ? N LYS F 55  
K  9  10 O LEU F 53  ? O LEU F 52  N LEU F 44  ? N LEU F 43  
K  10 11 O TYR F 45  ? O TYR F 44  N ARG F 28  ? N ARG F 27  
L  1  2  N LYS E 105 ? N LYS E 104 O PHE E 207 ? O PHE E 206 
L  2  3  N ASP E 208 ? N ASP E 207 O LYS E 211 ? O LYS E 210 
M  1  2  N VAL E 194 ? N VAL E 193 O ALA E 224 ? O ALA E 223 
N  1  2  N LYS F 105 ? N LYS F 104 O PHE F 207 ? O PHE F 206 
N  2  3  N ILE F 206 ? N ILE F 205 O GLY F 214 ? O GLY F 213 
O  1  2  N VAL F 194 ? N VAL F 193 O ALA F 224 ? O ALA F 223 
P  1  2  N THR G 9   ? N THR G 8   O ARG H 31  ? O ARG H 30  
P  2  3  N ARG H 28  ? N ARG H 27  O TYR H 45  ? O TYR H 44  
P  3  4  N TYR H 42  ? N TYR H 41  O LEU H 55  ? O LEU H 54  
P  4  5  N PHE H 54  ? N PHE H 53  O THR H 99  ? O THR H 98  
P  5  6  O LEU H 98  ? O LEU H 97  N LYS H 86  ? N LYS H 85  
P  6  7  O PHE H 88  ? O PHE H 87  N ARG G 90  ? N ARG G 89  
P  7  8  N HIS G 87  ? N HIS G 86  O LEU G 98  ? O LEU G 97  
P  8  9  O LEU G 97  ? O LEU G 96  N LYS G 56  ? N LYS G 55  
P  9  10 O LEU G 53  ? O LEU G 52  N LEU G 44  ? N LEU G 43  
P  10 11 O ARG G 43  ? O ARG G 42  N ALA G 30  ? N ALA G 29  
Q  1  2  N LYS G 105 ? N LYS G 104 O PHE G 207 ? O PHE G 206 
Q  2  3  N ILE G 206 ? N ILE G 205 O GLY G 214 ? O GLY G 213 
R  1  2  N VAL G 194 ? N VAL G 193 O ALA G 224 ? O ALA G 223 
S  1  2  N LYS H 105 ? N LYS H 104 O PHE H 207 ? O PHE H 206 
S  2  3  N ILE H 206 ? N ILE H 205 O GLY H 214 ? O GLY H 213 
T  1  2  N VAL H 194 ? N VAL H 193 O ALA H 224 ? O ALA H 223 
U  1  2  N THR I 9   ? N THR I 8   O ARG J 31  ? O ARG J 30  
U  2  3  N ASP J 32  ? N ASP J 31  O ILE J 41  ? O ILE J 40  
U  3  4  N LEU J 44  ? N LEU J 43  O LEU J 53  ? O LEU J 52  
U  4  5  N PHE J 54  ? N PHE J 53  O THR J 99  ? O THR J 98  
U  5  6  O LEU J 98  ? O LEU J 97  N HIS J 87  ? N HIS J 86  
U  6  7  O ARG J 90  ? O ARG J 89  N PHE I 88  ? N PHE I 87  
U  7  8  N THR I 91  ? N THR I 90  O ASP I 94  ? O ASP I 93  
U  8  9  O LEU I 97  ? O LEU I 96  N LYS I 56  ? N LYS I 55  
U  9  10 O LEU I 55  ? O LEU I 54  N TYR I 42  ? N TYR I 41  
U  10 11 O TYR I 45  ? O TYR I 44  N ARG I 28  ? N ARG I 27  
U  11 12 N ARG I 31  ? N ARG I 30  O THR J 9   ? O THR J 8   
V  1  2  N LYS I 105 ? N LYS I 104 O PHE I 207 ? O PHE I 206 
V  2  3  N ASP I 208 ? N ASP I 207 O LYS I 211 ? O LYS I 210 
W  1  2  N VAL I 194 ? N VAL I 193 O ALA I 224 ? O ALA I 223 
X  1  2  N LYS J 105 ? N LYS J 104 O PHE J 207 ? O PHE J 206 
X  2  3  N ASP J 208 ? N ASP J 207 O LYS J 211 ? O LYS J 210 
Y  1  2  N THR J 196 ? N THR J 195 O GLY J 222 ? O GLY J 221 
Z  1  2  N ARG K 7   ? N ARG K 6   O ASN L 33  ? O ASN L 32  
Z  2  3  N ARG L 28  ? N ARG L 27  O TYR L 45  ? O TYR L 44  
Z  3  4  N TYR L 42  ? N TYR L 41  O LEU L 55  ? O LEU L 54  
Z  4  5  N GLY L 58  ? N GLY L 57  O ALA L 95  ? O ALA L 94  
Z  5  6  O LEU L 98  ? O LEU L 97  N HIS L 87  ? N HIS L 86  
Z  6  7  O PHE L 88  ? O PHE L 87  N ARG K 90  ? N ARG K 89  
Z  7  8  N ILE K 89  ? N ILE K 88  O TRP K 96  ? O TRP K 95  
Z  8  9  O LEU K 97  ? O LEU K 96  N LYS K 56  ? N LYS K 55  
Z  9  10 O LEU K 53  ? O LEU K 52  N LEU K 44  ? N LEU K 43  
AA 1  2  N LYS K 105 ? N LYS K 104 O PHE K 207 ? O PHE K 206 
AA 2  3  N ASP K 208 ? N ASP K 207 O LYS K 211 ? O LYS K 210 
AB 1  2  N VAL K 194 ? N VAL K 193 O ALA K 224 ? O ALA K 223 
AC 1  2  N LYS L 105 ? N LYS L 104 O PHE L 207 ? O PHE L 206 
AC 2  3  N ILE L 206 ? N ILE L 205 O GLY L 214 ? O GLY L 213 
AD 1  2  N VAL L 194 ? N VAL L 193 O ALA L 224 ? O ALA L 223 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE KAN A 301' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 0J9 A 302' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 303'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT A 304' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 305' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT A 306' 
AC7 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE KAN B 301' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE 0J9 B 302' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 303'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 304'  
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACT B 305' 
BC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT B 306' 
BC4 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE KAN C 301' 
BC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 0J9 C 302' 
BC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 0J9 C 303' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA C 304'  
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL C 305'  
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT C 306' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT C 307' 
CC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT C 308' 
CC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE KAN D 301' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT D 302' 
CC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT D 303' 
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT D 304' 
CC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT D 305' 
CC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PEG D 306' 
CC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PEG D 307' 
DC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE KAN E 301' 
DC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 0J9 E 302' 
DC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA E 303'  
DC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT E 304' 
DC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT E 305' 
DC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT E 306' 
DC7 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE KAN F 301' 
DC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 0J9 F 302' 
DC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA F 303'  
EC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA F 304'  
EC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT F 305' 
EC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT F 306' 
EC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT F 307' 
EC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT F 308' 
EC6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE KAN G 301' 
EC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 0J9 G 302' 
EC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA G 303'  
EC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA G 304'  
FC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT G 305' 
FC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT G 306' 
FC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT G 307' 
FC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE KAN H 301' 
FC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 0J9 H 302' 
FC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA H 303'  
FC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT H 304' 
FC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT H 305' 
FC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PEG H 306' 
GC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE KAN I 301' 
GC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 0J9 I 302' 
GC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA I 303'  
GC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL I 304'  
GC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT I 305' 
GC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACT I 306' 
GC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT I 307' 
GC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE KAN J 301' 
GC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 0J9 J 302' 
HC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT J 303' 
HC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE KAN K 301' 
HC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 0J9 K 302' 
HC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA K 303'  
HC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA K 304'  
HC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT K 305' 
HC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT K 306' 
HC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT K 307' 
HC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE KAN L 301' 
IC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 0J9 L 302' 
IC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA L 303'  
IC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACT L 304' 
IC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT L 305' 
IC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT L 307' 
IC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT L 308' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 21 GLN A  36  ? GLN A 35  . ? 1_555 ? 
2   AC1 21 ASP A  166 ? ASP A 165 . ? 1_555 ? 
3   AC1 21 PHE A  167 ? PHE A 166 . ? 1_555 ? 
4   AC1 21 ASP A  168 ? ASP A 167 . ? 1_555 ? 
5   AC1 21 ASP A  199 ? ASP A 198 . ? 1_555 ? 
6   AC1 21 ARG A  220 ? ARG A 219 . ? 1_555 ? 
7   AC1 21 ASN A  235 ? ASN A 234 . ? 1_555 ? 
8   AC1 21 CYS A  236 ? CYS A 235 . ? 1_555 ? 
9   AC1 21 ASP A  269 ? ASP A 268 . ? 1_555 ? 
10  AC1 21 GLU A  270 ? GLU A 269 . ? 1_555 ? 
11  AC1 21 PHE A  272 ? PHE A 271 . ? 1_555 ? 
12  AC1 21 HOH NC .   ? HOH A 405 . ? 1_555 ? 
13  AC1 21 HOH NC .   ? HOH A 427 . ? 1_555 ? 
14  AC1 21 HOH NC .   ? HOH A 450 . ? 1_555 ? 
15  AC1 21 HOH NC .   ? HOH A 480 . ? 1_555 ? 
16  AC1 21 HOH NC .   ? HOH A 482 . ? 1_555 ? 
17  AC1 21 HOH NC .   ? HOH A 491 . ? 1_555 ? 
18  AC1 21 HOH NC .   ? HOH A 661 . ? 1_555 ? 
19  AC1 21 SER B  3   ? SER B 2   . ? 1_555 ? 
20  AC1 21 HIS B  4   ? HIS B 3   . ? 1_555 ? 
21  AC1 21 ARG K  7   ? ARG K 6   . ? 1_655 ? 
22  AC2 11 ASP A  32  ? ASP A 31  . ? 1_555 ? 
23  AC2 11 ILE A  41  ? ILE A 40  . ? 1_555 ? 
24  AC2 11 PHE A  54  ? PHE A 53  . ? 1_555 ? 
25  AC2 11 PRO A  83  ? PRO A 82  . ? 1_555 ? 
26  AC2 11 THR A  100 ? THR A 99  . ? 1_555 ? 
27  AC2 11 ALA A  101 ? ALA A 100 . ? 1_555 ? 
28  AC2 11 ILE A  102 ? ILE A 101 . ? 1_555 ? 
29  AC2 11 ILE A  216 ? ILE A 215 . ? 1_555 ? 
30  AC2 11 ACT R  .   ? ACT A 305 . ? 1_555 ? 
31  AC2 11 HOH NC .   ? HOH A 409 . ? 1_555 ? 
32  AC2 11 GLN B  6   ? GLN B 5   . ? 1_555 ? 
33  AC3 6  GLY A  160 ? GLY A 159 . ? 1_555 ? 
34  AC3 6  HOH NC .   ? HOH A 456 . ? 1_555 ? 
35  AC3 6  HOH PC .   ? HOH C 536 . ? 1_555 ? 
36  AC3 6  HOH XC .   ? HOH K 426 . ? 1_555 ? 
37  AC3 6  HOH XC .   ? HOH K 474 . ? 1_555 ? 
38  AC3 6  HOH XC .   ? HOH K 605 . ? 1_555 ? 
39  AC4 4  VAL A  110 ? VAL A 109 . ? 1_555 ? 
40  AC4 4  SER A  117 ? SER A 116 . ? 1_555 ? 
41  AC4 4  GLY A  210 ? GLY A 209 . ? 1_555 ? 
42  AC4 4  HOH NC .   ? HOH A 511 . ? 1_555 ? 
43  AC5 5  VAL A  34  ? VAL A 33  . ? 1_555 ? 
44  AC5 5  THR A  106 ? THR A 105 . ? 1_555 ? 
45  AC5 5  ASP A  203 ? ASP A 202 . ? 1_555 ? 
46  AC5 5  0J9 N  .   ? 0J9 A 302 . ? 1_555 ? 
47  AC5 5  HOH OC .   ? HOH B 453 . ? 1_555 ? 
48  AC6 7  GLY A  38  ? GLY A 37  . ? 1_555 ? 
49  AC6 7  THR A  40  ? THR A 39  . ? 1_555 ? 
50  AC6 7  HIS A  57  ? HIS A 56  . ? 1_555 ? 
51  AC6 7  GLY A  58  ? GLY A 57  . ? 1_555 ? 
52  AC6 7  LYS A  59  ? LYS A 58  . ? 1_555 ? 
53  AC6 7  VAL A  62  ? VAL A 61  . ? 1_555 ? 
54  AC6 7  HOH NC .   ? HOH A 597 . ? 1_555 ? 
55  AC7 22 ASP B  166 ? ASP B 165 . ? 1_555 ? 
56  AC7 22 ASP B  168 ? ASP B 167 . ? 1_555 ? 
57  AC7 22 ASP B  199 ? ASP B 198 . ? 1_555 ? 
58  AC7 22 ASN B  235 ? ASN B 234 . ? 1_555 ? 
59  AC7 22 CYS B  236 ? CYS B 235 . ? 1_555 ? 
60  AC7 22 GLU B  239 ? GLU B 238 . ? 1_555 ? 
61  AC7 22 ASP B  269 ? ASP B 268 . ? 1_555 ? 
62  AC7 22 GLU B  270 ? GLU B 269 . ? 1_555 ? 
63  AC7 22 PHE B  272 ? PHE B 271 . ? 1_555 ? 
64  AC7 22 HOH OC .   ? HOH B 404 . ? 1_555 ? 
65  AC7 22 HOH OC .   ? HOH B 432 . ? 1_555 ? 
66  AC7 22 HOH OC .   ? HOH B 433 . ? 1_555 ? 
67  AC7 22 HOH OC .   ? HOH B 434 . ? 1_555 ? 
68  AC7 22 HOH OC .   ? HOH B 539 . ? 1_555 ? 
69  AC7 22 HOH OC .   ? HOH B 540 . ? 1_555 ? 
70  AC7 22 HOH OC .   ? HOH B 552 . ? 1_555 ? 
71  AC7 22 HOH OC .   ? HOH B 559 . ? 1_555 ? 
72  AC7 22 HOH OC .   ? HOH B 573 . ? 1_555 ? 
73  AC7 22 HOH OC .   ? HOH B 597 . ? 1_555 ? 
74  AC7 22 HOH OC .   ? HOH B 640 . ? 1_555 ? 
75  AC7 22 GLY H  253 ? GLY H 252 . ? 1_665 ? 
76  AC7 22 ASP H  255 ? ASP H 254 . ? 1_665 ? 
77  AC8 5  ILE B  41  ? ILE B 40  . ? 1_555 ? 
78  AC8 5  PHE B  54  ? PHE B 53  . ? 1_555 ? 
79  AC8 5  PRO B  83  ? PRO B 82  . ? 1_555 ? 
80  AC8 5  ILE B  102 ? ILE B 101 . ? 1_555 ? 
81  AC8 5  ASP B  217 ? ASP B 216 . ? 1_555 ? 
82  AC9 5  THR B  77  ? THR B 76  . ? 1_555 ? 
83  AC9 5  MSE B  80  ? MSE B 79  . ? 1_555 ? 
84  AC9 5  HOH OC .   ? HOH B 528 . ? 1_555 ? 
85  AC9 5  HOH OC .   ? HOH B 631 . ? 1_555 ? 
86  AC9 5  HOH OC .   ? HOH B 647 . ? 1_555 ? 
87  BC1 5  ASN B  235 ? ASN B 234 . ? 1_555 ? 
88  BC1 5  HOH OC .   ? HOH B 432 . ? 1_555 ? 
89  BC1 5  HOH OC .   ? HOH B 458 . ? 1_555 ? 
90  BC1 5  HOH OC .   ? HOH B 474 . ? 1_555 ? 
91  BC1 5  HOH OC .   ? HOH B 486 . ? 1_555 ? 
92  BC2 2  TYR B  114 ? TYR B 113 . ? 1_555 ? 
93  BC2 2  SER B  117 ? SER B 116 . ? 1_555 ? 
94  BC3 7  GLY B  38  ? GLY B 37  . ? 1_555 ? 
95  BC3 7  ALA B  39  ? ALA B 38  . ? 1_555 ? 
96  BC3 7  THR B  40  ? THR B 39  . ? 1_555 ? 
97  BC3 7  HIS B  57  ? HIS B 56  . ? 1_555 ? 
98  BC3 7  LYS B  59  ? LYS B 58  . ? 1_555 ? 
99  BC3 7  VAL B  62  ? VAL B 61  . ? 1_555 ? 
100 BC3 7  HOH OC .   ? HOH B 605 . ? 1_555 ? 
101 BC4 23 GLN C  36  ? GLN C 35  . ? 1_555 ? 
102 BC4 23 ASP C  166 ? ASP C 165 . ? 1_555 ? 
103 BC4 23 ASP C  168 ? ASP C 167 . ? 1_555 ? 
104 BC4 23 ASP C  199 ? ASP C 198 . ? 1_555 ? 
105 BC4 23 ARG C  220 ? ARG C 219 . ? 1_555 ? 
106 BC4 23 ASN C  235 ? ASN C 234 . ? 1_555 ? 
107 BC4 23 CYS C  236 ? CYS C 235 . ? 1_555 ? 
108 BC4 23 GLU C  239 ? GLU C 238 . ? 1_555 ? 
109 BC4 23 ASP C  269 ? ASP C 268 . ? 1_555 ? 
110 BC4 23 GLU C  270 ? GLU C 269 . ? 1_555 ? 
111 BC4 23 PHE C  272 ? PHE C 271 . ? 1_555 ? 
112 BC4 23 HOH PC .   ? HOH C 423 . ? 1_555 ? 
113 BC4 23 HOH PC .   ? HOH C 430 . ? 1_555 ? 
114 BC4 23 HOH PC .   ? HOH C 448 . ? 1_555 ? 
115 BC4 23 HOH PC .   ? HOH C 455 . ? 1_555 ? 
116 BC4 23 HOH PC .   ? HOH C 459 . ? 1_555 ? 
117 BC4 23 HOH PC .   ? HOH C 463 . ? 1_555 ? 
118 BC4 23 HOH PC .   ? HOH C 508 . ? 1_555 ? 
119 BC4 23 HOH PC .   ? HOH C 518 . ? 1_555 ? 
120 BC4 23 HOH PC .   ? HOH C 546 . ? 1_555 ? 
121 BC4 23 HOH PC .   ? HOH C 588 . ? 1_555 ? 
122 BC4 23 HOH PC .   ? HOH C 620 . ? 1_555 ? 
123 BC4 23 HOH PC .   ? HOH C 636 . ? 1_555 ? 
124 BC5 10 ASP C  32  ? ASP C 31  . ? 1_555 ? 
125 BC5 10 ASN C  33  ? ASN C 32  . ? 1_555 ? 
126 BC5 10 PHE C  54  ? PHE C 53  . ? 1_555 ? 
127 BC5 10 PRO C  83  ? PRO C 82  . ? 1_555 ? 
128 BC5 10 ALA C  101 ? ALA C 100 . ? 1_555 ? 
129 BC5 10 ILE C  102 ? ILE C 101 . ? 1_555 ? 
130 BC5 10 ILE C  216 ? ILE C 215 . ? 1_555 ? 
131 BC5 10 HOH PC .   ? HOH C 425 . ? 1_555 ? 
132 BC5 10 HOH PC .   ? HOH C 462 . ? 1_555 ? 
133 BC5 10 GLN D  6   ? GLN D 5   . ? 1_555 ? 
134 BC6 7  GLN C  6   ? GLN C 5   . ? 1_555 ? 
135 BC6 7  PHE D  54  ? PHE D 53  . ? 1_555 ? 
136 BC6 7  PRO D  83  ? PRO D 82  . ? 1_555 ? 
137 BC6 7  THR D  100 ? THR D 99  . ? 1_555 ? 
138 BC6 7  ILE D  102 ? ILE D 101 . ? 1_555 ? 
139 BC6 7  ASP D  217 ? ASP D 216 . ? 1_555 ? 
140 BC6 7  HOH QC .   ? HOH D 475 . ? 1_555 ? 
141 BC7 5  THR C  77  ? THR C 76  . ? 1_555 ? 
142 BC7 5  MSE C  80  ? MSE C 79  . ? 1_555 ? 
143 BC7 5  ACT EA .   ? ACT C 307 . ? 1_555 ? 
144 BC7 5  HOH PC .   ? HOH C 449 . ? 1_555 ? 
145 BC7 5  HOH PC .   ? HOH C 533 . ? 1_555 ? 
146 BC8 3  GLN C  36  ? GLN C 35  . ? 1_555 ? 
147 BC8 3  SER C  37  ? SER C 36  . ? 1_555 ? 
148 BC8 3  ALA C  39  ? ALA C 38  . ? 1_555 ? 
149 BC9 3  VAL C  110 ? VAL C 109 . ? 1_555 ? 
150 BC9 3  SER C  117 ? SER C 116 . ? 1_555 ? 
151 BC9 3  GLY C  210 ? GLY C 209 . ? 1_555 ? 
152 CC1 5  THR C  77  ? THR C 76  . ? 1_555 ? 
153 CC1 5  ALA C  78  ? ALA C 77  . ? 1_555 ? 
154 CC1 5  MSE C  80  ? MSE C 79  . ? 1_555 ? 
155 CC1 5  PRO C  81  ? PRO C 80  . ? 1_555 ? 
156 CC1 5  NA  BA .   ? NA  C 304 . ? 1_555 ? 
157 CC2 3  ARG C  31  ? ARG C 30  . ? 1_555 ? 
158 CC2 3  LEU H  244 ? LEU H 243 . ? 1_655 ? 
159 CC2 3  HOH UC .   ? HOH H 498 . ? 1_655 ? 
160 CC3 19 ASP D  166 ? ASP D 165 . ? 1_555 ? 
161 CC3 19 ASP D  168 ? ASP D 167 . ? 1_555 ? 
162 CC3 19 ASP D  199 ? ASP D 198 . ? 1_555 ? 
163 CC3 19 ASN D  235 ? ASN D 234 . ? 1_555 ? 
164 CC3 19 CYS D  236 ? CYS D 235 . ? 1_555 ? 
165 CC3 19 GLU D  239 ? GLU D 238 . ? 1_555 ? 
166 CC3 19 ASP D  269 ? ASP D 268 . ? 1_555 ? 
167 CC3 19 GLU D  270 ? GLU D 269 . ? 1_555 ? 
168 CC3 19 PHE D  272 ? PHE D 271 . ? 1_555 ? 
169 CC3 19 HOH QC .   ? HOH D 414 . ? 1_555 ? 
170 CC3 19 HOH QC .   ? HOH D 415 . ? 1_555 ? 
171 CC3 19 HOH QC .   ? HOH D 418 . ? 1_555 ? 
172 CC3 19 HOH QC .   ? HOH D 420 . ? 1_555 ? 
173 CC3 19 HOH QC .   ? HOH D 429 . ? 1_555 ? 
174 CC3 19 HOH QC .   ? HOH D 433 . ? 1_555 ? 
175 CC3 19 HOH QC .   ? HOH D 512 . ? 1_555 ? 
176 CC3 19 HOH QC .   ? HOH D 527 . ? 1_555 ? 
177 CC3 19 HOH QC .   ? HOH D 538 . ? 1_555 ? 
178 CC3 19 HOH QC .   ? HOH D 556 . ? 1_555 ? 
179 CC4 6  GLY D  38  ? GLY D 37  . ? 1_555 ? 
180 CC4 6  THR D  40  ? THR D 39  . ? 1_555 ? 
181 CC4 6  HIS D  57  ? HIS D 56  . ? 1_555 ? 
182 CC4 6  GLY D  58  ? GLY D 57  . ? 1_555 ? 
183 CC4 6  LYS D  59  ? LYS D 58  . ? 1_555 ? 
184 CC4 6  VAL D  62  ? VAL D 61  . ? 1_555 ? 
185 CC5 5  PRO D  188 ? PRO D 187 . ? 1_555 ? 
186 CC5 5  PHE D  189 ? PHE D 188 . ? 1_555 ? 
187 CC5 5  SER D  190 ? SER D 189 . ? 1_555 ? 
188 CC5 5  HOH QC .   ? HOH D 453 . ? 1_555 ? 
189 CC5 5  ARG I  15  ? ARG I 14  . ? 1_555 ? 
190 CC6 4  PHE D  108 ? PHE D 107 . ? 1_555 ? 
191 CC6 4  GLU D  112 ? GLU D 111 . ? 1_555 ? 
192 CC6 4  GLU D  239 ? GLU D 238 . ? 1_555 ? 
193 CC6 4  GLU L  177 ? GLU L 176 . ? 1_545 ? 
194 CC7 5  THR D  77  ? THR D 76  . ? 1_555 ? 
195 CC7 5  ALA D  78  ? ALA D 77  . ? 1_555 ? 
196 CC7 5  MSE D  80  ? MSE D 79  . ? 1_555 ? 
197 CC7 5  PRO D  81  ? PRO D 80  . ? 1_555 ? 
198 CC7 5  ARG D  131 ? ARG D 130 . ? 1_555 ? 
199 CC8 5  ARG D  130 ? ARG D 129 . ? 1_555 ? 
200 CC8 5  SER D  134 ? SER D 133 . ? 1_555 ? 
201 CC8 5  ARG D  226 ? ARG D 225 . ? 1_555 ? 
202 CC8 5  TYR D  252 ? TYR D 251 . ? 1_555 ? 
203 CC8 5  HOH QC .   ? HOH D 567 . ? 1_555 ? 
204 CC9 3  TYR D  114 ? TYR D 113 . ? 1_555 ? 
205 CC9 3  ASN D  120 ? ASN D 119 . ? 1_555 ? 
206 CC9 3  GLY D  210 ? GLY D 209 . ? 1_555 ? 
207 DC1 22 GLN E  36  ? GLN E 35  . ? 1_555 ? 
208 DC1 22 ASP E  166 ? ASP E 165 . ? 1_555 ? 
209 DC1 22 PHE E  167 ? PHE E 166 . ? 1_555 ? 
210 DC1 22 ASP E  168 ? ASP E 167 . ? 1_555 ? 
211 DC1 22 ASP E  199 ? ASP E 198 . ? 1_555 ? 
212 DC1 22 ARG E  220 ? ARG E 219 . ? 1_555 ? 
213 DC1 22 ASN E  235 ? ASN E 234 . ? 1_555 ? 
214 DC1 22 ASP E  269 ? ASP E 268 . ? 1_555 ? 
215 DC1 22 GLU E  270 ? GLU E 269 . ? 1_555 ? 
216 DC1 22 PHE E  272 ? PHE E 271 . ? 1_555 ? 
217 DC1 22 HOH RC .   ? HOH E 403 . ? 1_555 ? 
218 DC1 22 HOH RC .   ? HOH E 407 . ? 1_555 ? 
219 DC1 22 HOH RC .   ? HOH E 420 . ? 1_555 ? 
220 DC1 22 HOH RC .   ? HOH E 425 . ? 1_555 ? 
221 DC1 22 HOH RC .   ? HOH E 427 . ? 1_555 ? 
222 DC1 22 HOH RC .   ? HOH E 462 . ? 1_555 ? 
223 DC1 22 HOH RC .   ? HOH E 496 . ? 1_555 ? 
224 DC1 22 HOH RC .   ? HOH E 512 . ? 1_555 ? 
225 DC1 22 SER F  3   ? SER F 2   . ? 1_555 ? 
226 DC1 22 HIS F  4   ? HIS F 3   . ? 1_555 ? 
227 DC1 22 HOH SC .   ? HOH F 488 . ? 1_555 ? 
228 DC1 22 ARG G  7   ? ARG G 6   . ? 1_655 ? 
229 DC2 12 ASP E  32  ? ASP E 31  . ? 1_555 ? 
230 DC2 12 ILE E  41  ? ILE E 40  . ? 1_555 ? 
231 DC2 12 PHE E  54  ? PHE E 53  . ? 1_555 ? 
232 DC2 12 PRO E  83  ? PRO E 82  . ? 1_555 ? 
233 DC2 12 ALA E  101 ? ALA E 100 . ? 1_555 ? 
234 DC2 12 ILE E  102 ? ILE E 101 . ? 1_555 ? 
235 DC2 12 ILE E  216 ? ILE E 215 . ? 1_555 ? 
236 DC2 12 ASP E  217 ? ASP E 216 . ? 1_555 ? 
237 DC2 12 ACT SA .   ? ACT E 306 . ? 1_555 ? 
238 DC2 12 HOH RC .   ? HOH E 413 . ? 1_555 ? 
239 DC2 12 HOH RC .   ? HOH E 439 . ? 1_555 ? 
240 DC2 12 GLN F  6   ? GLN F 5   . ? 1_555 ? 
241 DC3 5  GLY E  160 ? GLY E 159 . ? 1_555 ? 
242 DC3 5  HOH RC .   ? HOH E 482 . ? 1_555 ? 
243 DC3 5  HOH TC .   ? HOH G 413 . ? 1_555 ? 
244 DC3 5  HOH TC .   ? HOH G 473 . ? 1_555 ? 
245 DC3 5  HOH VC .   ? HOH I 660 . ? 1_444 ? 
246 DC4 6  GLY E  38  ? GLY E 37  . ? 1_555 ? 
247 DC4 6  THR E  40  ? THR E 39  . ? 1_555 ? 
248 DC4 6  HIS E  57  ? HIS E 56  . ? 1_555 ? 
249 DC4 6  GLY E  58  ? GLY E 57  . ? 1_555 ? 
250 DC4 6  LYS E  59  ? LYS E 58  . ? 1_555 ? 
251 DC4 6  VAL E  62  ? VAL E 61  . ? 1_555 ? 
252 DC5 4  VAL E  110 ? VAL E 109 . ? 1_555 ? 
253 DC5 4  SER E  117 ? SER E 116 . ? 1_555 ? 
254 DC5 4  GLY E  210 ? GLY E 209 . ? 1_555 ? 
255 DC5 4  HOH RC .   ? HOH E 459 . ? 1_555 ? 
256 DC6 4  VAL E  34  ? VAL E 33  . ? 1_555 ? 
257 DC6 4  ASP E  203 ? ASP E 202 . ? 1_555 ? 
258 DC6 4  0J9 OA .   ? 0J9 E 302 . ? 1_555 ? 
259 DC6 4  GLN F  6   ? GLN F 5   . ? 1_555 ? 
260 DC7 21 ASP F  166 ? ASP F 165 . ? 1_555 ? 
261 DC7 21 ASP F  168 ? ASP F 167 . ? 1_555 ? 
262 DC7 21 ASP F  199 ? ASP F 198 . ? 1_555 ? 
263 DC7 21 ARG F  220 ? ARG F 219 . ? 1_555 ? 
264 DC7 21 ASN F  235 ? ASN F 234 . ? 1_555 ? 
265 DC7 21 CYS F  236 ? CYS F 235 . ? 1_555 ? 
266 DC7 21 GLU F  239 ? GLU F 238 . ? 1_555 ? 
267 DC7 21 ASP F  269 ? ASP F 268 . ? 1_555 ? 
268 DC7 21 GLU F  270 ? GLU F 269 . ? 1_555 ? 
269 DC7 21 PHE F  272 ? PHE F 271 . ? 1_555 ? 
270 DC7 21 HOH SC .   ? HOH F 409 . ? 1_555 ? 
271 DC7 21 HOH SC .   ? HOH F 415 . ? 1_555 ? 
272 DC7 21 HOH SC .   ? HOH F 429 . ? 1_555 ? 
273 DC7 21 HOH SC .   ? HOH F 432 . ? 1_555 ? 
274 DC7 21 HOH SC .   ? HOH F 446 . ? 1_555 ? 
275 DC7 21 HOH SC .   ? HOH F 468 . ? 1_555 ? 
276 DC7 21 HOH SC .   ? HOH F 477 . ? 1_555 ? 
277 DC7 21 HOH SC .   ? HOH F 492 . ? 1_555 ? 
278 DC7 21 HOH SC .   ? HOH F 507 . ? 1_555 ? 
279 DC7 21 HOH SC .   ? HOH F 528 . ? 1_555 ? 
280 DC7 21 GLY L  253 ? GLY L 252 . ? 1_554 ? 
281 DC8 6  ASN F  33  ? ASN F 32  . ? 1_555 ? 
282 DC8 6  PHE F  54  ? PHE F 53  . ? 1_555 ? 
283 DC8 6  PRO F  83  ? PRO F 82  . ? 1_555 ? 
284 DC8 6  ILE F  102 ? ILE F 101 . ? 1_555 ? 
285 DC8 6  ILE F  216 ? ILE F 215 . ? 1_555 ? 
286 DC8 6  HOH SC .   ? HOH F 506 . ? 1_555 ? 
287 DC9 5  THR F  77  ? THR F 76  . ? 1_555 ? 
288 DC9 5  MSE F  80  ? MSE F 79  . ? 1_555 ? 
289 DC9 5  HOH SC .   ? HOH F 486 . ? 1_555 ? 
290 DC9 5  HOH SC .   ? HOH F 623 . ? 1_555 ? 
291 DC9 5  HOH SC .   ? HOH F 643 . ? 1_555 ? 
292 EC1 5  ASN F  235 ? ASN F 234 . ? 1_555 ? 
293 EC1 5  HOH SC .   ? HOH F 409 . ? 1_555 ? 
294 EC1 5  HOH SC .   ? HOH F 419 . ? 1_555 ? 
295 EC1 5  HOH SC .   ? HOH F 453 . ? 1_555 ? 
296 EC1 5  HOH SC .   ? HOH F 462 . ? 1_555 ? 
297 EC2 3  VAL F  110 ? VAL F 109 . ? 1_555 ? 
298 EC2 3  TYR F  114 ? TYR F 113 . ? 1_555 ? 
299 EC2 3  GLY F  210 ? GLY F 209 . ? 1_555 ? 
300 EC3 3  MSE F  259 ? MSE F 258 . ? 1_555 ? 
301 EC3 3  GLN F  263 ? GLN F 262 . ? 1_555 ? 
302 EC3 3  HOH SC .   ? HOH F 500 . ? 1_555 ? 
303 EC4 5  ARG F  130 ? ARG F 129 . ? 1_555 ? 
304 EC4 5  ARG F  226 ? ARG F 225 . ? 1_555 ? 
305 EC4 5  TYR F  252 ? TYR F 251 . ? 1_555 ? 
306 EC4 5  HOH SC .   ? HOH F 565 . ? 1_555 ? 
307 EC4 5  HOH SC .   ? HOH F 625 . ? 1_555 ? 
308 EC5 8  GLY F  38  ? GLY F 37  . ? 1_555 ? 
309 EC5 8  ALA F  39  ? ALA F 38  . ? 1_555 ? 
310 EC5 8  THR F  40  ? THR F 39  . ? 1_555 ? 
311 EC5 8  HIS F  57  ? HIS F 56  . ? 1_555 ? 
312 EC5 8  GLY F  58  ? GLY F 57  . ? 1_555 ? 
313 EC5 8  LYS F  59  ? LYS F 58  . ? 1_555 ? 
314 EC5 8  VAL F  62  ? VAL F 61  . ? 1_555 ? 
315 EC5 8  HOH SC .   ? HOH F 586 . ? 1_555 ? 
316 EC6 21 ASP G  166 ? ASP G 165 . ? 1_555 ? 
317 EC6 21 ASP G  168 ? ASP G 167 . ? 1_555 ? 
318 EC6 21 ASP G  199 ? ASP G 198 . ? 1_555 ? 
319 EC6 21 ASN G  235 ? ASN G 234 . ? 1_555 ? 
320 EC6 21 CYS G  236 ? CYS G 235 . ? 1_555 ? 
321 EC6 21 GLU G  239 ? GLU G 238 . ? 1_555 ? 
322 EC6 21 ASP G  269 ? ASP G 268 . ? 1_555 ? 
323 EC6 21 GLU G  270 ? GLU G 269 . ? 1_555 ? 
324 EC6 21 PHE G  272 ? PHE G 271 . ? 1_555 ? 
325 EC6 21 HOH TC .   ? HOH G 411 . ? 1_555 ? 
326 EC6 21 HOH TC .   ? HOH G 414 . ? 1_555 ? 
327 EC6 21 HOH TC .   ? HOH G 422 . ? 1_555 ? 
328 EC6 21 HOH TC .   ? HOH G 431 . ? 1_555 ? 
329 EC6 21 HOH TC .   ? HOH G 448 . ? 1_555 ? 
330 EC6 21 HOH TC .   ? HOH G 480 . ? 1_555 ? 
331 EC6 21 HOH TC .   ? HOH G 482 . ? 1_555 ? 
332 EC6 21 HOH TC .   ? HOH G 483 . ? 1_555 ? 
333 EC6 21 HOH TC .   ? HOH G 495 . ? 1_555 ? 
334 EC6 21 HOH TC .   ? HOH G 504 . ? 1_555 ? 
335 EC6 21 HOH TC .   ? HOH G 579 . ? 1_555 ? 
336 EC6 21 GLY I  253 ? GLY I 252 . ? 1_444 ? 
337 EC7 6  PHE G  54  ? PHE G 53  . ? 1_555 ? 
338 EC7 6  PRO G  83  ? PRO G 82  . ? 1_555 ? 
339 EC7 6  ILE G  102 ? ILE G 101 . ? 1_555 ? 
340 EC7 6  ILE G  216 ? ILE G 215 . ? 1_555 ? 
341 EC7 6  HOH TC .   ? HOH G 585 . ? 1_555 ? 
342 EC7 6  HOH TC .   ? HOH G 649 . ? 1_555 ? 
343 EC8 5  THR G  77  ? THR G 76  . ? 1_555 ? 
344 EC8 5  MSE G  80  ? MSE G 79  . ? 1_555 ? 
345 EC8 5  ACT GB .   ? ACT G 306 . ? 1_555 ? 
346 EC8 5  HOH TC .   ? HOH G 539 . ? 1_555 ? 
347 EC8 5  HOH TC .   ? HOH G 575 . ? 1_555 ? 
348 EC9 5  ASN G  235 ? ASN G 234 . ? 1_555 ? 
349 EC9 5  HOH TC .   ? HOH G 411 . ? 1_555 ? 
350 EC9 5  HOH TC .   ? HOH G 421 . ? 1_555 ? 
351 EC9 5  HOH TC .   ? HOH G 453 . ? 1_555 ? 
352 EC9 5  HOH TC .   ? HOH G 467 . ? 1_555 ? 
353 FC1 4  VAL G  110 ? VAL G 109 . ? 1_555 ? 
354 FC1 4  TYR G  114 ? TYR G 113 . ? 1_555 ? 
355 FC1 4  SER G  117 ? SER G 116 . ? 1_555 ? 
356 FC1 4  ILE G  121 ? ILE G 120 . ? 1_555 ? 
357 FC2 5  ALA G  78  ? ALA G 77  . ? 1_555 ? 
358 FC2 5  PHE G  79  ? PHE G 78  . ? 1_555 ? 
359 FC2 5  MSE G  80  ? MSE G 79  . ? 1_555 ? 
360 FC2 5  PRO G  81  ? PRO G 80  . ? 1_555 ? 
361 FC2 5  NA  DB .   ? NA  G 303 . ? 1_555 ? 
362 FC3 4  TRP G  234 ? TRP G 233 . ? 1_555 ? 
363 FC3 4  MSE G  259 ? MSE G 258 . ? 1_555 ? 
364 FC3 4  GLN G  263 ? GLN G 262 . ? 1_555 ? 
365 FC3 4  HOH TC .   ? HOH G 486 . ? 1_555 ? 
366 FC4 21 SER G  3   ? SER G 2   . ? 1_555 ? 
367 FC4 21 HIS G  4   ? HIS G 3   . ? 1_555 ? 
368 FC4 21 HOH TC .   ? HOH G 503 . ? 1_555 ? 
369 FC4 21 ASP H  166 ? ASP H 165 . ? 1_555 ? 
370 FC4 21 ASP H  168 ? ASP H 167 . ? 1_555 ? 
371 FC4 21 ASP H  199 ? ASP H 198 . ? 1_555 ? 
372 FC4 21 ASN H  235 ? ASN H 234 . ? 1_555 ? 
373 FC4 21 CYS H  236 ? CYS H 235 . ? 1_555 ? 
374 FC4 21 GLU H  239 ? GLU H 238 . ? 1_555 ? 
375 FC4 21 ASP H  269 ? ASP H 268 . ? 1_555 ? 
376 FC4 21 GLU H  270 ? GLU H 269 . ? 1_555 ? 
377 FC4 21 PHE H  272 ? PHE H 271 . ? 1_555 ? 
378 FC4 21 HOH UC .   ? HOH H 424 . ? 1_555 ? 
379 FC4 21 HOH UC .   ? HOH H 429 . ? 1_555 ? 
380 FC4 21 HOH UC .   ? HOH H 439 . ? 1_555 ? 
381 FC4 21 HOH UC .   ? HOH H 443 . ? 1_555 ? 
382 FC4 21 HOH UC .   ? HOH H 448 . ? 1_555 ? 
383 FC4 21 HOH UC .   ? HOH H 478 . ? 1_555 ? 
384 FC4 21 HOH UC .   ? HOH H 499 . ? 1_555 ? 
385 FC4 21 HOH UC .   ? HOH H 511 . ? 1_555 ? 
386 FC4 21 HOH UC .   ? HOH H 548 . ? 1_555 ? 
387 FC5 12 GLN G  6   ? GLN G 5   . ? 1_555 ? 
388 FC5 12 ASP H  32  ? ASP H 31  . ? 1_555 ? 
389 FC5 12 VAL H  34  ? VAL H 33  . ? 1_555 ? 
390 FC5 12 PHE H  54  ? PHE H 53  . ? 1_555 ? 
391 FC5 12 PRO H  83  ? PRO H 82  . ? 1_555 ? 
392 FC5 12 ALA H  101 ? ALA H 100 . ? 1_555 ? 
393 FC5 12 ILE H  102 ? ILE H 101 . ? 1_555 ? 
394 FC5 12 ILE H  216 ? ILE H 215 . ? 1_555 ? 
395 FC5 12 ASP H  217 ? ASP H 216 . ? 1_555 ? 
396 FC5 12 ACT NB .   ? ACT H 304 . ? 1_555 ? 
397 FC5 12 HOH UC .   ? HOH H 407 . ? 1_555 ? 
398 FC5 12 HOH UC .   ? HOH H 467 . ? 1_555 ? 
399 FC6 5  THR H  77  ? THR H 76  . ? 1_555 ? 
400 FC6 5  MSE H  80  ? MSE H 79  . ? 1_555 ? 
401 FC6 5  ACT JB .   ? ACT H 305 . ? 1_555 ? 
402 FC6 5  HOH UC .   ? HOH H 529 . ? 1_555 ? 
403 FC6 5  HOH UC .   ? HOH H 530 . ? 1_555 ? 
404 FC7 3  HOH TC .   ? HOH G 449 . ? 1_555 ? 
405 FC7 3  ASP H  203 ? ASP H 202 . ? 1_555 ? 
406 FC7 3  0J9 MB .   ? 0J9 H 302 . ? 1_555 ? 
407 FC8 6  THR H  77  ? THR H 76  . ? 1_555 ? 
408 FC8 6  ALA H  78  ? ALA H 77  . ? 1_555 ? 
409 FC8 6  PHE H  79  ? PHE H 78  . ? 1_555 ? 
410 FC8 6  MSE H  80  ? MSE H 79  . ? 1_555 ? 
411 FC8 6  PRO H  81  ? PRO H 80  . ? 1_555 ? 
412 FC8 6  NA  IB .   ? NA  H 303 . ? 1_555 ? 
413 FC9 2  ARG D  15  ? ARG D 14  . ? 1_455 ? 
414 FC9 2  SER H  117 ? SER H 116 . ? 1_555 ? 
415 GC1 23 ARG F  7   ? ARG F 6   . ? 1_666 ? 
416 GC1 23 HOH SC .   ? HOH F 476 . ? 1_666 ? 
417 GC1 23 GLN I  36  ? GLN I 35  . ? 1_555 ? 
418 GC1 23 ASP I  166 ? ASP I 165 . ? 1_555 ? 
419 GC1 23 ASP I  168 ? ASP I 167 . ? 1_555 ? 
420 GC1 23 ASP I  199 ? ASP I 198 . ? 1_555 ? 
421 GC1 23 ARG I  220 ? ARG I 219 . ? 1_555 ? 
422 GC1 23 ASN I  235 ? ASN I 234 . ? 1_555 ? 
423 GC1 23 CYS I  236 ? CYS I 235 . ? 1_555 ? 
424 GC1 23 GLU I  239 ? GLU I 238 . ? 1_555 ? 
425 GC1 23 ASP I  269 ? ASP I 268 . ? 1_555 ? 
426 GC1 23 GLU I  270 ? GLU I 269 . ? 1_555 ? 
427 GC1 23 PHE I  272 ? PHE I 271 . ? 1_555 ? 
428 GC1 23 HOH VC .   ? HOH I 424 . ? 1_555 ? 
429 GC1 23 HOH VC .   ? HOH I 425 . ? 1_555 ? 
430 GC1 23 HOH VC .   ? HOH I 447 . ? 1_555 ? 
431 GC1 23 HOH VC .   ? HOH I 494 . ? 1_555 ? 
432 GC1 23 HOH VC .   ? HOH I 507 . ? 1_555 ? 
433 GC1 23 HOH VC .   ? HOH I 542 . ? 1_555 ? 
434 GC1 23 HOH VC .   ? HOH I 558 . ? 1_555 ? 
435 GC1 23 HOH VC .   ? HOH I 600 . ? 1_555 ? 
436 GC1 23 SER J  3   ? SER J 2   . ? 1_555 ? 
437 GC1 23 HOH WC .   ? HOH J 496 . ? 1_555 ? 
438 GC2 10 ASP I  32  ? ASP I 31  . ? 1_555 ? 
439 GC2 10 ILE I  41  ? ILE I 40  . ? 1_555 ? 
440 GC2 10 PHE I  54  ? PHE I 53  . ? 1_555 ? 
441 GC2 10 PRO I  83  ? PRO I 82  . ? 1_555 ? 
442 GC2 10 ALA I  101 ? ALA I 100 . ? 1_555 ? 
443 GC2 10 ILE I  102 ? ILE I 101 . ? 1_555 ? 
444 GC2 10 ILE I  216 ? ILE I 215 . ? 1_555 ? 
445 GC2 10 ASP I  217 ? ASP I 216 . ? 1_555 ? 
446 GC2 10 HOH VC .   ? HOH I 446 . ? 1_555 ? 
447 GC2 10 GLN J  6   ? GLN J 5   . ? 1_555 ? 
448 GC3 5  THR I  77  ? THR I 76  . ? 1_555 ? 
449 GC3 5  MSE I  80  ? MSE I 79  . ? 1_555 ? 
450 GC3 5  ACT SB .   ? ACT I 305 . ? 1_555 ? 
451 GC3 5  HOH VC .   ? HOH I 456 . ? 1_555 ? 
452 GC3 5  HOH VC .   ? HOH I 492 . ? 1_555 ? 
453 GC4 5  GLN I  36  ? GLN I 35  . ? 1_555 ? 
454 GC4 5  SER I  37  ? SER I 36  . ? 1_555 ? 
455 GC4 5  ALA I  39  ? ALA I 38  . ? 1_555 ? 
456 GC4 5  LYS I  56  ? LYS I 55  . ? 1_555 ? 
457 GC4 5  HOH VC .   ? HOH I 476 . ? 1_555 ? 
458 GC5 6  THR I  77  ? THR I 76  . ? 1_555 ? 
459 GC5 6  ALA I  78  ? ALA I 77  . ? 1_555 ? 
460 GC5 6  PHE I  79  ? PHE I 78  . ? 1_555 ? 
461 GC5 6  MSE I  80  ? MSE I 79  . ? 1_555 ? 
462 GC5 6  PRO I  81  ? PRO I 80  . ? 1_555 ? 
463 GC5 6  NA  QB .   ? NA  I 303 . ? 1_555 ? 
464 GC6 2  SER I  117 ? SER I 116 . ? 1_555 ? 
465 GC6 2  HOH VC .   ? HOH I 644 . ? 1_555 ? 
466 GC7 3  ASP I  203 ? ASP I 202 . ? 1_555 ? 
467 GC7 3  HOH VC .   ? HOH I 653 . ? 1_555 ? 
468 GC7 3  GLN J  6   ? GLN J 5   . ? 1_555 ? 
469 GC8 17 HOH NC .   ? HOH A 536 . ? 1_556 ? 
470 GC8 17 ASP J  166 ? ASP J 165 . ? 1_555 ? 
471 GC8 17 ASP J  168 ? ASP J 167 . ? 1_555 ? 
472 GC8 17 ASP J  199 ? ASP J 198 . ? 1_555 ? 
473 GC8 17 ASN J  235 ? ASN J 234 . ? 1_555 ? 
474 GC8 17 CYS J  236 ? CYS J 235 . ? 1_555 ? 
475 GC8 17 ASP J  269 ? ASP J 268 . ? 1_555 ? 
476 GC8 17 GLU J  270 ? GLU J 269 . ? 1_555 ? 
477 GC8 17 PHE J  272 ? PHE J 271 . ? 1_555 ? 
478 GC8 17 HOH WC .   ? HOH J 409 . ? 1_555 ? 
479 GC8 17 HOH WC .   ? HOH J 426 . ? 1_555 ? 
480 GC8 17 HOH WC .   ? HOH J 435 . ? 1_555 ? 
481 GC8 17 HOH WC .   ? HOH J 436 . ? 1_555 ? 
482 GC8 17 HOH WC .   ? HOH J 454 . ? 1_555 ? 
483 GC8 17 HOH WC .   ? HOH J 468 . ? 1_555 ? 
484 GC8 17 HOH WC .   ? HOH J 483 . ? 1_555 ? 
485 GC8 17 HOH WC .   ? HOH J 540 . ? 1_555 ? 
486 GC9 8  ASP J  32  ? ASP J 31  . ? 1_555 ? 
487 GC9 8  ILE J  41  ? ILE J 40  . ? 1_555 ? 
488 GC9 8  PHE J  54  ? PHE J 53  . ? 1_555 ? 
489 GC9 8  PRO J  83  ? PRO J 82  . ? 1_555 ? 
490 GC9 8  THR J  100 ? THR J 99  . ? 1_555 ? 
491 GC9 8  ALA J  101 ? ALA J 100 . ? 1_555 ? 
492 GC9 8  ILE J  102 ? ILE J 101 . ? 1_555 ? 
493 GC9 8  HOH WC .   ? HOH J 516 . ? 1_555 ? 
494 HC1 7  GLY J  38  ? GLY J 37  . ? 1_555 ? 
495 HC1 7  ALA J  39  ? ALA J 38  . ? 1_555 ? 
496 HC1 7  THR J  40  ? THR J 39  . ? 1_555 ? 
497 HC1 7  HIS J  57  ? HIS J 56  . ? 1_555 ? 
498 HC1 7  GLY J  58  ? GLY J 57  . ? 1_555 ? 
499 HC1 7  LYS J  59  ? LYS J 58  . ? 1_555 ? 
500 HC1 7  VAL J  62  ? VAL J 61  . ? 1_555 ? 
501 HC2 23 GLY C  253 ? GLY C 252 . ? 1_555 ? 
502 HC2 23 ASP C  255 ? ASP C 254 . ? 1_555 ? 
503 HC2 23 HOH PC .   ? HOH C 403 . ? 1_555 ? 
504 HC2 23 ASP K  166 ? ASP K 165 . ? 1_555 ? 
505 HC2 23 ASP K  168 ? ASP K 167 . ? 1_555 ? 
506 HC2 23 ASP K  199 ? ASP K 198 . ? 1_555 ? 
507 HC2 23 ASN K  235 ? ASN K 234 . ? 1_555 ? 
508 HC2 23 CYS K  236 ? CYS K 235 . ? 1_555 ? 
509 HC2 23 GLU K  239 ? GLU K 238 . ? 1_555 ? 
510 HC2 23 ASP K  269 ? ASP K 268 . ? 1_555 ? 
511 HC2 23 GLU K  270 ? GLU K 269 . ? 1_555 ? 
512 HC2 23 PHE K  272 ? PHE K 271 . ? 1_555 ? 
513 HC2 23 HOH XC .   ? HOH K 409 . ? 1_555 ? 
514 HC2 23 HOH XC .   ? HOH K 421 . ? 1_555 ? 
515 HC2 23 HOH XC .   ? HOH K 429 . ? 1_555 ? 
516 HC2 23 HOH XC .   ? HOH K 462 . ? 1_555 ? 
517 HC2 23 HOH XC .   ? HOH K 463 . ? 1_555 ? 
518 HC2 23 HOH XC .   ? HOH K 505 . ? 1_555 ? 
519 HC2 23 HOH XC .   ? HOH K 506 . ? 1_555 ? 
520 HC2 23 HOH XC .   ? HOH K 513 . ? 1_555 ? 
521 HC2 23 HOH XC .   ? HOH K 528 . ? 1_555 ? 
522 HC2 23 HOH XC .   ? HOH K 529 . ? 1_555 ? 
523 HC2 23 HOH XC .   ? HOH K 584 . ? 1_555 ? 
524 HC3 8  ASP K  32  ? ASP K 31  . ? 1_555 ? 
525 HC3 8  PHE K  54  ? PHE K 53  . ? 1_555 ? 
526 HC3 8  PRO K  83  ? PRO K 82  . ? 1_555 ? 
527 HC3 8  THR K  100 ? THR K 99  . ? 1_555 ? 
528 HC3 8  ILE K  102 ? ILE K 101 . ? 1_555 ? 
529 HC3 8  HOH XC .   ? HOH K 559 . ? 1_555 ? 
530 HC3 8  HOH XC .   ? HOH K 582 . ? 1_555 ? 
531 HC3 8  HOH XC .   ? HOH K 598 . ? 1_555 ? 
532 HC4 5  THR K  77  ? THR K 76  . ? 1_555 ? 
533 HC4 5  MSE K  80  ? MSE K 79  . ? 1_555 ? 
534 HC4 5  HOH XC .   ? HOH K 481 . ? 1_555 ? 
535 HC4 5  HOH XC .   ? HOH K 601 . ? 1_555 ? 
536 HC4 5  HOH XC .   ? HOH K 658 . ? 1_555 ? 
537 HC5 5  HOH PC .   ? HOH C 403 . ? 1_555 ? 
538 HC5 5  ASN K  235 ? ASN K 234 . ? 1_555 ? 
539 HC5 5  HOH XC .   ? HOH K 424 . ? 1_555 ? 
540 HC5 5  HOH XC .   ? HOH K 459 . ? 1_555 ? 
541 HC5 5  HOH XC .   ? HOH K 485 . ? 1_555 ? 
542 HC6 4  TRP K  234 ? TRP K 233 . ? 1_555 ? 
543 HC6 4  MSE K  259 ? MSE K 258 . ? 1_555 ? 
544 HC6 4  GLN K  263 ? GLN K 262 . ? 1_555 ? 
545 HC6 4  HOH XC .   ? HOH K 547 . ? 1_555 ? 
546 HC7 4  TYR K  114 ? TYR K 113 . ? 1_555 ? 
547 HC7 4  SER K  117 ? SER K 116 . ? 1_555 ? 
548 HC7 4  GLY K  210 ? GLY K 209 . ? 1_555 ? 
549 HC7 4  HOH XC .   ? HOH K 647 . ? 1_555 ? 
550 HC8 6  GLY K  38  ? GLY K 37  . ? 1_555 ? 
551 HC8 6  ALA K  39  ? ALA K 38  . ? 1_555 ? 
552 HC8 6  HIS K  57  ? HIS K 56  . ? 1_555 ? 
553 HC8 6  GLY K  58  ? GLY K 57  . ? 1_555 ? 
554 HC8 6  LYS K  59  ? LYS K 58  . ? 1_555 ? 
555 HC8 6  VAL K  62  ? VAL K 61  . ? 1_555 ? 
556 HC9 21 ARG J  7   ? ARG J 6   . ? 1_455 ? 
557 HC9 21 SER K  3   ? SER K 2   . ? 1_555 ? 
558 HC9 21 HIS K  4   ? HIS K 3   . ? 1_555 ? 
559 HC9 21 ASP L  166 ? ASP L 165 . ? 1_555 ? 
560 HC9 21 ASP L  168 ? ASP L 167 . ? 1_555 ? 
561 HC9 21 ASP L  199 ? ASP L 198 . ? 1_555 ? 
562 HC9 21 ASN L  235 ? ASN L 234 . ? 1_555 ? 
563 HC9 21 CYS L  236 ? CYS L 235 . ? 1_555 ? 
564 HC9 21 GLU L  239 ? GLU L 238 . ? 1_555 ? 
565 HC9 21 ASP L  269 ? ASP L 268 . ? 1_555 ? 
566 HC9 21 GLU L  270 ? GLU L 269 . ? 1_555 ? 
567 HC9 21 PHE L  272 ? PHE L 271 . ? 1_555 ? 
568 HC9 21 HOH YC .   ? HOH L 422 . ? 1_555 ? 
569 HC9 21 HOH YC .   ? HOH L 439 . ? 1_555 ? 
570 HC9 21 HOH YC .   ? HOH L 442 . ? 1_555 ? 
571 HC9 21 HOH YC .   ? HOH L 463 . ? 1_555 ? 
572 HC9 21 HOH YC .   ? HOH L 465 . ? 1_555 ? 
573 HC9 21 HOH YC .   ? HOH L 469 . ? 1_555 ? 
574 HC9 21 HOH YC .   ? HOH L 490 . ? 1_555 ? 
575 HC9 21 HOH YC .   ? HOH L 521 . ? 1_555 ? 
576 HC9 21 HOH YC .   ? HOH L 652 . ? 1_555 ? 
577 IC1 11 ASP L  32  ? ASP L 31  . ? 1_555 ? 
578 IC1 11 VAL L  34  ? VAL L 33  . ? 1_555 ? 
579 IC1 11 PHE L  54  ? PHE L 53  . ? 1_555 ? 
580 IC1 11 PRO L  83  ? PRO L 82  . ? 1_555 ? 
581 IC1 11 ALA L  101 ? ALA L 100 . ? 1_555 ? 
582 IC1 11 ILE L  102 ? ILE L 101 . ? 1_555 ? 
583 IC1 11 ILE L  216 ? ILE L 215 . ? 1_555 ? 
584 IC1 11 ASP L  217 ? ASP L 216 . ? 1_555 ? 
585 IC1 11 ACT MC .   ? ACT L 308 . ? 1_555 ? 
586 IC1 11 HOH YC .   ? HOH L 408 . ? 1_555 ? 
587 IC1 11 HOH YC .   ? HOH L 487 . ? 1_555 ? 
588 IC2 5  THR L  77  ? THR L 76  . ? 1_555 ? 
589 IC2 5  MSE L  80  ? MSE L 79  . ? 1_555 ? 
590 IC2 5  ACT JC .   ? ACT L 305 . ? 1_555 ? 
591 IC2 5  HOH YC .   ? HOH L 527 . ? 1_555 ? 
592 IC2 5  HOH YC .   ? HOH L 530 . ? 1_555 ? 
593 IC3 2  ASP L  21  ? ASP L 20  . ? 1_555 ? 
594 IC3 2  TYR L  25  ? TYR L 24  . ? 1_555 ? 
595 IC4 7  GLN F  36  ? GLN F 35  . ? 1_556 ? 
596 IC4 7  THR L  77  ? THR L 76  . ? 1_555 ? 
597 IC4 7  ALA L  78  ? ALA L 77  . ? 1_555 ? 
598 IC4 7  PHE L  79  ? PHE L 78  . ? 1_555 ? 
599 IC4 7  MSE L  80  ? MSE L 79  . ? 1_555 ? 
600 IC4 7  PRO L  81  ? PRO L 80  . ? 1_555 ? 
601 IC4 7  NA  HC .   ? NA  L 303 . ? 1_555 ? 
602 IC5 4  MSE L  259 ? MSE L 258 . ? 1_555 ? 
603 IC5 4  LEU L  262 ? LEU L 261 . ? 1_555 ? 
604 IC5 4  GLN L  263 ? GLN L 262 . ? 1_555 ? 
605 IC5 4  HOH YC .   ? HOH L 631 . ? 1_555 ? 
606 IC6 5  GLN K  6   ? GLN K 5   . ? 1_555 ? 
607 IC6 5  THR L  106 ? THR L 105 . ? 1_555 ? 
608 IC6 5  ASP L  203 ? ASP L 202 . ? 1_555 ? 
609 IC6 5  0J9 GC .   ? 0J9 L 302 . ? 1_555 ? 
610 IC6 5  HOH YC .   ? HOH L 473 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4GKH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4GKH 
_atom_sites.fract_transf_matrix[1][1]   0.010290 
_atom_sites.fract_transf_matrix[1][2]   0.004296 
_atom_sites.fract_transf_matrix[1][3]   0.004962 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011137 
_atom_sites.fract_transf_matrix[2][3]   0.004500 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009963 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASN A  1 19  ? 66.755  55.913  -50.588  1.00 93.17  ? 18  ASN A N   1 
ATOM   2     C  CA  . ASN A  1 19  ? 66.218  54.690  -49.994  1.00 99.84  ? 18  ASN A CA  1 
ATOM   3     C  C   . ASN A  1 19  ? 67.263  53.862  -49.262  1.00 91.16  ? 18  ASN A C   1 
ATOM   4     O  O   . ASN A  1 19  ? 68.386  53.688  -49.754  1.00 88.48  ? 18  ASN A O   1 
ATOM   5     C  CB  . ASN A  1 19  ? 65.550  53.820  -51.060  1.00 88.83  ? 18  ASN A CB  1 
ATOM   6     C  CG  . ASN A  1 19  ? 64.048  54.005  -51.105  1.00 125.10 ? 18  ASN A CG  1 
ATOM   7     O  OD1 . ASN A  1 19  ? 63.531  55.072  -50.769  1.00 134.48 ? 18  ASN A OD1 1 
ATOM   8     N  ND2 . ASN A  1 19  ? 63.335  52.959  -51.516  1.00 126.17 ? 18  ASN A ND2 1 
ATOM   9     N  N   . LEU A  1 20  ? 66.892  53.348  -48.091  1.00 70.46  ? 19  LEU A N   1 
ATOM   10    C  CA  . LEU A  1 20  ? 67.766  52.425  -47.366  1.00 52.59  ? 19  LEU A CA  1 
ATOM   11    C  C   . LEU A  1 20  ? 67.951  51.180  -48.231  1.00 60.53  ? 19  LEU A C   1 
ATOM   12    O  O   . LEU A  1 20  ? 69.056  50.666  -48.361  1.00 68.94  ? 19  LEU A O   1 
ATOM   13    C  CB  . LEU A  1 20  ? 67.189  52.063  -45.996  1.00 62.19  ? 19  LEU A CB  1 
ATOM   14    C  CG  . LEU A  1 20  ? 68.184  51.432  -45.019  1.00 61.48  ? 19  LEU A CG  1 
ATOM   15    C  CD1 . LEU A  1 20  ? 69.428  52.304  -44.889  1.00 63.24  ? 19  LEU A CD1 1 
ATOM   16    C  CD2 . LEU A  1 20  ? 67.562  51.178  -43.649  1.00 51.48  ? 19  LEU A CD2 1 
ATOM   17    N  N   . ASP A  1 21  ? 66.860  50.739  -48.856  1.00 62.96  ? 20  ASP A N   1 
ATOM   18    C  CA  . ASP A  1 21  ? 66.876  49.599  -49.769  1.00 76.36  ? 20  ASP A CA  1 
ATOM   19    C  C   . ASP A  1 21  ? 67.918  49.720  -50.871  1.00 75.55  ? 20  ASP A C   1 
ATOM   20    O  O   . ASP A  1 21  ? 68.580  48.744  -51.220  1.00 82.98  ? 20  ASP A O   1 
ATOM   21    C  CB  . ASP A  1 21  ? 65.492  49.405  -50.394  1.00 67.16  ? 20  ASP A CB  1 
ATOM   22    C  CG  . ASP A  1 21  ? 64.553  48.650  -49.484  1.00 80.13  ? 20  ASP A CG  1 
ATOM   23    O  OD1 . ASP A  1 21  ? 64.484  47.410  -49.608  1.00 93.36  ? 20  ASP A OD1 1 
ATOM   24    O  OD2 . ASP A  1 21  ? 63.899  49.291  -48.633  1.00 107.28 ? 20  ASP A OD2 1 
ATOM   25    N  N   . ALA A  1 22  ? 68.056  50.923  -51.416  1.00 62.26  ? 21  ALA A N   1 
ATOM   26    C  CA  . ALA A  1 22  ? 69.005  51.169  -52.494  1.00 66.59  ? 21  ALA A CA  1 
ATOM   27    C  C   . ALA A  1 22  ? 70.429  50.996  -51.995  1.00 57.64  ? 21  ALA A C   1 
ATOM   28    O  O   . ALA A  1 22  ? 71.292  50.500  -52.718  1.00 72.46  ? 21  ALA A O   1 
ATOM   29    C  CB  . ALA A  1 22  ? 68.811  52.564  -53.055  1.00 66.45  ? 21  ALA A CB  1 
ATOM   30    N  N   . ASP A  1 23  ? 70.662  51.413  -50.752  1.00 50.04  ? 22  ASP A N   1 
ATOM   31    C  CA  . ASP A  1 23  ? 71.987  51.351  -50.151  1.00 51.05  ? 22  ASP A CA  1 
ATOM   32    C  C   . ASP A  1 23  ? 72.355  49.940  -49.694  1.00 76.53  ? 22  ASP A C   1 
ATOM   33    O  O   . ASP A  1 23  ? 73.528  49.651  -49.466  1.00 56.21  ? 22  ASP A O   1 
ATOM   34    C  CB  . ASP A  1 23  ? 72.097  52.313  -48.957  1.00 49.13  ? 22  ASP A CB  1 
ATOM   35    C  CG  . ASP A  1 23  ? 72.199  53.777  -49.380  1.00 78.49  ? 22  ASP A CG  1 
ATOM   36    O  OD1 . ASP A  1 23  ? 72.556  54.043  -50.549  1.00 70.48  ? 22  ASP A OD1 1 
ATOM   37    O  OD2 . ASP A  1 23  ? 71.934  54.663  -48.535  1.00 58.73  ? 22  ASP A OD2 1 
ATOM   38    N  N   . LEU A  1 24  ? 71.362  49.066  -49.555  1.00 57.14  ? 23  LEU A N   1 
ATOM   39    C  CA  . LEU A  1 24  ? 71.599  47.741  -48.984  1.00 63.25  ? 23  LEU A CA  1 
ATOM   40    C  C   . LEU A  1 24  ? 71.586  46.623  -50.027  1.00 42.65  ? 23  LEU A C   1 
ATOM   41    O  O   . LEU A  1 24  ? 71.925  45.482  -49.720  1.00 53.70  ? 23  LEU A O   1 
ATOM   42    C  CB  . LEU A  1 24  ? 70.572  47.430  -47.891  1.00 58.38  ? 23  LEU A CB  1 
ATOM   43    C  CG  . LEU A  1 24  ? 70.359  48.428  -46.749  1.00 61.99  ? 23  LEU A CG  1 
ATOM   44    C  CD1 . LEU A  1 24  ? 69.104  48.068  -45.972  1.00 49.25  ? 23  LEU A CD1 1 
ATOM   45    C  CD2 . LEU A  1 24  ? 71.536  48.485  -45.818  1.00 49.78  ? 23  LEU A CD2 1 
ATOM   46    N  N   . TYR A  1 25  ? 71.202  46.956  -51.256  1.00 48.35  ? 24  TYR A N   1 
ATOM   47    C  CA  . TYR A  1 25  ? 71.064  45.963  -52.323  1.00 51.54  ? 24  TYR A CA  1 
ATOM   48    C  C   . TYR A  1 25  ? 72.338  45.157  -52.603  1.00 72.37  ? 24  TYR A C   1 
ATOM   49    O  O   . TYR A  1 25  ? 73.438  45.705  -52.619  1.00 51.03  ? 24  TYR A O   1 
ATOM   50    C  CB  . TYR A  1 25  ? 70.588  46.635  -53.614  1.00 65.74  ? 24  TYR A CB  1 
ATOM   51    C  CG  . TYR A  1 25  ? 70.247  45.654  -54.713  1.00 57.09  ? 24  TYR A CG  1 
ATOM   52    C  CD1 . TYR A  1 25  ? 69.004  45.036  -54.756  1.00 65.42  ? 24  TYR A CD1 1 
ATOM   53    C  CD2 . TYR A  1 25  ? 71.170  45.336  -55.700  1.00 60.48  ? 24  TYR A CD2 1 
ATOM   54    C  CE1 . TYR A  1 25  ? 68.689  44.137  -55.752  1.00 66.00  ? 24  TYR A CE1 1 
ATOM   55    C  CE2 . TYR A  1 25  ? 70.862  44.440  -56.707  1.00 67.46  ? 24  TYR A CE2 1 
ATOM   56    C  CZ  . TYR A  1 25  ? 69.621  43.842  -56.726  1.00 83.87  ? 24  TYR A CZ  1 
ATOM   57    O  OH  . TYR A  1 25  ? 69.308  42.944  -57.721  1.00 90.93  ? 24  TYR A OH  1 
ATOM   58    N  N   . GLY A  1 26  ? 72.172  43.851  -52.814  1.00 53.62  ? 25  GLY A N   1 
ATOM   59    C  CA  . GLY A  1 26  ? 73.263  42.978  -53.220  1.00 58.44  ? 25  GLY A CA  1 
ATOM   60    C  C   . GLY A  1 26  ? 74.285  42.587  -52.159  1.00 59.39  ? 25  GLY A C   1 
ATOM   61    O  O   . GLY A  1 26  ? 75.350  42.059  -52.487  1.00 53.07  ? 25  GLY A O   1 
ATOM   62    N  N   . TYR A  1 27  ? 73.972  42.836  -50.891  1.00 39.04  ? 26  TYR A N   1 
ATOM   63    C  CA  . TYR A  1 27  ? 74.899  42.521  -49.808  1.00 38.28  ? 26  TYR A CA  1 
ATOM   64    C  C   . TYR A  1 27  ? 74.531  41.198  -49.159  1.00 52.56  ? 26  TYR A C   1 
ATOM   65    O  O   . TYR A  1 27  ? 73.357  40.836  -49.100  1.00 42.86  ? 26  TYR A O   1 
ATOM   66    C  CB  . TYR A  1 27  ? 74.882  43.614  -48.738  1.00 43.24  ? 26  TYR A CB  1 
ATOM   67    C  CG  . TYR A  1 27  ? 75.822  44.770  -48.998  1.00 40.09  ? 26  TYR A CG  1 
ATOM   68    C  CD1 . TYR A  1 27  ? 77.199  44.626  -48.831  1.00 43.73  ? 26  TYR A CD1 1 
ATOM   69    C  CD2 . TYR A  1 27  ? 75.337  46.010  -49.398  1.00 49.39  ? 26  TYR A CD2 1 
ATOM   70    C  CE1 . TYR A  1 27  ? 78.069  45.688  -49.064  1.00 45.97  ? 26  TYR A CE1 1 
ATOM   71    C  CE2 . TYR A  1 27  ? 76.197  47.081  -49.630  1.00 39.59  ? 26  TYR A CE2 1 
ATOM   72    C  CZ  . TYR A  1 27  ? 77.561  46.912  -49.463  1.00 58.79  ? 26  TYR A CZ  1 
ATOM   73    O  OH  . TYR A  1 27  ? 78.417  47.966  -49.690  1.00 48.70  ? 26  TYR A OH  1 
ATOM   74    N  N   . ARG A  1 28  ? 75.537  40.480  -48.671  1.00 52.90  ? 27  ARG A N   1 
ATOM   75    C  CA  . ARG A  1 28  ? 75.292  39.345  -47.787  1.00 37.71  ? 27  ARG A CA  1 
ATOM   76    C  C   . ARG A  1 28  ? 75.126  39.877  -46.372  1.00 39.38  ? 27  ARG A C   1 
ATOM   77    O  O   . ARG A  1 28  ? 75.722  40.899  -46.022  1.00 35.44  ? 27  ARG A O   1 
ATOM   78    C  CB  . ARG A  1 28  ? 76.451  38.341  -47.842  1.00 40.13  ? 27  ARG A CB  1 
ATOM   79    C  CG  . ARG A  1 28  ? 76.658  37.687  -49.189  1.00 51.54  ? 27  ARG A CG  1 
ATOM   80    C  CD  . ARG A  1 28  ? 77.688  36.553  -49.104  1.00 66.10  ? 27  ARG A CD  1 
ATOM   81    N  NE  . ARG A  1 28  ? 77.937  35.955  -50.414  1.00 74.45  ? 27  ARG A NE  1 
ATOM   82    C  CZ  . ARG A  1 28  ? 77.176  35.010  -50.964  1.00 85.42  ? 27  ARG A CZ  1 
ATOM   83    N  NH1 . ARG A  1 28  ? 77.474  34.530  -52.165  1.00 64.96  ? 27  ARG A NH1 1 
ATOM   84    N  NH2 . ARG A  1 28  ? 76.116  34.544  -50.314  1.00 69.14  ? 27  ARG A NH2 1 
ATOM   85    N  N   . TRP A  1 29  ? 74.318  39.197  -45.557  1.00 36.02  ? 28  TRP A N   1 
ATOM   86    C  CA  . TRP A  1 29  ? 74.020  39.693  -44.209  1.00 34.25  ? 28  TRP A CA  1 
ATOM   87    C  C   . TRP A  1 29  ? 74.524  38.764  -43.117  1.00 52.67  ? 28  TRP A C   1 
ATOM   88    O  O   . TRP A  1 29  ? 74.302  37.561  -43.174  1.00 36.15  ? 28  TRP A O   1 
ATOM   89    C  CB  . TRP A  1 29  ? 72.511  39.867  -44.023  1.00 37.24  ? 28  TRP A CB  1 
ATOM   90    C  CG  . TRP A  1 29  ? 71.928  41.021  -44.783  1.00 44.13  ? 28  TRP A CG  1 
ATOM   91    C  CD1 . TRP A  1 29  ? 71.698  41.086  -46.124  1.00 42.50  ? 28  TRP A CD1 1 
ATOM   92    C  CD2 . TRP A  1 29  ? 71.481  42.269  -44.235  1.00 47.49  ? 28  TRP A CD2 1 
ATOM   93    N  NE1 . TRP A  1 29  ? 71.145  42.304  -46.451  1.00 42.86  ? 28  TRP A NE1 1 
ATOM   94    C  CE2 . TRP A  1 29  ? 71.006  43.049  -45.308  1.00 43.02  ? 28  TRP A CE2 1 
ATOM   95    C  CE3 . TRP A  1 29  ? 71.442  42.804  -42.940  1.00 39.23  ? 28  TRP A CE3 1 
ATOM   96    C  CZ2 . TRP A  1 29  ? 70.495  44.333  -45.128  1.00 48.27  ? 28  TRP A CZ2 1 
ATOM   97    C  CZ3 . TRP A  1 29  ? 70.942  44.083  -42.763  1.00 39.68  ? 28  TRP A CZ3 1 
ATOM   98    C  CH2 . TRP A  1 29  ? 70.468  44.831  -43.850  1.00 57.41  ? 28  TRP A CH2 1 
ATOM   99    N  N   . ALA A  1 30  ? 75.180  39.332  -42.112  1.00 41.13  ? 29  ALA A N   1 
ATOM   100   C  CA  . ALA A  1 30  ? 75.526  38.583  -40.908  1.00 45.35  ? 29  ALA A CA  1 
ATOM   101   C  C   . ALA A  1 30  ? 75.111  39.399  -39.690  1.00 51.12  ? 29  ALA A C   1 
ATOM   102   O  O   . ALA A  1 30  ? 74.944  40.610  -39.782  1.00 40.18  ? 29  ALA A O   1 
ATOM   103   C  CB  . ALA A  1 30  ? 77.011  38.267  -40.868  1.00 39.94  ? 29  ALA A CB  1 
ATOM   104   N  N   . ARG A  1 31  ? 74.931  38.730  -38.559  1.00 34.62  ? 30  ARG A N   1 
ATOM   105   C  CA  . ARG A  1 31  ? 74.509  39.383  -37.321  1.00 30.55  ? 30  ARG A CA  1 
ATOM   106   C  C   . ARG A  1 31  ? 75.646  39.216  -36.314  1.00 38.33  ? 30  ARG A C   1 
ATOM   107   O  O   . ARG A  1 31  ? 76.139  38.106  -36.108  1.00 36.81  ? 30  ARG A O   1 
ATOM   108   C  CB  . ARG A  1 31  ? 73.215  38.739  -36.798  1.00 32.75  ? 30  ARG A CB  1 
ATOM   109   C  CG  . ARG A  1 31  ? 72.805  39.168  -35.406  1.00 45.31  ? 30  ARG A CG  1 
ATOM   110   C  CD  . ARG A  1 31  ? 71.468  38.555  -34.991  1.00 39.51  ? 30  ARG A CD  1 
ATOM   111   N  NE  . ARG A  1 31  ? 70.927  39.233  -33.816  1.00 38.52  ? 30  ARG A NE  1 
ATOM   112   C  CZ  . ARG A  1 31  ? 69.663  39.155  -33.432  1.00 42.66  ? 30  ARG A CZ  1 
ATOM   113   N  NH1 . ARG A  1 31  ? 69.256  39.805  -32.350  1.00 46.31  ? 30  ARG A NH1 1 
ATOM   114   N  NH2 . ARG A  1 31  ? 68.804  38.436  -34.141  1.00 38.61  ? 30  ARG A NH2 1 
ATOM   115   N  N   . ASP A  1 32  ? 76.087  40.314  -35.713  1.00 33.38  ? 31  ASP A N   1 
ATOM   116   C  CA  . ASP A  1 32  ? 77.235  40.265  -34.802  1.00 34.99  ? 31  ASP A CA  1 
ATOM   117   C  C   . ASP A  1 32  ? 76.794  40.529  -33.374  1.00 38.54  ? 31  ASP A C   1 
ATOM   118   O  O   . ASP A  1 32  ? 76.210  41.578  -33.085  1.00 41.80  ? 31  ASP A O   1 
ATOM   119   C  CB  . ASP A  1 32  ? 78.287  41.306  -35.198  1.00 39.88  ? 31  ASP A CB  1 
ATOM   120   C  CG  . ASP A  1 32  ? 78.907  41.018  -36.540  1.00 49.10  ? 31  ASP A CG  1 
ATOM   121   O  OD1 . ASP A  1 32  ? 79.011  39.829  -36.896  1.00 41.83  ? 31  ASP A OD1 1 
ATOM   122   O  OD2 . ASP A  1 32  ? 79.294  41.975  -37.237  1.00 62.62  ? 31  ASP A OD2 1 
ATOM   123   N  N   . ASN A  1 33  ? 77.052  39.579  -32.483  1.00 39.15  ? 32  ASN A N   1 
ATOM   124   C  CA  . ASN A  1 33  ? 76.852  39.831  -31.063  1.00 41.32  ? 32  ASN A CA  1 
ATOM   125   C  C   . ASN A  1 33  ? 78.112  40.485  -30.511  1.00 39.22  ? 32  ASN A C   1 
ATOM   126   O  O   . ASN A  1 33  ? 79.079  39.808  -30.153  1.00 46.54  ? 32  ASN A O   1 
ATOM   127   C  CB  . ASN A  1 33  ? 76.520  38.550  -30.286  1.00 39.36  ? 32  ASN A CB  1 
ATOM   128   C  CG  . ASN A  1 33  ? 76.264  38.822  -28.813  1.00 39.58  ? 32  ASN A CG  1 
ATOM   129   O  OD1 . ASN A  1 33  ? 76.167  39.979  -28.402  1.00 42.38  ? 32  ASN A OD1 1 
ATOM   130   N  ND2 . ASN A  1 33  ? 76.128  37.758  -28.013  1.00 40.03  ? 32  ASN A ND2 1 
ATOM   131   N  N   . VAL A  1 34  ? 78.043  41.807  -30.428  1.00 47.12  ? 33  VAL A N   1 
ATOM   132   C  CA  . VAL A  1 34  ? 79.176  42.681  -30.226  1.00 60.12  ? 33  VAL A CA  1 
ATOM   133   C  C   . VAL A  1 34  ? 78.531  44.055  -30.046  1.00 83.34  ? 33  VAL A C   1 
ATOM   134   O  O   . VAL A  1 34  ? 77.308  44.184  -30.195  1.00 91.06  ? 33  VAL A O   1 
ATOM   135   C  CB  . VAL A  1 34  ? 80.066  42.661  -31.487  1.00 63.30  ? 33  VAL A CB  1 
ATOM   136   C  CG1 . VAL A  1 34  ? 79.610  43.721  -32.501  1.00 53.96  ? 33  VAL A CG1 1 
ATOM   137   C  CG2 . VAL A  1 34  ? 81.523  42.812  -31.121  1.00 56.74  ? 33  VAL A CG2 1 
ATOM   138   N  N   . GLY A  1 35  ? 79.313  45.075  -29.700  1.00 45.77  ? 34  GLY A N   1 
ATOM   139   C  CA  . GLY A  1 35  ? 78.782  46.433  -29.652  1.00 91.69  ? 34  GLY A CA  1 
ATOM   140   C  C   . GLY A  1 35  ? 78.289  46.972  -28.311  1.00 107.89 ? 34  GLY A C   1 
ATOM   141   O  O   . GLY A  1 35  ? 77.812  46.228  -27.443  1.00 82.92  ? 34  GLY A O   1 
ATOM   142   N  N   . GLN A  1 36  ? 78.369  48.295  -28.180  1.00 72.55  ? 35  GLN A N   1 
ATOM   143   C  CA  . GLN A  1 36  ? 78.162  49.017  -26.918  1.00 75.59  ? 35  GLN A CA  1 
ATOM   144   C  C   . GLN A  1 36  ? 76.750  48.933  -26.310  1.00 74.79  ? 35  GLN A C   1 
ATOM   145   O  O   . GLN A  1 36  ? 76.594  48.605  -25.134  1.00 49.02  ? 35  GLN A O   1 
ATOM   146   C  CB  . GLN A  1 36  ? 78.544  50.489  -27.118  1.00 88.04  ? 35  GLN A CB  1 
ATOM   147   C  CG  . GLN A  1 36  ? 78.387  51.367  -25.895  1.00 55.56  ? 35  GLN A CG  1 
ATOM   148   C  CD  . GLN A  1 36  ? 78.662  52.827  -26.212  1.00 82.67  ? 35  GLN A CD  1 
ATOM   149   O  OE1 . GLN A  1 36  ? 77.784  53.560  -26.674  1.00 53.38  ? 35  GLN A OE1 1 
ATOM   150   N  NE2 . GLN A  1 36  ? 79.891  53.253  -25.978  1.00 42.81  ? 35  GLN A NE2 1 
ATOM   151   N  N   . SER A  1 37  ? 75.731  49.270  -27.096  1.00 73.94  ? 36  SER A N   1 
ATOM   152   C  CA  . SER A  1 37  ? 74.350  49.205  -26.617  1.00 63.21  ? 36  SER A CA  1 
ATOM   153   C  C   . SER A  1 37  ? 73.746  47.833  -26.911  1.00 84.28  ? 36  SER A C   1 
ATOM   154   O  O   . SER A  1 37  ? 74.435  46.935  -27.400  1.00 93.52  ? 36  SER A O   1 
ATOM   155   C  CB  . SER A  1 37  ? 73.498  50.305  -27.265  1.00 84.02  ? 36  SER A CB  1 
ATOM   156   O  OG  . SER A  1 37  ? 73.422  50.140  -28.674  1.00 57.38  ? 36  SER A OG  1 
ATOM   157   N  N   . GLY A  1 38  ? 72.463  47.669  -26.608  1.00 75.03  ? 37  GLY A N   1 
ATOM   158   C  CA  . GLY A  1 38  ? 71.772  46.431  -26.924  1.00 47.88  ? 37  GLY A CA  1 
ATOM   159   C  C   . GLY A  1 38  ? 71.225  46.442  -28.346  1.00 38.76  ? 37  GLY A C   1 
ATOM   160   O  O   . GLY A  1 38  ? 70.270  45.725  -28.661  1.00 48.87  ? 37  GLY A O   1 
ATOM   161   N  N   . ALA A  1 39  ? 71.804  47.279  -29.203  1.00 41.55  ? 38  ALA A N   1 
ATOM   162   C  CA  . ALA A  1 39  ? 71.366  47.341  -30.593  1.00 36.38  ? 38  ALA A CA  1 
ATOM   163   C  C   . ALA A  1 39  ? 71.628  46.018  -31.305  1.00 43.79  ? 38  ALA A C   1 
ATOM   164   O  O   . ALA A  1 39  ? 72.502  45.251  -30.902  1.00 44.21  ? 38  ALA A O   1 
ATOM   165   C  CB  . ALA A  1 39  ? 72.049  48.480  -31.320  1.00 42.85  ? 38  ALA A CB  1 
ATOM   166   N  N   . THR A  1 40  ? 70.857  45.732  -32.348  1.00 30.00  ? 39  THR A N   1 
ATOM   167   C  CA  . THR A  1 40  ? 71.202  44.605  -33.209  1.00 33.94  ? 39  THR A CA  1 
ATOM   168   C  C   . THR A  1 40  ? 72.191  45.100  -34.251  1.00 35.82  ? 39  THR A C   1 
ATOM   169   O  O   . THR A  1 40  ? 71.972  46.126  -34.881  1.00 34.92  ? 39  THR A O   1 
ATOM   170   C  CB  . THR A  1 40  ? 69.975  43.988  -33.877  1.00 37.32  ? 39  THR A CB  1 
ATOM   171   O  OG1 . THR A  1 40  ? 69.092  43.489  -32.868  1.00 36.50  ? 39  THR A OG1 1 
ATOM   172   C  CG2 . THR A  1 40  ? 70.385  42.823  -34.763  1.00 41.31  ? 39  THR A CG2 1 
ATOM   173   N  N   . ILE A  1 41  ? 73.303  44.397  -34.402  1.00 34.05  ? 40  ILE A N   1 
ATOM   174   C  CA  . ILE A  1 41  ? 74.342  44.836  -35.340  1.00 29.95  ? 40  ILE A CA  1 
ATOM   175   C  C   . ILE A  1 41  ? 74.439  43.874  -36.512  1.00 41.06  ? 40  ILE A C   1 
ATOM   176   O  O   . ILE A  1 41  ? 74.625  42.675  -36.321  1.00 33.07  ? 40  ILE A O   1 
ATOM   177   C  CB  . ILE A  1 41  ? 75.692  44.928  -34.629  1.00 34.25  ? 40  ILE A CB  1 
ATOM   178   C  CG1 . ILE A  1 41  ? 75.617  46.030  -33.568  1.00 45.92  ? 40  ILE A CG1 1 
ATOM   179   C  CG2 . ILE A  1 41  ? 76.813  45.224  -35.634  1.00 34.24  ? 40  ILE A CG2 1 
ATOM   180   C  CD1 . ILE A  1 41  ? 76.780  46.047  -32.641  1.00 58.92  ? 40  ILE A CD1 1 
ATOM   181   N  N   . TYR A  1 42  ? 74.298  44.408  -37.723  1.00 32.77  ? 41  TYR A N   1 
ATOM   182   C  CA  . TYR A  1 42  ? 74.450  43.617  -38.936  1.00 29.38  ? 41  TYR A CA  1 
ATOM   183   C  C   . TYR A  1 42  ? 75.730  44.011  -39.677  1.00 39.86  ? 41  TYR A C   1 
ATOM   184   O  O   . TYR A  1 42  ? 76.080  45.193  -39.751  1.00 29.59  ? 41  TYR A O   1 
ATOM   185   C  CB  . TYR A  1 42  ? 73.241  43.814  -39.854  1.00 27.38  ? 41  TYR A CB  1 
ATOM   186   C  CG  . TYR A  1 42  ? 71.911  43.406  -39.241  1.00 32.71  ? 41  TYR A CG  1 
ATOM   187   C  CD1 . TYR A  1 42  ? 71.526  42.065  -39.196  1.00 33.15  ? 41  TYR A CD1 1 
ATOM   188   C  CD2 . TYR A  1 42  ? 71.045  44.355  -38.704  1.00 37.36  ? 41  TYR A CD2 1 
ATOM   189   C  CE1 . TYR A  1 42  ? 70.304  41.688  -38.631  1.00 35.95  ? 41  TYR A CE1 1 
ATOM   190   C  CE2 . TYR A  1 42  ? 69.808  43.984  -38.139  1.00 37.55  ? 41  TYR A CE2 1 
ATOM   191   C  CZ  . TYR A  1 42  ? 69.457  42.651  -38.102  1.00 35.63  ? 41  TYR A CZ  1 
ATOM   192   O  OH  . TYR A  1 42  ? 68.251  42.266  -37.547  1.00 36.38  ? 41  TYR A OH  1 
ATOM   193   N  N   . ARG A  1 43  ? 76.438  43.010  -40.186  1.00 29.84  ? 42  ARG A N   1 
ATOM   194   C  CA  . ARG A  1 43  ? 77.556  43.229  -41.083  1.00 33.20  ? 42  ARG A CA  1 
ATOM   195   C  C   . ARG A  1 43  ? 77.100  42.939  -42.513  1.00 38.85  ? 42  ARG A C   1 
ATOM   196   O  O   . ARG A  1 43  ? 76.564  41.863  -42.799  1.00 35.68  ? 42  ARG A O   1 
ATOM   197   C  CB  . ARG A  1 43  ? 78.730  42.323  -40.705  1.00 30.66  ? 42  ARG A CB  1 
ATOM   198   C  CG  . ARG A  1 43  ? 80.043  42.720  -41.359  1.00 32.88  ? 42  ARG A CG  1 
ATOM   199   C  CD  . ARG A  1 43  ? 81.210  41.929  -40.770  1.00 36.65  ? 42  ARG A CD  1 
ATOM   200   N  NE  . ARG A  1 43  ? 81.068  40.490  -40.999  1.00 40.13  ? 42  ARG A NE  1 
ATOM   201   C  CZ  . ARG A  1 43  ? 81.487  39.860  -42.091  1.00 45.72  ? 42  ARG A CZ  1 
ATOM   202   N  NH1 . ARG A  1 43  ? 81.320  38.547  -42.208  1.00 48.53  ? 42  ARG A NH1 1 
ATOM   203   N  NH2 . ARG A  1 43  ? 82.077  40.539  -43.065  1.00 41.07  ? 42  ARG A NH2 1 
ATOM   204   N  N   . LEU A  1 44  ? 77.288  43.914  -43.397  1.00 32.77  ? 43  LEU A N   1 
ATOM   205   C  CA  . LEU A  1 44  ? 76.942  43.773  -44.808  1.00 33.63  ? 43  LEU A CA  1 
ATOM   206   C  C   . LEU A  1 44  ? 78.237  43.602  -45.579  1.00 33.59  ? 43  LEU A C   1 
ATOM   207   O  O   . LEU A  1 44  ? 79.131  44.433  -45.470  1.00 40.10  ? 43  LEU A O   1 
ATOM   208   C  CB  . LEU A  1 44  ? 76.193  45.015  -45.311  1.00 36.47  ? 43  LEU A CB  1 
ATOM   209   C  CG  . LEU A  1 44  ? 74.735  45.190  -44.871  1.00 45.98  ? 43  LEU A CG  1 
ATOM   210   C  CD1 . LEU A  1 44  ? 74.640  45.780  -43.476  1.00 51.14  ? 43  LEU A CD1 1 
ATOM   211   C  CD2 . LEU A  1 44  ? 74.005  46.056  -45.861  1.00 71.70  ? 43  LEU A CD2 1 
ATOM   212   N  N   . TYR A  1 45  ? 78.352  42.515  -46.338  1.00 39.98  ? 44  TYR A N   1 
ATOM   213   C  CA  . TYR A  1 45  ? 79.620  42.167  -46.965  1.00 39.83  ? 44  TYR A CA  1 
ATOM   214   C  C   . TYR A  1 45  ? 79.356  41.332  -48.211  1.00 49.12  ? 44  TYR A C   1 
ATOM   215   O  O   . TYR A  1 45  ? 78.203  41.031  -48.537  1.00 43.11  ? 44  TYR A O   1 
ATOM   216   C  CB  . TYR A  1 45  ? 80.500  41.370  -45.983  1.00 43.98  ? 44  TYR A CB  1 
ATOM   217   C  CG  . TYR A  1 45  ? 79.956  39.980  -45.692  1.00 41.00  ? 44  TYR A CG  1 
ATOM   218   C  CD1 . TYR A  1 45  ? 78.872  39.795  -44.829  1.00 39.57  ? 44  TYR A CD1 1 
ATOM   219   C  CD2 . TYR A  1 45  ? 80.517  38.853  -46.289  1.00 46.32  ? 44  TYR A CD2 1 
ATOM   220   C  CE1 . TYR A  1 45  ? 78.357  38.513  -44.575  1.00 42.79  ? 44  TYR A CE1 1 
ATOM   221   C  CE2 . TYR A  1 45  ? 80.013  37.578  -46.041  1.00 57.46  ? 44  TYR A CE2 1 
ATOM   222   C  CZ  . TYR A  1 45  ? 78.940  37.415  -45.184  1.00 51.43  ? 44  TYR A CZ  1 
ATOM   223   O  OH  . TYR A  1 45  ? 78.447  36.150  -44.947  1.00 53.55  ? 44  TYR A OH  1 
ATOM   224   N  N   . GLY A  1 46  ? 80.425  40.949  -48.900  1.00 49.99  ? 45  GLY A N   1 
ATOM   225   C  CA  . GLY A  1 46  ? 80.315  40.018  -50.010  1.00 45.29  ? 45  GLY A CA  1 
ATOM   226   C  C   . GLY A  1 46  ? 79.744  40.614  -51.283  1.00 59.06  ? 45  GLY A C   1 
ATOM   227   O  O   . GLY A  1 46  ? 79.387  39.881  -52.204  1.00 64.22  ? 45  GLY A O   1 
ATOM   228   N  N   . LYS A  1 47  ? 79.647  41.940  -51.345  1.00 44.08  ? 46  LYS A N   1 
ATOM   229   C  CA  . LYS A  1 47  ? 79.155  42.589  -52.559  1.00 63.62  ? 46  LYS A CA  1 
ATOM   230   C  C   . LYS A  1 47  ? 80.315  42.988  -53.455  1.00 45.24  ? 46  LYS A C   1 
ATOM   231   O  O   . LYS A  1 47  ? 81.168  43.783  -53.049  1.00 56.78  ? 46  LYS A O   1 
ATOM   232   C  CB  . LYS A  1 47  ? 78.308  43.823  -52.230  1.00 54.30  ? 46  LYS A CB  1 
ATOM   233   C  CG  . LYS A  1 47  ? 77.671  44.476  -53.457  1.00 65.47  ? 46  LYS A CG  1 
ATOM   234   C  CD  . LYS A  1 47  ? 76.798  45.668  -53.064  1.00 55.42  ? 46  LYS A CD  1 
ATOM   235   C  CE  . LYS A  1 47  ? 76.164  46.329  -54.286  1.00 57.59  ? 46  LYS A CE  1 
ATOM   236   N  NZ  . LYS A  1 47  ? 75.355  47.508  -53.870  1.00 61.98  ? 46  LYS A NZ  1 
ATOM   237   N  N   . PRO A  1 48  ? 80.361  42.426  -54.674  1.00 59.34  ? 47  PRO A N   1 
ATOM   238   C  CA  . PRO A  1 48  ? 81.425  42.769  -55.622  1.00 55.64  ? 47  PRO A CA  1 
ATOM   239   C  C   . PRO A  1 48  ? 81.531  44.281  -55.849  1.00 55.63  ? 47  PRO A C   1 
ATOM   240   O  O   . PRO A  1 48  ? 80.515  44.960  -55.993  1.00 65.57  ? 47  PRO A O   1 
ATOM   241   C  CB  . PRO A  1 48  ? 80.988  42.052  -56.906  1.00 62.05  ? 47  PRO A CB  1 
ATOM   242   C  CG  . PRO A  1 48  ? 80.205  40.880  -56.426  1.00 64.11  ? 47  PRO A CG  1 
ATOM   243   C  CD  . PRO A  1 48  ? 79.466  41.381  -55.204  1.00 62.41  ? 47  PRO A CD  1 
ATOM   244   N  N   . ASN A  1 49  ? 82.756  44.796  -55.846  1.00 81.34  ? 48  ASN A N   1 
ATOM   245   C  CA  . ASN A  1 49  ? 83.009  46.215  -56.085  1.00 56.10  ? 48  ASN A CA  1 
ATOM   246   C  C   . ASN A  1 49  ? 82.334  47.152  -55.092  1.00 74.38  ? 48  ASN A C   1 
ATOM   247   O  O   . ASN A  1 49  ? 82.038  48.299  -55.419  1.00 58.56  ? 48  ASN A O   1 
ATOM   248   C  CB  . ASN A  1 49  ? 82.610  46.594  -57.515  1.00 73.36  ? 48  ASN A CB  1 
ATOM   249   C  CG  . ASN A  1 49  ? 83.335  45.768  -58.558  1.00 99.48  ? 48  ASN A CG  1 
ATOM   250   O  OD1 . ASN A  1 49  ? 84.563  45.636  -58.524  1.00 71.57  ? 48  ASN A OD1 1 
ATOM   251   N  ND2 . ASN A  1 49  ? 82.574  45.196  -59.491  1.00 75.66  ? 48  ASN A ND2 1 
ATOM   252   N  N   . ALA A  1 50  ? 82.090  46.663  -53.879  1.00 54.87  ? 49  ALA A N   1 
ATOM   253   C  CA  . ALA A  1 50  ? 81.471  47.483  -52.848  1.00 55.56  ? 49  ALA A CA  1 
ATOM   254   C  C   . ALA A  1 50  ? 82.126  47.228  -51.493  1.00 62.81  ? 49  ALA A C   1 
ATOM   255   O  O   . ALA A  1 50  ? 82.549  46.105  -51.209  1.00 60.10  ? 49  ALA A O   1 
ATOM   256   C  CB  . ALA A  1 50  ? 79.978  47.207  -52.781  1.00 57.85  ? 49  ALA A CB  1 
ATOM   257   N  N   . PRO A  1 51  ? 82.216  48.275  -50.653  1.00 41.76  ? 50  PRO A N   1 
ATOM   258   C  CA  . PRO A  1 51  ? 82.826  48.155  -49.324  1.00 47.70  ? 50  PRO A CA  1 
ATOM   259   C  C   . PRO A  1 51  ? 81.947  47.377  -48.352  1.00 47.56  ? 50  PRO A C   1 
ATOM   260   O  O   . PRO A  1 51  ? 80.749  47.220  -48.585  1.00 48.21  ? 50  PRO A O   1 
ATOM   261   C  CB  . PRO A  1 51  ? 82.918  49.611  -48.857  1.00 45.29  ? 50  PRO A CB  1 
ATOM   262   C  CG  . PRO A  1 51  ? 81.799  50.287  -49.554  1.00 54.96  ? 50  PRO A CG  1 
ATOM   263   C  CD  . PRO A  1 51  ? 81.757  49.651  -50.915  1.00 60.17  ? 50  PRO A CD  1 
ATOM   264   N  N   . GLU A  1 52  ? 82.542  46.904  -47.265  1.00 45.95  ? 51  GLU A N   1 
ATOM   265   C  CA  . GLU A  1 52  ? 81.778  46.341  -46.156  1.00 40.88  ? 51  GLU A CA  1 
ATOM   266   C  C   . GLU A  1 52  ? 81.098  47.479  -45.382  1.00 35.55  ? 51  GLU A C   1 
ATOM   267   O  O   . GLU A  1 52  ? 81.664  48.563  -45.253  1.00 35.98  ? 51  GLU A O   1 
ATOM   268   C  CB  . GLU A  1 52  ? 82.727  45.564  -45.246  1.00 41.19  ? 51  GLU A CB  1 
ATOM   269   C  CG  . GLU A  1 52  ? 82.090  44.949  -44.017  1.00 44.52  ? 51  GLU A CG  1 
ATOM   270   C  CD  . GLU A  1 52  ? 83.120  44.331  -43.082  1.00 50.73  ? 51  GLU A CD  1 
ATOM   271   O  OE1 . GLU A  1 52  ? 83.859  45.090  -42.422  1.00 52.86  ? 51  GLU A OE1 1 
ATOM   272   O  OE2 . GLU A  1 52  ? 83.199  43.089  -43.018  1.00 51.81  ? 51  GLU A OE2 1 
ATOM   273   N  N   . LEU A  1 53  ? 79.884  47.242  -44.870  1.00 31.52  ? 52  LEU A N   1 
ATOM   274   C  CA  . LEU A  1 53  ? 79.164  48.254  -44.092  1.00 36.51  ? 52  LEU A CA  1 
ATOM   275   C  C   . LEU A  1 53  ? 78.659  47.661  -42.794  1.00 33.91  ? 52  LEU A C   1 
ATOM   276   O  O   . LEU A  1 53  ? 78.586  46.451  -42.662  1.00 30.81  ? 52  LEU A O   1 
ATOM   277   C  CB  . LEU A  1 53  ? 77.951  48.783  -44.868  1.00 36.56  ? 52  LEU A CB  1 
ATOM   278   C  CG  . LEU A  1 53  ? 78.197  49.335  -46.265  1.00 39.37  ? 52  LEU A CG  1 
ATOM   279   C  CD1 . LEU A  1 53  ? 76.861  49.556  -46.972  1.00 35.91  ? 52  LEU A CD1 1 
ATOM   280   C  CD2 . LEU A  1 53  ? 78.996  50.640  -46.180  1.00 32.04  ? 52  LEU A CD2 1 
ATOM   281   N  N   . PHE A  1 54  ? 78.299  48.517  -41.840  1.00 29.78  ? 53  PHE A N   1 
ATOM   282   C  CA  . PHE A  1 54  ? 77.596  48.042  -40.654  1.00 27.18  ? 53  PHE A CA  1 
ATOM   283   C  C   . PHE A  1 54  ? 76.250  48.716  -40.528  1.00 33.14  ? 53  PHE A C   1 
ATOM   284   O  O   . PHE A  1 54  ? 76.091  49.890  -40.889  1.00 31.29  ? 53  PHE A O   1 
ATOM   285   C  CB  . PHE A  1 54  ? 78.423  48.261  -39.381  1.00 27.36  ? 53  PHE A CB  1 
ATOM   286   C  CG  . PHE A  1 54  ? 79.550  47.293  -39.230  1.00 28.81  ? 53  PHE A CG  1 
ATOM   287   C  CD1 . PHE A  1 54  ? 79.319  46.003  -38.740  1.00 28.97  ? 53  PHE A CD1 1 
ATOM   288   C  CD2 . PHE A  1 54  ? 80.833  47.658  -39.575  1.00 30.58  ? 53  PHE A CD2 1 
ATOM   289   C  CE1 . PHE A  1 54  ? 80.342  45.108  -38.603  1.00 34.89  ? 53  PHE A CE1 1 
ATOM   290   C  CE2 . PHE A  1 54  ? 81.886  46.759  -39.436  1.00 36.79  ? 53  PHE A CE2 1 
ATOM   291   C  CZ  . PHE A  1 54  ? 81.639  45.482  -38.949  1.00 39.23  ? 53  PHE A CZ  1 
ATOM   292   N  N   . LEU A  1 55  ? 75.263  47.961  -40.049  1.00 28.09  ? 54  LEU A N   1 
ATOM   293   C  CA  . LEU A  1 55  ? 73.922  48.515  -39.839  1.00 28.84  ? 54  LEU A CA  1 
ATOM   294   C  C   . LEU A  1 55  ? 73.506  48.252  -38.407  1.00 36.35  ? 54  LEU A C   1 
ATOM   295   O  O   . LEU A  1 55  ? 73.393  47.103  -37.994  1.00 35.89  ? 54  LEU A O   1 
ATOM   296   C  CB  . LEU A  1 55  ? 72.901  47.897  -40.807  1.00 28.41  ? 54  LEU A CB  1 
ATOM   297   C  CG  . LEU A  1 55  ? 71.466  48.390  -40.620  1.00 32.56  ? 54  LEU A CG  1 
ATOM   298   C  CD1 . LEU A  1 55  ? 71.387  49.901  -40.824  1.00 39.62  ? 54  LEU A CD1 1 
ATOM   299   C  CD2 . LEU A  1 55  ? 70.493  47.673  -41.577  1.00 38.73  ? 54  LEU A CD2 1 
ATOM   300   N  N   . LYS A  1 56  ? 73.294  49.316  -37.640  1.00 31.56  ? 55  LYS A N   1 
ATOM   301   C  CA  . LYS A  1 56  ? 72.826  49.162  -36.267  1.00 32.52  ? 55  LYS A CA  1 
ATOM   302   C  C   . LYS A  1 56  ? 71.322  49.387  -36.225  1.00 34.12  ? 55  LYS A C   1 
ATOM   303   O  O   . LYS A  1 56  ? 70.816  50.358  -36.784  1.00 30.97  ? 55  LYS A O   1 
ATOM   304   C  CB  . LYS A  1 56  ? 73.496  50.187  -35.353  1.00 36.81  ? 55  LYS A CB  1 
ATOM   305   C  CG  . LYS A  1 56  ? 74.861  49.835  -34.827  1.00 57.51  ? 55  LYS A CG  1 
ATOM   306   C  CD  . LYS A  1 56  ? 75.132  50.658  -33.567  1.00 42.58  ? 55  LYS A CD  1 
ATOM   307   C  CE  . LYS A  1 56  ? 76.468  50.311  -32.930  1.00 51.16  ? 55  LYS A CE  1 
ATOM   308   N  NZ  . LYS A  1 56  ? 76.682  51.085  -31.677  1.00 56.40  ? 55  LYS A NZ  1 
ATOM   309   N  N   . HIS A  1 57  ? 70.596  48.505  -35.557  1.00 27.43  ? 56  HIS A N   1 
ATOM   310   C  CA  . HIS A  1 57  ? 69.161  48.718  -35.416  1.00 28.88  ? 56  HIS A CA  1 
ATOM   311   C  C   . HIS A  1 57  ? 68.807  48.777  -33.942  1.00 28.57  ? 56  HIS A C   1 
ATOM   312   O  O   . HIS A  1 57  ? 69.102  47.844  -33.192  1.00 33.93  ? 56  HIS A O   1 
ATOM   313   C  CB  . HIS A  1 57  ? 68.359  47.596  -36.088  1.00 33.72  ? 56  HIS A CB  1 
ATOM   314   C  CG  . HIS A  1 57  ? 66.883  47.707  -35.862  1.00 35.91  ? 56  HIS A CG  1 
ATOM   315   N  ND1 . HIS A  1 57  ? 66.066  46.609  -35.690  1.00 37.99  ? 56  HIS A ND1 1 
ATOM   316   C  CD2 . HIS A  1 57  ? 66.076  48.794  -35.774  1.00 35.41  ? 56  HIS A CD2 1 
ATOM   317   C  CE1 . HIS A  1 57  ? 64.822  47.016  -35.511  1.00 39.94  ? 56  HIS A CE1 1 
ATOM   318   N  NE2 . HIS A  1 57  ? 64.801  48.337  -35.558  1.00 35.11  ? 56  HIS A NE2 1 
ATOM   319   N  N   . GLY A  1 58  ? 68.185  49.875  -33.526  1.00 29.72  ? 57  GLY A N   1 
ATOM   320   C  CA  . GLY A  1 58  ? 67.728  50.002  -32.157  1.00 30.51  ? 57  GLY A CA  1 
ATOM   321   C  C   . GLY A  1 58  ? 66.217  50.088  -32.111  1.00 33.56  ? 57  GLY A C   1 
ATOM   322   O  O   . GLY A  1 58  ? 65.611  50.879  -32.836  1.00 32.54  ? 57  GLY A O   1 
ATOM   323   N  N   . LYS A  1 59  ? 65.613  49.269  -31.255  1.00 30.37  ? 58  LYS A N   1 
ATOM   324   C  CA  . LYS A  1 59  ? 64.165  49.231  -31.103  1.00 32.04  ? 58  LYS A CA  1 
ATOM   325   C  C   . LYS A  1 59  ? 63.808  49.727  -29.690  1.00 36.31  ? 58  LYS A C   1 
ATOM   326   O  O   . LYS A  1 59  ? 64.546  49.464  -28.736  1.00 34.19  ? 58  LYS A O   1 
ATOM   327   C  CB  . LYS A  1 59  ? 63.668  47.790  -31.330  1.00 38.38  ? 58  LYS A CB  1 
ATOM   328   C  CG  . LYS A  1 59  ? 62.156  47.645  -31.429  1.00 53.66  ? 58  LYS A CG  1 
ATOM   329   C  CD  . LYS A  1 59  ? 61.772  46.257  -31.954  1.00 54.92  ? 58  LYS A CD  1 
ATOM   330   C  CE  . LYS A  1 59  ? 60.255  46.112  -32.081  1.00 61.29  ? 58  LYS A CE  1 
ATOM   331   N  NZ  . LYS A  1 59  ? 59.579  46.082  -30.754  1.00 78.54  ? 58  LYS A NZ  1 
ATOM   332   N  N   . GLY A  1 60  ? 62.703  50.461  -29.557  1.00 31.52  ? 59  GLY A N   1 
ATOM   333   C  CA  . GLY A  1 60  ? 62.271  50.957  -28.255  1.00 36.94  ? 59  GLY A CA  1 
ATOM   334   C  C   . GLY A  1 60  ? 63.294  51.885  -27.605  1.00 40.75  ? 59  GLY A C   1 
ATOM   335   O  O   . GLY A  1 60  ? 63.742  52.846  -28.227  1.00 37.37  ? 59  GLY A O   1 
ATOM   336   N  N   . SER A  1 61  ? 63.662  51.612  -26.351  1.00 34.54  ? 60  SER A N   1 
ATOM   337   C  CA  . SER A  1 61  ? 64.632  52.448  -25.639  1.00 34.41  ? 60  SER A CA  1 
ATOM   338   C  C   . SER A  1 61  ? 65.946  52.518  -26.419  1.00 34.05  ? 60  SER A C   1 
ATOM   339   O  O   . SER A  1 61  ? 66.593  53.557  -26.475  1.00 33.87  ? 60  SER A O   1 
ATOM   340   C  CB  . SER A  1 61  ? 64.909  51.881  -24.242  1.00 32.18  ? 60  SER A CB  1 
ATOM   341   O  OG  . SER A  1 61  ? 63.767  51.956  -23.419  1.00 37.14  ? 60  SER A OG  1 
ATOM   342   N  N   . VAL A  1 62  ? 66.321  51.408  -27.044  1.00 30.13  ? 61  VAL A N   1 
ATOM   343   C  CA  . VAL A  1 62  ? 67.589  51.318  -27.761  1.00 33.72  ? 61  VAL A CA  1 
ATOM   344   C  C   . VAL A  1 62  ? 67.620  52.212  -29.008  1.00 38.03  ? 61  VAL A C   1 
ATOM   345   O  O   . VAL A  1 62  ? 68.687  52.613  -29.479  1.00 33.11  ? 61  VAL A O   1 
ATOM   346   C  CB  . VAL A  1 62  ? 67.927  49.847  -28.092  1.00 30.42  ? 61  VAL A CB  1 
ATOM   347   C  CG1 . VAL A  1 62  ? 69.245  49.741  -28.850  1.00 34.02  ? 61  VAL A CG1 1 
ATOM   348   C  CG2 . VAL A  1 62  ? 68.007  49.045  -26.810  1.00 33.13  ? 61  VAL A CG2 1 
ATOM   349   N  N   . ALA A  1 63  ? 66.446  52.567  -29.517  1.00 32.47  ? 62  ALA A N   1 
ATOM   350   C  CA  . ALA A  1 63  ? 66.387  53.545  -30.598  1.00 36.27  ? 62  ALA A CA  1 
ATOM   351   C  C   . ALA A  1 63  ? 67.069  54.838  -30.190  1.00 27.08  ? 62  ALA A C   1 
ATOM   352   O  O   . ALA A  1 63  ? 67.749  55.468  -30.997  1.00 31.15  ? 62  ALA A O   1 
ATOM   353   C  CB  . ALA A  1 63  ? 64.941  53.820  -31.014  1.00 33.61  ? 62  ALA A CB  1 
ATOM   354   N  N   . ASN A  1 64  ? 66.886  55.245  -28.936  1.00 28.39  ? 63  ASN A N   1 
ATOM   355   C  CA  . ASN A  1 64  ? 67.528  56.469  -28.453  1.00 30.57  ? 63  ASN A CA  1 
ATOM   356   C  C   . ASN A  1 64  ? 69.053  56.350  -28.428  1.00 35.75  ? 63  ASN A C   1 
ATOM   357   O  O   . ASN A  1 64  ? 69.772  57.285  -28.806  1.00 32.33  ? 63  ASN A O   1 
ATOM   358   C  CB  . ASN A  1 64  ? 66.995  56.832  -27.072  1.00 31.40  ? 63  ASN A CB  1 
ATOM   359   C  CG  . ASN A  1 64  ? 65.518  57.139  -27.105  1.00 49.25  ? 63  ASN A CG  1 
ATOM   360   O  OD1 . ASN A  1 64  ? 65.037  57.755  -28.051  1.00 35.81  ? 63  ASN A OD1 1 
ATOM   361   N  ND2 . ASN A  1 64  ? 64.786  56.680  -26.101  1.00 50.42  ? 63  ASN A ND2 1 
ATOM   362   N  N   . ASP A  1 65  ? 69.542  55.192  -28.002  1.00 33.54  ? 64  ASP A N   1 
ATOM   363   C  CA  . ASP A  1 65  ? 70.986  54.957  -27.965  1.00 28.28  ? 64  ASP A CA  1 
ATOM   364   C  C   . ASP A  1 65  ? 71.608  55.053  -29.348  1.00 33.03  ? 64  ASP A C   1 
ATOM   365   O  O   . ASP A  1 65  ? 72.672  55.651  -29.522  1.00 31.13  ? 64  ASP A O   1 
ATOM   366   C  CB  . ASP A  1 65  ? 71.284  53.588  -27.349  1.00 36.26  ? 64  ASP A CB  1 
ATOM   367   C  CG  . ASP A  1 65  ? 70.888  53.511  -25.878  1.00 46.43  ? 64  ASP A CG  1 
ATOM   368   O  OD1 . ASP A  1 65  ? 71.191  54.453  -25.117  1.00 57.80  ? 64  ASP A OD1 1 
ATOM   369   O  OD2 . ASP A  1 65  ? 70.261  52.509  -25.486  1.00 51.97  ? 64  ASP A OD2 1 
ATOM   370   N  N   . VAL A  1 66  ? 70.948  54.458  -30.334  1.00 26.81  ? 65  VAL A N   1 
ATOM   371   C  CA  . VAL A  1 66  ? 71.437  54.514  -31.705  1.00 23.59  ? 65  VAL A CA  1 
ATOM   372   C  C   . VAL A  1 66  ? 71.388  55.957  -32.266  1.00 31.80  ? 65  VAL A C   1 
ATOM   373   O  O   . VAL A  1 66  ? 72.308  56.413  -32.960  1.00 30.78  ? 65  VAL A O   1 
ATOM   374   C  CB  . VAL A  1 66  ? 70.645  53.540  -32.599  1.00 24.89  ? 65  VAL A CB  1 
ATOM   375   C  CG1 . VAL A  1 66  ? 71.088  53.669  -34.070  1.00 28.00  ? 65  VAL A CG1 1 
ATOM   376   C  CG2 . VAL A  1 66  ? 70.845  52.121  -32.102  1.00 33.75  ? 65  VAL A CG2 1 
ATOM   377   N  N   . THR A  1 67  ? 70.326  56.680  -31.938  1.00 29.03  ? 66  THR A N   1 
ATOM   378   C  CA  . THR A  1 67  ? 70.203  58.086  -32.349  1.00 32.86  ? 66  THR A CA  1 
ATOM   379   C  C   . THR A  1 67  ? 71.313  58.922  -31.722  1.00 30.85  ? 66  THR A C   1 
ATOM   380   O  O   . THR A  1 67  ? 71.894  59.801  -32.384  1.00 31.45  ? 66  THR A O   1 
ATOM   381   C  CB  . THR A  1 67  ? 68.835  58.672  -31.959  1.00 38.32  ? 66  THR A CB  1 
ATOM   382   O  OG1 . THR A  1 67  ? 67.796  57.871  -32.530  1.00 31.88  ? 66  THR A OG1 1 
ATOM   383   C  CG2 . THR A  1 67  ? 68.702  60.101  -32.473  1.00 32.87  ? 66  THR A CG2 1 
ATOM   384   N  N   . ASP A  1 68  ? 71.631  58.624  -30.458  1.00 31.42  ? 67  ASP A N   1 
ATOM   385   C  CA  . ASP A  1 68  ? 72.697  59.322  -29.745  1.00 28.81  ? 67  ASP A CA  1 
ATOM   386   C  C   . ASP A  1 68  ? 74.020  59.105  -30.471  1.00 31.63  ? 67  ASP A C   1 
ATOM   387   O  O   . ASP A  1 68  ? 74.816  60.042  -30.634  1.00 28.37  ? 67  ASP A O   1 
ATOM   388   C  CB  . ASP A  1 68  ? 72.861  58.791  -28.313  1.00 34.01  ? 67  ASP A CB  1 
ATOM   389   C  CG  . ASP A  1 68  ? 71.741  59.218  -27.390  1.00 71.32  ? 67  ASP A CG  1 
ATOM   390   O  OD1 . ASP A  1 68  ? 70.984  60.144  -27.751  1.00 42.62  ? 67  ASP A OD1 1 
ATOM   391   O  OD2 . ASP A  1 68  ? 71.634  58.629  -26.290  1.00 43.67  ? 67  ASP A OD2 1 
ATOM   392   N  N   . GLU A  1 69  ? 74.259  57.872  -30.911  1.00 32.58  ? 68  GLU A N   1 
ATOM   393   C  CA  . GLU A  1 69  ? 75.514  57.609  -31.610  1.00 32.57  ? 68  GLU A CA  1 
ATOM   394   C  C   . GLU A  1 69  ? 75.579  58.349  -32.919  1.00 30.46  ? 68  GLU A C   1 
ATOM   395   O  O   . GLU A  1 69  ? 76.615  58.915  -33.260  1.00 30.60  ? 68  GLU A O   1 
ATOM   396   C  CB  . GLU A  1 69  ? 75.814  56.124  -31.845  1.00 38.90  ? 68  GLU A CB  1 
ATOM   397   C  CG  . GLU A  1 69  ? 77.138  56.008  -32.610  1.00 36.27  ? 68  GLU A CG  1 
ATOM   398   C  CD  . GLU A  1 69  ? 77.670  54.613  -32.765  1.00 61.26  ? 68  GLU A CD  1 
ATOM   399   O  OE1 . GLU A  1 69  ? 76.869  53.665  -32.908  1.00 49.31  ? 68  GLU A OE1 1 
ATOM   400   O  OE2 . GLU A  1 69  ? 78.914  54.481  -32.758  1.00 46.44  ? 68  GLU A OE2 1 
HETATM 401   N  N   . MSE A  1 70  ? 74.471  58.361  -33.653  1.00 28.58  ? 69  MSE A N   1 
HETATM 402   C  CA  . MSE A  1 70  ? 74.453  59.036  -34.943  1.00 32.24  ? 69  MSE A CA  1 
HETATM 403   C  C   . MSE A  1 70  ? 74.887  60.491  -34.831  1.00 32.51  ? 69  MSE A C   1 
HETATM 404   O  O   . MSE A  1 70  ? 75.724  60.941  -35.603  1.00 28.63  ? 69  MSE A O   1 
HETATM 405   C  CB  . MSE A  1 70  ? 73.066  58.945  -35.603  1.00 32.53  ? 69  MSE A CB  1 
HETATM 406   C  CG  . MSE A  1 70  ? 73.019  59.536  -37.010  1.00 29.48  ? 69  MSE A CG  1 
HETATM 407   SE SE  . MSE A  1 70  ? 72.622  61.465  -37.044  0.64 34.62  ? 69  MSE A SE  1 
HETATM 408   C  CE  . MSE A  1 70  ? 70.897  61.357  -36.208  1.00 40.66  ? 69  MSE A CE  1 
ATOM   409   N  N   . VAL A  1 71  ? 74.325  61.243  -33.889  1.00 28.64  ? 70  VAL A N   1 
ATOM   410   C  CA  . VAL A  1 71  ? 74.646  62.670  -33.875  1.00 30.97  ? 70  VAL A CA  1 
ATOM   411   C  C   . VAL A  1 71  ? 76.051  62.931  -33.376  1.00 29.75  ? 70  VAL A C   1 
ATOM   412   O  O   . VAL A  1 71  ? 76.681  63.909  -33.775  1.00 30.66  ? 70  VAL A O   1 
ATOM   413   C  CB  . VAL A  1 71  ? 73.673  63.519  -33.062  1.00 35.61  ? 70  VAL A CB  1 
ATOM   414   C  CG1 . VAL A  1 71  ? 72.344  63.518  -33.734  1.00 51.09  ? 70  VAL A CG1 1 
ATOM   415   C  CG2 . VAL A  1 71  ? 73.597  63.044  -31.611  1.00 33.49  ? 70  VAL A CG2 1 
ATOM   416   N  N   . ARG A  1 72  ? 76.528  62.068  -32.490  1.00 29.77  ? 71  ARG A N   1 
ATOM   417   C  CA  . ARG A  1 72  ? 77.903  62.180  -32.024  1.00 31.01  ? 71  ARG A CA  1 
ATOM   418   C  C   . ARG A  1 72  ? 78.905  61.847  -33.139  1.00 31.53  ? 71  ARG A C   1 
ATOM   419   O  O   . ARG A  1 72  ? 79.946  62.514  -33.264  1.00 31.47  ? 71  ARG A O   1 
ATOM   420   C  CB  . ARG A  1 72  ? 78.114  61.335  -30.759  1.00 29.19  ? 71  ARG A CB  1 
ATOM   421   C  CG  . ARG A  1 72  ? 77.616  62.069  -29.500  1.00 27.61  ? 71  ARG A CG  1 
ATOM   422   C  CD  . ARG A  1 72  ? 77.176  61.111  -28.389  1.00 27.62  ? 71  ARG A CD  1 
ATOM   423   N  NE  . ARG A  1 72  ? 76.558  61.829  -27.271  1.00 30.95  ? 71  ARG A NE  1 
ATOM   424   C  CZ  . ARG A  1 72  ? 75.302  62.273  -27.264  1.00 37.91  ? 71  ARG A CZ  1 
ATOM   425   N  NH1 . ARG A  1 72  ? 74.518  62.082  -28.322  1.00 28.71  ? 71  ARG A NH1 1 
ATOM   426   N  NH2 . ARG A  1 72  ? 74.833  62.909  -26.200  1.00 29.26  ? 71  ARG A NH2 1 
ATOM   427   N  N   . LEU A  1 73  ? 78.584  60.841  -33.959  1.00 33.10  ? 72  LEU A N   1 
ATOM   428   C  CA  . LEU A  1 73  ? 79.414  60.520  -35.134  1.00 35.04  ? 72  LEU A CA  1 
ATOM   429   C  C   . LEU A  1 73  ? 79.440  61.707  -36.079  1.00 33.39  ? 72  LEU A C   1 
ATOM   430   O  O   . LEU A  1 73  ? 80.483  62.083  -36.616  1.00 32.94  ? 72  LEU A O   1 
ATOM   431   C  CB  . LEU A  1 73  ? 78.854  59.329  -35.917  1.00 36.49  ? 72  LEU A CB  1 
ATOM   432   C  CG  . LEU A  1 73  ? 79.142  57.877  -35.532  1.00 40.94  ? 72  LEU A CG  1 
ATOM   433   C  CD1 . LEU A  1 73  ? 78.205  56.975  -36.316  1.00 52.44  ? 72  LEU A CD1 1 
ATOM   434   C  CD2 . LEU A  1 73  ? 80.589  57.530  -35.839  1.00 39.30  ? 72  LEU A CD2 1 
ATOM   435   N  N   . ASN A  1 74  ? 78.271  62.281  -36.297  1.00 28.99  ? 73  ASN A N   1 
ATOM   436   C  CA  . ASN A  1 74  ? 78.156  63.423  -37.195  1.00 31.48  ? 73  ASN A CA  1 
ATOM   437   C  C   . ASN A  1 74  ? 79.028  64.590  -36.731  1.00 39.40  ? 73  ASN A C   1 
ATOM   438   O  O   . ASN A  1 74  ? 79.659  65.261  -37.551  1.00 38.61  ? 73  ASN A O   1 
ATOM   439   C  CB  . ASN A  1 74  ? 76.689  63.832  -37.324  1.00 33.88  ? 73  ASN A CB  1 
ATOM   440   C  CG  . ASN A  1 74  ? 76.468  64.877  -38.395  1.00 71.81  ? 73  ASN A CG  1 
ATOM   441   O  OD1 . ASN A  1 74  ? 76.675  64.620  -39.580  1.00 53.03  ? 73  ASN A OD1 1 
ATOM   442   N  ND2 . ASN A  1 74  ? 76.023  66.060  -37.984  1.00 57.34  ? 73  ASN A ND2 1 
ATOM   443   N  N   . TRP A  1 75  ? 79.096  64.803  -35.416  1.00 26.74  ? 74  TRP A N   1 
ATOM   444   C  CA  . TRP A  1 75  ? 79.892  65.897  -34.863  1.00 32.64  ? 74  TRP A CA  1 
ATOM   445   C  C   . TRP A  1 75  ? 81.386  65.616  -34.855  1.00 31.81  ? 74  TRP A C   1 
ATOM   446   O  O   . TRP A  1 75  ? 82.197  66.424  -35.339  1.00 30.74  ? 74  TRP A O   1 
ATOM   447   C  CB  . TRP A  1 75  ? 79.444  66.260  -33.440  1.00 32.82  ? 74  TRP A CB  1 
ATOM   448   C  CG  . TRP A  1 75  ? 80.375  67.250  -32.828  1.00 35.47  ? 74  TRP A CG  1 
ATOM   449   C  CD1 . TRP A  1 75  ? 80.493  68.590  -33.142  1.00 31.92  ? 74  TRP A CD1 1 
ATOM   450   C  CD2 . TRP A  1 75  ? 81.369  66.985  -31.839  1.00 30.78  ? 74  TRP A CD2 1 
ATOM   451   N  NE1 . TRP A  1 75  ? 81.494  69.162  -32.398  1.00 38.62  ? 74  TRP A NE1 1 
ATOM   452   C  CE2 . TRP A  1 75  ? 82.042  68.204  -31.583  1.00 33.76  ? 74  TRP A CE2 1 
ATOM   453   C  CE3 . TRP A  1 75  ? 81.738  65.844  -31.121  1.00 27.99  ? 74  TRP A CE3 1 
ATOM   454   C  CZ2 . TRP A  1 75  ? 83.069  68.307  -30.650  1.00 30.69  ? 74  TRP A CZ2 1 
ATOM   455   C  CZ3 . TRP A  1 75  ? 82.788  65.945  -30.203  1.00 29.47  ? 74  TRP A CZ3 1 
ATOM   456   C  CH2 . TRP A  1 75  ? 83.429  67.164  -29.972  1.00 34.69  ? 74  TRP A CH2 1 
ATOM   457   N  N   . LEU A  1 76  ? 81.752  64.469  -34.299  1.00 28.02  ? 75  LEU A N   1 
ATOM   458   C  CA  . LEU A  1 76  ? 83.154  64.200  -33.983  1.00 32.18  ? 75  LEU A CA  1 
ATOM   459   C  C   . LEU A  1 76  ? 84.012  63.952  -35.230  1.00 33.35  ? 75  LEU A C   1 
ATOM   460   O  O   . LEU A  1 76  ? 85.244  64.088  -35.200  1.00 30.73  ? 75  LEU A O   1 
ATOM   461   C  CB  . LEU A  1 76  ? 83.239  63.032  -32.998  1.00 31.98  ? 75  LEU A CB  1 
ATOM   462   C  CG  . LEU A  1 76  ? 84.620  62.622  -32.478  1.00 34.87  ? 75  LEU A CG  1 
ATOM   463   C  CD1 . LEU A  1 76  ? 85.335  63.803  -31.832  1.00 27.86  ? 75  LEU A CD1 1 
ATOM   464   C  CD2 . LEU A  1 76  ? 84.463  61.474  -31.487  1.00 31.86  ? 75  LEU A CD2 1 
ATOM   465   N  N   . THR A  1 77  ? 83.360  63.628  -36.338  1.00 33.64  ? 76  THR A N   1 
ATOM   466   C  CA  . THR A  1 77  ? 84.073  63.333  -37.575  1.00 37.61  ? 76  THR A CA  1 
ATOM   467   C  C   . THR A  1 77  ? 84.894  64.521  -38.104  1.00 29.66  ? 76  THR A C   1 
ATOM   468   O  O   . THR A  1 77  ? 85.860  64.341  -38.856  1.00 33.29  ? 76  THR A O   1 
ATOM   469   C  CB  . THR A  1 77  ? 83.114  62.823  -38.663  1.00 48.06  ? 76  THR A CB  1 
ATOM   470   O  OG1 . THR A  1 77  ? 83.858  62.528  -39.850  1.00 71.52  ? 76  THR A OG1 1 
ATOM   471   C  CG2 . THR A  1 77  ? 82.070  63.861  -38.980  1.00 53.94  ? 76  THR A CG2 1 
ATOM   472   N  N   . ALA A  1 78  ? 84.526  65.731  -37.689  1.00 33.39  ? 77  ALA A N   1 
ATOM   473   C  CA  . ALA A  1 78  ? 85.302  66.916  -38.048  1.00 37.46  ? 77  ALA A CA  1 
ATOM   474   C  C   . ALA A  1 78  ? 86.677  66.905  -37.379  1.00 40.24  ? 77  ALA A C   1 
ATOM   475   O  O   . ALA A  1 78  ? 87.629  67.555  -37.862  1.00 37.74  ? 77  ALA A O   1 
ATOM   476   C  CB  . ALA A  1 78  ? 84.545  68.174  -37.677  1.00 36.32  ? 77  ALA A CB  1 
ATOM   477   N  N   . PHE A  1 79  ? 86.786  66.151  -36.282  1.00 38.47  ? 78  PHE A N   1 
ATOM   478   C  CA  . PHE A  1 79  ? 87.991  66.175  -35.443  1.00 34.36  ? 78  PHE A CA  1 
ATOM   479   C  C   . PHE A  1 79  ? 88.821  64.878  -35.376  1.00 35.11  ? 78  PHE A C   1 
ATOM   480   O  O   . PHE A  1 79  ? 90.040  64.916  -35.156  1.00 41.30  ? 78  PHE A O   1 
ATOM   481   C  CB  . PHE A  1 79  ? 87.616  66.622  -34.026  1.00 35.45  ? 78  PHE A CB  1 
ATOM   482   C  CG  . PHE A  1 79  ? 86.867  67.912  -33.984  1.00 36.11  ? 78  PHE A CG  1 
ATOM   483   C  CD1 . PHE A  1 79  ? 87.548  69.120  -33.989  1.00 45.29  ? 78  PHE A CD1 1 
ATOM   484   C  CD2 . PHE A  1 79  ? 85.480  67.928  -33.960  1.00 52.67  ? 78  PHE A CD2 1 
ATOM   485   C  CE1 . PHE A  1 79  ? 86.866  70.311  -33.952  1.00 38.43  ? 78  PHE A CE1 1 
ATOM   486   C  CE2 . PHE A  1 79  ? 84.782  69.122  -33.927  1.00 40.49  ? 78  PHE A CE2 1 
ATOM   487   C  CZ  . PHE A  1 79  ? 85.469  70.316  -33.925  1.00 35.74  ? 78  PHE A CZ  1 
HETATM 488   N  N   . MSE A  1 80  ? 88.176  63.732  -35.559  1.00 30.86  ? 79  MSE A N   1 
HETATM 489   C  CA  . MSE A  1 80  ? 88.821  62.439  -35.358  1.00 36.32  ? 79  MSE A CA  1 
HETATM 490   C  C   . MSE A  1 80  ? 88.369  61.452  -36.430  1.00 36.02  ? 79  MSE A C   1 
HETATM 491   O  O   . MSE A  1 80  ? 87.271  61.596  -36.972  1.00 37.86  ? 79  MSE A O   1 
HETATM 492   C  CB  . MSE A  1 80  ? 88.440  61.883  -33.966  1.00 37.29  ? 79  MSE A CB  1 
HETATM 493   C  CG  . MSE A  1 80  ? 88.896  62.770  -32.799  1.00 43.32  ? 79  MSE A CG  1 
HETATM 494   SE SE  . MSE A  1 80  ? 90.819  62.896  -32.641  0.66 39.61  ? 79  MSE A SE  1 
HETATM 495   C  CE  . MSE A  1 80  ? 91.148  61.072  -32.014  1.00 39.64  ? 79  MSE A CE  1 
ATOM   496   N  N   . PRO A  1 81  ? 89.191  60.430  -36.714  1.00 37.98  ? 80  PRO A N   1 
ATOM   497   C  CA  . PRO A  1 81  ? 88.812  59.380  -37.676  1.00 28.20  ? 80  PRO A CA  1 
ATOM   498   C  C   . PRO A  1 81  ? 87.774  58.409  -37.104  1.00 34.22  ? 80  PRO A C   1 
ATOM   499   O  O   . PRO A  1 81  ? 88.064  57.734  -36.122  1.00 35.37  ? 80  PRO A O   1 
ATOM   500   C  CB  . PRO A  1 81  ? 90.132  58.653  -37.941  1.00 28.50  ? 80  PRO A CB  1 
ATOM   501   C  CG  . PRO A  1 81  ? 90.940  58.889  -36.716  1.00 33.58  ? 80  PRO A CG  1 
ATOM   502   C  CD  . PRO A  1 81  ? 90.572  60.259  -36.226  1.00 33.71  ? 80  PRO A CD  1 
ATOM   503   N  N   . LEU A  1 82  ? 86.593  58.347  -37.727  1.00 31.10  ? 81  LEU A N   1 
ATOM   504   C  CA  . LEU A  1 82  ? 85.448  57.554  -37.250  1.00 30.03  ? 81  LEU A CA  1 
ATOM   505   C  C   . LEU A  1 82  ? 84.777  56.954  -38.473  1.00 36.04  ? 81  LEU A C   1 
ATOM   506   O  O   . LEU A  1 82  ? 85.082  57.375  -39.602  1.00 34.35  ? 81  LEU A O   1 
ATOM   507   C  CB  . LEU A  1 82  ? 84.398  58.477  -36.612  1.00 37.25  ? 81  LEU A CB  1 
ATOM   508   C  CG  . LEU A  1 82  ? 84.777  59.548  -35.607  1.00 51.19  ? 81  LEU A CG  1 
ATOM   509   C  CD1 . LEU A  1 82  ? 83.522  60.175  -35.062  1.00 32.58  ? 81  LEU A CD1 1 
ATOM   510   C  CD2 . LEU A  1 82  ? 85.532  58.902  -34.518  1.00 50.29  ? 81  LEU A CD2 1 
ATOM   511   N  N   . PRO A  1 83  ? 83.838  56.001  -38.272  1.00 27.89  ? 82  PRO A N   1 
ATOM   512   C  CA  . PRO A  1 83  ? 83.107  55.510  -39.448  1.00 31.52  ? 82  PRO A CA  1 
ATOM   513   C  C   . PRO A  1 83  ? 82.336  56.653  -40.087  1.00 45.67  ? 82  PRO A C   1 
ATOM   514   O  O   . PRO A  1 83  ? 82.003  57.613  -39.392  1.00 31.82  ? 82  PRO A O   1 
ATOM   515   C  CB  . PRO A  1 83  ? 82.114  54.512  -38.854  1.00 31.59  ? 82  PRO A CB  1 
ATOM   516   C  CG  . PRO A  1 83  ? 82.763  54.037  -37.584  1.00 29.34  ? 82  PRO A CG  1 
ATOM   517   C  CD  . PRO A  1 83  ? 83.471  55.258  -37.043  1.00 26.13  ? 82  PRO A CD  1 
ATOM   518   N  N   . THR A  1 84  ? 82.062  56.543  -41.382  1.00 29.25  ? 83  THR A N   1 
ATOM   519   C  CA  . THR A  1 84  ? 81.293  57.554  -42.113  1.00 32.81  ? 83  THR A CA  1 
ATOM   520   C  C   . THR A  1 84  ? 79.826  57.130  -42.142  1.00 39.38  ? 83  THR A C   1 
ATOM   521   O  O   . THR A  1 84  ? 79.525  55.984  -42.443  1.00 34.63  ? 83  THR A O   1 
ATOM   522   C  CB  . THR A  1 84  ? 81.813  57.669  -43.548  1.00 35.72  ? 83  THR A CB  1 
ATOM   523   O  OG1 . THR A  1 84  ? 83.100  58.308  -43.533  1.00 42.11  ? 83  THR A OG1 1 
ATOM   524   C  CG2 . THR A  1 84  ? 80.860  58.470  -44.419  1.00 33.69  ? 83  THR A CG2 1 
ATOM   525   N  N   . ILE A  1 85  ? 78.923  58.038  -41.800  1.00 33.99  ? 84  ILE A N   1 
ATOM   526   C  CA  . ILE A  1 85  ? 77.484  57.760  -41.886  1.00 34.86  ? 84  ILE A CA  1 
ATOM   527   C  C   . ILE A  1 85  ? 77.015  57.695  -43.329  1.00 34.22  ? 84  ILE A C   1 
ATOM   528   O  O   . ILE A  1 85  ? 77.143  58.662  -44.088  1.00 36.31  ? 84  ILE A O   1 
ATOM   529   C  CB  . ILE A  1 85  ? 76.664  58.843  -41.177  1.00 38.69  ? 84  ILE A CB  1 
ATOM   530   C  CG1 . ILE A  1 85  ? 76.999  58.861  -39.685  1.00 37.60  ? 84  ILE A CG1 1 
ATOM   531   C  CG2 . ILE A  1 85  ? 75.154  58.619  -41.399  1.00 38.25  ? 84  ILE A CG2 1 
ATOM   532   C  CD1 . ILE A  1 85  ? 76.472  60.083  -38.968  1.00 43.61  ? 84  ILE A CD1 1 
ATOM   533   N  N   . LYS A  1 86  ? 76.449  56.562  -43.717  1.00 29.81  ? 85  LYS A N   1 
ATOM   534   C  CA  . LYS A  1 86  ? 75.876  56.468  -45.043  1.00 29.51  ? 85  LYS A CA  1 
ATOM   535   C  C   . LYS A  1 86  ? 74.370  56.772  -45.078  1.00 31.32  ? 85  LYS A C   1 
ATOM   536   O  O   . LYS A  1 86  ? 73.894  57.369  -46.030  1.00 33.31  ? 85  LYS A O   1 
ATOM   537   C  CB  . LYS A  1 86  ? 76.196  55.112  -45.687  1.00 45.52  ? 85  LYS A CB  1 
ATOM   538   C  CG  . LYS A  1 86  ? 77.639  55.021  -46.218  1.00 52.20  ? 85  LYS A CG  1 
ATOM   539   C  CD  . LYS A  1 86  ? 77.928  56.102  -47.272  1.00 62.46  ? 85  LYS A CD  1 
ATOM   540   C  CE  . LYS A  1 86  ? 79.392  56.102  -47.728  1.00 85.34  ? 85  LYS A CE  1 
ATOM   541   N  NZ  . LYS A  1 86  ? 79.774  54.881  -48.506  1.00 75.70  ? 85  LYS A NZ  1 
ATOM   542   N  N   . HIS A  1 87  ? 73.636  56.374  -44.037  1.00 32.68  ? 86  HIS A N   1 
ATOM   543   C  CA  . HIS A  1 87  ? 72.186  56.579  -44.024  1.00 33.56  ? 86  HIS A CA  1 
ATOM   544   C  C   . HIS A  1 87  ? 71.720  56.428  -42.589  1.00 31.54  ? 86  HIS A C   1 
ATOM   545   O  O   . HIS A  1 87  ? 72.266  55.622  -41.833  1.00 35.09  ? 86  HIS A O   1 
ATOM   546   C  CB  . HIS A  1 87  ? 71.512  55.522  -44.909  1.00 33.39  ? 86  HIS A CB  1 
ATOM   547   C  CG  . HIS A  1 87  ? 70.197  55.938  -45.497  1.00 47.45  ? 86  HIS A CG  1 
ATOM   548   N  ND1 . HIS A  1 87  ? 69.932  55.858  -46.847  1.00 61.69  ? 86  HIS A ND1 1 
ATOM   549   C  CD2 . HIS A  1 87  ? 69.063  56.401  -44.919  1.00 52.40  ? 86  HIS A CD2 1 
ATOM   550   C  CE1 . HIS A  1 87  ? 68.697  56.268  -47.079  1.00 59.26  ? 86  HIS A CE1 1 
ATOM   551   N  NE2 . HIS A  1 87  ? 68.147  56.604  -45.926  1.00 48.41  ? 86  HIS A NE2 1 
ATOM   552   N  N   . PHE A  1 88  ? 70.737  57.228  -42.184  1.00 31.20  ? 87  PHE A N   1 
ATOM   553   C  CA  . PHE A  1 88  ? 70.154  57.035  -40.856  1.00 29.79  ? 87  PHE A CA  1 
ATOM   554   C  C   . PHE A  1 88  ? 68.659  57.291  -40.948  1.00 30.38  ? 87  PHE A C   1 
ATOM   555   O  O   . PHE A  1 88  ? 68.218  58.169  -41.682  1.00 34.59  ? 87  PHE A O   1 
ATOM   556   C  CB  . PHE A  1 88  ? 70.805  57.951  -39.812  1.00 28.17  ? 87  PHE A CB  1 
ATOM   557   C  CG  . PHE A  1 88  ? 70.097  57.955  -38.471  1.00 33.92  ? 87  PHE A CG  1 
ATOM   558   C  CD1 . PHE A  1 88  ? 70.454  57.046  -37.475  1.00 26.51  ? 87  PHE A CD1 1 
ATOM   559   C  CD2 . PHE A  1 88  ? 69.090  58.879  -38.206  1.00 30.78  ? 87  PHE A CD2 1 
ATOM   560   C  CE1 . PHE A  1 88  ? 69.787  57.049  -36.235  1.00 29.95  ? 87  PHE A CE1 1 
ATOM   561   C  CE2 . PHE A  1 88  ? 68.436  58.895  -36.978  1.00 37.20  ? 87  PHE A CE2 1 
ATOM   562   C  CZ  . PHE A  1 88  ? 68.785  57.981  -35.989  1.00 28.09  ? 87  PHE A CZ  1 
ATOM   563   N  N   . ILE A  1 89  ? 67.887  56.494  -40.212  1.00 27.73  ? 88  ILE A N   1 
ATOM   564   C  CA  A ILE A  1 89  ? 66.442  56.645  -40.213  0.53 26.14  ? 88  ILE A CA  1 
ATOM   565   C  CA  B ILE A  1 89  ? 66.433  56.587  -40.216  0.47 34.33  ? 88  ILE A CA  1 
ATOM   566   C  C   . ILE A  1 89  ? 65.952  56.535  -38.777  1.00 29.43  ? 88  ILE A C   1 
ATOM   567   O  O   . ILE A  1 89  ? 66.410  55.691  -38.019  1.00 32.87  ? 88  ILE A O   1 
ATOM   568   C  CB  A ILE A  1 89  ? 65.752  55.558  -41.070  0.53 40.94  ? 88  ILE A CB  1 
ATOM   569   C  CB  B ILE A  1 89  ? 65.803  55.376  -40.935  0.47 29.86  ? 88  ILE A CB  1 
ATOM   570   C  CG1 A ILE A  1 89  ? 66.275  55.587  -42.508  0.53 46.63  ? 88  ILE A CG1 1 
ATOM   571   C  CG1 B ILE A  1 89  ? 66.311  55.269  -42.369  0.47 39.19  ? 88  ILE A CG1 1 
ATOM   572   C  CG2 A ILE A  1 89  ? 64.233  55.736  -41.059  0.53 38.94  ? 88  ILE A CG2 1 
ATOM   573   C  CG2 B ILE A  1 89  ? 64.277  55.470  -40.928  0.47 38.99  ? 88  ILE A CG2 1 
ATOM   574   C  CD1 A ILE A  1 89  ? 65.728  54.486  -43.384  0.53 32.87  ? 88  ILE A CD1 1 
ATOM   575   C  CD1 B ILE A  1 89  ? 65.926  56.444  -43.210  0.47 34.04  ? 88  ILE A CD1 1 
ATOM   576   N  N   . ARG A  1 90  ? 65.028  57.418  -38.412  1.00 38.04  ? 89  ARG A N   1 
ATOM   577   C  CA  . ARG A  1 90  ? 64.397  57.355  -37.105  1.00 37.23  ? 89  ARG A CA  1 
ATOM   578   C  C   . ARG A  1 90  ? 62.886  57.427  -37.293  1.00 33.85  ? 89  ARG A C   1 
ATOM   579   O  O   . ARG A  1 90  ? 62.367  58.369  -37.908  1.00 35.96  ? 89  ARG A O   1 
ATOM   580   C  CB  . ARG A  1 90  ? 64.851  58.514  -36.210  1.00 36.43  ? 89  ARG A CB  1 
ATOM   581   C  CG  . ARG A  1 90  ? 64.138  58.545  -34.845  1.00 39.51  ? 89  ARG A CG  1 
ATOM   582   C  CD  . ARG A  1 90  ? 64.533  57.312  -34.030  1.00 41.05  ? 89  ARG A CD  1 
ATOM   583   N  NE  . ARG A  1 90  ? 63.658  57.052  -32.885  1.00 53.66  ? 89  ARG A NE  1 
ATOM   584   C  CZ  . ARG A  1 90  ? 63.945  57.415  -31.640  1.00 40.06  ? 89  ARG A CZ  1 
ATOM   585   N  NH1 . ARG A  1 90  ? 65.074  58.067  -31.392  1.00 41.92  ? 89  ARG A NH1 1 
ATOM   586   N  NH2 . ARG A  1 90  ? 63.107  57.131  -30.646  1.00 38.34  ? 89  ARG A NH2 1 
ATOM   587   N  N   . THR A  1 91  ? 62.195  56.421  -36.773  1.00 34.56  ? 90  THR A N   1 
ATOM   588   C  CA  . THR A  1 91  ? 60.746  56.465  -36.624  1.00 39.90  ? 90  THR A CA  1 
ATOM   589   C  C   . THR A  1 91  ? 60.476  56.420  -35.107  1.00 37.29  ? 90  THR A C   1 
ATOM   590   O  O   . THR A  1 91  ? 61.430  56.289  -34.337  1.00 38.77  ? 90  THR A O   1 
ATOM   591   C  CB  . THR A  1 91  ? 60.070  55.308  -37.394  1.00 49.06  ? 90  THR A CB  1 
ATOM   592   O  OG1 . THR A  1 91  ? 60.554  54.055  -36.906  1.00 42.34  ? 90  THR A OG1 1 
ATOM   593   C  CG2 . THR A  1 91  ? 60.364  55.418  -38.884  1.00 49.78  ? 90  THR A CG2 1 
ATOM   594   N  N   . PRO A  1 92  ? 59.201  56.560  -34.672  1.00 44.47  ? 91  PRO A N   1 
ATOM   595   C  CA  . PRO A  1 92  ? 58.984  56.643  -33.220  1.00 59.71  ? 91  PRO A CA  1 
ATOM   596   C  C   . PRO A  1 92  ? 59.623  55.516  -32.405  1.00 52.93  ? 91  PRO A C   1 
ATOM   597   O  O   . PRO A  1 92  ? 60.247  55.818  -31.387  1.00 49.46  ? 91  PRO A O   1 
ATOM   598   C  CB  . PRO A  1 92  ? 57.462  56.614  -33.103  1.00 70.51  ? 91  PRO A CB  1 
ATOM   599   C  CG  . PRO A  1 92  ? 57.013  57.352  -34.322  1.00 62.23  ? 91  PRO A CG  1 
ATOM   600   C  CD  . PRO A  1 92  ? 57.982  56.948  -35.414  1.00 45.62  ? 91  PRO A CD  1 
ATOM   601   N  N   . ASP A  1 93  ? 59.526  54.273  -32.872  1.00 39.24  ? 92  ASP A N   1 
ATOM   602   C  CA  . ASP A  1 93  ? 60.038  53.119  -32.123  1.00 36.69  ? 92  ASP A CA  1 
ATOM   603   C  C   . ASP A  1 93  ? 61.336  52.486  -32.652  1.00 35.50  ? 92  ASP A C   1 
ATOM   604   O  O   . ASP A  1 93  ? 61.806  51.493  -32.086  1.00 35.92  ? 92  ASP A O   1 
ATOM   605   C  CB  . ASP A  1 93  ? 58.967  52.031  -32.035  1.00 44.13  ? 92  ASP A CB  1 
ATOM   606   C  CG  . ASP A  1 93  ? 57.729  52.486  -31.280  1.00 50.54  ? 92  ASP A CG  1 
ATOM   607   O  OD1 . ASP A  1 93  ? 57.852  53.351  -30.389  1.00 64.80  ? 92  ASP A OD1 1 
ATOM   608   O  OD2 . ASP A  1 93  ? 56.636  51.967  -31.578  1.00 56.99  ? 92  ASP A OD2 1 
ATOM   609   N  N   . ASP A  1 94  ? 61.919  53.038  -33.717  1.00 34.50  ? 93  ASP A N   1 
ATOM   610   C  CA  . ASP A  1 94  ? 63.056  52.390  -34.362  1.00 30.39  ? 93  ASP A CA  1 
ATOM   611   C  C   . ASP A  1 94  ? 64.081  53.379  -34.870  1.00 30.80  ? 93  ASP A C   1 
ATOM   612   O  O   . ASP A  1 94  ? 63.732  54.452  -35.326  1.00 32.86  ? 93  ASP A O   1 
ATOM   613   C  CB  . ASP A  1 94  ? 62.600  51.526  -35.545  1.00 36.17  ? 93  ASP A CB  1 
ATOM   614   C  CG  . ASP A  1 94  ? 61.724  50.366  -35.120  1.00 44.94  ? 93  ASP A CG  1 
ATOM   615   O  OD1 . ASP A  1 94  ? 62.280  49.281  -34.837  1.00 39.71  ? 93  ASP A OD1 1 
ATOM   616   O  OD2 . ASP A  1 94  ? 60.486  50.541  -35.070  1.00 40.91  ? 93  ASP A OD2 1 
ATOM   617   N  N   . ALA A  1 95  ? 65.345  52.982  -34.795  1.00 28.16  ? 94  ALA A N   1 
ATOM   618   C  CA  . ALA A  1 95  ? 66.433  53.755  -35.381  1.00 32.92  ? 94  ALA A CA  1 
ATOM   619   C  C   . ALA A  1 95  ? 67.343  52.799  -36.141  1.00 34.96  ? 94  ALA A C   1 
ATOM   620   O  O   . ALA A  1 95  ? 67.687  51.716  -35.649  1.00 30.44  ? 94  ALA A O   1 
ATOM   621   C  CB  . ALA A  1 95  ? 67.199  54.503  -34.304  1.00 28.74  ? 94  ALA A CB  1 
ATOM   622   N  N   . TRP A  1 96  ? 67.715  53.192  -37.357  1.00 30.79  ? 95  TRP A N   1 
ATOM   623   C  CA  . TRP A  1 96  ? 68.610  52.392  -38.192  1.00 28.92  ? 95  TRP A CA  1 
ATOM   624   C  C   . TRP A  1 96  ? 69.811  53.252  -38.571  1.00 29.75  ? 95  TRP A C   1 
ATOM   625   O  O   . TRP A  1 96  ? 69.616  54.302  -39.170  1.00 30.80  ? 95  TRP A O   1 
ATOM   626   C  CB  . TRP A  1 96  ? 67.869  51.994  -39.467  1.00 32.75  ? 95  TRP A CB  1 
ATOM   627   C  CG  . TRP A  1 96  ? 66.673  51.120  -39.227  1.00 37.56  ? 95  TRP A CG  1 
ATOM   628   C  CD1 . TRP A  1 96  ? 65.398  51.532  -38.942  1.00 40.19  ? 95  TRP A CD1 1 
ATOM   629   C  CD2 . TRP A  1 96  ? 66.636  49.688  -39.265  1.00 37.73  ? 95  TRP A CD2 1 
ATOM   630   N  NE1 . TRP A  1 96  ? 64.574  50.441  -38.790  1.00 41.30  ? 95  TRP A NE1 1 
ATOM   631   C  CE2 . TRP A  1 96  ? 65.306  49.298  -38.989  1.00 39.52  ? 95  TRP A CE2 1 
ATOM   632   C  CE3 . TRP A  1 96  ? 67.594  48.698  -39.507  1.00 40.66  ? 95  TRP A CE3 1 
ATOM   633   C  CZ2 . TRP A  1 96  ? 64.912  47.956  -38.943  1.00 49.93  ? 95  TRP A CZ2 1 
ATOM   634   C  CZ3 . TRP A  1 96  ? 67.197  47.356  -39.467  1.00 41.97  ? 95  TRP A CZ3 1 
ATOM   635   C  CH2 . TRP A  1 96  ? 65.865  47.004  -39.188  1.00 40.84  ? 95  TRP A CH2 1 
ATOM   636   N  N   . LEU A  1 97  ? 71.030  52.805  -38.252  1.00 27.82  ? 96  LEU A N   1 
ATOM   637   C  CA  . LEU A  1 97  ? 72.242  53.580  -38.550  1.00 29.70  ? 96  LEU A CA  1 
ATOM   638   C  C   . LEU A  1 97  ? 73.196  52.770  -39.445  1.00 28.75  ? 96  LEU A C   1 
ATOM   639   O  O   . LEU A  1 97  ? 73.729  51.754  -39.011  1.00 30.46  ? 96  LEU A O   1 
ATOM   640   C  CB  . LEU A  1 97  ? 72.952  53.945  -37.232  1.00 26.37  ? 96  LEU A CB  1 
ATOM   641   C  CG  . LEU A  1 97  ? 74.323  54.643  -37.333  1.00 30.02  ? 96  LEU A CG  1 
ATOM   642   C  CD1 . LEU A  1 97  ? 74.235  55.945  -38.147  1.00 28.92  ? 96  LEU A CD1 1 
ATOM   643   C  CD2 . LEU A  1 97  ? 74.859  54.899  -35.916  1.00 31.36  ? 96  LEU A CD2 1 
ATOM   644   N  N   . LEU A  1 98  ? 73.389  53.218  -40.688  1.00 32.02  ? 97  LEU A N   1 
ATOM   645   C  CA  . LEU A  1 98  ? 74.240  52.524  -41.650  1.00 32.69  ? 97  LEU A CA  1 
ATOM   646   C  C   . LEU A  1 98  ? 75.558  53.279  -41.798  1.00 31.27  ? 97  LEU A C   1 
ATOM   647   O  O   . LEU A  1 98  ? 75.559  54.445  -42.212  1.00 30.52  ? 97  LEU A O   1 
ATOM   648   C  CB  . LEU A  1 98  ? 73.541  52.471  -43.023  1.00 28.22  ? 97  LEU A CB  1 
ATOM   649   C  CG  . LEU A  1 98  ? 74.293  51.688  -44.123  1.00 32.40  ? 97  LEU A CG  1 
ATOM   650   C  CD1 . LEU A  1 98  ? 74.401  50.189  -43.763  1.00 32.67  ? 97  LEU A CD1 1 
ATOM   651   C  CD2 . LEU A  1 98  ? 73.664  51.865  -45.493  1.00 37.32  ? 97  LEU A CD2 1 
ATOM   652   N  N   . THR A  1 99  ? 76.679  52.627  -41.479  1.00 30.97  ? 98  THR A N   1 
ATOM   653   C  CA  . THR A  1 99  ? 77.981  53.290  -41.563  1.00 37.83  ? 98  THR A CA  1 
ATOM   654   C  C   . THR A  1 99  ? 78.988  52.454  -42.347  1.00 32.68  ? 98  THR A C   1 
ATOM   655   O  O   . THR A  1 99  ? 78.809  51.247  -42.514  1.00 30.52  ? 98  THR A O   1 
ATOM   656   C  CB  . THR A  1 99  ? 78.580  53.554  -40.163  1.00 35.36  ? 98  THR A CB  1 
ATOM   657   O  OG1 . THR A  1 99  ? 78.912  52.304  -39.545  1.00 36.62  ? 98  THR A OG1 1 
ATOM   658   C  CG2 . THR A  1 99  ? 77.583  54.317  -39.271  1.00 33.54  ? 98  THR A CG2 1 
ATOM   659   N  N   . THR A  1 100 ? 80.054  53.097  -42.810  1.00 34.73  ? 99  THR A N   1 
ATOM   660   C  CA  . THR A  1 100 ? 81.154  52.382  -43.447  1.00 29.71  ? 99  THR A CA  1 
ATOM   661   C  C   . THR A  1 100 ? 81.908  51.556  -42.399  1.00 33.98  ? 99  THR A C   1 
ATOM   662   O  O   . THR A  1 100 ? 81.902  51.894  -41.220  1.00 42.38  ? 99  THR A O   1 
ATOM   663   C  CB  . THR A  1 100 ? 82.138  53.362  -44.128  1.00 34.48  ? 99  THR A CB  1 
ATOM   664   O  OG1 . THR A  1 100 ? 82.726  54.232  -43.140  1.00 40.25  ? 99  THR A OG1 1 
ATOM   665   C  CG2 . THR A  1 100 ? 81.424  54.173  -45.175  1.00 39.39  ? 99  THR A CG2 1 
ATOM   666   N  N   . ALA A  1 101 ? 82.531  50.457  -42.813  1.00 31.55  ? 100 ALA A N   1 
ATOM   667   C  CA  . ALA A  1 101 ? 83.355  49.693  -41.880  1.00 35.22  ? 100 ALA A CA  1 
ATOM   668   C  C   . ALA A  1 101 ? 84.764  50.253  -41.877  1.00 35.83  ? 100 ALA A C   1 
ATOM   669   O  O   . ALA A  1 101 ? 85.348  50.462  -42.939  1.00 43.38  ? 100 ALA A O   1 
ATOM   670   C  CB  . ALA A  1 101 ? 83.403  48.240  -42.284  1.00 35.67  ? 100 ALA A CB  1 
ATOM   671   N  N   . ILE A  1 102 ? 85.327  50.487  -40.698  1.00 33.05  ? 101 ILE A N   1 
ATOM   672   C  CA  . ILE A  1 102 ? 86.757  50.769  -40.637  1.00 32.23  ? 101 ILE A CA  1 
ATOM   673   C  C   . ILE A  1 102 ? 87.531  49.457  -40.745  1.00 32.34  ? 101 ILE A C   1 
ATOM   674   O  O   . ILE A  1 102 ? 87.377  48.578  -39.909  1.00 36.90  ? 101 ILE A O   1 
ATOM   675   C  CB  . ILE A  1 102 ? 87.135  51.504  -39.336  1.00 34.88  ? 101 ILE A CB  1 
ATOM   676   C  CG1 . ILE A  1 102 ? 86.333  52.806  -39.217  1.00 37.81  ? 101 ILE A CG1 1 
ATOM   677   C  CG2 . ILE A  1 102 ? 88.651  51.746  -39.282  1.00 39.12  ? 101 ILE A CG2 1 
ATOM   678   C  CD1 . ILE A  1 102 ? 86.622  53.586  -37.969  1.00 40.38  ? 101 ILE A CD1 1 
ATOM   679   N  N   . PRO A  1 103 ? 88.365  49.306  -41.789  1.00 32.82  ? 102 PRO A N   1 
ATOM   680   C  CA  . PRO A  1 103 ? 89.077  48.036  -41.971  1.00 40.67  ? 102 PRO A CA  1 
ATOM   681   C  C   . PRO A  1 103 ? 90.061  47.801  -40.831  1.00 39.05  ? 102 PRO A C   1 
ATOM   682   O  O   . PRO A  1 103 ? 90.535  48.773  -40.241  1.00 35.90  ? 102 PRO A O   1 
ATOM   683   C  CB  . PRO A  1 103 ? 89.845  48.246  -43.284  1.00 46.65  ? 102 PRO A CB  1 
ATOM   684   C  CG  . PRO A  1 103 ? 89.116  49.338  -43.974  1.00 40.15  ? 102 PRO A CG  1 
ATOM   685   C  CD  . PRO A  1 103 ? 88.640  50.252  -42.882  1.00 36.50  ? 102 PRO A CD  1 
ATOM   686   N  N   . GLY A  1 104 ? 90.348  46.539  -40.529  1.00 34.25  ? 103 GLY A N   1 
ATOM   687   C  CA  . GLY A  1 104 ? 91.310  46.196  -39.494  1.00 38.78  ? 103 GLY A CA  1 
ATOM   688   C  C   . GLY A  1 104 ? 90.731  45.384  -38.342  1.00 40.67  ? 103 GLY A C   1 
ATOM   689   O  O   . GLY A  1 104 ? 89.653  44.793  -38.447  1.00 34.79  ? 103 GLY A O   1 
ATOM   690   N  N   . LYS A  1 105 ? 91.459  45.364  -37.232  1.00 34.19  ? 104 LYS A N   1 
ATOM   691   C  CA  . LYS A  1 105 ? 91.086  44.576  -36.060  1.00 35.31  ? 104 LYS A CA  1 
ATOM   692   C  C   . LYS A  1 105 ? 91.103  45.471  -34.833  1.00 32.95  ? 104 LYS A C   1 
ATOM   693   O  O   . LYS A  1 105 ? 91.709  46.537  -34.867  1.00 34.16  ? 104 LYS A O   1 
ATOM   694   C  CB  . LYS A  1 105 ? 92.090  43.429  -35.882  1.00 37.35  ? 104 LYS A CB  1 
ATOM   695   C  CG  . LYS A  1 105 ? 91.941  42.322  -36.911  1.00 43.91  ? 104 LYS A CG  1 
ATOM   696   C  CD  . LYS A  1 105 ? 92.994  41.249  -36.710  1.00 52.73  ? 104 LYS A CD  1 
ATOM   697   C  CE  . LYS A  1 105 ? 92.880  40.143  -37.744  1.00 72.58  ? 104 LYS A CE  1 
ATOM   698   N  NZ  . LYS A  1 105 ? 93.910  39.091  -37.519  1.00 75.00  ? 104 LYS A NZ  1 
ATOM   699   N  N   . THR A  1 106 ? 90.436  45.060  -33.753  1.00 31.20  ? 105 THR A N   1 
ATOM   700   C  CA  . THR A  1 106 ? 90.446  45.863  -32.528  1.00 26.64  ? 105 THR A CA  1 
ATOM   701   C  C   . THR A  1 106 ? 91.821  45.858  -31.864  1.00 30.90  ? 105 THR A C   1 
ATOM   702   O  O   . THR A  1 106 ? 92.635  44.966  -32.115  1.00 30.93  ? 105 THR A O   1 
ATOM   703   C  CB  . THR A  1 106 ? 89.401  45.383  -31.503  1.00 30.80  ? 105 THR A CB  1 
ATOM   704   O  OG1 . THR A  1 106 ? 89.766  44.081  -31.022  1.00 31.53  ? 105 THR A OG1 1 
ATOM   705   C  CG2 . THR A  1 106 ? 88.021  45.319  -32.163  1.00 29.50  ? 105 THR A CG2 1 
ATOM   706   N  N   . ALA A  1 107 ? 92.072  46.851  -31.011  1.00 28.61  ? 106 ALA A N   1 
ATOM   707   C  CA  . ALA A  1 107 ? 93.324  46.888  -30.260  1.00 31.97  ? 106 ALA A CA  1 
ATOM   708   C  C   . ALA A  1 107 ? 93.480  45.599  -29.459  1.00 35.64  ? 106 ALA A C   1 
ATOM   709   O  O   . ALA A  1 107 ? 94.583  45.055  -29.337  1.00 33.37  ? 106 ALA A O   1 
ATOM   710   C  CB  . ALA A  1 107 ? 93.373  48.112  -29.343  1.00 29.14  ? 106 ALA A CB  1 
ATOM   711   N  N   . PHE A  1 108 ? 92.374  45.092  -28.934  1.00 32.01  ? 107 PHE A N   1 
ATOM   712   C  CA  . PHE A  1 108 ? 92.432  43.834  -28.184  1.00 34.53  ? 107 PHE A CA  1 
ATOM   713   C  C   . PHE A  1 108 ? 92.948  42.691  -29.060  1.00 32.92  ? 107 PHE A C   1 
ATOM   714   O  O   . PHE A  1 108 ? 93.874  41.949  -28.680  1.00 30.80  ? 107 PHE A O   1 
ATOM   715   C  CB  . PHE A  1 108 ? 91.058  43.498  -27.624  1.00 27.43  ? 107 PHE A CB  1 
ATOM   716   C  CG  . PHE A  1 108 ? 91.014  42.202  -26.849  1.00 30.50  ? 107 PHE A CG  1 
ATOM   717   C  CD1 . PHE A  1 108 ? 91.329  42.176  -25.500  1.00 39.74  ? 107 PHE A CD1 1 
ATOM   718   C  CD2 . PHE A  1 108 ? 90.626  41.020  -27.467  1.00 37.86  ? 107 PHE A CD2 1 
ATOM   719   C  CE1 . PHE A  1 108 ? 91.268  40.984  -24.781  1.00 36.84  ? 107 PHE A CE1 1 
ATOM   720   C  CE2 . PHE A  1 108 ? 90.562  39.836  -26.755  1.00 38.68  ? 107 PHE A CE2 1 
ATOM   721   C  CZ  . PHE A  1 108 ? 90.882  39.820  -25.416  1.00 37.92  ? 107 PHE A CZ  1 
ATOM   722   N  N   . GLN A  1 109 ? 92.364  42.563  -30.247  1.00 33.85  ? 108 GLN A N   1 
ATOM   723   C  CA  . GLN A  1 109 ? 92.770  41.529  -31.191  1.00 37.57  ? 108 GLN A CA  1 
ATOM   724   C  C   . GLN A  1 109 ? 94.244  41.629  -31.574  1.00 37.48  ? 108 GLN A C   1 
ATOM   725   O  O   . GLN A  1 109 ? 94.948  40.623  -31.598  1.00 36.84  ? 108 GLN A O   1 
ATOM   726   C  CB  . GLN A  1 109 ? 91.910  41.580  -32.457  1.00 37.27  ? 108 GLN A CB  1 
ATOM   727   C  CG  . GLN A  1 109 ? 90.428  41.249  -32.228  1.00 40.82  ? 108 GLN A CG  1 
ATOM   728   C  CD  . GLN A  1 109 ? 89.606  41.306  -33.521  1.00 49.51  ? 108 GLN A CD  1 
ATOM   729   O  OE1 . GLN A  1 109 ? 89.166  42.376  -33.950  1.00 42.99  ? 108 GLN A OE1 1 
ATOM   730   N  NE2 . GLN A  1 109 ? 89.405  40.151  -34.145  1.00 56.78  ? 108 GLN A NE2 1 
ATOM   731   N  N   . VAL A  1 110 ? 94.712  42.835  -31.893  1.00 34.00  ? 109 VAL A N   1 
ATOM   732   C  CA  A VAL A  1 110 ? 96.095  42.950  -32.351  0.49 31.59  ? 109 VAL A CA  1 
ATOM   733   C  CA  B VAL A  1 110 ? 96.086  43.027  -32.340  0.51 35.85  ? 109 VAL A CA  1 
ATOM   734   C  C   . VAL A  1 110 ? 97.071  42.780  -31.196  1.00 33.73  ? 109 VAL A C   1 
ATOM   735   O  O   . VAL A  1 110 ? 98.187  42.276  -31.395  1.00 37.58  ? 109 VAL A O   1 
ATOM   736   C  CB  A VAL A  1 110 ? 96.384  44.242  -33.164  0.49 29.30  ? 109 VAL A CB  1 
ATOM   737   C  CB  B VAL A  1 110 ? 96.271  44.448  -32.911  0.51 46.05  ? 109 VAL A CB  1 
ATOM   738   C  CG1 A VAL A  1 110 ? 95.544  44.258  -34.436  0.49 39.25  ? 109 VAL A CG1 1 
ATOM   739   C  CG1 B VAL A  1 110 ? 97.710  44.707  -33.215  0.51 29.62  ? 109 VAL A CG1 1 
ATOM   740   C  CG2 A VAL A  1 110 ? 96.131  45.486  -32.333  0.49 28.29  ? 109 VAL A CG2 1 
ATOM   741   C  CG2 B VAL A  1 110 ? 95.418  44.631  -34.163  0.51 33.73  ? 109 VAL A CG2 1 
ATOM   742   N  N   . LEU A  1 111 ? 96.654  43.152  -29.987  1.00 33.46  ? 110 LEU A N   1 
ATOM   743   C  CA  . LEU A  1 111 ? 97.497  42.878  -28.823  1.00 38.67  ? 110 LEU A CA  1 
ATOM   744   C  C   . LEU A  1 111 ? 97.681  41.359  -28.641  1.00 33.97  ? 110 LEU A C   1 
ATOM   745   O  O   . LEU A  1 111 ? 98.809  40.873  -28.448  1.00 36.04  ? 110 LEU A O   1 
ATOM   746   C  CB  . LEU A  1 111 ? 96.904  43.525  -27.568  1.00 38.30  ? 110 LEU A CB  1 
ATOM   747   C  CG  . LEU A  1 111 ? 97.734  43.566  -26.281  1.00 48.33  ? 110 LEU A CG  1 
ATOM   748   C  CD1 . LEU A  1 111 ? 99.069  44.232  -26.531  1.00 45.62  ? 110 LEU A CD1 1 
ATOM   749   C  CD2 . LEU A  1 111 ? 96.985  44.306  -25.192  1.00 51.57  ? 110 LEU A CD2 1 
ATOM   750   N  N   . GLU A  1 112 ? 96.593  40.593  -28.734  1.00 34.17  ? 111 GLU A N   1 
ATOM   751   C  CA  . GLU A  1 112 ? 96.701  39.124  -28.626  1.00 33.13  ? 111 GLU A CA  1 
ATOM   752   C  C   . GLU A  1 112 ? 97.514  38.504  -29.758  1.00 37.70  ? 111 GLU A C   1 
ATOM   753   O  O   . GLU A  1 112 ? 98.214  37.500  -29.571  1.00 34.11  ? 111 GLU A O   1 
ATOM   754   C  CB  . GLU A  1 112 ? 95.320  38.460  -28.551  1.00 35.69  ? 111 GLU A CB  1 
ATOM   755   C  CG  . GLU A  1 112 ? 94.526  38.858  -27.296  1.00 37.04  ? 111 GLU A CG  1 
ATOM   756   C  CD  . GLU A  1 112 ? 93.472  37.834  -26.876  1.00 64.18  ? 111 GLU A CD  1 
ATOM   757   O  OE1 . GLU A  1 112 ? 92.951  37.095  -27.744  1.00 42.73  ? 111 GLU A OE1 1 
ATOM   758   O  OE2 . GLU A  1 112 ? 93.174  37.764  -25.660  1.00 47.58  ? 111 GLU A OE2 1 
ATOM   759   N  N   . GLU A  1 113 ? 97.410  39.102  -30.939  1.00 37.47  ? 112 GLU A N   1 
ATOM   760   C  CA  . GLU A  1 113 ? 98.119  38.604  -32.123  1.00 40.59  ? 112 GLU A CA  1 
ATOM   761   C  C   . GLU A  1 113 ? 99.607  38.953  -32.106  1.00 37.10  ? 112 GLU A C   1 
ATOM   762   O  O   . GLU A  1 113 ? 100.453 38.199  -32.613  1.00 37.85  ? 112 GLU A O   1 
ATOM   763   C  CB  . GLU A  1 113 ? 97.467  39.191  -33.381  1.00 41.76  ? 112 GLU A CB  1 
ATOM   764   C  CG  . GLU A  1 113 ? 98.086  38.739  -34.680  1.00 56.70  ? 112 GLU A CG  1 
ATOM   765   C  CD  . GLU A  1 113 ? 97.261  39.134  -35.901  1.00 97.37  ? 112 GLU A CD  1 
ATOM   766   O  OE1 . GLU A  1 113 ? 96.184  39.754  -35.728  1.00 64.51  ? 112 GLU A OE1 1 
ATOM   767   O  OE2 . GLU A  1 113 ? 97.695  38.820  -37.037  1.00 76.38  ? 112 GLU A OE2 1 
ATOM   768   N  N   . TYR A  1 114 ? 99.935  40.109  -31.542  1.00 37.49  ? 113 TYR A N   1 
ATOM   769   C  CA  . TYR A  1 114 ? 101.326 40.535  -31.493  1.00 34.76  ? 113 TYR A CA  1 
ATOM   770   C  C   . TYR A  1 114 ? 101.694 40.926  -30.076  1.00 45.42  ? 113 TYR A C   1 
ATOM   771   O  O   . TYR A  1 114 ? 101.858 42.102  -29.780  1.00 37.91  ? 113 TYR A O   1 
ATOM   772   C  CB  . TYR A  1 114 ? 101.548 41.724  -32.441  1.00 40.40  ? 113 TYR A CB  1 
ATOM   773   C  CG  . TYR A  1 114 ? 101.181 41.417  -33.874  1.00 45.84  ? 113 TYR A CG  1 
ATOM   774   C  CD1 . TYR A  1 114 ? 102.016 40.650  -34.673  1.00 45.52  ? 113 TYR A CD1 1 
ATOM   775   C  CD2 . TYR A  1 114 ? 99.995  41.891  -34.429  1.00 52.63  ? 113 TYR A CD2 1 
ATOM   776   C  CE1 . TYR A  1 114 ? 101.685 40.357  -35.985  1.00 55.34  ? 113 TYR A CE1 1 
ATOM   777   C  CE2 . TYR A  1 114 ? 99.658  41.608  -35.741  1.00 53.38  ? 113 TYR A CE2 1 
ATOM   778   C  CZ  . TYR A  1 114 ? 100.507 40.842  -36.512  1.00 64.44  ? 113 TYR A CZ  1 
ATOM   779   O  OH  . TYR A  1 114 ? 100.173 40.558  -37.815  1.00 82.51  ? 113 TYR A OH  1 
ATOM   780   N  N   . PRO A  1 115 ? 101.815 39.937  -29.183  1.00 44.66  ? 114 PRO A N   1 
ATOM   781   C  CA  . PRO A  1 115 ? 102.047 40.266  -27.774  1.00 42.27  ? 114 PRO A CA  1 
ATOM   782   C  C   . PRO A  1 115 ? 103.336 41.068  -27.569  1.00 46.11  ? 114 PRO A C   1 
ATOM   783   O  O   . PRO A  1 115 ? 103.388 41.883  -26.649  1.00 44.24  ? 114 PRO A O   1 
ATOM   784   C  CB  . PRO A  1 115 ? 102.128 38.888  -27.098  1.00 35.17  ? 114 PRO A CB  1 
ATOM   785   C  CG  . PRO A  1 115 ? 102.428 37.931  -28.195  1.00 42.29  ? 114 PRO A CG  1 
ATOM   786   C  CD  . PRO A  1 115 ? 101.737 38.487  -29.409  1.00 45.43  ? 114 PRO A CD  1 
ATOM   787   N  N   . ASP A  1 116 ? 104.329 40.861  -28.434  1.00 42.32  ? 115 ASP A N   1 
ATOM   788   C  CA  . ASP A  1 116 ? 105.587 41.616  -28.411  1.00 49.72  ? 115 ASP A CA  1 
ATOM   789   C  C   . ASP A  1 116 ? 105.440 43.107  -28.749  1.00 51.34  ? 115 ASP A C   1 
ATOM   790   O  O   . ASP A  1 116 ? 106.360 43.887  -28.510  1.00 47.56  ? 115 ASP A O   1 
ATOM   791   C  CB  . ASP A  1 116 ? 106.582 41.009  -29.402  1.00 51.09  ? 115 ASP A CB  1 
ATOM   792   C  CG  . ASP A  1 116 ? 107.596 40.098  -28.739  1.00 69.23  ? 115 ASP A CG  1 
ATOM   793   O  OD1 . ASP A  1 116 ? 107.292 39.529  -27.665  1.00 90.16  ? 115 ASP A OD1 1 
ATOM   794   O  OD2 . ASP A  1 116 ? 108.707 39.951  -29.296  1.00 114.94 ? 115 ASP A OD2 1 
ATOM   795   N  N   . SER A  1 117 ? 104.306 43.488  -29.328  1.00 41.96  ? 116 SER A N   1 
ATOM   796   C  CA  . SER A  1 117 ? 104.063 44.871  -29.737  1.00 48.25  ? 116 SER A CA  1 
ATOM   797   C  C   . SER A  1 117 ? 103.267 45.684  -28.712  1.00 38.66  ? 116 SER A C   1 
ATOM   798   O  O   . SER A  1 117 ? 102.800 46.784  -29.013  1.00 37.08  ? 116 SER A O   1 
ATOM   799   C  CB  . SER A  1 117 ? 103.311 44.899  -31.066  1.00 45.17  ? 116 SER A CB  1 
ATOM   800   O  OG  . SER A  1 117 ? 104.119 44.414  -32.116  1.00 45.41  ? 116 SER A OG  1 
ATOM   801   N  N   . GLY A  1 118 ? 103.111 45.150  -27.507  1.00 36.21  ? 117 GLY A N   1 
ATOM   802   C  CA  . GLY A  1 118 ? 102.334 45.837  -26.478  1.00 42.56  ? 117 GLY A CA  1 
ATOM   803   C  C   . GLY A  1 118 ? 102.750 47.279  -26.204  1.00 33.20  ? 117 GLY A C   1 
ATOM   804   O  O   . GLY A  1 118 ? 101.908 48.156  -26.107  1.00 35.92  ? 117 GLY A O   1 
ATOM   805   N  N   . GLU A  1 119 ? 104.049 47.522  -26.053  1.00 38.82  ? 118 GLU A N   1 
ATOM   806   C  CA  . GLU A  1 119 ? 104.500 48.881  -25.805  1.00 38.68  ? 118 GLU A CA  1 
ATOM   807   C  C   . GLU A  1 119 ? 104.130 49.801  -26.971  1.00 38.10  ? 118 GLU A C   1 
ATOM   808   O  O   . GLU A  1 119 ? 103.618 50.895  -26.758  1.00 40.41  ? 118 GLU A O   1 
ATOM   809   C  CB  . GLU A  1 119 ? 105.986 48.920  -25.467  1.00 39.56  ? 118 GLU A CB  1 
ATOM   810   C  CG  . GLU A  1 119 ? 106.263 48.194  -24.153  1.00 40.59  ? 118 GLU A CG  1 
ATOM   811   C  CD  . GLU A  1 119 ? 107.735 48.062  -23.857  1.00 64.53  ? 118 GLU A CD  1 
ATOM   812   O  OE1 . GLU A  1 119 ? 108.544 48.541  -24.679  1.00 52.88  ? 118 GLU A OE1 1 
ATOM   813   O  OE2 . GLU A  1 119 ? 108.082 47.478  -22.806  1.00 67.13  ? 118 GLU A OE2 1 
ATOM   814   N  N   . ASN A  1 120 ? 104.330 49.338  -28.199  1.00 35.05  ? 119 ASN A N   1 
ATOM   815   C  CA  . ASN A  1 120 ? 103.988 50.163  -29.352  1.00 33.94  ? 119 ASN A CA  1 
ATOM   816   C  C   . ASN A  1 120 ? 102.490 50.425  -29.439  1.00 33.14  ? 119 ASN A C   1 
ATOM   817   O  O   . ASN A  1 120 ? 102.056 51.520  -29.838  1.00 36.44  ? 119 ASN A O   1 
ATOM   818   C  CB  . ASN A  1 120 ? 104.458 49.507  -30.650  1.00 44.67  ? 119 ASN A CB  1 
ATOM   819   C  CG  . ASN A  1 120 ? 105.965 49.532  -30.810  1.00 72.47  ? 119 ASN A CG  1 
ATOM   820   O  OD1 . ASN A  1 120 ? 106.658 50.361  -30.215  1.00 53.20  ? 119 ASN A OD1 1 
ATOM   821   N  ND2 . ASN A  1 120 ? 106.480 48.627  -31.631  1.00 52.93  ? 119 ASN A ND2 1 
ATOM   822   N  N   . ILE A  1 121 ? 101.697 49.415  -29.087  1.00 34.59  ? 120 ILE A N   1 
ATOM   823   C  CA  . ILE A  1 121 ? 100.244 49.539  -29.164  1.00 32.72  ? 120 ILE A CA  1 
ATOM   824   C  C   . ILE A  1 121 ? 99.731  50.558  -28.148  1.00 33.67  ? 120 ILE A C   1 
ATOM   825   O  O   . ILE A  1 121 ? 98.912  51.422  -28.465  1.00 32.40  ? 120 ILE A O   1 
ATOM   826   C  CB  . ILE A  1 121 ? 99.553  48.160  -28.977  1.00 33.30  ? 120 ILE A CB  1 
ATOM   827   C  CG1 . ILE A  1 121 ? 99.722  47.327  -30.254  1.00 39.03  ? 120 ILE A CG1 1 
ATOM   828   C  CG2 . ILE A  1 121 ? 98.082  48.331  -28.655  1.00 29.68  ? 120 ILE A CG2 1 
ATOM   829   C  CD1 . ILE A  1 121 ? 99.367  45.845  -30.097  1.00 36.96  ? 120 ILE A CD1 1 
ATOM   830   N  N   . VAL A  1 122 ? 100.250 50.485  -26.930  1.00 33.31  ? 121 VAL A N   1 
ATOM   831   C  CA  . VAL A  1 122 ? 99.854  51.434  -25.898  1.00 34.91  ? 121 VAL A CA  1 
ATOM   832   C  C   . VAL A  1 122 ? 100.331 52.858  -26.231  1.00 39.48  ? 121 VAL A C   1 
ATOM   833   O  O   . VAL A  1 122 ? 99.592  53.829  -26.034  1.00 33.71  ? 121 VAL A O   1 
ATOM   834   C  CB  . VAL A  1 122 ? 100.347 50.978  -24.504  1.00 34.86  ? 121 VAL A CB  1 
ATOM   835   C  CG1 . VAL A  1 122 ? 100.296 52.123  -23.501  1.00 34.49  ? 121 VAL A CG1 1 
ATOM   836   C  CG2 . VAL A  1 122 ? 99.524  49.771  -24.027  1.00 32.29  ? 121 VAL A CG2 1 
ATOM   837   N  N   . ASP A  1 123 ? 101.547 52.977  -26.759  1.00 37.64  ? 122 ASP A N   1 
ATOM   838   C  CA  . ASP A  1 123 ? 102.060 54.283  -27.183  1.00 32.25  ? 122 ASP A CA  1 
ATOM   839   C  C   . ASP A  1 123 ? 101.120 54.921  -28.201  1.00 36.06  ? 122 ASP A C   1 
ATOM   840   O  O   . ASP A  1 123 ? 100.835 56.111  -28.126  1.00 34.66  ? 122 ASP A O   1 
ATOM   841   C  CB  . ASP A  1 123 ? 103.450 54.163  -27.815  1.00 37.64  ? 122 ASP A CB  1 
ATOM   842   C  CG  . ASP A  1 123 ? 104.525 53.808  -26.810  1.00 43.16  ? 122 ASP A CG  1 
ATOM   843   O  OD1 . ASP A  1 123 ? 104.226 53.762  -25.596  1.00 50.13  ? 122 ASP A OD1 1 
ATOM   844   O  OD2 . ASP A  1 123 ? 105.673 53.578  -27.240  1.00 46.52  ? 122 ASP A OD2 1 
ATOM   845   N  N   . ALA A  1 124 ? 100.656 54.127  -29.161  1.00 34.07  ? 123 ALA A N   1 
ATOM   846   C  CA  . ALA A  1 124 ? 99.726  54.634  -30.166  1.00 40.32  ? 123 ALA A CA  1 
ATOM   847   C  C   . ALA A  1 124 ? 98.402  55.032  -29.532  1.00 40.81  ? 123 ALA A C   1 
ATOM   848   O  O   . ALA A  1 124 ? 97.804  56.031  -29.916  1.00 33.33  ? 123 ALA A O   1 
ATOM   849   C  CB  . ALA A  1 124 ? 99.496  53.614  -31.271  1.00 36.33  ? 123 ALA A CB  1 
ATOM   850   N  N   . LEU A  1 125 ? 97.943  54.246  -28.563  1.00 32.75  ? 124 LEU A N   1 
ATOM   851   C  CA  . LEU A  1 125 ? 96.671  54.542  -27.889  1.00 30.95  ? 124 LEU A CA  1 
ATOM   852   C  C   . LEU A  1 125 ? 96.747  55.858  -27.120  1.00 34.90  ? 124 LEU A C   1 
ATOM   853   O  O   . LEU A  1 125 ? 95.801  56.649  -27.140  1.00 32.59  ? 124 LEU A O   1 
ATOM   854   C  CB  . LEU A  1 125 ? 96.296  53.409  -26.940  1.00 27.39  ? 124 LEU A CB  1 
ATOM   855   C  CG  . LEU A  1 125 ? 95.765  52.097  -27.546  1.00 31.45  ? 124 LEU A CG  1 
ATOM   856   C  CD1 . LEU A  1 125 ? 95.755  50.972  -26.493  1.00 31.49  ? 124 LEU A CD1 1 
ATOM   857   C  CD2 . LEU A  1 125 ? 94.368  52.270  -28.174  1.00 30.34  ? 124 LEU A CD2 1 
ATOM   858   N  N   . ALA A  1 126 ? 97.875  56.093  -26.446  1.00 31.44  ? 125 ALA A N   1 
ATOM   859   C  CA  . ALA A  1 126 ? 98.072  57.342  -25.697  1.00 35.15  ? 125 ALA A CA  1 
ATOM   860   C  C   . ALA A  1 126 ? 98.061  58.549  -26.628  1.00 34.56  ? 125 ALA A C   1 
ATOM   861   O  O   . ALA A  1 126 ? 97.426  59.573  -26.331  1.00 34.23  ? 125 ALA A O   1 
ATOM   862   C  CB  . ALA A  1 126 ? 99.387  57.302  -24.889  1.00 38.86  ? 125 ALA A CB  1 
ATOM   863   N  N   . VAL A  1 127 ? 98.745  58.421  -27.761  1.00 32.59  ? 126 VAL A N   1 
ATOM   864   C  CA  . VAL A  1 127 ? 98.816  59.521  -28.727  1.00 36.44  ? 126 VAL A CA  1 
ATOM   865   C  C   . VAL A  1 127 ? 97.420  59.879  -29.230  1.00 37.71  ? 126 VAL A C   1 
ATOM   866   O  O   . VAL A  1 127 ? 97.051  61.060  -29.348  1.00 30.77  ? 126 VAL A O   1 
ATOM   867   C  CB  . VAL A  1 127 ? 99.705  59.158  -29.946  1.00 41.53  ? 126 VAL A CB  1 
ATOM   868   C  CG1 . VAL A  1 127 ? 99.525  60.188  -31.064  1.00 45.96  ? 126 VAL A CG1 1 
ATOM   869   C  CG2 . VAL A  1 127 ? 101.177 59.041  -29.539  1.00 41.83  ? 126 VAL A CG2 1 
ATOM   870   N  N   . PHE A  1 128 ? 96.639  58.840  -29.505  1.00 35.09  ? 127 PHE A N   1 
ATOM   871   C  CA  . PHE A  1 128 ? 95.288  58.993  -30.026  1.00 31.51  ? 127 PHE A CA  1 
ATOM   872   C  C   . PHE A  1 128 ? 94.382  59.642  -28.984  1.00 31.53  ? 127 PHE A C   1 
ATOM   873   O  O   . PHE A  1 128 ? 93.566  60.507  -29.308  1.00 31.45  ? 127 PHE A O   1 
ATOM   874   C  CB  . PHE A  1 128 ? 94.746  57.615  -30.431  1.00 32.42  ? 127 PHE A CB  1 
ATOM   875   C  CG  . PHE A  1 128 ? 93.473  57.655  -31.241  1.00 36.40  ? 127 PHE A CG  1 
ATOM   876   C  CD1 . PHE A  1 128 ? 92.230  57.646  -30.620  1.00 38.06  ? 127 PHE A CD1 1 
ATOM   877   C  CD2 . PHE A  1 128 ? 93.519  57.660  -32.627  1.00 35.20  ? 127 PHE A CD2 1 
ATOM   878   C  CE1 . PHE A  1 128 ? 91.048  57.673  -31.370  1.00 31.08  ? 127 PHE A CE1 1 
ATOM   879   C  CE2 . PHE A  1 128 ? 92.345  57.679  -33.379  1.00 40.68  ? 127 PHE A CE2 1 
ATOM   880   C  CZ  . PHE A  1 128 ? 91.108  57.669  -32.739  1.00 35.08  ? 127 PHE A CZ  1 
ATOM   881   N  N   . LEU A  1 129 ? 94.522  59.218  -27.738  1.00 30.54  ? 128 LEU A N   1 
ATOM   882   C  CA  . LEU A  1 129 ? 93.746  59.767  -26.640  1.00 31.47  ? 128 LEU A CA  1 
ATOM   883   C  C   . LEU A  1 129 ? 94.144  61.218  -26.372  1.00 37.47  ? 128 LEU A C   1 
ATOM   884   O  O   . LEU A  1 129 ? 93.282  62.067  -26.111  1.00 31.63  ? 128 LEU A O   1 
ATOM   885   C  CB  . LEU A  1 129 ? 93.904  58.896  -25.382  1.00 35.13  ? 128 LEU A CB  1 
ATOM   886   C  CG  . LEU A  1 129 ? 92.961  59.179  -24.208  1.00 51.67  ? 128 LEU A CG  1 
ATOM   887   C  CD1 . LEU A  1 129 ? 91.509  59.048  -24.651  1.00 38.51  ? 128 LEU A CD1 1 
ATOM   888   C  CD2 . LEU A  1 129 ? 93.244  58.234  -23.039  1.00 34.25  ? 128 LEU A CD2 1 
ATOM   889   N  N   . ARG A  1 130 ? 95.441  61.512  -26.467  1.00 32.16  ? 129 ARG A N   1 
ATOM   890   C  CA  . ARG A  1 130 ? 95.906  62.887  -26.337  1.00 32.77  ? 129 ARG A CA  1 
ATOM   891   C  C   . ARG A  1 130 ? 95.267  63.787  -27.399  1.00 37.98  ? 129 ARG A C   1 
ATOM   892   O  O   . ARG A  1 130 ? 94.868  64.913  -27.099  1.00 39.20  ? 129 ARG A O   1 
ATOM   893   C  CB  . ARG A  1 130 ? 97.448  62.974  -26.417  1.00 37.24  ? 129 ARG A CB  1 
ATOM   894   C  CG  . ARG A  1 130 ? 98.163  62.619  -25.112  1.00 39.45  ? 129 ARG A CG  1 
ATOM   895   C  CD  . ARG A  1 130 ? 99.654  62.398  -25.324  1.00 51.40  ? 129 ARG A CD  1 
ATOM   896   N  NE  . ARG A  1 130 ? 100.318 63.595  -25.826  1.00 72.16  ? 129 ARG A NE  1 
ATOM   897   C  CZ  . ARG A  1 130 ? 100.801 64.562  -25.051  1.00 93.84  ? 129 ARG A CZ  1 
ATOM   898   N  NH1 . ARG A  1 130 ? 100.694 64.478  -23.729  1.00 49.60  ? 129 ARG A NH1 1 
ATOM   899   N  NH2 . ARG A  1 130 ? 101.392 65.616  -25.600  1.00 75.64  ? 129 ARG A NH2 1 
ATOM   900   N  N   . ARG A  1 131 ? 95.171  63.288  -28.631  1.00 37.94  ? 130 ARG A N   1 
ATOM   901   C  CA  . ARG A  1 131 ? 94.516  64.039  -29.711  1.00 39.95  ? 130 ARG A CA  1 
ATOM   902   C  C   . ARG A  1 131 ? 93.076  64.349  -29.347  1.00 34.28  ? 130 ARG A C   1 
ATOM   903   O  O   . ARG A  1 131 ? 92.640  65.509  -29.414  1.00 30.69  ? 130 ARG A O   1 
ATOM   904   C  CB  . ARG A  1 131 ? 94.520  63.261  -31.030  1.00 34.72  ? 130 ARG A CB  1 
ATOM   905   C  CG  . ARG A  1 131 ? 95.828  63.264  -31.784  1.00 61.70  ? 130 ARG A CG  1 
ATOM   906   C  CD  . ARG A  1 131 ? 95.773  62.285  -32.953  1.00 72.46  ? 130 ARG A CD  1 
ATOM   907   N  NE  . ARG A  1 131 ? 94.761  62.648  -33.946  1.00 53.30  ? 130 ARG A NE  1 
ATOM   908   C  CZ  . ARG A  1 131 ? 94.385  61.857  -34.950  1.00 65.14  ? 130 ARG A CZ  1 
ATOM   909   N  NH1 . ARG A  1 131 ? 93.463  62.265  -35.812  1.00 48.24  ? 130 ARG A NH1 1 
ATOM   910   N  NH2 . ARG A  1 131 ? 94.932  60.654  -35.093  1.00 67.79  ? 130 ARG A NH2 1 
ATOM   911   N  N   . LEU A  1 132 ? 92.333  63.313  -28.977  1.00 30.64  ? 131 LEU A N   1 
ATOM   912   C  CA  . LEU A  1 132 ? 90.925  63.486  -28.598  1.00 28.03  ? 131 LEU A CA  1 
ATOM   913   C  C   . LEU A  1 132 ? 90.757  64.504  -27.482  1.00 36.10  ? 131 LEU A C   1 
ATOM   914   O  O   . LEU A  1 132 ? 89.897  65.398  -27.548  1.00 31.29  ? 131 LEU A O   1 
ATOM   915   C  CB  . LEU A  1 132 ? 90.330  62.143  -28.149  1.00 28.07  ? 131 LEU A CB  1 
ATOM   916   C  CG  . LEU A  1 132 ? 88.836  62.198  -27.798  1.00 32.32  ? 131 LEU A CG  1 
ATOM   917   C  CD1 . LEU A  1 132 ? 88.017  62.478  -29.046  1.00 35.86  ? 131 LEU A CD1 1 
ATOM   918   C  CD2 . LEU A  1 132 ? 88.402  60.887  -27.137  1.00 25.56  ? 131 LEU A CD2 1 
ATOM   919   N  N   . HIS A  1 133 ? 91.587  64.373  -26.455  1.00 28.07  ? 132 HIS A N   1 
ATOM   920   C  CA  . HIS A  1 133 ? 91.522  65.270  -25.320  1.00 31.33  ? 132 HIS A CA  1 
ATOM   921   C  C   . HIS A  1 133 ? 92.062  66.665  -25.582  1.00 33.51  ? 132 HIS A C   1 
ATOM   922   O  O   . HIS A  1 133 ? 91.955  67.534  -24.720  1.00 35.06  ? 132 HIS A O   1 
ATOM   923   C  CB  . HIS A  1 133 ? 92.187  64.621  -24.094  1.00 26.64  ? 132 HIS A CB  1 
ATOM   924   C  CG  . HIS A  1 133 ? 91.418  63.454  -23.565  1.00 30.53  ? 132 HIS A CG  1 
ATOM   925   N  ND1 . HIS A  1 133 ? 91.792  62.762  -22.434  1.00 33.23  ? 132 HIS A ND1 1 
ATOM   926   C  CD2 . HIS A  1 133 ? 90.284  62.863  -24.013  1.00 34.65  ? 132 HIS A CD2 1 
ATOM   927   C  CE1 . HIS A  1 133 ? 90.919  61.794  -22.206  1.00 28.76  ? 132 HIS A CE1 1 
ATOM   928   N  NE2 . HIS A  1 133 ? 89.993  61.834  -23.150  1.00 28.86  ? 132 HIS A NE2 1 
ATOM   929   N  N   . SER A  1 134 ? 92.622  66.901  -26.770  1.00 33.97  ? 133 SER A N   1 
ATOM   930   C  CA  A SER A  1 134 ? 93.117  68.230  -27.111  0.52 33.92  ? 133 SER A CA  1 
ATOM   931   C  CA  B SER A  1 134 ? 93.117  68.230  -27.110  0.48 33.99  ? 133 SER A CA  1 
ATOM   932   C  C   . SER A  1 134 ? 92.071  69.054  -27.862  1.00 37.91  ? 133 SER A C   1 
ATOM   933   O  O   . SER A  1 134 ? 92.288  70.234  -28.138  1.00 34.09  ? 133 SER A O   1 
ATOM   934   C  CB  A SER A  1 134 ? 94.387  68.142  -27.961  0.52 37.78  ? 133 SER A CB  1 
ATOM   935   C  CB  B SER A  1 134 ? 94.407  68.146  -27.935  0.48 36.55  ? 133 SER A CB  1 
ATOM   936   O  OG  A SER A  1 134 ? 94.078  67.680  -29.262  0.52 37.62  ? 133 SER A OG  1 
ATOM   937   O  OG  B SER A  1 134 ? 95.463  67.576  -27.179  0.48 29.49  ? 133 SER A OG  1 
ATOM   938   N  N   . ILE A  1 135 ? 90.938  68.439  -28.204  1.00 32.40  ? 134 ILE A N   1 
ATOM   939   C  CA  . ILE A  1 135 ? 89.889  69.205  -28.895  1.00 32.27  ? 134 ILE A CA  1 
ATOM   940   C  C   . ILE A  1 135 ? 89.364  70.267  -27.930  1.00 38.98  ? 134 ILE A C   1 
ATOM   941   O  O   . ILE A  1 135 ? 88.957  69.926  -26.815  1.00 32.19  ? 134 ILE A O   1 
ATOM   942   C  CB  . ILE A  1 135 ? 88.715  68.308  -29.327  1.00 34.94  ? 134 ILE A CB  1 
ATOM   943   C  CG1 . ILE A  1 135 ? 89.178  67.232  -30.313  1.00 33.23  ? 134 ILE A CG1 1 
ATOM   944   C  CG2 . ILE A  1 135 ? 87.596  69.166  -29.931  1.00 34.91  ? 134 ILE A CG2 1 
ATOM   945   C  CD1 . ILE A  1 135 ? 88.151  66.124  -30.516  1.00 28.37  ? 134 ILE A CD1 1 
ATOM   946   N  N   . PRO A  1 136 ? 89.385  71.553  -28.328  1.00 37.78  ? 135 PRO A N   1 
ATOM   947   C  CA  . PRO A  1 136 ? 88.866  72.556  -27.384  1.00 34.59  ? 135 PRO A CA  1 
ATOM   948   C  C   . PRO A  1 136 ? 87.414  72.264  -27.008  1.00 32.73  ? 135 PRO A C   1 
ATOM   949   O  O   . PRO A  1 136 ? 86.622  72.002  -27.910  1.00 34.60  ? 135 PRO A O   1 
ATOM   950   C  CB  . PRO A  1 136 ? 88.997  73.867  -28.163  1.00 37.41  ? 135 PRO A CB  1 
ATOM   951   C  CG  . PRO A  1 136 ? 90.203  73.607  -29.066  1.00 40.33  ? 135 PRO A CG  1 
ATOM   952   C  CD  . PRO A  1 136 ? 90.025  72.182  -29.504  1.00 34.44  ? 135 PRO A CD  1 
ATOM   953   N  N   . VAL A  1 137 ? 87.084  72.261  -25.714  1.00 36.55  ? 136 VAL A N   1 
ATOM   954   C  CA  . VAL A  1 137 ? 85.741  71.849  -25.302  1.00 33.40  ? 136 VAL A CA  1 
ATOM   955   C  C   . VAL A  1 137 ? 84.674  72.829  -25.803  1.00 29.01  ? 136 VAL A C   1 
ATOM   956   O  O   . VAL A  1 137 ? 83.499  72.493  -25.830  1.00 36.13  ? 136 VAL A O   1 
ATOM   957   C  CB  . VAL A  1 137 ? 85.563  71.646  -23.766  1.00 35.74  ? 136 VAL A CB  1 
ATOM   958   C  CG1 . VAL A  1 137 ? 86.434  70.477  -23.251  1.00 36.25  ? 136 VAL A CG1 1 
ATOM   959   C  CG2 . VAL A  1 137 ? 85.808  72.929  -23.001  1.00 37.39  ? 136 VAL A CG2 1 
ATOM   960   N  N   . CYS A  1 138 ? 85.087  74.030  -26.195  1.00 32.37  ? 137 CYS A N   1 
ATOM   961   C  CA  . CYS A  1 138 ? 84.136  74.992  -26.770  1.00 35.94  ? 137 CYS A CA  1 
ATOM   962   C  C   . CYS A  1 138 ? 83.509  74.499  -28.082  1.00 40.06  ? 137 CYS A C   1 
ATOM   963   O  O   . CYS A  1 138 ? 82.501  75.046  -28.536  1.00 39.66  ? 137 CYS A O   1 
ATOM   964   C  CB  . CYS A  1 138 ? 84.790  76.353  -26.990  1.00 36.34  ? 137 CYS A CB  1 
ATOM   965   S  SG  . CYS A  1 138 ? 86.126  76.376  -28.228  1.00 42.89  ? 137 CYS A SG  1 
ATOM   966   N  N   . ASN A  1 139 ? 84.087  73.457  -28.675  1.00 29.24  ? 138 ASN A N   1 
ATOM   967   C  CA  . ASN A  1 139 ? 83.573  72.889  -29.914  1.00 31.27  ? 138 ASN A CA  1 
ATOM   968   C  C   . ASN A  1 139 ? 82.454  71.871  -29.686  1.00 37.22  ? 138 ASN A C   1 
ATOM   969   O  O   . ASN A  1 139 ? 81.764  71.489  -30.627  1.00 30.94  ? 138 ASN A O   1 
ATOM   970   C  CB  . ASN A  1 139 ? 84.703  72.188  -30.673  1.00 31.53  ? 138 ASN A CB  1 
ATOM   971   C  CG  . ASN A  1 139 ? 85.747  73.155  -31.206  1.00 41.93  ? 138 ASN A CG  1 
ATOM   972   O  OD1 . ASN A  1 139 ? 85.484  73.903  -32.134  1.00 44.11  ? 138 ASN A OD1 1 
ATOM   973   N  ND2 . ASN A  1 139 ? 86.943  73.121  -30.633  1.00 45.37  ? 138 ASN A ND2 1 
ATOM   974   N  N   . CYS A  1 140 ? 82.284  71.428  -28.444  1.00 30.76  ? 139 CYS A N   1 
ATOM   975   C  CA  . CYS A  1 140 ? 81.500  70.218  -28.172  1.00 32.05  ? 139 CYS A CA  1 
ATOM   976   C  C   . CYS A  1 140 ? 80.115  70.481  -27.577  1.00 26.87  ? 139 CYS A C   1 
ATOM   977   O  O   . CYS A  1 140 ? 80.006  71.026  -26.479  1.00 35.20  ? 139 CYS A O   1 
ATOM   978   C  CB  . CYS A  1 140 ? 82.279  69.266  -27.256  1.00 30.68  ? 139 CYS A CB  1 
ATOM   979   S  SG  . CYS A  1 140 ? 81.415  67.677  -26.985  1.00 33.05  ? 139 CYS A SG  1 
ATOM   980   N  N   . PRO A  1 141 ? 79.050  70.109  -28.314  1.00 32.78  ? 140 PRO A N   1 
ATOM   981   C  CA  . PRO A  1 141 ? 77.680  70.423  -27.889  1.00 27.17  ? 140 PRO A CA  1 
ATOM   982   C  C   . PRO A  1 141 ? 77.105  69.332  -26.980  1.00 28.65  ? 140 PRO A C   1 
ATOM   983   O  O   . PRO A  1 141 ? 75.908  69.371  -26.630  1.00 33.88  ? 140 PRO A O   1 
ATOM   984   C  CB  . PRO A  1 141 ? 76.915  70.454  -29.219  1.00 31.94  ? 140 PRO A CB  1 
ATOM   985   C  CG  . PRO A  1 141 ? 77.585  69.410  -30.029  1.00 33.77  ? 140 PRO A CG  1 
ATOM   986   C  CD  . PRO A  1 141 ? 79.068  69.445  -29.630  1.00 31.58  ? 140 PRO A CD  1 
ATOM   987   N  N   . PHE A  1 142 ? 77.933  68.372  -26.589  1.00 27.16  ? 141 PHE A N   1 
ATOM   988   C  CA  . PHE A  1 142 ? 77.452  67.255  -25.769  1.00 31.32  ? 141 PHE A CA  1 
ATOM   989   C  C   . PHE A  1 142 ? 77.964  67.265  -24.327  1.00 36.29  ? 141 PHE A C   1 
ATOM   990   O  O   . PHE A  1 142 ? 79.166  67.444  -24.058  1.00 31.07  ? 141 PHE A O   1 
ATOM   991   C  CB  . PHE A  1 142 ? 77.777  65.903  -26.427  1.00 32.65  ? 141 PHE A CB  1 
ATOM   992   C  CG  . PHE A  1 142 ? 77.284  65.791  -27.835  1.00 31.66  ? 141 PHE A CG  1 
ATOM   993   C  CD1 . PHE A  1 142 ? 75.920  65.740  -28.101  1.00 33.25  ? 141 PHE A CD1 1 
ATOM   994   C  CD2 . PHE A  1 142 ? 78.177  65.759  -28.900  1.00 33.21  ? 141 PHE A CD2 1 
ATOM   995   C  CE1 . PHE A  1 142 ? 75.460  65.664  -29.408  1.00 35.32  ? 141 PHE A CE1 1 
ATOM   996   C  CE2 . PHE A  1 142 ? 77.727  65.665  -30.197  1.00 36.76  ? 141 PHE A CE2 1 
ATOM   997   C  CZ  . PHE A  1 142 ? 76.363  65.619  -30.455  1.00 35.75  ? 141 PHE A CZ  1 
ATOM   998   N  N   . ASN A  1 143 ? 77.039  67.038  -23.404  1.00 32.53  ? 142 ASN A N   1 
ATOM   999   C  CA  . ASN A  1 143 ? 77.345  66.979  -21.981  1.00 29.03  ? 142 ASN A CA  1 
ATOM   1000  C  C   . ASN A  1 143 ? 77.396  65.536  -21.533  1.00 30.57  ? 142 ASN A C   1 
ATOM   1001  O  O   . ASN A  1 143 ? 76.385  64.838  -21.614  1.00 30.31  ? 142 ASN A O   1 
ATOM   1002  C  CB  . ASN A  1 143 ? 76.250  67.709  -21.180  1.00 37.73  ? 142 ASN A CB  1 
ATOM   1003  C  CG  . ASN A  1 143 ? 76.335  67.439  -19.682  1.00 41.71  ? 142 ASN A CG  1 
ATOM   1004  O  OD1 . ASN A  1 143 ? 77.430  67.341  -19.114  1.00 33.36  ? 142 ASN A OD1 1 
ATOM   1005  N  ND2 . ASN A  1 143 ? 75.177  67.310  -19.035  1.00 29.94  ? 142 ASN A ND2 1 
ATOM   1006  N  N   . SER A  1 144 ? 78.565  65.090  -21.057  1.00 31.47  ? 143 SER A N   1 
ATOM   1007  C  CA  . SER A  1 144 ? 78.714  63.746  -20.502  1.00 29.84  ? 143 SER A CA  1 
ATOM   1008  C  C   . SER A  1 144 ? 79.282  63.787  -19.083  1.00 27.92  ? 143 SER A C   1 
ATOM   1009  O  O   . SER A  1 144 ? 79.957  62.859  -18.655  1.00 31.01  ? 143 SER A O   1 
ATOM   1010  C  CB  . SER A  1 144 ? 79.631  62.896  -21.393  1.00 32.53  ? 143 SER A CB  1 
ATOM   1011  O  OG  . SER A  1 144 ? 78.988  62.581  -22.620  1.00 38.70  ? 143 SER A OG  1 
ATOM   1012  N  N   . ASP A  1 145 ? 79.001  64.859  -18.352  1.00 31.14  ? 144 ASP A N   1 
ATOM   1013  C  CA  . ASP A  1 145 ? 79.647  65.050  -17.068  1.00 35.69  ? 144 ASP A CA  1 
ATOM   1014  C  C   . ASP A  1 145 ? 79.145  64.099  -15.999  1.00 36.65  ? 144 ASP A C   1 
ATOM   1015  O  O   . ASP A  1 145 ? 78.197  63.323  -16.214  1.00 29.80  ? 144 ASP A O   1 
ATOM   1016  C  CB  . ASP A  1 145 ? 79.639  66.522  -16.610  1.00 32.79  ? 144 ASP A CB  1 
ATOM   1017  C  CG  . ASP A  1 145 ? 78.265  67.032  -16.189  1.00 36.63  ? 144 ASP A CG  1 
ATOM   1018  O  OD1 . ASP A  1 145 ? 77.315  66.235  -15.978  1.00 34.52  ? 144 ASP A OD1 1 
ATOM   1019  O  OD2 . ASP A  1 145 ? 78.144  68.277  -16.056  1.00 42.24  ? 144 ASP A OD2 1 
ATOM   1020  N  N   . ARG A  1 146 ? 79.811  64.131  -14.855  1.00 39.70  ? 145 ARG A N   1 
ATOM   1021  C  CA  . ARG A  1 146 ? 79.533  63.123  -13.845  1.00 40.21  ? 145 ARG A CA  1 
ATOM   1022  C  C   . ARG A  1 146 ? 78.125  63.247  -13.260  1.00 35.36  ? 145 ARG A C   1 
ATOM   1023  O  O   . ARG A  1 146 ? 77.507  62.246  -12.941  1.00 34.21  ? 145 ARG A O   1 
ATOM   1024  C  CB  . ARG A  1 146 ? 80.616  63.090  -12.759  1.00 40.18  ? 145 ARG A CB  1 
ATOM   1025  C  CG  . ARG A  1 146 ? 80.387  63.976  -11.565  1.00 59.87  ? 145 ARG A CG  1 
ATOM   1026  C  CD  . ARG A  1 146 ? 81.156  63.429  -10.367  1.00 47.94  ? 145 ARG A CD  1 
ATOM   1027  N  NE  . ARG A  1 146 ? 81.225  64.373  -9.259   1.00 74.28  ? 145 ARG A NE  1 
ATOM   1028  C  CZ  . ARG A  1 146 ? 82.194  65.269  -9.100   1.00 82.46  ? 145 ARG A CZ  1 
ATOM   1029  N  NH1 . ARG A  1 146 ? 82.176  66.082  -8.052   1.00 59.57  ? 145 ARG A NH1 1 
ATOM   1030  N  NH2 . ARG A  1 146 ? 83.180  65.353  -9.987   1.00 61.89  ? 145 ARG A NH2 1 
ATOM   1031  N  N   . VAL A  1 147 ? 77.596  64.462  -13.132  1.00 35.94  ? 146 VAL A N   1 
ATOM   1032  C  CA  A VAL A  1 147 ? 76.237  64.641  -12.631  0.57 32.92  ? 146 VAL A CA  1 
ATOM   1033  C  CA  B VAL A  1 147 ? 76.240  64.588  -12.602  0.43 32.76  ? 146 VAL A CA  1 
ATOM   1034  C  C   . VAL A  1 147 ? 75.244  63.963  -13.578  1.00 35.93  ? 146 VAL A C   1 
ATOM   1035  O  O   . VAL A  1 147 ? 74.295  63.287  -13.150  1.00 33.97  ? 146 VAL A O   1 
ATOM   1036  C  CB  A VAL A  1 147 ? 75.927  66.147  -12.427  0.57 52.53  ? 146 VAL A CB  1 
ATOM   1037  C  CB  B VAL A  1 147 ? 75.864  66.046  -12.199  0.43 39.66  ? 146 VAL A CB  1 
ATOM   1038  C  CG1 A VAL A  1 147 ? 74.441  66.428  -12.494  0.57 34.66  ? 146 VAL A CG1 1 
ATOM   1039  C  CG1 B VAL A  1 147 ? 75.819  66.949  -13.396  0.43 25.52  ? 146 VAL A CG1 1 
ATOM   1040  C  CG2 A VAL A  1 147 ? 76.525  66.632  -11.101  0.57 34.07  ? 146 VAL A CG2 1 
ATOM   1041  C  CG2 B VAL A  1 147 ? 74.531  66.079  -11.466  0.43 53.79  ? 146 VAL A CG2 1 
ATOM   1042  N  N   . PHE A  1 148 ? 75.493  64.126  -14.878  1.00 28.96  ? 147 PHE A N   1 
ATOM   1043  C  CA  . PHE A  1 148 ? 74.672  63.504  -15.917  1.00 24.56  ? 147 PHE A CA  1 
ATOM   1044  C  C   . PHE A  1 148 ? 74.777  61.964  -15.911  1.00 33.72  ? 147 PHE A C   1 
ATOM   1045  O  O   . PHE A  1 148 ? 73.770  61.247  -15.982  1.00 31.55  ? 147 PHE A O   1 
ATOM   1046  C  CB  . PHE A  1 148 ? 75.072  64.059  -17.290  1.00 30.33  ? 147 PHE A CB  1 
ATOM   1047  C  CG  . PHE A  1 148 ? 74.359  63.414  -18.440  1.00 32.96  ? 147 PHE A CG  1 
ATOM   1048  C  CD1 . PHE A  1 148 ? 73.080  63.821  -18.792  1.00 29.70  ? 147 PHE A CD1 1 
ATOM   1049  C  CD2 . PHE A  1 148 ? 74.973  62.414  -19.183  1.00 39.69  ? 147 PHE A CD2 1 
ATOM   1050  C  CE1 . PHE A  1 148 ? 72.410  63.220  -19.848  1.00 35.01  ? 147 PHE A CE1 1 
ATOM   1051  C  CE2 . PHE A  1 148 ? 74.315  61.810  -20.243  1.00 47.59  ? 147 PHE A CE2 1 
ATOM   1052  C  CZ  . PHE A  1 148 ? 73.035  62.213  -20.582  1.00 42.44  ? 147 PHE A CZ  1 
ATOM   1053  N  N   . ARG A  1 149 ? 75.999  61.453  -15.825  1.00 28.69  ? 148 ARG A N   1 
ATOM   1054  C  CA  . ARG A  1 149 ? 76.217  60.006  -15.865  1.00 26.57  ? 148 ARG A CA  1 
ATOM   1055  C  C   . ARG A  1 149 ? 75.755  59.338  -14.586  1.00 26.64  ? 148 ARG A C   1 
ATOM   1056  O  O   . ARG A  1 149 ? 75.291  58.192  -14.609  1.00 34.65  ? 148 ARG A O   1 
ATOM   1057  C  CB  . ARG A  1 149 ? 77.700  59.666  -16.107  1.00 30.12  ? 148 ARG A CB  1 
ATOM   1058  C  CG  . ARG A  1 149 ? 78.304  60.128  -17.444  1.00 36.81  ? 148 ARG A CG  1 
ATOM   1059  C  CD  . ARG A  1 149 ? 77.657  59.532  -18.705  1.00 37.96  ? 148 ARG A CD  1 
ATOM   1060  N  NE  . ARG A  1 149 ? 77.639  58.065  -18.750  1.00 41.45  ? 148 ARG A NE  1 
ATOM   1061  C  CZ  . ARG A  1 149 ? 78.700  57.289  -18.974  1.00 64.21  ? 148 ARG A CZ  1 
ATOM   1062  N  NH1 . ARG A  1 149 ? 79.904  57.820  -19.170  1.00 46.20  ? 148 ARG A NH1 1 
ATOM   1063  N  NH2 . ARG A  1 149 ? 78.555  55.970  -19.000  1.00 43.82  ? 148 ARG A NH2 1 
ATOM   1064  N  N   . LEU A  1 150 ? 75.896  60.028  -13.461  1.00 26.89  ? 149 LEU A N   1 
ATOM   1065  C  CA  . LEU A  1 150 ? 75.443  59.436  -12.202  1.00 28.68  ? 149 LEU A CA  1 
ATOM   1066  C  C   . LEU A  1 150 ? 73.918  59.262  -12.218  1.00 41.52  ? 149 LEU A C   1 
ATOM   1067  O  O   . LEU A  1 150 ? 73.376  58.241  -11.781  1.00 30.62  ? 149 LEU A O   1 
ATOM   1068  C  CB  . LEU A  1 150 ? 75.894  60.276  -11.011  1.00 26.41  ? 149 LEU A CB  1 
ATOM   1069  C  CG  . LEU A  1 150 ? 77.345  60.037  -10.581  1.00 29.89  ? 149 LEU A CG  1 
ATOM   1070  C  CD1 . LEU A  1 150 ? 77.800  61.132  -9.629   1.00 37.74  ? 149 LEU A CD1 1 
ATOM   1071  C  CD2 . LEU A  1 150 ? 77.505  58.679  -9.917   1.00 32.79  ? 149 LEU A CD2 1 
ATOM   1072  N  N   . ALA A  1 151 ? 73.219  60.256  -12.746  1.00 33.56  ? 150 ALA A N   1 
ATOM   1073  C  CA  . ALA A  1 151 ? 71.773  60.139  -12.865  1.00 36.55  ? 150 ALA A CA  1 
ATOM   1074  C  C   . ALA A  1 151 ? 71.395  59.014  -13.831  1.00 35.31  ? 150 ALA A C   1 
ATOM   1075  O  O   . ALA A  1 151 ? 70.420  58.305  -13.609  1.00 33.27  ? 150 ALA A O   1 
ATOM   1076  C  CB  . ALA A  1 151 ? 71.148  61.471  -13.304  1.00 33.65  ? 150 ALA A CB  1 
ATOM   1077  N  N   . GLN A  1 152 ? 72.160  58.856  -14.908  1.00 32.95  ? 151 GLN A N   1 
ATOM   1078  C  CA  . GLN A  1 152 ? 71.936  57.750  -15.827  1.00 32.61  ? 151 GLN A CA  1 
ATOM   1079  C  C   . GLN A  1 152 ? 72.126  56.423  -15.102  1.00 33.07  ? 151 GLN A C   1 
ATOM   1080  O  O   . GLN A  1 152 ? 71.351  55.485  -15.273  1.00 29.37  ? 151 GLN A O   1 
ATOM   1081  C  CB  . GLN A  1 152 ? 72.932  57.797  -16.976  1.00 29.52  ? 151 GLN A CB  1 
ATOM   1082  C  CG  . GLN A  1 152 ? 72.400  58.318  -18.297  1.00 44.89  ? 151 GLN A CG  1 
ATOM   1083  C  CD  . GLN A  1 152 ? 73.461  58.293  -19.402  1.00 62.48  ? 151 GLN A CD  1 
ATOM   1084  O  OE1 . GLN A  1 152 ? 74.642  58.054  -19.143  1.00 39.69  ? 151 GLN A OE1 1 
ATOM   1085  N  NE2 . GLN A  1 152 ? 73.040  58.540  -20.636  1.00 47.41  ? 151 GLN A NE2 1 
ATOM   1086  N  N   . ALA A  1 153 ? 73.183  56.346  -14.305  1.00 32.26  ? 152 ALA A N   1 
ATOM   1087  C  CA  . ALA A  1 153 ? 73.502  55.121  -13.573  1.00 32.82  ? 152 ALA A CA  1 
ATOM   1088  C  C   . ALA A  1 153 ? 72.403  54.772  -12.569  1.00 36.76  ? 152 ALA A C   1 
ATOM   1089  O  O   . ALA A  1 153 ? 72.002  53.592  -12.413  1.00 31.49  ? 152 ALA A O   1 
ATOM   1090  C  CB  . ALA A  1 153 ? 74.836  55.289  -12.860  1.00 29.45  ? 152 ALA A CB  1 
ATOM   1091  N  N   . GLN A  1 154 ? 71.922  55.797  -11.876  1.00 31.48  ? 153 GLN A N   1 
ATOM   1092  C  CA  . GLN A  1 154 ? 70.883  55.587  -10.868  1.00 32.22  ? 153 GLN A CA  1 
ATOM   1093  C  C   . GLN A  1 154 ? 69.647  54.966  -11.524  1.00 32.42  ? 153 GLN A C   1 
ATOM   1094  O  O   . GLN A  1 154 ? 69.088  53.984  -11.013  1.00 32.27  ? 153 GLN A O   1 
ATOM   1095  C  CB  . GLN A  1 154 ? 70.526  56.894  -10.165  1.00 33.55  ? 153 GLN A CB  1 
ATOM   1096  C  CG  . GLN A  1 154 ? 69.360  56.741  -9.194   1.00 45.26  ? 153 GLN A CG  1 
ATOM   1097  C  CD  . GLN A  1 154 ? 69.458  57.671  -8.003   1.00 45.05  ? 153 GLN A CD  1 
ATOM   1098  O  OE1 . GLN A  1 154 ? 69.543  58.890  -8.148   1.00 63.86  ? 153 GLN A OE1 1 
ATOM   1099  N  NE2 . GLN A  1 154 ? 69.443  57.095  -6.815   1.00 49.68  ? 153 GLN A NE2 1 
ATOM   1100  N  N   . SER A  1 155 ? 69.270  55.517  -12.678  1.00 33.47  ? 154 SER A N   1 
ATOM   1101  C  CA  . SER A  1 155 ? 68.119  55.033  -13.428  1.00 35.54  ? 154 SER A CA  1 
ATOM   1102  C  C   . SER A  1 155 ? 68.288  53.618  -13.951  1.00 38.12  ? 154 SER A C   1 
ATOM   1103  O  O   . SER A  1 155 ? 67.366  52.818  -13.864  1.00 32.04  ? 154 SER A O   1 
ATOM   1104  C  CB  . SER A  1 155 ? 67.794  55.987  -14.577  1.00 42.39  ? 154 SER A CB  1 
ATOM   1105  O  OG  . SER A  1 155 ? 67.253  57.182  -14.043  1.00 39.11  ? 154 SER A OG  1 
ATOM   1106  N  N   . ARG A  1 156 ? 69.459  53.313  -14.500  1.00 34.54  ? 155 ARG A N   1 
ATOM   1107  C  CA  . ARG A  1 156 ? 69.758  51.949  -14.933  1.00 36.55  ? 155 ARG A CA  1 
ATOM   1108  C  C   . ARG A  1 156 ? 69.684  50.956  -13.776  1.00 38.11  ? 155 ARG A C   1 
ATOM   1109  O  O   . ARG A  1 156 ? 69.130  49.869  -13.927  1.00 28.44  ? 155 ARG A O   1 
ATOM   1110  C  CB  . ARG A  1 156 ? 71.116  51.884  -15.643  1.00 37.30  ? 155 ARG A CB  1 
ATOM   1111  C  CG  . ARG A  1 156 ? 71.044  52.456  -17.056  1.00 34.72  ? 155 ARG A CG  1 
ATOM   1112  C  CD  . ARG A  1 156 ? 72.334  52.341  -17.809  1.00 41.14  ? 155 ARG A CD  1 
ATOM   1113  N  NE  . ARG A  1 156 ? 72.961  51.040  -17.649  1.00 39.82  ? 155 ARG A NE  1 
ATOM   1114  C  CZ  . ARG A  1 156 ? 72.671  49.966  -18.372  1.00 39.54  ? 155 ARG A CZ  1 
ATOM   1115  N  NH1 . ARG A  1 156 ? 73.326  48.834  -18.155  1.00 40.42  ? 155 ARG A NH1 1 
ATOM   1116  N  NH2 . ARG A  1 156 ? 71.735  50.023  -19.308  1.00 47.32  ? 155 ARG A NH2 1 
HETATM 1117  N  N   . MSE A  1 157 ? 70.209  51.345  -12.616  1.00 30.67  ? 156 MSE A N   1 
HETATM 1118  C  CA  . MSE A  1 157 ? 70.130  50.496  -11.431  1.00 31.86  ? 156 MSE A CA  1 
HETATM 1119  C  C   . MSE A  1 157 ? 68.680  50.282  -11.036  1.00 29.41  ? 156 MSE A C   1 
HETATM 1120  O  O   . MSE A  1 157 ? 68.261  49.168  -10.748  1.00 32.53  ? 156 MSE A O   1 
HETATM 1121  C  CB  . MSE A  1 157 ? 70.875  51.130  -10.256  1.00 32.69  ? 156 MSE A CB  1 
HETATM 1122  C  CG  . MSE A  1 157 ? 70.743  50.336  -8.953   1.00 41.60  ? 156 MSE A CG  1 
HETATM 1123  SE SE  . MSE A  1 157 ? 71.796  51.059  -7.462   0.61 35.23  ? 156 MSE A SE  1 
HETATM 1124  C  CE  . MSE A  1 157 ? 71.097  52.884  -7.481   1.00 42.27  ? 156 MSE A CE  1 
ATOM   1125  N  N   . ASN A  1 158 ? 67.916  51.369  -11.024  1.00 34.85  ? 157 ASN A N   1 
ATOM   1126  C  CA  . ASN A  1 158 ? 66.525  51.324  -10.591  1.00 39.30  ? 157 ASN A CA  1 
ATOM   1127  C  C   . ASN A  1 158 ? 65.636  50.538  -11.551  1.00 34.74  ? 157 ASN A C   1 
ATOM   1128  O  O   . ASN A  1 158 ? 64.641  49.927  -11.143  1.00 33.14  ? 157 ASN A O   1 
ATOM   1129  C  CB  . ASN A  1 158 ? 65.977  52.748  -10.417  1.00 30.38  ? 157 ASN A CB  1 
ATOM   1130  C  CG  . ASN A  1 158 ? 66.506  53.430  -9.165   1.00 40.06  ? 157 ASN A CG  1 
ATOM   1131  O  OD1 . ASN A  1 158 ? 67.170  52.804  -8.345   1.00 49.54  ? 157 ASN A OD1 1 
ATOM   1132  N  ND2 . ASN A  1 158 ? 66.196  54.717  -9.008   1.00 44.80  ? 157 ASN A ND2 1 
ATOM   1133  N  N   . ASN A  1 159 ? 65.986  50.581  -12.828  1.00 34.59  ? 158 ASN A N   1 
ATOM   1134  C  CA  . ASN A  1 159 ? 65.259  49.851  -13.857  1.00 33.93  ? 158 ASN A CA  1 
ATOM   1135  C  C   . ASN A  1 159 ? 65.684  48.393  -13.955  1.00 33.42  ? 158 ASN A C   1 
ATOM   1136  O  O   . ASN A  1 159 ? 65.106  47.619  -14.714  1.00 37.41  ? 158 ASN A O   1 
ATOM   1137  C  CB  . ASN A  1 159 ? 65.406  50.576  -15.209  1.00 31.48  ? 158 ASN A CB  1 
ATOM   1138  C  CG  . ASN A  1 159 ? 64.495  51.789  -15.291  1.00 37.65  ? 158 ASN A CG  1 
ATOM   1139  O  OD1 . ASN A  1 159 ? 63.365  51.741  -14.797  1.00 37.64  ? 158 ASN A OD1 1 
ATOM   1140  N  ND2 . ASN A  1 159 ? 64.991  52.893  -15.860  1.00 29.80  ? 158 ASN A ND2 1 
ATOM   1141  N  N   . GLY A  1 160 ? 66.699  48.020  -13.174  1.00 31.83  ? 159 GLY A N   1 
ATOM   1142  C  CA  . GLY A  1 160 ? 67.144  46.646  -13.119  1.00 32.83  ? 159 GLY A CA  1 
ATOM   1143  C  C   . GLY A  1 160 ? 68.069  46.261  -14.260  1.00 38.89  ? 159 GLY A C   1 
ATOM   1144  O  O   . GLY A  1 160 ? 68.230  45.078  -14.565  1.00 39.52  ? 159 GLY A O   1 
ATOM   1145  N  N   . LEU A  1 161 ? 68.694  47.255  -14.872  1.00 31.00  ? 160 LEU A N   1 
ATOM   1146  C  CA  . LEU A  1 161 ? 69.450  47.019  -16.099  1.00 30.41  ? 160 LEU A CA  1 
ATOM   1147  C  C   . LEU A  1 161 ? 70.939  46.785  -15.871  1.00 39.35  ? 160 LEU A C   1 
ATOM   1148  O  O   . LEU A  1 161 ? 71.659  46.455  -16.809  1.00 35.84  ? 160 LEU A O   1 
ATOM   1149  C  CB  . LEU A  1 161 ? 69.279  48.186  -17.076  1.00 31.91  ? 160 LEU A CB  1 
ATOM   1150  C  CG  . LEU A  1 161 ? 67.812  48.549  -17.325  1.00 29.55  ? 160 LEU A CG  1 
ATOM   1151  C  CD1 . LEU A  1 161 ? 67.726  49.676  -18.360  1.00 40.75  ? 160 LEU A CD1 1 
ATOM   1152  C  CD2 . LEU A  1 161 ? 67.028  47.329  -17.755  1.00 36.75  ? 160 LEU A CD2 1 
ATOM   1153  N  N   . VAL A  1 162 ? 71.408  46.964  -14.643  1.00 34.48  ? 161 VAL A N   1 
ATOM   1154  C  CA  . VAL A  1 162 ? 72.844  46.784  -14.378  1.00 45.00  ? 161 VAL A CA  1 
ATOM   1155  C  C   . VAL A  1 162 ? 73.261  45.307  -14.414  1.00 37.42  ? 161 VAL A C   1 
ATOM   1156  O  O   . VAL A  1 162 ? 72.637  44.470  -13.782  1.00 38.44  ? 161 VAL A O   1 
ATOM   1157  C  CB  . VAL A  1 162 ? 73.249  47.434  -13.029  1.00 37.94  ? 161 VAL A CB  1 
ATOM   1158  C  CG1 . VAL A  1 162 ? 74.705  47.114  -12.678  1.00 37.40  ? 161 VAL A CG1 1 
ATOM   1159  C  CG2 . VAL A  1 162 ? 73.036  48.944  -13.086  1.00 32.72  ? 161 VAL A CG2 1 
ATOM   1160  N  N   . ASP A  1 163 ? 74.325  44.980  -15.146  1.00 39.93  ? 162 ASP A N   1 
ATOM   1161  C  CA  . ASP A  1 163 ? 74.805  43.597  -15.193  1.00 39.07  ? 162 ASP A CA  1 
ATOM   1162  C  C   . ASP A  1 163 ? 75.722  43.304  -14.011  1.00 34.65  ? 162 ASP A C   1 
ATOM   1163  O  O   . ASP A  1 163 ? 76.920  43.536  -14.097  1.00 37.66  ? 162 ASP A O   1 
ATOM   1164  C  CB  . ASP A  1 163 ? 75.574  43.355  -16.494  1.00 47.49  ? 162 ASP A CB  1 
ATOM   1165  C  CG  . ASP A  1 163 ? 76.011  41.898  -16.668  1.00 43.85  ? 162 ASP A CG  1 
ATOM   1166  O  OD1 . ASP A  1 163 ? 75.776  41.058  -15.768  1.00 41.10  ? 162 ASP A OD1 1 
ATOM   1167  O  OD2 . ASP A  1 163 ? 76.595  41.601  -17.727  1.00 44.40  ? 162 ASP A OD2 1 
ATOM   1168  N  N   . ALA A  1 164 ? 75.167  42.766  -12.925  1.00 35.48  ? 163 ALA A N   1 
ATOM   1169  C  CA  . ALA A  1 164 ? 75.939  42.558  -11.702  1.00 43.51  ? 163 ALA A CA  1 
ATOM   1170  C  C   . ALA A  1 164 ? 76.954  41.415  -11.804  1.00 50.32  ? 163 ALA A C   1 
ATOM   1171  O  O   . ALA A  1 164 ? 77.816  41.263  -10.941  1.00 47.55  ? 163 ALA A O   1 
ATOM   1172  C  CB  . ALA A  1 164 ? 75.006  42.351  -10.503  1.00 46.42  ? 163 ALA A CB  1 
ATOM   1173  N  N   . SER A  1 165 ? 76.848  40.616  -12.860  1.00 40.41  ? 164 SER A N   1 
ATOM   1174  C  CA  . SER A  1 165 ? 77.781  39.528  -13.086  1.00 42.08  ? 164 SER A CA  1 
ATOM   1175  C  C   . SER A  1 165 ? 79.052  40.031  -13.754  1.00 59.00  ? 164 SER A C   1 
ATOM   1176  O  O   . SER A  1 165 ? 80.055  39.329  -13.764  1.00 45.94  ? 164 SER A O   1 
ATOM   1177  C  CB  . SER A  1 165 ? 77.149  38.448  -13.960  1.00 44.76  ? 164 SER A CB  1 
ATOM   1178  O  OG  . SER A  1 165 ? 77.049  38.899  -15.300  1.00 48.51  ? 164 SER A OG  1 
ATOM   1179  N  N   . ASP A  1 166 ? 79.012  41.243  -14.304  1.00 38.15  ? 165 ASP A N   1 
ATOM   1180  C  CA  . ASP A  1 166 ? 80.116  41.751  -15.114  1.00 36.71  ? 165 ASP A CA  1 
ATOM   1181  C  C   . ASP A  1 166 ? 80.995  42.763  -14.361  1.00 40.62  ? 165 ASP A C   1 
ATOM   1182  O  O   . ASP A  1 166 ? 81.742  43.507  -14.984  1.00 37.48  ? 165 ASP A O   1 
ATOM   1183  C  CB  . ASP A  1 166 ? 79.575  42.378  -16.416  1.00 38.52  ? 165 ASP A CB  1 
ATOM   1184  C  CG  . ASP A  1 166 ? 80.635  42.508  -17.506  1.00 40.74  ? 165 ASP A CG  1 
ATOM   1185  O  OD1 . ASP A  1 166 ? 81.587  41.692  -17.529  1.00 42.88  ? 165 ASP A OD1 1 
ATOM   1186  O  OD2 . ASP A  1 166 ? 80.524  43.429  -18.353  1.00 46.27  ? 165 ASP A OD2 1 
ATOM   1187  N  N   . PHE A  1 167 ? 80.893  42.814  -13.034  1.00 35.78  ? 166 PHE A N   1 
ATOM   1188  C  CA  . PHE A  1 167 ? 81.700  43.768  -12.270  1.00 33.19  ? 166 PHE A CA  1 
ATOM   1189  C  C   . PHE A  1 167 ? 83.185  43.373  -12.314  1.00 38.09  ? 166 PHE A C   1 
ATOM   1190  O  O   . PHE A  1 167 ? 83.512  42.209  -12.549  1.00 36.52  ? 166 PHE A O   1 
ATOM   1191  C  CB  . PHE A  1 167 ? 81.269  43.812  -10.800  1.00 32.60  ? 166 PHE A CB  1 
ATOM   1192  C  CG  . PHE A  1 167 ? 79.898  44.401  -10.565  1.00 32.69  ? 166 PHE A CG  1 
ATOM   1193  C  CD1 . PHE A  1 167 ? 79.292  45.213  -11.510  1.00 33.18  ? 166 PHE A CD1 1 
ATOM   1194  C  CD2 . PHE A  1 167 ? 79.213  44.116  -9.378   1.00 35.07  ? 166 PHE A CD2 1 
ATOM   1195  C  CE1 . PHE A  1 167 ? 78.040  45.755  -11.272  1.00 36.64  ? 166 PHE A CE1 1 
ATOM   1196  C  CE2 . PHE A  1 167 ? 77.953  44.649  -9.137   1.00 46.31  ? 166 PHE A CE2 1 
ATOM   1197  C  CZ  . PHE A  1 167 ? 77.369  45.464  -10.078  1.00 36.91  ? 166 PHE A CZ  1 
ATOM   1198  N  N   . ASP A  1 168 ? 84.070  44.337  -12.061  1.00 34.54  ? 167 ASP A N   1 
ATOM   1199  C  CA  . ASP A  1 168 ? 85.505  44.051  -11.902  1.00 38.80  ? 167 ASP A CA  1 
ATOM   1200  C  C   . ASP A  1 168 ? 85.794  43.132  -10.711  1.00 42.66  ? 167 ASP A C   1 
ATOM   1201  O  O   . ASP A  1 168 ? 84.935  42.924  -9.853   1.00 37.07  ? 167 ASP A O   1 
ATOM   1202  C  CB  . ASP A  1 168 ? 86.293  45.347  -11.721  1.00 43.70  ? 167 ASP A CB  1 
ATOM   1203  C  CG  . ASP A  1 168 ? 86.234  46.244  -12.937  1.00 42.24  ? 167 ASP A CG  1 
ATOM   1204  O  OD1 . ASP A  1 168 ? 86.241  45.725  -14.078  1.00 38.24  ? 167 ASP A OD1 1 
ATOM   1205  O  OD2 . ASP A  1 168 ? 86.179  47.476  -12.741  1.00 38.56  ? 167 ASP A OD2 1 
ATOM   1206  N  N   . ASP A  1 169 ? 87.015  42.598  -10.641  1.00 37.97  ? 168 ASP A N   1 
ATOM   1207  C  CA  . ASP A  1 169 ? 87.344  41.625  -9.600   1.00 51.62  ? 168 ASP A CA  1 
ATOM   1208  C  C   . ASP A  1 169 ? 87.233  42.198  -8.189   1.00 36.67  ? 168 ASP A C   1 
ATOM   1209  O  O   . ASP A  1 169 ? 86.818  41.493  -7.263   1.00 41.43  ? 168 ASP A O   1 
ATOM   1210  C  CB  . ASP A  1 169 ? 88.741  41.032  -9.821   1.00 53.14  ? 168 ASP A CB  1 
ATOM   1211  C  CG  . ASP A  1 169 ? 88.789  40.059  -10.987  1.00 84.32  ? 168 ASP A CG  1 
ATOM   1212  O  OD1 . ASP A  1 169 ? 87.748  39.434  -11.279  1.00 57.05  ? 168 ASP A OD1 1 
ATOM   1213  O  OD2 . ASP A  1 169 ? 89.870  39.914  -11.607  1.00 89.56  ? 168 ASP A OD2 1 
ATOM   1214  N  N   . GLU A  1 170 ? 87.616  43.466  -8.021   1.00 39.87  ? 169 GLU A N   1 
ATOM   1215  C  CA  . GLU A  1 170 ? 87.504  44.142  -6.725   1.00 42.31  ? 169 GLU A CA  1 
ATOM   1216  C  C   . GLU A  1 170 ? 86.085  44.075  -6.173   1.00 46.63  ? 169 GLU A C   1 
ATOM   1217  O  O   . GLU A  1 170 ? 85.890  44.026  -4.960   1.00 49.24  ? 169 GLU A O   1 
ATOM   1218  C  CB  . GLU A  1 170 ? 87.895  45.619  -6.825   1.00 55.32  ? 169 GLU A CB  1 
ATOM   1219  C  CG  . GLU A  1 170 ? 89.303  45.880  -7.299   1.00 92.50  ? 169 GLU A CG  1 
ATOM   1220  C  CD  . GLU A  1 170 ? 89.384  46.038  -8.802   1.00 78.08  ? 169 GLU A CD  1 
ATOM   1221  O  OE1 . GLU A  1 170 ? 89.583  47.183  -9.267   1.00 84.68  ? 169 GLU A OE1 1 
ATOM   1222  O  OE2 . GLU A  1 170 ? 89.243  45.019  -9.517   1.00 48.65  ? 169 GLU A OE2 1 
ATOM   1223  N  N   . ARG A  1 171 ? 85.099  44.082  -7.067   1.00 42.43  ? 170 ARG A N   1 
ATOM   1224  C  CA  . ARG A  1 171 ? 83.688  44.123  -6.651   1.00 39.26  ? 170 ARG A CA  1 
ATOM   1225  C  C   . ARG A  1 171 ? 82.890  42.868  -7.019   1.00 44.06  ? 170 ARG A C   1 
ATOM   1226  O  O   . ARG A  1 171 ? 81.674  42.916  -7.229   1.00 40.90  ? 170 ARG A O   1 
ATOM   1227  C  CB  . ARG A  1 171 ? 83.011  45.363  -7.239   1.00 36.50  ? 170 ARG A CB  1 
ATOM   1228  C  CG  . ARG A  1 171 ? 83.603  46.667  -6.727   1.00 48.65  ? 170 ARG A CG  1 
ATOM   1229  C  CD  . ARG A  1 171 ? 83.197  47.857  -7.586   1.00 33.48  ? 170 ARG A CD  1 
ATOM   1230  N  NE  . ARG A  1 171 ? 83.964  47.953  -8.825   1.00 37.79  ? 170 ARG A NE  1 
ATOM   1231  C  CZ  . ARG A  1 171 ? 85.192  48.451  -8.900   1.00 41.72  ? 170 ARG A CZ  1 
ATOM   1232  N  NH1 . ARG A  1 171 ? 85.798  48.897  -7.803   1.00 38.14  ? 170 ARG A NH1 1 
ATOM   1233  N  NH2 . ARG A  1 171 ? 85.812  48.504  -10.067  1.00 38.32  ? 170 ARG A NH2 1 
ATOM   1234  N  N   . ASN A  1 172 ? 83.573  41.737  -7.086   1.00 43.08  ? 171 ASN A N   1 
ATOM   1235  C  CA  . ASN A  1 172 ? 82.915  40.509  -7.473   1.00 44.10  ? 171 ASN A CA  1 
ATOM   1236  C  C   . ASN A  1 172 ? 81.953  40.078  -6.374   1.00 40.24  ? 171 ASN A C   1 
ATOM   1237  O  O   . ASN A  1 172 ? 82.357  39.916  -5.219   1.00 44.38  ? 171 ASN A O   1 
ATOM   1238  C  CB  . ASN A  1 172 ? 83.953  39.420  -7.740   1.00 63.93  ? 171 ASN A CB  1 
ATOM   1239  C  CG  . ASN A  1 172 ? 83.332  38.146  -8.252   1.00 57.98  ? 171 ASN A CG  1 
ATOM   1240  O  OD1 . ASN A  1 172 ? 83.074  37.220  -7.486   1.00 74.05  ? 171 ASN A OD1 1 
ATOM   1241  N  ND2 . ASN A  1 172 ? 83.080  38.092  -9.553   1.00 63.84  ? 171 ASN A ND2 1 
ATOM   1242  N  N   . GLY A  1 173 ? 80.682  39.914  -6.725   1.00 48.09  ? 172 GLY A N   1 
ATOM   1243  C  CA  . GLY A  1 173 ? 79.691  39.474  -5.756   1.00 47.89  ? 172 GLY A CA  1 
ATOM   1244  C  C   . GLY A  1 173 ? 79.056  40.611  -4.970   1.00 46.64  ? 172 GLY A C   1 
ATOM   1245  O  O   . GLY A  1 173 ? 78.184  40.386  -4.134   1.00 49.60  ? 172 GLY A O   1 
ATOM   1246  N  N   . TRP A  1 174 ? 79.491  41.841  -5.230   1.00 38.86  ? 173 TRP A N   1 
ATOM   1247  C  CA  . TRP A  1 174 ? 78.892  43.006  -4.589   1.00 48.01  ? 173 TRP A CA  1 
ATOM   1248  C  C   . TRP A  1 174 ? 77.466  43.221  -5.091   1.00 43.16  ? 173 TRP A C   1 
ATOM   1249  O  O   . TRP A  1 174 ? 77.224  43.196  -6.300   1.00 42.84  ? 173 TRP A O   1 
ATOM   1250  C  CB  . TRP A  1 174 ? 79.714  44.271  -4.897   1.00 41.88  ? 173 TRP A CB  1 
ATOM   1251  C  CG  . TRP A  1 174 ? 80.996  44.392  -4.118   1.00 39.36  ? 173 TRP A CG  1 
ATOM   1252  C  CD1 . TRP A  1 174 ? 81.804  43.371  -3.684   1.00 39.49  ? 173 TRP A CD1 1 
ATOM   1253  C  CD2 . TRP A  1 174 ? 81.612  45.607  -3.674   1.00 55.74  ? 173 TRP A CD2 1 
ATOM   1254  N  NE1 . TRP A  1 174 ? 82.879  43.883  -2.998   1.00 51.26  ? 173 TRP A NE1 1 
ATOM   1255  C  CE2 . TRP A  1 174 ? 82.787  45.250  -2.977   1.00 57.91  ? 173 TRP A CE2 1 
ATOM   1256  C  CE3 . TRP A  1 174 ? 81.282  46.961  -3.793   1.00 45.08  ? 173 TRP A CE3 1 
ATOM   1257  C  CZ2 . TRP A  1 174 ? 83.633  46.198  -2.405   1.00 51.96  ? 173 TRP A CZ2 1 
ATOM   1258  C  CZ3 . TRP A  1 174 ? 82.123  47.902  -3.225   1.00 49.14  ? 173 TRP A CZ3 1 
ATOM   1259  C  CH2 . TRP A  1 174 ? 83.288  47.516  -2.541   1.00 50.18  ? 173 TRP A CH2 1 
ATOM   1260  N  N   . PRO A  1 175 ? 76.518  43.468  -4.172   1.00 38.76  ? 174 PRO A N   1 
ATOM   1261  C  CA  . PRO A  1 175 ? 75.206  43.933  -4.645   1.00 41.58  ? 174 PRO A CA  1 
ATOM   1262  C  C   . PRO A  1 175 ? 75.370  45.267  -5.355   1.00 43.69  ? 174 PRO A C   1 
ATOM   1263  O  O   . PRO A  1 175 ? 76.197  46.067  -4.919   1.00 39.50  ? 174 PRO A O   1 
ATOM   1264  C  CB  . PRO A  1 175 ? 74.425  44.140  -3.348   1.00 43.02  ? 174 PRO A CB  1 
ATOM   1265  C  CG  . PRO A  1 175 ? 75.103  43.234  -2.341   1.00 60.54  ? 174 PRO A CG  1 
ATOM   1266  C  CD  . PRO A  1 175 ? 76.555  43.277  -2.713   1.00 45.79  ? 174 PRO A CD  1 
ATOM   1267  N  N   . VAL A  1 176 ? 74.619  45.504  -6.427   1.00 39.59  ? 175 VAL A N   1 
ATOM   1268  C  CA  . VAL A  1 176 ? 74.707  46.772  -7.146   1.00 35.83  ? 175 VAL A CA  1 
ATOM   1269  C  C   . VAL A  1 176 ? 74.540  47.972  -6.199   1.00 38.68  ? 175 VAL A C   1 
ATOM   1270  O  O   . VAL A  1 176 ? 75.232  48.982  -6.344   1.00 37.34  ? 175 VAL A O   1 
ATOM   1271  C  CB  . VAL A  1 176 ? 73.710  46.852  -8.334   1.00 39.16  ? 175 VAL A CB  1 
ATOM   1272  C  CG1 . VAL A  1 176 ? 72.278  46.659  -7.854   1.00 60.92  ? 175 VAL A CG1 1 
ATOM   1273  C  CG2 . VAL A  1 176 ? 73.860  48.167  -9.093   1.00 35.38  ? 175 VAL A CG2 1 
ATOM   1274  N  N   . GLU A  1 177 ? 73.656  47.830  -5.210   1.00 41.30  ? 176 GLU A N   1 
ATOM   1275  C  CA  . GLU A  1 177 ? 73.436  48.865  -4.209   1.00 38.66  ? 176 GLU A CA  1 
ATOM   1276  C  C   . GLU A  1 177 ? 74.705  49.215  -3.431   1.00 42.69  ? 176 GLU A C   1 
ATOM   1277  O  O   . GLU A  1 177 ? 74.926  50.377  -3.102   1.00 40.47  ? 176 GLU A O   1 
ATOM   1278  C  CB  . GLU A  1 177 ? 72.326  48.447  -3.233   1.00 44.40  ? 176 GLU A CB  1 
ATOM   1279  C  CG  . GLU A  1 177 ? 70.954  48.284  -3.892   1.00 54.70  ? 176 GLU A CG  1 
ATOM   1280  C  CD  . GLU A  1 177 ? 70.762  46.919  -4.549   1.00 99.92  ? 176 GLU A CD  1 
ATOM   1281  O  OE1 . GLU A  1 177 ? 71.650  46.042  -4.391   1.00 46.63  ? 176 GLU A OE1 1 
ATOM   1282  O  OE2 . GLU A  1 177 ? 69.719  46.727  -5.220   1.00 60.11  ? 176 GLU A OE2 1 
ATOM   1283  N  N   . GLN A  1 178 ? 75.526  48.215  -3.126   1.00 38.01  ? 177 GLN A N   1 
ATOM   1284  C  CA  . GLN A  1 178 ? 76.798  48.463  -2.454   1.00 44.60  ? 177 GLN A CA  1 
ATOM   1285  C  C   . GLN A  1 178 ? 77.815  49.195  -3.346   1.00 40.56  ? 177 GLN A C   1 
ATOM   1286  O  O   . GLN A  1 178 ? 78.536  50.075  -2.874   1.00 39.04  ? 177 GLN A O   1 
ATOM   1287  C  CB  . GLN A  1 178 ? 77.402  47.165  -1.926   1.00 41.01  ? 177 GLN A CB  1 
ATOM   1288  C  CG  . GLN A  1 178 ? 78.569  47.396  -0.995   1.00 45.07  ? 177 GLN A CG  1 
ATOM   1289  C  CD  . GLN A  1 178 ? 79.296  46.117  -0.650   1.00 71.43  ? 177 GLN A CD  1 
ATOM   1290  O  OE1 . GLN A  1 178 ? 78.790  45.020  -0.887   1.00 64.25  ? 177 GLN A OE1 1 
ATOM   1291  N  NE2 . GLN A  1 178 ? 80.493  46.249  -0.094   1.00 64.34  ? 177 GLN A NE2 1 
ATOM   1292  N  N   . VAL A  1 179 ? 77.884  48.827  -4.621   1.00 34.81  ? 178 VAL A N   1 
ATOM   1293  C  CA  . VAL A  1 179 ? 78.692  49.586  -5.579   1.00 34.76  ? 178 VAL A CA  1 
ATOM   1294  C  C   . VAL A  1 179 ? 78.250  51.055  -5.604   1.00 42.98  ? 178 VAL A C   1 
ATOM   1295  O  O   . VAL A  1 179 ? 79.080  51.963  -5.518   1.00 38.24  ? 178 VAL A O   1 
ATOM   1296  C  CB  . VAL A  1 179 ? 78.661  48.945  -6.981   1.00 33.97  ? 178 VAL A CB  1 
ATOM   1297  C  CG1 . VAL A  1 179 ? 79.532  49.724  -7.971   1.00 34.02  ? 178 VAL A CG1 1 
ATOM   1298  C  CG2 . VAL A  1 179 ? 79.121  47.484  -6.894   1.00 35.14  ? 178 VAL A CG2 1 
ATOM   1299  N  N   . TRP A  1 180 ? 76.940  51.284  -5.667   1.00 36.62  ? 179 TRP A N   1 
ATOM   1300  C  CA  . TRP A  1 180 ? 76.390  52.636  -5.658   1.00 32.90  ? 179 TRP A CA  1 
ATOM   1301  C  C   . TRP A  1 180 ? 76.789  53.408  -4.387   1.00 31.33  ? 179 TRP A C   1 
ATOM   1302  O  O   . TRP A  1 180 ? 77.299  54.516  -4.465   1.00 37.02  ? 179 TRP A O   1 
ATOM   1303  C  CB  . TRP A  1 180 ? 74.862  52.565  -5.806   1.00 34.17  ? 179 TRP A CB  1 
ATOM   1304  C  CG  . TRP A  1 180 ? 74.162  53.872  -5.806   1.00 38.30  ? 179 TRP A CG  1 
ATOM   1305  C  CD1 . TRP A  1 180 ? 73.394  54.389  -4.795   1.00 44.35  ? 179 TRP A CD1 1 
ATOM   1306  C  CD2 . TRP A  1 180 ? 74.119  54.824  -6.872   1.00 32.91  ? 179 TRP A CD2 1 
ATOM   1307  N  NE1 . TRP A  1 180 ? 72.891  55.614  -5.165   1.00 39.73  ? 179 TRP A NE1 1 
ATOM   1308  C  CE2 . TRP A  1 180 ? 73.321  55.904  -6.435   1.00 42.43  ? 179 TRP A CE2 1 
ATOM   1309  C  CE3 . TRP A  1 180 ? 74.686  54.877  -8.148   1.00 32.39  ? 179 TRP A CE3 1 
ATOM   1310  C  CZ2 . TRP A  1 180 ? 73.069  57.015  -7.234   1.00 44.92  ? 179 TRP A CZ2 1 
ATOM   1311  C  CZ3 . TRP A  1 180 ? 74.433  55.995  -8.943   1.00 31.96  ? 179 TRP A CZ3 1 
ATOM   1312  C  CH2 . TRP A  1 180 ? 73.648  57.047  -8.477   1.00 37.44  ? 179 TRP A CH2 1 
ATOM   1313  N  N   . LYS A  1 181 ? 76.566  52.819  -3.218   1.00 35.64  ? 180 LYS A N   1 
ATOM   1314  C  CA  . LYS A  1 181 ? 76.879  53.502  -1.963   1.00 39.47  ? 180 LYS A CA  1 
ATOM   1315  C  C   . LYS A  1 181 ? 78.367  53.810  -1.811   1.00 53.68  ? 180 LYS A C   1 
ATOM   1316  O  O   . LYS A  1 181 ? 78.735  54.909  -1.411   1.00 41.60  ? 180 LYS A O   1 
ATOM   1317  C  CB  . LYS A  1 181 ? 76.398  52.691  -0.756   1.00 42.77  ? 180 LYS A CB  1 
ATOM   1318  C  CG  . LYS A  1 181 ? 74.887  52.663  -0.596   1.00 70.59  ? 180 LYS A CG  1 
ATOM   1319  C  CD  . LYS A  1 181 ? 74.475  52.106  0.760    1.00 73.24  ? 180 LYS A CD  1 
ATOM   1320  C  CE  . LYS A  1 181 ? 73.500  53.035  1.472    1.00 88.64  ? 180 LYS A CE  1 
ATOM   1321  N  NZ  . LYS A  1 181 ? 72.227  53.227  0.721    1.00 77.46  ? 180 LYS A NZ  1 
ATOM   1322  N  N   . GLU A  1 182 ? 79.213  52.830  -2.120   1.00 39.69  ? 181 GLU A N   1 
ATOM   1323  C  CA  . GLU A  1 182 ? 80.654  52.985  -1.956   1.00 55.68  ? 181 GLU A CA  1 
ATOM   1324  C  C   . GLU A  1 182 ? 81.190  54.043  -2.899   1.00 40.78  ? 181 GLU A C   1 
ATOM   1325  O  O   . GLU A  1 182 ? 82.088  54.797  -2.558   1.00 44.39  ? 181 GLU A O   1 
ATOM   1326  C  CB  . GLU A  1 182 ? 81.363  51.656  -2.211   1.00 40.60  ? 181 GLU A CB  1 
ATOM   1327  C  CG  . GLU A  1 182 ? 81.087  50.623  -1.134   1.00 62.02  ? 181 GLU A CG  1 
ATOM   1328  C  CD  . GLU A  1 182 ? 81.850  50.916  0.135    1.00 80.57  ? 181 GLU A CD  1 
ATOM   1329  O  OE1 . GLU A  1 182 ? 81.209  51.154  1.182    1.00 86.75  ? 181 GLU A OE1 1 
ATOM   1330  O  OE2 . GLU A  1 182 ? 83.099  50.910  0.076    1.00 58.40  ? 181 GLU A OE2 1 
HETATM 1331  N  N   . MSE A  1 183 ? 80.628  54.082  -4.094   1.00 37.22  ? 182 MSE A N   1 
HETATM 1332  C  CA  . MSE A  1 183 ? 81.057  55.037  -5.094   1.00 35.89  ? 182 MSE A CA  1 
HETATM 1333  C  C   . MSE A  1 183 ? 80.870  56.471  -4.595   1.00 37.71  ? 182 MSE A C   1 
HETATM 1334  O  O   . MSE A  1 183 ? 81.683  57.339  -4.887   1.00 37.33  ? 182 MSE A O   1 
HETATM 1335  C  CB  . MSE A  1 183 ? 80.292  54.819  -6.401   1.00 29.84  ? 182 MSE A CB  1 
HETATM 1336  C  CG  . MSE A  1 183 ? 80.742  55.738  -7.524   1.00 37.74  ? 182 MSE A CG  1 
HETATM 1337  SE SE  . MSE A  1 183 ? 79.961  55.344  -9.249   0.67 32.95  ? 182 MSE A SE  1 
HETATM 1338  C  CE  . MSE A  1 183 ? 78.072  55.413  -8.730   1.00 34.36  ? 182 MSE A CE  1 
ATOM   1339  N  N   . HIS A  1 184 ? 79.807  56.726  -3.836   1.00 39.62  ? 183 HIS A N   1 
ATOM   1340  C  CA  . HIS A  1 184 ? 79.541  58.100  -3.405   1.00 45.45  ? 183 HIS A CA  1 
ATOM   1341  C  C   . HIS A  1 184 ? 80.489  58.605  -2.313   1.00 49.26  ? 183 HIS A C   1 
ATOM   1342  O  O   . HIS A  1 184 ? 80.624  59.808  -2.107   1.00 56.95  ? 183 HIS A O   1 
ATOM   1343  C  CB  . HIS A  1 184 ? 78.061  58.307  -3.054   1.00 43.15  ? 183 HIS A CB  1 
ATOM   1344  C  CG  . HIS A  1 184 ? 77.186  58.406  -4.264   1.00 48.83  ? 183 HIS A CG  1 
ATOM   1345  N  ND1 . HIS A  1 184 ? 76.831  57.305  -5.014   1.00 41.73  ? 183 HIS A ND1 1 
ATOM   1346  C  CD2 . HIS A  1 184 ? 76.648  59.479  -4.893   1.00 39.97  ? 183 HIS A CD2 1 
ATOM   1347  C  CE1 . HIS A  1 184 ? 76.098  57.692  -6.043   1.00 40.90  ? 183 HIS A CE1 1 
ATOM   1348  N  NE2 . HIS A  1 184 ? 75.968  59.006  -5.991   1.00 38.76  ? 183 HIS A NE2 1 
ATOM   1349  N  N   . LYS A  1 185 ? 81.184  57.681  -1.657   1.00 46.14  ? 184 LYS A N   1 
ATOM   1350  C  CA  . LYS A  1 185 ? 82.197  58.047  -0.668   1.00 47.71  ? 184 LYS A CA  1 
ATOM   1351  C  C   . LYS A  1 185 ? 83.470  58.697  -1.243   1.00 67.60  ? 184 LYS A C   1 
ATOM   1352  O  O   . LYS A  1 185 ? 84.218  59.345  -0.513   1.00 50.14  ? 184 LYS A O   1 
ATOM   1353  C  CB  . LYS A  1 185 ? 82.528  56.842  0.215    1.00 51.36  ? 184 LYS A CB  1 
ATOM   1354  C  CG  . LYS A  1 185 ? 81.309  56.340  0.968    1.00 56.52  ? 184 LYS A CG  1 
ATOM   1355  C  CD  . LYS A  1 185 ? 81.523  54.969  1.576    1.00 76.87  ? 184 LYS A CD  1 
ATOM   1356  C  CE  . LYS A  1 185 ? 80.247  54.481  2.251    1.00 74.64  ? 184 LYS A CE  1 
ATOM   1357  N  NZ  . LYS A  1 185 ? 80.410  53.129  2.854    1.00 83.24  ? 184 LYS A NZ  1 
ATOM   1358  N  N   . LEU A  1 186 ? 83.698  58.546  -2.545   1.00 45.34  ? 185 LEU A N   1 
ATOM   1359  C  CA  . LEU A  1 186 ? 84.843  59.169  -3.211   1.00 45.51  ? 185 LEU A CA  1 
ATOM   1360  C  C   . LEU A  1 186 ? 84.606  60.644  -3.574   1.00 79.26  ? 185 LEU A C   1 
ATOM   1361  O  O   . LEU A  1 186 ? 85.554  61.428  -3.692   1.00 77.23  ? 185 LEU A O   1 
ATOM   1362  C  CB  . LEU A  1 186 ? 85.182  58.382  -4.484   1.00 49.97  ? 185 LEU A CB  1 
ATOM   1363  C  CG  . LEU A  1 186 ? 85.247  56.856  -4.364   1.00 56.16  ? 185 LEU A CG  1 
ATOM   1364  C  CD1 . LEU A  1 186 ? 85.160  56.209  -5.737   1.00 61.56  ? 185 LEU A CD1 1 
ATOM   1365  C  CD2 . LEU A  1 186 ? 86.507  56.402  -3.646   1.00 50.93  ? 185 LEU A CD2 1 
ATOM   1366  N  N   . LEU A  1 187 ? 83.339  61.007  -3.766   1.00 79.72  ? 186 LEU A N   1 
ATOM   1367  C  CA  . LEU A  1 187 ? 82.952  62.356  -4.196   1.00 50.33  ? 186 LEU A CA  1 
ATOM   1368  C  C   . LEU A  1 187 ? 83.072  63.380  -3.056   1.00 71.50  ? 186 LEU A C   1 
ATOM   1369  O  O   . LEU A  1 187 ? 82.890  63.031  -1.888   1.00 87.37  ? 186 LEU A O   1 
ATOM   1370  C  CB  . LEU A  1 187 ? 81.519  62.337  -4.768   1.00 50.47  ? 186 LEU A CB  1 
ATOM   1371  C  CG  . LEU A  1 187 ? 81.316  61.594  -6.099   1.00 66.43  ? 186 LEU A CG  1 
ATOM   1372  C  CD1 . LEU A  1 187 ? 79.873  61.702  -6.614   1.00 46.72  ? 186 LEU A CD1 1 
ATOM   1373  C  CD2 . LEU A  1 187 ? 82.307  62.093  -7.158   1.00 61.07  ? 186 LEU A CD2 1 
ATOM   1374  N  N   . PRO A  1 188 ? 83.347  64.654  -3.391   1.00 69.24  ? 187 PRO A N   1 
ATOM   1375  C  CA  . PRO A  1 188 ? 83.476  65.191  -4.751   1.00 53.99  ? 187 PRO A CA  1 
ATOM   1376  C  C   . PRO A  1 188 ? 84.889  65.610  -5.158   1.00 60.10  ? 187 PRO A C   1 
ATOM   1377  O  O   . PRO A  1 188 ? 85.771  65.759  -4.316   1.00 67.58  ? 187 PRO A O   1 
ATOM   1378  C  CB  . PRO A  1 188 ? 82.571  66.426  -4.696   1.00 66.49  ? 187 PRO A CB  1 
ATOM   1379  C  CG  . PRO A  1 188 ? 82.730  66.928  -3.275   1.00 62.61  ? 187 PRO A CG  1 
ATOM   1380  C  CD  . PRO A  1 188 ? 83.144  65.736  -2.410   1.00 58.44  ? 187 PRO A CD  1 
ATOM   1381  N  N   . PHE A  1 189 ? 85.086  65.805  -6.461   1.00 48.72  ? 188 PHE A N   1 
ATOM   1382  C  CA  . PHE A  1 189 ? 86.330  66.362  -6.987   1.00 45.14  ? 188 PHE A CA  1 
ATOM   1383  C  C   . PHE A  1 189 ? 86.036  67.365  -8.103   1.00 44.80  ? 188 PHE A C   1 
ATOM   1384  O  O   . PHE A  1 189 ? 84.973  67.324  -8.716   1.00 47.29  ? 188 PHE A O   1 
ATOM   1385  C  CB  . PHE A  1 189 ? 87.259  65.253  -7.492   1.00 42.95  ? 188 PHE A CB  1 
ATOM   1386  C  CG  . PHE A  1 189 ? 86.648  64.371  -8.547   1.00 47.35  ? 188 PHE A CG  1 
ATOM   1387  C  CD1 . PHE A  1 189 ? 86.751  64.697  -9.891   1.00 46.57  ? 188 PHE A CD1 1 
ATOM   1388  C  CD2 . PHE A  1 189 ? 85.980  63.205  -8.196   1.00 51.42  ? 188 PHE A CD2 1 
ATOM   1389  C  CE1 . PHE A  1 189 ? 86.194  63.887  -10.861  1.00 62.36  ? 188 PHE A CE1 1 
ATOM   1390  C  CE2 . PHE A  1 189 ? 85.422  62.389  -9.162   1.00 46.23  ? 188 PHE A CE2 1 
ATOM   1391  C  CZ  . PHE A  1 189 ? 85.526  62.731  -10.497  1.00 66.29  ? 188 PHE A CZ  1 
ATOM   1392  N  N   . SER A  1 190 ? 86.968  68.272  -8.362   1.00 50.51  ? 189 SER A N   1 
ATOM   1393  C  CA  . SER A  1 190 ? 86.787  69.215  -9.464   1.00 73.09  ? 189 SER A CA  1 
ATOM   1394  C  C   . SER A  1 190 ? 87.176  68.546  -10.772  1.00 43.53  ? 189 SER A C   1 
ATOM   1395  O  O   . SER A  1 190 ? 88.286  68.037  -10.906  1.00 40.87  ? 189 SER A O   1 
ATOM   1396  C  CB  . SER A  1 190 ? 87.607  70.488  -9.247   1.00 58.09  ? 189 SER A CB  1 
ATOM   1397  O  OG  . SER A  1 190 ? 88.981  70.179  -9.106   1.00 72.21  ? 189 SER A OG  1 
ATOM   1398  N  N   . PRO A  1 191 ? 86.255  68.531  -11.742  1.00 43.61  ? 190 PRO A N   1 
ATOM   1399  C  CA  . PRO A  1 191 ? 86.554  67.858  -13.008  1.00 52.47  ? 190 PRO A CA  1 
ATOM   1400  C  C   . PRO A  1 191 ? 87.629  68.588  -13.801  1.00 44.07  ? 190 PRO A C   1 
ATOM   1401  O  O   . PRO A  1 191 ? 87.740  69.808  -13.743  1.00 43.10  ? 190 PRO A O   1 
ATOM   1402  C  CB  . PRO A  1 191 ? 85.221  67.916  -13.756  1.00 52.76  ? 190 PRO A CB  1 
ATOM   1403  C  CG  . PRO A  1 191 ? 84.561  69.132  -13.220  1.00 41.97  ? 190 PRO A CG  1 
ATOM   1404  C  CD  . PRO A  1 191 ? 84.930  69.174  -11.760  1.00 45.89  ? 190 PRO A CD  1 
ATOM   1405  N  N   . ASP A  1 192 ? 88.430  67.809  -14.512  1.00 44.03  ? 191 ASP A N   1 
ATOM   1406  C  CA  . ASP A  1 192 ? 89.410  68.309  -15.462  1.00 36.31  ? 191 ASP A CA  1 
ATOM   1407  C  C   . ASP A  1 192 ? 88.779  67.946  -16.806  1.00 35.69  ? 191 ASP A C   1 
ATOM   1408  O  O   . ASP A  1 192 ? 89.018  66.857  -17.342  1.00 33.94  ? 191 ASP A O   1 
ATOM   1409  C  CB  . ASP A  1 192 ? 90.718  67.553  -15.249  1.00 39.74  ? 191 ASP A CB  1 
ATOM   1410  C  CG  . ASP A  1 192 ? 91.831  68.044  -16.127  1.00 64.66  ? 191 ASP A CG  1 
ATOM   1411  O  OD1 . ASP A  1 192 ? 91.579  68.914  -16.986  1.00 50.31  ? 191 ASP A OD1 1 
ATOM   1412  O  OD2 . ASP A  1 192 ? 92.962  67.541  -15.960  1.00 55.73  ? 191 ASP A OD2 1 
ATOM   1413  N  N   . SER A  1 193 ? 87.927  68.838  -17.314  1.00 37.64  ? 192 SER A N   1 
ATOM   1414  C  CA  . SER A  1 193 ? 87.001  68.492  -18.401  1.00 32.06  ? 192 SER A CA  1 
ATOM   1415  C  C   . SER A  1 193 ? 87.635  68.565  -19.776  1.00 34.25  ? 192 SER A C   1 
ATOM   1416  O  O   . SER A  1 193 ? 88.301  69.539  -20.107  1.00 31.51  ? 192 SER A O   1 
ATOM   1417  C  CB  . SER A  1 193 ? 85.772  69.405  -18.370  1.00 43.40  ? 192 SER A CB  1 
ATOM   1418  O  OG  . SER A  1 193 ? 85.104  69.327  -17.125  1.00 39.88  ? 192 SER A OG  1 
ATOM   1419  N  N   . VAL A  1 194 ? 87.400  67.534  -20.579  1.00 30.17  ? 193 VAL A N   1 
ATOM   1420  C  CA  . VAL A  1 194 ? 87.902  67.492  -21.942  1.00 26.16  ? 193 VAL A CA  1 
ATOM   1421  C  C   . VAL A  1 194 ? 86.835  66.808  -22.768  1.00 34.51  ? 193 VAL A C   1 
ATOM   1422  O  O   . VAL A  1 194 ? 85.872  66.273  -22.218  1.00 29.41  ? 193 VAL A O   1 
ATOM   1423  C  CB  . VAL A  1 194 ? 89.180  66.642  -22.039  1.00 27.73  ? 193 VAL A CB  1 
ATOM   1424  C  CG1 . VAL A  1 194 ? 90.314  67.261  -21.188  1.00 31.20  ? 193 VAL A CG1 1 
ATOM   1425  C  CG2 . VAL A  1 194 ? 88.880  65.216  -21.601  1.00 28.69  ? 193 VAL A CG2 1 
ATOM   1426  N  N   . VAL A  1 195 ? 86.996  66.810  -24.084  1.00 29.95  ? 194 VAL A N   1 
ATOM   1427  C  CA  . VAL A  1 195 ? 86.124  65.990  -24.928  1.00 26.52  ? 194 VAL A CA  1 
ATOM   1428  C  C   . VAL A  1 195 ? 86.481  64.511  -24.735  1.00 33.47  ? 194 VAL A C   1 
ATOM   1429  O  O   . VAL A  1 195 ? 87.631  64.110  -24.966  1.00 32.75  ? 194 VAL A O   1 
ATOM   1430  C  CB  . VAL A  1 195 ? 86.281  66.359  -26.433  1.00 32.67  ? 194 VAL A CB  1 
ATOM   1431  C  CG1 . VAL A  1 195 ? 85.398  65.455  -27.284  1.00 26.51  ? 194 VAL A CG1 1 
ATOM   1432  C  CG2 . VAL A  1 195 ? 85.939  67.852  -26.681  1.00 28.61  ? 194 VAL A CG2 1 
ATOM   1433  N  N   . THR A  1 196 ? 85.513  63.703  -24.300  1.00 31.46  ? 195 THR A N   1 
ATOM   1434  C  CA  . THR A  1 196 ? 85.778  62.286  -24.041  1.00 30.66  ? 195 THR A CA  1 
ATOM   1435  C  C   . THR A  1 196 ? 85.014  61.381  -24.989  1.00 34.31  ? 195 THR A C   1 
ATOM   1436  O  O   . THR A  1 196 ? 83.986  61.768  -25.561  1.00 31.85  ? 195 THR A O   1 
ATOM   1437  C  CB  . THR A  1 196 ? 85.437  61.852  -22.590  1.00 33.51  ? 195 THR A CB  1 
ATOM   1438  O  OG1 . THR A  1 196 ? 84.035  62.030  -22.359  1.00 36.78  ? 195 THR A OG1 1 
ATOM   1439  C  CG2 . THR A  1 196 ? 86.250  62.652  -21.568  1.00 28.92  ? 195 THR A CG2 1 
ATOM   1440  N  N   . HIS A  1 197 ? 85.523  60.164  -25.146  1.00 28.75  ? 196 HIS A N   1 
ATOM   1441  C  CA  . HIS A  1 197 ? 84.885  59.165  -25.996  1.00 26.89  ? 196 HIS A CA  1 
ATOM   1442  C  C   . HIS A  1 197 ? 83.738  58.503  -25.232  1.00 34.81  ? 196 HIS A C   1 
ATOM   1443  O  O   . HIS A  1 197 ? 82.643  58.292  -25.762  1.00 32.21  ? 196 HIS A O   1 
ATOM   1444  C  CB  . HIS A  1 197 ? 85.935  58.107  -26.374  1.00 25.82  ? 196 HIS A CB  1 
ATOM   1445  C  CG  . HIS A  1 197 ? 85.393  56.987  -27.205  1.00 28.57  ? 196 HIS A CG  1 
ATOM   1446  N  ND1 . HIS A  1 197 ? 84.723  55.915  -26.660  1.00 26.27  ? 196 HIS A ND1 1 
ATOM   1447  C  CD2 . HIS A  1 197 ? 85.444  56.760  -28.537  1.00 31.04  ? 196 HIS A CD2 1 
ATOM   1448  C  CE1 . HIS A  1 197 ? 84.364  55.085  -27.621  1.00 31.49  ? 196 HIS A CE1 1 
ATOM   1449  N  NE2 . HIS A  1 197 ? 84.787  55.576  -28.772  1.00 30.09  ? 196 HIS A NE2 1 
ATOM   1450  N  N   . GLY A  1 198 ? 84.001  58.158  -23.978  1.00 27.89  ? 197 GLY A N   1 
ATOM   1451  C  CA  . GLY A  1 198 ? 82.991  57.540  -23.130  1.00 26.62  ? 197 GLY A CA  1 
ATOM   1452  C  C   . GLY A  1 198 ? 83.045  56.027  -22.971  1.00 35.09  ? 197 GLY A C   1 
ATOM   1453  O  O   . GLY A  1 198 ? 82.510  55.488  -22.001  1.00 31.45  ? 197 GLY A O   1 
ATOM   1454  N  N   . ASP A  1 199 ? 83.648  55.342  -23.935  1.00 27.25  ? 198 ASP A N   1 
ATOM   1455  C  CA  . ASP A  1 199 ? 83.894  53.901  -23.824  1.00 24.85  ? 198 ASP A CA  1 
ATOM   1456  C  C   . ASP A  1 199 ? 85.219  53.560  -24.516  1.00 26.64  ? 198 ASP A C   1 
ATOM   1457  O  O   . ASP A  1 199 ? 85.254  52.807  -25.479  1.00 29.75  ? 198 ASP A O   1 
ATOM   1458  C  CB  . ASP A  1 199 ? 82.701  53.106  -24.404  1.00 26.83  ? 198 ASP A CB  1 
ATOM   1459  C  CG  . ASP A  1 199 ? 82.720  51.636  -24.019  1.00 39.96  ? 198 ASP A CG  1 
ATOM   1460  O  OD1 . ASP A  1 199 ? 83.603  51.219  -23.238  1.00 36.29  ? 198 ASP A OD1 1 
ATOM   1461  O  OD2 . ASP A  1 199 ? 81.830  50.897  -24.491  1.00 36.40  ? 198 ASP A OD2 1 
ATOM   1462  N  N   . PHE A  1 200 ? 86.304  54.158  -24.015  1.00 33.42  ? 199 PHE A N   1 
ATOM   1463  C  CA  . PHE A  1 200 ? 87.621  54.063  -24.642  1.00 31.97  ? 199 PHE A CA  1 
ATOM   1464  C  C   . PHE A  1 200 ? 88.271  52.736  -24.236  1.00 31.88  ? 199 PHE A C   1 
ATOM   1465  O  O   . PHE A  1 200 ? 89.258  52.701  -23.494  1.00 29.12  ? 199 PHE A O   1 
ATOM   1466  C  CB  . PHE A  1 200 ? 88.492  55.277  -24.257  1.00 30.75  ? 199 PHE A CB  1 
ATOM   1467  C  CG  . PHE A  1 200 ? 89.584  55.614  -25.267  1.00 30.27  ? 199 PHE A CG  1 
ATOM   1468  C  CD1 . PHE A  1 200 ? 89.309  56.407  -26.375  1.00 36.25  ? 199 PHE A CD1 1 
ATOM   1469  C  CD2 . PHE A  1 200 ? 90.884  55.147  -25.094  1.00 31.73  ? 199 PHE A CD2 1 
ATOM   1470  C  CE1 . PHE A  1 200 ? 90.303  56.719  -27.305  1.00 35.31  ? 199 PHE A CE1 1 
ATOM   1471  C  CE2 . PHE A  1 200 ? 91.904  55.469  -26.028  1.00 31.09  ? 199 PHE A CE2 1 
ATOM   1472  C  CZ  . PHE A  1 200 ? 91.605  56.250  -27.132  1.00 34.56  ? 199 PHE A CZ  1 
ATOM   1473  N  N   . SER A  1 201 ? 87.703  51.643  -24.734  1.00 34.70  ? 200 SER A N   1 
ATOM   1474  C  CA  . SER A  1 201 ? 88.188  50.319  -24.405  1.00 28.45  ? 200 SER A CA  1 
ATOM   1475  C  C   . SER A  1 201 ? 89.008  49.755  -25.558  1.00 29.80  ? 200 SER A C   1 
ATOM   1476  O  O   . SER A  1 201 ? 88.997  50.298  -26.652  1.00 31.27  ? 200 SER A O   1 
ATOM   1477  C  CB  . SER A  1 201 ? 87.021  49.379  -24.132  1.00 35.56  ? 200 SER A CB  1 
ATOM   1478  O  OG  . SER A  1 201 ? 86.420  49.019  -25.366  1.00 32.88  ? 200 SER A OG  1 
ATOM   1479  N  N   . LEU A  1 202 ? 89.676  48.631  -25.315  1.00 29.43  ? 201 LEU A N   1 
ATOM   1480  C  CA  . LEU A  1 202 ? 90.438  47.977  -26.375  1.00 30.81  ? 201 LEU A CA  1 
ATOM   1481  C  C   . LEU A  1 202 ? 89.563  47.428  -27.508  1.00 37.74  ? 201 LEU A C   1 
ATOM   1482  O  O   . LEU A  1 202 ? 90.069  47.118  -28.580  1.00 34.51  ? 201 LEU A O   1 
ATOM   1483  C  CB  . LEU A  1 202 ? 91.290  46.851  -25.800  1.00 31.17  ? 201 LEU A CB  1 
ATOM   1484  C  CG  . LEU A  1 202 ? 92.448  47.248  -24.884  1.00 31.63  ? 201 LEU A CG  1 
ATOM   1485  C  CD1 . LEU A  1 202 ? 93.008  45.966  -24.245  1.00 31.64  ? 201 LEU A CD1 1 
ATOM   1486  C  CD2 . LEU A  1 202 ? 93.538  47.975  -25.664  1.00 35.20  ? 201 LEU A CD2 1 
ATOM   1487  N  N   . ASP A  1 203 ? 88.257  47.305  -27.284  1.00 28.23  ? 202 ASP A N   1 
ATOM   1488  C  CA  . ASP A  1 203 ? 87.379  46.809  -28.341  1.00 29.70  ? 202 ASP A CA  1 
ATOM   1489  C  C   . ASP A  1 203 ? 86.950  47.933  -29.290  1.00 31.12  ? 202 ASP A C   1 
ATOM   1490  O  O   . ASP A  1 203 ? 86.411  47.665  -30.363  1.00 32.84  ? 202 ASP A O   1 
ATOM   1491  C  CB  . ASP A  1 203 ? 86.116  46.171  -27.757  1.00 31.92  ? 202 ASP A CB  1 
ATOM   1492  C  CG  . ASP A  1 203 ? 86.421  45.048  -26.806  1.00 38.31  ? 202 ASP A CG  1 
ATOM   1493  O  OD1 . ASP A  1 203 ? 87.379  44.287  -27.068  1.00 37.54  ? 202 ASP A OD1 1 
ATOM   1494  O  OD2 . ASP A  1 203 ? 85.701  44.934  -25.791  1.00 46.16  ? 202 ASP A OD2 1 
ATOM   1495  N  N   . ASN A  1 204 ? 87.179  49.182  -28.903  1.00 28.20  ? 203 ASN A N   1 
ATOM   1496  C  CA  . ASN A  1 204 ? 86.610  50.307  -29.672  1.00 28.09  ? 203 ASN A CA  1 
ATOM   1497  C  C   . ASN A  1 204 ? 87.622  51.159  -30.422  1.00 31.70  ? 203 ASN A C   1 
ATOM   1498  O  O   . ASN A  1 204 ? 87.283  52.232  -30.932  1.00 30.61  ? 203 ASN A O   1 
ATOM   1499  C  CB  . ASN A  1 204 ? 85.776  51.201  -28.764  1.00 31.70  ? 203 ASN A CB  1 
ATOM   1500  C  CG  . ASN A  1 204 ? 84.465  50.562  -28.388  1.00 35.56  ? 203 ASN A CG  1 
ATOM   1501  O  OD1 . ASN A  1 204 ? 83.951  49.715  -29.124  1.00 32.65  ? 203 ASN A OD1 1 
ATOM   1502  N  ND2 . ASN A  1 204 ? 83.906  50.967  -27.249  1.00 31.12  ? 203 ASN A ND2 1 
ATOM   1503  N  N   . LEU A  1 205 ? 88.862  50.681  -30.469  1.00 30.56  ? 204 LEU A N   1 
ATOM   1504  C  CA  . LEU A  1 205 ? 89.940  51.356  -31.185  1.00 35.76  ? 204 LEU A CA  1 
ATOM   1505  C  C   . LEU A  1 205 ? 90.418  50.394  -32.249  1.00 31.92  ? 204 LEU A C   1 
ATOM   1506  O  O   . LEU A  1 205 ? 90.695  49.226  -31.949  1.00 34.39  ? 204 LEU A O   1 
ATOM   1507  C  CB  . LEU A  1 205 ? 91.087  51.689  -30.237  1.00 30.74  ? 204 LEU A CB  1 
ATOM   1508  C  CG  . LEU A  1 205 ? 91.036  52.942  -29.356  1.00 40.81  ? 204 LEU A CG  1 
ATOM   1509  C  CD1 . LEU A  1 205 ? 90.799  54.193  -30.202  1.00 35.07  ? 204 LEU A CD1 1 
ATOM   1510  C  CD2 . LEU A  1 205 ? 90.005  52.813  -28.259  1.00 45.83  ? 204 LEU A CD2 1 
ATOM   1511  N  N   . ILE A  1 206 ? 90.529  50.866  -33.492  1.00 27.52  ? 205 ILE A N   1 
ATOM   1512  C  CA  . ILE A  1 206 ? 90.790  49.950  -34.603  1.00 29.94  ? 205 ILE A CA  1 
ATOM   1513  C  C   . ILE A  1 206 ? 92.175  50.131  -35.218  1.00 36.30  ? 205 ILE A C   1 
ATOM   1514  O  O   . ILE A  1 206 ? 92.543  51.234  -35.602  1.00 29.63  ? 205 ILE A O   1 
ATOM   1515  C  CB  . ILE A  1 206 ? 89.721  50.102  -35.713  1.00 33.95  ? 205 ILE A CB  1 
ATOM   1516  C  CG1 . ILE A  1 206 ? 88.325  49.998  -35.103  1.00 31.09  ? 205 ILE A CG1 1 
ATOM   1517  C  CG2 . ILE A  1 206 ? 89.911  49.045  -36.798  1.00 36.04  ? 205 ILE A CG2 1 
ATOM   1518  C  CD1 . ILE A  1 206 ? 88.052  48.654  -34.458  1.00 29.94  ? 205 ILE A CD1 1 
ATOM   1519  N  N   . PHE A  1 207 ? 92.919  49.033  -35.296  1.00 32.49  ? 206 PHE A N   1 
ATOM   1520  C  CA  . PHE A  1 207 ? 94.262  49.014  -35.857  1.00 36.85  ? 206 PHE A CA  1 
ATOM   1521  C  C   . PHE A  1 207 ? 94.235  48.359  -37.221  1.00 36.82  ? 206 PHE A C   1 
ATOM   1522  O  O   . PHE A  1 207 ? 93.548  47.351  -37.428  1.00 34.73  ? 206 PHE A O   1 
ATOM   1523  C  CB  . PHE A  1 207 ? 95.212  48.224  -34.954  1.00 39.29  ? 206 PHE A CB  1 
ATOM   1524  C  CG  . PHE A  1 207 ? 95.782  49.025  -33.811  1.00 36.47  ? 206 PHE A CG  1 
ATOM   1525  C  CD1 . PHE A  1 207 ? 95.028  49.269  -32.668  1.00 36.99  ? 206 PHE A CD1 1 
ATOM   1526  C  CD2 . PHE A  1 207 ? 97.079  49.502  -33.869  1.00 38.36  ? 206 PHE A CD2 1 
ATOM   1527  C  CE1 . PHE A  1 207 ? 95.560  49.992  -31.615  1.00 36.92  ? 206 PHE A CE1 1 
ATOM   1528  C  CE2 . PHE A  1 207 ? 97.618  50.219  -32.831  1.00 36.80  ? 206 PHE A CE2 1 
ATOM   1529  C  CZ  . PHE A  1 207 ? 96.860  50.469  -31.699  1.00 35.09  ? 206 PHE A CZ  1 
ATOM   1530  N  N   . ASP A  1 208 ? 95.006  48.923  -38.146  1.00 36.97  ? 207 ASP A N   1 
ATOM   1531  C  CA  . ASP A  1 208 ? 95.089  48.398  -39.502  1.00 33.60  ? 207 ASP A CA  1 
ATOM   1532  C  C   . ASP A  1 208 ? 96.504  48.593  -40.028  1.00 40.21  ? 207 ASP A C   1 
ATOM   1533  O  O   . ASP A  1 208 ? 97.014  49.713  -40.034  1.00 40.19  ? 207 ASP A O   1 
ATOM   1534  C  CB  . ASP A  1 208 ? 94.095  49.127  -40.405  1.00 35.01  ? 207 ASP A CB  1 
ATOM   1535  C  CG  . ASP A  1 208 ? 94.061  48.564  -41.817  1.00 45.80  ? 207 ASP A CG  1 
ATOM   1536  O  OD1 . ASP A  1 208 ? 93.684  47.385  -41.986  1.00 61.63  ? 207 ASP A OD1 1 
ATOM   1537  O  OD2 . ASP A  1 208 ? 94.400  49.309  -42.756  1.00 69.27  ? 207 ASP A OD2 1 
ATOM   1538  N  N   . GLU A  1 209 ? 97.132  47.501  -40.454  1.00 41.34  ? 208 GLU A N   1 
ATOM   1539  C  CA  . GLU A  1 209 ? 98.513  47.527  -40.941  1.00 54.55  ? 208 GLU A CA  1 
ATOM   1540  C  C   . GLU A  1 209 ? 99.466  48.251  -39.995  1.00 51.04  ? 208 GLU A C   1 
ATOM   1541  O  O   . GLU A  1 209 ? 100.355 48.986  -40.437  1.00 54.67  ? 208 GLU A O   1 
ATOM   1542  C  CB  . GLU A  1 209 ? 98.585  48.163  -42.326  1.00 44.14  ? 208 GLU A CB  1 
ATOM   1543  C  CG  . GLU A  1 209 ? 97.716  47.481  -43.356  1.00 66.34  ? 208 GLU A CG  1 
ATOM   1544  C  CD  . GLU A  1 209 ? 98.040  47.929  -44.768  1.00 97.15  ? 208 GLU A CD  1 
ATOM   1545  O  OE1 . GLU A  1 209 ? 98.901  48.824  -44.931  1.00 75.87  ? 208 GLU A OE1 1 
ATOM   1546  O  OE2 . GLU A  1 209 ? 97.436  47.381  -45.714  1.00 72.10  ? 208 GLU A OE2 1 
ATOM   1547  N  N   . GLY A  1 210 ? 99.259  48.064  -38.695  1.00 46.76  ? 209 GLY A N   1 
ATOM   1548  C  CA  . GLY A  1 210 ? 100.181 48.575  -37.703  1.00 50.57  ? 209 GLY A CA  1 
ATOM   1549  C  C   . GLY A  1 210 ? 99.780  49.901  -37.099  1.00 65.79  ? 209 GLY A C   1 
ATOM   1550  O  O   . GLY A  1 210 ? 100.312 50.308  -36.066  1.00 59.47  ? 209 GLY A O   1 
ATOM   1551  N  N   . LYS A  1 211 ? 98.831  50.573  -37.738  1.00 51.93  ? 210 LYS A N   1 
ATOM   1552  C  CA  . LYS A  1 211 ? 98.460  51.917  -37.332  1.00 41.11  ? 210 LYS A CA  1 
ATOM   1553  C  C   . LYS A  1 211 ? 97.066  51.949  -36.721  1.00 41.83  ? 210 LYS A C   1 
ATOM   1554  O  O   . LYS A  1 211 ? 96.150  51.275  -37.194  1.00 36.98  ? 210 LYS A O   1 
ATOM   1555  C  CB  . LYS A  1 211 ? 98.509  52.865  -38.533  1.00 45.62  ? 210 LYS A CB  1 
ATOM   1556  C  CG  . LYS A  1 211 ? 97.988  54.273  -38.234  1.00 49.48  ? 210 LYS A CG  1 
ATOM   1557  C  CD  . LYS A  1 211 ? 98.021  55.172  -39.466  1.00 75.96  ? 210 LYS A CD  1 
ATOM   1558  C  CE  . LYS A  1 211 ? 97.569  56.590  -39.127  1.00 61.29  ? 210 LYS A CE  1 
ATOM   1559  N  NZ  . LYS A  1 211 ? 97.769  57.542  -40.264  1.00 63.07  ? 210 LYS A NZ  1 
ATOM   1560  N  N   . LEU A  1 212 ? 96.912  52.739  -35.666  1.00 37.39  ? 211 LEU A N   1 
ATOM   1561  C  CA  . LEU A  1 212 ? 95.598  53.001  -35.106  1.00 32.44  ? 211 LEU A CA  1 
ATOM   1562  C  C   . LEU A  1 212 ? 94.911  54.008  -36.018  1.00 46.20  ? 211 LEU A C   1 
ATOM   1563  O  O   . LEU A  1 212 ? 95.336  55.159  -36.109  1.00 43.74  ? 211 LEU A O   1 
ATOM   1564  C  CB  . LEU A  1 212 ? 95.764  53.538  -33.686  1.00 33.89  ? 211 LEU A CB  1 
ATOM   1565  C  CG  . LEU A  1 212 ? 94.578  54.042  -32.884  1.00 46.77  ? 211 LEU A CG  1 
ATOM   1566  C  CD1 . LEU A  1 212 ? 93.421  53.086  -33.002  1.00 56.13  ? 211 LEU A CD1 1 
ATOM   1567  C  CD2 . LEU A  1 212 ? 95.021  54.195  -31.440  1.00 37.26  ? 211 LEU A CD2 1 
ATOM   1568  N  N   . ILE A  1 213 ? 93.868  53.570  -36.721  1.00 36.44  ? 212 ILE A N   1 
ATOM   1569  C  CA  . ILE A  1 213 ? 93.289  54.390  -37.778  1.00 34.96  ? 212 ILE A CA  1 
ATOM   1570  C  C   . ILE A  1 213 ? 91.880  54.913  -37.497  1.00 38.41  ? 212 ILE A C   1 
ATOM   1571  O  O   . ILE A  1 213 ? 91.346  55.687  -38.284  1.00 41.69  ? 212 ILE A O   1 
ATOM   1572  C  CB  . ILE A  1 213 ? 93.322  53.668  -39.135  1.00 36.99  ? 212 ILE A CB  1 
ATOM   1573  C  CG1 . ILE A  1 213 ? 92.422  52.428  -39.122  1.00 35.14  ? 212 ILE A CG1 1 
ATOM   1574  C  CG2 . ILE A  1 213 ? 94.763  53.278  -39.501  1.00 44.11  ? 212 ILE A CG2 1 
ATOM   1575  C  CD1 . ILE A  1 213 ? 92.048  51.953  -40.540  1.00 38.00  ? 212 ILE A CD1 1 
ATOM   1576  N  N   . GLY A  1 214 ? 91.279  54.509  -36.377  1.00 35.49  ? 213 GLY A N   1 
ATOM   1577  C  CA  . GLY A  1 214 ? 89.951  54.982  -36.047  1.00 34.90  ? 213 GLY A CA  1 
ATOM   1578  C  C   . GLY A  1 214 ? 89.395  54.476  -34.733  1.00 31.44  ? 213 GLY A C   1 
ATOM   1579  O  O   . GLY A  1 214 ? 89.952  53.559  -34.112  1.00 30.74  ? 213 GLY A O   1 
ATOM   1580  N  N   . CYS A  1 215 ? 88.319  55.106  -34.287  1.00 33.53  ? 214 CYS A N   1 
ATOM   1581  C  CA  . CYS A  1 215 ? 87.567  54.620  -33.133  1.00 32.51  ? 214 CYS A CA  1 
ATOM   1582  C  C   . CYS A  1 215 ? 86.108  54.411  -33.520  1.00 36.75  ? 214 CYS A C   1 
ATOM   1583  O  O   . CYS A  1 215 ? 85.621  54.997  -34.494  1.00 30.02  ? 214 CYS A O   1 
ATOM   1584  C  CB  . CYS A  1 215 ? 87.680  55.570  -31.927  1.00 31.35  ? 214 CYS A CB  1 
ATOM   1585  S  SG  . CYS A  1 215 ? 87.058  57.244  -32.165  1.00 39.73  ? 214 CYS A SG  1 
ATOM   1586  N  N   . ILE A  1 216 ? 85.426  53.551  -32.770  1.00 31.75  ? 215 ILE A N   1 
ATOM   1587  C  CA  . ILE A  1 216 ? 84.040  53.217  -33.045  1.00 30.94  ? 215 ILE A CA  1 
ATOM   1588  C  C   . ILE A  1 216 ? 83.216  53.337  -31.759  1.00 33.09  ? 215 ILE A C   1 
ATOM   1589  O  O   . ILE A  1 216 ? 83.774  53.603  -30.688  1.00 30.53  ? 215 ILE A O   1 
ATOM   1590  C  CB  . ILE A  1 216 ? 83.915  51.786  -33.617  1.00 30.29  ? 215 ILE A CB  1 
ATOM   1591  C  CG1 . ILE A  1 216 ? 84.492  50.766  -32.621  1.00 29.17  ? 215 ILE A CG1 1 
ATOM   1592  C  CG2 . ILE A  1 216 ? 84.651  51.685  -34.981  1.00 29.20  ? 215 ILE A CG2 1 
ATOM   1593  C  CD1 . ILE A  1 216 ? 84.241  49.295  -33.030  1.00 32.67  ? 215 ILE A CD1 1 
ATOM   1594  N  N   . ASP A  1 217 ? 81.902  53.154  -31.873  1.00 28.99  ? 216 ASP A N   1 
ATOM   1595  C  CA  . ASP A  1 217 ? 81.010  53.140  -30.700  1.00 27.34  ? 216 ASP A CA  1 
ATOM   1596  C  C   . ASP A  1 217 ? 81.057  54.449  -29.926  1.00 35.23  ? 216 ASP A C   1 
ATOM   1597  O  O   . ASP A  1 217 ? 81.402  54.467  -28.747  1.00 30.05  ? 216 ASP A O   1 
ATOM   1598  C  CB  . ASP A  1 217 ? 81.387  51.979  -29.757  1.00 31.06  ? 216 ASP A CB  1 
ATOM   1599  C  CG  . ASP A  1 217 ? 80.683  50.679  -30.116  1.00 75.84  ? 216 ASP A CG  1 
ATOM   1600  O  OD1 . ASP A  1 217 ? 79.511  50.741  -30.543  1.00 48.10  ? 216 ASP A OD1 1 
ATOM   1601  O  OD2 . ASP A  1 217 ? 81.296  49.597  -29.975  1.00 78.52  ? 216 ASP A OD2 1 
ATOM   1602  N  N   . VAL A  1 218 ? 80.665  55.548  -30.565  1.00 28.97  ? 217 VAL A N   1 
ATOM   1603  C  CA  . VAL A  1 218 ? 80.894  56.862  -29.962  1.00 29.50  ? 217 VAL A CA  1 
ATOM   1604  C  C   . VAL A  1 218 ? 79.634  57.430  -29.303  1.00 34.22  ? 217 VAL A C   1 
ATOM   1605  O  O   . VAL A  1 218 ? 79.523  58.634  -29.082  1.00 29.85  ? 217 VAL A O   1 
ATOM   1606  C  CB  . VAL A  1 218 ? 81.436  57.848  -31.004  1.00 29.94  ? 217 VAL A CB  1 
ATOM   1607  C  CG1 . VAL A  1 218 ? 82.793  57.363  -31.527  1.00 32.92  ? 217 VAL A CG1 1 
ATOM   1608  C  CG2 . VAL A  1 218 ? 80.444  57.981  -32.155  1.00 32.95  ? 217 VAL A CG2 1 
ATOM   1609  N  N   . GLY A  1 219 ? 78.692  56.552  -28.974  1.00 30.10  ? 218 GLY A N   1 
ATOM   1610  C  CA  . GLY A  1 219 ? 77.431  56.969  -28.393  1.00 27.15  ? 218 GLY A CA  1 
ATOM   1611  C  C   . GLY A  1 219 ? 77.485  57.726  -27.075  1.00 31.06  ? 218 GLY A C   1 
ATOM   1612  O  O   . GLY A  1 219 ? 76.529  58.404  -26.713  1.00 31.52  ? 218 GLY A O   1 
ATOM   1613  N  N   . ARG A  1 220 ? 78.589  57.602  -26.349  1.00 29.68  ? 219 ARG A N   1 
ATOM   1614  C  CA  . ARG A  1 220 ? 78.733  58.266  -25.051  1.00 29.59  ? 219 ARG A CA  1 
ATOM   1615  C  C   . ARG A  1 220 ? 79.687  59.473  -25.104  1.00 31.08  ? 219 ARG A C   1 
ATOM   1616  O  O   . ARG A  1 220 ? 80.067  60.024  -24.056  1.00 29.36  ? 219 ARG A O   1 
ATOM   1617  C  CB  . ARG A  1 220 ? 79.201  57.248  -23.983  1.00 32.37  ? 219 ARG A CB  1 
ATOM   1618  C  CG  . ARG A  1 220 ? 78.151  56.147  -23.668  1.00 38.70  ? 219 ARG A CG  1 
ATOM   1619  C  CD  . ARG A  1 220 ? 78.665  55.013  -22.720  1.00 41.44  ? 219 ARG A CD  1 
ATOM   1620  N  NE  . ARG A  1 220 ? 77.607  54.008  -22.546  1.00 49.06  ? 219 ARG A NE  1 
ATOM   1621  C  CZ  . ARG A  1 220 ? 77.793  52.692  -22.426  1.00 91.15  ? 219 ARG A CZ  1 
ATOM   1622  N  NH1 . ARG A  1 220 ? 76.737  51.890  -22.293  1.00 55.11  ? 219 ARG A NH1 1 
ATOM   1623  N  NH2 . ARG A  1 220 ? 79.019  52.168  -22.433  1.00 47.88  ? 219 ARG A NH2 1 
ATOM   1624  N  N   . VAL A  1 221 ? 80.048  59.900  -26.316  1.00 31.30  ? 220 VAL A N   1 
ATOM   1625  C  CA  . VAL A  1 221 ? 80.882  61.103  -26.487  1.00 34.72  ? 220 VAL A CA  1 
ATOM   1626  C  C   . VAL A  1 221 ? 80.283  62.349  -25.828  1.00 31.40  ? 220 VAL A C   1 
ATOM   1627  O  O   . VAL A  1 221 ? 79.092  62.631  -25.976  1.00 28.87  ? 220 VAL A O   1 
ATOM   1628  C  CB  . VAL A  1 221 ? 81.169  61.409  -28.001  1.00 29.24  ? 220 VAL A CB  1 
ATOM   1629  C  CG1 . VAL A  1 221 ? 81.667  62.854  -28.196  1.00 27.32  ? 220 VAL A CG1 1 
ATOM   1630  C  CG2 . VAL A  1 221 ? 82.201  60.441  -28.553  1.00 33.17  ? 220 VAL A CG2 1 
ATOM   1631  N  N   . GLY A  1 222 ? 81.117  63.101  -25.110  1.00 29.80  ? 221 GLY A N   1 
ATOM   1632  C  CA  . GLY A  1 222 ? 80.706  64.384  -24.568  1.00 31.35  ? 221 GLY A CA  1 
ATOM   1633  C  C   . GLY A  1 222 ? 81.753  64.945  -23.633  1.00 29.97  ? 221 GLY A C   1 
ATOM   1634  O  O   . GLY A  1 222 ? 82.765  64.286  -23.368  1.00 28.62  ? 221 GLY A O   1 
ATOM   1635  N  N   . ILE A  1 223 ? 81.532  66.169  -23.153  1.00 29.03  ? 222 ILE A N   1 
ATOM   1636  C  CA  . ILE A  1 223 ? 82.447  66.758  -22.181  1.00 29.39  ? 222 ILE A CA  1 
ATOM   1637  C  C   . ILE A  1 223 ? 82.367  66.001  -20.839  1.00 30.84  ? 222 ILE A C   1 
ATOM   1638  O  O   . ILE A  1 223 ? 81.289  65.848  -20.264  1.00 31.99  ? 222 ILE A O   1 
ATOM   1639  C  CB  . ILE A  1 223 ? 82.174  68.252  -21.973  1.00 29.79  ? 222 ILE A CB  1 
ATOM   1640  C  CG1 . ILE A  1 223 ? 82.345  69.018  -23.302  1.00 34.97  ? 222 ILE A CG1 1 
ATOM   1641  C  CG2 . ILE A  1 223 ? 83.104  68.805  -20.881  1.00 31.50  ? 222 ILE A CG2 1 
ATOM   1642  C  CD1 . ILE A  1 223 ? 81.892  70.489  -23.258  1.00 38.69  ? 222 ILE A CD1 1 
ATOM   1643  N  N   . ALA A  1 224 ? 83.513  65.527  -20.359  1.00 31.23  ? 223 ALA A N   1 
ATOM   1644  C  CA  . ALA A  1 224 ? 83.608  64.812  -19.080  1.00 25.93  ? 223 ALA A CA  1 
ATOM   1645  C  C   . ALA A  1 224 ? 85.040  64.910  -18.543  1.00 35.03  ? 223 ALA A C   1 
ATOM   1646  O  O   . ALA A  1 224 ? 85.920  65.488  -19.190  1.00 28.93  ? 223 ALA A O   1 
ATOM   1647  C  CB  . ALA A  1 224 ? 83.186  63.361  -19.256  1.00 27.29  ? 223 ALA A CB  1 
ATOM   1648  N  N   . ASP A  1 225 ? 85.288  64.371  -17.355  1.00 32.36  ? 224 ASP A N   1 
ATOM   1649  C  CA  . ASP A  1 225 ? 86.656  64.397  -16.817  1.00 31.47  ? 224 ASP A CA  1 
ATOM   1650  C  C   . ASP A  1 225 ? 87.539  63.491  -17.686  1.00 28.62  ? 224 ASP A C   1 
ATOM   1651  O  O   . ASP A  1 225 ? 87.068  62.465  -18.167  1.00 30.12  ? 224 ASP A O   1 
ATOM   1652  C  CB  . ASP A  1 225 ? 86.670  63.923  -15.355  1.00 30.05  ? 224 ASP A CB  1 
ATOM   1653  C  CG  . ASP A  1 225 ? 88.036  64.060  -14.716  1.00 34.78  ? 224 ASP A CG  1 
ATOM   1654  O  OD1 . ASP A  1 225 ? 88.852  63.123  -14.857  1.00 39.04  ? 224 ASP A OD1 1 
ATOM   1655  O  OD2 . ASP A  1 225 ? 88.296  65.107  -14.088  1.00 37.36  ? 224 ASP A OD2 1 
ATOM   1656  N  N   . ARG A  1 226 ? 88.815  63.846  -17.874  1.00 31.68  ? 225 ARG A N   1 
ATOM   1657  C  CA  . ARG A  1 226 ? 89.690  63.019  -18.726  1.00 26.98  ? 225 ARG A CA  1 
ATOM   1658  C  C   . ARG A  1 226 ? 89.831  61.573  -18.217  1.00 33.04  ? 225 ARG A C   1 
ATOM   1659  O  O   . ARG A  1 226 ? 90.088  60.658  -18.994  1.00 29.78  ? 225 ARG A O   1 
ATOM   1660  C  CB  . ARG A  1 226 ? 91.066  63.678  -18.942  1.00 29.06  ? 225 ARG A CB  1 
ATOM   1661  C  CG  . ARG A  1 226 ? 91.921  63.839  -17.700  1.00 34.11  ? 225 ARG A CG  1 
ATOM   1662  C  CD  . ARG A  1 226 ? 93.264  64.541  -18.007  1.00 39.07  ? 225 ARG A CD  1 
ATOM   1663  N  NE  . ARG A  1 226 ? 93.139  65.991  -18.129  1.00 42.36  ? 225 ARG A NE  1 
ATOM   1664  C  CZ  . ARG A  1 226 ? 93.412  66.692  -19.231  1.00 56.22  ? 225 ARG A CZ  1 
ATOM   1665  N  NH1 . ARG A  1 226 ? 93.837  66.093  -20.331  1.00 40.56  ? 225 ARG A NH1 1 
ATOM   1666  N  NH2 . ARG A  1 226 ? 93.260  68.009  -19.233  1.00 41.92  ? 225 ARG A NH2 1 
ATOM   1667  N  N   . TYR A  1 227 ? 89.636  61.355  -16.919  1.00 33.18  ? 226 TYR A N   1 
ATOM   1668  C  CA  . TYR A  1 227 ? 89.731  59.994  -16.373  1.00 28.59  ? 226 TYR A CA  1 
ATOM   1669  C  C   . TYR A  1 227 ? 88.583  59.060  -16.799  1.00 33.62  ? 226 TYR A C   1 
ATOM   1670  O  O   . TYR A  1 227 ? 88.649  57.848  -16.588  1.00 30.18  ? 226 TYR A O   1 
ATOM   1671  C  CB  . TYR A  1 227 ? 89.888  60.021  -14.845  1.00 28.65  ? 226 TYR A CB  1 
ATOM   1672  C  CG  . TYR A  1 227 ? 91.311  60.279  -14.391  1.00 28.73  ? 226 TYR A CG  1 
ATOM   1673  C  CD1 . TYR A  1 227 ? 91.883  61.544  -14.508  1.00 36.77  ? 226 TYR A CD1 1 
ATOM   1674  C  CD2 . TYR A  1 227 ? 92.079  59.258  -13.832  1.00 29.96  ? 226 TYR A CD2 1 
ATOM   1675  C  CE1 . TYR A  1 227 ? 93.191  61.786  -14.103  1.00 36.72  ? 226 TYR A CE1 1 
ATOM   1676  C  CE2 . TYR A  1 227 ? 93.384  59.490  -13.419  1.00 31.01  ? 226 TYR A CE2 1 
ATOM   1677  C  CZ  . TYR A  1 227 ? 93.933  60.757  -13.552  1.00 35.08  ? 226 TYR A CZ  1 
ATOM   1678  O  OH  . TYR A  1 227 ? 95.228  60.983  -13.129  1.00 35.89  ? 226 TYR A OH  1 
ATOM   1679  N  N   . GLN A  1 228 ? 87.531  59.607  -17.403  1.00 29.06  ? 227 GLN A N   1 
ATOM   1680  C  CA  . GLN A  1 228 ? 86.500  58.744  -17.981  1.00 29.03  ? 227 GLN A CA  1 
ATOM   1681  C  C   . GLN A  1 228 ? 87.105  57.813  -19.025  1.00 37.49  ? 227 GLN A C   1 
ATOM   1682  O  O   . GLN A  1 228 ? 86.746  56.642  -19.112  1.00 33.07  ? 227 GLN A O   1 
ATOM   1683  C  CB  . GLN A  1 228 ? 85.384  59.567  -18.643  1.00 30.00  ? 227 GLN A CB  1 
ATOM   1684  C  CG  . GLN A  1 228 ? 84.418  58.705  -19.488  1.00 32.58  ? 227 GLN A CG  1 
ATOM   1685  C  CD  . GLN A  1 228 ? 83.679  57.663  -18.652  1.00 33.79  ? 227 GLN A CD  1 
ATOM   1686  O  OE1 . GLN A  1 228 ? 83.521  57.826  -17.442  1.00 32.96  ? 227 GLN A OE1 1 
ATOM   1687  N  NE2 . GLN A  1 228 ? 83.225  56.581  -19.298  1.00 31.27  ? 227 GLN A NE2 1 
ATOM   1688  N  N   . ASP A  1 229 ? 88.029  58.336  -19.821  1.00 29.40  ? 228 ASP A N   1 
ATOM   1689  C  CA  . ASP A  1 229 ? 88.649  57.535  -20.875  1.00 25.11  ? 228 ASP A CA  1 
ATOM   1690  C  C   . ASP A  1 229 ? 89.861  56.790  -20.346  1.00 30.42  ? 228 ASP A C   1 
ATOM   1691  O  O   . ASP A  1 229 ? 90.076  55.623  -20.677  1.00 31.23  ? 228 ASP A O   1 
ATOM   1692  C  CB  . ASP A  1 229 ? 89.037  58.420  -22.078  1.00 25.97  ? 228 ASP A CB  1 
ATOM   1693  C  CG  . ASP A  1 229 ? 87.797  58.940  -22.853  1.00 31.51  ? 228 ASP A CG  1 
ATOM   1694  O  OD1 . ASP A  1 229 ? 86.720  58.286  -22.783  1.00 29.01  ? 228 ASP A OD1 1 
ATOM   1695  O  OD2 . ASP A  1 229 ? 87.916  59.995  -23.525  1.00 31.25  ? 228 ASP A OD2 1 
ATOM   1696  N  N   . LEU A  1 230 ? 90.653  57.471  -19.528  1.00 29.29  ? 229 LEU A N   1 
ATOM   1697  C  CA  . LEU A  1 230 ? 91.845  56.859  -18.974  1.00 32.04  ? 229 LEU A CA  1 
ATOM   1698  C  C   . LEU A  1 230 ? 91.482  55.625  -18.145  1.00 36.65  ? 229 LEU A C   1 
ATOM   1699  O  O   . LEU A  1 230 ? 92.172  54.612  -18.226  1.00 31.56  ? 229 LEU A O   1 
ATOM   1700  C  CB  . LEU A  1 230 ? 92.621  57.858  -18.126  1.00 30.88  ? 229 LEU A CB  1 
ATOM   1701  C  CG  . LEU A  1 230 ? 93.353  58.982  -18.859  1.00 36.54  ? 229 LEU A CG  1 
ATOM   1702  C  CD1 . LEU A  1 230 ? 93.682  60.087  -17.867  1.00 33.44  ? 229 LEU A CD1 1 
ATOM   1703  C  CD2 . LEU A  1 230 ? 94.628  58.446  -19.537  1.00 33.24  ? 229 LEU A CD2 1 
ATOM   1704  N  N   . ALA A  1 231 ? 90.394  55.697  -17.376  1.00 31.40  ? 230 ALA A N   1 
ATOM   1705  C  CA  . ALA A  1 231 ? 90.058  54.603  -16.451  1.00 29.42  ? 230 ALA A CA  1 
ATOM   1706  C  C   . ALA A  1 231 ? 89.696  53.332  -17.195  1.00 28.68  ? 230 ALA A C   1 
ATOM   1707  O  O   . ALA A  1 231 ? 90.141  52.229  -16.849  1.00 30.05  ? 230 ALA A O   1 
ATOM   1708  C  CB  . ALA A  1 231 ? 88.906  55.004  -15.514  1.00 31.11  ? 230 ALA A CB  1 
ATOM   1709  N  N   . ILE A  1 232 ? 88.869  53.485  -18.219  1.00 30.13  ? 231 ILE A N   1 
ATOM   1710  C  CA  . ILE A  1 232 ? 88.375  52.331  -18.942  1.00 29.65  ? 231 ILE A CA  1 
ATOM   1711  C  C   . ILE A  1 232 ? 89.492  51.631  -19.701  1.00 32.42  ? 231 ILE A C   1 
ATOM   1712  O  O   . ILE A  1 232 ? 89.561  50.405  -19.711  1.00 30.19  ? 231 ILE A O   1 
ATOM   1713  C  CB  . ILE A  1 232 ? 87.197  52.722  -19.859  1.00 28.83  ? 231 ILE A CB  1 
ATOM   1714  C  CG1 . ILE A  1 232 ? 86.007  53.138  -18.981  1.00 36.27  ? 231 ILE A CG1 1 
ATOM   1715  C  CG2 . ILE A  1 232 ? 86.828  51.577  -20.797  1.00 33.60  ? 231 ILE A CG2 1 
ATOM   1716  C  CD1 . ILE A  1 232 ? 84.697  53.379  -19.753  1.00 40.49  ? 231 ILE A CD1 1 
ATOM   1717  N  N   . LEU A  1 233 ? 90.383  52.405  -20.319  1.00 27.95  ? 232 LEU A N   1 
ATOM   1718  C  CA  . LEU A  1 233 ? 91.485  51.788  -21.052  1.00 25.36  ? 232 LEU A CA  1 
ATOM   1719  C  C   . LEU A  1 233 ? 92.456  51.132  -20.069  1.00 27.86  ? 232 LEU A C   1 
ATOM   1720  O  O   . LEU A  1 233 ? 92.980  50.038  -20.315  1.00 31.90  ? 232 LEU A O   1 
ATOM   1721  C  CB  . LEU A  1 233 ? 92.208  52.832  -21.919  1.00 26.34  ? 232 LEU A CB  1 
ATOM   1722  C  CG  . LEU A  1 233 ? 93.352  52.265  -22.773  1.00 31.91  ? 232 LEU A CG  1 
ATOM   1723  C  CD1 . LEU A  1 233 ? 92.848  51.113  -23.639  1.00 39.03  ? 232 LEU A CD1 1 
ATOM   1724  C  CD2 . LEU A  1 233 ? 93.973  53.360  -23.648  1.00 28.62  ? 232 LEU A CD2 1 
ATOM   1725  N  N   . TRP A  1 234 ? 92.723  51.820  -18.960  1.00 32.84  ? 233 TRP A N   1 
ATOM   1726  C  CA  . TRP A  1 234 ? 93.613  51.294  -17.917  1.00 34.15  ? 233 TRP A CA  1 
ATOM   1727  C  C   . TRP A  1 234 ? 93.079  49.954  -17.380  1.00 32.17  ? 233 TRP A C   1 
ATOM   1728  O  O   . TRP A  1 234 ? 93.833  49.001  -17.122  1.00 33.37  ? 233 TRP A O   1 
ATOM   1729  C  CB  . TRP A  1 234 ? 93.750  52.329  -16.784  1.00 29.58  ? 233 TRP A CB  1 
ATOM   1730  C  CG  . TRP A  1 234 ? 94.662  51.939  -15.668  1.00 35.37  ? 233 TRP A CG  1 
ATOM   1731  C  CD1 . TRP A  1 234 ? 96.007  52.176  -15.585  1.00 35.60  ? 233 TRP A CD1 1 
ATOM   1732  C  CD2 . TRP A  1 234 ? 94.297  51.278  -14.452  1.00 34.45  ? 233 TRP A CD2 1 
ATOM   1733  N  NE1 . TRP A  1 234 ? 96.502  51.678  -14.405  1.00 37.64  ? 233 TRP A NE1 1 
ATOM   1734  C  CE2 . TRP A  1 234 ? 95.475  51.120  -13.692  1.00 41.34  ? 233 TRP A CE2 1 
ATOM   1735  C  CE3 . TRP A  1 234 ? 93.096  50.783  -13.943  1.00 38.33  ? 233 TRP A CE3 1 
ATOM   1736  C  CZ2 . TRP A  1 234 ? 95.484  50.499  -12.440  1.00 46.48  ? 233 TRP A CZ2 1 
ATOM   1737  C  CZ3 . TRP A  1 234 ? 93.106  50.157  -12.692  1.00 44.69  ? 233 TRP A CZ3 1 
ATOM   1738  C  CH2 . TRP A  1 234 ? 94.290  50.027  -11.960  1.00 42.39  ? 233 TRP A CH2 1 
ATOM   1739  N  N   . ASN A  1 235 ? 91.763  49.881  -17.229  1.00 30.09  ? 234 ASN A N   1 
ATOM   1740  C  CA  . ASN A  1 235 ? 91.128  48.646  -16.768  1.00 28.79  ? 234 ASN A CA  1 
ATOM   1741  C  C   . ASN A  1 235 ? 91.374  47.508  -17.777  1.00 30.77  ? 234 ASN A C   1 
ATOM   1742  O  O   . ASN A  1 235 ? 91.775  46.404  -17.390  1.00 32.39  ? 234 ASN A O   1 
ATOM   1743  C  CB  . ASN A  1 235 ? 89.621  48.867  -16.535  1.00 28.79  ? 234 ASN A CB  1 
ATOM   1744  C  CG  . ASN A  1 235 ? 88.980  47.731  -15.749  1.00 49.10  ? 234 ASN A CG  1 
ATOM   1745  O  OD1 . ASN A  1 235 ? 89.581  47.186  -14.827  1.00 53.39  ? 234 ASN A OD1 1 
ATOM   1746  N  ND2 . ASN A  1 235 ? 87.762  47.371  -16.111  1.00 39.98  ? 234 ASN A ND2 1 
ATOM   1747  N  N   . CYS A  1 236 ? 91.181  47.797  -19.064  1.00 29.77  ? 235 CYS A N   1 
ATOM   1748  C  CA  . CYS A  1 236 ? 91.396  46.805  -20.121  1.00 29.73  ? 235 CYS A CA  1 
ATOM   1749  C  C   . CYS A  1 236 ? 92.814  46.268  -20.116  1.00 33.41  ? 235 CYS A C   1 
ATOM   1750  O  O   . CYS A  1 236 ? 93.044  45.054  -20.217  1.00 30.25  ? 235 CYS A O   1 
ATOM   1751  C  CB  . CYS A  1 236 ? 91.118  47.417  -21.492  1.00 29.71  ? 235 CYS A CB  1 
ATOM   1752  S  SG  . CYS A  1 236 ? 89.352  47.725  -21.738  1.00 35.94  ? 235 CYS A SG  1 
ATOM   1753  N  N   . LEU A  1 237 ? 93.765  47.187  -20.013  1.00 28.09  ? 236 LEU A N   1 
ATOM   1754  C  CA  . LEU A  1 237 ? 95.179  46.825  -20.024  1.00 31.23  ? 236 LEU A CA  1 
ATOM   1755  C  C   . LEU A  1 237 ? 95.566  45.967  -18.830  1.00 28.14  ? 236 LEU A C   1 
ATOM   1756  O  O   . LEU A  1 237 ? 96.531  45.209  -18.886  1.00 33.07  ? 236 LEU A O   1 
ATOM   1757  C  CB  . LEU A  1 237 ? 96.041  48.078  -20.101  1.00 29.27  ? 236 LEU A CB  1 
ATOM   1758  C  CG  . LEU A  1 237 ? 95.969  48.843  -21.424  1.00 39.09  ? 236 LEU A CG  1 
ATOM   1759  C  CD1 . LEU A  1 237 ? 96.742  50.167  -21.346  1.00 38.69  ? 236 LEU A CD1 1 
ATOM   1760  C  CD2 . LEU A  1 237 ? 96.509  47.974  -22.548  1.00 35.24  ? 236 LEU A CD2 1 
ATOM   1761  N  N   . GLY A  1 238 ? 94.808  46.071  -17.745  1.00 32.42  ? 237 GLY A N   1 
ATOM   1762  C  CA  . GLY A  1 238 ? 95.035  45.247  -16.567  1.00 33.42  ? 237 GLY A CA  1 
ATOM   1763  C  C   . GLY A  1 238 ? 94.873  43.767  -16.832  1.00 33.81  ? 237 GLY A C   1 
ATOM   1764  O  O   . GLY A  1 238 ? 95.302  42.938  -16.035  1.00 34.55  ? 237 GLY A O   1 
ATOM   1765  N  N   . GLU A  1 239 ? 94.245  43.428  -17.956  1.00 38.35  ? 238 GLU A N   1 
ATOM   1766  C  CA  . GLU A  1 239 ? 94.135  42.024  -18.340  1.00 33.26  ? 238 GLU A CA  1 
ATOM   1767  C  C   . GLU A  1 239 ? 95.475  41.496  -18.859  1.00 36.19  ? 238 GLU A C   1 
ATOM   1768  O  O   . GLU A  1 239 ? 95.703  40.284  -18.889  1.00 41.53  ? 238 GLU A O   1 
ATOM   1769  C  CB  . GLU A  1 239 ? 93.023  41.815  -19.384  1.00 43.97  ? 238 GLU A CB  1 
ATOM   1770  C  CG  . GLU A  1 239 ? 92.509  40.368  -19.455  1.00 66.72  ? 238 GLU A CG  1 
ATOM   1771  C  CD  . GLU A  1 239 ? 91.340  40.166  -20.426  1.00 70.15  ? 238 GLU A CD  1 
ATOM   1772  O  OE1 . GLU A  1 239 ? 90.911  38.994  -20.608  1.00 45.39  ? 238 GLU A OE1 1 
ATOM   1773  O  OE2 . GLU A  1 239 ? 90.851  41.166  -21.002  1.00 51.60  ? 238 GLU A OE2 1 
ATOM   1774  N  N   . PHE A  1 240 ? 96.362  42.411  -19.253  1.00 32.14  ? 239 PHE A N   1 
ATOM   1775  C  CA  . PHE A  1 240 ? 97.603  42.035  -19.923  1.00 34.53  ? 239 PHE A CA  1 
ATOM   1776  C  C   . PHE A  1 240 ? 98.855  42.261  -19.073  1.00 36.03  ? 239 PHE A C   1 
ATOM   1777  O  O   . PHE A  1 240 ? 99.711  41.390  -18.991  1.00 39.47  ? 239 PHE A O   1 
ATOM   1778  C  CB  . PHE A  1 240 ? 97.739  42.795  -21.249  1.00 35.85  ? 239 PHE A CB  1 
ATOM   1779  C  CG  . PHE A  1 240 ? 96.680  42.446  -22.252  1.00 42.73  ? 239 PHE A CG  1 
ATOM   1780  C  CD1 . PHE A  1 240 ? 95.463  43.099  -22.244  1.00 33.57  ? 239 PHE A CD1 1 
ATOM   1781  C  CD2 . PHE A  1 240 ? 96.899  41.445  -23.189  1.00 33.07  ? 239 PHE A CD2 1 
ATOM   1782  C  CE1 . PHE A  1 240 ? 94.484  42.769  -23.155  1.00 37.82  ? 239 PHE A CE1 1 
ATOM   1783  C  CE2 . PHE A  1 240 ? 95.926  41.112  -24.105  1.00 46.10  ? 239 PHE A CE2 1 
ATOM   1784  C  CZ  . PHE A  1 240 ? 94.718  41.774  -24.091  1.00 38.38  ? 239 PHE A CZ  1 
ATOM   1785  N  N   . SER A  1 241 ? 98.956  43.422  -18.433  1.00 39.61  ? 240 SER A N   1 
ATOM   1786  C  CA  . SER A  1 241 ? 100.239 43.823  -17.855  1.00 40.40  ? 240 SER A CA  1 
ATOM   1787  C  C   . SER A  1 241 ? 100.164 45.082  -17.000  1.00 48.17  ? 240 SER A C   1 
ATOM   1788  O  O   . SER A  1 241 ? 99.703  46.122  -17.465  1.00 38.64  ? 240 SER A O   1 
ATOM   1789  C  CB  . SER A  1 241 ? 101.240 44.079  -18.993  1.00 41.87  ? 240 SER A CB  1 
ATOM   1790  O  OG  . SER A  1 241 ? 102.240 44.993  -18.594  1.00 43.92  ? 240 SER A OG  1 
ATOM   1791  N  N   . PRO A  1 242 ? 100.666 45.004  -15.758  1.00 40.36  ? 241 PRO A N   1 
ATOM   1792  C  CA  . PRO A  1 242 ? 100.760 46.207  -14.931  1.00 38.03  ? 241 PRO A CA  1 
ATOM   1793  C  C   . PRO A  1 242 ? 101.676 47.237  -15.580  1.00 37.49  ? 241 PRO A C   1 
ATOM   1794  O  O   . PRO A  1 242 ? 101.446 48.429  -15.425  1.00 39.94  ? 241 PRO A O   1 
ATOM   1795  C  CB  . PRO A  1 242 ? 101.398 45.698  -13.633  1.00 39.22  ? 241 PRO A CB  1 
ATOM   1796  C  CG  . PRO A  1 242 ? 101.135 44.237  -13.624  1.00 47.77  ? 241 PRO A CG  1 
ATOM   1797  C  CD  . PRO A  1 242 ? 101.186 43.817  -15.059  1.00 44.13  ? 241 PRO A CD  1 
ATOM   1798  N  N   A SER A  1 243 ? 102.706 46.789  -16.294  0.50 33.72  ? 242 SER A N   1 
ATOM   1799  N  N   B SER A  1 243 ? 102.704 46.781  -16.291  0.50 33.60  ? 242 SER A N   1 
ATOM   1800  C  CA  A SER A  1 243 ? 103.593 47.728  -16.984  0.50 38.94  ? 242 SER A CA  1 
ATOM   1801  C  CA  B SER A  1 243 ? 103.605 47.709  -16.972  0.50 38.95  ? 242 SER A CA  1 
ATOM   1802  C  C   A SER A  1 243 ? 102.855 48.514  -18.074  0.50 37.92  ? 242 SER A C   1 
ATOM   1803  C  C   B SER A  1 243 ? 102.903 48.486  -18.099  0.50 35.21  ? 242 SER A C   1 
ATOM   1804  O  O   A SER A  1 243 ? 103.047 49.727  -18.234  0.50 32.09  ? 242 SER A O   1 
ATOM   1805  O  O   B SER A  1 243 ? 103.162 49.676  -18.299  0.50 50.22  ? 242 SER A O   1 
ATOM   1806  C  CB  A SER A  1 243 ? 104.809 47.005  -17.572  0.50 40.45  ? 242 SER A CB  1 
ATOM   1807  C  CB  B SER A  1 243 ? 104.855 46.985  -17.486  0.50 38.74  ? 242 SER A CB  1 
ATOM   1808  O  OG  A SER A  1 243 ? 104.422 45.993  -18.487  0.50 65.55  ? 242 SER A OG  1 
ATOM   1809  O  OG  B SER A  1 243 ? 105.650 46.495  -16.409  0.50 36.13  ? 242 SER A OG  1 
ATOM   1810  N  N   . LEU A  1 244 ? 102.001 47.824  -18.820  1.00 34.06  ? 243 LEU A N   1 
ATOM   1811  C  CA  . LEU A  1 244 ? 101.276 48.478  -19.893  1.00 33.91  ? 243 LEU A CA  1 
ATOM   1812  C  C   . LEU A  1 244 ? 100.303 49.514  -19.319  1.00 39.68  ? 243 LEU A C   1 
ATOM   1813  O  O   . LEU A  1 244 ? 100.085 50.560  -19.925  1.00 34.15  ? 243 LEU A O   1 
ATOM   1814  C  CB  . LEU A  1 244 ? 100.558 47.457  -20.777  1.00 38.23  ? 243 LEU A CB  1 
ATOM   1815  C  CG  . LEU A  1 244 ? 101.469 46.623  -21.687  1.00 33.88  ? 243 LEU A CG  1 
ATOM   1816  C  CD1 . LEU A  1 244 ? 100.659 45.776  -22.653  1.00 41.06  ? 243 LEU A CD1 1 
ATOM   1817  C  CD2 . LEU A  1 244 ? 102.453 47.528  -22.459  1.00 38.11  ? 243 LEU A CD2 1 
ATOM   1818  N  N   . GLN A  1 245 ? 99.735  49.216  -18.151  1.00 33.97  ? 244 GLN A N   1 
ATOM   1819  C  CA  . GLN A  1 245 ? 98.822  50.147  -17.483  1.00 33.79  ? 244 GLN A CA  1 
ATOM   1820  C  C   . GLN A  1 245 ? 99.566  51.416  -17.082  1.00 32.72  ? 244 GLN A C   1 
ATOM   1821  O  O   . GLN A  1 245 ? 99.059  52.526  -17.267  1.00 35.48  ? 244 GLN A O   1 
ATOM   1822  C  CB  . GLN A  1 245 ? 98.218  49.522  -16.217  1.00 35.95  ? 244 GLN A CB  1 
ATOM   1823  C  CG  . GLN A  1 245 ? 97.210  48.385  -16.448  1.00 33.02  ? 244 GLN A CG  1 
ATOM   1824  C  CD  . GLN A  1 245 ? 96.670  47.825  -15.148  1.00 36.26  ? 244 GLN A CD  1 
ATOM   1825  O  OE1 . GLN A  1 245 ? 97.418  47.254  -14.345  1.00 36.87  ? 244 GLN A OE1 1 
ATOM   1826  N  NE2 . GLN A  1 245 ? 95.361  47.997  -14.921  1.00 36.90  ? 244 GLN A NE2 1 
ATOM   1827  N  N   . LYS A  1 246 ? 100.745 51.240  -16.486  1.00 37.44  ? 245 LYS A N   1 
ATOM   1828  C  CA  . LYS A  1 246 ? 101.556 52.377  -16.072  1.00 36.35  ? 245 LYS A CA  1 
ATOM   1829  C  C   . LYS A  1 246 ? 102.021 53.168  -17.303  1.00 48.31  ? 245 LYS A C   1 
ATOM   1830  O  O   . LYS A  1 246 ? 102.047 54.402  -17.292  1.00 41.08  ? 245 LYS A O   1 
ATOM   1831  C  CB  . LYS A  1 246 ? 102.762 51.917  -15.242  1.00 37.11  ? 245 LYS A CB  1 
ATOM   1832  C  CG  . LYS A  1 246 ? 103.595 53.073  -14.719  1.00 45.87  ? 245 LYS A CG  1 
ATOM   1833  C  CD  . LYS A  1 246 ? 104.844 52.603  -13.995  1.00 73.54  ? 245 LYS A CD  1 
ATOM   1834  C  CE  . LYS A  1 246 ? 105.581 53.771  -13.351  1.00 87.12  ? 245 LYS A CE  1 
ATOM   1835  N  NZ  . LYS A  1 246 ? 104.817 54.368  -12.221  1.00 83.51  ? 245 LYS A NZ  1 
ATOM   1836  N  N   . ARG A  1 247 ? 102.366 52.452  -18.369  1.00 39.77  ? 246 ARG A N   1 
ATOM   1837  C  CA  . ARG A  1 247 ? 102.844 53.087  -19.596  1.00 38.40  ? 246 ARG A CA  1 
ATOM   1838  C  C   . ARG A  1 247 ? 101.794 53.997  -20.240  1.00 35.25  ? 246 ARG A C   1 
ATOM   1839  O  O   . ARG A  1 247 ? 102.134 55.022  -20.843  1.00 37.54  ? 246 ARG A O   1 
ATOM   1840  C  CB  . ARG A  1 247 ? 103.321 52.042  -20.609  1.00 41.32  ? 246 ARG A CB  1 
ATOM   1841  C  CG  . ARG A  1 247 ? 103.871 52.646  -21.906  1.00 35.75  ? 246 ARG A CG  1 
ATOM   1842  C  CD  . ARG A  1 247 ? 104.491 51.574  -22.793  1.00 49.07  ? 246 ARG A CD  1 
ATOM   1843  N  NE  . ARG A  1 247 ? 105.304 52.152  -23.860  1.00 50.55  ? 246 ARG A NE  1 
ATOM   1844  C  CZ  . ARG A  1 247 ? 106.628 52.101  -23.902  1.00 46.17  ? 246 ARG A CZ  1 
ATOM   1845  N  NH1 . ARG A  1 247 ? 107.307 51.475  -22.941  1.00 44.89  ? 246 ARG A NH1 1 
ATOM   1846  N  NH2 . ARG A  1 247 ? 107.276 52.659  -24.916  1.00 45.72  ? 246 ARG A NH2 1 
ATOM   1847  N  N   . LEU A  1 248 ? 100.527 53.611  -20.115  1.00 34.25  ? 247 LEU A N   1 
ATOM   1848  C  CA  . LEU A  1 248 ? 99.431  54.410  -20.643  1.00 30.95  ? 247 LEU A CA  1 
ATOM   1849  C  C   . LEU A  1 248 ? 99.438  55.807  -20.033  1.00 32.65  ? 247 LEU A C   1 
ATOM   1850  O  O   . LEU A  1 248 ? 99.412  56.797  -20.753  1.00 34.21  ? 247 LEU A O   1 
ATOM   1851  C  CB  . LEU A  1 248 ? 98.090  53.734  -20.377  1.00 28.27  ? 247 LEU A CB  1 
ATOM   1852  C  CG  . LEU A  1 248 ? 96.905  54.646  -20.694  1.00 30.81  ? 247 LEU A CG  1 
ATOM   1853  C  CD1 . LEU A  1 248 ? 96.891  54.997  -22.179  1.00 36.97  ? 247 LEU A CD1 1 
ATOM   1854  C  CD2 . LEU A  1 248 ? 95.581  53.978  -20.239  1.00 28.67  ? 247 LEU A CD2 1 
ATOM   1855  N  N   . PHE A  1 249 ? 99.475  55.878  -18.706  1.00 39.32  ? 248 PHE A N   1 
ATOM   1856  C  CA  . PHE A  1 249 ? 99.573  57.166  -18.023  1.00 36.81  ? 248 PHE A CA  1 
ATOM   1857  C  C   . PHE A  1 249 ? 100.851 57.931  -18.367  1.00 38.83  ? 248 PHE A C   1 
ATOM   1858  O  O   . PHE A  1 249 ? 100.799 59.132  -18.659  1.00 42.10  ? 248 PHE A O   1 
ATOM   1859  C  CB  . PHE A  1 249 ? 99.459  56.995  -16.512  1.00 34.64  ? 248 PHE A CB  1 
ATOM   1860  C  CG  . PHE A  1 249 ? 98.049  56.868  -16.032  1.00 36.65  ? 248 PHE A CG  1 
ATOM   1861  C  CD1 . PHE A  1 249 ? 97.222  57.973  -15.989  1.00 41.16  ? 248 PHE A CD1 1 
ATOM   1862  C  CD2 . PHE A  1 249 ? 97.548  55.644  -15.620  1.00 45.59  ? 248 PHE A CD2 1 
ATOM   1863  C  CE1 . PHE A  1 249 ? 95.916  57.862  -15.548  1.00 40.28  ? 248 PHE A CE1 1 
ATOM   1864  C  CE2 . PHE A  1 249 ? 96.248  55.530  -15.174  1.00 53.23  ? 248 PHE A CE2 1 
ATOM   1865  C  CZ  . PHE A  1 249 ? 95.429  56.638  -15.147  1.00 37.57  ? 248 PHE A CZ  1 
ATOM   1866  N  N   . GLN A  1 250 ? 101.994 57.243  -18.311  1.00 31.32  ? 249 GLN A N   1 
ATOM   1867  C  CA  . GLN A  1 250 ? 103.269 57.862  -18.640  1.00 34.68  ? 249 GLN A CA  1 
ATOM   1868  C  C   . GLN A  1 250 ? 103.274 58.545  -20.008  1.00 49.19  ? 249 GLN A C   1 
ATOM   1869  O  O   . GLN A  1 250 ? 103.638 59.718  -20.117  1.00 43.52  ? 249 GLN A O   1 
ATOM   1870  C  CB  . GLN A  1 250 ? 104.405 56.840  -18.572  1.00 36.66  ? 249 GLN A CB  1 
ATOM   1871  C  CG  . GLN A  1 250 ? 105.732 57.351  -19.132  1.00 52.18  ? 249 GLN A CG  1 
ATOM   1872  C  CD  . GLN A  1 250 ? 106.357 58.423  -18.269  1.00 74.72  ? 249 GLN A CD  1 
ATOM   1873  O  OE1 . GLN A  1 250 ? 107.125 59.256  -18.754  1.00 80.59  ? 249 GLN A OE1 1 
ATOM   1874  N  NE2 . GLN A  1 250 ? 106.036 58.408  -16.978  1.00 69.33  ? 249 GLN A NE2 1 
ATOM   1875  N  N   . LYS A  1 251 ? 102.874 57.812  -21.044  1.00 38.32  ? 250 LYS A N   1 
ATOM   1876  C  CA  . LYS A  1 251 ? 102.913 58.325  -22.416  1.00 41.00  ? 250 LYS A CA  1 
ATOM   1877  C  C   . LYS A  1 251 ? 101.849 59.394  -22.625  1.00 41.66  ? 250 LYS A C   1 
ATOM   1878  O  O   . LYS A  1 251 ? 102.039 60.322  -23.397  1.00 40.22  ? 250 LYS A O   1 
ATOM   1879  C  CB  . LYS A  1 251 ? 102.740 57.179  -23.427  1.00 31.66  ? 250 LYS A CB  1 
ATOM   1880  C  CG  . LYS A  1 251 ? 103.967 56.231  -23.430  1.00 36.05  ? 250 LYS A CG  1 
ATOM   1881  C  CD  . LYS A  1 251 ? 105.197 56.970  -23.881  1.00 39.86  ? 250 LYS A CD  1 
ATOM   1882  C  CE  . LYS A  1 251 ? 106.422 56.076  -23.870  1.00 49.39  ? 250 LYS A CE  1 
ATOM   1883  N  NZ  . LYS A  1 251 ? 107.518 56.713  -24.652  1.00 63.37  ? 250 LYS A NZ  1 
ATOM   1884  N  N   . TYR A  1 252 ? 100.732 59.259  -21.922  1.00 31.86  ? 251 TYR A N   1 
ATOM   1885  C  CA  . TYR A  1 252 ? 99.638  60.237  -22.023  1.00 33.46  ? 251 TYR A CA  1 
ATOM   1886  C  C   . TYR A  1 252 ? 100.094 61.582  -21.443  1.00 40.34  ? 251 TYR A C   1 
ATOM   1887  O  O   . TYR A  1 252 ? 99.649  62.647  -21.872  1.00 39.29  ? 251 TYR A O   1 
ATOM   1888  C  CB  . TYR A  1 252 ? 98.403  59.722  -21.276  1.00 31.21  ? 251 TYR A CB  1 
ATOM   1889  C  CG  . TYR A  1 252 ? 97.255  60.699  -21.244  1.00 30.60  ? 251 TYR A CG  1 
ATOM   1890  C  CD1 . TYR A  1 252 ? 96.342  60.764  -22.289  1.00 36.51  ? 251 TYR A CD1 1 
ATOM   1891  C  CD2 . TYR A  1 252 ? 97.078  61.547  -20.161  1.00 33.65  ? 251 TYR A CD2 1 
ATOM   1892  C  CE1 . TYR A  1 252 ? 95.271  61.646  -22.251  1.00 36.67  ? 251 TYR A CE1 1 
ATOM   1893  C  CE2 . TYR A  1 252 ? 96.025  62.433  -20.117  1.00 36.60  ? 251 TYR A CE2 1 
ATOM   1894  C  CZ  . TYR A  1 252 ? 95.126  62.477  -21.161  1.00 42.20  ? 251 TYR A CZ  1 
ATOM   1895  O  OH  . TYR A  1 252 ? 94.084  63.362  -21.099  1.00 30.53  ? 251 TYR A OH  1 
ATOM   1896  N  N   . GLY A  1 253 ? 100.980 61.519  -20.452  1.00 36.38  ? 252 GLY A N   1 
ATOM   1897  C  CA  . GLY A  1 253 ? 101.581 62.711  -19.875  1.00 41.66  ? 252 GLY A CA  1 
ATOM   1898  C  C   . GLY A  1 253 ? 101.295 62.894  -18.396  1.00 49.94  ? 252 GLY A C   1 
ATOM   1899  O  O   . GLY A  1 253 ? 101.512 63.975  -17.842  1.00 42.15  ? 252 GLY A O   1 
ATOM   1900  N  N   . ILE A  1 254 ? 100.812 61.839  -17.748  1.00 36.31  ? 253 ILE A N   1 
ATOM   1901  C  CA  . ILE A  1 254 ? 100.513 61.885  -16.317  1.00 36.96  ? 253 ILE A CA  1 
ATOM   1902  C  C   . ILE A  1 254 ? 101.472 61.014  -15.518  1.00 40.99  ? 253 ILE A C   1 
ATOM   1903  O  O   . ILE A  1 254 ? 101.483 59.797  -15.670  1.00 46.04  ? 253 ILE A O   1 
ATOM   1904  C  CB  . ILE A  1 254 ? 99.080  61.413  -16.031  1.00 40.22  ? 253 ILE A CB  1 
ATOM   1905  C  CG1 . ILE A  1 254 ? 98.074  62.437  -16.553  1.00 36.78  ? 253 ILE A CG1 1 
ATOM   1906  C  CG2 . ILE A  1 254 ? 98.882  61.213  -14.537  1.00 43.23  ? 253 ILE A CG2 1 
ATOM   1907  C  CD1 . ILE A  1 254 ? 96.612  61.977  -16.468  1.00 34.38  ? 253 ILE A CD1 1 
ATOM   1908  N  N   . ASP A  1 255 ? 102.274 61.640  -14.665  1.00 46.24  ? 254 ASP A N   1 
ATOM   1909  C  CA  . ASP A  1 255 ? 103.256 60.912  -13.865  1.00 53.28  ? 254 ASP A CA  1 
ATOM   1910  C  C   . ASP A  1 255 ? 102.729 60.420  -12.523  1.00 65.12  ? 254 ASP A C   1 
ATOM   1911  O  O   . ASP A  1 255 ? 103.234 59.440  -11.985  1.00 50.53  ? 254 ASP A O   1 
ATOM   1912  C  CB  . ASP A  1 255 ? 104.503 61.757  -13.642  1.00 73.78  ? 254 ASP A CB  1 
ATOM   1913  C  CG  . ASP A  1 255 ? 105.382 61.811  -14.862  1.00 64.34  ? 254 ASP A CG  1 
ATOM   1914  O  OD1 . ASP A  1 255 ? 105.427 60.806  -15.606  1.00 69.16  ? 254 ASP A OD1 1 
ATOM   1915  O  OD2 . ASP A  1 255 ? 106.019 62.859  -15.075  1.00 61.68  ? 254 ASP A OD2 1 
ATOM   1916  N  N   . ASN A  1 256 ? 101.736 61.105  -11.970  1.00 47.17  ? 255 ASN A N   1 
ATOM   1917  C  CA  . ASN A  1 256 ? 101.127 60.644  -10.724  1.00 50.15  ? 255 ASN A CA  1 
ATOM   1918  C  C   . ASN A  1 256 ? 99.624  60.491  -10.878  1.00 35.23  ? 255 ASN A C   1 
ATOM   1919  O  O   . ASN A  1 256 ? 98.874  61.427  -10.604  1.00 48.42  ? 255 ASN A O   1 
ATOM   1920  C  CB  . ASN A  1 256 ? 101.464 61.575  -9.560   1.00 48.56  ? 255 ASN A CB  1 
ATOM   1921  C  CG  . ASN A  1 256 ? 102.927 61.487  -9.149   1.00 80.63  ? 255 ASN A CG  1 
ATOM   1922  O  OD1 . ASN A  1 256 ? 103.320 60.607  -8.379   1.00 66.05  ? 255 ASN A OD1 1 
ATOM   1923  N  ND2 . ASN A  1 256 ? 103.740 62.401  -9.663   1.00 61.09  ? 255 ASN A ND2 1 
ATOM   1924  N  N   . PRO A  1 257 ? 99.186  59.314  -11.350  1.00 46.09  ? 256 PRO A N   1 
ATOM   1925  C  CA  . PRO A  1 257 ? 97.757  59.042  -11.553  1.00 45.97  ? 256 PRO A CA  1 
ATOM   1926  C  C   . PRO A  1 257 ? 96.943  59.377  -10.301  1.00 41.69  ? 256 PRO A C   1 
ATOM   1927  O  O   . PRO A  1 257 ? 97.401  59.139  -9.187   1.00 42.39  ? 256 PRO A O   1 
ATOM   1928  C  CB  . PRO A  1 257 ? 97.726  57.539  -11.842  1.00 41.91  ? 256 PRO A CB  1 
ATOM   1929  C  CG  . PRO A  1 257 ? 99.085  57.243  -12.438  1.00 50.38  ? 256 PRO A CG  1 
ATOM   1930  C  CD  . PRO A  1 257 ? 100.032 58.155  -11.701  1.00 42.68  ? 256 PRO A CD  1 
ATOM   1931  N  N   . ASP A  1 258 ? 95.770  59.966  -10.501  1.00 37.38  ? 257 ASP A N   1 
ATOM   1932  C  CA  . ASP A  1 258 ? 94.881  60.356  -9.418   1.00 39.39  ? 257 ASP A CA  1 
ATOM   1933  C  C   . ASP A  1 258 ? 94.035  59.126  -9.119   1.00 47.17  ? 257 ASP A C   1 
ATOM   1934  O  O   . ASP A  1 258 ? 93.068  58.851  -9.819   1.00 38.49  ? 257 ASP A O   1 
ATOM   1935  C  CB  . ASP A  1 258 ? 94.001  61.521  -9.882   1.00 41.44  ? 257 ASP A CB  1 
ATOM   1936  C  CG  . ASP A  1 258 ? 93.064  62.046  -8.794   1.00 45.86  ? 257 ASP A CG  1 
ATOM   1937  O  OD1 . ASP A  1 258 ? 92.638  61.279  -7.906   1.00 40.98  ? 257 ASP A OD1 1 
ATOM   1938  O  OD2 . ASP A  1 258 ? 92.747  63.253  -8.833   1.00 53.23  ? 257 ASP A OD2 1 
HETATM 1939  N  N   . MSE A  1 259 ? 94.411  58.387  -8.081   1.00 42.37  ? 258 MSE A N   1 
HETATM 1940  C  CA  . MSE A  1 259 ? 93.776  57.110  -7.785   1.00 38.75  ? 258 MSE A CA  1 
HETATM 1941  C  C   . MSE A  1 259 ? 92.281  57.264  -7.460   1.00 35.22  ? 258 MSE A C   1 
HETATM 1942  O  O   . MSE A  1 259 ? 91.476  56.397  -7.799   1.00 40.63  ? 258 MSE A O   1 
HETATM 1943  C  CB  . MSE A  1 259 ? 94.510  56.403  -6.645   1.00 45.29  ? 258 MSE A CB  1 
HETATM 1944  C  CG  . MSE A  1 259 ? 95.971  56.080  -6.953   1.00 46.34  ? 258 MSE A CG  1 
HETATM 1945  SE SE  . MSE A  1 259 ? 96.167  55.213  -8.674   0.62 53.75  ? 258 MSE A SE  1 
HETATM 1946  C  CE  . MSE A  1 259 ? 95.285  53.525  -8.282   1.00 42.74  ? 258 MSE A CE  1 
ATOM   1947  N  N   . ASN A  1 260 ? 91.918  58.368  -6.809   1.00 36.97  ? 259 ASN A N   1 
ATOM   1948  C  CA  . ASN A  1 260 ? 90.517  58.638  -6.504   1.00 46.04  ? 259 ASN A CA  1 
ATOM   1949  C  C   . ASN A  1 260 ? 89.672  58.802  -7.762   1.00 56.50  ? 259 ASN A C   1 
ATOM   1950  O  O   . ASN A  1 260 ? 88.565  58.263  -7.852   1.00 36.71  ? 259 ASN A O   1 
ATOM   1951  C  CB  . ASN A  1 260 ? 90.379  59.870  -5.613   1.00 53.86  ? 259 ASN A CB  1 
ATOM   1952  C  CG  . ASN A  1 260 ? 88.940  60.152  -5.229   1.00 43.93  ? 259 ASN A CG  1 
ATOM   1953  O  OD1 . ASN A  1 260 ? 88.358  59.446  -4.403   1.00 52.79  ? 259 ASN A OD1 1 
ATOM   1954  N  ND2 . ASN A  1 260 ? 88.357  61.189  -5.824   1.00 50.38  ? 259 ASN A ND2 1 
ATOM   1955  N  N   . LYS A  1 261 ? 90.187  59.543  -8.739   1.00 37.20  ? 260 LYS A N   1 
ATOM   1956  C  CA  . LYS A  1 261 ? 89.444  59.735  -9.975   1.00 35.29  ? 260 LYS A CA  1 
ATOM   1957  C  C   . LYS A  1 261 ? 89.436  58.457  -10.794  1.00 38.11  ? 260 LYS A C   1 
ATOM   1958  O  O   . LYS A  1 261 ? 88.455  58.140  -11.461  1.00 33.13  ? 260 LYS A O   1 
ATOM   1959  C  CB  . LYS A  1 261 ? 90.007  60.903  -10.803  1.00 34.72  ? 260 LYS A CB  1 
ATOM   1960  C  CG  . LYS A  1 261 ? 89.740  62.269  -10.188  1.00 39.29  ? 260 LYS A CG  1 
ATOM   1961  C  CD  . LYS A  1 261 ? 89.589  63.353  -11.262  1.00 41.83  ? 260 LYS A CD  1 
ATOM   1962  C  CE  . LYS A  1 261 ? 90.889  63.769  -11.871  1.00 60.22  ? 260 LYS A CE  1 
ATOM   1963  N  NZ  . LYS A  1 261 ? 90.700  65.041  -12.617  1.00 54.87  ? 260 LYS A NZ  1 
ATOM   1964  N  N   . LEU A  1 262 ? 90.529  57.707  -10.724  1.00 36.92  ? 261 LEU A N   1 
ATOM   1965  C  CA  . LEU A  1 262 ? 90.583  56.429  -11.418  1.00 27.70  ? 261 LEU A CA  1 
ATOM   1966  C  C   . LEU A  1 262 ? 89.485  55.498  -10.868  1.00 33.31  ? 261 LEU A C   1 
ATOM   1967  O  O   . LEU A  1 262 ? 88.672  54.938  -11.621  1.00 33.94  ? 261 LEU A O   1 
ATOM   1968  C  CB  . LEU A  1 262 ? 91.967  55.797  -11.212  1.00 34.36  ? 261 LEU A CB  1 
ATOM   1969  C  CG  . LEU A  1 262 ? 92.291  54.480  -11.919  1.00 43.41  ? 261 LEU A CG  1 
ATOM   1970  C  CD1 . LEU A  1 262 ? 92.024  54.591  -13.391  1.00 35.20  ? 261 LEU A CD1 1 
ATOM   1971  C  CD2 . LEU A  1 262 ? 93.754  54.091  -11.672  1.00 51.61  ? 261 LEU A CD2 1 
ATOM   1972  N  N   . GLN A  1 263 ? 89.457  55.365  -9.552   1.00 36.38  ? 262 GLN A N   1 
ATOM   1973  C  CA  . GLN A  1 263 ? 88.526  54.455  -8.894   1.00 30.40  ? 262 GLN A CA  1 
ATOM   1974  C  C   . GLN A  1 263 ? 87.092  54.898  -9.145   1.00 33.76  ? 262 GLN A C   1 
ATOM   1975  O  O   . GLN A  1 263 ? 86.219  54.076  -9.460   1.00 36.82  ? 262 GLN A O   1 
ATOM   1976  C  CB  . GLN A  1 263 ? 88.810  54.421  -7.394   1.00 39.72  ? 262 GLN A CB  1 
ATOM   1977  C  CG  . GLN A  1 263 ? 87.840  53.573  -6.604   1.00 53.41  ? 262 GLN A CG  1 
ATOM   1978  C  CD  . GLN A  1 263 ? 88.197  52.101  -6.621   1.00 83.35  ? 262 GLN A CD  1 
ATOM   1979  O  OE1 . GLN A  1 263 ? 88.779  51.595  -7.584   1.00 61.67  ? 262 GLN A OE1 1 
ATOM   1980  N  NE2 . GLN A  1 263 ? 87.856  51.403  -5.541   1.00 90.27  ? 262 GLN A NE2 1 
ATOM   1981  N  N   . PHE A  1 264 ? 86.841  56.197  -9.020   1.00 29.39  ? 263 PHE A N   1 
ATOM   1982  C  CA  . PHE A  1 264 ? 85.506  56.691  -9.318   1.00 29.71  ? 263 PHE A CA  1 
ATOM   1983  C  C   . PHE A  1 264 ? 85.005  56.271  -10.701  1.00 38.32  ? 263 PHE A C   1 
ATOM   1984  O  O   . PHE A  1 264 ? 83.887  55.775  -10.837  1.00 30.32  ? 263 PHE A O   1 
ATOM   1985  C  CB  . PHE A  1 264 ? 85.361  58.210  -9.140   1.00 32.58  ? 263 PHE A CB  1 
ATOM   1986  C  CG  . PHE A  1 264 ? 84.019  58.717  -9.596   1.00 29.13  ? 263 PHE A CG  1 
ATOM   1987  C  CD1 . PHE A  1 264 ? 82.920  58.637  -8.753   1.00 35.03  ? 263 PHE A CD1 1 
ATOM   1988  C  CD2 . PHE A  1 264 ? 83.845  59.201  -10.894  1.00 33.36  ? 263 PHE A CD2 1 
ATOM   1989  C  CE1 . PHE A  1 264 ? 81.669  59.083  -9.172   1.00 30.37  ? 263 PHE A CE1 1 
ATOM   1990  C  CE2 . PHE A  1 264 ? 82.592  59.629  -11.324  1.00 38.45  ? 263 PHE A CE2 1 
ATOM   1991  C  CZ  . PHE A  1 264 ? 81.507  59.568  -10.456  1.00 34.47  ? 263 PHE A CZ  1 
ATOM   1992  N  N   . HIS A  1 265 ? 85.818  56.463  -11.731  1.00 32.36  ? 264 HIS A N   1 
ATOM   1993  C  CA  . HIS A  1 265 ? 85.362  56.185  -13.080  1.00 26.93  ? 264 HIS A CA  1 
ATOM   1994  C  C   . HIS A  1 265 ? 85.225  54.699  -13.385  1.00 29.44  ? 264 HIS A C   1 
ATOM   1995  O  O   . HIS A  1 265 ? 84.352  54.299  -14.161  1.00 33.46  ? 264 HIS A O   1 
ATOM   1996  C  CB  . HIS A  1 265 ? 86.231  56.911  -14.122  1.00 32.95  ? 264 HIS A CB  1 
ATOM   1997  C  CG  . HIS A  1 265 ? 86.005  58.392  -14.148  1.00 29.97  ? 264 HIS A CG  1 
ATOM   1998  N  ND1 . HIS A  1 265 ? 86.730  59.270  -13.366  1.00 28.95  ? 264 HIS A ND1 1 
ATOM   1999  C  CD2 . HIS A  1 265 ? 85.089  59.142  -14.807  1.00 36.49  ? 264 HIS A CD2 1 
ATOM   2000  C  CE1 . HIS A  1 265 ? 86.292  60.501  -13.572  1.00 38.03  ? 264 HIS A CE1 1 
ATOM   2001  N  NE2 . HIS A  1 265 ? 85.297  60.451  -14.442  1.00 35.97  ? 264 HIS A NE2 1 
ATOM   2002  N  N   . LEU A  1 266 ? 86.071  53.885  -12.758  1.00 33.41  ? 265 LEU A N   1 
ATOM   2003  C  CA  . LEU A  1 266 ? 85.943  52.428  -12.838  1.00 28.12  ? 265 LEU A CA  1 
ATOM   2004  C  C   . LEU A  1 266 ? 84.617  51.993  -12.218  1.00 32.53  ? 265 LEU A C   1 
ATOM   2005  O  O   . LEU A  1 266 ? 83.894  51.157  -12.761  1.00 33.53  ? 265 LEU A O   1 
ATOM   2006  C  CB  . LEU A  1 266 ? 87.084  51.763  -12.077  1.00 26.46  ? 265 LEU A CB  1 
ATOM   2007  C  CG  . LEU A  1 266 ? 88.454  51.893  -12.743  1.00 41.90  ? 265 LEU A CG  1 
ATOM   2008  C  CD1 . LEU A  1 266 ? 89.548  51.378  -11.821  1.00 41.87  ? 265 LEU A CD1 1 
ATOM   2009  C  CD2 . LEU A  1 266 ? 88.432  51.128  -14.043  1.00 45.19  ? 265 LEU A CD2 1 
HETATM 2010  N  N   . MSE A  1 267 ? 84.307  52.557  -11.064  1.00 29.81  ? 266 MSE A N   1 
HETATM 2011  C  CA  . MSE A  1 267 ? 83.070  52.191  -10.399  1.00 31.21  ? 266 MSE A CA  1 
HETATM 2012  C  C   . MSE A  1 267 ? 81.861  52.662  -11.215  1.00 31.35  ? 266 MSE A C   1 
HETATM 2013  O  O   . MSE A  1 267 ? 80.867  51.948  -11.345  1.00 32.19  ? 266 MSE A O   1 
HETATM 2014  C  CB  . MSE A  1 267 ? 83.053  52.731  -8.970   1.00 30.69  ? 266 MSE A CB  1 
HETATM 2015  C  CG  . MSE A  1 267 ? 84.086  52.063  -8.058   1.00 30.86  ? 266 MSE A CG  1 
HETATM 2016  SE SE  . MSE A  1 267 ? 83.970  52.692  -6.249   0.64 37.74  ? 266 MSE A SE  1 
HETATM 2017  C  CE  . MSE A  1 267 ? 82.602  51.477  -5.632   1.00 36.75  ? 266 MSE A CE  1 
ATOM   2018  N  N   . LEU A  1 268 ? 81.959  53.840  -11.812  1.00 30.75  ? 267 LEU A N   1 
ATOM   2019  C  CA  . LEU A  1 268 ? 80.829  54.350  -12.598  1.00 28.82  ? 267 LEU A CA  1 
ATOM   2020  C  C   . LEU A  1 268 ? 80.549  53.457  -13.797  1.00 35.09  ? 267 LEU A C   1 
ATOM   2021  O  O   . LEU A  1 268 ? 79.392  53.209  -14.149  1.00 29.94  ? 267 LEU A O   1 
ATOM   2022  C  CB  . LEU A  1 268 ? 81.081  55.792  -13.042  1.00 26.90  ? 267 LEU A CB  1 
ATOM   2023  C  CG  . LEU A  1 268 ? 79.977  56.527  -13.816  1.00 32.09  ? 267 LEU A CG  1 
ATOM   2024  C  CD1 . LEU A  1 268 ? 78.726  56.685  -12.960  1.00 33.18  ? 267 LEU A CD1 1 
ATOM   2025  C  CD2 . LEU A  1 268 ? 80.494  57.889  -14.255  1.00 32.23  ? 267 LEU A CD2 1 
ATOM   2026  N  N   . ASP A  1 269 ? 81.605  52.931  -14.402  1.00 27.58  ? 268 ASP A N   1 
ATOM   2027  C  CA  . ASP A  1 269 ? 81.423  52.090  -15.585  1.00 30.97  ? 268 ASP A CA  1 
ATOM   2028  C  C   . ASP A  1 269 ? 80.759  50.749  -15.268  1.00 30.27  ? 268 ASP A C   1 
ATOM   2029  O  O   . ASP A  1 269 ? 80.236  50.098  -16.179  1.00 30.51  ? 268 ASP A O   1 
ATOM   2030  C  CB  . ASP A  1 269 ? 82.739  51.894  -16.368  1.00 32.05  ? 268 ASP A CB  1 
ATOM   2031  C  CG  . ASP A  1 269 ? 82.505  51.491  -17.828  1.00 39.53  ? 268 ASP A CG  1 
ATOM   2032  O  OD1 . ASP A  1 269 ? 81.672  52.121  -18.503  1.00 33.06  ? 268 ASP A OD1 1 
ATOM   2033  O  OD2 . ASP A  1 269 ? 83.161  50.546  -18.319  1.00 33.52  ? 268 ASP A OD2 1 
ATOM   2034  N  N   . GLU A  1 270 ? 80.753  50.348  -13.996  1.00 29.41  ? 269 GLU A N   1 
ATOM   2035  C  CA  . GLU A  1 270 ? 80.039  49.120  -13.581  1.00 28.97  ? 269 GLU A CA  1 
ATOM   2036  C  C   . GLU A  1 270 ? 78.551  49.192  -13.918  1.00 31.92  ? 269 GLU A C   1 
ATOM   2037  O  O   . GLU A  1 270 ? 77.877  48.166  -14.102  1.00 32.68  ? 269 GLU A O   1 
ATOM   2038  C  CB  . GLU A  1 270 ? 80.203  48.845  -12.082  1.00 32.93  ? 269 GLU A CB  1 
ATOM   2039  C  CG  . GLU A  1 270 ? 81.641  48.657  -11.582  1.00 40.87  ? 269 GLU A CG  1 
ATOM   2040  C  CD  . GLU A  1 270 ? 82.303  47.368  -12.066  1.00 38.43  ? 269 GLU A CD  1 
ATOM   2041  O  OE1 . GLU A  1 270 ? 82.063  46.947  -13.218  1.00 35.17  ? 269 GLU A OE1 1 
ATOM   2042  O  OE2 . GLU A  1 270 ? 83.090  46.777  -11.289  1.00 38.82  ? 269 GLU A OE2 1 
ATOM   2043  N  N   . PHE A  1 271 ? 78.043  50.411  -14.004  1.00 29.70  ? 270 PHE A N   1 
ATOM   2044  C  CA  . PHE A  1 271 ? 76.602  50.638  -14.183  1.00 27.48  ? 270 PHE A CA  1 
ATOM   2045  C  C   . PHE A  1 271 ? 76.120  50.611  -15.636  1.00 32.02  ? 270 PHE A C   1 
ATOM   2046  O  O   . PHE A  1 271 ? 74.902  50.663  -15.901  1.00 33.80  ? 270 PHE A O   1 
ATOM   2047  C  CB  . PHE A  1 271 ? 76.208  51.970  -13.515  1.00 31.61  ? 270 PHE A CB  1 
ATOM   2048  C  CG  . PHE A  1 271 ? 76.288  51.927  -12.014  1.00 31.64  ? 270 PHE A CG  1 
ATOM   2049  C  CD1 . PHE A  1 271 ? 77.489  52.204  -11.355  1.00 32.80  ? 270 PHE A CD1 1 
ATOM   2050  C  CD2 . PHE A  1 271 ? 75.180  51.561  -11.260  1.00 32.94  ? 270 PHE A CD2 1 
ATOM   2051  C  CE1 . PHE A  1 271 ? 77.571  52.137  -9.974   1.00 35.50  ? 270 PHE A CE1 1 
ATOM   2052  C  CE2 . PHE A  1 271 ? 75.248  51.493  -9.874   1.00 35.73  ? 270 PHE A CE2 1 
ATOM   2053  C  CZ  . PHE A  1 271 ? 76.448  51.784  -9.224   1.00 32.66  ? 270 PHE A CZ  1 
ATOM   2054  N  N   . PHE A  1 272 ? 77.061  50.515  -16.573  1.00 31.29  ? 271 PHE A N   1 
ATOM   2055  C  CA  . PHE A  1 272 ? 76.748  50.671  -17.987  1.00 34.76  ? 271 PHE A CA  1 
ATOM   2056  C  C   . PHE A  1 272 ? 77.050  49.422  -18.803  1.00 44.67  ? 271 PHE A C   1 
ATOM   2057  O  O   . PHE A  1 272 ? 76.791  49.386  -20.008  1.00 60.54  ? 271 PHE A O   1 
ATOM   2058  C  CB  . PHE A  1 272 ? 77.445  51.917  -18.548  1.00 31.46  ? 271 PHE A CB  1 
ATOM   2059  C  CG  . PHE A  1 272 ? 76.945  53.187  -17.914  1.00 32.88  ? 271 PHE A CG  1 
ATOM   2060  C  CD1 . PHE A  1 272 ? 75.801  53.819  -18.405  1.00 34.68  ? 271 PHE A CD1 1 
ATOM   2061  C  CD2 . PHE A  1 272 ? 77.562  53.710  -16.792  1.00 27.23  ? 271 PHE A CD2 1 
ATOM   2062  C  CE1 . PHE A  1 272 ? 75.318  54.974  -17.815  1.00 36.11  ? 271 PHE A CE1 1 
ATOM   2063  C  CE2 . PHE A  1 272 ? 77.074  54.872  -16.180  1.00 28.43  ? 271 PHE A CE2 1 
ATOM   2064  C  CZ  . PHE A  1 272 ? 75.950  55.506  -16.702  1.00 36.99  ? 271 PHE A CZ  1 
ATOM   2065  O  OXT . PHE A  1 272 ? 77.530  48.428  -18.258  1.00 52.53  ? 271 PHE A OXT 1 
HETATM 2066  N  N   . MSE B  1 2   ? 81.322  37.268  -19.910  1.00 111.18 ? 1   MSE B N   1 
HETATM 2067  C  CA  . MSE B  1 2   ? 82.653  37.253  -20.508  1.00 118.50 ? 1   MSE B CA  1 
HETATM 2068  C  C   . MSE B  1 2   ? 82.972  38.590  -21.179  1.00 104.66 ? 1   MSE B C   1 
HETATM 2069  O  O   . MSE B  1 2   ? 82.127  39.486  -21.228  1.00 98.69  ? 1   MSE B O   1 
HETATM 2070  C  CB  . MSE B  1 2   ? 82.770  36.120  -21.526  1.00 94.27  ? 1   MSE B CB  1 
HETATM 2071  C  CG  . MSE B  1 2   ? 84.148  35.494  -21.582  1.00 109.20 ? 1   MSE B CG  1 
HETATM 2072  SE SE  . MSE B  1 2   ? 84.401  34.419  -23.177  0.50 119.31 ? 1   MSE B SE  1 
HETATM 2073  C  CE  . MSE B  1 2   ? 86.222  33.811  -22.824  1.00 96.70  ? 1   MSE B CE  1 
ATOM   2074  N  N   . SER B  1 3   ? 84.191  38.722  -21.695  1.00 102.67 ? 2   SER B N   1 
ATOM   2075  C  CA  . SER B  1 3   ? 84.616  39.972  -22.328  1.00 74.75  ? 2   SER B CA  1 
ATOM   2076  C  C   . SER B  1 3   ? 85.091  39.763  -23.768  1.00 69.38  ? 2   SER B C   1 
ATOM   2077  O  O   . SER B  1 3   ? 85.462  38.641  -24.163  1.00 65.95  ? 2   SER B O   1 
ATOM   2078  C  CB  . SER B  1 3   ? 85.734  40.633  -21.511  1.00 96.85  ? 2   SER B CB  1 
ATOM   2079  O  OG  . SER B  1 3   ? 85.354  40.832  -20.161  1.00 91.65  ? 2   SER B OG  1 
ATOM   2080  N  N   . HIS B  1 4   ? 85.076  40.851  -24.537  1.00 72.58  ? 3   HIS B N   1 
ATOM   2081  C  CA  . HIS B  1 4   ? 85.612  40.873  -25.899  1.00 90.89  ? 3   HIS B CA  1 
ATOM   2082  C  C   . HIS B  1 4   ? 84.905  39.876  -26.813  1.00 98.73  ? 3   HIS B C   1 
ATOM   2083  O  O   . HIS B  1 4   ? 85.493  39.364  -27.773  1.00 72.44  ? 3   HIS B O   1 
ATOM   2084  C  CB  . HIS B  1 4   ? 87.125  40.630  -25.875  1.00 64.67  ? 3   HIS B CB  1 
ATOM   2085  C  CG  . HIS B  1 4   ? 87.826  41.383  -24.789  1.00 59.15  ? 3   HIS B CG  1 
ATOM   2086  N  ND1 . HIS B  1 4   ? 87.971  42.756  -24.809  1.00 53.95  ? 3   HIS B ND1 1 
ATOM   2087  C  CD2 . HIS B  1 4   ? 88.389  40.960  -23.630  1.00 69.69  ? 3   HIS B CD2 1 
ATOM   2088  C  CE1 . HIS B  1 4   ? 88.612  43.141  -23.719  1.00 71.31  ? 3   HIS B CE1 1 
ATOM   2089  N  NE2 . HIS B  1 4   ? 88.879  42.071  -22.990  1.00 79.68  ? 3   HIS B NE2 1 
ATOM   2090  N  N   . ILE B  1 5   ? 83.639  39.611  -26.500  1.00 83.95  ? 4   ILE B N   1 
ATOM   2091  C  CA  . ILE B  1 5   ? 82.810  38.703  -27.285  1.00 87.70  ? 4   ILE B CA  1 
ATOM   2092  C  C   . ILE B  1 5   ? 82.671  39.230  -28.712  1.00 69.87  ? 4   ILE B C   1 
ATOM   2093  O  O   . ILE B  1 5   ? 82.508  40.434  -28.933  1.00 57.73  ? 4   ILE B O   1 
ATOM   2094  C  CB  . ILE B  1 5   ? 81.420  38.496  -26.624  1.00 91.15  ? 4   ILE B CB  1 
ATOM   2095  C  CG1 . ILE B  1 5   ? 81.536  37.536  -25.436  1.00 84.23  ? 4   ILE B CG1 1 
ATOM   2096  C  CG2 . ILE B  1 5   ? 80.394  37.970  -27.622  1.00 72.39  ? 4   ILE B CG2 1 
ATOM   2097  C  CD1 . ILE B  1 5   ? 80.238  37.349  -24.677  1.00 87.17  ? 4   ILE B CD1 1 
ATOM   2098  N  N   . GLN B  1 6   ? 82.761  38.318  -29.672  1.00 54.67  ? 5   GLN B N   1 
ATOM   2099  C  CA  . GLN B  1 6   ? 82.707  38.661  -31.083  1.00 58.39  ? 5   GLN B CA  1 
ATOM   2100  C  C   . GLN B  1 6   ? 82.137  37.456  -31.832  1.00 95.70  ? 5   GLN B C   1 
ATOM   2101  O  O   . GLN B  1 6   ? 82.872  36.689  -32.462  1.00 80.45  ? 5   GLN B O   1 
ATOM   2102  C  CB  . GLN B  1 6   ? 84.114  38.995  -31.573  1.00 61.36  ? 5   GLN B CB  1 
ATOM   2103  C  CG  . GLN B  1 6   ? 84.190  39.586  -32.959  1.00 84.62  ? 5   GLN B CG  1 
ATOM   2104  C  CD  . GLN B  1 6   ? 85.622  39.798  -33.404  1.00 93.99  ? 5   GLN B CD  1 
ATOM   2105  O  OE1 . GLN B  1 6   ? 86.392  40.500  -32.745  1.00 90.42  ? 5   GLN B OE1 1 
ATOM   2106  N  NE2 . GLN B  1 6   ? 85.992  39.178  -34.522  1.00 73.76  ? 5   GLN B NE2 1 
ATOM   2107  N  N   . ARG B  1 7   ? 80.822  37.284  -31.737  1.00 48.87  ? 6   ARG B N   1 
ATOM   2108  C  CA  . ARG B  1 7   ? 80.153  36.106  -32.279  1.00 55.42  ? 6   ARG B CA  1 
ATOM   2109  C  C   . ARG B  1 7   ? 79.257  36.493  -33.451  1.00 41.23  ? 6   ARG B C   1 
ATOM   2110  O  O   . ARG B  1 7   ? 78.395  37.364  -33.323  1.00 45.02  ? 6   ARG B O   1 
ATOM   2111  C  CB  . ARG B  1 7   ? 79.325  35.415  -31.191  1.00 59.23  ? 6   ARG B CB  1 
ATOM   2112  C  CG  . ARG B  1 7   ? 80.116  35.054  -29.942  1.00 61.99  ? 6   ARG B CG  1 
ATOM   2113  C  CD  . ARG B  1 7   ? 79.361  34.063  -29.067  1.00 64.47  ? 6   ARG B CD  1 
ATOM   2114  N  NE  . ARG B  1 7   ? 80.136  33.689  -27.888  1.00 97.03  ? 6   ARG B NE  1 
ATOM   2115  C  CZ  . ARG B  1 7   ? 79.803  34.002  -26.640  1.00 73.79  ? 6   ARG B CZ  1 
ATOM   2116  N  NH1 . ARG B  1 7   ? 78.691  34.685  -26.392  1.00 78.70  ? 6   ARG B NH1 1 
ATOM   2117  N  NH2 . ARG B  1 7   ? 80.580  33.618  -25.633  1.00 90.44  ? 6   ARG B NH2 1 
ATOM   2118  N  N   . GLU B  1 8   ? 79.471  35.841  -34.591  1.00 49.13  ? 7   GLU B N   1 
ATOM   2119  C  CA  . GLU B  1 8   ? 78.718  36.166  -35.794  1.00 53.19  ? 7   GLU B CA  1 
ATOM   2120  C  C   . GLU B  1 8   ? 77.874  34.980  -36.243  1.00 47.95  ? 7   GLU B C   1 
ATOM   2121  O  O   . GLU B  1 8   ? 78.310  33.841  -36.174  1.00 46.09  ? 7   GLU B O   1 
ATOM   2122  C  CB  . GLU B  1 8   ? 79.672  36.597  -36.910  1.00 61.56  ? 7   GLU B CB  1 
ATOM   2123  C  CG  . GLU B  1 8   ? 78.987  37.004  -38.198  1.00 44.78  ? 7   GLU B CG  1 
ATOM   2124  C  CD  . GLU B  1 8   ? 79.946  37.655  -39.205  1.00 49.12  ? 7   GLU B CD  1 
ATOM   2125  O  OE1 . GLU B  1 8   ? 80.410  36.946  -40.126  1.00 47.78  ? 7   GLU B OE1 1 
ATOM   2126  O  OE2 . GLU B  1 8   ? 80.209  38.872  -39.074  1.00 49.79  ? 7   GLU B OE2 1 
ATOM   2127  N  N   . THR B  1 9   ? 76.643  35.252  -36.661  1.00 42.78  ? 8   THR B N   1 
ATOM   2128  C  CA  . THR B  1 9   ? 75.757  34.213  -37.177  1.00 45.63  ? 8   THR B CA  1 
ATOM   2129  C  C   . THR B  1 9   ? 75.238  34.685  -38.525  1.00 43.40  ? 8   THR B C   1 
ATOM   2130  O  O   . THR B  1 9   ? 75.052  35.884  -38.731  1.00 41.17  ? 8   THR B O   1 
ATOM   2131  C  CB  . THR B  1 9   ? 74.525  33.973  -36.242  1.00 47.55  ? 8   THR B CB  1 
ATOM   2132  O  OG1 . THR B  1 9   ? 73.846  35.211  -35.999  1.00 42.82  ? 8   THR B OG1 1 
ATOM   2133  C  CG2 . THR B  1 9   ? 74.946  33.363  -34.914  1.00 54.88  ? 8   THR B CG2 1 
ATOM   2134  N  N   . SER B  1 10  ? 75.004  33.751  -39.443  1.00 48.53  ? 9   SER B N   1 
ATOM   2135  C  CA  . SER B  1 10  ? 74.376  34.093  -40.716  1.00 52.66  ? 9   SER B CA  1 
ATOM   2136  C  C   . SER B  1 10  ? 72.936  34.528  -40.475  1.00 44.23  ? 9   SER B C   1 
ATOM   2137  O  O   . SER B  1 10  ? 72.276  34.038  -39.561  1.00 51.89  ? 9   SER B O   1 
ATOM   2138  C  CB  . SER B  1 10  ? 74.392  32.900  -41.672  1.00 51.70  ? 9   SER B CB  1 
ATOM   2139  O  OG  . SER B  1 10  ? 75.709  32.597  -42.089  1.00 89.40  ? 9   SER B OG  1 
ATOM   2140  N  N   . CYS B  1 11  ? 72.444  35.452  -41.288  1.00 42.28  ? 10  CYS B N   1 
ATOM   2141  C  CA  . CYS B  1 11  ? 71.044  35.866  -41.171  1.00 42.10  ? 10  CYS B CA  1 
ATOM   2142  C  C   . CYS B  1 11  ? 70.463  36.343  -42.495  1.00 76.24  ? 10  CYS B C   1 
ATOM   2143  O  O   . CYS B  1 11  ? 71.189  36.626  -43.452  1.00 48.89  ? 10  CYS B O   1 
ATOM   2144  C  CB  . CYS B  1 11  ? 70.874  36.962  -40.108  1.00 40.55  ? 10  CYS B CB  1 
ATOM   2145  S  SG  . CYS B  1 11  ? 71.489  38.603  -40.535  1.00 43.04  ? 10  CYS B SG  1 
ATOM   2146  N  N   . SER B  1 12  ? 69.142  36.423  -42.536  1.00 55.01  ? 11  SER B N   1 
ATOM   2147  C  CA  . SER B  1 12  ? 68.451  37.015  -43.662  1.00 63.51  ? 11  SER B CA  1 
ATOM   2148  C  C   . SER B  1 12  ? 68.297  38.501  -43.411  1.00 55.90  ? 11  SER B C   1 
ATOM   2149  O  O   . SER B  1 12  ? 68.529  38.991  -42.301  1.00 58.09  ? 11  SER B O   1 
ATOM   2150  C  CB  . SER B  1 12  ? 67.079  36.361  -43.861  1.00 45.57  ? 11  SER B CB  1 
ATOM   2151  O  OG  . SER B  1 12  ? 67.216  35.001  -44.237  1.00 55.13  ? 11  SER B OG  1 
ATOM   2152  N  N   . ARG B  1 13  ? 67.920  39.222  -44.454  1.00 53.96  ? 12  ARG B N   1 
ATOM   2153  C  CA  . ARG B  1 13  ? 67.679  40.652  -44.348  1.00 49.83  ? 12  ARG B CA  1 
ATOM   2154  C  C   . ARG B  1 13  ? 66.552  40.894  -43.335  1.00 44.47  ? 12  ARG B C   1 
ATOM   2155  O  O   . ARG B  1 13  ? 65.494  40.270  -43.424  1.00 53.95  ? 12  ARG B O   1 
ATOM   2156  C  CB  . ARG B  1 13  ? 67.283  41.168  -45.731  1.00 57.59  ? 12  ARG B CB  1 
ATOM   2157  C  CG  . ARG B  1 13  ? 67.227  42.663  -45.893  1.00 66.92  ? 12  ARG B CG  1 
ATOM   2158  C  CD  . ARG B  1 13  ? 66.821  42.985  -47.321  1.00 55.63  ? 12  ARG B CD  1 
ATOM   2159  N  NE  . ARG B  1 13  ? 66.510  44.398  -47.498  1.00 86.32  ? 12  ARG B NE  1 
ATOM   2160  C  CZ  . ARG B  1 13  ? 67.051  45.168  -48.436  1.00 88.30  ? 12  ARG B CZ  1 
ATOM   2161  N  NH1 . ARG B  1 13  ? 67.935  44.662  -49.287  1.00 84.88  ? 12  ARG B NH1 1 
ATOM   2162  N  NH2 . ARG B  1 13  ? 66.707  46.446  -48.524  1.00 101.35 ? 12  ARG B NH2 1 
ATOM   2163  N  N   . PRO B  1 14  ? 66.787  41.777  -42.352  1.00 48.93  ? 13  PRO B N   1 
ATOM   2164  C  CA  . PRO B  1 14  ? 65.748  42.110  -41.371  1.00 66.61  ? 13  PRO B CA  1 
ATOM   2165  C  C   . PRO B  1 14  ? 64.596  42.869  -42.022  1.00 67.71  ? 13  PRO B C   1 
ATOM   2166  O  O   . PRO B  1 14  ? 64.774  43.447  -43.094  1.00 55.89  ? 13  PRO B O   1 
ATOM   2167  C  CB  . PRO B  1 14  ? 66.482  43.037  -40.398  1.00 58.79  ? 13  PRO B CB  1 
ATOM   2168  C  CG  . PRO B  1 14  ? 67.564  43.660  -41.225  1.00 44.47  ? 13  PRO B CG  1 
ATOM   2169  C  CD  . PRO B  1 14  ? 68.018  42.551  -42.131  1.00 61.83  ? 13  PRO B CD  1 
ATOM   2170  N  N   . ARG B  1 15  ? 63.433  42.875  -41.379  1.00 61.72  ? 14  ARG B N   1 
ATOM   2171  C  CA  . ARG B  1 15  ? 62.315  43.673  -41.867  1.00 61.97  ? 14  ARG B CA  1 
ATOM   2172  C  C   . ARG B  1 15  ? 62.624  45.158  -41.756  1.00 57.67  ? 14  ARG B C   1 
ATOM   2173  O  O   . ARG B  1 15  ? 62.884  45.669  -40.668  1.00 76.62  ? 14  ARG B O   1 
ATOM   2174  C  CB  . ARG B  1 15  ? 61.021  43.343  -41.114  1.00 70.91  ? 14  ARG B CB  1 
ATOM   2175  C  CG  . ARG B  1 15  ? 60.368  42.054  -41.560  1.00 80.14  ? 14  ARG B CG  1 
ATOM   2176  C  CD  . ARG B  1 15  ? 58.947  41.937  -41.034  1.00 88.71  ? 14  ARG B CD  1 
ATOM   2177  N  NE  . ARG B  1 15  ? 58.198  40.901  -41.741  1.00 104.89 ? 14  ARG B NE  1 
ATOM   2178  C  CZ  . ARG B  1 15  ? 58.261  39.603  -41.457  1.00 101.79 ? 14  ARG B CZ  1 
ATOM   2179  N  NH1 . ARG B  1 15  ? 59.046  39.173  -40.478  1.00 97.09  ? 14  ARG B NH1 1 
ATOM   2180  N  NH2 . ARG B  1 15  ? 57.541  38.732  -42.154  1.00 83.58  ? 14  ARG B NH2 1 
ATOM   2181  N  N   . LEU B  1 16  ? 62.599  45.843  -42.893  1.00 89.37  ? 15  LEU B N   1 
ATOM   2182  C  CA  . LEU B  1 16  ? 62.863  47.276  -42.930  1.00 96.91  ? 15  LEU B CA  1 
ATOM   2183  C  C   . LEU B  1 16  ? 61.571  48.075  -42.843  1.00 104.33 ? 15  LEU B C   1 
ATOM   2184  O  O   . LEU B  1 16  ? 60.571  47.737  -43.488  1.00 104.08 ? 15  LEU B O   1 
ATOM   2185  C  CB  . LEU B  1 16  ? 63.608  47.645  -44.208  1.00 90.14  ? 15  LEU B CB  1 
ATOM   2186  C  CG  . LEU B  1 16  ? 65.054  47.174  -44.266  1.00 93.02  ? 15  LEU B CG  1 
ATOM   2187  C  CD1 . LEU B  1 16  ? 65.625  47.475  -45.634  1.00 84.25  ? 15  LEU B CD1 1 
ATOM   2188  C  CD2 . LEU B  1 16  ? 65.858  47.856  -43.167  1.00 85.03  ? 15  LEU B CD2 1 
ATOM   2189  N  N   . ASN B  1 17  ? 61.600  49.139  -42.045  1.00 117.16 ? 16  ASN B N   1 
ATOM   2190  C  CA  . ASN B  1 17  ? 60.432  49.994  -41.871  1.00 116.12 ? 16  ASN B CA  1 
ATOM   2191  C  C   . ASN B  1 17  ? 60.151  50.830  -43.125  1.00 111.77 ? 16  ASN B C   1 
ATOM   2192  O  O   . ASN B  1 17  ? 61.063  51.098  -43.917  1.00 120.53 ? 16  ASN B O   1 
ATOM   2193  C  CB  . ASN B  1 17  ? 60.594  50.880  -40.627  1.00 106.15 ? 16  ASN B CB  1 
ATOM   2194  C  CG  . ASN B  1 17  ? 60.765  50.064  -39.347  1.00 101.92 ? 16  ASN B CG  1 
ATOM   2195  O  OD1 . ASN B  1 17  ? 61.676  50.308  -38.552  1.00 49.78  ? 16  ASN B OD1 1 
ATOM   2196  N  ND2 . ASN B  1 17  ? 59.889  49.084  -39.150  1.00 90.97  ? 16  ASN B ND2 1 
ATOM   2197  N  N   . SER B  1 18  ? 58.888  51.224  -43.294  1.00 102.73 ? 17  SER B N   1 
ATOM   2198  C  CA  . SER B  1 18  ? 58.423  51.983  -44.459  1.00 80.49  ? 17  SER B CA  1 
ATOM   2199  C  C   . SER B  1 18  ? 59.301  53.187  -44.821  1.00 96.29  ? 17  SER B C   1 
ATOM   2200  O  O   . SER B  1 18  ? 59.971  53.766  -43.960  1.00 114.67 ? 17  SER B O   1 
ATOM   2201  C  CB  . SER B  1 18  ? 56.995  52.472  -44.218  1.00 86.87  ? 17  SER B CB  1 
ATOM   2202  O  OG  . SER B  1 18  ? 56.145  51.411  -43.820  1.00 104.48 ? 17  SER B OG  1 
ATOM   2203  N  N   . ASN B  1 19  ? 59.290  53.553  -46.102  1.00 102.92 ? 18  ASN B N   1 
ATOM   2204  C  CA  . ASN B  1 19  ? 59.953  54.767  -46.574  1.00 103.84 ? 18  ASN B CA  1 
ATOM   2205  C  C   . ASN B  1 19  ? 59.265  56.022  -46.036  1.00 109.43 ? 18  ASN B C   1 
ATOM   2206  O  O   . ASN B  1 19  ? 58.265  55.936  -45.316  1.00 100.06 ? 18  ASN B O   1 
ATOM   2207  C  CB  . ASN B  1 19  ? 59.978  54.812  -48.111  1.00 99.40  ? 18  ASN B CB  1 
ATOM   2208  C  CG  . ASN B  1 19  ? 61.085  53.953  -48.710  1.00 103.37 ? 18  ASN B CG  1 
ATOM   2209  O  OD1 . ASN B  1 19  ? 62.113  53.708  -48.075  1.00 121.72 ? 18  ASN B OD1 1 
ATOM   2210  N  ND2 . ASN B  1 19  ? 60.880  53.501  -49.944  1.00 100.32 ? 18  ASN B ND2 1 
ATOM   2211  N  N   . LEU B  1 20  ? 59.796  57.187  -46.392  1.00 92.10  ? 19  LEU B N   1 
ATOM   2212  C  CA  . LEU B  1 20  ? 59.163  58.445  -46.017  1.00 90.80  ? 19  LEU B CA  1 
ATOM   2213  C  C   . LEU B  1 20  ? 57.789  58.579  -46.679  1.00 81.75  ? 19  LEU B C   1 
ATOM   2214  O  O   . LEU B  1 20  ? 56.876  59.176  -46.112  1.00 107.37 ? 19  LEU B O   1 
ATOM   2215  C  CB  . LEU B  1 20  ? 60.054  59.634  -46.392  1.00 81.41  ? 19  LEU B CB  1 
ATOM   2216  C  CG  . LEU B  1 20  ? 59.600  60.995  -45.856  1.00 82.50  ? 19  LEU B CG  1 
ATOM   2217  C  CD1 . LEU B  1 20  ? 59.506  60.947  -44.340  1.00 70.23  ? 19  LEU B CD1 1 
ATOM   2218  C  CD2 . LEU B  1 20  ? 60.521  62.128  -46.302  1.00 63.35  ? 19  LEU B CD2 1 
ATOM   2219  N  N   . ASP B  1 21  ? 57.642  58.000  -47.867  1.00 84.59  ? 20  ASP B N   1 
ATOM   2220  C  CA  . ASP B  1 21  ? 56.434  58.178  -48.671  1.00 77.50  ? 20  ASP B CA  1 
ATOM   2221  C  C   . ASP B  1 21  ? 55.192  57.543  -48.059  1.00 94.91  ? 20  ASP B C   1 
ATOM   2222  O  O   . ASP B  1 21  ? 54.082  58.057  -48.220  1.00 106.48 ? 20  ASP B O   1 
ATOM   2223  C  CB  . ASP B  1 21  ? 56.645  57.616  -50.078  1.00 99.92  ? 20  ASP B CB  1 
ATOM   2224  C  CG  . ASP B  1 21  ? 58.057  57.820  -50.575  1.00 109.82 ? 20  ASP B CG  1 
ATOM   2225  O  OD1 . ASP B  1 21  ? 59.000  57.523  -49.809  1.00 83.33  ? 20  ASP B OD1 1 
ATOM   2226  O  OD2 . ASP B  1 21  ? 58.222  58.281  -51.726  1.00 117.16 ? 20  ASP B OD2 1 
ATOM   2227  N  N   . ALA B  1 22  ? 55.375  56.419  -47.374  1.00 71.36  ? 21  ALA B N   1 
ATOM   2228  C  CA  . ALA B  1 22  ? 54.248  55.712  -46.777  1.00 97.85  ? 21  ALA B CA  1 
ATOM   2229  C  C   . ALA B  1 22  ? 53.615  56.556  -45.677  1.00 97.49  ? 21  ALA B C   1 
ATOM   2230  O  O   . ALA B  1 22  ? 52.392  56.561  -45.503  1.00 102.01 ? 21  ALA B O   1 
ATOM   2231  C  CB  . ALA B  1 22  ? 54.691  54.365  -46.235  1.00 102.49 ? 21  ALA B CB  1 
ATOM   2232  N  N   . ASP B  1 23  ? 54.461  57.271  -44.941  1.00 71.41  ? 22  ASP B N   1 
ATOM   2233  C  CA  . ASP B  1 23  ? 54.003  58.177  -43.896  1.00 83.02  ? 22  ASP B CA  1 
ATOM   2234  C  C   . ASP B  1 23  ? 53.200  59.329  -44.496  1.00 97.36  ? 22  ASP B C   1 
ATOM   2235  O  O   . ASP B  1 23  ? 52.097  59.636  -44.037  1.00 100.84 ? 22  ASP B O   1 
ATOM   2236  C  CB  . ASP B  1 23  ? 55.191  58.726  -43.095  1.00 82.07  ? 22  ASP B CB  1 
ATOM   2237  C  CG  . ASP B  1 23  ? 55.638  57.789  -41.978  1.00 96.19  ? 22  ASP B CG  1 
ATOM   2238  O  OD1 . ASP B  1 23  ? 54.765  57.181  -41.322  1.00 95.97  ? 22  ASP B OD1 1 
ATOM   2239  O  OD2 . ASP B  1 23  ? 56.861  57.666  -41.747  1.00 70.10  ? 22  ASP B OD2 1 
ATOM   2240  N  N   . LEU B  1 24  ? 53.749  59.952  -45.535  1.00 82.99  ? 23  LEU B N   1 
ATOM   2241  C  CA  . LEU B  1 24  ? 53.142  61.150  -46.112  1.00 101.91 ? 23  LEU B CA  1 
ATOM   2242  C  C   . LEU B  1 24  ? 52.482  60.929  -47.477  1.00 94.97  ? 23  LEU B C   1 
ATOM   2243  O  O   . LEU B  1 24  ? 52.787  61.620  -48.448  1.00 114.31 ? 23  LEU B O   1 
ATOM   2244  C  CB  . LEU B  1 24  ? 54.157  62.303  -46.160  1.00 92.35  ? 23  LEU B CB  1 
ATOM   2245  C  CG  . LEU B  1 24  ? 55.615  62.060  -46.566  1.00 67.77  ? 23  LEU B CG  1 
ATOM   2246  C  CD1 . LEU B  1 24  ? 55.815  62.199  -48.070  1.00 84.02  ? 23  LEU B CD1 1 
ATOM   2247  C  CD2 . LEU B  1 24  ? 56.535  63.013  -45.818  1.00 97.14  ? 23  LEU B CD2 1 
ATOM   2248  N  N   . TYR B  1 25  ? 51.558  59.977  -47.538  1.00 83.34  ? 24  TYR B N   1 
ATOM   2249  C  CA  . TYR B  1 25  ? 50.844  59.699  -48.779  1.00 92.48  ? 24  TYR B CA  1 
ATOM   2250  C  C   . TYR B  1 25  ? 49.496  60.421  -48.805  1.00 125.40 ? 24  TYR B C   1 
ATOM   2251  O  O   . TYR B  1 25  ? 48.727  60.350  -47.847  1.00 125.48 ? 24  TYR B O   1 
ATOM   2252  C  CB  . TYR B  1 25  ? 50.654  58.189  -48.957  1.00 102.52 ? 24  TYR B CB  1 
ATOM   2253  C  CG  . TYR B  1 25  ? 49.508  57.816  -49.872  1.00 117.19 ? 24  TYR B CG  1 
ATOM   2254  C  CD1 . TYR B  1 25  ? 49.654  57.855  -51.255  1.00 128.78 ? 24  TYR B CD1 1 
ATOM   2255  C  CD2 . TYR B  1 25  ? 48.279  57.420  -49.354  1.00 97.98  ? 24  TYR B CD2 1 
ATOM   2256  C  CE1 . TYR B  1 25  ? 48.605  57.513  -52.097  1.00 113.82 ? 24  TYR B CE1 1 
ATOM   2257  C  CE2 . TYR B  1 25  ? 47.226  57.078  -50.185  1.00 110.13 ? 24  TYR B CE2 1 
ATOM   2258  C  CZ  . TYR B  1 25  ? 47.394  57.126  -51.555  1.00 121.31 ? 24  TYR B CZ  1 
ATOM   2259  O  OH  . TYR B  1 25  ? 46.349  56.786  -52.385  1.00 124.55 ? 24  TYR B OH  1 
ATOM   2260  N  N   . GLY B  1 26  ? 49.211  61.116  -49.903  1.00 82.59  ? 25  GLY B N   1 
ATOM   2261  C  CA  . GLY B  1 26  ? 47.955  61.832  -50.040  1.00 103.94 ? 25  GLY B CA  1 
ATOM   2262  C  C   . GLY B  1 26  ? 47.860  63.062  -49.153  1.00 114.93 ? 25  GLY B C   1 
ATOM   2263  O  O   . GLY B  1 26  ? 47.081  63.097  -48.201  1.00 103.28 ? 25  GLY B O   1 
ATOM   2264  N  N   . TYR B  1 27  ? 48.658  64.075  -49.474  1.00 86.79  ? 26  TYR B N   1 
ATOM   2265  C  CA  . TYR B  1 27  ? 48.646  65.342  -48.755  1.00 74.87  ? 26  TYR B CA  1 
ATOM   2266  C  C   . TYR B  1 27  ? 48.763  66.488  -49.748  1.00 87.90  ? 26  TYR B C   1 
ATOM   2267  O  O   . TYR B  1 27  ? 49.306  66.318  -50.837  1.00 105.40 ? 26  TYR B O   1 
ATOM   2268  C  CB  . TYR B  1 27  ? 49.832  65.423  -47.792  1.00 93.18  ? 26  TYR B CB  1 
ATOM   2269  C  CG  . TYR B  1 27  ? 49.606  64.851  -46.409  1.00 76.69  ? 26  TYR B CG  1 
ATOM   2270  C  CD1 . TYR B  1 27  ? 48.979  65.602  -45.417  1.00 77.81  ? 26  TYR B CD1 1 
ATOM   2271  C  CD2 . TYR B  1 27  ? 50.049  63.576  -46.082  1.00 63.08  ? 26  TYR B CD2 1 
ATOM   2272  C  CE1 . TYR B  1 27  ? 48.783  65.091  -44.146  1.00 59.33  ? 26  TYR B CE1 1 
ATOM   2273  C  CE2 . TYR B  1 27  ? 49.866  63.056  -44.806  1.00 69.31  ? 26  TYR B CE2 1 
ATOM   2274  C  CZ  . TYR B  1 27  ? 49.231  63.817  -43.843  1.00 84.47  ? 26  TYR B CZ  1 
ATOM   2275  O  OH  . TYR B  1 27  ? 49.044  63.302  -42.577  1.00 65.13  ? 26  TYR B OH  1 
ATOM   2276  N  N   . ARG B  1 28  ? 48.265  67.659  -49.372  1.00 100.02 ? 27  ARG B N   1 
ATOM   2277  C  CA  . ARG B  1 28  ? 48.515  68.861  -50.158  1.00 107.46 ? 27  ARG B CA  1 
ATOM   2278  C  C   . ARG B  1 28  ? 49.751  69.555  -49.586  1.00 95.13  ? 27  ARG B C   1 
ATOM   2279  O  O   . ARG B  1 28  ? 50.113  69.311  -48.436  1.00 73.07  ? 27  ARG B O   1 
ATOM   2280  C  CB  . ARG B  1 28  ? 47.295  69.782  -50.147  1.00 83.94  ? 27  ARG B CB  1 
ATOM   2281  C  CG  . ARG B  1 28  ? 46.029  69.127  -50.692  1.00 75.58  ? 27  ARG B CG  1 
ATOM   2282  C  CD  . ARG B  1 28  ? 44.893  70.126  -50.799  1.00 87.46  ? 27  ARG B CD  1 
ATOM   2283  N  NE  . ARG B  1 28  ? 45.120  71.083  -51.876  1.00 120.74 ? 27  ARG B NE  1 
ATOM   2284  C  CZ  . ARG B  1 28  ? 44.445  72.218  -52.029  1.00 105.00 ? 27  ARG B CZ  1 
ATOM   2285  N  NH1 . ARG B  1 28  ? 44.726  73.022  -53.045  1.00 115.40 ? 27  ARG B NH1 1 
ATOM   2286  N  NH2 . ARG B  1 28  ? 43.497  72.554  -51.163  1.00 97.51  ? 27  ARG B NH2 1 
ATOM   2287  N  N   . TRP B  1 29  ? 50.403  70.399  -50.385  1.00 86.51  ? 28  TRP B N   1 
ATOM   2288  C  CA  . TRP B  1 29  ? 51.726  70.920  -50.025  1.00 75.70  ? 28  TRP B CA  1 
ATOM   2289  C  C   . TRP B  1 29  ? 51.859  72.437  -50.160  1.00 87.69  ? 28  TRP B C   1 
ATOM   2290  O  O   . TRP B  1 29  ? 51.425  73.022  -51.150  1.00 84.27  ? 28  TRP B O   1 
ATOM   2291  C  CB  . TRP B  1 29  ? 52.805  70.232  -50.867  1.00 67.09  ? 28  TRP B CB  1 
ATOM   2292  C  CG  . TRP B  1 29  ? 52.920  68.759  -50.611  1.00 73.09  ? 28  TRP B CG  1 
ATOM   2293  C  CD1 . TRP B  1 29  ? 51.983  67.806  -50.881  1.00 77.34  ? 28  TRP B CD1 1 
ATOM   2294  C  CD2 . TRP B  1 29  ? 54.044  68.065  -50.048  1.00 95.93  ? 28  TRP B CD2 1 
ATOM   2295  N  NE1 . TRP B  1 29  ? 52.445  66.565  -50.508  1.00 90.38  ? 28  TRP B NE1 1 
ATOM   2296  C  CE2 . TRP B  1 29  ? 53.708  66.697  -49.996  1.00 69.67  ? 28  TRP B CE2 1 
ATOM   2297  C  CE3 . TRP B  1 29  ? 55.301  68.469  -49.580  1.00 76.21  ? 28  TRP B CE3 1 
ATOM   2298  C  CZ2 . TRP B  1 29  ? 54.581  65.731  -49.495  1.00 62.76  ? 28  TRP B CZ2 1 
ATOM   2299  C  CZ3 . TRP B  1 29  ? 56.166  67.505  -49.083  1.00 88.98  ? 28  TRP B CZ3 1 
ATOM   2300  C  CH2 . TRP B  1 29  ? 55.802  66.154  -49.047  1.00 67.27  ? 28  TRP B CH2 1 
ATOM   2301  N  N   . ALA B  1 30  ? 52.474  73.064  -49.159  1.00 93.06  ? 29  ALA B N   1 
ATOM   2302  C  CA  . ALA B  1 30  ? 52.750  74.498  -49.190  1.00 84.01  ? 29  ALA B CA  1 
ATOM   2303  C  C   . ALA B  1 30  ? 54.164  74.761  -48.676  1.00 80.70  ? 29  ALA B C   1 
ATOM   2304  O  O   . ALA B  1 30  ? 54.595  74.156  -47.695  1.00 77.70  ? 29  ALA B O   1 
ATOM   2305  C  CB  . ALA B  1 30  ? 51.720  75.261  -48.364  1.00 76.21  ? 29  ALA B CB  1 
ATOM   2306  N  N   . ARG B  1 31  ? 54.883  75.664  -49.335  1.00 71.85  ? 30  ARG B N   1 
ATOM   2307  C  CA  . ARG B  1 31  ? 56.310  75.839  -49.064  1.00 89.82  ? 30  ARG B CA  1 
ATOM   2308  C  C   . ARG B  1 31  ? 56.595  76.992  -48.095  1.00 119.73 ? 30  ARG B C   1 
ATOM   2309  O  O   . ARG B  1 31  ? 57.192  78.001  -48.479  1.00 108.78 ? 30  ARG B O   1 
ATOM   2310  C  CB  . ARG B  1 31  ? 57.054  76.064  -50.384  1.00 91.34  ? 30  ARG B CB  1 
ATOM   2311  C  CG  . ARG B  1 31  ? 58.515  75.618  -50.410  1.00 72.58  ? 30  ARG B CG  1 
ATOM   2312  C  CD  . ARG B  1 31  ? 59.095  75.907  -51.789  1.00 100.11 ? 30  ARG B CD  1 
ATOM   2313  N  NE  . ARG B  1 31  ? 60.401  75.296  -52.014  1.00 98.46  ? 30  ARG B NE  1 
ATOM   2314  C  CZ  . ARG B  1 31  ? 61.560  75.928  -51.856  1.00 113.53 ? 30  ARG B CZ  1 
ATOM   2315  N  NH1 . ARG B  1 31  ? 62.702  75.293  -52.092  1.00 100.20 ? 30  ARG B NH1 1 
ATOM   2316  N  NH2 . ARG B  1 31  ? 61.579  77.195  -51.461  1.00 112.94 ? 30  ARG B NH2 1 
ATOM   2317  N  N   . ASP B  1 32  ? 56.180  76.838  -46.838  1.00 75.53  ? 31  ASP B N   1 
ATOM   2318  C  CA  . ASP B  1 32  ? 56.365  77.896  -45.843  1.00 85.34  ? 31  ASP B CA  1 
ATOM   2319  C  C   . ASP B  1 32  ? 57.832  78.146  -45.496  1.00 105.14 ? 31  ASP B C   1 
ATOM   2320  O  O   . ASP B  1 32  ? 58.303  79.285  -45.541  1.00 99.82  ? 31  ASP B O   1 
ATOM   2321  C  CB  . ASP B  1 32  ? 55.561  77.604  -44.572  1.00 95.85  ? 31  ASP B CB  1 
ATOM   2322  C  CG  . ASP B  1 32  ? 54.141  78.149  -44.642  1.00 116.45 ? 31  ASP B CG  1 
ATOM   2323  O  OD1 . ASP B  1 32  ? 53.966  79.385  -44.528  1.00 112.78 ? 31  ASP B OD1 1 
ATOM   2324  O  OD2 . ASP B  1 32  ? 53.199  77.342  -44.807  1.00 122.05 ? 31  ASP B OD2 1 
ATOM   2325  N  N   . GLN B  1 36  ? 62.373  81.039  -44.906  1.00 109.44 ? 35  GLN B N   1 
ATOM   2326  C  CA  . GLN B  1 36  ? 63.159  81.255  -46.118  1.00 95.07  ? 35  GLN B CA  1 
ATOM   2327  C  C   . GLN B  1 36  ? 64.577  80.715  -45.960  1.00 135.37 ? 35  GLN B C   1 
ATOM   2328  O  O   . GLN B  1 36  ? 64.913  79.666  -46.516  1.00 123.89 ? 35  GLN B O   1 
ATOM   2329  C  CB  . GLN B  1 36  ? 63.186  82.741  -46.494  1.00 88.16  ? 35  GLN B CB  1 
ATOM   2330  C  CG  . GLN B  1 36  ? 64.181  83.108  -47.591  1.00 92.18  ? 35  GLN B CG  1 
ATOM   2331  C  CD  . GLN B  1 36  ? 63.841  82.500  -48.943  1.00 132.20 ? 35  GLN B CD  1 
ATOM   2332  O  OE1 . GLN B  1 36  ? 62.782  81.894  -49.122  1.00 121.45 ? 35  GLN B OE1 1 
ATOM   2333  N  NE2 . GLN B  1 36  ? 64.743  82.667  -49.908  1.00 128.15 ? 35  GLN B NE2 1 
ATOM   2334  N  N   . SER B  1 37  ? 65.403  81.428  -45.199  1.00 123.04 ? 36  SER B N   1 
ATOM   2335  C  CA  . SER B  1 37  ? 66.764  80.982  -44.929  1.00 96.27  ? 36  SER B CA  1 
ATOM   2336  C  C   . SER B  1 37  ? 66.722  79.739  -44.053  1.00 108.29 ? 36  SER B C   1 
ATOM   2337  O  O   . SER B  1 37  ? 65.698  79.435  -43.434  1.00 106.72 ? 36  SER B O   1 
ATOM   2338  C  CB  . SER B  1 37  ? 67.560  82.075  -44.225  1.00 80.16  ? 36  SER B CB  1 
ATOM   2339  O  OG  . SER B  1 37  ? 67.273  82.083  -42.837  1.00 83.96  ? 36  SER B OG  1 
ATOM   2340  N  N   . GLY B  1 38  ? 67.842  79.028  -43.989  1.00 92.63  ? 37  GLY B N   1 
ATOM   2341  C  CA  . GLY B  1 38  ? 67.888  77.774  -43.265  1.00 71.53  ? 37  GLY B CA  1 
ATOM   2342  C  C   . GLY B  1 38  ? 67.144  76.703  -44.039  1.00 76.72  ? 37  GLY B C   1 
ATOM   2343  O  O   . GLY B  1 38  ? 67.223  76.646  -45.264  1.00 56.65  ? 37  GLY B O   1 
ATOM   2344  N  N   . ALA B  1 39  ? 66.405  75.864  -43.324  1.00 69.84  ? 38  ALA B N   1 
ATOM   2345  C  CA  . ALA B  1 39  ? 65.727  74.725  -43.936  1.00 53.70  ? 38  ALA B CA  1 
ATOM   2346  C  C   . ALA B  1 39  ? 64.531  75.125  -44.799  1.00 53.67  ? 38  ALA B C   1 
ATOM   2347  O  O   . ALA B  1 39  ? 63.833  76.088  -44.494  1.00 75.25  ? 38  ALA B O   1 
ATOM   2348  C  CB  . ALA B  1 39  ? 65.295  73.727  -42.854  1.00 52.76  ? 38  ALA B CB  1 
ATOM   2349  N  N   . THR B  1 40  ? 64.310  74.383  -45.880  1.00 51.34  ? 39  THR B N   1 
ATOM   2350  C  CA  . THR B  1 40  ? 63.076  74.492  -46.653  1.00 61.57  ? 39  THR B CA  1 
ATOM   2351  C  C   . THR B  1 40  ? 61.965  73.809  -45.872  1.00 61.97  ? 39  THR B C   1 
ATOM   2352  O  O   . THR B  1 40  ? 62.119  72.667  -45.454  1.00 54.74  ? 39  THR B O   1 
ATOM   2353  C  CB  . THR B  1 40  ? 63.189  73.775  -48.006  1.00 64.02  ? 39  THR B CB  1 
ATOM   2354  O  OG1 . THR B  1 40  ? 64.265  74.340  -48.766  1.00 96.59  ? 39  THR B OG1 1 
ATOM   2355  C  CG2 . THR B  1 40  ? 61.889  73.913  -48.791  1.00 63.18  ? 39  THR B CG2 1 
ATOM   2356  N  N   . ILE B  1 41  ? 60.845  74.496  -45.680  1.00 60.14  ? 40  ILE B N   1 
ATOM   2357  C  CA  . ILE B  1 41  ? 59.757  73.939  -44.885  1.00 55.78  ? 40  ILE B CA  1 
ATOM   2358  C  C   . ILE B  1 41  ? 58.486  73.714  -45.698  1.00 59.35  ? 40  ILE B C   1 
ATOM   2359  O  O   . ILE B  1 41  ? 58.009  74.608  -46.397  1.00 64.84  ? 40  ILE B O   1 
ATOM   2360  C  CB  . ILE B  1 41  ? 59.468  74.804  -43.637  1.00 71.49  ? 40  ILE B CB  1 
ATOM   2361  C  CG1 . ILE B  1 41  ? 60.653  74.728  -42.670  1.00 64.11  ? 40  ILE B CG1 1 
ATOM   2362  C  CG2 . ILE B  1 41  ? 58.189  74.353  -42.941  1.00 53.76  ? 40  ILE B CG2 1 
ATOM   2363  C  CD1 . ILE B  1 41  ? 60.430  75.433  -41.357  1.00 56.82  ? 40  ILE B CD1 1 
ATOM   2364  N  N   . TYR B  1 42  ? 57.954  72.500  -45.606  1.00 53.52  ? 41  TYR B N   1 
ATOM   2365  C  CA  . TYR B  1 42  ? 56.716  72.142  -46.284  1.00 69.67  ? 41  TYR B CA  1 
ATOM   2366  C  C   . TYR B  1 42  ? 55.618  71.891  -45.261  1.00 51.68  ? 41  TYR B C   1 
ATOM   2367  O  O   . TYR B  1 42  ? 55.844  71.238  -44.232  1.00 58.39  ? 41  TYR B O   1 
ATOM   2368  C  CB  . TYR B  1 42  ? 56.902  70.885  -47.136  1.00 56.37  ? 41  TYR B CB  1 
ATOM   2369  C  CG  . TYR B  1 42  ? 57.937  71.009  -48.228  1.00 68.82  ? 41  TYR B CG  1 
ATOM   2370  C  CD1 . TYR B  1 42  ? 59.261  70.664  -47.996  1.00 67.38  ? 41  TYR B CD1 1 
ATOM   2371  C  CD2 . TYR B  1 42  ? 57.590  71.466  -49.495  1.00 82.36  ? 41  TYR B CD2 1 
ATOM   2372  C  CE1 . TYR B  1 42  ? 60.216  70.773  -48.994  1.00 57.60  ? 41  TYR B CE1 1 
ATOM   2373  C  CE2 . TYR B  1 42  ? 58.539  71.578  -50.501  1.00 79.37  ? 41  TYR B CE2 1 
ATOM   2374  C  CZ  . TYR B  1 42  ? 59.851  71.229  -50.242  1.00 63.75  ? 41  TYR B CZ  1 
ATOM   2375  O  OH  . TYR B  1 42  ? 60.806  71.333  -51.225  1.00 90.66  ? 41  TYR B OH  1 
ATOM   2376  N  N   . ARG B  1 43  ? 54.436  72.423  -45.542  1.00 55.01  ? 42  ARG B N   1 
ATOM   2377  C  CA  . ARG B  1 43  ? 53.248  72.139  -44.750  1.00 75.68  ? 42  ARG B CA  1 
ATOM   2378  C  C   . ARG B  1 43  ? 52.430  71.077  -45.473  1.00 71.24  ? 42  ARG B C   1 
ATOM   2379  O  O   . ARG B  1 43  ? 52.113  71.232  -46.652  1.00 73.31  ? 42  ARG B O   1 
ATOM   2380  C  CB  . ARG B  1 43  ? 52.408  73.406  -44.579  1.00 80.28  ? 42  ARG B CB  1 
ATOM   2381  C  CG  . ARG B  1 43  ? 51.172  73.219  -43.711  1.00 69.70  ? 42  ARG B CG  1 
ATOM   2382  C  CD  . ARG B  1 43  ? 50.309  74.479  -43.666  1.00 94.19  ? 42  ARG B CD  1 
ATOM   2383  N  NE  . ARG B  1 43  ? 49.718  74.677  -42.345  1.00 108.31 ? 42  ARG B NE  1 
ATOM   2384  C  CZ  . ARG B  1 43  ? 50.203  75.510  -41.427  1.00 110.85 ? 42  ARG B CZ  1 
ATOM   2385  N  NH1 . ARG B  1 43  ? 49.604  75.621  -40.247  1.00 103.69 ? 42  ARG B NH1 1 
ATOM   2386  N  NH2 . ARG B  1 43  ? 51.283  76.239  -41.689  1.00 90.34  ? 42  ARG B NH2 1 
ATOM   2387  N  N   . LEU B  1 44  ? 52.096  69.999  -44.771  1.00 71.08  ? 43  LEU B N   1 
ATOM   2388  C  CA  . LEU B  1 44  ? 51.309  68.915  -45.362  1.00 61.89  ? 43  LEU B CA  1 
ATOM   2389  C  C   . LEU B  1 44  ? 49.927  68.841  -44.724  1.00 74.39  ? 43  LEU B C   1 
ATOM   2390  O  O   . LEU B  1 44  ? 49.804  68.684  -43.504  1.00 58.60  ? 43  LEU B O   1 
ATOM   2391  C  CB  . LEU B  1 44  ? 52.031  67.573  -45.210  1.00 63.55  ? 43  LEU B CB  1 
ATOM   2392  C  CG  . LEU B  1 44  ? 53.132  67.241  -46.220  1.00 71.56  ? 43  LEU B CG  1 
ATOM   2393  C  CD1 . LEU B  1 44  ? 54.350  68.135  -46.042  1.00 74.81  ? 43  LEU B CD1 1 
ATOM   2394  C  CD2 . LEU B  1 44  ? 53.527  65.784  -46.094  1.00 81.43  ? 43  LEU B CD2 1 
ATOM   2395  N  N   . TYR B  1 45  ? 48.890  68.943  -45.554  1.00 66.95  ? 44  TYR B N   1 
ATOM   2396  C  CA  . TYR B  1 45  ? 47.527  69.035  -45.053  1.00 78.00  ? 44  TYR B CA  1 
ATOM   2397  C  C   . TYR B  1 45  ? 46.510  68.346  -45.960  1.00 71.70  ? 44  TYR B C   1 
ATOM   2398  O  O   . TYR B  1 45  ? 46.867  67.754  -46.980  1.00 91.75  ? 44  TYR B O   1 
ATOM   2399  C  CB  . TYR B  1 45  ? 47.139  70.506  -44.867  1.00 62.96  ? 44  TYR B CB  1 
ATOM   2400  C  CG  . TYR B  1 45  ? 47.155  71.317  -46.143  1.00 75.10  ? 44  TYR B CG  1 
ATOM   2401  C  CD1 . TYR B  1 45  ? 45.994  71.509  -46.881  1.00 92.81  ? 44  TYR B CD1 1 
ATOM   2402  C  CD2 . TYR B  1 45  ? 48.330  71.901  -46.607  1.00 85.65  ? 44  TYR B CD2 1 
ATOM   2403  C  CE1 . TYR B  1 45  ? 45.999  72.255  -48.047  1.00 85.48  ? 44  TYR B CE1 1 
ATOM   2404  C  CE2 . TYR B  1 45  ? 48.346  72.648  -47.777  1.00 80.83  ? 44  TYR B CE2 1 
ATOM   2405  C  CZ  . TYR B  1 45  ? 47.178  72.821  -48.492  1.00 103.41 ? 44  TYR B CZ  1 
ATOM   2406  O  OH  . TYR B  1 45  ? 47.182  73.564  -49.655  1.00 105.62 ? 44  TYR B OH  1 
ATOM   2407  N  N   . GLY B  1 46  ? 45.243  68.422  -45.566  1.00 88.76  ? 45  GLY B N   1 
ATOM   2408  C  CA  . GLY B  1 46  ? 44.139  67.954  -46.389  1.00 100.02 ? 45  GLY B CA  1 
ATOM   2409  C  C   . GLY B  1 46  ? 44.050  66.456  -46.620  1.00 99.90  ? 45  GLY B C   1 
ATOM   2410  O  O   . GLY B  1 46  ? 43.837  66.013  -47.749  1.00 113.26 ? 45  GLY B O   1 
ATOM   2411  N  N   . LYS B  1 47  ? 44.206  65.672  -45.558  1.00 79.24  ? 46  LYS B N   1 
ATOM   2412  C  CA  . LYS B  1 47  ? 44.059  64.222  -45.653  1.00 71.79  ? 46  LYS B CA  1 
ATOM   2413  C  C   . LYS B  1 47  ? 43.108  63.704  -44.580  1.00 109.52 ? 46  LYS B C   1 
ATOM   2414  O  O   . LYS B  1 47  ? 43.331  63.939  -43.387  1.00 89.05  ? 46  LYS B O   1 
ATOM   2415  C  CB  . LYS B  1 47  ? 45.414  63.524  -45.533  1.00 86.94  ? 46  LYS B CB  1 
ATOM   2416  C  CG  . LYS B  1 47  ? 45.322  62.004  -45.512  1.00 87.49  ? 46  LYS B CG  1 
ATOM   2417  C  CD  . LYS B  1 47  ? 46.698  61.367  -45.483  1.00 88.12  ? 46  LYS B CD  1 
ATOM   2418  C  CE  . LYS B  1 47  ? 46.618  59.864  -45.257  1.00 69.18  ? 46  LYS B CE  1 
ATOM   2419  N  NZ  . LYS B  1 47  ? 47.981  59.255  -45.226  1.00 82.32  ? 46  LYS B NZ  1 
ATOM   2420  N  N   . PRO B  1 48  ? 42.053  62.986  -45.008  1.00 99.89  ? 47  PRO B N   1 
ATOM   2421  C  CA  . PRO B  1 48  ? 40.958  62.478  -44.167  1.00 107.33 ? 47  PRO B CA  1 
ATOM   2422  C  C   . PRO B  1 48  ? 41.430  61.830  -42.865  1.00 95.01  ? 47  PRO B C   1 
ATOM   2423  O  O   . PRO B  1 48  ? 42.240  60.898  -42.884  1.00 93.27  ? 47  PRO B O   1 
ATOM   2424  C  CB  . PRO B  1 48  ? 40.260  61.448  -45.073  1.00 108.82 ? 47  PRO B CB  1 
ATOM   2425  C  CG  . PRO B  1 48  ? 41.183  61.248  -46.250  1.00 118.33 ? 47  PRO B CG  1 
ATOM   2426  C  CD  . PRO B  1 48  ? 41.908  62.540  -46.403  1.00 101.00 ? 47  PRO B CD  1 
ATOM   2427  N  N   . ASN B  1 49  ? 40.927  62.357  -41.748  1.00 82.64  ? 48  ASN B N   1 
ATOM   2428  C  CA  . ASN B  1 49  ? 41.316  61.948  -40.392  1.00 71.76  ? 48  ASN B CA  1 
ATOM   2429  C  C   . ASN B  1 49  ? 42.765  62.278  -40.007  1.00 91.63  ? 48  ASN B C   1 
ATOM   2430  O  O   . ASN B  1 49  ? 43.063  62.503  -38.832  1.00 100.17 ? 48  ASN B O   1 
ATOM   2431  C  CB  . ASN B  1 49  ? 41.000  60.465  -40.140  1.00 91.69  ? 48  ASN B CB  1 
ATOM   2432  C  CG  . ASN B  1 49  ? 39.544  60.122  -40.411  1.00 105.79 ? 48  ASN B CG  1 
ATOM   2433  O  OD1 . ASN B  1 49  ? 39.241  59.284  -41.262  1.00 105.75 ? 48  ASN B OD1 1 
ATOM   2434  N  ND2 . ASN B  1 49  ? 38.634  60.772  -39.687  1.00 103.82 ? 48  ASN B ND2 1 
ATOM   2435  N  N   . ALA B  1 50  ? 43.654  62.323  -40.995  1.00 100.70 ? 49  ALA B N   1 
ATOM   2436  C  CA  . ALA B  1 50  ? 45.080  62.535  -40.742  1.00 88.39  ? 49  ALA B CA  1 
ATOM   2437  C  C   . ALA B  1 50  ? 45.400  63.958  -40.287  1.00 72.64  ? 49  ALA B C   1 
ATOM   2438  O  O   . ALA B  1 50  ? 44.814  64.923  -40.782  1.00 96.61  ? 49  ALA B O   1 
ATOM   2439  C  CB  . ALA B  1 50  ? 45.897  62.174  -41.976  1.00 99.51  ? 49  ALA B CB  1 
ATOM   2440  N  N   . PRO B  1 51  ? 46.342  64.089  -39.339  1.00 85.21  ? 50  PRO B N   1 
ATOM   2441  C  CA  . PRO B  1 51  ? 46.737  65.395  -38.800  1.00 68.20  ? 50  PRO B CA  1 
ATOM   2442  C  C   . PRO B  1 51  ? 47.726  66.141  -39.698  1.00 74.90  ? 50  PRO B C   1 
ATOM   2443  O  O   . PRO B  1 51  ? 48.436  65.517  -40.489  1.00 79.82  ? 50  PRO B O   1 
ATOM   2444  C  CB  . PRO B  1 51  ? 47.400  65.028  -37.473  1.00 57.89  ? 50  PRO B CB  1 
ATOM   2445  C  CG  . PRO B  1 51  ? 47.967  63.668  -37.711  1.00 67.53  ? 50  PRO B CG  1 
ATOM   2446  C  CD  . PRO B  1 51  ? 47.021  62.975  -38.648  1.00 70.68  ? 50  PRO B CD  1 
ATOM   2447  N  N   . GLU B  1 52  ? 47.758  67.466  -39.574  1.00 72.07  ? 51  GLU B N   1 
ATOM   2448  C  CA  . GLU B  1 52  ? 48.719  68.289  -40.302  1.00 64.17  ? 51  GLU B CA  1 
ATOM   2449  C  C   . GLU B  1 52  ? 50.134  67.918  -39.906  1.00 54.60  ? 51  GLU B C   1 
ATOM   2450  O  O   . GLU B  1 52  ? 50.422  67.674  -38.729  1.00 52.82  ? 51  GLU B O   1 
ATOM   2451  C  CB  . GLU B  1 52  ? 48.519  69.773  -39.992  1.00 53.78  ? 51  GLU B CB  1 
ATOM   2452  C  CG  . GLU B  1 52  ? 47.563  70.505  -40.900  1.00 91.06  ? 51  GLU B CG  1 
ATOM   2453  C  CD  . GLU B  1 52  ? 47.880  71.987  -40.970  1.00 91.46  ? 51  GLU B CD  1 
ATOM   2454  O  OE1 . GLU B  1 52  ? 48.708  72.457  -40.153  1.00 72.74  ? 51  GLU B OE1 1 
ATOM   2455  O  OE2 . GLU B  1 52  ? 47.316  72.674  -41.848  1.00 83.48  ? 51  GLU B OE2 1 
ATOM   2456  N  N   . LEU B  1 53  ? 51.028  67.910  -40.885  1.00 49.69  ? 52  LEU B N   1 
ATOM   2457  C  CA  . LEU B  1 53  ? 52.434  67.651  -40.612  1.00 46.42  ? 52  LEU B CA  1 
ATOM   2458  C  C   . LEU B  1 53  ? 53.290  68.778  -41.160  1.00 52.81  ? 52  LEU B C   1 
ATOM   2459  O  O   . LEU B  1 53  ? 52.841  69.561  -42.003  1.00 55.13  ? 52  LEU B O   1 
ATOM   2460  C  CB  . LEU B  1 53  ? 52.868  66.328  -41.253  1.00 43.24  ? 52  LEU B CB  1 
ATOM   2461  C  CG  . LEU B  1 53  ? 51.991  65.108  -40.964  1.00 54.22  ? 52  LEU B CG  1 
ATOM   2462  C  CD1 . LEU B  1 53  ? 52.442  63.935  -41.811  1.00 61.14  ? 52  LEU B CD1 1 
ATOM   2463  C  CD2 . LEU B  1 53  ? 52.048  64.754  -39.477  1.00 53.64  ? 52  LEU B CD2 1 
ATOM   2464  N  N   . PHE B  1 54  ? 54.527  68.849  -40.670  1.00 45.52  ? 53  PHE B N   1 
ATOM   2465  C  CA  . PHE B  1 54  ? 55.525  69.735  -41.232  1.00 38.98  ? 53  PHE B CA  1 
ATOM   2466  C  C   . PHE B  1 54  ? 56.717  68.887  -41.649  1.00 44.57  ? 53  PHE B C   1 
ATOM   2467  O  O   . PHE B  1 54  ? 57.086  67.944  -40.949  1.00 40.87  ? 53  PHE B O   1 
ATOM   2468  C  CB  . PHE B  1 54  ? 55.958  70.783  -40.202  1.00 47.76  ? 53  PHE B CB  1 
ATOM   2469  C  CG  . PHE B  1 54  ? 55.032  71.959  -40.116  1.00 44.29  ? 53  PHE B CG  1 
ATOM   2470  C  CD1 . PHE B  1 54  ? 55.062  72.945  -41.086  1.00 51.39  ? 53  PHE B CD1 1 
ATOM   2471  C  CD2 . PHE B  1 54  ? 54.136  72.081  -39.066  1.00 55.04  ? 53  PHE B CD2 1 
ATOM   2472  C  CE1 . PHE B  1 54  ? 54.204  74.044  -41.020  1.00 68.57  ? 53  PHE B CE1 1 
ATOM   2473  C  CE2 . PHE B  1 54  ? 53.273  73.177  -38.987  1.00 55.03  ? 53  PHE B CE2 1 
ATOM   2474  C  CZ  . PHE B  1 54  ? 53.312  74.158  -39.968  1.00 56.55  ? 53  PHE B CZ  1 
ATOM   2475  N  N   . LEU B  1 55  ? 57.302  69.217  -42.793  1.00 50.02  ? 54  LEU B N   1 
ATOM   2476  C  CA  . LEU B  1 55  ? 58.498  68.532  -43.264  1.00 46.06  ? 54  LEU B CA  1 
ATOM   2477  C  C   . LEU B  1 55  ? 59.616  69.552  -43.486  1.00 51.19  ? 54  LEU B C   1 
ATOM   2478  O  O   . LEU B  1 55  ? 59.453  70.500  -44.261  1.00 57.65  ? 54  LEU B O   1 
ATOM   2479  C  CB  . LEU B  1 55  ? 58.184  67.777  -44.557  1.00 46.62  ? 54  LEU B CB  1 
ATOM   2480  C  CG  . LEU B  1 55  ? 59.342  67.081  -45.274  1.00 49.71  ? 54  LEU B CG  1 
ATOM   2481  C  CD1 . LEU B  1 55  ? 59.921  65.984  -44.420  1.00 41.14  ? 54  LEU B CD1 1 
ATOM   2482  C  CD2 . LEU B  1 55  ? 58.866  66.535  -46.614  1.00 52.29  ? 54  LEU B CD2 1 
ATOM   2483  N  N   . LYS B  1 56  ? 60.728  69.371  -42.779  1.00 39.89  ? 55  LYS B N   1 
ATOM   2484  C  CA  . LYS B  1 56  ? 61.898  70.231  -42.929  1.00 39.12  ? 55  LYS B CA  1 
ATOM   2485  C  C   . LYS B  1 56  ? 62.963  69.494  -43.711  1.00 48.09  ? 55  LYS B C   1 
ATOM   2486  O  O   . LYS B  1 56  ? 63.304  68.350  -43.385  1.00 41.26  ? 55  LYS B O   1 
ATOM   2487  C  CB  . LYS B  1 56  ? 62.500  70.621  -41.575  1.00 43.36  ? 55  LYS B CB  1 
ATOM   2488  C  CG  . LYS B  1 56  ? 61.729  71.644  -40.770  1.00 60.84  ? 55  LYS B CG  1 
ATOM   2489  C  CD  . LYS B  1 56  ? 62.604  72.188  -39.644  1.00 60.31  ? 55  LYS B CD  1 
ATOM   2490  C  CE  . LYS B  1 56  ? 61.837  73.160  -38.762  1.00 76.56  ? 55  LYS B CE  1 
ATOM   2491  N  NZ  . LYS B  1 56  ? 62.722  73.835  -37.772  1.00 66.81  ? 55  LYS B NZ  1 
ATOM   2492  N  N   . HIS B  1 57  ? 63.497  70.166  -44.726  1.00 43.68  ? 56  HIS B N   1 
ATOM   2493  C  CA  . HIS B  1 57  ? 64.597  69.634  -45.508  1.00 50.68  ? 56  HIS B CA  1 
ATOM   2494  C  C   . HIS B  1 57  ? 65.815  70.547  -45.395  1.00 55.22  ? 56  HIS B C   1 
ATOM   2495  O  O   . HIS B  1 57  ? 65.746  71.726  -45.744  1.00 49.26  ? 56  HIS B O   1 
ATOM   2496  C  CB  . HIS B  1 57  ? 64.200  69.518  -46.979  1.00 43.72  ? 56  HIS B CB  1 
ATOM   2497  C  CG  . HIS B  1 57  ? 65.311  69.034  -47.857  1.00 70.85  ? 56  HIS B CG  1 
ATOM   2498  N  ND1 . HIS B  1 57  ? 65.473  69.459  -49.157  1.00 55.29  ? 56  HIS B ND1 1 
ATOM   2499  C  CD2 . HIS B  1 57  ? 66.325  68.170  -47.613  1.00 46.57  ? 56  HIS B CD2 1 
ATOM   2500  C  CE1 . HIS B  1 57  ? 66.536  68.872  -49.680  1.00 65.56  ? 56  HIS B CE1 1 
ATOM   2501  N  NE2 . HIS B  1 57  ? 67.068  68.081  -48.765  1.00 53.05  ? 56  HIS B NE2 1 
ATOM   2502  N  N   . GLY B  1 58  ? 66.927  70.002  -44.911  1.00 43.58  ? 57  GLY B N   1 
ATOM   2503  C  CA  . GLY B  1 58  ? 68.169  70.749  -44.864  1.00 47.04  ? 57  GLY B CA  1 
ATOM   2504  C  C   . GLY B  1 58  ? 69.254  70.116  -45.714  1.00 51.98  ? 57  GLY B C   1 
ATOM   2505  O  O   . GLY B  1 58  ? 69.390  68.897  -45.766  1.00 43.97  ? 57  GLY B O   1 
ATOM   2506  N  N   . LYS B  1 59  ? 70.035  70.956  -46.379  1.00 45.14  ? 58  LYS B N   1 
ATOM   2507  C  CA  . LYS B  1 59  ? 71.093  70.498  -47.262  1.00 45.86  ? 58  LYS B CA  1 
ATOM   2508  C  C   . LYS B  1 59  ? 72.429  71.100  -46.803  1.00 53.56  ? 58  LYS B C   1 
ATOM   2509  O  O   . LYS B  1 59  ? 72.465  72.199  -46.247  1.00 48.80  ? 58  LYS B O   1 
ATOM   2510  C  CB  . LYS B  1 59  ? 70.756  70.905  -48.697  1.00 60.68  ? 58  LYS B CB  1 
ATOM   2511  C  CG  . LYS B  1 59  ? 71.616  70.272  -49.770  1.00 80.83  ? 58  LYS B CG  1 
ATOM   2512  C  CD  . LYS B  1 59  ? 71.078  70.596  -51.167  1.00 74.92  ? 58  LYS B CD  1 
ATOM   2513  C  CE  . LYS B  1 59  ? 70.715  72.072  -51.310  1.00 84.47  ? 58  LYS B CE  1 
ATOM   2514  N  NZ  . LYS B  1 59  ? 71.890  72.984  -51.168  1.00 81.82  ? 58  LYS B NZ  1 
ATOM   2515  N  N   . GLY B  1 60  ? 73.520  70.373  -47.016  1.00 59.00  ? 59  GLY B N   1 
ATOM   2516  C  CA  . GLY B  1 60  ? 74.825  70.808  -46.548  1.00 55.20  ? 59  GLY B CA  1 
ATOM   2517  C  C   . GLY B  1 60  ? 74.860  71.076  -45.052  1.00 68.28  ? 59  GLY B C   1 
ATOM   2518  O  O   . GLY B  1 60  ? 74.422  70.249  -44.248  1.00 53.15  ? 59  GLY B O   1 
ATOM   2519  N  N   . SER B  1 61  ? 75.366  72.248  -44.676  1.00 50.54  ? 60  SER B N   1 
ATOM   2520  C  CA  . SER B  1 61  ? 75.441  72.627  -43.267  1.00 50.97  ? 60  SER B CA  1 
ATOM   2521  C  C   . SER B  1 61  ? 74.062  72.673  -42.616  1.00 49.84  ? 60  SER B C   1 
ATOM   2522  O  O   . SER B  1 61  ? 73.922  72.366  -41.434  1.00 57.93  ? 60  SER B O   1 
ATOM   2523  C  CB  . SER B  1 61  ? 76.150  73.976  -43.094  1.00 66.26  ? 60  SER B CB  1 
ATOM   2524  O  OG  . SER B  1 61  ? 75.323  75.052  -43.498  1.00 74.97  ? 60  SER B OG  1 
ATOM   2525  N  N   . VAL B  1 62  ? 73.046  73.046  -43.390  1.00 50.46  ? 61  VAL B N   1 
ATOM   2526  C  CA  . VAL B  1 62  ? 71.675  73.090  -42.874  1.00 48.52  ? 61  VAL B CA  1 
ATOM   2527  C  C   . VAL B  1 62  ? 71.184  71.697  -42.473  1.00 38.44  ? 61  VAL B C   1 
ATOM   2528  O  O   . VAL B  1 62  ? 70.356  71.560  -41.573  1.00 39.43  ? 61  VAL B O   1 
ATOM   2529  C  CB  . VAL B  1 62  ? 70.689  73.729  -43.889  1.00 67.37  ? 61  VAL B CB  1 
ATOM   2530  C  CG1 . VAL B  1 62  ? 69.275  73.855  -43.283  1.00 43.47  ? 61  VAL B CG1 1 
ATOM   2531  C  CG2 . VAL B  1 62  ? 71.200  75.085  -44.332  1.00 61.41  ? 61  VAL B CG2 1 
ATOM   2532  N  N   . ALA B  1 63  ? 71.711  70.664  -43.122  1.00 41.03  ? 62  ALA B N   1 
ATOM   2533  C  CA  . ALA B  1 63  ? 71.398  69.290  -42.730  1.00 38.52  ? 62  ALA B CA  1 
ATOM   2534  C  C   . ALA B  1 63  ? 71.797  69.041  -41.279  1.00 39.07  ? 62  ALA B C   1 
ATOM   2535  O  O   . ALA B  1 63  ? 71.099  68.344  -40.532  1.00 31.24  ? 62  ALA B O   1 
ATOM   2536  C  CB  . ALA B  1 63  ? 72.074  68.289  -43.655  1.00 39.75  ? 62  ALA B CB  1 
ATOM   2537  N  N   . ASN B  1 64  ? 72.910  69.632  -40.860  1.00 38.59  ? 63  ASN B N   1 
ATOM   2538  C  CA  . ASN B  1 64  ? 73.312  69.506  -39.465  1.00 40.57  ? 63  ASN B CA  1 
ATOM   2539  C  C   . ASN B  1 64  ? 72.348  70.209  -38.511  1.00 39.47  ? 63  ASN B C   1 
ATOM   2540  O  O   . ASN B  1 64  ? 72.025  69.682  -37.449  1.00 37.69  ? 63  ASN B O   1 
ATOM   2541  C  CB  . ASN B  1 64  ? 74.751  69.985  -39.275  1.00 37.35  ? 63  ASN B CB  1 
ATOM   2542  C  CG  . ASN B  1 64  ? 75.744  69.080  -39.983  1.00 37.23  ? 63  ASN B CG  1 
ATOM   2543  O  OD1 . ASN B  1 64  ? 75.618  67.862  -39.935  1.00 43.50  ? 63  ASN B OD1 1 
ATOM   2544  N  ND2 . ASN B  1 64  ? 76.723  69.672  -40.657  1.00 40.77  ? 63  ASN B ND2 1 
ATOM   2545  N  N   . ASP B  1 65  ? 71.867  71.384  -38.907  1.00 46.96  ? 64  ASP B N   1 
ATOM   2546  C  CA  . ASP B  1 65  ? 70.894  72.118  -38.101  1.00 38.67  ? 64  ASP B CA  1 
ATOM   2547  C  C   . ASP B  1 65  ? 69.626  71.306  -37.878  1.00 31.06  ? 64  ASP B C   1 
ATOM   2548  O  O   . ASP B  1 65  ? 69.098  71.240  -36.766  1.00 40.83  ? 64  ASP B O   1 
ATOM   2549  C  CB  . ASP B  1 65  ? 70.520  73.436  -38.776  1.00 50.63  ? 64  ASP B CB  1 
ATOM   2550  C  CG  . ASP B  1 65  ? 71.691  74.386  -38.876  1.00 72.56  ? 64  ASP B CG  1 
ATOM   2551  O  OD1 . ASP B  1 65  ? 72.550  74.361  -37.971  1.00 51.47  ? 64  ASP B OD1 1 
ATOM   2552  O  OD2 . ASP B  1 65  ? 71.754  75.152  -39.859  1.00 56.87  ? 64  ASP B OD2 1 
ATOM   2553  N  N   . VAL B  1 66  ? 69.142  70.691  -38.949  1.00 38.86  ? 65  VAL B N   1 
ATOM   2554  C  CA  . VAL B  1 66  ? 67.931  69.899  -38.873  1.00 30.95  ? 65  VAL B CA  1 
ATOM   2555  C  C   . VAL B  1 66  ? 68.164  68.685  -37.972  1.00 33.81  ? 65  VAL B C   1 
ATOM   2556  O  O   . VAL B  1 66  ? 67.297  68.304  -37.189  1.00 33.37  ? 65  VAL B O   1 
ATOM   2557  C  CB  . VAL B  1 66  ? 67.467  69.463  -40.272  1.00 31.70  ? 65  VAL B CB  1 
ATOM   2558  C  CG1 . VAL B  1 66  ? 66.235  68.582  -40.159  1.00 35.54  ? 65  VAL B CG1 1 
ATOM   2559  C  CG2 . VAL B  1 66  ? 67.178  70.697  -41.147  1.00 37.86  ? 65  VAL B CG2 1 
ATOM   2560  N  N   . THR B  1 67  ? 69.350  68.087  -38.074  1.00 36.20  ? 66  THR B N   1 
ATOM   2561  C  CA  . THR B  1 67  ? 69.697  66.951  -37.221  1.00 33.23  ? 66  THR B CA  1 
ATOM   2562  C  C   . THR B  1 67  ? 69.742  67.367  -35.742  1.00 28.54  ? 66  THR B C   1 
ATOM   2563  O  O   . THR B  1 67  ? 69.281  66.623  -34.866  1.00 29.73  ? 66  THR B O   1 
ATOM   2564  C  CB  . THR B  1 67  ? 71.062  66.332  -37.629  1.00 35.29  ? 66  THR B CB  1 
ATOM   2565  O  OG1 . THR B  1 67  ? 71.016  65.923  -39.004  1.00 37.37  ? 66  THR B OG1 1 
ATOM   2566  C  CG2 . THR B  1 67  ? 71.387  65.126  -36.760  1.00 34.12  ? 66  THR B CG2 1 
ATOM   2567  N  N   . ASP B  1 68  ? 70.281  68.558  -35.482  1.00 34.36  ? 67  ASP B N   1 
ATOM   2568  C  CA  . ASP B  1 68  ? 70.353  69.100  -34.126  1.00 29.05  ? 67  ASP B CA  1 
ATOM   2569  C  C   . ASP B  1 68  ? 68.973  69.253  -33.544  1.00 34.35  ? 67  ASP B C   1 
ATOM   2570  O  O   . ASP B  1 68  ? 68.762  68.973  -32.361  1.00 33.86  ? 67  ASP B O   1 
ATOM   2571  C  CB  . ASP B  1 68  ? 71.025  70.481  -34.094  1.00 35.89  ? 67  ASP B CB  1 
ATOM   2572  C  CG  . ASP B  1 68  ? 72.514  70.427  -34.386  1.00 57.39  ? 67  ASP B CG  1 
ATOM   2573  O  OD1 . ASP B  1 68  ? 73.075  69.316  -34.415  1.00 47.76  ? 67  ASP B OD1 1 
ATOM   2574  O  OD2 . ASP B  1 68  ? 73.124  71.507  -34.578  1.00 51.59  ? 67  ASP B OD2 1 
ATOM   2575  N  N   . GLU B  1 69  ? 68.036  69.734  -34.365  1.00 34.18  ? 68  GLU B N   1 
ATOM   2576  C  CA  . GLU B  1 69  ? 66.661  69.891  -33.902  1.00 32.36  ? 68  GLU B CA  1 
ATOM   2577  C  C   . GLU B  1 69  ? 66.020  68.545  -33.600  1.00 29.33  ? 68  GLU B C   1 
ATOM   2578  O  O   . GLU B  1 69  ? 65.315  68.389  -32.586  1.00 34.12  ? 68  GLU B O   1 
ATOM   2579  C  CB  . GLU B  1 69  ? 65.796  70.691  -34.898  1.00 35.64  ? 68  GLU B CB  1 
ATOM   2580  C  CG  . GLU B  1 69  ? 64.308  70.445  -34.668  1.00 58.55  ? 68  GLU B CG  1 
ATOM   2581  C  CD  . GLU B  1 69  ? 63.422  71.607  -35.065  1.00 78.37  ? 68  GLU B CD  1 
ATOM   2582  O  OE1 . GLU B  1 69  ? 63.610  72.142  -36.177  1.00 73.47  ? 68  GLU B OE1 1 
ATOM   2583  O  OE2 . GLU B  1 69  ? 62.535  71.979  -34.257  1.00 50.27  ? 68  GLU B OE2 1 
HETATM 2584  N  N   . MSE B  1 70  ? 66.261  67.571  -34.482  1.00 30.25  ? 69  MSE B N   1 
HETATM 2585  C  CA  . MSE B  1 70  ? 65.652  66.254  -34.334  1.00 28.93  ? 69  MSE B CA  1 
HETATM 2586  C  C   . MSE B  1 70  ? 66.027  65.634  -32.990  1.00 30.10  ? 69  MSE B C   1 
HETATM 2587  O  O   . MSE B  1 70  ? 65.162  65.156  -32.258  1.00 30.96  ? 69  MSE B O   1 
HETATM 2588  C  CB  . MSE B  1 70  ? 66.068  65.315  -35.480  1.00 27.49  ? 69  MSE B CB  1 
HETATM 2589  C  CG  . MSE B  1 70  ? 65.379  63.948  -35.460  1.00 28.70  ? 69  MSE B CG  1 
HETATM 2590  SE SE  . MSE B  1 70  ? 66.256  62.650  -34.257  0.62 34.12  ? 69  MSE B SE  1 
HETATM 2591  C  CE  . MSE B  1 70  ? 67.949  62.648  -35.135  1.00 37.62  ? 69  MSE B CE  1 
ATOM   2592  N  N   . VAL B  1 71  ? 67.313  65.630  -32.650  1.00 29.51  ? 70  VAL B N   1 
ATOM   2593  C  CA  A VAL B  1 71  ? 67.702  64.994  -31.394  0.53 35.65  ? 70  VAL B CA  1 
ATOM   2594  C  CA  B VAL B  1 71  ? 67.743  64.998  -31.407  0.47 34.16  ? 70  VAL B CA  1 
ATOM   2595  C  C   . VAL B  1 71  ? 67.232  65.752  -30.173  1.00 26.75  ? 70  VAL B C   1 
ATOM   2596  O  O   . VAL B  1 71  ? 66.896  65.139  -29.147  1.00 34.31  ? 70  VAL B O   1 
ATOM   2597  C  CB  A VAL B  1 71  ? 69.199  64.694  -31.292  0.53 32.31  ? 70  VAL B CB  1 
ATOM   2598  C  CB  B VAL B  1 71  ? 69.284  64.776  -31.362  0.47 38.27  ? 70  VAL B CB  1 
ATOM   2599  C  CG1 A VAL B  1 71  ? 69.486  63.489  -32.101  0.53 26.52  ? 70  VAL B CG1 1 
ATOM   2600  C  CG1 B VAL B  1 71  ? 70.045  66.093  -31.178  0.47 21.86  ? 70  VAL B CG1 1 
ATOM   2601  C  CG2 A VAL B  1 71  ? 70.039  65.889  -31.740  0.53 37.73  ? 70  VAL B CG2 1 
ATOM   2602  C  CG2 B VAL B  1 71  ? 69.632  63.797  -30.272  0.47 23.34  ? 70  VAL B CG2 1 
ATOM   2603  N  N   . ARG B  1 72  ? 67.170  67.077  -30.274  1.00 29.65  ? 71  ARG B N   1 
ATOM   2604  C  CA  . ARG B  1 72  ? 66.636  67.851  -29.162  1.00 31.03  ? 71  ARG B CA  1 
ATOM   2605  C  C   . ARG B  1 72  ? 65.116  67.659  -28.996  1.00 34.97  ? 71  ARG B C   1 
ATOM   2606  O  O   . ARG B  1 72  ? 64.615  67.597  -27.878  1.00 34.66  ? 71  ARG B O   1 
ATOM   2607  C  CB  . ARG B  1 72  ? 67.055  69.326  -29.280  1.00 29.55  ? 71  ARG B CB  1 
ATOM   2608  C  CG  . ARG B  1 72  ? 68.543  69.500  -28.933  1.00 29.53  ? 71  ARG B CG  1 
ATOM   2609  C  CD  . ARG B  1 72  ? 69.175  70.726  -29.552  1.00 28.76  ? 71  ARG B CD  1 
ATOM   2610  N  NE  . ARG B  1 72  ? 70.568  70.852  -29.127  1.00 33.78  ? 71  ARG B NE  1 
ATOM   2611  C  CZ  . ARG B  1 72  ? 71.578  70.144  -29.646  1.00 35.73  ? 71  ARG B CZ  1 
ATOM   2612  N  NH1 . ARG B  1 72  ? 71.369  69.274  -30.633  1.00 31.55  ? 71  ARG B NH1 1 
ATOM   2613  N  NH2 . ARG B  1 72  ? 72.805  70.323  -29.191  1.00 31.92  ? 71  ARG B NH2 1 
ATOM   2614  N  N   . LEU B  1 73  ? 64.387  67.535  -30.102  1.00 26.35  ? 72  LEU B N   1 
ATOM   2615  C  CA  . LEU B  1 73  ? 62.954  67.207  -30.038  1.00 33.34  ? 72  LEU B CA  1 
ATOM   2616  C  C   . LEU B  1 73  ? 62.734  65.860  -29.345  1.00 37.06  ? 72  LEU B C   1 
ATOM   2617  O  O   . LEU B  1 73  ? 61.867  65.720  -28.486  1.00 34.11  ? 72  LEU B O   1 
ATOM   2618  C  CB  . LEU B  1 73  ? 62.343  67.135  -31.440  1.00 38.65  ? 72  LEU B CB  1 
ATOM   2619  C  CG  . LEU B  1 73  ? 61.929  68.400  -32.187  1.00 48.59  ? 72  LEU B CG  1 
ATOM   2620  C  CD1 . LEU B  1 73  ? 61.663  68.056  -33.651  1.00 41.15  ? 72  LEU B CD1 1 
ATOM   2621  C  CD2 . LEU B  1 73  ? 60.681  69.021  -31.550  1.00 37.88  ? 72  LEU B CD2 1 
ATOM   2622  N  N   . ASN B  1 74  ? 63.521  64.870  -29.743  1.00 36.84  ? 73  ASN B N   1 
ATOM   2623  C  CA  . ASN B  1 74  ? 63.421  63.526  -29.188  1.00 35.99  ? 73  ASN B CA  1 
ATOM   2624  C  C   . ASN B  1 74  ? 63.686  63.498  -27.685  1.00 33.29  ? 73  ASN B C   1 
ATOM   2625  O  O   . ASN B  1 74  ? 62.978  62.817  -26.931  1.00 38.98  ? 73  ASN B O   1 
ATOM   2626  C  CB  . ASN B  1 74  ? 64.393  62.599  -29.912  1.00 36.20  ? 73  ASN B CB  1 
ATOM   2627  C  CG  . ASN B  1 74  ? 64.224  61.155  -29.510  1.00 42.12  ? 73  ASN B CG  1 
ATOM   2628  O  OD1 . ASN B  1 74  ? 63.184  60.549  -29.773  1.00 43.92  ? 73  ASN B OD1 1 
ATOM   2629  N  ND2 . ASN B  1 74  ? 65.246  60.589  -28.876  1.00 43.86  ? 73  ASN B ND2 1 
ATOM   2630  N  N   . TRP B  1 75  ? 64.692  64.255  -27.251  1.00 36.85  ? 74  TRP B N   1 
ATOM   2631  C  CA  . TRP B  1 75  ? 65.050  64.296  -25.839  1.00 31.33  ? 74  TRP B CA  1 
ATOM   2632  C  C   . TRP B  1 75  ? 64.032  65.072  -25.021  1.00 36.44  ? 74  TRP B C   1 
ATOM   2633  O  O   . TRP B  1 75  ? 63.473  64.562  -24.032  1.00 33.12  ? 74  TRP B O   1 
ATOM   2634  C  CB  . TRP B  1 75  ? 66.440  64.918  -25.619  1.00 25.76  ? 74  TRP B CB  1 
ATOM   2635  C  CG  . TRP B  1 75  ? 66.661  65.113  -24.155  1.00 34.07  ? 74  TRP B CG  1 
ATOM   2636  C  CD1 . TRP B  1 75  ? 66.880  64.127  -23.229  1.00 36.67  ? 74  TRP B CD1 1 
ATOM   2637  C  CD2 . TRP B  1 75  ? 66.618  66.345  -23.425  1.00 38.75  ? 74  TRP B CD2 1 
ATOM   2638  N  NE1 . TRP B  1 75  ? 66.987  64.670  -21.976  1.00 35.22  ? 74  TRP B NE1 1 
ATOM   2639  C  CE2 . TRP B  1 75  ? 66.825  66.029  -22.063  1.00 35.16  ? 74  TRP B CE2 1 
ATOM   2640  C  CE3 . TRP B  1 75  ? 66.440  67.685  -23.788  1.00 29.75  ? 74  TRP B CE3 1 
ATOM   2641  C  CZ2 . TRP B  1 75  ? 66.856  67.001  -21.068  1.00 38.17  ? 74  TRP B CZ2 1 
ATOM   2642  C  CZ3 . TRP B  1 75  ? 66.456  68.651  -22.797  1.00 34.16  ? 74  TRP B CZ3 1 
ATOM   2643  C  CH2 . TRP B  1 75  ? 66.668  68.307  -21.452  1.00 44.12  ? 74  TRP B CH2 1 
ATOM   2644  N  N   . LEU B  1 76  ? 63.771  66.308  -25.438  1.00 32.39  ? 75  LEU B N   1 
ATOM   2645  C  CA  . LEU B  1 76  ? 62.975  67.227  -24.622  1.00 34.42  ? 75  LEU B CA  1 
ATOM   2646  C  C   . LEU B  1 76  ? 61.495  66.858  -24.559  1.00 40.78  ? 75  LEU B C   1 
ATOM   2647  O  O   . LEU B  1 76  ? 60.784  67.278  -23.644  1.00 35.60  ? 75  LEU B O   1 
ATOM   2648  C  CB  . LEU B  1 76  ? 63.143  68.673  -25.115  1.00 33.65  ? 75  LEU B CB  1 
ATOM   2649  C  CG  . LEU B  1 76  ? 62.439  69.828  -24.385  1.00 38.80  ? 75  LEU B CG  1 
ATOM   2650  C  CD1 . LEU B  1 76  ? 62.824  69.912  -22.913  1.00 33.20  ? 75  LEU B CD1 1 
ATOM   2651  C  CD2 . LEU B  1 76  ? 62.757  71.156  -25.083  1.00 34.68  ? 75  LEU B CD2 1 
ATOM   2652  N  N   . THR B  1 77  ? 61.021  66.059  -25.508  1.00 32.80  ? 76  THR B N   1 
ATOM   2653  C  CA  . THR B  1 77  ? 59.592  65.760  -25.521  1.00 37.56  ? 76  THR B CA  1 
ATOM   2654  C  C   . THR B  1 77  ? 59.145  64.930  -24.306  1.00 43.45  ? 76  THR B C   1 
ATOM   2655  O  O   . THR B  1 77  ? 57.965  64.878  -23.991  1.00 35.77  ? 76  THR B O   1 
ATOM   2656  C  CB  . THR B  1 77  ? 59.137  65.097  -26.832  1.00 46.70  ? 76  THR B CB  1 
ATOM   2657  O  OG1 . THR B  1 77  ? 57.712  65.231  -26.956  1.00 45.87  ? 76  THR B OG1 1 
ATOM   2658  C  CG2 . THR B  1 77  ? 59.531  63.625  -26.862  1.00 42.72  ? 76  THR B CG2 1 
ATOM   2659  N  N   . ALA B  1 78  ? 60.095  64.306  -23.612  1.00 42.63  ? 77  ALA B N   1 
ATOM   2660  C  CA  . ALA B  1 78  ? 59.785  63.566  -22.389  1.00 45.49  ? 77  ALA B CA  1 
ATOM   2661  C  C   . ALA B  1 78  ? 59.398  64.484  -21.236  1.00 41.22  ? 77  ALA B C   1 
ATOM   2662  O  O   . ALA B  1 78  ? 58.819  64.038  -20.241  1.00 42.13  ? 77  ALA B O   1 
ATOM   2663  C  CB  . ALA B  1 78  ? 60.957  62.670  -21.992  1.00 42.73  ? 77  ALA B CB  1 
ATOM   2664  N  N   . PHE B  1 79  ? 59.683  65.774  -21.386  1.00 35.04  ? 78  PHE B N   1 
ATOM   2665  C  CA  . PHE B  1 79  ? 59.479  66.747  -20.318  1.00 41.12  ? 78  PHE B CA  1 
ATOM   2666  C  C   . PHE B  1 79  ? 58.516  67.871  -20.713  1.00 52.30  ? 78  PHE B C   1 
ATOM   2667  O  O   . PHE B  1 79  ? 57.926  68.511  -19.846  1.00 52.30  ? 78  PHE B O   1 
ATOM   2668  C  CB  . PHE B  1 79  ? 60.829  67.373  -19.911  1.00 38.59  ? 78  PHE B CB  1 
ATOM   2669  C  CG  . PHE B  1 79  ? 61.884  66.363  -19.538  1.00 46.45  ? 78  PHE B CG  1 
ATOM   2670  C  CD1 . PHE B  1 79  ? 61.914  65.809  -18.265  1.00 50.02  ? 78  PHE B CD1 1 
ATOM   2671  C  CD2 . PHE B  1 79  ? 62.845  65.965  -20.456  1.00 36.05  ? 78  PHE B CD2 1 
ATOM   2672  C  CE1 . PHE B  1 79  ? 62.884  64.875  -17.927  1.00 38.98  ? 78  PHE B CE1 1 
ATOM   2673  C  CE2 . PHE B  1 79  ? 63.811  65.038  -20.120  1.00 37.86  ? 78  PHE B CE2 1 
ATOM   2674  C  CZ  . PHE B  1 79  ? 63.829  64.492  -18.850  1.00 33.23  ? 78  PHE B CZ  1 
HETATM 2675  N  N   . MSE B  1 80  ? 58.383  68.128  -22.014  1.00 43.04  ? 79  MSE B N   1 
HETATM 2676  C  CA  . MSE B  1 80  ? 57.645  69.304  -22.506  1.00 41.00  ? 79  MSE B CA  1 
HETATM 2677  C  C   . MSE B  1 80  ? 56.769  68.962  -23.713  1.00 43.65  ? 79  MSE B C   1 
HETATM 2678  O  O   . MSE B  1 80  ? 57.040  67.999  -24.429  1.00 39.19  ? 79  MSE B O   1 
HETATM 2679  C  CB  . MSE B  1 80  ? 58.611  70.442  -22.873  1.00 37.91  ? 79  MSE B CB  1 
HETATM 2680  C  CG  . MSE B  1 80  ? 59.460  70.971  -21.726  1.00 38.40  ? 79  MSE B CG  1 
HETATM 2681  SE SE  . MSE B  1 80  ? 58.470  71.796  -20.267  0.56 46.73  ? 79  MSE B SE  1 
HETATM 2682  C  CE  . MSE B  1 80  ? 58.244  73.562  -21.024  1.00 49.65  ? 79  MSE B CE  1 
ATOM   2683  N  N   . PRO B  1 81  ? 55.705  69.749  -23.941  1.00 40.85  ? 80  PRO B N   1 
ATOM   2684  C  CA  . PRO B  1 81  ? 54.838  69.494  -25.099  1.00 41.26  ? 80  PRO B CA  1 
ATOM   2685  C  C   . PRO B  1 81  ? 55.496  70.017  -26.380  1.00 47.54  ? 80  PRO B C   1 
ATOM   2686  O  O   . PRO B  1 81  ? 55.632  71.232  -26.563  1.00 51.67  ? 80  PRO B O   1 
ATOM   2687  C  CB  . PRO B  1 81  ? 53.565  70.281  -24.760  1.00 40.98  ? 80  PRO B CB  1 
ATOM   2688  C  CG  . PRO B  1 81  ? 54.053  71.410  -23.897  1.00 43.59  ? 80  PRO B CG  1 
ATOM   2689  C  CD  . PRO B  1 81  ? 55.200  70.849  -23.097  1.00 51.40  ? 80  PRO B CD  1 
ATOM   2690  N  N   . LEU B  1 82  ? 55.911  69.091  -27.241  1.00 39.72  ? 81  LEU B N   1 
ATOM   2691  C  CA  . LEU B  1 82  ? 56.650  69.405  -28.456  1.00 39.27  ? 81  LEU B CA  1 
ATOM   2692  C  C   . LEU B  1 82  ? 56.012  68.713  -29.653  1.00 49.07  ? 81  LEU B C   1 
ATOM   2693  O  O   . LEU B  1 82  ? 55.224  67.787  -29.483  1.00 41.76  ? 81  LEU B O   1 
ATOM   2694  C  CB  . LEU B  1 82  ? 58.091  68.908  -28.328  1.00 46.89  ? 81  LEU B CB  1 
ATOM   2695  C  CG  . LEU B  1 82  ? 58.923  69.474  -27.185  1.00 46.71  ? 81  LEU B CG  1 
ATOM   2696  C  CD1 . LEU B  1 82  ? 60.365  69.009  -27.301  1.00 43.81  ? 81  LEU B CD1 1 
ATOM   2697  C  CD2 . LEU B  1 82  ? 58.858  70.978  -27.192  1.00 43.98  ? 81  LEU B CD2 1 
ATOM   2698  N  N   . PRO B  1 83  ? 56.352  69.155  -30.874  1.00 38.68  ? 82  PRO B N   1 
ATOM   2699  C  CA  . PRO B  1 83  ? 55.916  68.370  -32.032  1.00 38.66  ? 82  PRO B CA  1 
ATOM   2700  C  C   . PRO B  1 83  ? 56.455  66.945  -31.923  1.00 41.35  ? 82  PRO B C   1 
ATOM   2701  O  O   . PRO B  1 83  ? 57.554  66.742  -31.391  1.00 40.62  ? 82  PRO B O   1 
ATOM   2702  C  CB  . PRO B  1 83  ? 56.586  69.086  -33.209  1.00 38.45  ? 82  PRO B CB  1 
ATOM   2703  C  CG  . PRO B  1 83  ? 56.810  70.491  -32.724  1.00 39.86  ? 82  PRO B CG  1 
ATOM   2704  C  CD  . PRO B  1 83  ? 57.150  70.333  -31.269  1.00 42.46  ? 82  PRO B CD  1 
ATOM   2705  N  N   . THR B  1 84  ? 55.692  65.978  -32.411  1.00 46.34  ? 83  THR B N   1 
ATOM   2706  C  CA  . THR B  1 84  ? 56.119  64.586  -32.385  1.00 42.54  ? 83  THR B CA  1 
ATOM   2707  C  C   . THR B  1 84  ? 56.859  64.217  -33.669  1.00 37.73  ? 83  THR B C   1 
ATOM   2708  O  O   . THR B  1 84  ? 56.414  64.545  -34.772  1.00 41.89  ? 83  THR B O   1 
ATOM   2709  C  CB  . THR B  1 84  ? 54.910  63.633  -32.204  1.00 41.35  ? 83  THR B CB  1 
ATOM   2710  O  OG1 . THR B  1 84  ? 54.141  64.046  -31.069  1.00 57.72  ? 83  THR B OG1 1 
ATOM   2711  C  CG2 . THR B  1 84  ? 55.377  62.202  -31.997  1.00 56.95  ? 83  THR B CG2 1 
ATOM   2712  N  N   . ILE B  1 85  ? 57.981  63.523  -33.520  1.00 33.29  ? 84  ILE B N   1 
ATOM   2713  C  CA  . ILE B  1 85  ? 58.756  63.069  -34.674  1.00 35.48  ? 84  ILE B CA  1 
ATOM   2714  C  C   . ILE B  1 85  ? 58.060  61.892  -35.348  1.00 44.95  ? 84  ILE B C   1 
ATOM   2715  O  O   . ILE B  1 85  ? 57.878  60.835  -34.741  1.00 44.20  ? 84  ILE B O   1 
ATOM   2716  C  CB  . ILE B  1 85  ? 60.166  62.647  -34.247  1.00 34.38  ? 84  ILE B CB  1 
ATOM   2717  C  CG1 . ILE B  1 85  ? 60.901  63.834  -33.626  1.00 30.60  ? 84  ILE B CG1 1 
ATOM   2718  C  CG2 . ILE B  1 85  ? 60.953  62.092  -35.433  1.00 38.41  ? 84  ILE B CG2 1 
ATOM   2719  C  CD1 . ILE B  1 85  ? 62.220  63.454  -32.946  1.00 31.53  ? 84  ILE B CD1 1 
ATOM   2720  N  N   . LYS B  1 86  ? 57.652  62.073  -36.598  1.00 37.19  ? 85  LYS B N   1 
ATOM   2721  C  CA  . LYS B  1 86  ? 57.029  60.981  -37.331  1.00 35.84  ? 85  LYS B CA  1 
ATOM   2722  C  C   . LYS B  1 86  ? 58.079  60.200  -38.111  1.00 39.47  ? 85  LYS B C   1 
ATOM   2723  O  O   . LYS B  1 86  ? 57.991  58.981  -38.242  1.00 34.62  ? 85  LYS B O   1 
ATOM   2724  C  CB  . LYS B  1 86  ? 55.927  61.490  -38.266  1.00 47.18  ? 85  LYS B CB  1 
ATOM   2725  C  CG  . LYS B  1 86  ? 54.598  60.773  -38.077  1.00 71.12  ? 85  LYS B CG  1 
ATOM   2726  C  CD  . LYS B  1 86  ? 53.782  60.742  -39.363  1.00 71.73  ? 85  LYS B CD  1 
ATOM   2727  C  CE  . LYS B  1 86  ? 52.611  59.772  -39.250  1.00 59.46  ? 85  LYS B CE  1 
ATOM   2728  N  NZ  . LYS B  1 86  ? 52.036  59.428  -40.582  1.00 78.72  ? 85  LYS B NZ  1 
ATOM   2729  N  N   . HIS B  1 87  ? 59.083  60.902  -38.620  1.00 36.38  ? 86  HIS B N   1 
ATOM   2730  C  CA  . HIS B  1 87  ? 60.072  60.252  -39.465  1.00 32.57  ? 86  HIS B CA  1 
ATOM   2731  C  C   . HIS B  1 87  ? 61.238  61.211  -39.635  1.00 38.70  ? 86  HIS B C   1 
ATOM   2732  O  O   . HIS B  1 87  ? 61.034  62.415  -39.784  1.00 38.55  ? 86  HIS B O   1 
ATOM   2733  C  CB  . HIS B  1 87  ? 59.450  59.906  -40.829  1.00 33.17  ? 86  HIS B CB  1 
ATOM   2734  C  CG  . HIS B  1 87  ? 60.099  58.751  -41.534  1.00 51.73  ? 86  HIS B CG  1 
ATOM   2735  N  ND1 . HIS B  1 87  ? 59.420  57.590  -41.840  1.00 64.32  ? 86  HIS B ND1 1 
ATOM   2736  C  CD2 . HIS B  1 87  ? 61.357  58.585  -42.010  1.00 58.14  ? 86  HIS B CD2 1 
ATOM   2737  C  CE1 . HIS B  1 87  ? 60.233  56.757  -42.466  1.00 60.77  ? 86  HIS B CE1 1 
ATOM   2738  N  NE2 . HIS B  1 87  ? 61.414  57.337  -42.583  1.00 43.76  ? 86  HIS B NE2 1 
ATOM   2739  N  N   . PHE B  1 88  ? 62.456  60.681  -39.592  1.00 34.17  ? 87  PHE B N   1 
ATOM   2740  C  CA  . PHE B  1 88  ? 63.654  61.476  -39.844  1.00 29.32  ? 87  PHE B CA  1 
ATOM   2741  C  C   . PHE B  1 88  ? 64.614  60.660  -40.692  1.00 41.54  ? 87  PHE B C   1 
ATOM   2742  O  O   . PHE B  1 88  ? 64.771  59.468  -40.477  1.00 30.85  ? 87  PHE B O   1 
ATOM   2743  C  CB  . PHE B  1 88  ? 64.342  61.878  -38.529  1.00 27.33  ? 87  PHE B CB  1 
ATOM   2744  C  CG  . PHE B  1 88  ? 65.668  62.584  -38.722  1.00 35.22  ? 87  PHE B CG  1 
ATOM   2745  C  CD1 . PHE B  1 88  ? 65.716  63.950  -38.964  1.00 33.01  ? 87  PHE B CD1 1 
ATOM   2746  C  CD2 . PHE B  1 88  ? 66.864  61.881  -38.649  1.00 35.91  ? 87  PHE B CD2 1 
ATOM   2747  C  CE1 . PHE B  1 88  ? 66.930  64.611  -39.137  1.00 35.38  ? 87  PHE B CE1 1 
ATOM   2748  C  CE2 . PHE B  1 88  ? 68.078  62.527  -38.825  1.00 29.67  ? 87  PHE B CE2 1 
ATOM   2749  C  CZ  . PHE B  1 88  ? 68.114  63.897  -39.072  1.00 33.98  ? 87  PHE B CZ  1 
ATOM   2750  N  N   . ILE B  1 89  ? 65.266  61.305  -41.648  1.00 30.92  ? 88  ILE B N   1 
ATOM   2751  C  CA  . ILE B  1 89  ? 66.195  60.621  -42.537  1.00 33.82  ? 88  ILE B CA  1 
ATOM   2752  C  C   . ILE B  1 89  ? 67.445  61.488  -42.640  1.00 39.44  ? 88  ILE B C   1 
ATOM   2753  O  O   . ILE B  1 89  ? 67.332  62.684  -42.833  1.00 35.91  ? 88  ILE B O   1 
ATOM   2754  C  CB  . ILE B  1 89  ? 65.589  60.482  -43.957  1.00 42.81  ? 88  ILE B CB  1 
ATOM   2755  C  CG1 . ILE B  1 89  ? 64.353  59.579  -43.952  1.00 37.57  ? 88  ILE B CG1 1 
ATOM   2756  C  CG2 . ILE B  1 89  ? 66.611  59.943  -44.960  1.00 42.75  ? 88  ILE B CG2 1 
ATOM   2757  C  CD1 . ILE B  1 89  ? 63.672  59.518  -45.293  1.00 45.88  ? 88  ILE B CD1 1 
ATOM   2758  N  N   A ARG B  1 90  ? 68.623  60.887  -42.489  0.50 28.70  ? 89  ARG B N   1 
ATOM   2759  N  N   B ARG B  1 90  ? 68.624  60.881  -42.501  0.50 39.10  ? 89  ARG B N   1 
ATOM   2760  C  CA  A ARG B  1 90  ? 69.880  61.591  -42.735  0.50 39.26  ? 89  ARG B CA  1 
ATOM   2761  C  CA  B ARG B  1 90  ? 69.894  61.577  -42.721  0.50 38.43  ? 89  ARG B CA  1 
ATOM   2762  C  C   A ARG B  1 90  ? 70.715  60.835  -43.766  0.50 42.83  ? 89  ARG B C   1 
ATOM   2763  C  C   B ARG B  1 90  ? 70.714  60.828  -43.771  0.50 42.72  ? 89  ARG B C   1 
ATOM   2764  O  O   A ARG B  1 90  ? 70.944  59.631  -43.636  0.50 36.49  ? 89  ARG B O   1 
ATOM   2765  O  O   B ARG B  1 90  ? 70.931  59.620  -43.660  0.50 33.96  ? 89  ARG B O   1 
ATOM   2766  C  CB  A ARG B  1 90  ? 70.670  61.779  -41.434  0.50 32.30  ? 89  ARG B CB  1 
ATOM   2767  C  CB  B ARG B  1 90  ? 70.684  61.693  -41.410  0.50 36.71  ? 89  ARG B CB  1 
ATOM   2768  C  CG  A ARG B  1 90  ? 71.996  62.528  -41.593  0.50 34.59  ? 89  ARG B CG  1 
ATOM   2769  C  CG  B ARG B  1 90  ? 72.004  62.480  -41.491  0.50 31.29  ? 89  ARG B CG  1 
ATOM   2770  C  CD  A ARG B  1 90  ? 71.775  63.966  -42.047  0.50 28.57  ? 89  ARG B CD  1 
ATOM   2771  C  CD  B ARG B  1 90  ? 71.763  63.979  -41.621  0.50 44.16  ? 89  ARG B CD  1 
ATOM   2772  N  NE  A ARG B  1 90  ? 72.995  64.572  -42.583  0.50 38.19  ? 89  ARG B NE  1 
ATOM   2773  N  NE  B ARG B  1 90  ? 72.961  64.776  -41.346  0.50 34.78  ? 89  ARG B NE  1 
ATOM   2774  C  CZ  A ARG B  1 90  ? 73.811  65.367  -41.897  0.50 39.28  ? 89  ARG B CZ  1 
ATOM   2775  C  CZ  B ARG B  1 90  ? 73.760  65.284  -42.279  0.50 44.15  ? 89  ARG B CZ  1 
ATOM   2776  N  NH1 A ARG B  1 90  ? 73.547  65.672  -40.634  0.50 45.03  ? 89  ARG B NH1 1 
ATOM   2777  N  NH1 B ARG B  1 90  ? 73.503  65.088  -43.568  0.50 33.46  ? 89  ARG B NH1 1 
ATOM   2778  N  NH2 A ARG B  1 90  ? 74.892  65.868  -42.484  0.50 40.89  ? 89  ARG B NH2 1 
ATOM   2779  N  NH2 B ARG B  1 90  ? 74.818  66.000  -41.923  0.50 43.04  ? 89  ARG B NH2 1 
ATOM   2780  N  N   . THR B  1 91  ? 71.142  61.540  -44.806  1.00 37.20  ? 90  THR B N   1 
ATOM   2781  C  CA  . THR B  1 91  ? 72.087  60.989  -45.771  1.00 36.47  ? 90  THR B CA  1 
ATOM   2782  C  C   . THR B  1 91  ? 73.281  61.953  -45.720  1.00 39.42  ? 90  THR B C   1 
ATOM   2783  O  O   . THR B  1 91  ? 73.216  62.948  -44.996  1.00 37.51  ? 90  THR B O   1 
ATOM   2784  C  CB  . THR B  1 91  ? 71.461  60.825  -47.173  1.00 44.12  ? 90  THR B CB  1 
ATOM   2785  O  OG1 . THR B  1 91  ? 71.005  62.091  -47.657  1.00 38.71  ? 90  THR B OG1 1 
ATOM   2786  C  CG2 . THR B  1 91  ? 70.301  59.821  -47.128  1.00 44.65  ? 90  THR B CG2 1 
ATOM   2787  N  N   . PRO B  1 92  ? 74.388  61.640  -46.413  1.00 36.34  ? 91  PRO B N   1 
ATOM   2788  C  CA  . PRO B  1 92  ? 75.565  62.501  -46.225  1.00 35.87  ? 91  PRO B CA  1 
ATOM   2789  C  C   . PRO B  1 92  ? 75.324  64.013  -46.379  1.00 38.84  ? 91  PRO B C   1 
ATOM   2790  O  O   . PRO B  1 92  ? 75.873  64.793  -45.599  1.00 56.21  ? 91  PRO B O   1 
ATOM   2791  C  CB  . PRO B  1 92  ? 76.521  62.001  -47.311  1.00 45.30  ? 91  PRO B CB  1 
ATOM   2792  C  CG  . PRO B  1 92  ? 76.216  60.545  -47.387  1.00 44.18  ? 91  PRO B CG  1 
ATOM   2793  C  CD  . PRO B  1 92  ? 74.725  60.436  -47.202  1.00 40.79  ? 91  PRO B CD  1 
ATOM   2794  N  N   A ASP B  1 93  ? 74.501  64.409  -47.346  0.49 40.49  ? 92  ASP B N   1 
ATOM   2795  N  N   B ASP B  1 93  ? 74.506  64.417  -47.346  0.51 40.64  ? 92  ASP B N   1 
ATOM   2796  C  CA  A ASP B  1 93  ? 74.299  65.830  -47.620  0.49 45.46  ? 92  ASP B CA  1 
ATOM   2797  C  CA  B ASP B  1 93  ? 74.308  65.842  -47.595  0.51 46.44  ? 92  ASP B CA  1 
ATOM   2798  C  C   A ASP B  1 93  ? 72.897  66.362  -47.331  0.49 50.58  ? 92  ASP B C   1 
ATOM   2799  C  C   B ASP B  1 93  ? 72.876  66.339  -47.407  0.51 54.57  ? 92  ASP B C   1 
ATOM   2800  O  O   A ASP B  1 93  ? 72.632  67.544  -47.551  0.49 42.49  ? 92  ASP B O   1 
ATOM   2801  O  O   B ASP B  1 93  ? 72.568  67.472  -47.776  0.51 50.15  ? 92  ASP B O   1 
ATOM   2802  C  CB  A ASP B  1 93  ? 74.664  66.149  -49.070  0.49 46.63  ? 92  ASP B CB  1 
ATOM   2803  C  CB  B ASP B  1 93  ? 74.791  66.209  -48.998  0.51 53.06  ? 92  ASP B CB  1 
ATOM   2804  C  CG  A ASP B  1 93  ? 75.756  67.185  -49.171  0.49 63.53  ? 92  ASP B CG  1 
ATOM   2805  C  CG  B ASP B  1 93  ? 76.221  65.780  -49.248  0.51 61.77  ? 92  ASP B CG  1 
ATOM   2806  O  OD1 A ASP B  1 93  ? 76.937  66.811  -49.010  0.49 86.88  ? 92  ASP B OD1 1 
ATOM   2807  O  OD1 B ASP B  1 93  ? 77.051  65.879  -48.317  0.51 44.27  ? 92  ASP B OD1 1 
ATOM   2808  O  OD2 A ASP B  1 93  ? 75.436  68.370  -49.402  0.49 67.62  ? 92  ASP B OD2 1 
ATOM   2809  O  OD2 B ASP B  1 93  ? 76.509  65.331  -50.374  0.51 59.34  ? 92  ASP B OD2 1 
ATOM   2810  N  N   . ASP B  1 94  ? 72.006  65.507  -46.842  1.00 39.70  ? 93  ASP B N   1 
ATOM   2811  C  CA  . ASP B  1 94  ? 70.607  65.901  -46.659  1.00 37.30  ? 93  ASP B CA  1 
ATOM   2812  C  C   . ASP B  1 94  ? 70.014  65.379  -45.365  1.00 37.74  ? 93  ASP B C   1 
ATOM   2813  O  O   . ASP B  1 94  ? 70.369  64.306  -44.896  1.00 37.53  ? 93  ASP B O   1 
ATOM   2814  C  CB  . ASP B  1 94  ? 69.729  65.410  -47.827  1.00 36.53  ? 93  ASP B CB  1 
ATOM   2815  C  CG  . ASP B  1 94  ? 70.111  66.019  -49.143  1.00 54.61  ? 93  ASP B CG  1 
ATOM   2816  O  OD1 . ASP B  1 94  ? 70.981  65.434  -49.820  1.00 50.29  ? 93  ASP B OD1 1 
ATOM   2817  O  OD2 . ASP B  1 94  ? 69.535  67.069  -49.507  1.00 47.65  ? 93  ASP B OD2 1 
ATOM   2818  N  N   . ALA B  1 95  ? 69.118  66.163  -44.781  1.00 42.63  ? 94  ALA B N   1 
ATOM   2819  C  CA  . ALA B  1 95  ? 68.314  65.684  -43.662  1.00 34.81  ? 94  ALA B CA  1 
ATOM   2820  C  C   . ALA B  1 95  ? 66.868  66.080  -43.902  1.00 51.15  ? 94  ALA B C   1 
ATOM   2821  O  O   . ALA B  1 95  ? 66.581  67.178  -44.394  1.00 41.63  ? 94  ALA B O   1 
ATOM   2822  C  CB  . ALA B  1 95  ? 68.818  66.226  -42.329  1.00 33.49  ? 94  ALA B CB  1 
ATOM   2823  N  N   . TRP B  1 96  ? 65.970  65.155  -43.582  1.00 36.22  ? 95  TRP B N   1 
ATOM   2824  C  CA  . TRP B  1 96  ? 64.539  65.351  -43.733  1.00 35.11  ? 95  TRP B CA  1 
ATOM   2825  C  C   . TRP B  1 96  ? 63.896  65.045  -42.391  1.00 40.60  ? 95  TRP B C   1 
ATOM   2826  O  O   . TRP B  1 96  ? 64.120  63.977  -41.818  1.00 37.87  ? 95  TRP B O   1 
ATOM   2827  C  CB  . TRP B  1 96  ? 63.993  64.391  -44.780  1.00 34.69  ? 95  TRP B CB  1 
ATOM   2828  C  CG  . TRP B  1 96  ? 64.475  64.666  -46.160  1.00 44.05  ? 95  TRP B CG  1 
ATOM   2829  C  CD1 . TRP B  1 96  ? 65.618  64.198  -46.744  1.00 55.29  ? 95  TRP B CD1 1 
ATOM   2830  C  CD2 . TRP B  1 96  ? 63.826  65.476  -47.139  1.00 47.66  ? 95  TRP B CD2 1 
ATOM   2831  N  NE1 . TRP B  1 96  ? 65.716  64.671  -48.031  1.00 51.45  ? 95  TRP B NE1 1 
ATOM   2832  C  CE2 . TRP B  1 96  ? 64.626  65.458  -48.296  1.00 52.12  ? 95  TRP B CE2 1 
ATOM   2833  C  CE3 . TRP B  1 96  ? 62.641  66.211  -47.152  1.00 53.72  ? 95  TRP B CE3 1 
ATOM   2834  C  CZ2 . TRP B  1 96  ? 64.279  66.148  -49.447  1.00 52.12  ? 95  TRP B CZ2 1 
ATOM   2835  C  CZ3 . TRP B  1 96  ? 62.301  66.894  -48.297  1.00 71.01  ? 95  TRP B CZ3 1 
ATOM   2836  C  CH2 . TRP B  1 96  ? 63.117  66.860  -49.427  1.00 71.77  ? 95  TRP B CH2 1 
ATOM   2837  N  N   . LEU B  1 97  ? 63.110  65.986  -41.883  1.00 37.67  ? 96  LEU B N   1 
ATOM   2838  C  CA  . LEU B  1 97  ? 62.496  65.848  -40.570  1.00 34.62  ? 96  LEU B CA  1 
ATOM   2839  C  C   . LEU B  1 97  ? 60.987  66.071  -40.664  1.00 45.54  ? 96  LEU B C   1 
ATOM   2840  O  O   . LEU B  1 97  ? 60.531  67.172  -40.978  1.00 37.74  ? 96  LEU B O   1 
ATOM   2841  C  CB  . LEU B  1 97  ? 63.114  66.844  -39.590  1.00 38.44  ? 96  LEU B CB  1 
ATOM   2842  C  CG  . LEU B  1 97  ? 62.476  66.894  -38.200  1.00 34.42  ? 96  LEU B CG  1 
ATOM   2843  C  CD1 . LEU B  1 97  ? 62.511  65.533  -37.521  1.00 34.00  ? 96  LEU B CD1 1 
ATOM   2844  C  CD2 . LEU B  1 97  ? 63.159  67.953  -37.335  1.00 45.48  ? 96  LEU B CD2 1 
ATOM   2845  N  N   . LEU B  1 98  ? 60.225  65.014  -40.408  1.00 36.34  ? 97  LEU B N   1 
ATOM   2846  C  CA  . LEU B  1 98  ? 58.778  65.047  -40.543  1.00 39.51  ? 97  LEU B CA  1 
ATOM   2847  C  C   . LEU B  1 98  ? 58.179  65.007  -39.153  1.00 39.24  ? 97  LEU B C   1 
ATOM   2848  O  O   . LEU B  1 98  ? 58.462  64.087  -38.390  1.00 42.66  ? 97  LEU B O   1 
ATOM   2849  C  CB  . LEU B  1 98  ? 58.298  63.839  -41.342  1.00 41.53  ? 97  LEU B CB  1 
ATOM   2850  C  CG  . LEU B  1 98  ? 56.791  63.773  -41.606  1.00 44.54  ? 97  LEU B CG  1 
ATOM   2851  C  CD1 . LEU B  1 98  ? 56.345  64.878  -42.576  1.00 45.51  ? 97  LEU B CD1 1 
ATOM   2852  C  CD2 . LEU B  1 98  ? 56.382  62.394  -42.120  1.00 47.62  ? 97  LEU B CD2 1 
ATOM   2853  N  N   . THR B  1 99  ? 57.373  66.013  -38.820  1.00 44.44  ? 98  THR B N   1 
ATOM   2854  C  CA  . THR B  1 99  ? 56.806  66.129  -37.480  1.00 32.82  ? 98  THR B CA  1 
ATOM   2855  C  C   . THR B  1 99  ? 55.341  66.525  -37.541  1.00 36.67  ? 98  THR B C   1 
ATOM   2856  O  O   . THR B  1 99  ? 54.876  67.081  -38.527  1.00 43.05  ? 98  THR B O   1 
ATOM   2857  C  CB  . THR B  1 99  ? 57.519  67.211  -36.639  1.00 38.46  ? 98  THR B CB  1 
ATOM   2858  O  OG1 . THR B  1 99  ? 57.338  68.484  -37.268  1.00 40.41  ? 98  THR B OG1 1 
ATOM   2859  C  CG2 . THR B  1 99  ? 59.007  66.915  -36.489  1.00 39.82  ? 98  THR B CG2 1 
ATOM   2860  N  N   . THR B  1 100 ? 54.614  66.227  -36.475  1.00 38.51  ? 99  THR B N   1 
ATOM   2861  C  CA  . THR B  1 100 ? 53.201  66.571  -36.393  1.00 38.94  ? 99  THR B CA  1 
ATOM   2862  C  C   . THR B  1 100 ? 53.068  68.060  -36.087  1.00 47.21  ? 99  THR B C   1 
ATOM   2863  O  O   . THR B  1 100 ? 53.885  68.626  -35.352  1.00 50.17  ? 99  THR B O   1 
ATOM   2864  C  CB  . THR B  1 100 ? 52.534  65.800  -35.262  1.00 51.35  ? 99  THR B CB  1 
ATOM   2865  O  OG1 . THR B  1 100 ? 53.147  66.178  -34.024  1.00 52.23  ? 99  THR B OG1 1 
ATOM   2866  C  CG2 . THR B  1 100 ? 52.703  64.302  -35.463  1.00 43.32  ? 99  THR B CG2 1 
ATOM   2867  N  N   . ALA B  1 101 ? 52.046  68.702  -36.637  1.00 43.02  ? 100 ALA B N   1 
ATOM   2868  C  CA  . ALA B  1 101 ? 51.836  70.118  -36.371  1.00 52.11  ? 100 ALA B CA  1 
ATOM   2869  C  C   . ALA B  1 101 ? 51.207  70.297  -35.000  1.00 63.12  ? 100 ALA B C   1 
ATOM   2870  O  O   . ALA B  1 101 ? 50.363  69.504  -34.585  1.00 59.85  ? 100 ALA B O   1 
ATOM   2871  C  CB  . ALA B  1 101 ? 50.949  70.739  -37.442  1.00 53.23  ? 100 ALA B CB  1 
ATOM   2872  N  N   . ILE B  1 102 ? 51.625  71.334  -34.289  1.00 44.38  ? 101 ILE B N   1 
ATOM   2873  C  CA  . ILE B  1 102 ? 50.909  71.722  -33.091  1.00 51.81  ? 101 ILE B CA  1 
ATOM   2874  C  C   . ILE B  1 102 ? 49.887  72.756  -33.501  1.00 55.56  ? 101 ILE B C   1 
ATOM   2875  O  O   . ILE B  1 102 ? 50.248  73.854  -33.937  1.00 50.46  ? 101 ILE B O   1 
ATOM   2876  C  CB  . ILE B  1 102 ? 51.821  72.333  -32.030  1.00 49.91  ? 101 ILE B CB  1 
ATOM   2877  C  CG1 . ILE B  1 102 ? 52.856  71.320  -31.553  1.00 56.69  ? 101 ILE B CG1 1 
ATOM   2878  C  CG2 . ILE B  1 102 ? 51.006  72.777  -30.840  1.00 46.93  ? 101 ILE B CG2 1 
ATOM   2879  C  CD1 . ILE B  1 102 ? 53.716  71.862  -30.426  1.00 56.19  ? 101 ILE B CD1 1 
ATOM   2880  N  N   . PRO B  1 103 ? 48.600  72.413  -33.372  1.00 50.56  ? 102 PRO B N   1 
ATOM   2881  C  CA  . PRO B  1 103 ? 47.545  73.348  -33.764  1.00 49.70  ? 102 PRO B CA  1 
ATOM   2882  C  C   . PRO B  1 103 ? 47.579  74.619  -32.916  1.00 51.27  ? 102 PRO B C   1 
ATOM   2883  O  O   . PRO B  1 103 ? 47.935  74.565  -31.739  1.00 49.69  ? 102 PRO B O   1 
ATOM   2884  C  CB  . PRO B  1 103 ? 46.254  72.555  -33.497  1.00 63.91  ? 102 PRO B CB  1 
ATOM   2885  C  CG  . PRO B  1 103 ? 46.636  71.543  -32.469  1.00 65.59  ? 102 PRO B CG  1 
ATOM   2886  C  CD  . PRO B  1 103 ? 48.064  71.178  -32.773  1.00 55.35  ? 102 PRO B CD  1 
ATOM   2887  N  N   . GLY B  1 104 ? 47.234  75.751  -33.520  1.00 41.52  ? 103 GLY B N   1 
ATOM   2888  C  CA  . GLY B  1 104 ? 47.153  77.005  -32.794  1.00 47.88  ? 103 GLY B CA  1 
ATOM   2889  C  C   . GLY B  1 104 ? 47.844  78.144  -33.515  1.00 41.29  ? 103 GLY B C   1 
ATOM   2890  O  O   . GLY B  1 104 ? 48.160  78.039  -34.700  1.00 45.74  ? 103 GLY B O   1 
ATOM   2891  N  N   . LYS B  1 105 ? 48.071  79.235  -32.788  1.00 36.14  ? 104 LYS B N   1 
ATOM   2892  C  CA  . LYS B  1 105 ? 48.760  80.409  -33.319  1.00 37.09  ? 104 LYS B CA  1 
ATOM   2893  C  C   . LYS B  1 105 ? 49.935  80.726  -32.418  1.00 32.87  ? 104 LYS B C   1 
ATOM   2894  O  O   . LYS B  1 105 ? 49.951  80.307  -31.259  1.00 36.65  ? 104 LYS B O   1 
ATOM   2895  C  CB  . LYS B  1 105 ? 47.808  81.603  -33.355  1.00 37.15  ? 104 LYS B CB  1 
ATOM   2896  C  CG  . LYS B  1 105 ? 46.647  81.409  -34.321  1.00 55.09  ? 104 LYS B CG  1 
ATOM   2897  C  CD  . LYS B  1 105 ? 45.659  82.552  -34.258  1.00 53.52  ? 104 LYS B CD  1 
ATOM   2898  C  CE  . LYS B  1 105 ? 44.564  82.376  -35.308  1.00 59.29  ? 104 LYS B CE  1 
ATOM   2899  N  NZ  . LYS B  1 105 ? 43.520  83.437  -35.204  1.00 77.77  ? 104 LYS B NZ  1 
ATOM   2900  N  N   . THR B  1 106 ? 50.911  81.476  -32.922  1.00 31.45  ? 105 THR B N   1 
ATOM   2901  C  CA  . THR B  1 106 ? 52.066  81.798  -32.093  1.00 32.20  ? 105 THR B CA  1 
ATOM   2902  C  C   . THR B  1 106 ? 51.659  82.782  -31.014  1.00 33.81  ? 105 THR B C   1 
ATOM   2903  O  O   . THR B  1 106 ? 50.627  83.446  -31.129  1.00 32.05  ? 105 THR B O   1 
ATOM   2904  C  CB  . THR B  1 106 ? 53.210  82.425  -32.908  1.00 35.31  ? 105 THR B CB  1 
ATOM   2905  O  OG1 . THR B  1 106 ? 52.778  83.695  -33.415  1.00 28.42  ? 105 THR B OG1 1 
ATOM   2906  C  CG2 . THR B  1 106 ? 53.602  81.512  -34.074  1.00 28.93  ? 105 THR B CG2 1 
ATOM   2907  N  N   . ALA B  1 107 ? 52.486  82.897  -29.980  1.00 31.00  ? 106 ALA B N   1 
ATOM   2908  C  CA  . ALA B  1 107 ? 52.239  83.885  -28.936  1.00 35.44  ? 106 ALA B CA  1 
ATOM   2909  C  C   . ALA B  1 107 ? 52.210  85.300  -29.522  1.00 39.36  ? 106 ALA B C   1 
ATOM   2910  O  O   . ALA B  1 107 ? 51.399  86.129  -29.098  1.00 34.86  ? 106 ALA B O   1 
ATOM   2911  C  CB  . ALA B  1 107 ? 53.280  83.764  -27.819  1.00 33.67  ? 106 ALA B CB  1 
ATOM   2912  N  N   . PHE B  1 108 ? 53.070  85.563  -30.511  1.00 29.36  ? 107 PHE B N   1 
ATOM   2913  C  CA  . PHE B  1 108 ? 53.018  86.837  -31.230  1.00 29.29  ? 107 PHE B CA  1 
ATOM   2914  C  C   . PHE B  1 108 ? 51.633  87.087  -31.821  1.00 31.32  ? 107 PHE B C   1 
ATOM   2915  O  O   . PHE B  1 108 ? 51.051  88.157  -31.630  1.00 33.88  ? 107 PHE B O   1 
ATOM   2916  C  CB  . PHE B  1 108 ? 54.083  86.922  -32.352  1.00 34.53  ? 107 PHE B CB  1 
ATOM   2917  C  CG  . PHE B  1 108 ? 54.059  88.232  -33.112  1.00 31.22  ? 107 PHE B CG  1 
ATOM   2918  C  CD1 . PHE B  1 108 ? 54.704  89.362  -32.603  1.00 30.40  ? 107 PHE B CD1 1 
ATOM   2919  C  CD2 . PHE B  1 108 ? 53.371  88.344  -34.317  1.00 34.34  ? 107 PHE B CD2 1 
ATOM   2920  C  CE1 . PHE B  1 108 ? 54.659  90.583  -33.289  1.00 30.56  ? 107 PHE B CE1 1 
ATOM   2921  C  CE2 . PHE B  1 108 ? 53.313  89.563  -35.014  1.00 36.44  ? 107 PHE B CE2 1 
ATOM   2922  C  CZ  . PHE B  1 108 ? 53.965  90.682  -34.498  1.00 34.52  ? 107 PHE B CZ  1 
ATOM   2923  N  N   . GLN B  1 109 ? 51.108  86.109  -32.552  1.00 26.57  ? 108 GLN B N   1 
ATOM   2924  C  CA  . GLN B  1 109 ? 49.818  86.285  -33.212  1.00 33.82  ? 108 GLN B CA  1 
ATOM   2925  C  C   . GLN B  1 109 ? 48.688  86.524  -32.210  1.00 30.98  ? 108 GLN B C   1 
ATOM   2926  O  O   . GLN B  1 109 ? 47.813  87.376  -32.420  1.00 33.74  ? 108 GLN B O   1 
ATOM   2927  C  CB  . GLN B  1 109 ? 49.501  85.074  -34.079  1.00 27.85  ? 108 GLN B CB  1 
ATOM   2928  C  CG  . GLN B  1 109 ? 50.451  84.925  -35.269  1.00 39.49  ? 108 GLN B CG  1 
ATOM   2929  C  CD  . GLN B  1 109 ? 50.156  83.688  -36.085  1.00 47.33  ? 108 GLN B CD  1 
ATOM   2930  O  OE1 . GLN B  1 109 ? 50.251  82.570  -35.583  1.00 39.23  ? 108 GLN B OE1 1 
ATOM   2931  N  NE2 . GLN B  1 109 ? 49.775  83.880  -37.346  1.00 51.22  ? 108 GLN B NE2 1 
ATOM   2932  N  N   . VAL B  1 110 ? 48.738  85.774  -31.118  1.00 35.63  ? 109 VAL B N   1 
ATOM   2933  C  CA  . VAL B  1 110 ? 47.708  85.836  -30.090  1.00 34.55  ? 109 VAL B CA  1 
ATOM   2934  C  C   . VAL B  1 110 ? 47.764  87.158  -29.335  1.00 35.19  ? 109 VAL B C   1 
ATOM   2935  O  O   . VAL B  1 110 ? 46.732  87.755  -29.061  1.00 33.87  ? 109 VAL B O   1 
ATOM   2936  C  CB  . VAL B  1 110 ? 47.808  84.635  -29.123  1.00 33.47  ? 109 VAL B CB  1 
ATOM   2937  C  CG1 . VAL B  1 110 ? 46.932  84.854  -27.882  1.00 39.19  ? 109 VAL B CG1 1 
ATOM   2938  C  CG2 . VAL B  1 110 ? 47.361  83.385  -29.847  1.00 39.44  ? 109 VAL B CG2 1 
ATOM   2939  N  N   . LEU B  1 111 ? 48.968  87.627  -29.022  1.00 30.41  ? 110 LEU B N   1 
ATOM   2940  C  CA  . LEU B  1 111 ? 49.118  88.952  -28.424  1.00 34.37  ? 110 LEU B CA  1 
ATOM   2941  C  C   . LEU B  1 111 ? 48.581  90.049  -29.332  1.00 35.66  ? 110 LEU B C   1 
ATOM   2942  O  O   . LEU B  1 111 ? 47.926  90.997  -28.863  1.00 37.14  ? 110 LEU B O   1 
ATOM   2943  C  CB  . LEU B  1 111 ? 50.586  89.237  -28.105  1.00 36.78  ? 110 LEU B CB  1 
ATOM   2944  C  CG  . LEU B  1 111 ? 51.114  89.074  -26.689  1.00 44.50  ? 110 LEU B CG  1 
ATOM   2945  C  CD1 . LEU B  1 111 ? 52.598  89.453  -26.669  1.00 46.30  ? 110 LEU B CD1 1 
ATOM   2946  C  CD2 . LEU B  1 111 ? 50.320  89.911  -25.696  1.00 39.99  ? 110 LEU B CD2 1 
ATOM   2947  N  N   . GLU B  1 112 ? 48.853  89.943  -30.634  1.00 32.03  ? 111 GLU B N   1 
ATOM   2948  C  CA  . GLU B  1 112 ? 48.335  90.940  -31.578  1.00 30.11  ? 111 GLU B CA  1 
ATOM   2949  C  C   . GLU B  1 112 ? 46.810  90.914  -31.647  1.00 38.86  ? 111 GLU B C   1 
ATOM   2950  O  O   . GLU B  1 112 ? 46.158  91.952  -31.758  1.00 38.29  ? 111 GLU B O   1 
ATOM   2951  C  CB  . GLU B  1 112 ? 48.895  90.713  -32.991  1.00 35.06  ? 111 GLU B CB  1 
ATOM   2952  C  CG  . GLU B  1 112 ? 50.393  90.977  -33.128  1.00 37.41  ? 111 GLU B CG  1 
ATOM   2953  C  CD  . GLU B  1 112 ? 50.727  92.463  -33.093  1.00 45.14  ? 111 GLU B CD  1 
ATOM   2954  O  OE1 . GLU B  1 112 ? 51.919  92.808  -32.965  1.00 53.62  ? 111 GLU B OE1 1 
ATOM   2955  O  OE2 . GLU B  1 112 ? 49.796  93.282  -33.214  1.00 41.55  ? 111 GLU B OE2 1 
ATOM   2956  N  N   . GLU B  1 113 ? 46.246  89.718  -31.603  1.00 29.67  ? 112 GLU B N   1 
ATOM   2957  C  CA  . GLU B  1 113 ? 44.799  89.550  -31.769  1.00 34.40  ? 112 GLU B CA  1 
ATOM   2958  C  C   . GLU B  1 113 ? 44.023  89.901  -30.494  1.00 30.95  ? 112 GLU B C   1 
ATOM   2959  O  O   . GLU B  1 113 ? 42.894  90.423  -30.546  1.00 33.93  ? 112 GLU B O   1 
ATOM   2960  C  CB  . GLU B  1 113 ? 44.489  88.112  -32.201  1.00 41.28  ? 112 GLU B CB  1 
ATOM   2961  C  CG  . GLU B  1 113 ? 43.005  87.850  -32.372  1.00 38.53  ? 112 GLU B CG  1 
ATOM   2962  C  CD  . GLU B  1 113 ? 42.703  86.507  -33.013  1.00 71.89  ? 112 GLU B CD  1 
ATOM   2963  O  OE1 . GLU B  1 113 ? 41.592  86.355  -33.574  1.00 60.33  ? 112 GLU B OE1 1 
ATOM   2964  O  OE2 . GLU B  1 113 ? 43.567  85.609  -32.951  1.00 76.86  ? 112 GLU B OE2 1 
ATOM   2965  N  N   . TYR B  1 114 ? 44.652  89.614  -29.359  1.00 32.75  ? 113 TYR B N   1 
ATOM   2966  C  CA  . TYR B  1 114 ? 44.082  89.844  -28.042  1.00 33.41  ? 113 TYR B CA  1 
ATOM   2967  C  C   . TYR B  1 114 ? 44.926  90.776  -27.162  1.00 34.03  ? 113 TYR B C   1 
ATOM   2968  O  O   . TYR B  1 114 ? 45.375  90.376  -26.090  1.00 36.55  ? 113 TYR B O   1 
ATOM   2969  C  CB  . TYR B  1 114 ? 43.886  88.488  -27.356  1.00 33.25  ? 113 TYR B CB  1 
ATOM   2970  C  CG  . TYR B  1 114 ? 42.702  87.749  -27.929  1.00 34.98  ? 113 TYR B CG  1 
ATOM   2971  C  CD1 . TYR B  1 114 ? 41.409  88.060  -27.517  1.00 41.48  ? 113 TYR B CD1 1 
ATOM   2972  C  CD2 . TYR B  1 114 ? 42.864  86.776  -28.904  1.00 39.96  ? 113 TYR B CD2 1 
ATOM   2973  C  CE1 . TYR B  1 114 ? 40.320  87.414  -28.041  1.00 49.51  ? 113 TYR B CE1 1 
ATOM   2974  C  CE2 . TYR B  1 114 ? 41.762  86.116  -29.439  1.00 47.81  ? 113 TYR B CE2 1 
ATOM   2975  C  CZ  . TYR B  1 114 ? 40.496  86.444  -28.999  1.00 52.28  ? 113 TYR B CZ  1 
ATOM   2976  O  OH  . TYR B  1 114 ? 39.385  85.814  -29.508  1.00 51.38  ? 113 TYR B OH  1 
ATOM   2977  N  N   . PRO B  1 115 ? 45.141  92.027  -27.615  1.00 33.32  ? 114 PRO B N   1 
ATOM   2978  C  CA  . PRO B  1 115 ? 46.017  92.951  -26.881  1.00 38.08  ? 114 PRO B CA  1 
ATOM   2979  C  C   . PRO B  1 115 ? 45.520  93.268  -25.461  1.00 37.77  ? 114 PRO B C   1 
ATOM   2980  O  O   . PRO B  1 115 ? 46.344  93.572  -24.596  1.00 38.47  ? 114 PRO B O   1 
ATOM   2981  C  CB  . PRO B  1 115 ? 46.017  94.211  -27.760  1.00 38.39  ? 114 PRO B CB  1 
ATOM   2982  C  CG  . PRO B  1 115 ? 44.734  94.128  -28.558  1.00 39.78  ? 114 PRO B CG  1 
ATOM   2983  C  CD  . PRO B  1 115 ? 44.583  92.650  -28.830  1.00 34.15  ? 114 PRO B CD  1 
ATOM   2984  N  N   . ASP B  1 116 ? 44.211  93.173  -25.222  1.00 32.14  ? 115 ASP B N   1 
ATOM   2985  C  CA  . ASP B  1 116 ? 43.662  93.364  -23.885  1.00 51.21  ? 115 ASP B CA  1 
ATOM   2986  C  C   . ASP B  1 116 ? 44.030  92.224  -22.954  1.00 51.52  ? 115 ASP B C   1 
ATOM   2987  O  O   . ASP B  1 116 ? 43.802  92.315  -21.751  1.00 40.83  ? 115 ASP B O   1 
ATOM   2988  C  CB  . ASP B  1 116 ? 42.136  93.492  -23.910  1.00 38.95  ? 115 ASP B CB  1 
ATOM   2989  C  CG  . ASP B  1 116 ? 41.667  94.815  -24.476  1.00 44.34  ? 115 ASP B CG  1 
ATOM   2990  O  OD1 . ASP B  1 116 ? 42.448  95.793  -24.456  1.00 43.22  ? 115 ASP B OD1 1 
ATOM   2991  O  OD2 . ASP B  1 116 ? 40.509  94.875  -24.940  1.00 54.09  ? 115 ASP B OD2 1 
ATOM   2992  N  N   . SER B  1 117 ? 44.582  91.145  -23.504  1.00 43.18  ? 116 SER B N   1 
ATOM   2993  C  CA  . SER B  1 117 ? 44.966  89.996  -22.678  1.00 34.49  ? 116 SER B CA  1 
ATOM   2994  C  C   . SER B  1 117 ? 46.477  89.913  -22.447  1.00 32.06  ? 116 SER B C   1 
ATOM   2995  O  O   . SER B  1 117 ? 46.978  88.870  -22.030  1.00 34.30  ? 116 SER B O   1 
ATOM   2996  C  CB  . SER B  1 117 ? 44.495  88.685  -23.314  1.00 39.51  ? 116 SER B CB  1 
ATOM   2997  O  OG  . SER B  1 117 ? 43.083  88.628  -23.370  1.00 43.02  ? 116 SER B OG  1 
ATOM   2998  N  N   . GLY B  1 118 ? 47.197  90.998  -22.716  1.00 37.19  ? 117 GLY B N   1 
ATOM   2999  C  CA  . GLY B  1 118 ? 48.652  90.964  -22.662  1.00 32.13  ? 117 GLY B CA  1 
ATOM   3000  C  C   . GLY B  1 118 ? 49.187  90.452  -21.335  1.00 32.06  ? 117 GLY B C   1 
ATOM   3001  O  O   . GLY B  1 118 ? 50.084  89.606  -21.295  1.00 35.48  ? 117 GLY B O   1 
ATOM   3002  N  N   . GLU B  1 119 ? 48.622  90.955  -20.244  1.00 36.69  ? 118 GLU B N   1 
ATOM   3003  C  CA  . GLU B  1 119 ? 49.071  90.553  -18.919  1.00 40.90  ? 118 GLU B CA  1 
ATOM   3004  C  C   . GLU B  1 119 ? 48.863  89.055  -18.659  1.00 37.06  ? 118 GLU B C   1 
ATOM   3005  O  O   . GLU B  1 119 ? 49.780  88.382  -18.182  1.00 38.12  ? 118 GLU B O   1 
ATOM   3006  C  CB  . GLU B  1 119 ? 48.449  91.447  -17.836  1.00 50.03  ? 118 GLU B CB  1 
ATOM   3007  C  CG  . GLU B  1 119 ? 48.960  92.894  -17.907  1.00 45.16  ? 118 GLU B CG  1 
ATOM   3008  C  CD  . GLU B  1 119 ? 48.198  93.857  -16.992  1.00 77.46  ? 118 GLU B CD  1 
ATOM   3009  O  OE1 . GLU B  1 119 ? 46.949  93.881  -17.042  1.00 55.95  ? 118 GLU B OE1 1 
ATOM   3010  O  OE2 . GLU B  1 119 ? 48.852  94.600  -16.228  1.00 62.78  ? 118 GLU B OE2 1 
ATOM   3011  N  N   . ASN B  1 120 ? 47.686  88.526  -18.992  1.00 47.28  ? 119 ASN B N   1 
ATOM   3012  C  CA  . ASN B  1 120 ? 47.439  87.083  -18.865  1.00 36.26  ? 119 ASN B CA  1 
ATOM   3013  C  C   . ASN B  1 120 ? 48.325  86.239  -19.778  1.00 34.22  ? 119 ASN B C   1 
ATOM   3014  O  O   . ASN B  1 120 ? 48.745  85.149  -19.412  1.00 36.27  ? 119 ASN B O   1 
ATOM   3015  C  CB  . ASN B  1 120 ? 45.974  86.752  -19.151  1.00 44.37  ? 119 ASN B CB  1 
ATOM   3016  C  CG  . ASN B  1 120 ? 45.079  86.973  -17.948  1.00 78.77  ? 119 ASN B CG  1 
ATOM   3017  O  OD1 . ASN B  1 120 ? 45.540  86.964  -16.801  1.00 61.35  ? 119 ASN B OD1 1 
ATOM   3018  N  ND2 . ASN B  1 120 ? 43.786  87.166  -18.202  1.00 64.67  ? 119 ASN B ND2 1 
ATOM   3019  N  N   . ILE B  1 121 ? 48.582  86.732  -20.988  1.00 36.47  ? 120 ILE B N   1 
ATOM   3020  C  CA  . ILE B  1 121 ? 49.455  86.004  -21.910  1.00 32.36  ? 120 ILE B CA  1 
ATOM   3021  C  C   . ILE B  1 121 ? 50.874  85.919  -21.350  1.00 31.70  ? 120 ILE B C   1 
ATOM   3022  O  O   . ILE B  1 121 ? 51.514  84.856  -21.369  1.00 31.42  ? 120 ILE B O   1 
ATOM   3023  C  CB  . ILE B  1 121 ? 49.443  86.640  -23.305  1.00 37.47  ? 120 ILE B CB  1 
ATOM   3024  C  CG1 . ILE B  1 121 ? 48.088  86.396  -23.973  1.00 39.84  ? 120 ILE B CG1 1 
ATOM   3025  C  CG2 . ILE B  1 121 ? 50.568  86.078  -24.156  1.00 33.41  ? 120 ILE B CG2 1 
ATOM   3026  C  CD1 . ILE B  1 121 ? 47.876  87.168  -25.269  1.00 35.04  ? 120 ILE B CD1 1 
ATOM   3027  N  N   . VAL B  1 122 ? 51.357  87.032  -20.812  1.00 35.41  ? 121 VAL B N   1 
ATOM   3028  C  CA  . VAL B  1 122 ? 52.684  87.026  -20.202  1.00 33.70  ? 121 VAL B CA  1 
ATOM   3029  C  C   . VAL B  1 122 ? 52.752  86.113  -18.976  1.00 38.03  ? 121 VAL B C   1 
ATOM   3030  O  O   . VAL B  1 122 ? 53.749  85.427  -18.787  1.00 31.78  ? 121 VAL B O   1 
ATOM   3031  C  CB  . VAL B  1 122 ? 53.197  88.455  -19.892  1.00 38.76  ? 121 VAL B CB  1 
ATOM   3032  C  CG1 . VAL B  1 122 ? 54.413  88.413  -18.960  1.00 49.02  ? 121 VAL B CG1 1 
ATOM   3033  C  CG2 . VAL B  1 122 ? 53.551  89.168  -21.178  1.00 41.41  ? 121 VAL B CG2 1 
ATOM   3034  N  N   . ASP B  1 123 ? 51.695  86.083  -18.158  1.00 45.07  ? 122 ASP B N   1 
ATOM   3035  C  CA  . ASP B  1 123 ? 51.672  85.178  -17.004  1.00 41.22  ? 122 ASP B CA  1 
ATOM   3036  C  C   . ASP B  1 123 ? 51.843  83.731  -17.454  1.00 46.73  ? 122 ASP B C   1 
ATOM   3037  O  O   . ASP B  1 123 ? 52.572  82.958  -16.833  1.00 39.34  ? 122 ASP B O   1 
ATOM   3038  C  CB  . ASP B  1 123 ? 50.381  85.318  -16.175  1.00 36.51  ? 122 ASP B CB  1 
ATOM   3039  C  CG  . ASP B  1 123 ? 50.273  86.664  -15.474  1.00 66.35  ? 122 ASP B CG  1 
ATOM   3040  O  OD1 . ASP B  1 123 ? 51.259  87.437  -15.488  1.00 48.88  ? 122 ASP B OD1 1 
ATOM   3041  O  OD2 . ASP B  1 123 ? 49.201  86.945  -14.897  1.00 57.18  ? 122 ASP B OD2 1 
ATOM   3042  N  N   . ALA B  1 124 ? 51.170  83.377  -18.544  1.00 39.71  ? 123 ALA B N   1 
ATOM   3043  C  CA  . ALA B  1 124 ? 51.236  82.025  -19.090  1.00 39.75  ? 123 ALA B CA  1 
ATOM   3044  C  C   . ALA B  1 124 ? 52.635  81.683  -19.642  1.00 34.63  ? 123 ALA B C   1 
ATOM   3045  O  O   . ALA B  1 124 ? 53.137  80.564  -19.473  1.00 37.25  ? 123 ALA B O   1 
ATOM   3046  C  CB  . ALA B  1 124 ? 50.161  81.854  -20.170  1.00 38.49  ? 123 ALA B CB  1 
ATOM   3047  N  N   . LEU B  1 125 ? 53.253  82.649  -20.312  1.00 32.73  ? 124 LEU B N   1 
ATOM   3048  C  CA  . LEU B  1 125 ? 54.610  82.476  -20.834  1.00 32.35  ? 124 LEU B CA  1 
ATOM   3049  C  C   . LEU B  1 125 ? 55.582  82.263  -19.676  1.00 34.54  ? 124 LEU B C   1 
ATOM   3050  O  O   . LEU B  1 125 ? 56.453  81.384  -19.726  1.00 34.89  ? 124 LEU B O   1 
ATOM   3051  C  CB  . LEU B  1 125 ? 55.012  83.700  -21.671  1.00 28.30  ? 124 LEU B CB  1 
ATOM   3052  C  CG  . LEU B  1 125 ? 54.371  83.871  -23.058  1.00 28.62  ? 124 LEU B CG  1 
ATOM   3053  C  CD1 . LEU B  1 125 ? 54.585  85.277  -23.584  1.00 35.06  ? 124 LEU B CD1 1 
ATOM   3054  C  CD2 . LEU B  1 125 ? 54.972  82.881  -24.028  1.00 36.86  ? 124 LEU B CD2 1 
ATOM   3055  N  N   . ALA B  1 126 ? 55.425  83.049  -18.616  1.00 37.07  ? 125 ALA B N   1 
ATOM   3056  C  CA  . ALA B  1 126 ? 56.293  82.878  -17.448  1.00 38.12  ? 125 ALA B CA  1 
ATOM   3057  C  C   . ALA B  1 126 ? 56.128  81.509  -16.772  1.00 46.24  ? 125 ALA B C   1 
ATOM   3058  O  O   . ALA B  1 126 ? 57.108  80.919  -16.339  1.00 35.89  ? 125 ALA B O   1 
ATOM   3059  C  CB  . ALA B  1 126 ? 56.071  83.997  -16.436  1.00 41.05  ? 125 ALA B CB  1 
ATOM   3060  N  N   . VAL B  1 127 ? 54.900  81.005  -16.671  1.00 35.23  ? 126 VAL B N   1 
ATOM   3061  C  CA  . VAL B  1 127 ? 54.686  79.694  -16.044  1.00 37.72  ? 126 VAL B CA  1 
ATOM   3062  C  C   . VAL B  1 127 ? 55.337  78.605  -16.893  1.00 38.44  ? 126 VAL B C   1 
ATOM   3063  O  O   . VAL B  1 127 ? 55.985  77.676  -16.370  1.00 35.03  ? 126 VAL B O   1 
ATOM   3064  C  CB  . VAL B  1 127 ? 53.180  79.379  -15.842  1.00 37.61  ? 126 VAL B CB  1 
ATOM   3065  C  CG1 . VAL B  1 127 ? 52.985  77.942  -15.369  1.00 43.81  ? 126 VAL B CG1 1 
ATOM   3066  C  CG2 . VAL B  1 127 ? 52.563  80.352  -14.845  1.00 44.89  ? 126 VAL B CG2 1 
ATOM   3067  N  N   . PHE B  1 128 ? 55.172  78.734  -18.202  1.00 35.98  ? 127 PHE B N   1 
ATOM   3068  C  CA  . PHE B  1 128 ? 55.750  77.783  -19.143  1.00 36.79  ? 127 PHE B CA  1 
ATOM   3069  C  C   . PHE B  1 128 ? 57.273  77.800  -19.053  1.00 42.60  ? 127 PHE B C   1 
ATOM   3070  O  O   . PHE B  1 128 ? 57.912  76.748  -19.018  1.00 36.04  ? 127 PHE B O   1 
ATOM   3071  C  CB  . PHE B  1 128 ? 55.285  78.078  -20.576  1.00 38.42  ? 127 PHE B CB  1 
ATOM   3072  C  CG  . PHE B  1 128 ? 55.543  76.945  -21.547  1.00 41.63  ? 127 PHE B CG  1 
ATOM   3073  C  CD1 . PHE B  1 128 ? 54.662  75.869  -21.632  1.00 36.66  ? 127 PHE B CD1 1 
ATOM   3074  C  CD2 . PHE B  1 128 ? 56.659  76.956  -22.371  1.00 52.85  ? 127 PHE B CD2 1 
ATOM   3075  C  CE1 . PHE B  1 128 ? 54.892  74.836  -22.523  1.00 45.47  ? 127 PHE B CE1 1 
ATOM   3076  C  CE2 . PHE B  1 128 ? 56.894  75.922  -23.261  1.00 49.42  ? 127 PHE B CE2 1 
ATOM   3077  C  CZ  . PHE B  1 128 ? 56.008  74.863  -23.337  1.00 50.50  ? 127 PHE B CZ  1 
ATOM   3078  N  N   . LEU B  1 129 ? 57.865  78.990  -18.998  1.00 35.03  ? 128 LEU B N   1 
ATOM   3079  C  CA  . LEU B  1 129 ? 59.327  79.065  -18.875  1.00 36.18  ? 128 LEU B CA  1 
ATOM   3080  C  C   . LEU B  1 129 ? 59.823  78.503  -17.535  1.00 42.63  ? 128 LEU B C   1 
ATOM   3081  O  O   . LEU B  1 129 ? 60.891  77.898  -17.468  1.00 31.06  ? 128 LEU B O   1 
ATOM   3082  C  CB  . LEU B  1 129 ? 59.836  80.495  -19.118  1.00 34.00  ? 128 LEU B CB  1 
ATOM   3083  C  CG  . LEU B  1 129 ? 61.360  80.681  -19.194  1.00 39.22  ? 128 LEU B CG  1 
ATOM   3084  C  CD1 . LEU B  1 129 ? 61.986  79.783  -20.284  1.00 30.08  ? 128 LEU B CD1 1 
ATOM   3085  C  CD2 . LEU B  1 129 ? 61.700  82.143  -19.438  1.00 37.87  ? 128 LEU B CD2 1 
ATOM   3086  N  N   . ARG B  1 130 ? 59.041  78.662  -16.468  1.00 33.95  ? 129 ARG B N   1 
ATOM   3087  C  CA  . ARG B  1 130 ? 59.456  78.135  -15.167  1.00 38.53  ? 129 ARG B CA  1 
ATOM   3088  C  C   . ARG B  1 130 ? 59.480  76.608  -15.214  1.00 37.16  ? 129 ARG B C   1 
ATOM   3089  O  O   . ARG B  1 130 ? 60.311  75.965  -14.568  1.00 38.16  ? 129 ARG B O   1 
ATOM   3090  C  CB  . ARG B  1 130 ? 58.517  78.610  -14.043  1.00 38.22  ? 129 ARG B CB  1 
ATOM   3091  C  CG  . ARG B  1 130 ? 58.791  80.024  -13.538  1.00 45.96  ? 129 ARG B CG  1 
ATOM   3092  C  CD  . ARG B  1 130 ? 57.695  80.496  -12.562  1.00 71.89  ? 129 ARG B CD  1 
ATOM   3093  N  NE  . ARG B  1 130 ? 57.559  79.614  -11.403  1.00 75.37  ? 129 ARG B NE  1 
ATOM   3094  C  CZ  . ARG B  1 130 ? 58.169  79.802  -10.234  1.00 85.98  ? 129 ARG B CZ  1 
ATOM   3095  N  NH1 . ARG B  1 130 ? 58.959  80.852  -10.048  1.00 64.38  ? 129 ARG B NH1 1 
ATOM   3096  N  NH2 . ARG B  1 130 ? 57.986  78.937  -9.244   1.00 72.75  ? 129 ARG B NH2 1 
ATOM   3097  N  N   A ARG B  1 131 ? 58.555  76.035  -15.977  0.50 36.35  ? 130 ARG B N   1 
ATOM   3098  N  N   B ARG B  1 131 ? 58.552  76.057  -15.988  0.50 35.06  ? 130 ARG B N   1 
ATOM   3099  C  CA  A ARG B  1 131 ? 58.459  74.586  -16.114  0.50 36.26  ? 130 ARG B CA  1 
ATOM   3100  C  CA  B ARG B  1 131 ? 58.401  74.620  -16.180  0.50 52.30  ? 130 ARG B CA  1 
ATOM   3101  C  C   A ARG B  1 131 ? 59.666  74.034  -16.875  0.50 54.09  ? 130 ARG B C   1 
ATOM   3102  C  C   B ARG B  1 131 ? 59.640  74.056  -16.872  0.50 53.12  ? 130 ARG B C   1 
ATOM   3103  O  O   A ARG B  1 131 ? 60.277  73.048  -16.453  0.50 34.06  ? 130 ARG B O   1 
ATOM   3104  O  O   B ARG B  1 131 ? 60.248  73.090  -16.403  0.50 44.24  ? 130 ARG B O   1 
ATOM   3105  C  CB  A ARG B  1 131 ? 57.144  74.198  -16.803  0.50 47.39  ? 130 ARG B CB  1 
ATOM   3106  C  CB  B ARG B  1 131 ? 57.150  74.382  -17.032  0.50 36.10  ? 130 ARG B CB  1 
ATOM   3107  C  CG  A ARG B  1 131 ? 57.041  72.730  -17.189  0.50 55.48  ? 130 ARG B CG  1 
ATOM   3108  C  CG  B ARG B  1 131 ? 56.654  72.955  -17.144  0.50 64.34  ? 130 ARG B CG  1 
ATOM   3109  C  CD  A ARG B  1 131 ? 55.592  72.233  -17.192  0.50 72.84  ? 130 ARG B CD  1 
ATOM   3110  C  CD  B ARG B  1 131 ? 55.224  72.976  -17.682  0.50 69.00  ? 130 ARG B CD  1 
ATOM   3111  N  NE  A ARG B  1 131 ? 54.706  73.032  -18.038  0.50 63.91  ? 130 ARG B NE  1 
ATOM   3112  N  NE  B ARG B  1 131 ? 54.880  71.801  -18.479  0.50 71.98  ? 130 ARG B NE  1 
ATOM   3113  C  CZ  A ARG B  1 131 ? 53.983  72.542  -19.043  0.50 67.08  ? 130 ARG B CZ  1 
ATOM   3114  C  CZ  B ARG B  1 131 ? 53.827  71.740  -19.291  0.50 48.99  ? 130 ARG B CZ  1 
ATOM   3115  N  NH1 A ARG B  1 131 ? 53.200  73.345  -19.752  0.50 54.24  ? 130 ARG B NH1 1 
ATOM   3116  N  NH1 B ARG B  1 131 ? 53.584  70.637  -19.982  0.50 61.80  ? 130 ARG B NH1 1 
ATOM   3117  N  NH2 A ARG B  1 131 ? 54.041  71.249  -19.338  0.50 61.16  ? 130 ARG B NH2 1 
ATOM   3118  N  NH2 B ARG B  1 131 ? 53.021  72.786  -19.416  0.50 48.86  ? 130 ARG B NH2 1 
ATOM   3119  N  N   . LEU B  1 132 ? 60.012  74.679  -17.986  1.00 33.99  ? 131 LEU B N   1 
ATOM   3120  C  CA  . LEU B  1 132 ? 61.208  74.297  -18.740  1.00 32.90  ? 131 LEU B CA  1 
ATOM   3121  C  C   . LEU B  1 132 ? 62.462  74.341  -17.853  1.00 38.71  ? 131 LEU B C   1 
ATOM   3122  O  O   . LEU B  1 132 ? 63.247  73.388  -17.810  1.00 34.64  ? 131 LEU B O   1 
ATOM   3123  C  CB  . LEU B  1 132 ? 61.403  75.224  -19.942  1.00 33.62  ? 131 LEU B CB  1 
ATOM   3124  C  CG  . LEU B  1 132 ? 62.685  74.989  -20.755  1.00 42.06  ? 131 LEU B CG  1 
ATOM   3125  C  CD1 . LEU B  1 132 ? 62.640  73.613  -21.387  1.00 35.08  ? 131 LEU B CD1 1 
ATOM   3126  C  CD2 . LEU B  1 132 ? 62.915  76.080  -21.831  1.00 31.75  ? 131 LEU B CD2 1 
ATOM   3127  N  N   . HIS B  1 133 ? 62.617  75.448  -17.132  1.00 34.31  ? 132 HIS B N   1 
ATOM   3128  C  CA  . HIS B  1 133 ? 63.778  75.691  -16.272  1.00 34.75  ? 132 HIS B CA  1 
ATOM   3129  C  C   . HIS B  1 133 ? 63.809  74.866  -14.983  1.00 45.19  ? 132 HIS B C   1 
ATOM   3130  O  O   . HIS B  1 133 ? 64.804  74.894  -14.248  1.00 36.92  ? 132 HIS B O   1 
ATOM   3131  C  CB  . HIS B  1 133 ? 63.870  77.190  -15.959  1.00 30.40  ? 132 HIS B CB  1 
ATOM   3132  C  CG  . HIS B  1 133 ? 64.315  78.018  -17.125  1.00 33.69  ? 132 HIS B CG  1 
ATOM   3133  N  ND1 . HIS B  1 133 ? 64.571  79.367  -17.028  1.00 34.79  ? 132 HIS B ND1 1 
ATOM   3134  C  CD2 . HIS B  1 133 ? 64.584  77.677  -18.407  1.00 30.25  ? 132 HIS B CD2 1 
ATOM   3135  C  CE1 . HIS B  1 133 ? 64.976  79.822  -18.199  1.00 32.48  ? 132 HIS B CE1 1 
ATOM   3136  N  NE2 . HIS B  1 133 ? 64.994  78.816  -19.055  1.00 28.55  ? 132 HIS B NE2 1 
ATOM   3137  N  N   . SER B  1 134 ? 62.728  74.132  -14.705  1.00 39.38  ? 133 SER B N   1 
ATOM   3138  C  CA  A SER B  1 134 ? 62.688  73.263  -13.531  0.56 43.88  ? 133 SER B CA  1 
ATOM   3139  C  CA  B SER B  1 134 ? 62.672  73.259  -13.535  0.44 44.08  ? 133 SER B CA  1 
ATOM   3140  C  C   . SER B  1 134 ? 63.182  71.853  -13.839  1.00 36.62  ? 133 SER B C   1 
ATOM   3141  O  O   . SER B  1 134 ? 63.379  71.057  -12.935  1.00 35.83  ? 133 SER B O   1 
ATOM   3142  C  CB  A SER B  1 134 ? 61.279  73.192  -12.935  0.56 37.29  ? 133 SER B CB  1 
ATOM   3143  C  CB  B SER B  1 134 ? 61.246  73.175  -12.977  0.44 42.74  ? 133 SER B CB  1 
ATOM   3144  O  OG  A SER B  1 134 ? 60.394  72.513  -13.808  0.56 47.71  ? 133 SER B OG  1 
ATOM   3145  O  OG  B SER B  1 134 ? 60.800  74.429  -12.490  0.44 37.04  ? 133 SER B OG  1 
ATOM   3146  N  N   . ILE B  1 135 ? 63.379  71.543  -15.118  1.00 36.02  ? 134 ILE B N   1 
ATOM   3147  C  CA  . ILE B  1 135 ? 63.915  70.229  -15.468  1.00 35.28  ? 134 ILE B CA  1 
ATOM   3148  C  C   . ILE B  1 135 ? 65.324  70.079  -14.879  1.00 34.96  ? 134 ILE B C   1 
ATOM   3149  O  O   . ILE B  1 135 ? 66.206  70.898  -15.153  1.00 35.85  ? 134 ILE B O   1 
ATOM   3150  C  CB  . ILE B  1 135 ? 64.020  70.057  -16.987  1.00 33.03  ? 134 ILE B CB  1 
ATOM   3151  C  CG1 . ILE B  1 135 ? 62.642  70.180  -17.647  1.00 40.42  ? 134 ILE B CG1 1 
ATOM   3152  C  CG2 . ILE B  1 135 ? 64.699  68.722  -17.322  1.00 36.14  ? 134 ILE B CG2 1 
ATOM   3153  C  CD1 . ILE B  1 135 ? 62.711  70.295  -19.160  1.00 38.24  ? 134 ILE B CD1 1 
ATOM   3154  N  N   . PRO B  1 136 ? 65.545  69.048  -14.060  1.00 34.23  ? 135 PRO B N   1 
ATOM   3155  C  CA  . PRO B  1 136 ? 66.888  68.933  -13.465  1.00 39.45  ? 135 PRO B CA  1 
ATOM   3156  C  C   . PRO B  1 136 ? 67.993  68.797  -14.533  1.00 37.71  ? 135 PRO B C   1 
ATOM   3157  O  O   . PRO B  1 136 ? 67.839  68.000  -15.459  1.00 40.80  ? 135 PRO B O   1 
ATOM   3158  C  CB  . PRO B  1 136 ? 66.777  67.672  -12.611  1.00 38.75  ? 135 PRO B CB  1 
ATOM   3159  C  CG  . PRO B  1 136 ? 65.300  67.582  -12.269  1.00 47.12  ? 135 PRO B CG  1 
ATOM   3160  C  CD  . PRO B  1 136 ? 64.599  68.058  -13.507  1.00 34.83  ? 135 PRO B CD  1 
ATOM   3161  N  N   . VAL B  1 137 ? 69.073  69.569  -14.418  1.00 35.24  ? 136 VAL B N   1 
ATOM   3162  C  CA  . VAL B  1 137 ? 70.076  69.624  -15.493  1.00 32.12  ? 136 VAL B CA  1 
ATOM   3163  C  C   . VAL B  1 137 ? 70.764  68.268  -15.686  1.00 32.52  ? 136 VAL B C   1 
ATOM   3164  O  O   . VAL B  1 137 ? 71.317  67.982  -16.754  1.00 34.58  ? 136 VAL B O   1 
ATOM   3165  C  CB  . VAL B  1 137 ? 71.170  70.709  -15.265  1.00 40.15  ? 136 VAL B CB  1 
ATOM   3166  C  CG1 . VAL B  1 137 ? 70.588  72.129  -15.378  1.00 40.73  ? 136 VAL B CG1 1 
ATOM   3167  C  CG2 . VAL B  1 137 ? 71.871  70.493  -13.939  1.00 45.44  ? 136 VAL B CG2 1 
ATOM   3168  N  N   . CYS B  1 138 ? 70.707  67.436  -14.658  1.00 33.12  ? 137 CYS B N   1 
ATOM   3169  C  CA  . CYS B  1 138 ? 71.277  66.091  -14.739  1.00 32.66  ? 137 CYS B CA  1 
ATOM   3170  C  C   . CYS B  1 138 ? 70.607  65.235  -15.813  1.00 38.84  ? 137 CYS B C   1 
ATOM   3171  O  O   . CYS B  1 138 ? 71.142  64.196  -16.193  1.00 40.93  ? 137 CYS B O   1 
ATOM   3172  C  CB  . CYS B  1 138 ? 71.212  65.381  -13.373  1.00 37.46  ? 137 CYS B CB  1 
ATOM   3173  S  SG  . CYS B  1 138 ? 69.565  64.934  -12.814  1.00 45.43  ? 137 CYS B SG  1 
ATOM   3174  N  N   . ASN B  1 139 ? 69.441  65.670  -16.294  1.00 31.44  ? 138 ASN B N   1 
ATOM   3175  C  CA  . ASN B  1 139 ? 68.734  64.964  -17.349  1.00 41.14  ? 138 ASN B CA  1 
ATOM   3176  C  C   . ASN B  1 139 ? 69.205  65.324  -18.764  1.00 37.16  ? 138 ASN B C   1 
ATOM   3177  O  O   . ASN B  1 139 ? 68.872  64.630  -19.726  1.00 33.75  ? 138 ASN B O   1 
ATOM   3178  C  CB  . ASN B  1 139 ? 67.242  65.268  -17.254  1.00 35.97  ? 138 ASN B CB  1 
ATOM   3179  C  CG  . ASN B  1 139 ? 66.615  64.713  -15.995  1.00 42.86  ? 138 ASN B CG  1 
ATOM   3180  O  OD1 . ASN B  1 139 ? 66.563  63.512  -15.809  1.00 44.69  ? 138 ASN B OD1 1 
ATOM   3181  N  ND2 . ASN B  1 139 ? 66.132  65.592  -15.128  1.00 46.25  ? 138 ASN B ND2 1 
ATOM   3182  N  N   . CYS B  1 140 ? 69.954  66.413  -18.896  1.00 31.94  ? 139 CYS B N   1 
ATOM   3183  C  CA  . CYS B  1 140 ? 70.185  67.004  -20.215  1.00 34.58  ? 139 CYS B CA  1 
ATOM   3184  C  C   . CYS B  1 140 ? 71.568  66.699  -20.818  1.00 34.04  ? 139 CYS B C   1 
ATOM   3185  O  O   . CYS B  1 140 ? 72.597  67.047  -20.232  1.00 32.60  ? 139 CYS B O   1 
ATOM   3186  C  CB  . CYS B  1 140 ? 69.961  68.518  -20.140  1.00 32.43  ? 139 CYS B CB  1 
ATOM   3187  S  SG  . CYS B  1 140 ? 70.107  69.362  -21.707  1.00 32.91  ? 139 CYS B SG  1 
ATOM   3188  N  N   . PRO B  1 141 ? 71.594  66.050  -22.000  1.00 35.78  ? 140 PRO B N   1 
ATOM   3189  C  CA  . PRO B  1 141 ? 72.871  65.656  -22.615  1.00 29.49  ? 140 PRO B CA  1 
ATOM   3190  C  C   . PRO B  1 141 ? 73.457  66.726  -23.547  1.00 27.72  ? 140 PRO B C   1 
ATOM   3191  O  O   . PRO B  1 141 ? 74.457  66.455  -24.241  1.00 33.37  ? 140 PRO B O   1 
ATOM   3192  C  CB  . PRO B  1 141 ? 72.479  64.423  -23.437  1.00 28.75  ? 140 PRO B CB  1 
ATOM   3193  C  CG  . PRO B  1 141 ? 71.096  64.795  -23.924  1.00 35.83  ? 140 PRO B CG  1 
ATOM   3194  C  CD  . PRO B  1 141 ? 70.439  65.533  -22.760  1.00 31.95  ? 140 PRO B CD  1 
ATOM   3195  N  N   . PHE B  1 142 ? 72.844  67.906  -23.573  1.00 28.03  ? 141 PHE B N   1 
ATOM   3196  C  CA  . PHE B  1 142 ? 73.228  68.988  -24.485  1.00 36.16  ? 141 PHE B CA  1 
ATOM   3197  C  C   . PHE B  1 142 ? 73.855  70.198  -23.791  1.00 35.23  ? 141 PHE B C   1 
ATOM   3198  O  O   . PHE B  1 142 ? 73.354  70.701  -22.772  1.00 33.16  ? 141 PHE B O   1 
ATOM   3199  C  CB  . PHE B  1 142 ? 72.021  69.441  -25.326  1.00 32.14  ? 141 PHE B CB  1 
ATOM   3200  C  CG  . PHE B  1 142 ? 71.364  68.316  -26.076  1.00 32.30  ? 141 PHE B CG  1 
ATOM   3201  C  CD1 . PHE B  1 142 ? 72.052  67.639  -27.065  1.00 32.95  ? 141 PHE B CD1 1 
ATOM   3202  C  CD2 . PHE B  1 142 ? 70.062  67.937  -25.788  1.00 28.85  ? 141 PHE B CD2 1 
ATOM   3203  C  CE1 . PHE B  1 142 ? 71.460  66.601  -27.764  1.00 33.93  ? 141 PHE B CE1 1 
ATOM   3204  C  CE2 . PHE B  1 142 ? 69.465  66.908  -26.479  1.00 31.67  ? 141 PHE B CE2 1 
ATOM   3205  C  CZ  . PHE B  1 142 ? 70.164  66.230  -27.466  1.00 34.36  ? 141 PHE B CZ  1 
ATOM   3206  N  N   . ASN B  1 143 ? 74.958  70.661  -24.368  1.00 31.23  ? 142 ASN B N   1 
ATOM   3207  C  CA  . ASN B  1 143 ? 75.712  71.786  -23.836  1.00 29.91  ? 142 ASN B CA  1 
ATOM   3208  C  C   . ASN B  1 143 ? 75.415  72.998  -24.700  1.00 29.55  ? 142 ASN B C   1 
ATOM   3209  O  O   . ASN B  1 143 ? 75.727  73.000  -25.888  1.00 36.12  ? 142 ASN B O   1 
ATOM   3210  C  CB  . ASN B  1 143 ? 77.219  71.454  -23.874  1.00 31.72  ? 142 ASN B CB  1 
ATOM   3211  C  CG  . ASN B  1 143 ? 78.101  72.674  -23.605  1.00 38.40  ? 142 ASN B CG  1 
ATOM   3212  O  OD1 . ASN B  1 143 ? 77.763  73.520  -22.785  1.00 34.39  ? 142 ASN B OD1 1 
ATOM   3213  N  ND2 . ASN B  1 143 ? 79.236  72.766  -24.305  1.00 31.09  ? 142 ASN B ND2 1 
ATOM   3214  N  N   . SER B  1 144 ? 74.776  74.013  -24.118  1.00 30.86  ? 143 SER B N   1 
ATOM   3215  C  CA  . SER B  1 144 ? 74.587  75.306  -24.785  1.00 37.12  ? 143 SER B CA  1 
ATOM   3216  C  C   . SER B  1 144 ? 75.256  76.448  -24.000  1.00 33.29  ? 143 SER B C   1 
ATOM   3217  O  O   . SER B  1 144 ? 74.785  77.583  -24.024  1.00 31.38  ? 143 SER B O   1 
ATOM   3218  C  CB  . SER B  1 144 ? 73.086  75.610  -24.950  1.00 34.87  ? 143 SER B CB  1 
ATOM   3219  O  OG  . SER B  1 144 ? 72.478  74.705  -25.861  1.00 37.12  ? 143 SER B OG  1 
ATOM   3220  N  N   . ASP B  1 145 ? 76.360  76.163  -23.315  1.00 29.63  ? 144 ASP B N   1 
ATOM   3221  C  CA  . ASP B  1 145 ? 76.916  77.159  -22.409  1.00 33.32  ? 144 ASP B CA  1 
ATOM   3222  C  C   . ASP B  1 145 ? 77.616  78.319  -23.148  1.00 31.68  ? 144 ASP B C   1 
ATOM   3223  O  O   . ASP B  1 145 ? 77.817  78.269  -24.373  1.00 30.87  ? 144 ASP B O   1 
ATOM   3224  C  CB  . ASP B  1 145 ? 77.775  76.519  -21.314  1.00 31.00  ? 144 ASP B CB  1 
ATOM   3225  C  CG  . ASP B  1 145 ? 79.122  76.019  -21.814  1.00 44.92  ? 144 ASP B CG  1 
ATOM   3226  O  OD1 . ASP B  1 145 ? 79.532  76.332  -22.958  1.00 35.94  ? 144 ASP B OD1 1 
ATOM   3227  O  OD2 . ASP B  1 145 ? 79.786  75.309  -21.028  1.00 45.45  ? 144 ASP B OD2 1 
ATOM   3228  N  N   . ARG B  1 146 ? 77.962  79.370  -22.411  1.00 36.88  ? 145 ARG B N   1 
ATOM   3229  C  CA  . ARG B  1 146 ? 78.425  80.585  -23.071  1.00 38.47  ? 145 ARG B CA  1 
ATOM   3230  C  C   . ARG B  1 146 ? 79.780  80.383  -23.736  1.00 34.80  ? 145 ARG B C   1 
ATOM   3231  O  O   . ARG B  1 146 ? 80.042  80.960  -24.779  1.00 34.31  ? 145 ARG B O   1 
ATOM   3232  C  CB  . ARG B  1 146 ? 78.412  81.803  -22.135  1.00 42.48  ? 145 ARG B CB  1 
ATOM   3233  C  CG  . ARG B  1 146 ? 79.539  81.878  -21.145  1.00 41.42  ? 145 ARG B CG  1 
ATOM   3234  C  CD  . ARG B  1 146 ? 79.631  83.288  -20.541  1.00 38.90  ? 145 ARG B CD  1 
ATOM   3235  N  NE  . ARG B  1 146 ? 80.717  83.414  -19.573  1.00 51.54  ? 145 ARG B NE  1 
ATOM   3236  C  CZ  . ARG B  1 146 ? 80.556  83.457  -18.252  1.00 66.25  ? 145 ARG B CZ  1 
ATOM   3237  N  NH1 . ARG B  1 146 ? 81.619  83.580  -17.460  1.00 53.71  ? 145 ARG B NH1 1 
ATOM   3238  N  NH2 . ARG B  1 146 ? 79.342  83.380  -17.719  1.00 39.80  ? 145 ARG B NH2 1 
ATOM   3239  N  N   . VAL B  1 147 ? 80.624  79.528  -23.170  1.00 40.25  ? 146 VAL B N   1 
ATOM   3240  C  CA  . VAL B  1 147 ? 81.887  79.211  -23.837  1.00 32.67  ? 146 VAL B CA  1 
ATOM   3241  C  C   . VAL B  1 147 ? 81.635  78.633  -25.249  1.00 32.16  ? 146 VAL B C   1 
ATOM   3242  O  O   . VAL B  1 147 ? 82.264  79.035  -26.232  1.00 33.18  ? 146 VAL B O   1 
ATOM   3243  C  CB  . VAL B  1 147 ? 82.731  78.268  -22.988  1.00 40.87  ? 146 VAL B CB  1 
ATOM   3244  C  CG1 . VAL B  1 147 ? 83.694  77.484  -23.854  1.00 41.43  ? 146 VAL B CG1 1 
ATOM   3245  C  CG2 . VAL B  1 147 ? 83.470  79.072  -21.920  1.00 44.76  ? 146 VAL B CG2 1 
ATOM   3246  N  N   . PHE B  1 148 ? 80.698  77.702  -25.329  1.00 29.94  ? 147 PHE B N   1 
ATOM   3247  C  CA  . PHE B  1 148 ? 80.279  77.104  -26.591  1.00 32.85  ? 147 PHE B CA  1 
ATOM   3248  C  C   . PHE B  1 148 ? 79.647  78.132  -27.559  1.00 39.47  ? 147 PHE B C   1 
ATOM   3249  O  O   . PHE B  1 148 ? 79.980  78.174  -28.744  1.00 31.90  ? 147 PHE B O   1 
ATOM   3250  C  CB  . PHE B  1 148 ? 79.293  75.961  -26.289  1.00 31.17  ? 147 PHE B CB  1 
ATOM   3251  C  CG  . PHE B  1 148 ? 78.767  75.264  -27.515  1.00 34.04  ? 147 PHE B CG  1 
ATOM   3252  C  CD1 . PHE B  1 148 ? 79.506  74.258  -28.135  1.00 34.35  ? 147 PHE B CD1 1 
ATOM   3253  C  CD2 . PHE B  1 148 ? 77.521  75.602  -28.038  1.00 38.77  ? 147 PHE B CD2 1 
ATOM   3254  C  CE1 . PHE B  1 148 ? 79.019  73.613  -29.268  1.00 35.53  ? 147 PHE B CE1 1 
ATOM   3255  C  CE2 . PHE B  1 148 ? 77.026  74.957  -29.167  1.00 43.46  ? 147 PHE B CE2 1 
ATOM   3256  C  CZ  . PHE B  1 148 ? 77.771  73.967  -29.782  1.00 33.35  ? 147 PHE B CZ  1 
ATOM   3257  N  N   . ARG B  1 149 ? 78.730  78.953  -27.059  1.00 30.55  ? 148 ARG B N   1 
ATOM   3258  C  CA  . ARG B  1 149 ? 78.009  79.905  -27.912  1.00 28.68  ? 148 ARG B CA  1 
ATOM   3259  C  C   . ARG B  1 149 ? 78.939  81.039  -28.357  1.00 31.16  ? 148 ARG B C   1 
ATOM   3260  O  O   . ARG B  1 149 ? 78.874  81.518  -29.490  1.00 35.38  ? 148 ARG B O   1 
ATOM   3261  C  CB  . ARG B  1 149 ? 76.771  80.473  -27.179  1.00 26.55  ? 148 ARG B CB  1 
ATOM   3262  C  CG  . ARG B  1 149 ? 75.652  79.434  -26.934  1.00 27.59  ? 148 ARG B CG  1 
ATOM   3263  C  CD  . ARG B  1 149 ? 75.122  78.870  -28.254  1.00 35.45  ? 148 ARG B CD  1 
ATOM   3264  N  NE  . ARG B  1 149 ? 74.193  77.761  -28.053  1.00 54.80  ? 148 ARG B NE  1 
ATOM   3265  C  CZ  . ARG B  1 149 ? 73.751  76.958  -29.020  1.00 66.90  ? 148 ARG B CZ  1 
ATOM   3266  N  NH1 . ARG B  1 149 ? 74.156  77.129  -30.275  1.00 49.72  ? 148 ARG B NH1 1 
ATOM   3267  N  NH2 . ARG B  1 149 ? 72.900  75.978  -28.732  1.00 51.71  ? 148 ARG B NH2 1 
ATOM   3268  N  N   . LEU B  1 150 ? 79.827  81.449  -27.462  1.00 31.99  ? 149 LEU B N   1 
ATOM   3269  C  CA  . LEU B  1 150 ? 80.778  82.507  -27.800  1.00 32.18  ? 149 LEU B CA  1 
ATOM   3270  C  C   . LEU B  1 150 ? 81.704  82.063  -28.933  1.00 37.23  ? 149 LEU B C   1 
ATOM   3271  O  O   . LEU B  1 150 ? 82.010  82.853  -29.833  1.00 32.64  ? 149 LEU B O   1 
ATOM   3272  C  CB  . LEU B  1 150 ? 81.568  82.948  -26.569  1.00 31.97  ? 149 LEU B CB  1 
ATOM   3273  C  CG  . LEU B  1 150 ? 80.857  83.920  -25.607  1.00 32.14  ? 149 LEU B CG  1 
ATOM   3274  C  CD1 . LEU B  1 150 ? 81.645  84.018  -24.307  1.00 31.99  ? 149 LEU B CD1 1 
ATOM   3275  C  CD2 . LEU B  1 150 ? 80.679  85.324  -26.205  1.00 31.91  ? 149 LEU B CD2 1 
ATOM   3276  N  N   . ALA B  1 151 ? 82.129  80.800  -28.904  1.00 35.01  ? 150 ALA B N   1 
ATOM   3277  C  CA  . ALA B  1 151 ? 82.961  80.272  -29.987  1.00 33.99  ? 150 ALA B CA  1 
ATOM   3278  C  C   . ALA B  1 151 ? 82.199  80.236  -31.307  1.00 37.59  ? 150 ALA B C   1 
ATOM   3279  O  O   . ALA B  1 151 ? 82.767  80.555  -32.352  1.00 33.51  ? 150 ALA B O   1 
ATOM   3280  C  CB  . ALA B  1 151 ? 83.509  78.889  -29.652  1.00 37.10  ? 150 ALA B CB  1 
ATOM   3281  N  N   . GLN B  1 152 ? 80.932  79.822  -31.263  1.00 31.02  ? 151 GLN B N   1 
ATOM   3282  C  CA  . GLN B  1 152 ? 80.082  79.898  -32.444  1.00 36.08  ? 151 GLN B CA  1 
ATOM   3283  C  C   . GLN B  1 152 ? 79.944  81.333  -32.937  1.00 32.28  ? 151 GLN B C   1 
ATOM   3284  O  O   . GLN B  1 152 ? 79.954  81.589  -34.139  1.00 31.45  ? 151 GLN B O   1 
ATOM   3285  C  CB  . GLN B  1 152 ? 78.679  79.386  -32.145  1.00 34.08  ? 151 GLN B CB  1 
ATOM   3286  C  CG  . GLN B  1 152 ? 78.555  77.910  -31.887  1.00 46.15  ? 151 GLN B CG  1 
ATOM   3287  C  CD  . GLN B  1 152 ? 77.098  77.486  -31.749  1.00 55.45  ? 151 GLN B CD  1 
ATOM   3288  O  OE1 . GLN B  1 152 ? 76.282  78.208  -31.170  1.00 43.82  ? 151 GLN B OE1 1 
ATOM   3289  N  NE2 . GLN B  1 152 ? 76.760  76.323  -32.300  1.00 44.14  ? 151 GLN B NE2 1 
ATOM   3290  N  N   . ALA B  1 153 ? 79.745  82.262  -32.008  1.00 32.24  ? 152 ALA B N   1 
ATOM   3291  C  CA  . ALA B  1 153 ? 79.583  83.669  -32.380  1.00 41.64  ? 152 ALA B CA  1 
ATOM   3292  C  C   . ALA B  1 153 ? 80.834  84.211  -33.070  1.00 38.77  ? 152 ALA B C   1 
ATOM   3293  O  O   . ALA B  1 153 ? 80.740  84.925  -34.071  1.00 32.79  ? 152 ALA B O   1 
ATOM   3294  C  CB  . ALA B  1 153 ? 79.215  84.520  -31.157  1.00 35.71  ? 152 ALA B CB  1 
ATOM   3295  N  N   . GLN B  1 154 ? 82.005  83.868  -32.536  1.00 36.40  ? 153 GLN B N   1 
ATOM   3296  C  CA  . GLN B  1 154 ? 83.262  84.326  -33.107  1.00 43.32  ? 153 GLN B CA  1 
ATOM   3297  C  C   . GLN B  1 154 ? 83.379  83.858  -34.552  1.00 41.27  ? 153 GLN B C   1 
ATOM   3298  O  O   . GLN B  1 154 ? 83.764  84.615  -35.443  1.00 39.51  ? 153 GLN B O   1 
ATOM   3299  C  CB  . GLN B  1 154 ? 84.455  83.808  -32.287  1.00 40.88  ? 153 GLN B CB  1 
ATOM   3300  C  CG  . GLN B  1 154 ? 85.799  84.406  -32.723  1.00 38.86  ? 153 GLN B CG  1 
ATOM   3301  C  CD  . GLN B  1 154 ? 86.879  84.219  -31.669  1.00 45.34  ? 153 GLN B CD  1 
ATOM   3302  O  OE1 . GLN B  1 154 ? 87.018  83.141  -31.088  1.00 56.22  ? 153 GLN B OE1 1 
ATOM   3303  N  NE2 . GLN B  1 154 ? 87.637  85.280  -31.402  1.00 72.25  ? 153 GLN B NE2 1 
ATOM   3304  N  N   . SER B  1 155 ? 83.031  82.598  -34.768  1.00 32.73  ? 154 SER B N   1 
ATOM   3305  C  CA  . SER B  1 155 ? 83.100  81.990  -36.080  1.00 37.28  ? 154 SER B CA  1 
ATOM   3306  C  C   . SER B  1 155 ? 82.156  82.667  -37.069  1.00 42.07  ? 154 SER B C   1 
ATOM   3307  O  O   . SER B  1 155 ? 82.548  82.979  -38.203  1.00 36.95  ? 154 SER B O   1 
ATOM   3308  C  CB  . SER B  1 155 ? 82.810  80.487  -35.965  1.00 43.42  ? 154 SER B CB  1 
ATOM   3309  O  OG  . SER B  1 155 ? 83.000  79.832  -37.202  1.00 46.09  ? 154 SER B OG  1 
ATOM   3310  N  N   . ARG B  1 156 ? 80.924  82.922  -36.642  1.00 36.87  ? 155 ARG B N   1 
ATOM   3311  C  CA  . ARG B  1 156 ? 79.974  83.615  -37.508  1.00 36.54  ? 155 ARG B CA  1 
ATOM   3312  C  C   . ARG B  1 156 ? 80.468  85.020  -37.868  1.00 31.88  ? 155 ARG B C   1 
ATOM   3313  O  O   . ARG B  1 156 ? 80.300  85.475  -38.999  1.00 38.60  ? 155 ARG B O   1 
ATOM   3314  C  CB  . ARG B  1 156 ? 78.569  83.635  -36.888  1.00 40.78  ? 155 ARG B CB  1 
ATOM   3315  C  CG  . ARG B  1 156 ? 77.826  82.286  -37.055  1.00 39.44  ? 155 ARG B CG  1 
ATOM   3316  C  CD  . ARG B  1 156 ? 76.437  82.262  -36.412  1.00 49.90  ? 155 ARG B CD  1 
ATOM   3317  N  NE  . ARG B  1 156 ? 75.592  83.396  -36.787  1.00 46.53  ? 155 ARG B NE  1 
ATOM   3318  C  CZ  . ARG B  1 156 ? 74.859  83.471  -37.895  1.00 56.02  ? 155 ARG B CZ  1 
ATOM   3319  N  NH1 . ARG B  1 156 ? 74.127  84.553  -38.125  1.00 44.36  ? 155 ARG B NH1 1 
ATOM   3320  N  NH2 . ARG B  1 156 ? 74.859  82.479  -38.779  1.00 46.95  ? 155 ARG B NH2 1 
HETATM 3321  N  N   . MSE B  1 157 ? 81.090  85.693  -36.906  1.00 34.57  ? 156 MSE B N   1 
HETATM 3322  C  CA  . MSE B  1 157 ? 81.606  87.038  -37.141  1.00 42.71  ? 156 MSE B CA  1 
HETATM 3323  C  C   . MSE B  1 157 ? 82.724  86.961  -38.149  1.00 44.71  ? 156 MSE B C   1 
HETATM 3324  O  O   . MSE B  1 157 ? 82.748  87.708  -39.130  1.00 42.17  ? 156 MSE B O   1 
HETATM 3325  C  CB  . MSE B  1 157 ? 82.106  87.670  -35.834  1.00 38.96  ? 156 MSE B CB  1 
HETATM 3326  C  CG  . MSE B  1 157 ? 82.921  88.938  -36.012  1.00 38.31  ? 156 MSE B CG  1 
HETATM 3327  SE SE  . MSE B  1 157 ? 83.442  89.768  -34.323  0.68 42.53  ? 156 MSE B SE  1 
HETATM 3328  C  CE  . MSE B  1 157 ? 84.685  88.425  -33.679  1.00 48.48  ? 156 MSE B CE  1 
ATOM   3329  N  N   . ASN B  1 158 ? 83.655  86.038  -37.927  1.00 41.93  ? 157 ASN B N   1 
ATOM   3330  C  CA  . ASN B  1 158 ? 84.805  85.941  -38.827  1.00 46.68  ? 157 ASN B CA  1 
ATOM   3331  C  C   . ASN B  1 158 ? 84.448  85.449  -40.232  1.00 59.37  ? 157 ASN B C   1 
ATOM   3332  O  O   . ASN B  1 158 ? 85.154  85.743  -41.200  1.00 47.51  ? 157 ASN B O   1 
ATOM   3333  C  CB  . ASN B  1 158 ? 85.923  85.107  -38.199  1.00 50.33  ? 157 ASN B CB  1 
ATOM   3334  C  CG  . ASN B  1 158 ? 86.596  85.822  -37.043  1.00 52.47  ? 157 ASN B CG  1 
ATOM   3335  O  OD1 . ASN B  1 158 ? 86.801  87.037  -37.086  1.00 59.56  ? 157 ASN B OD1 1 
ATOM   3336  N  ND2 . ASN B  1 158 ? 86.931  85.076  -36.000  1.00 66.51  ? 157 ASN B ND2 1 
ATOM   3337  N  N   . ASN B  1 159 ? 83.336  84.731  -40.352  1.00 41.13  ? 158 ASN B N   1 
ATOM   3338  C  CA  . ASN B  1 159 ? 82.893  84.252  -41.657  1.00 40.69  ? 158 ASN B CA  1 
ATOM   3339  C  C   . ASN B  1 159 ? 81.910  85.190  -42.350  1.00 46.00  ? 158 ASN B C   1 
ATOM   3340  O  O   . ASN B  1 159 ? 81.372  84.866  -43.410  1.00 44.20  ? 158 ASN B O   1 
ATOM   3341  C  CB  . ASN B  1 159 ? 82.305  82.850  -41.528  1.00 43.01  ? 158 ASN B CB  1 
ATOM   3342  C  CG  . ASN B  1 159 ? 83.372  81.805  -41.301  1.00 51.83  ? 158 ASN B CG  1 
ATOM   3343  O  OD1 . ASN B  1 159 ? 84.283  81.667  -42.106  1.00 48.50  ? 158 ASN B OD1 1 
ATOM   3344  N  ND2 . ASN B  1 159 ? 83.280  81.085  -40.193  1.00 54.14  ? 158 ASN B ND2 1 
ATOM   3345  N  N   . GLY B  1 160 ? 81.685  86.353  -41.748  1.00 46.99  ? 159 GLY B N   1 
ATOM   3346  C  CA  . GLY B  1 160 ? 80.796  87.359  -42.312  1.00 44.46  ? 159 GLY B CA  1 
ATOM   3347  C  C   . GLY B  1 160 ? 79.336  86.956  -42.300  1.00 57.27  ? 159 GLY B C   1 
ATOM   3348  O  O   . GLY B  1 160 ? 78.562  87.362  -43.169  1.00 44.49  ? 159 GLY B O   1 
ATOM   3349  N  N   . LEU B  1 161 ? 78.939  86.164  -41.311  1.00 34.63  ? 160 LEU B N   1 
ATOM   3350  C  CA  . LEU B  1 161 ? 77.569  85.658  -41.307  1.00 41.79  ? 160 LEU B CA  1 
ATOM   3351  C  C   . LEU B  1 161 ? 76.634  86.399  -40.359  1.00 43.49  ? 160 LEU B C   1 
ATOM   3352  O  O   . LEU B  1 161 ? 75.444  86.107  -40.313  1.00 38.51  ? 160 LEU B O   1 
ATOM   3353  C  CB  . LEU B  1 161 ? 77.549  84.165  -40.986  1.00 35.61  ? 160 LEU B CB  1 
ATOM   3354  C  CG  . LEU B  1 161 ? 78.328  83.310  -41.984  1.00 45.42  ? 160 LEU B CG  1 
ATOM   3355  C  CD1 . LEU B  1 161 ? 78.287  81.839  -41.590  1.00 54.48  ? 160 LEU B CD1 1 
ATOM   3356  C  CD2 . LEU B  1 161 ? 77.810  83.524  -43.396  1.00 45.90  ? 160 LEU B CD2 1 
ATOM   3357  N  N   . VAL B  1 162 ? 77.164  87.347  -39.599  1.00 38.07  ? 161 VAL B N   1 
ATOM   3358  C  CA  . VAL B  1 162 ? 76.320  88.090  -38.661  1.00 35.81  ? 161 VAL B CA  1 
ATOM   3359  C  C   . VAL B  1 162 ? 75.388  89.062  -39.402  1.00 34.10  ? 161 VAL B C   1 
ATOM   3360  O  O   . VAL B  1 162 ? 75.808  89.770  -40.322  1.00 39.00  ? 161 VAL B O   1 
ATOM   3361  C  CB  . VAL B  1 162 ? 77.158  88.819  -37.576  1.00 37.72  ? 161 VAL B CB  1 
ATOM   3362  C  CG1 . VAL B  1 162 ? 76.262  89.618  -36.652  1.00 35.87  ? 161 VAL B CG1 1 
ATOM   3363  C  CG2 . VAL B  1 162 ? 77.973  87.817  -36.765  1.00 36.33  ? 161 VAL B CG2 1 
ATOM   3364  N  N   . ASP B  1 163 ? 74.121  89.089  -39.005  1.00 34.06  ? 162 ASP B N   1 
ATOM   3365  C  CA  . ASP B  1 163 ? 73.153  89.984  -39.657  1.00 33.64  ? 162 ASP B CA  1 
ATOM   3366  C  C   . ASP B  1 163 ? 73.174  91.355  -38.987  1.00 33.96  ? 162 ASP B C   1 
ATOM   3367  O  O   . ASP B  1 163 ? 72.402  91.622  -38.060  1.00 36.89  ? 162 ASP B O   1 
ATOM   3368  C  CB  . ASP B  1 163 ? 71.741  89.385  -39.602  1.00 30.91  ? 162 ASP B CB  1 
ATOM   3369  C  CG  . ASP B  1 163 ? 70.718  90.219  -40.369  1.00 41.89  ? 162 ASP B CG  1 
ATOM   3370  O  OD1 . ASP B  1 163 ? 71.089  91.283  -40.913  1.00 39.09  ? 162 ASP B OD1 1 
ATOM   3371  O  OD2 . ASP B  1 163 ? 69.535  89.811  -40.409  1.00 40.09  ? 162 ASP B OD2 1 
ATOM   3372  N  N   . ALA B  1 164 ? 74.074  92.213  -39.454  1.00 34.68  ? 163 ALA B N   1 
ATOM   3373  C  CA  . ALA B  1 164 ? 74.306  93.507  -38.828  1.00 45.27  ? 163 ALA B CA  1 
ATOM   3374  C  C   . ALA B  1 164 ? 73.125  94.440  -38.963  1.00 48.50  ? 163 ALA B C   1 
ATOM   3375  O  O   . ALA B  1 164 ? 73.017  95.409  -38.220  1.00 42.00  ? 163 ALA B O   1 
ATOM   3376  C  CB  . ALA B  1 164 ? 75.552  94.163  -39.399  1.00 34.13  ? 163 ALA B CB  1 
ATOM   3377  N  N   . SER B  1 165 ? 72.243  94.151  -39.912  1.00 37.99  ? 164 SER B N   1 
ATOM   3378  C  CA  . SER B  1 165 ? 71.052  94.976  -40.109  1.00 45.33  ? 164 SER B CA  1 
ATOM   3379  C  C   . SER B  1 165 ? 69.983  94.723  -39.051  1.00 39.77  ? 164 SER B C   1 
ATOM   3380  O  O   . SER B  1 165 ? 69.001  95.479  -38.941  1.00 37.05  ? 164 SER B O   1 
ATOM   3381  C  CB  . SER B  1 165 ? 70.448  94.696  -41.480  1.00 38.98  ? 164 SER B CB  1 
ATOM   3382  O  OG  . SER B  1 165 ? 69.629  93.534  -41.426  1.00 41.23  ? 164 SER B OG  1 
ATOM   3383  N  N   . ASP B  1 166 ? 70.166  93.668  -38.268  1.00 34.79  ? 165 ASP B N   1 
ATOM   3384  C  CA  . ASP B  1 166 ? 69.108  93.183  -37.389  1.00 37.61  ? 165 ASP B CA  1 
ATOM   3385  C  C   . ASP B  1 166 ? 69.451  93.337  -35.892  1.00 32.67  ? 165 ASP B C   1 
ATOM   3386  O  O   . ASP B  1 166 ? 68.880  92.650  -35.049  1.00 35.43  ? 165 ASP B O   1 
ATOM   3387  C  CB  . ASP B  1 166 ? 68.842  91.703  -37.715  1.00 40.75  ? 165 ASP B CB  1 
ATOM   3388  C  CG  . ASP B  1 166 ? 67.476  91.214  -37.234  1.00 52.71  ? 165 ASP B CG  1 
ATOM   3389  O  OD1 . ASP B  1 166 ? 66.513  92.015  -37.190  1.00 41.14  ? 165 ASP B OD1 1 
ATOM   3390  O  OD2 . ASP B  1 166 ? 67.368  90.011  -36.907  1.00 44.76  ? 165 ASP B OD2 1 
ATOM   3391  N  N   . PHE B  1 167 ? 70.399  94.210  -35.567  1.00 34.00  ? 166 PHE B N   1 
ATOM   3392  C  CA  . PHE B  1 167 ? 70.762  94.422  -34.167  1.00 35.29  ? 166 PHE B CA  1 
ATOM   3393  C  C   . PHE B  1 167 ? 69.617  95.154  -33.483  1.00 37.62  ? 166 PHE B C   1 
ATOM   3394  O  O   . PHE B  1 167 ? 68.823  95.827  -34.145  1.00 33.36  ? 166 PHE B O   1 
ATOM   3395  C  CB  . PHE B  1 167 ? 72.042  95.267  -34.034  1.00 29.45  ? 166 PHE B CB  1 
ATOM   3396  C  CG  . PHE B  1 167 ? 73.294  94.582  -34.502  1.00 32.64  ? 166 PHE B CG  1 
ATOM   3397  C  CD1 . PHE B  1 167 ? 73.352  93.207  -34.659  1.00 33.71  ? 166 PHE B CD1 1 
ATOM   3398  C  CD2 . PHE B  1 167 ? 74.441  95.335  -34.770  1.00 40.17  ? 166 PHE B CD2 1 
ATOM   3399  C  CE1 . PHE B  1 167 ? 74.517  92.598  -35.091  1.00 32.08  ? 166 PHE B CE1 1 
ATOM   3400  C  CE2 . PHE B  1 167 ? 75.610  94.731  -35.186  1.00 45.47  ? 166 PHE B CE2 1 
ATOM   3401  C  CZ  . PHE B  1 167 ? 75.654  93.370  -35.351  1.00 31.56  ? 166 PHE B CZ  1 
ATOM   3402  N  N   . ASP B  1 168 ? 69.530  95.027  -32.161  1.00 34.63  ? 167 ASP B N   1 
ATOM   3403  C  CA  . ASP B  1 168 ? 68.613  95.859  -31.383  1.00 40.83  ? 167 ASP B CA  1 
ATOM   3404  C  C   . ASP B  1 168 ? 68.944  97.336  -31.519  1.00 38.86  ? 167 ASP B C   1 
ATOM   3405  O  O   . ASP B  1 168 ? 70.084  97.707  -31.824  1.00 38.87  ? 167 ASP B O   1 
ATOM   3406  C  CB  . ASP B  1 168 ? 68.655  95.469  -29.917  1.00 33.33  ? 167 ASP B CB  1 
ATOM   3407  C  CG  . ASP B  1 168 ? 68.277  94.027  -29.699  1.00 42.86  ? 167 ASP B CG  1 
ATOM   3408  O  OD1 . ASP B  1 168 ? 67.491  93.493  -30.504  1.00 33.16  ? 167 ASP B OD1 1 
ATOM   3409  O  OD2 . ASP B  1 168 ? 68.774  93.430  -28.727  1.00 32.75  ? 167 ASP B OD2 1 
ATOM   3410  N  N   . ASP B  1 169 ? 67.948  98.176  -31.256  1.00 38.97  ? 168 ASP B N   1 
ATOM   3411  C  CA  . ASP B  1 169 ? 68.059  99.611  -31.488  1.00 44.33  ? 168 ASP B CA  1 
ATOM   3412  C  C   . ASP B  1 169 ? 69.257  100.273 -30.834  1.00 36.07  ? 168 ASP B C   1 
ATOM   3413  O  O   . ASP B  1 169 ? 69.897  101.138 -31.431  1.00 39.56  ? 168 ASP B O   1 
ATOM   3414  C  CB  . ASP B  1 169 ? 66.813  100.332 -31.007  1.00 47.31  ? 168 ASP B CB  1 
ATOM   3415  C  CG  . ASP B  1 169 ? 66.910  101.825 -31.225  1.00 62.52  ? 168 ASP B CG  1 
ATOM   3416  O  OD1 . ASP B  1 169 ? 66.890  102.236 -32.405  1.00 45.82  ? 168 ASP B OD1 1 
ATOM   3417  O  OD2 . ASP B  1 169 ? 67.033  102.576 -30.230  1.00 60.00  ? 168 ASP B OD2 1 
ATOM   3418  N  N   . GLU B  1 170 ? 69.541  99.876  -29.598  1.00 37.90  ? 169 GLU B N   1 
ATOM   3419  C  CA  . GLU B  1 170 ? 70.662  100.423 -28.845  1.00 47.63  ? 169 GLU B CA  1 
ATOM   3420  C  C   . GLU B  1 170 ? 72.017  100.117 -29.487  1.00 42.23  ? 169 GLU B C   1 
ATOM   3421  O  O   . GLU B  1 170 ? 73.021  100.736 -29.136  1.00 47.28  ? 169 GLU B O   1 
ATOM   3422  C  CB  . GLU B  1 170 ? 70.632  99.921  -27.394  1.00 52.11  ? 169 GLU B CB  1 
ATOM   3423  C  CG  . GLU B  1 170 ? 70.550  98.403  -27.235  1.00 55.26  ? 169 GLU B CG  1 
ATOM   3424  C  CD  . GLU B  1 170 ? 69.120  97.878  -27.082  1.00 58.31  ? 169 GLU B CD  1 
ATOM   3425  O  OE1 . GLU B  1 170 ? 68.207  98.363  -27.792  1.00 43.84  ? 169 GLU B OE1 1 
ATOM   3426  O  OE2 . GLU B  1 170 ? 68.910  96.975  -26.240  1.00 58.85  ? 169 GLU B OE2 1 
ATOM   3427  N  N   . ARG B  1 171 ? 72.045  99.175  -30.427  1.00 42.78  ? 170 ARG B N   1 
ATOM   3428  C  CA  . ARG B  1 171 ? 73.282  98.816  -31.144  1.00 41.04  ? 170 ARG B CA  1 
ATOM   3429  C  C   . ARG B  1 171 ? 73.149  99.034  -32.652  1.00 45.69  ? 170 ARG B C   1 
ATOM   3430  O  O   . ARG B  1 171 ? 73.913  98.496  -33.450  1.00 40.71  ? 170 ARG B O   1 
ATOM   3431  C  CB  . ARG B  1 171 ? 73.666  97.365  -30.863  1.00 40.81  ? 170 ARG B CB  1 
ATOM   3432  C  CG  . ARG B  1 171 ? 74.271  97.138  -29.476  1.00 40.38  ? 170 ARG B CG  1 
ATOM   3433  C  CD  . ARG B  1 171 ? 74.402  95.650  -29.148  1.00 31.00  ? 170 ARG B CD  1 
ATOM   3434  N  NE  . ARG B  1 171 ? 73.119  95.004  -28.919  1.00 35.55  ? 170 ARG B NE  1 
ATOM   3435  C  CZ  . ARG B  1 171 ? 72.448  95.047  -27.769  1.00 39.18  ? 170 ARG B CZ  1 
ATOM   3436  N  NH1 . ARG B  1 171 ? 72.933  95.714  -26.726  1.00 37.75  ? 170 ARG B NH1 1 
ATOM   3437  N  NH2 . ARG B  1 171 ? 71.281  94.428  -27.661  1.00 37.26  ? 170 ARG B NH2 1 
ATOM   3438  N  N   . ASN B  1 172 ? 72.176  99.846  -33.034  1.00 46.42  ? 171 ASN B N   1 
ATOM   3439  C  CA  . ASN B  1 172 ? 71.892  100.067 -34.438  1.00 38.16  ? 171 ASN B CA  1 
ATOM   3440  C  C   . ASN B  1 172 ? 73.060  100.703 -35.197  1.00 39.92  ? 171 ASN B C   1 
ATOM   3441  O  O   . ASN B  1 172 ? 73.573  101.756 -34.818  1.00 45.04  ? 171 ASN B O   1 
ATOM   3442  C  CB  . ASN B  1 172 ? 70.643  100.925 -34.575  1.00 66.18  ? 171 ASN B CB  1 
ATOM   3443  C  CG  . ASN B  1 172 ? 70.229  101.094 -35.999  1.00 73.67  ? 171 ASN B CG  1 
ATOM   3444  O  OD1 . ASN B  1 172 ? 70.393  102.169 -36.578  1.00 73.38  ? 171 ASN B OD1 1 
ATOM   3445  N  ND2 . ASN B  1 172 ? 69.717  100.017 -36.597  1.00 48.79  ? 171 ASN B ND2 1 
ATOM   3446  N  N   . GLY B  1 173 ? 73.504  100.038 -36.256  1.00 44.58  ? 172 GLY B N   1 
ATOM   3447  C  CA  . GLY B  1 173 ? 74.608  100.549 -37.035  1.00 48.14  ? 172 GLY B CA  1 
ATOM   3448  C  C   . GLY B  1 173 ? 75.990  100.283 -36.460  1.00 52.01  ? 172 GLY B C   1 
ATOM   3449  O  O   . GLY B  1 173 ? 76.983  100.674 -37.068  1.00 45.81  ? 172 GLY B O   1 
ATOM   3450  N  N   . TRP B  1 174 ? 76.077  99.635  -35.300  1.00 43.36  ? 173 TRP B N   1 
ATOM   3451  C  CA  . TRP B  1 174 ? 77.393  99.260  -34.767  1.00 40.73  ? 173 TRP B CA  1 
ATOM   3452  C  C   . TRP B  1 174 ? 78.065  98.244  -35.671  1.00 37.84  ? 173 TRP B C   1 
ATOM   3453  O  O   . TRP B  1 174 ? 77.419  97.312  -36.148  1.00 44.45  ? 173 TRP B O   1 
ATOM   3454  C  CB  . TRP B  1 174 ? 77.283  98.607  -33.389  1.00 40.03  ? 173 TRP B CB  1 
ATOM   3455  C  CG  . TRP B  1 174 ? 76.931  99.505  -32.246  1.00 41.07  ? 173 TRP B CG  1 
ATOM   3456  C  CD1 . TRP B  1 174 ? 76.277  100.697 -32.297  1.00 47.55  ? 173 TRP B CD1 1 
ATOM   3457  C  CD2 . TRP B  1 174 ? 77.206  99.255  -30.862  1.00 42.69  ? 173 TRP B CD2 1 
ATOM   3458  N  NE1 . TRP B  1 174 ? 76.132  101.213 -31.028  1.00 52.20  ? 173 TRP B NE1 1 
ATOM   3459  C  CE2 . TRP B  1 174 ? 76.692  100.341 -30.130  1.00 45.26  ? 173 TRP B CE2 1 
ATOM   3460  C  CE3 . TRP B  1 174 ? 77.833  98.210  -30.171  1.00 44.37  ? 173 TRP B CE3 1 
ATOM   3461  C  CZ2 . TRP B  1 174 ? 76.797  100.421 -28.740  1.00 58.77  ? 173 TRP B CZ2 1 
ATOM   3462  C  CZ3 . TRP B  1 174 ? 77.935  98.292  -28.791  1.00 35.76  ? 173 TRP B CZ3 1 
ATOM   3463  C  CH2 . TRP B  1 174 ? 77.421  99.390  -28.092  1.00 44.39  ? 173 TRP B CH2 1 
ATOM   3464  N  N   . PRO B  1 175 ? 79.387  98.383  -35.869  1.00 47.12  ? 174 PRO B N   1 
ATOM   3465  C  CA  . PRO B  1 175 ? 80.122  97.311  -36.539  1.00 40.12  ? 174 PRO B CA  1 
ATOM   3466  C  C   . PRO B  1 175 ? 80.019  96.059  -35.675  1.00 45.63  ? 174 PRO B C   1 
ATOM   3467  O  O   . PRO B  1 175 ? 79.924  96.203  -34.463  1.00 40.11  ? 174 PRO B O   1 
ATOM   3468  C  CB  . PRO B  1 175 ? 81.567  97.822  -36.534  1.00 43.71  ? 174 PRO B CB  1 
ATOM   3469  C  CG  . PRO B  1 175 ? 81.460  99.301  -36.365  1.00 57.73  ? 174 PRO B CG  1 
ATOM   3470  C  CD  . PRO B  1 175 ? 80.265  99.497  -35.480  1.00 49.33  ? 174 PRO B CD  1 
ATOM   3471  N  N   . VAL B  1 176 ? 80.036  94.873  -36.280  1.00 36.60  ? 175 VAL B N   1 
ATOM   3472  C  CA  . VAL B  1 176 ? 79.962  93.618  -35.534  1.00 46.15  ? 175 VAL B CA  1 
ATOM   3473  C  C   . VAL B  1 176 ? 81.085  93.533  -34.505  1.00 48.58  ? 175 VAL B C   1 
ATOM   3474  O  O   . VAL B  1 176 ? 80.868  93.101  -33.377  1.00 43.45  ? 175 VAL B O   1 
ATOM   3475  C  CB  . VAL B  1 176 ? 80.037  92.388  -36.478  1.00 41.18  ? 175 VAL B CB  1 
ATOM   3476  C  CG1 . VAL B  1 176 ? 79.937  91.084  -35.698  1.00 35.50  ? 175 VAL B CG1 1 
ATOM   3477  C  CG2 . VAL B  1 176 ? 78.953  92.464  -37.539  1.00 48.06  ? 175 VAL B CG2 1 
ATOM   3478  N  N   . GLU B  1 177 ? 82.281  93.965  -34.898  1.00 44.50  ? 176 GLU B N   1 
ATOM   3479  C  CA  . GLU B  1 177 ? 83.438  93.947  -34.013  1.00 47.71  ? 176 GLU B CA  1 
ATOM   3480  C  C   . GLU B  1 177 ? 83.212  94.768  -32.744  1.00 39.36  ? 176 GLU B C   1 
ATOM   3481  O  O   . GLU B  1 177 ? 83.695  94.401  -31.672  1.00 45.06  ? 176 GLU B O   1 
ATOM   3482  C  CB  . GLU B  1 177 ? 84.688  94.436  -34.761  1.00 65.92  ? 176 GLU B CB  1 
ATOM   3483  C  CG  . GLU B  1 177 ? 85.977  94.445  -33.937  1.00 60.73  ? 176 GLU B CG  1 
ATOM   3484  C  CD  . GLU B  1 177 ? 86.401  93.064  -33.465  1.00 88.46  ? 176 GLU B CD  1 
ATOM   3485  O  OE1 . GLU B  1 177 ? 86.361  92.104  -34.267  1.00 76.33  ? 176 GLU B OE1 1 
ATOM   3486  O  OE2 . GLU B  1 177 ? 86.783  92.940  -32.282  1.00 90.30  ? 176 GLU B OE2 1 
ATOM   3487  N  N   . GLN B  1 178 ? 82.468  95.870  -32.857  1.00 41.73  ? 177 GLN B N   1 
ATOM   3488  C  CA  . GLN B  1 178 ? 82.138  96.676  -31.682  1.00 48.73  ? 177 GLN B CA  1 
ATOM   3489  C  C   . GLN B  1 178 ? 81.195  95.952  -30.714  1.00 54.77  ? 177 GLN B C   1 
ATOM   3490  O  O   . GLN B  1 178 ? 81.352  96.048  -29.496  1.00 39.19  ? 177 GLN B O   1 
ATOM   3491  C  CB  . GLN B  1 178 ? 81.555  98.038  -32.072  1.00 51.31  ? 177 GLN B CB  1 
ATOM   3492  C  CG  . GLN B  1 178 ? 81.347  98.945  -30.871  1.00 45.80  ? 177 GLN B CG  1 
ATOM   3493  C  CD  . GLN B  1 178 ? 80.668  100.253 -31.215  1.00 62.39  ? 177 GLN B CD  1 
ATOM   3494  O  OE1 . GLN B  1 178 ? 80.514  100.602 -32.384  1.00 54.87  ? 177 GLN B OE1 1 
ATOM   3495  N  NE2 . GLN B  1 178 ? 80.254  100.984 -30.191  1.00 54.98  ? 177 GLN B NE2 1 
ATOM   3496  N  N   . VAL B  1 179 ? 80.218  95.227  -31.247  1.00 37.98  ? 178 VAL B N   1 
ATOM   3497  C  CA  . VAL B  1 179 ? 79.348  94.423  -30.400  1.00 40.92  ? 178 VAL B CA  1 
ATOM   3498  C  C   . VAL B  1 179 ? 80.182  93.368  -29.652  1.00 49.34  ? 178 VAL B C   1 
ATOM   3499  O  O   . VAL B  1 179 ? 80.013  93.154  -28.459  1.00 38.02  ? 178 VAL B O   1 
ATOM   3500  C  CB  . VAL B  1 179 ? 78.236  93.726  -31.209  1.00 36.32  ? 178 VAL B CB  1 
ATOM   3501  C  CG1 . VAL B  1 179 ? 77.314  92.917  -30.275  1.00 37.45  ? 178 VAL B CG1 1 
ATOM   3502  C  CG2 . VAL B  1 179 ? 77.429  94.738  -32.001  1.00 36.06  ? 178 VAL B CG2 1 
ATOM   3503  N  N   . TRP B  1 180 ? 81.099  92.732  -30.369  1.00 36.42  ? 179 TRP B N   1 
ATOM   3504  C  CA  . TRP B  1 180 ? 81.967  91.699  -29.810  1.00 36.51  ? 179 TRP B CA  1 
ATOM   3505  C  C   . TRP B  1 180 ? 82.821  92.212  -28.644  1.00 38.94  ? 179 TRP B C   1 
ATOM   3506  O  O   . TRP B  1 180 ? 82.852  91.596  -27.576  1.00 42.64  ? 179 TRP B O   1 
ATOM   3507  C  CB  . TRP B  1 180 ? 82.846  91.131  -30.926  1.00 41.01  ? 179 TRP B CB  1 
ATOM   3508  C  CG  . TRP B  1 180 ? 83.822  90.092  -30.494  1.00 39.43  ? 179 TRP B CG  1 
ATOM   3509  C  CD1 . TRP B  1 180 ? 85.165  90.259  -30.303  1.00 46.10  ? 179 TRP B CD1 1 
ATOM   3510  C  CD2 . TRP B  1 180 ? 83.539  88.717  -30.206  1.00 32.55  ? 179 TRP B CD2 1 
ATOM   3511  N  NE1 . TRP B  1 180 ? 85.733  89.070  -29.912  1.00 49.10  ? 179 TRP B NE1 1 
ATOM   3512  C  CE2 . TRP B  1 180 ? 84.758  88.107  -29.845  1.00 42.11  ? 179 TRP B CE2 1 
ATOM   3513  C  CE3 . TRP B  1 180 ? 82.374  87.938  -30.229  1.00 41.73  ? 179 TRP B CE3 1 
ATOM   3514  C  CZ2 . TRP B  1 180 ? 84.847  86.753  -29.500  1.00 40.38  ? 179 TRP B CZ2 1 
ATOM   3515  C  CZ3 . TRP B  1 180 ? 82.463  86.594  -29.879  1.00 44.88  ? 179 TRP B CZ3 1 
ATOM   3516  C  CH2 . TRP B  1 180 ? 83.690  86.018  -29.523  1.00 44.43  ? 179 TRP B CH2 1 
ATOM   3517  N  N   . LYS B  1 181 ? 83.492  93.346  -28.841  1.00 39.85  ? 180 LYS B N   1 
ATOM   3518  C  CA  . LYS B  1 181 ? 84.368  93.909  -27.812  1.00 49.96  ? 180 LYS B CA  1 
ATOM   3519  C  C   . LYS B  1 181 ? 83.590  94.329  -26.578  1.00 45.44  ? 180 LYS B C   1 
ATOM   3520  O  O   . LYS B  1 181 ? 83.955  93.987  -25.459  1.00 48.34  ? 180 LYS B O   1 
ATOM   3521  C  CB  . LYS B  1 181 ? 85.142  95.126  -28.345  1.00 45.07  ? 180 LYS B CB  1 
ATOM   3522  C  CG  . LYS B  1 181 ? 86.193  94.778  -29.368  1.00 58.10  ? 180 LYS B CG  1 
ATOM   3523  C  CD  . LYS B  1 181 ? 86.971  96.012  -29.782  1.00 68.85  ? 180 LYS B CD  1 
ATOM   3524  C  CE  . LYS B  1 181 ? 87.857  95.722  -30.976  1.00 69.44  ? 180 LYS B CE  1 
ATOM   3525  N  NZ  . LYS B  1 181 ? 88.788  94.607  -30.687  1.00 75.60  ? 180 LYS B NZ  1 
ATOM   3526  N  N   . GLU B  1 182 ? 82.518  95.079  -26.794  1.00 41.91  ? 181 GLU B N   1 
ATOM   3527  C  CA  . GLU B  1 182 ? 81.738  95.628  -25.697  1.00 43.08  ? 181 GLU B CA  1 
ATOM   3528  C  C   . GLU B  1 182 ? 81.054  94.532  -24.883  1.00 47.89  ? 181 GLU B C   1 
ATOM   3529  O  O   . GLU B  1 182 ? 80.943  94.639  -23.663  1.00 49.79  ? 181 GLU B O   1 
ATOM   3530  C  CB  . GLU B  1 182 ? 80.725  96.620  -26.248  1.00 40.06  ? 181 GLU B CB  1 
ATOM   3531  C  CG  . GLU B  1 182 ? 81.397  97.799  -26.936  1.00 39.84  ? 181 GLU B CG  1 
ATOM   3532  C  CD  . GLU B  1 182 ? 81.340  99.064  -26.119  1.00 82.77  ? 181 GLU B CD  1 
ATOM   3533  O  OE1 . GLU B  1 182 ? 82.409  99.522  -25.660  1.00 95.94  ? 181 GLU B OE1 1 
ATOM   3534  O  OE2 . GLU B  1 182 ? 80.226  99.605  -25.948  1.00 81.28  ? 181 GLU B OE2 1 
HETATM 3535  N  N   . MSE B  1 183 ? 80.598  93.481  -25.562  1.00 41.34  ? 182 MSE B N   1 
HETATM 3536  C  CA  . MSE B  1 183 ? 80.009  92.334  -24.884  1.00 48.26  ? 182 MSE B CA  1 
HETATM 3537  C  C   . MSE B  1 183 ? 80.986  91.682  -23.901  1.00 40.62  ? 182 MSE B C   1 
HETATM 3538  O  O   . MSE B  1 183 ? 80.585  91.238  -22.832  1.00 42.17  ? 182 MSE B O   1 
HETATM 3539  C  CB  . MSE B  1 183 ? 79.539  91.299  -25.899  1.00 39.66  ? 182 MSE B CB  1 
HETATM 3540  C  CG  . MSE B  1 183 ? 78.950  90.043  -25.276  1.00 37.98  ? 182 MSE B CG  1 
HETATM 3541  SE SE  . MSE B  1 183 ? 78.243  88.828  -26.616  0.62 33.50  ? 182 MSE B SE  1 
HETATM 3542  C  CE  . MSE B  1 183 ? 79.898  88.552  -27.612  1.00 37.58  ? 182 MSE B CE  1 
ATOM   3543  N  N   . HIS B  1 184 ? 82.264  91.631  -24.262  1.00 47.45  ? 183 HIS B N   1 
ATOM   3544  C  CA  . HIS B  1 184 ? 83.255  90.977  -23.410  1.00 46.54  ? 183 HIS B CA  1 
ATOM   3545  C  C   . HIS B  1 184 ? 83.579  91.768  -22.149  1.00 54.48  ? 183 HIS B C   1 
ATOM   3546  O  O   . HIS B  1 184 ? 84.184  91.237  -21.214  1.00 48.76  ? 183 HIS B O   1 
ATOM   3547  C  CB  . HIS B  1 184 ? 84.529  90.654  -24.191  1.00 39.44  ? 183 HIS B CB  1 
ATOM   3548  C  CG  . HIS B  1 184 ? 84.424  89.409  -25.012  1.00 45.15  ? 183 HIS B CG  1 
ATOM   3549  N  ND1 . HIS B  1 184 ? 83.701  89.350  -26.185  1.00 43.07  ? 183 HIS B ND1 1 
ATOM   3550  C  CD2 . HIS B  1 184 ? 84.932  88.168  -24.819  1.00 46.49  ? 183 HIS B CD2 1 
ATOM   3551  C  CE1 . HIS B  1 184 ? 83.776  88.128  -26.685  1.00 41.92  ? 183 HIS B CE1 1 
ATOM   3552  N  NE2 . HIS B  1 184 ? 84.516  87.391  -25.874  1.00 51.32  ? 183 HIS B NE2 1 
ATOM   3553  N  N   . LYS B  1 185 ? 83.173  93.033  -22.118  1.00 47.53  ? 184 LYS B N   1 
ATOM   3554  C  CA  . LYS B  1 185 ? 83.347  93.849  -20.921  1.00 60.12  ? 184 LYS B CA  1 
ATOM   3555  C  C   . LYS B  1 185 ? 82.388  93.422  -19.802  1.00 62.99  ? 184 LYS B C   1 
ATOM   3556  O  O   . LYS B  1 185 ? 82.587  93.765  -18.639  1.00 54.50  ? 184 LYS B O   1 
ATOM   3557  C  CB  . LYS B  1 185 ? 83.168  95.333  -21.247  1.00 60.71  ? 184 LYS B CB  1 
ATOM   3558  C  CG  . LYS B  1 185 ? 84.021  95.812  -22.410  1.00 51.02  ? 184 LYS B CG  1 
ATOM   3559  C  CD  . LYS B  1 185 ? 84.922  96.965  -22.018  1.00 77.94  ? 184 LYS B CD  1 
ATOM   3560  C  CE  . LYS B  1 185 ? 85.771  97.438  -23.196  1.00 86.42  ? 184 LYS B CE  1 
ATOM   3561  N  NZ  . LYS B  1 185 ? 84.940  97.971  -24.318  1.00 88.65  ? 184 LYS B NZ  1 
ATOM   3562  N  N   . LEU B  1 186 ? 81.356  92.664  -20.158  1.00 46.77  ? 185 LEU B N   1 
ATOM   3563  C  CA  . LEU B  1 186 ? 80.374  92.193  -19.180  1.00 48.70  ? 185 LEU B CA  1 
ATOM   3564  C  C   . LEU B  1 186 ? 80.773  90.854  -18.552  1.00 69.87  ? 185 LEU B C   1 
ATOM   3565  O  O   . LEU B  1 186 ? 80.102  90.359  -17.646  1.00 51.96  ? 185 LEU B O   1 
ATOM   3566  C  CB  . LEU B  1 186 ? 79.005  92.044  -19.837  1.00 43.10  ? 185 LEU B CB  1 
ATOM   3567  C  CG  . LEU B  1 186 ? 78.470  93.233  -20.634  1.00 54.67  ? 185 LEU B CG  1 
ATOM   3568  C  CD1 . LEU B  1 186 ? 77.211  92.806  -21.366  1.00 43.98  ? 185 LEU B CD1 1 
ATOM   3569  C  CD2 . LEU B  1 186 ? 78.200  94.421  -19.729  1.00 54.01  ? 185 LEU B CD2 1 
ATOM   3570  N  N   . LEU B  1 187 ? 81.855  90.262  -19.048  1.00 50.45  ? 186 LEU B N   1 
ATOM   3571  C  CA  . LEU B  1 187 ? 82.334  88.984  -18.533  1.00 39.77  ? 186 LEU B CA  1 
ATOM   3572  C  C   . LEU B  1 187 ? 83.440  89.232  -17.510  1.00 55.68  ? 186 LEU B C   1 
ATOM   3573  O  O   . LEU B  1 187 ? 84.147  90.236  -17.601  1.00 68.41  ? 186 LEU B O   1 
ATOM   3574  C  CB  . LEU B  1 187 ? 82.862  88.128  -19.682  1.00 48.30  ? 186 LEU B CB  1 
ATOM   3575  C  CG  . LEU B  1 187 ? 81.849  87.765  -20.765  1.00 52.69  ? 186 LEU B CG  1 
ATOM   3576  C  CD1 . LEU B  1 187 ? 82.513  86.973  -21.874  1.00 48.66  ? 186 LEU B CD1 1 
ATOM   3577  C  CD2 . LEU B  1 187 ? 80.711  86.978  -20.164  1.00 45.30  ? 186 LEU B CD2 1 
ATOM   3578  N  N   . PRO B  1 188 ? 83.604  88.319  -16.535  1.00 69.31  ? 187 PRO B N   1 
ATOM   3579  C  CA  . PRO B  1 188 ? 82.833  87.086  -16.338  1.00 54.32  ? 187 PRO B CA  1 
ATOM   3580  C  C   . PRO B  1 188 ? 81.671  87.262  -15.362  1.00 58.11  ? 187 PRO B C   1 
ATOM   3581  O  O   . PRO B  1 188 ? 81.596  88.272  -14.669  1.00 51.30  ? 187 PRO B O   1 
ATOM   3582  C  CB  . PRO B  1 188 ? 83.862  86.154  -15.713  1.00 70.33  ? 187 PRO B CB  1 
ATOM   3583  C  CG  . PRO B  1 188 ? 84.678  87.078  -14.852  1.00 60.56  ? 187 PRO B CG  1 
ATOM   3584  C  CD  . PRO B  1 188 ? 84.753  88.392  -15.611  1.00 64.12  ? 187 PRO B CD  1 
ATOM   3585  N  N   . PHE B  1 189 ? 80.776  86.278  -15.327  1.00 47.61  ? 188 PHE B N   1 
ATOM   3586  C  CA  . PHE B  1 189 ? 79.756  86.179  -14.287  1.00 55.37  ? 188 PHE B CA  1 
ATOM   3587  C  C   . PHE B  1 189 ? 79.487  84.704  -13.990  1.00 43.63  ? 188 PHE B C   1 
ATOM   3588  O  O   . PHE B  1 189 ? 79.736  83.847  -14.834  1.00 45.96  ? 188 PHE B O   1 
ATOM   3589  C  CB  . PHE B  1 189 ? 78.458  86.904  -14.686  1.00 51.85  ? 188 PHE B CB  1 
ATOM   3590  C  CG  . PHE B  1 189 ? 77.847  86.413  -15.974  1.00 47.98  ? 188 PHE B CG  1 
ATOM   3591  C  CD1 . PHE B  1 189 ? 77.037  85.285  -15.994  1.00 44.94  ? 188 PHE B CD1 1 
ATOM   3592  C  CD2 . PHE B  1 189 ? 78.071  87.086  -17.164  1.00 50.89  ? 188 PHE B CD2 1 
ATOM   3593  C  CE1 . PHE B  1 189 ? 76.478  84.829  -17.172  1.00 43.12  ? 188 PHE B CE1 1 
ATOM   3594  C  CE2 . PHE B  1 189 ? 77.511  86.638  -18.350  1.00 41.50  ? 188 PHE B CE2 1 
ATOM   3595  C  CZ  . PHE B  1 189 ? 76.716  85.506  -18.355  1.00 60.31  ? 188 PHE B CZ  1 
ATOM   3596  N  N   . SER B  1 190 ? 78.980  84.414  -12.794  1.00 44.22  ? 189 SER B N   1 
ATOM   3597  C  CA  . SER B  1 190 ? 78.670  83.040  -12.410  1.00 41.91  ? 189 SER B CA  1 
ATOM   3598  C  C   . SER B  1 190 ? 77.413  82.560  -13.119  1.00 49.01  ? 189 SER B C   1 
ATOM   3599  O  O   . SER B  1 190 ? 76.346  83.167  -12.988  1.00 43.67  ? 189 SER B O   1 
ATOM   3600  C  CB  . SER B  1 190 ? 78.462  82.941  -10.901  1.00 51.84  ? 189 SER B CB  1 
ATOM   3601  O  OG  . SER B  1 190 ? 79.586  83.440  -10.202  1.00 92.80  ? 189 SER B OG  1 
ATOM   3602  N  N   . PRO B  1 191 ? 77.524  81.463  -13.873  1.00 43.72  ? 190 PRO B N   1 
ATOM   3603  C  CA  . PRO B  1 191 ? 76.334  80.975  -14.572  1.00 47.26  ? 190 PRO B CA  1 
ATOM   3604  C  C   . PRO B  1 191 ? 75.314  80.391  -13.598  1.00 50.31  ? 190 PRO B C   1 
ATOM   3605  O  O   . PRO B  1 191 ? 75.672  79.792  -12.585  1.00 45.92  ? 190 PRO B O   1 
ATOM   3606  C  CB  . PRO B  1 191 ? 76.895  79.883  -15.487  1.00 47.53  ? 190 PRO B CB  1 
ATOM   3607  C  CG  . PRO B  1 191 ? 78.126  79.424  -14.805  1.00 58.52  ? 190 PRO B CG  1 
ATOM   3608  C  CD  . PRO B  1 191 ? 78.708  80.628  -14.135  1.00 49.42  ? 190 PRO B CD  1 
ATOM   3609  N  N   . ASP B  1 192 ? 74.044  80.614  -13.902  1.00 40.84  ? 191 ASP B N   1 
ATOM   3610  C  CA  . ASP B  1 192 ? 72.937  80.030  -13.162  1.00 45.09  ? 191 ASP B CA  1 
ATOM   3611  C  C   . ASP B  1 192 ? 72.269  79.059  -14.138  1.00 45.92  ? 191 ASP B C   1 
ATOM   3612  O  O   . ASP B  1 192 ? 71.290  79.399  -14.809  1.00 36.99  ? 191 ASP B O   1 
ATOM   3613  C  CB  . ASP B  1 192 ? 71.974  81.137  -12.727  1.00 41.63  ? 191 ASP B CB  1 
ATOM   3614  C  CG  . ASP B  1 192 ? 70.912  80.643  -11.792  1.00 48.74  ? 191 ASP B CG  1 
ATOM   3615  O  OD1 . ASP B  1 192 ? 70.858  79.422  -11.559  1.00 48.33  ? 191 ASP B OD1 1 
ATOM   3616  O  OD2 . ASP B  1 192 ? 70.119  81.474  -11.305  1.00 56.80  ? 191 ASP B OD2 1 
ATOM   3617  N  N   . SER B  1 193 ? 72.831  77.856  -14.227  1.00 36.88  ? 192 SER B N   1 
ATOM   3618  C  CA  . SER B  1 193 ? 72.578  76.959  -15.354  1.00 38.90  ? 192 SER B CA  1 
ATOM   3619  C  C   . SER B  1 193 ? 71.291  76.173  -15.197  1.00 31.84  ? 192 SER B C   1 
ATOM   3620  O  O   . SER B  1 193 ? 71.030  75.580  -14.143  1.00 37.08  ? 192 SER B O   1 
ATOM   3621  C  CB  . SER B  1 193 ? 73.740  75.974  -15.514  1.00 40.99  ? 192 SER B CB  1 
ATOM   3622  O  OG  . SER B  1 193 ? 74.964  76.666  -15.606  1.00 41.62  ? 192 SER B OG  1 
ATOM   3623  N  N   . VAL B  1 194 ? 70.511  76.163  -16.266  1.00 31.41  ? 193 VAL B N   1 
ATOM   3624  C  CA  . VAL B  1 194 ? 69.254  75.429  -16.311  1.00 29.07  ? 193 VAL B CA  1 
ATOM   3625  C  C   . VAL B  1 194 ? 69.118  74.842  -17.712  1.00 30.61  ? 193 VAL B C   1 
ATOM   3626  O  O   . VAL B  1 194 ? 69.903  75.159  -18.603  1.00 32.50  ? 193 VAL B O   1 
ATOM   3627  C  CB  . VAL B  1 194 ? 68.045  76.375  -16.045  1.00 27.13  ? 193 VAL B CB  1 
ATOM   3628  C  CG1 . VAL B  1 194 ? 68.158  77.015  -14.673  1.00 35.81  ? 193 VAL B CG1 1 
ATOM   3629  C  CG2 . VAL B  1 194 ? 67.954  77.443  -17.113  1.00 26.82  ? 193 VAL B CG2 1 
ATOM   3630  N  N   . VAL B  1 195 ? 68.132  73.982  -17.917  1.00 31.29  ? 194 VAL B N   1 
ATOM   3631  C  CA  . VAL B  1 195 ? 67.801  73.554  -19.269  1.00 31.43  ? 194 VAL B CA  1 
ATOM   3632  C  C   . VAL B  1 195 ? 67.153  74.717  -20.006  1.00 34.09  ? 194 VAL B C   1 
ATOM   3633  O  O   . VAL B  1 195 ? 66.124  75.222  -19.564  1.00 28.32  ? 194 VAL B O   1 
ATOM   3634  C  CB  . VAL B  1 195 ? 66.824  72.355  -19.258  1.00 37.05  ? 194 VAL B CB  1 
ATOM   3635  C  CG1 . VAL B  1 195 ? 66.402  71.990  -20.685  1.00 33.40  ? 194 VAL B CG1 1 
ATOM   3636  C  CG2 . VAL B  1 195 ? 67.460  71.177  -18.544  1.00 29.99  ? 194 VAL B CG2 1 
ATOM   3637  N  N   . THR B  1 196 ? 67.765  75.154  -21.107  1.00 32.39  ? 195 THR B N   1 
ATOM   3638  C  CA  . THR B  1 196 ? 67.220  76.267  -21.889  1.00 28.42  ? 195 THR B CA  1 
ATOM   3639  C  C   . THR B  1 196 ? 66.749  75.859  -23.283  1.00 30.61  ? 195 THR B C   1 
ATOM   3640  O  O   . THR B  1 196 ? 67.250  74.904  -23.872  1.00 30.11  ? 195 THR B O   1 
ATOM   3641  C  CB  . THR B  1 196 ? 68.230  77.413  -22.039  1.00 28.99  ? 195 THR B CB  1 
ATOM   3642  O  OG1 . THR B  1 196 ? 69.337  76.994  -22.852  1.00 32.18  ? 195 THR B OG1 1 
ATOM   3643  C  CG2 . THR B  1 196 ? 68.714  77.876  -20.660  1.00 30.37  ? 195 THR B CG2 1 
ATOM   3644  N  N   . HIS B  1 197 ? 65.793  76.621  -23.800  1.00 30.45  ? 196 HIS B N   1 
ATOM   3645  C  CA  . HIS B  1 197 ? 65.286  76.458  -25.156  1.00 32.66  ? 196 HIS B CA  1 
ATOM   3646  C  C   . HIS B  1 197 ? 66.287  76.972  -26.200  1.00 31.18  ? 196 HIS B C   1 
ATOM   3647  O  O   . HIS B  1 197 ? 66.557  76.295  -27.190  1.00 32.74  ? 196 HIS B O   1 
ATOM   3648  C  CB  . HIS B  1 197 ? 63.947  77.206  -25.293  1.00 28.33  ? 196 HIS B CB  1 
ATOM   3649  C  CG  . HIS B  1 197 ? 63.345  77.115  -26.658  1.00 30.78  ? 196 HIS B CG  1 
ATOM   3650  N  ND1 . HIS B  1 197 ? 63.737  77.925  -27.699  1.00 29.38  ? 196 HIS B ND1 1 
ATOM   3651  C  CD2 . HIS B  1 197 ? 62.379  76.307  -27.154  1.00 39.54  ? 196 HIS B CD2 1 
ATOM   3652  C  CE1 . HIS B  1 197 ? 63.045  77.617  -28.782  1.00 33.09  ? 196 HIS B CE1 1 
ATOM   3653  N  NE2 . HIS B  1 197 ? 62.204  76.646  -28.473  1.00 32.84  ? 196 HIS B NE2 1 
ATOM   3654  N  N   . GLY B  1 198 ? 66.825  78.170  -25.983  1.00 28.79  ? 197 GLY B N   1 
ATOM   3655  C  CA  . GLY B  1 198 ? 67.803  78.741  -26.904  1.00 28.23  ? 197 GLY B CA  1 
ATOM   3656  C  C   . GLY B  1 198 ? 67.280  79.796  -27.872  1.00 33.98  ? 197 GLY B C   1 
ATOM   3657  O  O   . GLY B  1 198 ? 68.037  80.640  -28.356  1.00 31.80  ? 197 GLY B O   1 
ATOM   3658  N  N   . ASP B  1 199 ? 65.987  79.750  -28.164  1.00 30.74  ? 198 ASP B N   1 
ATOM   3659  C  CA  . ASP B  1 199 ? 65.338  80.804  -28.945  1.00 32.88  ? 198 ASP B CA  1 
ATOM   3660  C  C   . ASP B  1 199 ? 63.898  80.980  -28.453  1.00 33.30  ? 198 ASP B C   1 
ATOM   3661  O  O   . ASP B  1 199 ? 62.930  80.746  -29.187  1.00 32.60  ? 198 ASP B O   1 
ATOM   3662  C  CB  . ASP B  1 199 ? 65.360  80.475  -30.441  1.00 31.98  ? 198 ASP B CB  1 
ATOM   3663  C  CG  . ASP B  1 199 ? 65.074  81.697  -31.307  1.00 44.82  ? 198 ASP B CG  1 
ATOM   3664  O  OD1 . ASP B  1 199 ? 64.792  82.775  -30.735  1.00 33.87  ? 198 ASP B OD1 1 
ATOM   3665  O  OD2 . ASP B  1 199 ? 65.129  81.581  -32.550  1.00 39.17  ? 198 ASP B OD2 1 
ATOM   3666  N  N   . PHE B  1 200 ? 63.769  81.383  -27.195  1.00 33.09  ? 199 PHE B N   1 
ATOM   3667  C  CA  . PHE B  1 200 ? 62.481  81.407  -26.534  1.00 32.19  ? 199 PHE B CA  1 
ATOM   3668  C  C   . PHE B  1 200 ? 61.755  82.691  -26.919  1.00 30.42  ? 199 PHE B C   1 
ATOM   3669  O  O   . PHE B  1 200 ? 61.558  83.572  -26.094  1.00 31.26  ? 199 PHE B O   1 
ATOM   3670  C  CB  . PHE B  1 200 ? 62.681  81.341  -25.022  1.00 31.43  ? 199 PHE B CB  1 
ATOM   3671  C  CG  . PHE B  1 200 ? 61.493  80.815  -24.280  1.00 33.59  ? 199 PHE B CG  1 
ATOM   3672  C  CD1 . PHE B  1 200 ? 61.215  79.459  -24.275  1.00 33.71  ? 199 PHE B CD1 1 
ATOM   3673  C  CD2 . PHE B  1 200 ? 60.648  81.675  -23.604  1.00 35.67  ? 199 PHE B CD2 1 
ATOM   3674  C  CE1 . PHE B  1 200 ? 60.118  78.962  -23.597  1.00 37.11  ? 199 PHE B CE1 1 
ATOM   3675  C  CE2 . PHE B  1 200 ? 59.540  81.188  -22.915  1.00 35.78  ? 199 PHE B CE2 1 
ATOM   3676  C  CZ  . PHE B  1 200 ? 59.273  79.833  -22.917  1.00 37.11  ? 199 PHE B CZ  1 
ATOM   3677  N  N   . SER B  1 201 ? 61.372  82.792  -28.183  1.00 37.47  ? 200 SER B N   1 
ATOM   3678  C  CA  . SER B  1 201 ? 60.781  84.019  -28.691  1.00 35.43  ? 200 SER B CA  1 
ATOM   3679  C  C   . SER B  1 201 ? 59.265  83.855  -28.839  1.00 34.56  ? 200 SER B C   1 
ATOM   3680  O  O   . SER B  1 201 ? 58.738  82.751  -28.762  1.00 34.65  ? 200 SER B O   1 
ATOM   3681  C  CB  . SER B  1 201 ? 61.401  84.374  -30.036  1.00 31.65  ? 200 SER B CB  1 
ATOM   3682  O  OG  . SER B  1 201 ? 60.966  83.432  -31.012  1.00 38.07  ? 200 SER B OG  1 
ATOM   3683  N  N   . LEU B  1 202 ? 58.565  84.957  -29.068  1.00 29.85  ? 201 LEU B N   1 
ATOM   3684  C  CA  . LEU B  1 202 ? 57.111  84.882  -29.220  1.00 38.56  ? 201 LEU B CA  1 
ATOM   3685  C  C   . LEU B  1 202 ? 56.685  84.058  -30.445  1.00 38.95  ? 201 LEU B C   1 
ATOM   3686  O  O   . LEU B  1 202 ? 55.553  83.587  -30.516  1.00 38.49  ? 201 LEU B O   1 
ATOM   3687  C  CB  . LEU B  1 202 ? 56.509  86.288  -29.297  1.00 29.29  ? 201 LEU B CB  1 
ATOM   3688  C  CG  . LEU B  1 202 ? 56.534  87.114  -28.014  1.00 36.56  ? 201 LEU B CG  1 
ATOM   3689  C  CD1 . LEU B  1 202 ? 55.989  88.504  -28.329  1.00 31.15  ? 201 LEU B CD1 1 
ATOM   3690  C  CD2 . LEU B  1 202 ? 55.705  86.442  -26.925  1.00 35.40  ? 201 LEU B CD2 1 
ATOM   3691  N  N   . ASP B  1 203 ? 57.584  83.882  -31.412  1.00 32.56  ? 202 ASP B N   1 
ATOM   3692  C  CA  . ASP B  1 203 ? 57.251  83.089  -32.600  1.00 29.39  ? 202 ASP B CA  1 
ATOM   3693  C  C   . ASP B  1 203 ? 57.308  81.584  -32.366  1.00 33.08  ? 202 ASP B C   1 
ATOM   3694  O  O   . ASP B  1 203 ? 56.787  80.809  -33.172  1.00 33.74  ? 202 ASP B O   1 
ATOM   3695  C  CB  . ASP B  1 203 ? 58.202  83.408  -33.757  1.00 35.08  ? 202 ASP B CB  1 
ATOM   3696  C  CG  . ASP B  1 203 ? 58.239  84.873  -34.083  1.00 67.26  ? 202 ASP B CG  1 
ATOM   3697  O  OD1 . ASP B  1 203 ? 57.191  85.542  -33.928  1.00 47.81  ? 202 ASP B OD1 1 
ATOM   3698  O  OD2 . ASP B  1 203 ? 59.319  85.352  -34.483  1.00 50.86  ? 202 ASP B OD2 1 
ATOM   3699  N  N   . ASN B  1 204 ? 57.958  81.174  -31.288  1.00 29.78  ? 203 ASN B N   1 
ATOM   3700  C  CA  . ASN B  1 204 ? 58.219  79.754  -31.049  1.00 33.70  ? 203 ASN B CA  1 
ATOM   3701  C  C   . ASN B  1 204 ? 57.376  79.129  -29.936  1.00 38.13  ? 203 ASN B C   1 
ATOM   3702  O  O   . ASN B  1 204 ? 57.638  78.018  -29.500  1.00 35.53  ? 203 ASN B O   1 
ATOM   3703  C  CB  . ASN B  1 204 ? 59.716  79.541  -30.788  1.00 32.30  ? 203 ASN B CB  1 
ATOM   3704  C  CG  . ASN B  1 204 ? 60.551  79.804  -32.013  1.00 39.59  ? 203 ASN B CG  1 
ATOM   3705  O  OD1 . ASN B  1 204 ? 60.050  79.720  -33.141  1.00 36.74  ? 203 ASN B OD1 1 
ATOM   3706  N  ND2 . ASN B  1 204 ? 61.842  80.097  -31.814  1.00 34.37  ? 203 ASN B ND2 1 
ATOM   3707  N  N   . LEU B  1 205 ? 56.355  79.847  -29.484  1.00 34.61  ? 204 LEU B N   1 
ATOM   3708  C  CA  . LEU B  1 205 ? 55.467  79.329  -28.458  1.00 35.50  ? 204 LEU B CA  1 
ATOM   3709  C  C   . LEU B  1 205 ? 54.046  79.345  -29.002  1.00 40.65  ? 204 LEU B C   1 
ATOM   3710  O  O   . LEU B  1 205 ? 53.593  80.354  -29.550  1.00 43.75  ? 204 LEU B O   1 
ATOM   3711  C  CB  . LEU B  1 205 ? 55.578  80.170  -27.191  1.00 35.33  ? 204 LEU B CB  1 
ATOM   3712  C  CG  . LEU B  1 205 ? 56.981  80.079  -26.582  1.00 37.81  ? 204 LEU B CG  1 
ATOM   3713  C  CD1 . LEU B  1 205 ? 57.435  81.425  -26.043  1.00 44.60  ? 204 LEU B CD1 1 
ATOM   3714  C  CD2 . LEU B  1 205 ? 56.993  79.007  -25.501  1.00 46.83  ? 204 LEU B CD2 1 
ATOM   3715  N  N   . ILE B  1 206 ? 53.346  78.230  -28.857  1.00 37.65  ? 205 ILE B N   1 
ATOM   3716  C  CA  . ILE B  1 206 ? 52.067  78.070  -29.542  1.00 35.77  ? 205 ILE B CA  1 
ATOM   3717  C  C   . ILE B  1 206 ? 50.899  78.030  -28.574  1.00 32.94  ? 205 ILE B C   1 
ATOM   3718  O  O   . ILE B  1 206 ? 50.919  77.262  -27.613  1.00 39.98  ? 205 ILE B O   1 
ATOM   3719  C  CB  . ILE B  1 206 ? 52.057  76.787  -30.372  1.00 38.03  ? 205 ILE B CB  1 
ATOM   3720  C  CG1 . ILE B  1 206 ? 53.319  76.713  -31.248  1.00 37.68  ? 205 ILE B CG1 1 
ATOM   3721  C  CG2 . ILE B  1 206 ? 50.776  76.690  -31.184  1.00 32.78  ? 205 ILE B CG2 1 
ATOM   3722  C  CD1 . ILE B  1 206 ? 53.520  77.925  -32.151  1.00 35.88  ? 205 ILE B CD1 1 
ATOM   3723  N  N   . PHE B  1 207 ? 49.887  78.861  -28.844  1.00 31.73  ? 206 PHE B N   1 
ATOM   3724  C  CA  . PHE B  1 207 ? 48.661  78.910  -28.042  1.00 37.56  ? 206 PHE B CA  1 
ATOM   3725  C  C   . PHE B  1 207 ? 47.496  78.285  -28.806  1.00 41.20  ? 206 PHE B C   1 
ATOM   3726  O  O   . PHE B  1 207 ? 47.359  78.481  -30.015  1.00 44.39  ? 206 PHE B O   1 
ATOM   3727  C  CB  . PHE B  1 207 ? 48.266  80.368  -27.753  1.00 36.36  ? 206 PHE B CB  1 
ATOM   3728  C  CG  . PHE B  1 207 ? 48.997  80.999  -26.607  1.00 37.86  ? 206 PHE B CG  1 
ATOM   3729  C  CD1 . PHE B  1 207 ? 50.272  81.508  -26.773  1.00 42.89  ? 206 PHE B CD1 1 
ATOM   3730  C  CD2 . PHE B  1 207 ? 48.387  81.128  -25.367  1.00 43.92  ? 206 PHE B CD2 1 
ATOM   3731  C  CE1 . PHE B  1 207 ? 50.944  82.106  -25.716  1.00 50.13  ? 206 PHE B CE1 1 
ATOM   3732  C  CE2 . PHE B  1 207 ? 49.054  81.729  -24.306  1.00 43.09  ? 206 PHE B CE2 1 
ATOM   3733  C  CZ  . PHE B  1 207 ? 50.337  82.221  -24.487  1.00 43.27  ? 206 PHE B CZ  1 
ATOM   3734  N  N   . ASP B  1 208 ? 46.629  77.559  -28.107  1.00 41.88  ? 207 ASP B N   1 
ATOM   3735  C  CA  . ASP B  1 208 ? 45.415  77.048  -28.735  1.00 45.92  ? 207 ASP B CA  1 
ATOM   3736  C  C   . ASP B  1 208 ? 44.289  77.078  -27.705  1.00 49.10  ? 207 ASP B C   1 
ATOM   3737  O  O   . ASP B  1 208 ? 44.470  76.639  -26.562  1.00 48.44  ? 207 ASP B O   1 
ATOM   3738  C  CB  . ASP B  1 208 ? 45.625  75.624  -29.261  1.00 40.65  ? 207 ASP B CB  1 
ATOM   3739  C  CG  . ASP B  1 208 ? 44.487  75.143  -30.140  1.00 59.91  ? 207 ASP B CG  1 
ATOM   3740  O  OD1 . ASP B  1 208 ? 44.008  75.924  -30.995  1.00 59.62  ? 207 ASP B OD1 1 
ATOM   3741  O  OD2 . ASP B  1 208 ? 44.075  73.974  -29.976  1.00 65.99  ? 207 ASP B OD2 1 
ATOM   3742  N  N   . GLU B  1 209 ? 43.149  77.629  -28.107  1.00 75.93  ? 208 GLU B N   1 
ATOM   3743  C  CA  . GLU B  1 209 ? 42.008  77.756  -27.215  1.00 78.52  ? 208 GLU B CA  1 
ATOM   3744  C  C   . GLU B  1 209 ? 42.389  78.447  -25.902  1.00 73.20  ? 208 GLU B C   1 
ATOM   3745  O  O   . GLU B  1 209 ? 41.937  78.056  -24.829  1.00 77.36  ? 208 GLU B O   1 
ATOM   3746  C  CB  . GLU B  1 209 ? 41.394  76.379  -26.962  1.00 56.82  ? 208 GLU B CB  1 
ATOM   3747  C  CG  . GLU B  1 209 ? 40.904  75.705  -28.236  1.00 82.77  ? 208 GLU B CG  1 
ATOM   3748  C  CD  . GLU B  1 209 ? 40.315  74.331  -27.989  1.00 89.82  ? 208 GLU B CD  1 
ATOM   3749  O  OE1 . GLU B  1 209 ? 40.462  73.813  -26.860  1.00 116.29 ? 208 GLU B OE1 1 
ATOM   3750  O  OE2 . GLU B  1 209 ? 39.704  73.770  -28.926  1.00 89.42  ? 208 GLU B OE2 1 
ATOM   3751  N  N   . GLY B  1 210 ? 43.247  79.461  -26.000  1.00 76.38  ? 209 GLY B N   1 
ATOM   3752  C  CA  . GLY B  1 210 ? 43.601  80.286  -24.858  1.00 71.49  ? 209 GLY B CA  1 
ATOM   3753  C  C   . GLY B  1 210 ? 44.661  79.738  -23.918  1.00 72.44  ? 209 GLY B C   1 
ATOM   3754  O  O   . GLY B  1 210 ? 44.971  80.362  -22.902  1.00 65.75  ? 209 GLY B O   1 
ATOM   3755  N  N   . LYS B  1 211 ? 45.220  78.576  -24.241  1.00 53.34  ? 210 LYS B N   1 
ATOM   3756  C  CA  . LYS B  1 211 ? 46.266  77.991  -23.401  1.00 51.45  ? 210 LYS B CA  1 
ATOM   3757  C  C   . LYS B  1 211 ? 47.569  77.774  -24.171  1.00 40.22  ? 210 LYS B C   1 
ATOM   3758  O  O   . LYS B  1 211 ? 47.561  77.475  -25.362  1.00 52.11  ? 210 LYS B O   1 
ATOM   3759  C  CB  . LYS B  1 211 ? 45.798  76.676  -22.774  1.00 48.98  ? 210 LYS B CB  1 
ATOM   3760  C  CG  . LYS B  1 211 ? 44.495  76.803  -21.994  1.00 55.32  ? 210 LYS B CG  1 
ATOM   3761  C  CD  . LYS B  1 211 ? 44.656  76.310  -20.564  1.00 76.79  ? 210 LYS B CD  1 
ATOM   3762  C  CE  . LYS B  1 211 ? 43.635  76.958  -19.641  1.00 76.48  ? 210 LYS B CE  1 
ATOM   3763  N  NZ  . LYS B  1 211 ? 43.849  78.437  -19.558  1.00 78.18  ? 210 LYS B NZ  1 
ATOM   3764  N  N   . LEU B  1 212 ? 48.682  77.927  -23.469  1.00 46.08  ? 211 LEU B N   1 
ATOM   3765  C  CA  . LEU B  1 212 ? 49.994  77.728  -24.047  1.00 52.99  ? 211 LEU B CA  1 
ATOM   3766  C  C   . LEU B  1 212 ? 50.227  76.231  -24.148  1.00 61.67  ? 211 LEU B C   1 
ATOM   3767  O  O   . LEU B  1 212 ? 50.471  75.572  -23.141  1.00 62.95  ? 211 LEU B O   1 
ATOM   3768  C  CB  . LEU B  1 212 ? 51.036  78.375  -23.140  1.00 42.79  ? 211 LEU B CB  1 
ATOM   3769  C  CG  . LEU B  1 212 ? 52.484  78.515  -23.591  1.00 54.73  ? 211 LEU B CG  1 
ATOM   3770  C  CD1 . LEU B  1 212 ? 52.583  78.761  -25.091  1.00 46.13  ? 211 LEU B CD1 1 
ATOM   3771  C  CD2 . LEU B  1 212 ? 53.095  79.675  -22.828  1.00 56.10  ? 211 LEU B CD2 1 
ATOM   3772  N  N   . ILE B  1 213 ? 50.130  75.683  -25.354  1.00 37.39  ? 212 ILE B N   1 
ATOM   3773  C  CA  . ILE B  1 213 ? 50.144  74.225  -25.486  1.00 53.88  ? 212 ILE B CA  1 
ATOM   3774  C  C   . ILE B  1 213 ? 51.424  73.610  -26.034  1.00 50.71  ? 212 ILE B C   1 
ATOM   3775  O  O   . ILE B  1 213 ? 51.559  72.393  -26.030  1.00 46.35  ? 212 ILE B O   1 
ATOM   3776  C  CB  . ILE B  1 213 ? 48.952  73.694  -26.307  1.00 56.85  ? 212 ILE B CB  1 
ATOM   3777  C  CG1 . ILE B  1 213 ? 49.043  74.158  -27.758  1.00 49.29  ? 212 ILE B CG1 1 
ATOM   3778  C  CG2 . ILE B  1 213 ? 47.643  74.121  -25.672  1.00 51.95  ? 212 ILE B CG2 1 
ATOM   3779  C  CD1 . ILE B  1 213 ? 48.215  73.327  -28.696  1.00 73.20  ? 212 ILE B CD1 1 
ATOM   3780  N  N   . GLY B  1 214 ? 52.364  74.425  -26.501  1.00 43.41  ? 213 GLY B N   1 
ATOM   3781  C  CA  . GLY B  1 214 ? 53.650  73.873  -26.902  1.00 47.36  ? 213 GLY B CA  1 
ATOM   3782  C  C   . GLY B  1 214 ? 54.699  74.865  -27.349  1.00 40.19  ? 213 GLY B C   1 
ATOM   3783  O  O   . GLY B  1 214 ? 54.419  76.058  -27.500  1.00 34.88  ? 213 GLY B O   1 
ATOM   3784  N  N   . CYS B  1 215 ? 55.926  74.376  -27.539  1.00 44.67  ? 214 CYS B N   1 
ATOM   3785  C  CA  . CYS B  1 215 ? 56.980  75.191  -28.140  1.00 36.89  ? 214 CYS B CA  1 
ATOM   3786  C  C   . CYS B  1 215 ? 57.598  74.476  -29.329  1.00 38.47  ? 214 CYS B C   1 
ATOM   3787  O  O   . CYS B  1 215 ? 57.493  73.252  -29.458  1.00 40.78  ? 214 CYS B O   1 
ATOM   3788  C  CB  . CYS B  1 215 ? 58.060  75.590  -27.122  1.00 38.72  ? 214 CYS B CB  1 
ATOM   3789  S  SG  . CYS B  1 215 ? 58.999  74.245  -26.431  1.00 47.07  ? 214 CYS B SG  1 
ATOM   3790  N  N   . ILE B  1 216 ? 58.229  75.246  -30.210  1.00 32.10  ? 215 ILE B N   1 
ATOM   3791  C  CA  . ILE B  1 216 ? 58.790  74.693  -31.437  1.00 34.64  ? 215 ILE B CA  1 
ATOM   3792  C  C   . ILE B  1 216 ? 60.197  75.256  -31.635  1.00 31.85  ? 215 ILE B C   1 
ATOM   3793  O  O   . ILE B  1 216 ? 60.642  76.074  -30.828  1.00 33.75  ? 215 ILE B O   1 
ATOM   3794  C  CB  . ILE B  1 216 ? 57.915  75.062  -32.662  1.00 38.83  ? 215 ILE B CB  1 
ATOM   3795  C  CG1 . ILE B  1 216 ? 57.840  76.587  -32.825  1.00 37.72  ? 215 ILE B CG1 1 
ATOM   3796  C  CG2 . ILE B  1 216 ? 56.513  74.487  -32.518  1.00 30.89  ? 215 ILE B CG2 1 
ATOM   3797  C  CD1 . ILE B  1 216 ? 57.096  77.042  -34.078  1.00 38.21  ? 215 ILE B CD1 1 
ATOM   3798  N  N   . ASP B  1 217 ? 60.878  74.807  -32.695  1.00 32.58  ? 216 ASP B N   1 
ATOM   3799  C  CA  A ASP B  1 217 ? 62.205  75.323  -33.056  0.54 28.43  ? 216 ASP B CA  1 
ATOM   3800  C  CA  B ASP B  1 217 ? 62.210  75.298  -33.059  0.46 33.06  ? 216 ASP B CA  1 
ATOM   3801  C  C   . ASP B  1 217 ? 63.226  75.127  -31.928  1.00 32.21  ? 216 ASP B C   1 
ATOM   3802  O  O   . ASP B  1 217 ? 63.785  76.090  -31.409  1.00 34.75  ? 216 ASP B O   1 
ATOM   3803  C  CB  A ASP B  1 217 ? 62.117  76.808  -33.446  0.54 32.98  ? 216 ASP B CB  1 
ATOM   3804  C  CB  B ASP B  1 217 ? 62.146  76.753  -33.543  0.46 33.05  ? 216 ASP B CB  1 
ATOM   3805  C  CG  A ASP B  1 217 ? 63.412  77.345  -34.039  0.54 41.50  ? 216 ASP B CG  1 
ATOM   3806  C  CG  B ASP B  1 217 ? 61.429  76.892  -34.878  0.46 62.57  ? 216 ASP B CG  1 
ATOM   3807  O  OD1 A ASP B  1 217 ? 64.016  76.657  -34.892  0.54 35.66  ? 216 ASP B OD1 1 
ATOM   3808  O  OD1 B ASP B  1 217 ? 61.469  75.929  -35.674  0.46 46.49  ? 216 ASP B OD1 1 
ATOM   3809  O  OD2 A ASP B  1 217 ? 63.821  78.464  -33.655  0.54 65.39  ? 216 ASP B OD2 1 
ATOM   3810  O  OD2 B ASP B  1 217 ? 60.826  77.958  -35.133  0.46 54.61  ? 216 ASP B OD2 1 
ATOM   3811  N  N   . VAL B  1 218 ? 63.472  73.876  -31.563  1.00 35.10  ? 217 VAL B N   1 
ATOM   3812  C  CA  . VAL B  1 218 ? 64.251  73.577  -30.366  1.00 31.16  ? 217 VAL B CA  1 
ATOM   3813  C  C   . VAL B  1 218 ? 65.721  73.213  -30.666  1.00 37.72  ? 217 VAL B C   1 
ATOM   3814  O  O   . VAL B  1 218 ? 66.408  72.662  -29.811  1.00 34.08  ? 217 VAL B O   1 
ATOM   3815  C  CB  . VAL B  1 218 ? 63.563  72.443  -29.559  1.00 30.41  ? 217 VAL B CB  1 
ATOM   3816  C  CG1 . VAL B  1 218 ? 62.162  72.869  -29.087  1.00 33.53  ? 217 VAL B CG1 1 
ATOM   3817  C  CG2 . VAL B  1 218 ? 63.434  71.181  -30.418  1.00 29.38  ? 217 VAL B CG2 1 
ATOM   3818  N  N   . GLY B  1 219 ? 66.200  73.518  -31.872  1.00 34.35  ? 218 GLY B N   1 
ATOM   3819  C  CA  . GLY B  1 219 ? 67.572  73.180  -32.249  1.00 33.75  ? 218 GLY B CA  1 
ATOM   3820  C  C   . GLY B  1 219 ? 68.689  73.702  -31.346  1.00 32.34  ? 218 GLY B C   1 
ATOM   3821  O  O   . GLY B  1 219 ? 69.812  73.183  -31.380  1.00 36.68  ? 218 GLY B O   1 
ATOM   3822  N  N   . ARG B  1 220 ? 68.407  74.725  -30.540  1.00 30.94  ? 219 ARG B N   1 
ATOM   3823  C  CA  . ARG B  1 220 ? 69.439  75.282  -29.653  1.00 32.91  ? 219 ARG B CA  1 
ATOM   3824  C  C   . ARG B  1 220 ? 69.317  74.860  -28.188  1.00 33.25  ? 219 ARG B C   1 
ATOM   3825  O  O   . ARG B  1 220 ? 70.025  75.392  -27.327  1.00 30.24  ? 219 ARG B O   1 
ATOM   3826  C  CB  . ARG B  1 220 ? 69.490  76.819  -29.737  1.00 34.19  ? 219 ARG B CB  1 
ATOM   3827  C  CG  . ARG B  1 220 ? 69.998  77.354  -31.061  1.00 43.01  ? 219 ARG B CG  1 
ATOM   3828  C  CD  . ARG B  1 220 ? 70.272  78.853  -30.959  1.00 48.34  ? 219 ARG B CD  1 
ATOM   3829  N  NE  . ARG B  1 220 ? 70.227  79.489  -32.271  1.00 83.32  ? 219 ARG B NE  1 
ATOM   3830  C  CZ  . ARG B  1 220 ? 71.229  79.480  -33.146  1.00 96.39  ? 219 ARG B CZ  1 
ATOM   3831  N  NH1 . ARG B  1 220 ? 71.087  80.089  -34.321  1.00 71.04  ? 219 ARG B NH1 1 
ATOM   3832  N  NH2 . ARG B  1 220 ? 72.372  78.862  -32.852  1.00 75.68  ? 219 ARG B NH2 1 
ATOM   3833  N  N   . VAL B  1 221 ? 68.421  73.922  -27.905  1.00 31.98  ? 220 VAL B N   1 
ATOM   3834  C  CA  . VAL B  1 221 ? 68.228  73.432  -26.541  1.00 32.63  ? 220 VAL B CA  1 
ATOM   3835  C  C   . VAL B  1 221 ? 69.538  72.936  -25.927  1.00 33.21  ? 220 VAL B C   1 
ATOM   3836  O  O   . VAL B  1 221 ? 70.322  72.263  -26.594  1.00 28.83  ? 220 VAL B O   1 
ATOM   3837  C  CB  . VAL B  1 221 ? 67.191  72.293  -26.503  1.00 35.85  ? 220 VAL B CB  1 
ATOM   3838  C  CG1 . VAL B  1 221 ? 67.309  71.482  -25.213  1.00 36.74  ? 220 VAL B CG1 1 
ATOM   3839  C  CG2 . VAL B  1 221 ? 65.781  72.856  -26.630  1.00 30.44  ? 220 VAL B CG2 1 
ATOM   3840  N  N   . GLY B  1 222 ? 69.772  73.293  -24.665  1.00 33.19  ? 221 GLY B N   1 
ATOM   3841  C  CA  . GLY B  1 222 ? 70.882  72.759  -23.903  1.00 31.17  ? 221 GLY B CA  1 
ATOM   3842  C  C   . GLY B  1 222 ? 71.040  73.489  -22.593  1.00 29.82  ? 221 GLY B C   1 
ATOM   3843  O  O   . GLY B  1 222 ? 70.339  74.468  -22.323  1.00 33.29  ? 221 GLY B O   1 
ATOM   3844  N  N   . ILE B  1 223 ? 71.979  73.019  -21.775  1.00 31.28  ? 222 ILE B N   1 
ATOM   3845  C  CA  . ILE B  1 223 ? 72.291  73.684  -20.522  1.00 32.27  ? 222 ILE B CA  1 
ATOM   3846  C  C   . ILE B  1 223 ? 72.957  75.041  -20.790  1.00 32.32  ? 222 ILE B C   1 
ATOM   3847  O  O   . ILE B  1 223 ? 73.991  75.114  -21.461  1.00 31.45  ? 222 ILE B O   1 
ATOM   3848  C  CB  . ILE B  1 223 ? 73.208  72.806  -19.637  1.00 25.30  ? 222 ILE B CB  1 
ATOM   3849  C  CG1 . ILE B  1 223 ? 72.523  71.456  -19.355  1.00 31.37  ? 222 ILE B CG1 1 
ATOM   3850  C  CG2 . ILE B  1 223 ? 73.506  73.516  -18.319  1.00 26.85  ? 222 ILE B CG2 1 
ATOM   3851  C  CD1 . ILE B  1 223 ? 73.468  70.425  -18.737  1.00 34.35  ? 222 ILE B CD1 1 
ATOM   3852  N  N   . ALA B  1 224 ? 72.351  76.103  -20.260  1.00 29.07  ? 223 ALA B N   1 
ATOM   3853  C  CA  . ALA B  1 224 ? 72.884  77.466  -20.366  1.00 32.57  ? 223 ALA B CA  1 
ATOM   3854  C  C   . ALA B  1 224 ? 72.378  78.292  -19.188  1.00 42.82  ? 223 ALA B C   1 
ATOM   3855  O  O   . ALA B  1 224 ? 71.566  77.816  -18.410  1.00 32.21  ? 223 ALA B O   1 
ATOM   3856  C  CB  . ALA B  1 224 ? 72.462  78.112  -21.685  1.00 32.01  ? 223 ALA B CB  1 
ATOM   3857  N  N   . ASP B  1 225 ? 72.843  79.531  -19.053  1.00 31.37  ? 224 ASP B N   1 
ATOM   3858  C  CA  . ASP B  1 225 ? 72.296  80.404  -18.020  1.00 37.22  ? 224 ASP B CA  1 
ATOM   3859  C  C   . ASP B  1 225 ? 70.800  80.695  -18.283  1.00 35.11  ? 224 ASP B C   1 
ATOM   3860  O  O   . ASP B  1 225 ? 70.382  80.825  -19.433  1.00 30.49  ? 224 ASP B O   1 
ATOM   3861  C  CB  . ASP B  1 225 ? 73.094  81.699  -17.960  1.00 30.38  ? 224 ASP B CB  1 
ATOM   3862  C  CG  . ASP B  1 225 ? 72.700  82.563  -16.800  1.00 46.24  ? 224 ASP B CG  1 
ATOM   3863  O  OD1 . ASP B  1 225 ? 73.319  82.420  -15.726  1.00 41.22  ? 224 ASP B OD1 1 
ATOM   3864  O  OD2 . ASP B  1 225 ? 71.775  83.388  -16.962  1.00 40.43  ? 224 ASP B OD2 1 
ATOM   3865  N  N   . ARG B  1 226 ? 69.998  80.803  -17.227  1.00 30.89  ? 225 ARG B N   1 
ATOM   3866  C  CA  . ARG B  1 226 ? 68.556  81.022  -17.413  1.00 34.22  ? 225 ARG B CA  1 
ATOM   3867  C  C   . ARG B  1 226 ? 68.257  82.306  -18.190  1.00 35.05  ? 225 ARG B C   1 
ATOM   3868  O  O   . ARG B  1 226 ? 67.252  82.400  -18.896  1.00 29.36  ? 225 ARG B O   1 
ATOM   3869  C  CB  . ARG B  1 226 ? 67.788  80.984  -16.080  1.00 35.15  ? 225 ARG B CB  1 
ATOM   3870  C  CG  . ARG B  1 226 ? 68.165  82.074  -15.093  1.00 43.77  ? 225 ARG B CG  1 
ATOM   3871  C  CD  . ARG B  1 226 ? 67.386  81.939  -13.774  1.00 46.13  ? 225 ARG B CD  1 
ATOM   3872  N  NE  . ARG B  1 226 ? 67.925  80.908  -12.887  1.00 45.95  ? 225 ARG B NE  1 
ATOM   3873  C  CZ  . ARG B  1 226 ? 67.282  79.797  -12.526  1.00 47.18  ? 225 ARG B CZ  1 
ATOM   3874  N  NH1 . ARG B  1 226 ? 66.050  79.553  -12.962  1.00 36.38  ? 225 ARG B NH1 1 
ATOM   3875  N  NH2 . ARG B  1 226 ? 67.870  78.931  -11.711  1.00 46.35  ? 225 ARG B NH2 1 
ATOM   3876  N  N   . TYR B  1 227 ? 69.147  83.282  -18.107  1.00 33.36  ? 226 TYR B N   1 
ATOM   3877  C  CA  . TYR B  1 227 ? 68.943  84.507  -18.884  1.00 37.89  ? 226 TYR B CA  1 
ATOM   3878  C  C   . TYR B  1 227 ? 68.999  84.317  -20.401  1.00 36.40  ? 226 TYR B C   1 
ATOM   3879  O  O   . TYR B  1 227 ? 68.593  85.200  -21.148  1.00 31.51  ? 226 TYR B O   1 
ATOM   3880  C  CB  . TYR B  1 227 ? 69.887  85.628  -18.426  1.00 28.71  ? 226 TYR B CB  1 
ATOM   3881  C  CG  . TYR B  1 227 ? 69.388  86.325  -17.183  1.00 30.88  ? 226 TYR B CG  1 
ATOM   3882  C  CD1 . TYR B  1 227 ? 69.397  85.680  -15.959  1.00 32.73  ? 226 TYR B CD1 1 
ATOM   3883  C  CD2 . TYR B  1 227 ? 68.913  87.636  -17.235  1.00 38.96  ? 226 TYR B CD2 1 
ATOM   3884  C  CE1 . TYR B  1 227 ? 68.944  86.309  -14.813  1.00 36.05  ? 226 TYR B CE1 1 
ATOM   3885  C  CE2 . TYR B  1 227 ? 68.457  88.281  -16.086  1.00 38.17  ? 226 TYR B CE2 1 
ATOM   3886  C  CZ  . TYR B  1 227 ? 68.471  87.608  -14.881  1.00 47.16  ? 226 TYR B CZ  1 
ATOM   3887  O  OH  . TYR B  1 227 ? 68.021  88.230  -13.730  1.00 41.58  ? 226 TYR B OH  1 
ATOM   3888  N  N   . GLN B  1 228 ? 69.472  83.169  -20.870  1.00 31.17  ? 227 GLN B N   1 
ATOM   3889  C  CA  . GLN B  1 228 ? 69.444  82.921  -22.310  1.00 30.59  ? 227 GLN B CA  1 
ATOM   3890  C  C   . GLN B  1 228 ? 67.997  82.991  -22.814  1.00 42.43  ? 227 GLN B C   1 
ATOM   3891  O  O   . GLN B  1 228 ? 67.704  83.570  -23.861  1.00 31.30  ? 227 GLN B O   1 
ATOM   3892  C  CB  . GLN B  1 228 ? 70.063  81.562  -22.650  1.00 28.66  ? 227 GLN B CB  1 
ATOM   3893  C  CG  . GLN B  1 228 ? 69.827  81.122  -24.115  1.00 38.48  ? 227 GLN B CG  1 
ATOM   3894  C  CD  . GLN B  1 228 ? 70.431  82.092  -25.133  1.00 40.28  ? 227 GLN B CD  1 
ATOM   3895  O  OE1 . GLN B  1 228 ? 71.415  82.780  -24.844  1.00 38.69  ? 227 GLN B OE1 1 
ATOM   3896  N  NE2 . GLN B  1 228 ? 69.840  82.151  -26.331  1.00 32.22  ? 227 GLN B NE2 1 
ATOM   3897  N  N   . ASP B  1 229 ? 67.084  82.425  -22.037  1.00 28.92  ? 228 ASP B N   1 
ATOM   3898  C  CA  . ASP B  1 229 ? 65.684  82.409  -22.422  1.00 29.41  ? 228 ASP B CA  1 
ATOM   3899  C  C   . ASP B  1 229 ? 64.967  83.680  -21.992  1.00 30.75  ? 228 ASP B C   1 
ATOM   3900  O  O   . ASP B  1 229 ? 64.185  84.236  -22.759  1.00 34.64  ? 228 ASP B O   1 
ATOM   3901  C  CB  . ASP B  1 229 ? 64.985  81.184  -21.829  1.00 30.17  ? 228 ASP B CB  1 
ATOM   3902  C  CG  . ASP B  1 229 ? 65.379  79.876  -22.537  1.00 34.24  ? 228 ASP B CG  1 
ATOM   3903  O  OD1 . ASP B  1 229 ? 65.864  79.906  -23.692  1.00 32.14  ? 228 ASP B OD1 1 
ATOM   3904  O  OD2 . ASP B  1 229 ? 65.172  78.806  -21.941  1.00 33.07  ? 228 ASP B OD2 1 
ATOM   3905  N  N   . LEU B  1 230 ? 65.236  84.150  -20.774  1.00 30.30  ? 229 LEU B N   1 
ATOM   3906  C  CA  . LEU B  1 230 ? 64.599  85.376  -20.297  1.00 30.76  ? 229 LEU B CA  1 
ATOM   3907  C  C   . LEU B  1 230 ? 64.900  86.570  -21.215  1.00 36.77  ? 229 LEU B C   1 
ATOM   3908  O  O   . LEU B  1 230 ? 64.028  87.394  -21.486  1.00 32.65  ? 229 LEU B O   1 
ATOM   3909  C  CB  . LEU B  1 230 ? 65.052  85.694  -18.877  1.00 30.50  ? 229 LEU B CB  1 
ATOM   3910  C  CG  . LEU B  1 230 ? 64.553  84.723  -17.814  1.00 41.17  ? 229 LEU B CG  1 
ATOM   3911  C  CD1 . LEU B  1 230 ? 65.375  84.859  -16.541  1.00 36.91  ? 229 LEU B CD1 1 
ATOM   3912  C  CD2 . LEU B  1 230 ? 63.066  84.981  -17.562  1.00 34.66  ? 229 LEU B CD2 1 
ATOM   3913  N  N   . ALA B  1 231 ? 66.140  86.662  -21.684  1.00 36.43  ? 230 ALA B N   1 
ATOM   3914  C  CA  . ALA B  1 231 ? 66.556  87.811  -22.486  1.00 34.24  ? 230 ALA B CA  1 
ATOM   3915  C  C   . ALA B  1 231 ? 65.851  87.862  -23.828  1.00 31.60  ? 230 ALA B C   1 
ATOM   3916  O  O   . ALA B  1 231 ? 65.400  88.922  -24.257  1.00 32.72  ? 230 ALA B O   1 
ATOM   3917  C  CB  . ALA B  1 231 ? 68.079  87.810  -22.695  1.00 31.05  ? 230 ALA B CB  1 
ATOM   3918  N  N   . ILE B  1 232 ? 65.787  86.723  -24.503  1.00 27.98  ? 231 ILE B N   1 
ATOM   3919  C  CA  . ILE B  1 232 ? 65.158  86.681  -25.813  1.00 33.89  ? 231 ILE B CA  1 
ATOM   3920  C  C   . ILE B  1 232 ? 63.664  87.001  -25.714  1.00 29.56  ? 231 ILE B C   1 
ATOM   3921  O  O   . ILE B  1 232 ? 63.155  87.794  -26.492  1.00 30.36  ? 231 ILE B O   1 
ATOM   3922  C  CB  . ILE B  1 232 ? 65.440  85.362  -26.544  1.00 34.28  ? 231 ILE B CB  1 
ATOM   3923  C  CG1 . ILE B  1 232 ? 66.896  85.381  -27.051  1.00 33.31  ? 231 ILE B CG1 1 
ATOM   3924  C  CG2 . ILE B  1 232 ? 64.475  85.180  -27.723  1.00 29.10  ? 231 ILE B CG2 1 
ATOM   3925  C  CD1 . ILE B  1 232 ? 67.320  84.142  -27.822  1.00 42.75  ? 231 ILE B CD1 1 
ATOM   3926  N  N   . LEU B  1 233 ? 62.981  86.438  -24.722  1.00 26.86  ? 232 LEU B N   1 
ATOM   3927  C  CA  . LEU B  1 233 ? 61.550  86.734  -24.566  1.00 30.98  ? 232 LEU B CA  1 
ATOM   3928  C  C   . LEU B  1 233 ? 61.305  88.183  -24.126  1.00 41.00  ? 232 LEU B C   1 
ATOM   3929  O  O   . LEU B  1 233 ? 60.388  88.860  -24.629  1.00 33.18  ? 232 LEU B O   1 
ATOM   3930  C  CB  . LEU B  1 233 ? 60.903  85.763  -23.589  1.00 32.88  ? 232 LEU B CB  1 
ATOM   3931  C  CG  . LEU B  1 233 ? 59.386  85.944  -23.448  1.00 37.15  ? 232 LEU B CG  1 
ATOM   3932  C  CD1 . LEU B  1 233 ? 58.711  85.952  -24.819  1.00 40.05  ? 232 LEU B CD1 1 
ATOM   3933  C  CD2 . LEU B  1 233 ? 58.813  84.842  -22.578  1.00 33.62  ? 232 LEU B CD2 1 
ATOM   3934  N  N   . TRP B  1 234 ? 62.128  88.651  -23.186  1.00 32.74  ? 233 TRP B N   1 
ATOM   3935  C  CA  . TRP B  1 234 ? 62.070  90.030  -22.715  1.00 30.64  ? 233 TRP B CA  1 
ATOM   3936  C  C   . TRP B  1 234 ? 62.198  90.976  -23.898  1.00 43.45  ? 233 TRP B C   1 
ATOM   3937  O  O   . TRP B  1 234 ? 61.459  91.962  -24.005  1.00 32.90  ? 233 TRP B O   1 
ATOM   3938  C  CB  . TRP B  1 234 ? 63.179  90.277  -21.671  1.00 35.23  ? 233 TRP B CB  1 
ATOM   3939  C  CG  . TRP B  1 234 ? 63.236  91.641  -21.070  1.00 41.14  ? 233 TRP B CG  1 
ATOM   3940  C  CD1 . TRP B  1 234 ? 62.649  92.059  -19.907  1.00 38.02  ? 233 TRP B CD1 1 
ATOM   3941  C  CD2 . TRP B  1 234 ? 63.951  92.766  -21.584  1.00 33.06  ? 233 TRP B CD2 1 
ATOM   3942  N  NE1 . TRP B  1 234 ? 62.952  93.376  -19.671  1.00 40.31  ? 233 TRP B NE1 1 
ATOM   3943  C  CE2 . TRP B  1 234 ? 63.743  93.837  -20.690  1.00 34.17  ? 233 TRP B CE2 1 
ATOM   3944  C  CE3 . TRP B  1 234 ? 64.736  92.974  -22.721  1.00 38.64  ? 233 TRP B CE3 1 
ATOM   3945  C  CZ2 . TRP B  1 234 ? 64.291  95.097  -20.897  1.00 42.08  ? 233 TRP B CZ2 1 
ATOM   3946  C  CZ3 . TRP B  1 234 ? 65.277  94.225  -22.927  1.00 38.74  ? 233 TRP B CZ3 1 
ATOM   3947  C  CH2 . TRP B  1 234 ? 65.054  95.274  -22.018  1.00 53.22  ? 233 TRP B CH2 1 
ATOM   3948  N  N   . ASN B  1 235 ? 63.130  90.660  -24.793  1.00 30.15  ? 234 ASN B N   1 
ATOM   3949  C  CA  . ASN B  1 235 ? 63.357  91.475  -25.981  1.00 31.47  ? 234 ASN B CA  1 
ATOM   3950  C  C   . ASN B  1 235 ? 62.092  91.536  -26.853  1.00 29.36  ? 234 ASN B C   1 
ATOM   3951  O  O   . ASN B  1 235 ? 61.657  92.616  -27.247  1.00 33.00  ? 234 ASN B O   1 
ATOM   3952  C  CB  . ASN B  1 235 ? 64.552  90.914  -26.773  1.00 28.57  ? 234 ASN B CB  1 
ATOM   3953  C  CG  . ASN B  1 235 ? 65.212  91.960  -27.662  1.00 36.92  ? 234 ASN B CG  1 
ATOM   3954  O  OD1 . ASN B  1 235 ? 65.162  93.150  -27.377  1.00 40.01  ? 234 ASN B OD1 1 
ATOM   3955  N  ND2 . ASN B  1 235 ? 65.852  91.511  -28.731  1.00 32.03  ? 234 ASN B ND2 1 
ATOM   3956  N  N   . CYS B  1 236 ? 61.507  90.375  -27.140  1.00 30.16  ? 235 CYS B N   1 
ATOM   3957  C  CA  . CYS B  1 236 ? 60.272  90.295  -27.929  1.00 33.72  ? 235 CYS B CA  1 
ATOM   3958  C  C   . CYS B  1 236 ? 59.111  91.104  -27.334  1.00 39.13  ? 235 CYS B C   1 
ATOM   3959  O  O   . CYS B  1 236 ? 58.337  91.705  -28.065  1.00 33.97  ? 235 CYS B O   1 
ATOM   3960  C  CB  . CYS B  1 236 ? 59.815  88.846  -28.065  1.00 29.99  ? 235 CYS B CB  1 
ATOM   3961  S  SG  . CYS B  1 236 ? 60.901  87.831  -29.093  1.00 37.05  ? 235 CYS B SG  1 
ATOM   3962  N  N   . LEU B  1 237 ? 58.990  91.097  -26.011  1.00 33.21  ? 236 LEU B N   1 
ATOM   3963  C  CA  . LEU B  1 237 ? 57.899  91.795  -25.334  1.00 27.88  ? 236 LEU B CA  1 
ATOM   3964  C  C   . LEU B  1 237 ? 58.055  93.317  -25.421  1.00 35.67  ? 236 LEU B C   1 
ATOM   3965  O  O   . LEU B  1 237 ? 57.105  94.058  -25.190  1.00 35.86  ? 236 LEU B O   1 
ATOM   3966  C  CB  . LEU B  1 237 ? 57.781  91.321  -23.878  1.00 31.58  ? 236 LEU B CB  1 
ATOM   3967  C  CG  . LEU B  1 237 ? 57.244  89.902  -23.669  1.00 35.13  ? 236 LEU B CG  1 
ATOM   3968  C  CD1 . LEU B  1 237 ? 57.401  89.457  -22.220  1.00 29.91  ? 236 LEU B CD1 1 
ATOM   3969  C  CD2 . LEU B  1 237 ? 55.778  89.808  -24.093  1.00 40.41  ? 236 LEU B CD2 1 
ATOM   3970  N  N   . GLY B  1 238 ? 59.250  93.777  -25.787  1.00 36.38  ? 237 GLY B N   1 
ATOM   3971  C  CA  . GLY B  1 238 ? 59.486  95.192  -26.055  1.00 38.72  ? 237 GLY B CA  1 
ATOM   3972  C  C   . GLY B  1 238 ? 58.659  95.757  -27.210  1.00 31.75  ? 237 GLY B C   1 
ATOM   3973  O  O   . GLY B  1 238 ? 58.390  96.958  -27.268  1.00 30.36  ? 237 GLY B O   1 
ATOM   3974  N  N   . GLU B  1 239 ? 58.240  94.893  -28.128  1.00 33.02  ? 238 GLU B N   1 
ATOM   3975  C  CA  . GLU B  1 239 ? 57.344  95.306  -29.209  1.00 36.24  ? 238 GLU B CA  1 
ATOM   3976  C  C   . GLU B  1 239 ? 55.934  95.629  -28.683  1.00 45.11  ? 238 GLU B C   1 
ATOM   3977  O  O   . GLU B  1 239 ? 55.091  96.162  -29.409  1.00 40.64  ? 238 GLU B O   1 
ATOM   3978  C  CB  . GLU B  1 239 ? 57.248  94.207  -30.257  1.00 35.29  ? 238 GLU B CB  1 
ATOM   3979  C  CG  . GLU B  1 239 ? 58.309  94.276  -31.334  1.00 42.10  ? 238 GLU B CG  1 
ATOM   3980  C  CD  . GLU B  1 239 ? 59.703  94.057  -30.796  1.00 49.80  ? 238 GLU B CD  1 
ATOM   3981  O  OE1 . GLU B  1 239 ? 60.642  94.668  -31.340  1.00 102.04 ? 238 GLU B OE1 1 
ATOM   3982  O  OE2 . GLU B  1 239 ? 59.867  93.271  -29.849  1.00 68.75  ? 238 GLU B OE2 1 
ATOM   3983  N  N   . PHE B  1 240 ? 55.690  95.316  -27.417  1.00 33.70  ? 239 PHE B N   1 
ATOM   3984  C  CA  . PHE B  1 240 ? 54.372  95.507  -26.812  1.00 35.72  ? 239 PHE B CA  1 
ATOM   3985  C  C   . PHE B  1 240 ? 54.333  96.568  -25.712  1.00 41.16  ? 239 PHE B C   1 
ATOM   3986  O  O   . PHE B  1 240 ? 53.638  97.567  -25.867  1.00 41.09  ? 239 PHE B O   1 
ATOM   3987  C  CB  . PHE B  1 240 ? 53.795  94.152  -26.406  1.00 35.10  ? 239 PHE B CB  1 
ATOM   3988  C  CG  . PHE B  1 240 ? 53.674  93.223  -27.571  1.00 40.16  ? 239 PHE B CG  1 
ATOM   3989  C  CD1 . PHE B  1 240 ? 52.529  93.226  -28.350  1.00 35.69  ? 239 PHE B CD1 1 
ATOM   3990  C  CD2 . PHE B  1 240 ? 54.740  92.419  -27.953  1.00 34.52  ? 239 PHE B CD2 1 
ATOM   3991  C  CE1 . PHE B  1 240 ? 52.429  92.405  -29.460  1.00 39.29  ? 239 PHE B CE1 1 
ATOM   3992  C  CE2 . PHE B  1 240 ? 54.646  91.594  -29.058  1.00 34.58  ? 239 PHE B CE2 1 
ATOM   3993  C  CZ  . PHE B  1 240 ? 53.489  91.584  -29.818  1.00 34.20  ? 239 PHE B CZ  1 
ATOM   3994  N  N   . SER B  1 241 ? 55.096  96.393  -24.635  1.00 36.45  ? 240 SER B N   1 
ATOM   3995  C  CA  . SER B  1 241 ? 55.242  97.467  -23.650  1.00 36.12  ? 240 SER B CA  1 
ATOM   3996  C  C   . SER B  1 241 ? 56.332  97.146  -22.656  1.00 32.62  ? 240 SER B C   1 
ATOM   3997  O  O   . SER B  1 241 ? 56.609  95.994  -22.412  1.00 34.00  ? 240 SER B O   1 
ATOM   3998  C  CB  . SER B  1 241 ? 53.938  97.678  -22.857  1.00 34.09  ? 240 SER B CB  1 
ATOM   3999  O  OG  . SER B  1 241 ? 53.930  96.830  -21.720  1.00 36.23  ? 240 SER B OG  1 
ATOM   4000  N  N   . PRO B  1 242 ? 56.918  98.176  -22.035  1.00 36.20  ? 241 PRO B N   1 
ATOM   4001  C  CA  . PRO B  1 242 ? 57.889  97.910  -20.974  1.00 39.52  ? 241 PRO B CA  1 
ATOM   4002  C  C   . PRO B  1 242 ? 57.238  97.283  -19.733  1.00 43.02  ? 241 PRO B C   1 
ATOM   4003  O  O   . PRO B  1 242 ? 57.922  96.614  -18.959  1.00 39.89  ? 241 PRO B O   1 
ATOM   4004  C  CB  . PRO B  1 242 ? 58.420  99.307  -20.617  1.00 42.48  ? 241 PRO B CB  1 
ATOM   4005  C  CG  . PRO B  1 242 ? 57.937  100.223 -21.697  1.00 55.95  ? 241 PRO B CG  1 
ATOM   4006  C  CD  . PRO B  1 242 ? 56.690  99.619  -22.230  1.00 38.32  ? 241 PRO B CD  1 
ATOM   4007  N  N   . SER B  1 243 ? 55.942  97.504  -19.530  1.00 38.21  ? 242 SER B N   1 
ATOM   4008  C  CA  . SER B  1 243 ? 55.268  96.908  -18.372  1.00 30.96  ? 242 SER B CA  1 
ATOM   4009  C  C   . SER B  1 243 ? 55.207  95.391  -18.541  1.00 33.19  ? 242 SER B C   1 
ATOM   4010  O  O   . SER B  1 243 ? 55.398  94.641  -17.583  1.00 35.68  ? 242 SER B O   1 
ATOM   4011  C  CB  . SER B  1 243 ? 53.861  97.500  -18.191  1.00 36.93  ? 242 SER B CB  1 
ATOM   4012  O  OG  . SER B  1 243 ? 53.179  96.938  -17.073  1.00 50.41  ? 242 SER B OG  1 
ATOM   4013  N  N   . LEU B  1 244 ? 54.948  94.934  -19.763  1.00 31.62  ? 243 LEU B N   1 
ATOM   4014  C  CA  . LEU B  1 244 ? 54.886  93.498  -20.018  1.00 34.35  ? 243 LEU B CA  1 
ATOM   4015  C  C   . LEU B  1 244 ? 56.283  92.881  -19.912  1.00 41.06  ? 243 LEU B C   1 
ATOM   4016  O  O   . LEU B  1 244 ? 56.441  91.737  -19.493  1.00 34.47  ? 243 LEU B O   1 
ATOM   4017  C  CB  . LEU B  1 244 ? 54.270  93.216  -21.387  1.00 29.91  ? 243 LEU B CB  1 
ATOM   4018  C  CG  . LEU B  1 244 ? 52.782  93.587  -21.535  1.00 32.32  ? 243 LEU B CG  1 
ATOM   4019  C  CD1 . LEU B  1 244 ? 52.289  93.263  -22.932  1.00 37.20  ? 243 LEU B CD1 1 
ATOM   4020  C  CD2 . LEU B  1 244 ? 51.938  92.862  -20.490  1.00 39.47  ? 243 LEU B CD2 1 
ATOM   4021  N  N   . GLN B  1 245 ? 57.298  93.649  -20.292  1.00 38.80  ? 244 GLN B N   1 
ATOM   4022  C  CA  . GLN B  1 245 ? 58.683  93.208  -20.120  1.00 36.69  ? 244 GLN B CA  1 
ATOM   4023  C  C   . GLN B  1 245 ? 58.997  92.976  -18.636  1.00 34.75  ? 244 GLN B C   1 
ATOM   4024  O  O   . GLN B  1 245 ? 59.551  91.940  -18.260  1.00 38.77  ? 244 GLN B O   1 
ATOM   4025  C  CB  . GLN B  1 245 ? 59.649  94.242  -20.699  1.00 33.80  ? 244 GLN B CB  1 
ATOM   4026  C  CG  . GLN B  1 245 ? 59.686  94.298  -22.215  1.00 29.80  ? 244 GLN B CG  1 
ATOM   4027  C  CD  . GLN B  1 245 ? 60.702  95.297  -22.713  1.00 43.32  ? 244 GLN B CD  1 
ATOM   4028  O  OE1 . GLN B  1 245 ? 60.608  96.484  -22.411  1.00 37.32  ? 244 GLN B OE1 1 
ATOM   4029  N  NE2 . GLN B  1 245 ? 61.693  94.822  -23.461  1.00 39.54  ? 244 GLN B NE2 1 
ATOM   4030  N  N   . LYS B  1 246 ? 58.651  93.941  -17.792  1.00 34.94  ? 245 LYS B N   1 
ATOM   4031  C  CA  . LYS B  1 246 ? 58.894  93.796  -16.361  1.00 39.35  ? 245 LYS B CA  1 
ATOM   4032  C  C   . LYS B  1 246 ? 58.088  92.631  -15.802  1.00 45.46  ? 245 LYS B C   1 
ATOM   4033  O  O   . LYS B  1 246 ? 58.576  91.865  -14.972  1.00 40.58  ? 245 LYS B O   1 
ATOM   4034  C  CB  . LYS B  1 246 ? 58.561  95.086  -15.593  1.00 43.28  ? 245 LYS B CB  1 
ATOM   4035  C  CG  . LYS B  1 246 ? 59.694  96.108  -15.590  1.00 76.32  ? 245 LYS B CG  1 
ATOM   4036  C  CD  . LYS B  1 246 ? 59.405  97.297  -14.676  1.00 66.95  ? 245 LYS B CD  1 
ATOM   4037  C  CE  . LYS B  1 246 ? 60.389  98.438  -14.942  1.00 82.44  ? 245 LYS B CE  1 
ATOM   4038  N  NZ  . LYS B  1 246 ? 60.309  98.940  -16.350  1.00 57.81  ? 245 LYS B NZ  1 
ATOM   4039  N  N   . ARG B  1 247 ? 56.854  92.498  -16.273  1.00 38.15  ? 246 ARG B N   1 
ATOM   4040  C  CA  . ARG B  1 247 ? 55.953  91.461  -15.780  1.00 44.79  ? 246 ARG B CA  1 
ATOM   4041  C  C   . ARG B  1 247 ? 56.495  90.057  -16.026  1.00 37.95  ? 246 ARG B C   1 
ATOM   4042  O  O   . ARG B  1 247 ? 56.319  89.176  -15.189  1.00 37.49  ? 246 ARG B O   1 
ATOM   4043  C  CB  . ARG B  1 247 ? 54.568  91.602  -16.405  1.00 44.88  ? 246 ARG B CB  1 
ATOM   4044  C  CG  . ARG B  1 247 ? 53.512  90.765  -15.720  1.00 37.44  ? 246 ARG B CG  1 
ATOM   4045  C  CD  . ARG B  1 247 ? 52.133  91.040  -16.311  1.00 50.74  ? 246 ARG B CD  1 
ATOM   4046  N  NE  . ARG B  1 247 ? 51.116  90.224  -15.661  1.00 57.58  ? 246 ARG B NE  1 
ATOM   4047  C  CZ  . ARG B  1 247 ? 50.286  90.665  -14.723  1.00 48.14  ? 246 ARG B CZ  1 
ATOM   4048  N  NH1 . ARG B  1 247 ? 50.331  91.933  -14.324  1.00 57.05  ? 246 ARG B NH1 1 
ATOM   4049  N  NH2 . ARG B  1 247 ? 49.402  89.836  -14.187  1.00 53.12  ? 246 ARG B NH2 1 
ATOM   4050  N  N   . LEU B  1 248 ? 57.150  89.844  -17.170  1.00 34.93  ? 247 LEU B N   1 
ATOM   4051  C  CA  . LEU B  1 248 ? 57.789  88.558  -17.420  1.00 38.24  ? 247 LEU B CA  1 
ATOM   4052  C  C   . LEU B  1 248 ? 58.722  88.163  -16.272  1.00 46.83  ? 247 LEU B C   1 
ATOM   4053  O  O   . LEU B  1 248 ? 58.625  87.055  -15.744  1.00 36.85  ? 247 LEU B O   1 
ATOM   4054  C  CB  . LEU B  1 248 ? 58.572  88.570  -18.733  1.00 40.23  ? 247 LEU B CB  1 
ATOM   4055  C  CG  . LEU B  1 248 ? 59.508  87.370  -18.912  1.00 40.13  ? 247 LEU B CG  1 
ATOM   4056  C  CD1 . LEU B  1 248 ? 58.718  86.073  -18.963  1.00 36.03  ? 247 LEU B CD1 1 
ATOM   4057  C  CD2 . LEU B  1 248 ? 60.394  87.528  -20.157  1.00 33.19  ? 247 LEU B CD2 1 
ATOM   4058  N  N   . PHE B  1 249 ? 59.618  89.067  -15.880  1.00 31.36  ? 248 PHE B N   1 
ATOM   4059  C  CA  . PHE B  1 249 ? 60.522  88.768  -14.764  1.00 41.55  ? 248 PHE B CA  1 
ATOM   4060  C  C   . PHE B  1 249 ? 59.764  88.592  -13.461  1.00 42.00  ? 248 PHE B C   1 
ATOM   4061  O  O   . PHE B  1 249 ? 60.056  87.676  -12.687  1.00 38.94  ? 248 PHE B O   1 
ATOM   4062  C  CB  . PHE B  1 249 ? 61.590  89.851  -14.583  1.00 35.70  ? 248 PHE B CB  1 
ATOM   4063  C  CG  . PHE B  1 249 ? 62.748  89.724  -15.532  1.00 39.42  ? 248 PHE B CG  1 
ATOM   4064  C  CD1 . PHE B  1 249 ? 63.720  88.763  -15.331  1.00 39.47  ? 248 PHE B CD1 1 
ATOM   4065  C  CD2 . PHE B  1 249 ? 62.877  90.574  -16.615  1.00 44.35  ? 248 PHE B CD2 1 
ATOM   4066  C  CE1 . PHE B  1 249 ? 64.791  88.643  -16.199  1.00 39.35  ? 248 PHE B CE1 1 
ATOM   4067  C  CE2 . PHE B  1 249 ? 63.949  90.455  -17.481  1.00 50.29  ? 248 PHE B CE2 1 
ATOM   4068  C  CZ  . PHE B  1 249 ? 64.902  89.489  -17.274  1.00 45.82  ? 248 PHE B CZ  1 
ATOM   4069  N  N   . GLN B  1 250 ? 58.810  89.485  -13.208  1.00 37.82  ? 249 GLN B N   1 
ATOM   4070  C  CA  . GLN B  1 250 ? 58.054  89.448  -11.955  1.00 48.66  ? 249 GLN B CA  1 
ATOM   4071  C  C   . GLN B  1 250 ? 57.411  88.085  -11.747  1.00 47.03  ? 249 GLN B C   1 
ATOM   4072  O  O   . GLN B  1 250 ? 57.578  87.460  -10.705  1.00 45.55  ? 249 GLN B O   1 
ATOM   4073  C  CB  . GLN B  1 250 ? 56.969  90.539  -11.934  1.00 47.69  ? 249 GLN B CB  1 
ATOM   4074  C  CG  . GLN B  1 250 ? 57.506  91.969  -11.979  1.00 76.78  ? 249 GLN B CG  1 
ATOM   4075  C  CD  . GLN B  1 250 ? 56.408  93.032  -11.997  1.00 84.50  ? 249 GLN B CD  1 
ATOM   4076  O  OE1 . GLN B  1 250 ? 55.404  92.910  -12.707  1.00 67.32  ? 249 GLN B OE1 1 
ATOM   4077  N  NE2 . GLN B  1 250 ? 56.603  94.085  -11.210  1.00 77.54  ? 249 GLN B NE2 1 
ATOM   4078  N  N   . LYS B  1 251 ? 56.686  87.627  -12.760  1.00 39.78  ? 250 LYS B N   1 
ATOM   4079  C  CA  . LYS B  1 251 ? 55.932  86.381  -12.679  1.00 38.49  ? 250 LYS B CA  1 
ATOM   4080  C  C   . LYS B  1 251 ? 56.826  85.153  -12.709  1.00 39.95  ? 250 LYS B C   1 
ATOM   4081  O  O   . LYS B  1 251 ? 56.494  84.123  -12.116  1.00 42.92  ? 250 LYS B O   1 
ATOM   4082  C  CB  . LYS B  1 251 ? 54.915  86.316  -13.816  1.00 35.39  ? 250 LYS B CB  1 
ATOM   4083  C  CG  . LYS B  1 251 ? 53.838  87.393  -13.711  1.00 45.27  ? 250 LYS B CG  1 
ATOM   4084  C  CD  . LYS B  1 251 ? 52.953  87.172  -12.478  1.00 58.74  ? 250 LYS B CD  1 
ATOM   4085  C  CE  . LYS B  1 251 ? 52.014  88.342  -12.241  1.00 54.49  ? 250 LYS B CE  1 
ATOM   4086  N  NZ  . LYS B  1 251 ? 51.180  88.169  -11.012  1.00 51.91  ? 250 LYS B NZ  1 
ATOM   4087  N  N   . TYR B  1 252 ? 57.956  85.258  -13.408  1.00 34.88  ? 251 TYR B N   1 
ATOM   4088  C  CA  . TYR B  1 252 ? 58.933  84.172  -13.445  1.00 35.58  ? 251 TYR B CA  1 
ATOM   4089  C  C   . TYR B  1 252 ? 59.551  84.004  -12.073  1.00 39.62  ? 251 TYR B C   1 
ATOM   4090  O  O   . TYR B  1 252 ? 59.961  82.909  -11.693  1.00 38.18  ? 251 TYR B O   1 
ATOM   4091  C  CB  . TYR B  1 252 ? 60.026  84.474  -14.467  1.00 42.18  ? 251 TYR B CB  1 
ATOM   4092  C  CG  . TYR B  1 252 ? 61.135  83.436  -14.544  1.00 43.16  ? 251 TYR B CG  1 
ATOM   4093  C  CD1 . TYR B  1 252 ? 61.018  82.313  -15.370  1.00 32.31  ? 251 TYR B CD1 1 
ATOM   4094  C  CD2 . TYR B  1 252 ? 62.305  83.589  -13.810  1.00 41.33  ? 251 TYR B CD2 1 
ATOM   4095  C  CE1 . TYR B  1 252 ? 62.040  81.365  -15.454  1.00 40.42  ? 251 TYR B CE1 1 
ATOM   4096  C  CE2 . TYR B  1 252 ? 63.331  82.638  -13.885  1.00 38.34  ? 251 TYR B CE2 1 
ATOM   4097  C  CZ  . TYR B  1 252 ? 63.191  81.536  -14.708  1.00 36.98  ? 251 TYR B CZ  1 
ATOM   4098  O  OH  . TYR B  1 252 ? 64.213  80.608  -14.780  1.00 39.02  ? 251 TYR B OH  1 
ATOM   4099  N  N   . GLY B  1 253 ? 59.640  85.107  -11.341  1.00 41.90  ? 252 GLY B N   1 
ATOM   4100  C  CA  . GLY B  1 253 ? 60.081  85.072  -9.955   1.00 41.75  ? 252 GLY B CA  1 
ATOM   4101  C  C   . GLY B  1 253 ? 61.368  85.816  -9.659   1.00 50.48  ? 252 GLY B C   1 
ATOM   4102  O  O   . GLY B  1 253 ? 61.993  85.604  -8.620   1.00 44.61  ? 252 GLY B O   1 
ATOM   4103  N  N   . ILE B  1 254 ? 61.771  86.689  -10.572  1.00 42.62  ? 253 ILE B N   1 
ATOM   4104  C  CA  . ILE B  1 254 ? 62.943  87.518  -10.355  1.00 49.14  ? 253 ILE B CA  1 
ATOM   4105  C  C   . ILE B  1 254 ? 62.535  88.953  -10.045  1.00 52.46  ? 253 ILE B C   1 
ATOM   4106  O  O   . ILE B  1 254 ? 62.076  89.679  -10.925  1.00 49.98  ? 253 ILE B O   1 
ATOM   4107  C  CB  . ILE B  1 254 ? 63.880  87.487  -11.572  1.00 43.71  ? 253 ILE B CB  1 
ATOM   4108  C  CG1 . ILE B  1 254 ? 64.435  86.072  -11.758  1.00 43.31  ? 253 ILE B CG1 1 
ATOM   4109  C  CG2 . ILE B  1 254 ? 65.017  88.475  -11.376  1.00 59.95  ? 253 ILE B CG2 1 
ATOM   4110  C  CD1 . ILE B  1 254 ? 65.283  85.896  -13.008  1.00 41.61  ? 253 ILE B CD1 1 
ATOM   4111  N  N   . ASP B  1 255 ? 62.710  89.340  -8.786   1.00 57.36  ? 254 ASP B N   1 
ATOM   4112  C  CA  . ASP B  1 255 ? 62.302  90.646  -8.283   1.00 66.63  ? 254 ASP B CA  1 
ATOM   4113  C  C   . ASP B  1 255 ? 63.061  91.797  -8.923   1.00 57.27  ? 254 ASP B C   1 
ATOM   4114  O  O   . ASP B  1 255 ? 62.461  92.745  -9.427   1.00 61.61  ? 254 ASP B O   1 
ATOM   4115  C  CB  . ASP B  1 255 ? 62.505  90.695  -6.774   1.00 59.45  ? 254 ASP B CB  1 
ATOM   4116  C  CG  . ASP B  1 255 ? 61.203  90.744  -6.025   1.00 79.87  ? 254 ASP B CG  1 
ATOM   4117  O  OD1 . ASP B  1 255 ? 60.200  91.172  -6.637   1.00 80.89  ? 254 ASP B OD1 1 
ATOM   4118  O  OD2 . ASP B  1 255 ? 61.182  90.359  -4.834   1.00 103.33 ? 254 ASP B OD2 1 
ATOM   4119  N  N   . ASN B  1 256 ? 64.386  91.719  -8.864   1.00 74.80  ? 255 ASN B N   1 
ATOM   4120  C  CA  . ASN B  1 256 ? 65.246  92.670  -9.553   1.00 58.59  ? 255 ASN B CA  1 
ATOM   4121  C  C   . ASN B  1 256 ? 66.130  91.911  -10.520  1.00 45.09  ? 255 ASN B C   1 
ATOM   4122  O  O   . ASN B  1 256 ? 67.034  91.188  -10.096  1.00 53.46  ? 255 ASN B O   1 
ATOM   4123  C  CB  . ASN B  1 256 ? 66.127  93.438  -8.564   1.00 50.70  ? 255 ASN B CB  1 
ATOM   4124  C  CG  . ASN B  1 256 ? 65.343  93.997  -7.391   1.00 72.13  ? 255 ASN B CG  1 
ATOM   4125  O  OD1 . ASN B  1 256 ? 65.640  93.695  -6.230   1.00 90.64  ? 255 ASN B OD1 1 
ATOM   4126  N  ND2 . ASN B  1 256 ? 64.340  94.818  -7.686   1.00 66.12  ? 255 ASN B ND2 1 
ATOM   4127  N  N   . PRO B  1 257 ? 65.870  92.065  -11.823  1.00 45.58  ? 256 PRO B N   1 
ATOM   4128  C  CA  . PRO B  1 257 ? 66.615  91.362  -12.872  1.00 44.63  ? 256 PRO B CA  1 
ATOM   4129  C  C   . PRO B  1 257 ? 68.076  91.803  -12.953  1.00 48.96  ? 256 PRO B C   1 
ATOM   4130  O  O   . PRO B  1 257 ? 68.380  92.974  -12.742  1.00 43.18  ? 256 PRO B O   1 
ATOM   4131  C  CB  . PRO B  1 257 ? 65.864  91.746  -14.153  1.00 57.29  ? 256 PRO B CB  1 
ATOM   4132  C  CG  . PRO B  1 257 ? 64.531  92.251  -13.694  1.00 60.64  ? 256 PRO B CG  1 
ATOM   4133  C  CD  . PRO B  1 257 ? 64.789  92.892  -12.381  1.00 45.47  ? 256 PRO B CD  1 
ATOM   4134  N  N   . ASP B  1 258 ? 68.962  90.857  -13.253  1.00 38.93  ? 257 ASP B N   1 
ATOM   4135  C  CA  . ASP B  1 258 ? 70.390  91.126  -13.394  1.00 43.79  ? 257 ASP B CA  1 
ATOM   4136  C  C   . ASP B  1 258 ? 70.654  91.807  -14.736  1.00 40.36  ? 257 ASP B C   1 
ATOM   4137  O  O   . ASP B  1 258 ? 70.699  91.152  -15.775  1.00 36.41  ? 257 ASP B O   1 
ATOM   4138  C  CB  . ASP B  1 258 ? 71.172  89.813  -13.300  1.00 45.30  ? 257 ASP B CB  1 
ATOM   4139  C  CG  . ASP B  1 258 ? 72.677  90.024  -13.181  1.00 50.05  ? 257 ASP B CG  1 
ATOM   4140  O  OD1 . ASP B  1 258 ? 73.199  91.037  -13.690  1.00 61.51  ? 257 ASP B OD1 1 
ATOM   4141  O  OD2 . ASP B  1 258 ? 73.345  89.161  -12.574  1.00 62.16  ? 257 ASP B OD2 1 
HETATM 4142  N  N   . MSE B  1 259 ? 70.824  93.124  -14.708  1.00 44.93  ? 258 MSE B N   1 
HETATM 4143  C  CA  . MSE B  1 259 ? 70.970  93.889  -15.944  1.00 53.03  ? 258 MSE B CA  1 
HETATM 4144  C  C   . MSE B  1 259 ? 72.225  93.506  -16.737  1.00 40.12  ? 258 MSE B C   1 
HETATM 4145  O  O   . MSE B  1 259 ? 72.218  93.558  -17.964  1.00 43.22  ? 258 MSE B O   1 
HETATM 4146  C  CB  . MSE B  1 259 ? 70.947  95.397  -15.666  1.00 48.08  ? 258 MSE B CB  1 
HETATM 4147  C  CG  . MSE B  1 259 ? 69.643  95.890  -15.046  1.00 48.20  ? 258 MSE B CG  1 
HETATM 4148  SE SE  . MSE B  1 259 ? 68.111  95.544  -16.180  0.60 54.53  ? 258 MSE B SE  1 
HETATM 4149  C  CE  . MSE B  1 259 ? 66.833  95.079  -14.795  1.00 79.74  ? 258 MSE B CE  1 
ATOM   4150  N  N   . ASN B  1 260 ? 73.295  93.126  -16.041  1.00 39.99  ? 259 ASN B N   1 
ATOM   4151  C  CA  . ASN B  1 260 ? 74.498  92.635  -16.717  1.00 42.95  ? 259 ASN B CA  1 
ATOM   4152  C  C   . ASN B  1 260 ? 74.246  91.342  -17.497  1.00 41.24  ? 259 ASN B C   1 
ATOM   4153  O  O   . ASN B  1 260 ? 74.611  91.220  -18.673  1.00 40.82  ? 259 ASN B O   1 
ATOM   4154  C  CB  . ASN B  1 260 ? 75.628  92.421  -15.710  1.00 45.22  ? 259 ASN B CB  1 
ATOM   4155  C  CG  . ASN B  1 260 ? 76.956  92.140  -16.376  1.00 57.41  ? 259 ASN B CG  1 
ATOM   4156  O  OD1 . ASN B  1 260 ? 77.586  93.041  -16.928  1.00 67.51  ? 259 ASN B OD1 1 
ATOM   4157  N  ND2 . ASN B  1 260 ? 77.390  90.886  -16.329  1.00 48.49  ? 259 ASN B ND2 1 
ATOM   4158  N  N   . LYS B  1 261 ? 73.628  90.371  -16.839  1.00 38.16  ? 260 LYS B N   1 
ATOM   4159  C  CA  . LYS B  1 261 ? 73.318  89.106  -17.483  1.00 34.93  ? 260 LYS B CA  1 
ATOM   4160  C  C   . LYS B  1 261 ? 72.321  89.302  -18.621  1.00 34.60  ? 260 LYS B C   1 
ATOM   4161  O  O   . LYS B  1 261 ? 72.404  88.637  -19.666  1.00 36.10  ? 260 LYS B O   1 
ATOM   4162  C  CB  . LYS B  1 261 ? 72.735  88.122  -16.473  1.00 41.03  ? 260 LYS B CB  1 
ATOM   4163  C  CG  . LYS B  1 261 ? 73.754  87.378  -15.622  1.00 55.61  ? 260 LYS B CG  1 
ATOM   4164  C  CD  . LYS B  1 261 ? 73.011  86.422  -14.705  1.00 57.10  ? 260 LYS B CD  1 
ATOM   4165  C  CE  . LYS B  1 261 ? 73.844  85.225  -14.331  1.00 64.92  ? 260 LYS B CE  1 
ATOM   4166  N  NZ  . LYS B  1 261 ? 73.027  84.248  -13.563  1.00 56.52  ? 260 LYS B NZ  1 
ATOM   4167  N  N   . LEU B  1 262 ? 71.363  90.199  -18.413  1.00 37.22  ? 261 LEU B N   1 
ATOM   4168  C  CA  . LEU B  1 262 ? 70.375  90.476  -19.449  1.00 38.80  ? 261 LEU B CA  1 
ATOM   4169  C  C   . LEU B  1 262 ? 71.071  91.046  -20.687  1.00 30.98  ? 261 LEU B C   1 
ATOM   4170  O  O   . LEU B  1 262 ? 70.896  90.549  -21.799  1.00 32.74  ? 261 LEU B O   1 
ATOM   4171  C  CB  . LEU B  1 262 ? 69.327  91.463  -18.929  1.00 35.50  ? 261 LEU B CB  1 
ATOM   4172  C  CG  . LEU B  1 262 ? 68.294  91.979  -19.924  1.00 36.13  ? 261 LEU B CG  1 
ATOM   4173  C  CD1 . LEU B  1 262 ? 67.650  90.821  -20.641  1.00 32.57  ? 261 LEU B CD1 1 
ATOM   4174  C  CD2 . LEU B  1 262 ? 67.258  92.813  -19.174  1.00 41.61  ? 261 LEU B CD2 1 
ATOM   4175  N  N   . GLN B  1 263 ? 71.890  92.067  -20.480  1.00 33.86  ? 262 GLN B N   1 
ATOM   4176  C  CA  A GLN B  1 263 ? 72.579  92.709  -21.591  0.50 35.84  ? 262 GLN B CA  1 
ATOM   4177  C  CA  B GLN B  1 263 ? 72.580  92.709  -21.590  0.50 36.04  ? 262 GLN B CA  1 
ATOM   4178  C  C   . GLN B  1 263 ? 73.511  91.733  -22.292  1.00 33.26  ? 262 GLN B C   1 
ATOM   4179  O  O   . GLN B  1 263 ? 73.588  91.715  -23.520  1.00 35.92  ? 262 GLN B O   1 
ATOM   4180  C  CB  A GLN B  1 263 ? 73.367  93.927  -21.119  0.50 41.56  ? 262 GLN B CB  1 
ATOM   4181  C  CB  B GLN B  1 263 ? 73.371  93.922  -21.115  0.50 40.91  ? 262 GLN B CB  1 
ATOM   4182  C  CG  A GLN B  1 263 ? 74.049  94.659  -22.256  0.50 47.57  ? 262 GLN B CG  1 
ATOM   4183  C  CG  B GLN B  1 263 ? 74.130  94.600  -22.236  0.50 48.87  ? 262 GLN B CG  1 
ATOM   4184  C  CD  A GLN B  1 263 ? 74.429  96.074  -21.895  0.50 74.21  ? 262 GLN B CD  1 
ATOM   4185  C  CD  B GLN B  1 263 ? 74.316  96.079  -22.003  0.50 74.53  ? 262 GLN B CD  1 
ATOM   4186  O  OE1 A GLN B  1 263 ? 74.917  96.339  -20.796  0.50 53.98  ? 262 GLN B OE1 1 
ATOM   4187  O  OE1 B GLN B  1 263 ? 73.991  96.896  -22.865  0.50 86.14  ? 262 GLN B OE1 1 
ATOM   4188  N  NE2 A GLN B  1 263 ? 74.200  96.999  -22.821  0.50 81.46  ? 262 GLN B NE2 1 
ATOM   4189  N  NE2 B GLN B  1 263 ? 74.845  96.435  -20.838  0.50 58.66  ? 262 GLN B NE2 1 
ATOM   4190  N  N   . PHE B  1 264 ? 74.214  90.921  -21.512  1.00 33.89  ? 263 PHE B N   1 
ATOM   4191  C  CA  . PHE B  1 264 ? 75.130  89.957  -22.126  1.00 31.29  ? 263 PHE B CA  1 
ATOM   4192  C  C   . PHE B  1 264 ? 74.402  89.058  -23.107  1.00 32.23  ? 263 PHE B C   1 
ATOM   4193  O  O   . PHE B  1 264 ? 74.870  88.841  -24.221  1.00 31.67  ? 263 PHE B O   1 
ATOM   4194  C  CB  . PHE B  1 264 ? 75.846  89.084  -21.104  1.00 37.18  ? 263 PHE B CB  1 
ATOM   4195  C  CG  . PHE B  1 264 ? 76.648  87.998  -21.739  1.00 43.09  ? 263 PHE B CG  1 
ATOM   4196  C  CD1 . PHE B  1 264 ? 77.880  88.282  -22.316  1.00 36.79  ? 263 PHE B CD1 1 
ATOM   4197  C  CD2 . PHE B  1 264 ? 76.154  86.706  -21.807  1.00 37.65  ? 263 PHE B CD2 1 
ATOM   4198  C  CE1 . PHE B  1 264 ? 78.606  87.281  -22.936  1.00 34.34  ? 263 PHE B CE1 1 
ATOM   4199  C  CE2 . PHE B  1 264 ? 76.873  85.709  -22.420  1.00 38.03  ? 263 PHE B CE2 1 
ATOM   4200  C  CZ  . PHE B  1 264 ? 78.104  85.996  -22.980  1.00 34.26  ? 263 PHE B CZ  1 
ATOM   4201  N  N   . HIS B  1 265 ? 73.260  88.522  -22.687  1.00 30.16  ? 264 HIS B N   1 
ATOM   4202  C  CA  . HIS B  1 265 ? 72.534  87.582  -23.533  1.00 31.57  ? 264 HIS B CA  1 
ATOM   4203  C  C   . HIS B  1 265 ? 71.845  88.229  -24.726  1.00 30.92  ? 264 HIS B C   1 
ATOM   4204  O  O   . HIS B  1 265 ? 71.727  87.595  -25.782  1.00 32.12  ? 264 HIS B O   1 
ATOM   4205  C  CB  . HIS B  1 265 ? 71.565  86.712  -22.719  1.00 29.13  ? 264 HIS B CB  1 
ATOM   4206  C  CG  . HIS B  1 265 ? 72.264  85.709  -21.858  1.00 31.15  ? 264 HIS B CG  1 
ATOM   4207  N  ND1 . HIS B  1 265 ? 72.700  85.998  -20.580  1.00 38.79  ? 264 HIS B ND1 1 
ATOM   4208  C  CD2 . HIS B  1 265 ? 72.662  84.441  -22.113  1.00 37.56  ? 264 HIS B CD2 1 
ATOM   4209  C  CE1 . HIS B  1 265 ? 73.296  84.936  -20.070  1.00 36.11  ? 264 HIS B CE1 1 
ATOM   4210  N  NE2 . HIS B  1 265 ? 73.291  83.979  -20.981  1.00 31.33  ? 264 HIS B NE2 1 
ATOM   4211  N  N   . LEU B  1 266 ? 71.411  89.481  -24.574  1.00 30.58  ? 265 LEU B N   1 
ATOM   4212  C  CA  . LEU B  1 266 ? 70.853  90.217  -25.709  1.00 34.33  ? 265 LEU B CA  1 
ATOM   4213  C  C   . LEU B  1 266 ? 71.954  90.439  -26.732  1.00 31.26  ? 265 LEU B C   1 
ATOM   4214  O  O   . LEU B  1 266 ? 71.740  90.283  -27.934  1.00 31.87  ? 265 LEU B O   1 
ATOM   4215  C  CB  . LEU B  1 266 ? 70.281  91.566  -25.273  1.00 33.86  ? 265 LEU B CB  1 
ATOM   4216  C  CG  . LEU B  1 266 ? 69.036  91.509  -24.388  1.00 32.64  ? 265 LEU B CG  1 
ATOM   4217  C  CD1 . LEU B  1 266 ? 68.742  92.884  -23.804  1.00 39.27  ? 265 LEU B CD1 1 
ATOM   4218  C  CD2 . LEU B  1 266 ? 67.871  91.003  -25.216  1.00 38.47  ? 265 LEU B CD2 1 
HETATM 4219  N  N   . MSE B  1 267 ? 73.140  90.797  -26.248  1.00 31.51  ? 266 MSE B N   1 
HETATM 4220  C  CA  . MSE B  1 267 ? 74.266  91.034  -27.143  1.00 36.32  ? 266 MSE B CA  1 
HETATM 4221  C  C   . MSE B  1 267 ? 74.720  89.751  -27.835  1.00 34.90  ? 266 MSE B C   1 
HETATM 4222  O  O   . MSE B  1 267 ? 75.023  89.761  -29.028  1.00 31.56  ? 266 MSE B O   1 
HETATM 4223  C  CB  . MSE B  1 267 ? 75.417  91.688  -26.386  1.00 31.14  ? 266 MSE B CB  1 
HETATM 4224  C  CG  . MSE B  1 267 ? 75.090  93.122  -25.972  1.00 35.21  ? 266 MSE B CG  1 
HETATM 4225  SE SE  . MSE B  1 267 ? 76.540  93.996  -25.016  0.61 37.46  ? 266 MSE B SE  1 
HETATM 4226  C  CE  . MSE B  1 267 ? 77.558  94.664  -26.533  1.00 35.01  ? 266 MSE B CE  1 
ATOM   4227  N  N   . LEU B  1 268 ? 74.748  88.647  -27.088  1.00 31.10  ? 267 LEU B N   1 
ATOM   4228  C  CA  . LEU B  1 268 ? 75.136  87.363  -27.658  1.00 27.56  ? 267 LEU B CA  1 
ATOM   4229  C  C   . LEU B  1 268 ? 74.189  86.951  -28.778  1.00 40.31  ? 267 LEU B C   1 
ATOM   4230  O  O   . LEU B  1 268 ? 74.629  86.456  -29.813  1.00 30.18  ? 267 LEU B O   1 
ATOM   4231  C  CB  . LEU B  1 268 ? 75.207  86.270  -26.581  1.00 27.50  ? 267 LEU B CB  1 
ATOM   4232  C  CG  . LEU B  1 268 ? 75.634  84.877  -27.054  1.00 36.88  ? 267 LEU B CG  1 
ATOM   4233  C  CD1 . LEU B  1 268 ? 77.061  84.872  -27.662  1.00 28.80  ? 267 LEU B CD1 1 
ATOM   4234  C  CD2 . LEU B  1 268 ? 75.515  83.867  -25.905  1.00 38.06  ? 267 LEU B CD2 1 
ATOM   4235  N  N   . ASP B  1 269 ? 72.888  87.170  -28.594  1.00 30.63  ? 268 ASP B N   1 
ATOM   4236  C  CA  . ASP B  1 269 ? 71.947  86.814  -29.654  1.00 29.55  ? 268 ASP B CA  1 
ATOM   4237  C  C   . ASP B  1 269 ? 72.138  87.631  -30.942  1.00 35.67  ? 268 ASP B C   1 
ATOM   4238  O  O   . ASP B  1 269 ? 71.654  87.230  -32.006  1.00 31.37  ? 268 ASP B O   1 
ATOM   4239  C  CB  . ASP B  1 269 ? 70.498  86.893  -29.175  1.00 36.19  ? 268 ASP B CB  1 
ATOM   4240  C  CG  . ASP B  1 269 ? 69.565  86.008  -29.999  1.00 44.29  ? 268 ASP B CG  1 
ATOM   4241  O  OD1 . ASP B  1 269 ? 69.958  84.871  -30.344  1.00 38.98  ? 268 ASP B OD1 1 
ATOM   4242  O  OD2 . ASP B  1 269 ? 68.442  86.449  -30.316  1.00 38.35  ? 268 ASP B OD2 1 
ATOM   4243  N  N   . GLU B  1 270 ? 72.850  88.755  -30.866  1.00 29.38  ? 269 GLU B N   1 
ATOM   4244  C  CA  . GLU B  1 270 ? 73.093  89.559  -32.086  1.00 28.34  ? 269 GLU B CA  1 
ATOM   4245  C  C   . GLU B  1 270 ? 73.864  88.735  -33.134  1.00 34.08  ? 269 GLU B C   1 
ATOM   4246  O  O   . GLU B  1 270 ? 73.765  88.981  -34.332  1.00 32.06  ? 269 GLU B O   1 
ATOM   4247  C  CB  . GLU B  1 270 ? 73.863  90.867  -31.798  1.00 29.65  ? 269 GLU B CB  1 
ATOM   4248  C  CG  . GLU B  1 270 ? 73.243  91.867  -30.766  1.00 34.63  ? 269 GLU B CG  1 
ATOM   4249  C  CD  . GLU B  1 270 ? 71.941  92.531  -31.233  1.00 38.07  ? 269 GLU B CD  1 
ATOM   4250  O  OE1 . GLU B  1 270 ? 71.235  91.933  -32.068  1.00 31.42  ? 269 GLU B OE1 1 
ATOM   4251  O  OE2 . GLU B  1 270 ? 71.621  93.659  -30.769  1.00 37.66  ? 269 GLU B OE2 1 
ATOM   4252  N  N   . PHE B  1 271 ? 74.632  87.751  -32.670  1.00 32.89  ? 270 PHE B N   1 
ATOM   4253  C  CA  . PHE B  1 271 ? 75.520  87.002  -33.550  1.00 30.92  ? 270 PHE B CA  1 
ATOM   4254  C  C   . PHE B  1 271 ? 74.846  85.838  -34.272  1.00 31.70  ? 270 PHE B C   1 
ATOM   4255  O  O   . PHE B  1 271 ? 75.479  85.148  -35.081  1.00 35.43  ? 270 PHE B O   1 
ATOM   4256  C  CB  . PHE B  1 271 ? 76.755  86.532  -32.755  1.00 30.92  ? 270 PHE B CB  1 
ATOM   4257  C  CG  . PHE B  1 271 ? 77.609  87.670  -32.274  1.00 32.20  ? 270 PHE B CG  1 
ATOM   4258  C  CD1 . PHE B  1 271 ? 77.285  88.344  -31.107  1.00 31.87  ? 270 PHE B CD1 1 
ATOM   4259  C  CD2 . PHE B  1 271 ? 78.708  88.107  -33.017  1.00 30.44  ? 270 PHE B CD2 1 
ATOM   4260  C  CE1 . PHE B  1 271 ? 78.042  89.422  -30.669  1.00 37.01  ? 270 PHE B CE1 1 
ATOM   4261  C  CE2 . PHE B  1 271 ? 79.471  89.173  -32.585  1.00 40.28  ? 270 PHE B CE2 1 
ATOM   4262  C  CZ  . PHE B  1 271 ? 79.137  89.837  -31.406  1.00 36.12  ? 270 PHE B CZ  1 
ATOM   4263  N  N   . PHE B  1 272 ? 73.561  85.632  -33.998  1.00 32.60  ? 271 PHE B N   1 
ATOM   4264  C  CA  . PHE B  1 272 ? 72.883  84.427  -34.449  1.00 31.17  ? 271 PHE B CA  1 
ATOM   4265  C  C   . PHE B  1 272 ? 71.672  84.676  -35.333  1.00 50.69  ? 271 PHE B C   1 
ATOM   4266  O  O   . PHE B  1 272 ? 71.070  83.717  -35.816  1.00 51.66  ? 271 PHE B O   1 
ATOM   4267  C  CB  . PHE B  1 272 ? 72.510  83.572  -33.238  1.00 29.45  ? 271 PHE B CB  1 
ATOM   4268  C  CG  . PHE B  1 272 ? 73.709  83.050  -32.505  1.00 28.56  ? 271 PHE B CG  1 
ATOM   4269  C  CD1 . PHE B  1 272 ? 74.456  82.007  -33.038  1.00 31.87  ? 271 PHE B CD1 1 
ATOM   4270  C  CD2 . PHE B  1 272 ? 74.121  83.631  -31.312  1.00 33.76  ? 271 PHE B CD2 1 
ATOM   4271  C  CE1 . PHE B  1 272 ? 75.592  81.540  -32.376  1.00 37.50  ? 271 PHE B CE1 1 
ATOM   4272  C  CE2 . PHE B  1 272 ? 75.237  83.158  -30.644  1.00 35.16  ? 271 PHE B CE2 1 
ATOM   4273  C  CZ  . PHE B  1 272 ? 75.982  82.122  -31.185  1.00 35.27  ? 271 PHE B CZ  1 
ATOM   4274  O  OXT . PHE B  1 272 ? 71.285  85.819  -35.594  1.00 46.38  ? 271 PHE B OXT 1 
ATOM   4275  N  N   . GLN C  1 6   ? 52.911  -24.766 -14.857  1.00 117.84 ? 5   GLN C N   1 
ATOM   4276  C  CA  . GLN C  1 6   ? 52.088  -24.100 -15.863  1.00 106.51 ? 5   GLN C CA  1 
ATOM   4277  C  C   . GLN C  1 6   ? 51.747  -25.013 -17.045  1.00 125.13 ? 5   GLN C C   1 
ATOM   4278  O  O   . GLN C  1 6   ? 51.695  -26.239 -16.899  1.00 100.46 ? 5   GLN C O   1 
ATOM   4279  C  CB  . GLN C  1 6   ? 52.758  -22.811 -16.349  1.00 84.70  ? 5   GLN C CB  1 
ATOM   4280  C  CG  . GLN C  1 6   ? 54.271  -22.823 -16.263  1.00 92.54  ? 5   GLN C CG  1 
ATOM   4281  C  CD  . GLN C  1 6   ? 54.912  -21.940 -17.310  1.00 94.33  ? 5   GLN C CD  1 
ATOM   4282  O  OE1 . GLN C  1 6   ? 55.520  -20.913 -16.994  1.00 106.67 ? 5   GLN C OE1 1 
ATOM   4283  N  NE2 . GLN C  1 6   ? 54.782  -22.336 -18.572  1.00 95.85  ? 5   GLN C NE2 1 
ATOM   4284  N  N   . ARG C  1 7   ? 51.518  -24.411 -18.212  1.00 119.47 ? 6   ARG C N   1 
ATOM   4285  C  CA  . ARG C  1 7   ? 51.018  -25.150 -19.372  1.00 105.78 ? 6   ARG C CA  1 
ATOM   4286  C  C   . ARG C  1 7   ? 51.711  -24.731 -20.674  1.00 128.63 ? 6   ARG C C   1 
ATOM   4287  O  O   . ARG C  1 7   ? 51.942  -23.539 -20.917  1.00 98.94  ? 6   ARG C O   1 
ATOM   4288  C  CB  . ARG C  1 7   ? 49.499  -24.966 -19.489  1.00 105.61 ? 6   ARG C CB  1 
ATOM   4289  C  CG  . ARG C  1 7   ? 48.806  -25.905 -20.462  1.00 118.69 ? 6   ARG C CG  1 
ATOM   4290  C  CD  . ARG C  1 7   ? 47.290  -25.696 -20.454  1.00 120.60 ? 6   ARG C CD  1 
ATOM   4291  N  NE  . ARG C  1 7   ? 46.621  -26.351 -19.329  1.00 99.79  ? 6   ARG C NE  1 
ATOM   4292  C  CZ  . ARG C  1 7   ? 45.896  -27.461 -19.435  1.00 111.80 ? 6   ARG C CZ  1 
ATOM   4293  N  NH1 . ARG C  1 7   ? 45.744  -28.042 -20.617  1.00 109.70 ? 6   ARG C NH1 1 
ATOM   4294  N  NH2 . ARG C  1 7   ? 45.318  -27.992 -18.363  1.00 113.02 ? 6   ARG C NH2 1 
ATOM   4295  N  N   . GLU C  1 8   ? 52.044  -25.721 -21.501  1.00 108.45 ? 7   GLU C N   1 
ATOM   4296  C  CA  . GLU C  1 8   ? 52.680  -25.475 -22.794  1.00 95.77  ? 7   GLU C CA  1 
ATOM   4297  C  C   . GLU C  1 8   ? 52.025  -26.294 -23.908  1.00 113.89 ? 7   GLU C C   1 
ATOM   4298  O  O   . GLU C  1 8   ? 51.873  -27.512 -23.791  1.00 101.83 ? 7   GLU C O   1 
ATOM   4299  C  CB  . GLU C  1 8   ? 54.179  -25.779 -22.728  1.00 102.65 ? 7   GLU C CB  1 
ATOM   4300  C  CG  . GLU C  1 8   ? 54.865  -25.791 -24.089  1.00 109.39 ? 7   GLU C CG  1 
ATOM   4301  C  CD  . GLU C  1 8   ? 56.381  -25.755 -23.988  1.00 107.51 ? 7   GLU C CD  1 
ATOM   4302  O  OE1 . GLU C  1 8   ? 56.911  -24.898 -23.249  1.00 86.79  ? 7   GLU C OE1 1 
ATOM   4303  O  OE2 . GLU C  1 8   ? 57.042  -26.584 -24.648  1.00 78.56  ? 7   GLU C OE2 1 
ATOM   4304  N  N   . THR C  1 9   ? 51.647  -25.614 -24.989  1.00 124.21 ? 8   THR C N   1 
ATOM   4305  C  CA  . THR C  1 9   ? 50.963  -26.255 -26.111  1.00 112.62 ? 8   THR C CA  1 
ATOM   4306  C  C   . THR C  1 9   ? 51.610  -25.868 -27.444  1.00 115.00 ? 8   THR C C   1 
ATOM   4307  O  O   . THR C  1 9   ? 52.050  -24.730 -27.622  1.00 122.54 ? 8   THR C O   1 
ATOM   4308  C  CB  . THR C  1 9   ? 49.470  -25.871 -26.143  1.00 111.18 ? 8   THR C CB  1 
ATOM   4309  O  OG1 . THR C  1 9   ? 49.107  -25.249 -24.903  1.00 117.39 ? 8   THR C OG1 1 
ATOM   4310  C  CG2 . THR C  1 9   ? 48.600  -27.103 -26.368  1.00 109.75 ? 8   THR C CG2 1 
ATOM   4311  N  N   . SER C  1 10  ? 51.659  -26.818 -28.376  1.00 104.14 ? 9   SER C N   1 
ATOM   4312  C  CA  . SER C  1 10  ? 52.301  -26.602 -29.673  1.00 88.17  ? 9   SER C CA  1 
ATOM   4313  C  C   . SER C  1 10  ? 51.627  -25.492 -30.477  1.00 101.82 ? 9   SER C C   1 
ATOM   4314  O  O   . SER C  1 10  ? 50.480  -25.131 -30.217  1.00 109.22 ? 9   SER C O   1 
ATOM   4315  C  CB  . SER C  1 10  ? 52.325  -27.901 -30.482  1.00 87.73  ? 9   SER C CB  1 
ATOM   4316  O  OG  . SER C  1 10  ? 51.021  -28.434 -30.630  1.00 110.46 ? 9   SER C OG  1 
ATOM   4317  N  N   . CYS C  1 11  ? 52.349  -24.958 -31.457  1.00 99.17  ? 10  CYS C N   1 
ATOM   4318  C  CA  . CYS C  1 11  ? 51.858  -23.835 -32.247  1.00 93.15  ? 10  CYS C CA  1 
ATOM   4319  C  C   . CYS C  1 11  ? 52.566  -23.761 -33.592  1.00 129.00 ? 10  CYS C C   1 
ATOM   4320  O  O   . CYS C  1 11  ? 53.588  -24.415 -33.805  1.00 132.71 ? 10  CYS C O   1 
ATOM   4321  C  CB  . CYS C  1 11  ? 52.064  -22.516 -31.493  1.00 126.66 ? 10  CYS C CB  1 
ATOM   4322  S  SG  . CYS C  1 11  ? 50.606  -21.877 -30.632  1.00 139.47 ? 10  CYS C SG  1 
ATOM   4323  N  N   . SER C  1 12  ? 52.011  -22.959 -34.496  1.00 137.53 ? 11  SER C N   1 
ATOM   4324  C  CA  . SER C  1 12  ? 52.664  -22.648 -35.760  1.00 119.74 ? 11  SER C CA  1 
ATOM   4325  C  C   . SER C  1 12  ? 53.564  -21.439 -35.548  1.00 114.81 ? 11  SER C C   1 
ATOM   4326  O  O   . SER C  1 12  ? 54.036  -21.209 -34.437  1.00 135.97 ? 11  SER C O   1 
ATOM   4327  C  CB  . SER C  1 12  ? 51.626  -22.364 -36.844  1.00 120.06 ? 11  SER C CB  1 
ATOM   4328  O  OG  . SER C  1 12  ? 50.672  -21.418 -36.395  1.00 126.92 ? 11  SER C OG  1 
ATOM   4329  N  N   . ARG C  1 13  ? 53.802  -20.663 -36.599  1.00 125.52 ? 12  ARG C N   1 
ATOM   4330  C  CA  . ARG C  1 13  ? 54.612  -19.453 -36.475  1.00 101.54 ? 12  ARG C CA  1 
ATOM   4331  C  C   . ARG C  1 13  ? 53.740  -18.225 -36.737  1.00 137.24 ? 12  ARG C C   1 
ATOM   4332  O  O   . ARG C  1 13  ? 53.858  -17.586 -37.784  1.00 131.64 ? 12  ARG C O   1 
ATOM   4333  C  CB  . ARG C  1 13  ? 55.790  -19.492 -37.455  1.00 98.52  ? 12  ARG C CB  1 
ATOM   4334  C  CG  . ARG C  1 13  ? 56.800  -18.357 -37.285  1.00 123.63 ? 12  ARG C CG  1 
ATOM   4335  C  CD  . ARG C  1 13  ? 57.486  -18.004 -38.604  1.00 127.60 ? 12  ARG C CD  1 
ATOM   4336  N  NE  . ARG C  1 13  ? 58.776  -18.671 -38.779  1.00 137.86 ? 12  ARG C NE  1 
ATOM   4337  C  CZ  . ARG C  1 13  ? 59.303  -18.986 -39.961  1.00 143.96 ? 12  ARG C CZ  1 
ATOM   4338  N  NH1 . ARG C  1 13  ? 58.648  -18.709 -41.084  1.00 131.46 ? 12  ARG C NH1 1 
ATOM   4339  N  NH2 . ARG C  1 13  ? 60.484  -19.590 -40.022  1.00 139.76 ? 12  ARG C NH2 1 
ATOM   4340  N  N   . PRO C  1 14  ? 52.867  -17.884 -35.774  1.00 150.67 ? 13  PRO C N   1 
ATOM   4341  C  CA  . PRO C  1 14  ? 51.810  -16.882 -35.976  1.00 149.81 ? 13  PRO C CA  1 
ATOM   4342  C  C   . PRO C  1 14  ? 52.335  -15.498 -36.370  1.00 127.14 ? 13  PRO C C   1 
ATOM   4343  O  O   . PRO C  1 14  ? 53.484  -15.170 -36.063  1.00 97.00  ? 13  PRO C O   1 
ATOM   4344  C  CB  . PRO C  1 14  ? 51.124  -16.820 -34.606  1.00 138.66 ? 13  PRO C CB  1 
ATOM   4345  C  CG  . PRO C  1 14  ? 52.169  -17.269 -33.641  1.00 126.96 ? 13  PRO C CG  1 
ATOM   4346  C  CD  . PRO C  1 14  ? 52.944  -18.322 -34.369  1.00 123.56 ? 13  PRO C CD  1 
ATOM   4347  N  N   . ARG C  1 15  ? 51.495  -14.718 -37.054  1.00 148.86 ? 14  ARG C N   1 
ATOM   4348  C  CA  . ARG C  1 15  ? 51.815  -13.336 -37.416  1.00 150.58 ? 14  ARG C CA  1 
ATOM   4349  C  C   . ARG C  1 15  ? 52.263  -12.553 -36.171  1.00 150.28 ? 14  ARG C C   1 
ATOM   4350  O  O   . ARG C  1 15  ? 51.437  -12.328 -35.283  1.00 148.08 ? 14  ARG C O   1 
ATOM   4351  C  CB  . ARG C  1 15  ? 50.618  -12.668 -38.109  1.00 153.34 ? 14  ARG C CB  1 
ATOM   4352  C  CG  . ARG C  1 15  ? 49.254  -13.276 -37.770  1.00 141.22 ? 14  ARG C CG  1 
ATOM   4353  C  CD  . ARG C  1 15  ? 48.521  -12.476 -36.697  1.00 143.62 ? 14  ARG C CD  1 
ATOM   4354  N  NE  . ARG C  1 15  ? 48.279  -11.094 -37.109  1.00 135.92 ? 14  ARG C NE  1 
ATOM   4355  C  CZ  . ARG C  1 15  ? 48.936  -10.040 -36.633  1.00 143.93 ? 14  ARG C CZ  1 
ATOM   4356  N  NH1 . ARG C  1 15  ? 49.881  -10.198 -35.712  1.00 120.06 ? 14  ARG C NH1 1 
ATOM   4357  N  NH2 . ARG C  1 15  ? 48.646  -8.823  -37.074  1.00 133.26 ? 14  ARG C NH2 1 
ATOM   4358  N  N   . LEU C  1 16  ? 53.528  -12.110 -36.068  1.00 138.19 ? 15  LEU C N   1 
ATOM   4359  C  CA  . LEU C  1 16  ? 54.539  -11.915 -37.136  1.00 113.63 ? 15  LEU C CA  1 
ATOM   4360  C  C   . LEU C  1 16  ? 54.160  -10.767 -38.064  1.00 120.49 ? 15  LEU C C   1 
ATOM   4361  O  O   . LEU C  1 16  ? 53.687  -10.979 -39.183  1.00 132.27 ? 15  LEU C O   1 
ATOM   4362  C  CB  . LEU C  1 16  ? 54.937  -13.187 -37.919  1.00 132.58 ? 15  LEU C CB  1 
ATOM   4363  C  CG  . LEU C  1 16  ? 56.386  -13.677 -37.843  1.00 125.86 ? 15  LEU C CG  1 
ATOM   4364  C  CD1 . LEU C  1 16  ? 57.330  -12.522 -37.550  1.00 124.03 ? 15  LEU C CD1 1 
ATOM   4365  C  CD2 . LEU C  1 16  ? 56.547  -14.796 -36.823  1.00 113.21 ? 15  LEU C CD2 1 
ATOM   4366  N  N   . ASN C  1 17  ? 54.381  -9.547  -37.580  1.00 128.51 ? 16  ASN C N   1 
ATOM   4367  C  CA  . ASN C  1 17  ? 53.994  -8.353  -38.315  1.00 113.91 ? 16  ASN C CA  1 
ATOM   4368  C  C   . ASN C  1 17  ? 55.125  -7.777  -39.169  1.00 127.19 ? 16  ASN C C   1 
ATOM   4369  O  O   . ASN C  1 17  ? 56.119  -8.454  -39.440  1.00 113.66 ? 16  ASN C O   1 
ATOM   4370  C  CB  . ASN C  1 17  ? 53.420  -7.293  -37.368  1.00 126.06 ? 16  ASN C CB  1 
ATOM   4371  C  CG  . ASN C  1 17  ? 52.088  -6.734  -37.855  1.00 125.56 ? 16  ASN C CG  1 
ATOM   4372  O  OD1 . ASN C  1 17  ? 51.516  -7.218  -38.836  1.00 117.75 ? 16  ASN C OD1 1 
ATOM   4373  N  ND2 . ASN C  1 17  ? 51.585  -5.715  -37.163  1.00 119.34 ? 16  ASN C ND2 1 
ATOM   4374  N  N   . SER C  1 18  ? 54.965  -6.515  -39.564  1.00 134.38 ? 17  SER C N   1 
ATOM   4375  C  CA  . SER C  1 18  ? 55.735  -5.922  -40.660  1.00 128.71 ? 17  SER C CA  1 
ATOM   4376  C  C   . SER C  1 18  ? 57.169  -5.492  -40.329  1.00 119.74 ? 17  SER C C   1 
ATOM   4377  O  O   . SER C  1 18  ? 57.559  -5.400  -39.159  1.00 98.97  ? 17  SER C O   1 
ATOM   4378  C  CB  . SER C  1 18  ? 54.967  -4.733  -41.257  1.00 120.12 ? 17  SER C CB  1 
ATOM   4379  O  OG  . SER C  1 18  ? 53.652  -5.106  -41.640  1.00 108.99 ? 17  SER C OG  1 
ATOM   4380  N  N   . ASN C  1 19  ? 57.935  -5.235  -41.391  1.00 124.29 ? 18  ASN C N   1 
ATOM   4381  C  CA  . ASN C  1 19  ? 59.305  -4.727  -41.296  1.00 120.23 ? 18  ASN C CA  1 
ATOM   4382  C  C   . ASN C  1 19  ? 59.503  -3.447  -42.116  1.00 98.59  ? 18  ASN C C   1 
ATOM   4383  O  O   . ASN C  1 19  ? 58.585  -2.994  -42.807  1.00 107.36 ? 18  ASN C O   1 
ATOM   4384  C  CB  . ASN C  1 19  ? 60.321  -5.798  -41.720  1.00 111.44 ? 18  ASN C CB  1 
ATOM   4385  C  CG  . ASN C  1 19  ? 60.827  -6.626  -40.546  1.00 125.90 ? 18  ASN C CG  1 
ATOM   4386  O  OD1 . ASN C  1 19  ? 61.683  -6.178  -39.774  1.00 100.46 ? 18  ASN C OD1 1 
ATOM   4387  N  ND2 . ASN C  1 19  ? 60.303  -7.843  -40.409  1.00 102.85 ? 18  ASN C ND2 1 
ATOM   4388  N  N   . LEU C  1 20  ? 60.710  -2.883  -42.042  1.00 102.94 ? 19  LEU C N   1 
ATOM   4389  C  CA  . LEU C  1 20  ? 61.015  -1.573  -42.624  1.00 82.57  ? 19  LEU C CA  1 
ATOM   4390  C  C   . LEU C  1 20  ? 60.763  -1.477  -44.117  1.00 89.88  ? 19  LEU C C   1 
ATOM   4391  O  O   . LEU C  1 20  ? 59.980  -0.645  -44.564  1.00 109.93 ? 19  LEU C O   1 
ATOM   4392  C  CB  . LEU C  1 20  ? 62.468  -1.183  -42.350  1.00 81.63  ? 19  LEU C CB  1 
ATOM   4393  C  CG  . LEU C  1 20  ? 62.775  -0.653  -40.956  1.00 66.57  ? 19  LEU C CG  1 
ATOM   4394  C  CD1 . LEU C  1 20  ? 64.124  0.051   -40.961  1.00 51.52  ? 19  LEU C CD1 1 
ATOM   4395  C  CD2 . LEU C  1 20  ? 61.668  0.284   -40.491  1.00 81.26  ? 19  LEU C CD2 1 
ATOM   4396  N  N   . ASP C  1 21  ? 61.457  -2.325  -44.869  1.00 115.59 ? 20  ASP C N   1 
ATOM   4397  C  CA  . ASP C  1 21  ? 61.380  -2.399  -46.329  1.00 111.32 ? 20  ASP C CA  1 
ATOM   4398  C  C   . ASP C  1 21  ? 60.082  -1.896  -46.977  1.00 106.55 ? 20  ASP C C   1 
ATOM   4399  O  O   . ASP C  1 21  ? 60.122  -1.181  -47.979  1.00 105.60 ? 20  ASP C O   1 
ATOM   4400  C  CB  . ASP C  1 21  ? 61.659  -3.839  -46.756  1.00 123.95 ? 20  ASP C CB  1 
ATOM   4401  C  CG  . ASP C  1 21  ? 61.845  -4.765  -45.564  1.00 123.44 ? 20  ASP C CG  1 
ATOM   4402  O  OD1 . ASP C  1 21  ? 62.997  -4.912  -45.096  1.00 113.43 ? 20  ASP C OD1 1 
ATOM   4403  O  OD2 . ASP C  1 21  ? 60.836  -5.329  -45.085  1.00 104.97 ? 20  ASP C OD2 1 
ATOM   4404  N  N   . ALA C  1 22  ? 58.941  -2.257  -46.394  1.00 84.00  ? 21  ALA C N   1 
ATOM   4405  C  CA  . ALA C  1 22  ? 57.644  -1.829  -46.916  1.00 77.40  ? 21  ALA C CA  1 
ATOM   4406  C  C   . ALA C  1 22  ? 57.241  -0.431  -46.435  1.00 72.36  ? 21  ALA C C   1 
ATOM   4407  O  O   . ALA C  1 22  ? 56.529  0.290   -47.135  1.00 99.53  ? 21  ALA C O   1 
ATOM   4408  C  CB  . ALA C  1 22  ? 56.568  -2.846  -46.572  1.00 98.95  ? 21  ALA C CB  1 
ATOM   4409  N  N   . ASP C  1 23  ? 57.698  -0.055  -45.242  1.00 69.55  ? 22  ASP C N   1 
ATOM   4410  C  CA  . ASP C  1 23  ? 57.485  1.291   -44.718  1.00 76.85  ? 22  ASP C CA  1 
ATOM   4411  C  C   . ASP C  1 23  ? 58.285  2.316   -45.515  1.00 80.30  ? 22  ASP C C   1 
ATOM   4412  O  O   . ASP C  1 23  ? 58.109  3.524   -45.345  1.00 92.95  ? 22  ASP C O   1 
ATOM   4413  C  CB  . ASP C  1 23  ? 57.929  1.377   -43.252  1.00 94.10  ? 22  ASP C CB  1 
ATOM   4414  C  CG  . ASP C  1 23  ? 57.190  0.407   -42.351  1.00 94.62  ? 22  ASP C CG  1 
ATOM   4415  O  OD1 . ASP C  1 23  ? 56.512  -0.506  -42.879  1.00 93.14  ? 22  ASP C OD1 1 
ATOM   4416  O  OD2 . ASP C  1 23  ? 57.301  0.557   -41.112  1.00 67.57  ? 22  ASP C OD2 1 
ATOM   4417  N  N   . LEU C  1 24  ? 59.174  1.836   -46.376  1.00 67.34  ? 23  LEU C N   1 
ATOM   4418  C  CA  . LEU C  1 24  ? 60.127  2.715   -47.031  1.00 59.21  ? 23  LEU C CA  1 
ATOM   4419  C  C   . LEU C  1 24  ? 59.954  2.769   -48.548  1.00 63.21  ? 23  LEU C C   1 
ATOM   4420  O  O   . LEU C  1 24  ? 60.651  3.524   -49.225  1.00 83.92  ? 23  LEU C O   1 
ATOM   4421  C  CB  . LEU C  1 24  ? 61.552  2.300   -46.661  1.00 63.97  ? 23  LEU C CB  1 
ATOM   4422  C  CG  . LEU C  1 24  ? 61.757  1.988   -45.172  1.00 94.54  ? 23  LEU C CG  1 
ATOM   4423  C  CD1 . LEU C  1 24  ? 63.174  1.494   -44.910  1.00 85.07  ? 23  LEU C CD1 1 
ATOM   4424  C  CD2 . LEU C  1 24  ? 61.427  3.189   -44.282  1.00 62.73  ? 23  LEU C CD2 1 
ATOM   4425  N  N   . TYR C  1 25  ? 59.030  1.970   -49.076  1.00 54.39  ? 24  TYR C N   1 
ATOM   4426  C  CA  . TYR C  1 25  ? 58.735  1.981   -50.505  1.00 61.82  ? 24  TYR C CA  1 
ATOM   4427  C  C   . TYR C  1 25  ? 58.376  3.390   -50.966  1.00 68.50  ? 24  TYR C C   1 
ATOM   4428  O  O   . TYR C  1 25  ? 57.574  4.068   -50.325  1.00 82.16  ? 24  TYR C O   1 
ATOM   4429  C  CB  . TYR C  1 25  ? 57.568  1.039   -50.817  1.00 81.97  ? 24  TYR C CB  1 
ATOM   4430  C  CG  . TYR C  1 25  ? 57.911  -0.433  -50.779  1.00 99.89  ? 24  TYR C CG  1 
ATOM   4431  C  CD1 . TYR C  1 25  ? 59.206  -0.875  -51.036  1.00 75.33  ? 24  TYR C CD1 1 
ATOM   4432  C  CD2 . TYR C  1 25  ? 56.935  -1.385  -50.496  1.00 85.21  ? 24  TYR C CD2 1 
ATOM   4433  C  CE1 . TYR C  1 25  ? 59.522  -2.225  -51.005  1.00 77.66  ? 24  TYR C CE1 1 
ATOM   4434  C  CE2 . TYR C  1 25  ? 57.240  -2.739  -50.465  1.00 76.74  ? 24  TYR C CE2 1 
ATOM   4435  C  CZ  . TYR C  1 25  ? 58.536  -3.152  -50.720  1.00 89.61  ? 24  TYR C CZ  1 
ATOM   4436  O  OH  . TYR C  1 25  ? 58.850  -4.492  -50.691  1.00 96.88  ? 24  TYR C OH  1 
ATOM   4437  N  N   . GLY C  1 26  ? 58.991  3.836   -52.059  1.00 80.69  ? 25  GLY C N   1 
ATOM   4438  C  CA  . GLY C  1 26  ? 58.603  5.084   -52.697  1.00 67.29  ? 25  GLY C CA  1 
ATOM   4439  C  C   . GLY C  1 26  ? 59.253  6.363   -52.198  1.00 55.03  ? 25  GLY C C   1 
ATOM   4440  O  O   . GLY C  1 26  ? 59.074  7.421   -52.801  1.00 92.26  ? 25  GLY C O   1 
ATOM   4441  N  N   . TYR C  1 27  ? 60.007  6.281   -51.103  1.00 55.30  ? 26  TYR C N   1 
ATOM   4442  C  CA  . TYR C  1 27  ? 60.687  7.457   -50.566  1.00 71.20  ? 26  TYR C CA  1 
ATOM   4443  C  C   . TYR C  1 27  ? 62.006  7.740   -51.271  1.00 61.02  ? 26  TYR C C   1 
ATOM   4444  O  O   . TYR C  1 27  ? 62.677  6.824   -51.747  1.00 75.29  ? 26  TYR C O   1 
ATOM   4445  C  CB  . TYR C  1 27  ? 60.951  7.306   -49.062  1.00 55.65  ? 26  TYR C CB  1 
ATOM   4446  C  CG  . TYR C  1 27  ? 59.757  7.599   -48.184  1.00 55.22  ? 26  TYR C CG  1 
ATOM   4447  C  CD1 . TYR C  1 27  ? 59.369  8.904   -47.922  1.00 51.38  ? 26  TYR C CD1 1 
ATOM   4448  C  CD2 . TYR C  1 27  ? 59.026  6.568   -47.605  1.00 63.36  ? 26  TYR C CD2 1 
ATOM   4449  C  CE1 . TYR C  1 27  ? 58.275  9.179   -47.117  1.00 53.62  ? 26  TYR C CE1 1 
ATOM   4450  C  CE2 . TYR C  1 27  ? 57.934  6.829   -46.800  1.00 57.07  ? 26  TYR C CE2 1 
ATOM   4451  C  CZ  . TYR C  1 27  ? 57.562  8.136   -46.558  1.00 77.37  ? 26  TYR C CZ  1 
ATOM   4452  O  OH  . TYR C  1 27  ? 56.474  8.393   -45.757  1.00 56.23  ? 26  TYR C OH  1 
ATOM   4453  N  N   . ARG C  1 28  ? 62.371  9.016   -51.330  1.00 55.85  ? 27  ARG C N   1 
ATOM   4454  C  CA  . ARG C  1 28  ? 63.736  9.398   -51.666  1.00 69.01  ? 27  ARG C CA  1 
ATOM   4455  C  C   . ARG C  1 28  ? 64.546  9.529   -50.384  1.00 77.76  ? 27  ARG C C   1 
ATOM   4456  O  O   . ARG C  1 28  ? 64.045  10.008  -49.360  1.00 58.48  ? 27  ARG C O   1 
ATOM   4457  C  CB  . ARG C  1 28  ? 63.772  10.708  -52.451  1.00 63.37  ? 27  ARG C CB  1 
ATOM   4458  C  CG  . ARG C  1 28  ? 63.233  10.581  -53.858  1.00 66.75  ? 27  ARG C CG  1 
ATOM   4459  C  CD  . ARG C  1 28  ? 63.365  11.878  -54.631  1.00 61.02  ? 27  ARG C CD  1 
ATOM   4460  N  NE  . ARG C  1 28  ? 62.866  11.745  -55.999  1.00 93.75  ? 27  ARG C NE  1 
ATOM   4461  C  CZ  . ARG C  1 28  ? 63.587  11.279  -57.016  1.00 78.75  ? 27  ARG C CZ  1 
ATOM   4462  N  NH1 . ARG C  1 28  ? 63.055  11.193  -58.227  1.00 71.78  ? 27  ARG C NH1 1 
ATOM   4463  N  NH2 . ARG C  1 28  ? 64.842  10.895  -56.820  1.00 98.88  ? 27  ARG C NH2 1 
ATOM   4464  N  N   . TRP C  1 29  ? 65.800  9.099   -50.449  1.00 61.18  ? 28  TRP C N   1 
ATOM   4465  C  CA  . TRP C  1 29  ? 66.678  9.093   -49.288  1.00 77.88  ? 28  TRP C CA  1 
ATOM   4466  C  C   . TRP C  1 29  ? 67.688  10.230  -49.336  1.00 43.22  ? 28  TRP C C   1 
ATOM   4467  O  O   . TRP C  1 29  ? 68.246  10.522  -50.391  1.00 53.42  ? 28  TRP C O   1 
ATOM   4468  C  CB  . TRP C  1 29  ? 67.445  7.771   -49.235  1.00 56.44  ? 28  TRP C CB  1 
ATOM   4469  C  CG  . TRP C  1 29  ? 66.579  6.604   -48.952  1.00 90.46  ? 28  TRP C CG  1 
ATOM   4470  C  CD1 . TRP C  1 29  ? 65.668  6.032   -49.794  1.00 56.78  ? 28  TRP C CD1 1 
ATOM   4471  C  CD2 . TRP C  1 29  ? 66.537  5.851   -47.735  1.00 66.84  ? 28  TRP C CD2 1 
ATOM   4472  N  NE1 . TRP C  1 29  ? 65.058  4.968   -49.169  1.00 83.74  ? 28  TRP C NE1 1 
ATOM   4473  C  CE2 . TRP C  1 29  ? 65.574  4.836   -47.905  1.00 74.24  ? 28  TRP C CE2 1 
ATOM   4474  C  CE3 . TRP C  1 29  ? 67.217  5.940   -46.515  1.00 74.77  ? 28  TRP C CE3 1 
ATOM   4475  C  CZ2 . TRP C  1 29  ? 65.274  3.914   -46.898  1.00 63.82  ? 28  TRP C CZ2 1 
ATOM   4476  C  CZ3 . TRP C  1 29  ? 66.917  5.025   -45.518  1.00 69.25  ? 28  TRP C CZ3 1 
ATOM   4477  C  CH2 . TRP C  1 29  ? 65.958  4.023   -45.719  1.00 67.76  ? 28  TRP C CH2 1 
ATOM   4478  N  N   . ALA C  1 30  ? 67.951  10.841  -48.186  1.00 48.94  ? 29  ALA C N   1 
ATOM   4479  C  CA  . ALA C  1 30  ? 69.063  11.778  -48.075  1.00 58.95  ? 29  ALA C CA  1 
ATOM   4480  C  C   . ALA C  1 30  ? 69.739  11.579  -46.728  1.00 59.38  ? 29  ALA C C   1 
ATOM   4481  O  O   . ALA C  1 30  ? 69.078  11.240  -45.746  1.00 47.89  ? 29  ALA C O   1 
ATOM   4482  C  CB  . ALA C  1 30  ? 68.581  13.207  -48.235  1.00 53.14  ? 29  ALA C CB  1 
ATOM   4483  N  N   . ARG C  1 31  ? 71.056  11.770  -46.678  1.00 42.82  ? 30  ARG C N   1 
ATOM   4484  C  CA  . ARG C  1 31  ? 71.791  11.598  -45.424  1.00 43.76  ? 30  ARG C CA  1 
ATOM   4485  C  C   . ARG C  1 31  ? 72.104  12.947  -44.787  1.00 49.89  ? 30  ARG C C   1 
ATOM   4486  O  O   . ARG C  1 31  ? 72.599  13.850  -45.453  1.00 60.00  ? 30  ARG C O   1 
ATOM   4487  C  CB  . ARG C  1 31  ? 73.079  10.800  -45.651  1.00 48.60  ? 30  ARG C CB  1 
ATOM   4488  C  CG  . ARG C  1 31  ? 73.804  10.447  -44.365  1.00 43.68  ? 30  ARG C CG  1 
ATOM   4489  C  CD  . ARG C  1 31  ? 74.782  9.323   -44.589  1.00 52.44  ? 30  ARG C CD  1 
ATOM   4490  N  NE  . ARG C  1 31  ? 75.710  9.669   -45.655  1.00 70.26  ? 30  ARG C NE  1 
ATOM   4491  C  CZ  . ARG C  1 31  ? 76.790  10.419  -45.473  1.00 80.46  ? 30  ARG C CZ  1 
ATOM   4492  N  NH1 . ARG C  1 31  ? 77.585  10.695  -46.496  1.00 62.17  ? 30  ARG C NH1 1 
ATOM   4493  N  NH2 . ARG C  1 31  ? 77.072  10.893  -44.264  1.00 66.38  ? 30  ARG C NH2 1 
ATOM   4494  N  N   . ASP C  1 32  ? 71.821  13.085  -43.497  1.00 50.73  ? 31  ASP C N   1 
ATOM   4495  C  CA  . ASP C  1 32  ? 71.988  14.382  -42.847  1.00 58.09  ? 31  ASP C CA  1 
ATOM   4496  C  C   . ASP C  1 32  ? 73.152  14.490  -41.849  1.00 83.08  ? 31  ASP C C   1 
ATOM   4497  O  O   . ASP C  1 32  ? 74.110  13.718  -41.890  1.00 72.08  ? 31  ASP C O   1 
ATOM   4498  C  CB  . ASP C  1 32  ? 70.669  14.846  -42.219  1.00 71.00  ? 31  ASP C CB  1 
ATOM   4499  C  CG  . ASP C  1 32  ? 69.652  15.289  -43.261  1.00 61.29  ? 31  ASP C CG  1 
ATOM   4500  O  OD1 . ASP C  1 32  ? 69.571  14.657  -44.331  1.00 83.36  ? 31  ASP C OD1 1 
ATOM   4501  O  OD2 . ASP C  1 32  ? 68.941  16.280  -43.020  1.00 95.38  ? 31  ASP C OD2 1 
ATOM   4502  N  N   . ASN C  1 33  ? 73.028  15.461  -40.951  1.00 68.10  ? 32  ASN C N   1 
ATOM   4503  C  CA  . ASN C  1 33  ? 74.109  15.961  -40.088  1.00 56.28  ? 32  ASN C CA  1 
ATOM   4504  C  C   . ASN C  1 33  ? 75.001  15.016  -39.242  1.00 65.95  ? 32  ASN C C   1 
ATOM   4505  O  O   . ASN C  1 33  ? 76.081  15.436  -38.849  1.00 80.67  ? 32  ASN C O   1 
ATOM   4506  C  CB  . ASN C  1 33  ? 73.524  17.048  -39.172  1.00 90.32  ? 32  ASN C CB  1 
ATOM   4507  C  CG  . ASN C  1 33  ? 72.024  16.860  -38.916  1.00 100.85 ? 32  ASN C CG  1 
ATOM   4508  O  OD1 . ASN C  1 33  ? 71.205  17.716  -39.268  1.00 71.82  ? 32  ASN C OD1 1 
ATOM   4509  N  ND2 . ASN C  1 33  ? 71.663  15.734  -38.310  1.00 64.94  ? 32  ASN C ND2 1 
ATOM   4510  N  N   . VAL C  1 34  ? 74.523  13.799  -38.940  1.00 73.71  ? 33  VAL C N   1 
ATOM   4511  C  CA  . VAL C  1 34  ? 75.181  12.718  -38.127  1.00 41.80  ? 33  VAL C CA  1 
ATOM   4512  C  C   . VAL C  1 34  ? 74.743  12.478  -36.649  1.00 93.32  ? 33  VAL C C   1 
ATOM   4513  O  O   . VAL C  1 34  ? 75.350  11.654  -35.963  1.00 116.59 ? 33  VAL C O   1 
ATOM   4514  C  CB  . VAL C  1 34  ? 76.772  12.581  -38.210  1.00 94.67  ? 33  VAL C CB  1 
ATOM   4515  C  CG1 . VAL C  1 34  ? 77.336  12.793  -39.645  1.00 79.24  ? 33  VAL C CG1 1 
ATOM   4516  C  CG2 . VAL C  1 34  ? 77.498  13.418  -37.113  1.00 59.50  ? 33  VAL C CG2 1 
ATOM   4517  N  N   . GLY C  1 35  ? 73.709  13.157  -36.157  1.00 66.26  ? 34  GLY C N   1 
ATOM   4518  C  CA  . GLY C  1 35  ? 73.094  12.774  -34.887  1.00 54.88  ? 34  GLY C CA  1 
ATOM   4519  C  C   . GLY C  1 35  ? 73.741  13.183  -33.563  1.00 73.78  ? 34  GLY C C   1 
ATOM   4520  O  O   . GLY C  1 35  ? 74.966  13.330  -33.468  1.00 60.68  ? 34  GLY C O   1 
ATOM   4521  N  N   . GLN C  1 36  ? 72.904  13.322  -32.529  1.00 67.69  ? 35  GLN C N   1 
ATOM   4522  C  CA  . GLN C  1 36  ? 73.311  13.871  -31.223  1.00 56.10  ? 35  GLN C CA  1 
ATOM   4523  C  C   . GLN C  1 36  ? 74.279  12.990  -30.428  1.00 72.28  ? 35  GLN C C   1 
ATOM   4524  O  O   . GLN C  1 36  ? 75.136  13.492  -29.692  1.00 54.97  ? 35  GLN C O   1 
ATOM   4525  C  CB  . GLN C  1 36  ? 72.080  14.222  -30.369  1.00 85.17  ? 35  GLN C CB  1 
ATOM   4526  C  CG  . GLN C  1 36  ? 71.948  13.446  -29.050  1.00 45.31  ? 35  GLN C CG  1 
ATOM   4527  C  CD  . GLN C  1 36  ? 71.030  14.142  -28.056  1.00 88.75  ? 35  GLN C CD  1 
ATOM   4528  O  OE1 . GLN C  1 36  ? 70.013  13.588  -27.632  1.00 74.25  ? 35  GLN C OE1 1 
ATOM   4529  N  NE2 . GLN C  1 36  ? 71.393  15.364  -27.676  1.00 62.58  ? 35  GLN C NE2 1 
ATOM   4530  N  N   . SER C  1 37  ? 74.134  11.680  -30.573  1.00 72.08  ? 36  SER C N   1 
ATOM   4531  C  CA  . SER C  1 37  ? 75.070  10.746  -29.968  1.00 65.06  ? 36  SER C CA  1 
ATOM   4532  C  C   . SER C  1 37  ? 75.867  10.063  -31.072  1.00 96.12  ? 36  SER C C   1 
ATOM   4533  O  O   . SER C  1 37  ? 76.569  9.079   -30.833  1.00 91.29  ? 36  SER C O   1 
ATOM   4534  C  CB  . SER C  1 37  ? 74.328  9.718   -29.125  1.00 53.65  ? 36  SER C CB  1 
ATOM   4535  O  OG  . SER C  1 37  ? 73.558  10.340  -28.105  1.00 63.76  ? 36  SER C OG  1 
ATOM   4536  N  N   . GLY C  1 38  ? 75.741  10.594  -32.286  1.00 46.37  ? 37  GLY C N   1 
ATOM   4537  C  CA  . GLY C  1 38  ? 76.523  10.123  -33.407  1.00 44.47  ? 37  GLY C CA  1 
ATOM   4538  C  C   . GLY C  1 38  ? 75.769  9.189   -34.340  1.00 41.74  ? 37  GLY C C   1 
ATOM   4539  O  O   . GLY C  1 38  ? 76.382  8.595   -35.223  1.00 46.98  ? 37  GLY C O   1 
ATOM   4540  N  N   . ALA C  1 39  ? 74.455  9.052   -34.168  1.00 39.64  ? 38  ALA C N   1 
ATOM   4541  C  CA  . ALA C  1 39  ? 73.701  8.135   -35.031  1.00 61.60  ? 38  ALA C CA  1 
ATOM   4542  C  C   . ALA C  1 39  ? 73.564  8.726   -36.424  1.00 46.18  ? 38  ALA C C   1 
ATOM   4543  O  O   . ALA C  1 39  ? 73.331  9.921   -36.559  1.00 43.03  ? 38  ALA C O   1 
ATOM   4544  C  CB  . ALA C  1 39  ? 72.325  7.850   -34.448  1.00 51.65  ? 38  ALA C CB  1 
ATOM   4545  N  N   . THR C  1 40  ? 73.694  7.925   -37.476  1.00 38.38  ? 39  THR C N   1 
ATOM   4546  C  CA  . THR C  1 40  ? 73.459  8.533   -38.786  1.00 38.80  ? 39  THR C CA  1 
ATOM   4547  C  C   . THR C  1 40  ? 71.965  8.782   -39.028  1.00 45.49  ? 39  THR C C   1 
ATOM   4548  O  O   . THR C  1 40  ? 71.106  7.984   -38.630  1.00 43.02  ? 39  THR C O   1 
ATOM   4549  C  CB  . THR C  1 40  ? 74.200  7.850   -39.976  1.00 69.02  ? 39  THR C CB  1 
ATOM   4550  O  OG1 . THR C  1 40  ? 73.289  7.558   -41.042  1.00 56.11  ? 39  THR C OG1 1 
ATOM   4551  C  CG2 . THR C  1 40  ? 74.916  6.610   -39.533  1.00 35.25  ? 39  THR C CG2 1 
ATOM   4552  N  N   . ILE C  1 41  ? 71.676  9.931   -39.627  1.00 38.89  ? 40  ILE C N   1 
ATOM   4553  C  CA  . ILE C  1 41  ? 70.310  10.395  -39.830  1.00 44.76  ? 40  ILE C CA  1 
ATOM   4554  C  C   . ILE C  1 41  ? 69.949  10.341  -41.308  1.00 41.59  ? 40  ILE C C   1 
ATOM   4555  O  O   . ILE C  1 41  ? 70.624  10.947  -42.142  1.00 43.63  ? 40  ILE C O   1 
ATOM   4556  C  CB  . ILE C  1 41  ? 70.156  11.870  -39.406  1.00 51.17  ? 40  ILE C CB  1 
ATOM   4557  C  CG1 . ILE C  1 41  ? 70.722  12.109  -38.004  1.00 44.26  ? 40  ILE C CG1 1 
ATOM   4558  C  CG2 . ILE C  1 41  ? 68.704  12.308  -39.505  1.00 36.48  ? 40  ILE C CG2 1 
ATOM   4559  C  CD1 . ILE C  1 41  ? 70.138  11.223  -36.949  1.00 49.11  ? 40  ILE C CD1 1 
ATOM   4560  N  N   . TYR C  1 42  ? 68.871  9.634   -41.626  1.00 43.46  ? 41  TYR C N   1 
ATOM   4561  C  CA  . TYR C  1 42  ? 68.335  9.634   -42.981  1.00 38.28  ? 41  TYR C CA  1 
ATOM   4562  C  C   . TYR C  1 42  ? 67.025  10.401  -43.004  1.00 43.74  ? 41  TYR C C   1 
ATOM   4563  O  O   . TYR C  1 42  ? 66.182  10.228  -42.125  1.00 41.97  ? 41  TYR C O   1 
ATOM   4564  C  CB  . TYR C  1 42  ? 68.084  8.214   -43.485  1.00 36.28  ? 41  TYR C CB  1 
ATOM   4565  C  CG  . TYR C  1 42  ? 69.332  7.373   -43.653  1.00 39.31  ? 41  TYR C CG  1 
ATOM   4566  C  CD1 . TYR C  1 42  ? 70.224  7.606   -44.695  1.00 43.78  ? 41  TYR C CD1 1 
ATOM   4567  C  CD2 . TYR C  1 42  ? 69.607  6.336   -42.778  1.00 44.03  ? 41  TYR C CD2 1 
ATOM   4568  C  CE1 . TYR C  1 42  ? 71.361  6.827   -44.844  1.00 50.06  ? 41  TYR C CE1 1 
ATOM   4569  C  CE2 . TYR C  1 42  ? 70.736  5.555   -42.919  1.00 53.49  ? 41  TYR C CE2 1 
ATOM   4570  C  CZ  . TYR C  1 42  ? 71.611  5.803   -43.947  1.00 55.41  ? 41  TYR C CZ  1 
ATOM   4571  O  OH  . TYR C  1 42  ? 72.734  5.010   -44.075  1.00 53.97  ? 41  TYR C OH  1 
ATOM   4572  N  N   . ARG C  1 43  ? 66.869  11.259  -44.006  1.00 45.38  ? 42  ARG C N   1 
ATOM   4573  C  CA  . ARG C  1 43  ? 65.606  11.936  -44.227  1.00 41.93  ? 42  ARG C CA  1 
ATOM   4574  C  C   . ARG C  1 43  ? 64.895  11.269  -45.404  1.00 47.82  ? 42  ARG C C   1 
ATOM   4575  O  O   . ARG C  1 43  ? 65.494  11.049  -46.459  1.00 46.89  ? 42  ARG C O   1 
ATOM   4576  C  CB  . ARG C  1 43  ? 65.819  13.425  -44.491  1.00 47.69  ? 42  ARG C CB  1 
ATOM   4577  C  CG  . ARG C  1 43  ? 64.530  14.230  -44.551  1.00 45.28  ? 42  ARG C CG  1 
ATOM   4578  C  CD  . ARG C  1 43  ? 64.812  15.727  -44.613  1.00 52.30  ? 42  ARG C CD  1 
ATOM   4579  N  NE  . ARG C  1 43  ? 65.377  16.108  -45.901  1.00 49.96  ? 42  ARG C NE  1 
ATOM   4580  C  CZ  . ARG C  1 43  ? 64.656  16.493  -46.948  1.00 67.42  ? 42  ARG C CZ  1 
ATOM   4581  N  NH1 . ARG C  1 43  ? 65.256  16.817  -48.087  1.00 58.65  ? 42  ARG C NH1 1 
ATOM   4582  N  NH2 . ARG C  1 43  ? 63.336  16.558  -46.855  1.00 52.69  ? 42  ARG C NH2 1 
ATOM   4583  N  N   . LEU C  1 44  ? 63.625  10.930  -45.196  1.00 39.24  ? 43  LEU C N   1 
ATOM   4584  C  CA  . LEU C  1 44  ? 62.812  10.258  -46.201  1.00 41.75  ? 43  LEU C CA  1 
ATOM   4585  C  C   . LEU C  1 44  ? 61.748  11.231  -46.685  1.00 46.19  ? 43  LEU C C   1 
ATOM   4586  O  O   . LEU C  1 44  ? 60.899  11.666  -45.911  1.00 56.93  ? 43  LEU C O   1 
ATOM   4587  C  CB  . LEU C  1 44  ? 62.151  9.015   -45.600  1.00 41.02  ? 43  LEU C CB  1 
ATOM   4588  C  CG  . LEU C  1 44  ? 63.132  7.954   -45.102  1.00 54.07  ? 43  LEU C CG  1 
ATOM   4589  C  CD1 . LEU C  1 44  ? 62.398  6.740   -44.557  1.00 65.06  ? 43  LEU C CD1 1 
ATOM   4590  C  CD2 . LEU C  1 44  ? 64.067  7.559   -46.226  1.00 64.06  ? 43  LEU C CD2 1 
ATOM   4591  N  N   . TYR C  1 45  ? 61.811  11.568  -47.969  1.00 51.63  ? 44  TYR C N   1 
ATOM   4592  C  CA  . TYR C  1 45  ? 61.006  12.642  -48.527  1.00 58.86  ? 44  TYR C CA  1 
ATOM   4593  C  C   . TYR C  1 45  ? 60.596  12.323  -49.959  1.00 58.94  ? 44  TYR C C   1 
ATOM   4594  O  O   . TYR C  1 45  ? 61.006  11.306  -50.530  1.00 59.91  ? 44  TYR C O   1 
ATOM   4595  C  CB  . TYR C  1 45  ? 61.812  13.944  -48.514  1.00 69.05  ? 44  TYR C CB  1 
ATOM   4596  C  CG  . TYR C  1 45  ? 63.016  13.920  -49.445  1.00 57.43  ? 44  TYR C CG  1 
ATOM   4597  C  CD1 . TYR C  1 45  ? 64.171  13.221  -49.107  1.00 63.87  ? 44  TYR C CD1 1 
ATOM   4598  C  CD2 . TYR C  1 45  ? 62.994  14.593  -50.660  1.00 65.48  ? 44  TYR C CD2 1 
ATOM   4599  C  CE1 . TYR C  1 45  ? 65.267  13.194  -49.954  1.00 72.53  ? 44  TYR C CE1 1 
ATOM   4600  C  CE2 . TYR C  1 45  ? 64.087  14.571  -51.512  1.00 86.17  ? 44  TYR C CE2 1 
ATOM   4601  C  CZ  . TYR C  1 45  ? 65.219  13.872  -51.153  1.00 62.71  ? 44  TYR C CZ  1 
ATOM   4602  O  OH  . TYR C  1 45  ? 66.305  13.849  -52.000  1.00 89.04  ? 44  TYR C OH  1 
ATOM   4603  N  N   . GLY C  1 46  ? 59.790  13.203  -50.542  1.00 55.97  ? 45  GLY C N   1 
ATOM   4604  C  CA  . GLY C  1 46  ? 59.432  13.085  -51.944  1.00 63.29  ? 45  GLY C CA  1 
ATOM   4605  C  C   . GLY C  1 46  ? 58.525  11.920  -52.290  1.00 67.21  ? 45  GLY C C   1 
ATOM   4606  O  O   . GLY C  1 46  ? 58.334  11.621  -53.463  1.00 80.22  ? 45  GLY C O   1 
ATOM   4607  N  N   . LYS C  1 47  ? 57.970  11.250  -51.282  1.00 66.04  ? 46  LYS C N   1 
ATOM   4608  C  CA  . LYS C  1 47  ? 56.966  10.224  -51.546  1.00 80.27  ? 46  LYS C CA  1 
ATOM   4609  C  C   . LYS C  1 47  ? 55.594  10.869  -51.560  1.00 53.19  ? 46  LYS C C   1 
ATOM   4610  O  O   . LYS C  1 47  ? 55.171  11.454  -50.562  1.00 65.25  ? 46  LYS C O   1 
ATOM   4611  C  CB  . LYS C  1 47  ? 56.997  9.099   -50.510  1.00 69.62  ? 46  LYS C CB  1 
ATOM   4612  C  CG  . LYS C  1 47  ? 55.954  8.011   -50.778  1.00 71.28  ? 46  LYS C CG  1 
ATOM   4613  C  CD  . LYS C  1 47  ? 56.062  6.863   -49.783  1.00 82.72  ? 46  LYS C CD  1 
ATOM   4614  C  CE  . LYS C  1 47  ? 54.951  5.841   -49.988  1.00 75.67  ? 46  LYS C CE  1 
ATOM   4615  N  NZ  . LYS C  1 47  ? 53.609  6.450   -49.809  1.00 90.43  ? 46  LYS C NZ  1 
ATOM   4616  N  N   . PRO C  1 48  ? 54.900  10.771  -52.698  1.00 81.65  ? 47  PRO C N   1 
ATOM   4617  C  CA  . PRO C  1 48  ? 53.587  11.408  -52.830  1.00 86.00  ? 47  PRO C CA  1 
ATOM   4618  C  C   . PRO C  1 48  ? 52.610  10.809  -51.829  1.00 93.00  ? 47  PRO C C   1 
ATOM   4619  O  O   . PRO C  1 48  ? 52.678  9.606   -51.569  1.00 70.93  ? 47  PRO C O   1 
ATOM   4620  C  CB  . PRO C  1 48  ? 53.170  11.058  -54.260  1.00 76.05  ? 47  PRO C CB  1 
ATOM   4621  C  CG  . PRO C  1 48  ? 53.915  9.805   -54.573  1.00 91.69  ? 47  PRO C CG  1 
ATOM   4622  C  CD  . PRO C  1 48  ? 55.228  9.914   -53.851  1.00 65.37  ? 47  PRO C CD  1 
ATOM   4623  N  N   . ASN C  1 49  ? 51.746  11.645  -51.256  1.00 79.64  ? 48  ASN C N   1 
ATOM   4624  C  CA  . ASN C  1 49  ? 50.698  11.178  -50.352  1.00 61.39  ? 48  ASN C CA  1 
ATOM   4625  C  C   . ASN C  1 49  ? 51.261  10.443  -49.142  1.00 82.72  ? 48  ASN C C   1 
ATOM   4626  O  O   . ASN C  1 49  ? 50.649  9.509   -48.620  1.00 88.96  ? 48  ASN C O   1 
ATOM   4627  C  CB  . ASN C  1 49  ? 49.700  10.302  -51.119  1.00 59.49  ? 48  ASN C CB  1 
ATOM   4628  C  CG  . ASN C  1 49  ? 49.380  10.860  -52.488  1.00 65.88  ? 48  ASN C CG  1 
ATOM   4629  O  OD1 . ASN C  1 49  ? 49.566  10.192  -53.509  1.00 77.59  ? 48  ASN C OD1 1 
ATOM   4630  N  ND2 . ASN C  1 49  ? 48.911  12.103  -52.520  1.00 93.44  ? 48  ASN C ND2 1 
ATOM   4631  N  N   . ALA C  1 50  ? 52.441  10.873  -48.710  1.00 63.87  ? 49  ALA C N   1 
ATOM   4632  C  CA  . ALA C  1 50  ? 53.088  10.310  -47.537  1.00 74.45  ? 49  ALA C CA  1 
ATOM   4633  C  C   . ALA C  1 50  ? 53.932  11.381  -46.847  1.00 69.91  ? 49  ALA C C   1 
ATOM   4634  O  O   . ALA C  1 50  ? 54.616  12.165  -47.513  1.00 71.65  ? 49  ALA C O   1 
ATOM   4635  C  CB  . ALA C  1 50  ? 53.939  9.121   -47.929  1.00 76.48  ? 49  ALA C CB  1 
ATOM   4636  N  N   . PRO C  1 51  ? 53.889  11.418  -45.508  1.00 70.15  ? 50  PRO C N   1 
ATOM   4637  C  CA  . PRO C  1 51  ? 54.596  12.470  -44.776  1.00 59.21  ? 50  PRO C CA  1 
ATOM   4638  C  C   . PRO C  1 51  ? 56.098  12.237  -44.779  1.00 71.22  ? 50  PRO C C   1 
ATOM   4639  O  O   . PRO C  1 51  ? 56.562  11.115  -44.998  1.00 50.34  ? 50  PRO C O   1 
ATOM   4640  C  CB  . PRO C  1 51  ? 54.070  12.304  -43.354  1.00 61.02  ? 50  PRO C CB  1 
ATOM   4641  C  CG  . PRO C  1 51  ? 53.813  10.845  -43.246  1.00 54.37  ? 50  PRO C CG  1 
ATOM   4642  C  CD  . PRO C  1 51  ? 53.268  10.441  -44.596  1.00 62.50  ? 50  PRO C CD  1 
ATOM   4643  N  N   . GLU C  1 52  ? 56.855  13.296  -44.531  1.00 46.75  ? 51  GLU C N   1 
ATOM   4644  C  CA  . GLU C  1 52  ? 58.288  13.158  -44.367  1.00 54.84  ? 51  GLU C CA  1 
ATOM   4645  C  C   . GLU C  1 52  ? 58.557  12.302  -43.130  1.00 55.09  ? 51  GLU C C   1 
ATOM   4646  O  O   . GLU C  1 52  ? 57.807  12.361  -42.152  1.00 43.62  ? 51  GLU C O   1 
ATOM   4647  C  CB  . GLU C  1 52  ? 58.936  14.536  -44.230  1.00 45.72  ? 51  GLU C CB  1 
ATOM   4648  C  CG  . GLU C  1 52  ? 60.449  14.522  -44.155  1.00 67.32  ? 51  GLU C CG  1 
ATOM   4649  C  CD  . GLU C  1 52  ? 61.031  15.920  -44.072  1.00 70.59  ? 51  GLU C CD  1 
ATOM   4650  O  OE1 . GLU C  1 52  ? 60.835  16.592  -43.038  1.00 58.72  ? 51  GLU C OE1 1 
ATOM   4651  O  OE2 . GLU C  1 52  ? 61.679  16.351  -45.047  1.00 65.74  ? 51  GLU C OE2 1 
ATOM   4652  N  N   . LEU C  1 53  ? 59.610  11.491  -43.193  1.00 39.55  ? 52  LEU C N   1 
ATOM   4653  C  CA  . LEU C  1 53  ? 60.030  10.670  -42.062  1.00 40.56  ? 52  LEU C CA  1 
ATOM   4654  C  C   . LEU C  1 53  ? 61.530  10.854  -41.815  1.00 33.96  ? 52  LEU C C   1 
ATOM   4655  O  O   . LEU C  1 53  ? 62.264  11.287  -42.704  1.00 44.01  ? 52  LEU C O   1 
ATOM   4656  C  CB  . LEU C  1 53  ? 59.765  9.191   -42.339  1.00 38.10  ? 52  LEU C CB  1 
ATOM   4657  C  CG  . LEU C  1 53  ? 58.380  8.784   -42.827  1.00 44.37  ? 52  LEU C CG  1 
ATOM   4658  C  CD1 . LEU C  1 53  ? 58.360  7.306   -43.227  1.00 41.99  ? 52  LEU C CD1 1 
ATOM   4659  C  CD2 . LEU C  1 53  ? 57.336  9.076   -41.757  1.00 46.91  ? 52  LEU C CD2 1 
ATOM   4660  N  N   . PHE C  1 54  ? 61.977  10.502  -40.612  1.00 37.28  ? 53  PHE C N   1 
ATOM   4661  C  CA  . PHE C  1 54  ? 63.403  10.411  -40.325  1.00 52.64  ? 53  PHE C CA  1 
ATOM   4662  C  C   . PHE C  1 54  ? 63.735  9.005   -39.860  1.00 42.80  ? 53  PHE C C   1 
ATOM   4663  O  O   . PHE C  1 54  ? 62.949  8.378   -39.145  1.00 40.38  ? 53  PHE C O   1 
ATOM   4664  C  CB  . PHE C  1 54  ? 63.832  11.448  -39.277  1.00 39.33  ? 53  PHE C CB  1 
ATOM   4665  C  CG  . PHE C  1 54  ? 63.894  12.854  -39.818  1.00 34.35  ? 53  PHE C CG  1 
ATOM   4666  C  CD1 . PHE C  1 54  ? 65.000  13.286  -40.530  1.00 38.95  ? 53  PHE C CD1 1 
ATOM   4667  C  CD2 . PHE C  1 54  ? 62.833  13.732  -39.633  1.00 39.04  ? 53  PHE C CD2 1 
ATOM   4668  C  CE1 . PHE C  1 54  ? 65.060  14.576  -41.053  1.00 37.52  ? 53  PHE C CE1 1 
ATOM   4669  C  CE2 . PHE C  1 54  ? 62.886  15.032  -40.153  1.00 43.73  ? 53  PHE C CE2 1 
ATOM   4670  C  CZ  . PHE C  1 54  ? 64.001  15.451  -40.866  1.00 44.42  ? 53  PHE C CZ  1 
ATOM   4671  N  N   . LEU C  1 55  ? 64.890  8.507   -40.293  1.00 34.49  ? 54  LEU C N   1 
ATOM   4672  C  CA  . LEU C  1 55  ? 65.383  7.210   -39.845  1.00 37.67  ? 54  LEU C CA  1 
ATOM   4673  C  C   . LEU C  1 55  ? 66.738  7.383   -39.184  1.00 41.44  ? 54  LEU C C   1 
ATOM   4674  O  O   . LEU C  1 55  ? 67.685  7.877   -39.813  1.00 40.52  ? 54  LEU C O   1 
ATOM   4675  C  CB  . LEU C  1 55  ? 65.507  6.238   -41.020  1.00 43.11  ? 54  LEU C CB  1 
ATOM   4676  C  CG  . LEU C  1 55  ? 66.031  4.834   -40.693  1.00 37.16  ? 54  LEU C CG  1 
ATOM   4677  C  CD1 . LEU C  1 55  ? 65.094  4.093   -39.724  1.00 39.14  ? 54  LEU C CD1 1 
ATOM   4678  C  CD2 . LEU C  1 55  ? 66.224  4.022   -41.971  1.00 43.38  ? 54  LEU C CD2 1 
ATOM   4679  N  N   . LYS C  1 56  ? 66.817  6.988   -37.915  1.00 36.63  ? 55  LYS C N   1 
ATOM   4680  C  CA  . LYS C  1 56  ? 68.062  6.997   -37.175  1.00 36.58  ? 55  LYS C CA  1 
ATOM   4681  C  C   . LYS C  1 56  ? 68.625  5.594   -37.117  1.00 50.20  ? 55  LYS C C   1 
ATOM   4682  O  O   . LYS C  1 56  ? 67.919  4.644   -36.770  1.00 43.04  ? 55  LYS C O   1 
ATOM   4683  C  CB  . LYS C  1 56  ? 67.853  7.500   -35.745  1.00 34.83  ? 55  LYS C CB  1 
ATOM   4684  C  CG  . LYS C  1 56  ? 67.736  9.001   -35.588  1.00 40.83  ? 55  LYS C CG  1 
ATOM   4685  C  CD  . LYS C  1 56  ? 68.042  9.393   -34.145  1.00 52.91  ? 55  LYS C CD  1 
ATOM   4686  C  CE  . LYS C  1 56  ? 68.040  10.900  -33.966  1.00 52.53  ? 55  LYS C CE  1 
ATOM   4687  N  NZ  . LYS C  1 56  ? 68.467  11.301  -32.595  1.00 50.60  ? 55  LYS C NZ  1 
ATOM   4688  N  N   . HIS C  1 57  ? 69.902  5.466   -37.456  1.00 35.78  ? 56  HIS C N   1 
ATOM   4689  C  CA  . HIS C  1 57  ? 70.607  4.197   -37.326  1.00 31.92  ? 56  HIS C CA  1 
ATOM   4690  C  C   . HIS C  1 57  ? 71.783  4.354   -36.374  1.00 43.37  ? 56  HIS C C   1 
ATOM   4691  O  O   . HIS C  1 57  ? 72.721  5.088   -36.667  1.00 45.67  ? 56  HIS C O   1 
ATOM   4692  C  CB  . HIS C  1 57  ? 71.131  3.722   -38.688  1.00 37.06  ? 56  HIS C CB  1 
ATOM   4693  C  CG  . HIS C  1 57  ? 71.904  2.443   -38.618  1.00 36.54  ? 56  HIS C CG  1 
ATOM   4694  N  ND1 . HIS C  1 57  ? 72.888  2.112   -39.524  1.00 40.62  ? 56  HIS C ND1 1 
ATOM   4695  C  CD2 . HIS C  1 57  ? 71.840  1.415   -37.740  1.00 31.68  ? 56  HIS C CD2 1 
ATOM   4696  C  CE1 . HIS C  1 57  ? 73.393  0.932   -39.210  1.00 46.75  ? 56  HIS C CE1 1 
ATOM   4697  N  NE2 . HIS C  1 57  ? 72.776  0.488   -38.129  1.00 42.88  ? 56  HIS C NE2 1 
ATOM   4698  N  N   . GLY C  1 58  ? 71.744  3.649   -35.248  1.00 31.32  ? 57  GLY C N   1 
ATOM   4699  C  CA  . GLY C  1 58  ? 72.869  3.645   -34.335  1.00 34.34  ? 57  GLY C CA  1 
ATOM   4700  C  C   . GLY C  1 58  ? 73.504  2.277   -34.325  1.00 36.37  ? 57  GLY C C   1 
ATOM   4701  O  O   . GLY C  1 58  ? 72.799  1.273   -34.324  1.00 33.14  ? 57  GLY C O   1 
ATOM   4702  N  N   . LYS C  1 59  ? 74.833  2.229   -34.322  1.00 34.61  ? 58  LYS C N   1 
ATOM   4703  C  CA  . LYS C  1 59  ? 75.545  0.963   -34.203  1.00 33.14  ? 58  LYS C CA  1 
ATOM   4704  C  C   . LYS C  1 59  ? 76.372  0.952   -32.918  1.00 39.01  ? 58  LYS C C   1 
ATOM   4705  O  O   . LYS C  1 59  ? 76.906  1.985   -32.512  1.00 35.76  ? 58  LYS C O   1 
ATOM   4706  C  CB  . LYS C  1 59  ? 76.459  0.768   -35.418  1.00 39.74  ? 58  LYS C CB  1 
ATOM   4707  C  CG  . LYS C  1 59  ? 77.072  -0.615  -35.522  1.00 54.93  ? 58  LYS C CG  1 
ATOM   4708  C  CD  . LYS C  1 59  ? 77.182  -1.068  -36.975  1.00 62.40  ? 58  LYS C CD  1 
ATOM   4709  C  CE  . LYS C  1 59  ? 77.953  -0.077  -37.820  1.00 80.15  ? 58  LYS C CE  1 
ATOM   4710  N  NZ  . LYS C  1 59  ? 77.939  -0.462  -39.260  1.00 87.24  ? 58  LYS C NZ  1 
ATOM   4711  N  N   . GLY C  1 60  ? 76.497  -0.210  -32.289  1.00 34.88  ? 59  GLY C N   1 
ATOM   4712  C  CA  . GLY C  1 60  ? 77.338  -0.344  -31.112  1.00 38.38  ? 59  GLY C CA  1 
ATOM   4713  C  C   . GLY C  1 60  ? 76.804  0.446   -29.930  1.00 49.89  ? 59  GLY C C   1 
ATOM   4714  O  O   . GLY C  1 60  ? 75.620  0.365   -29.622  1.00 37.37  ? 59  GLY C O   1 
ATOM   4715  N  N   . SER C  1 61  ? 77.673  1.204   -29.262  1.00 38.87  ? 60  SER C N   1 
ATOM   4716  C  CA  . SER C  1 61  ? 77.248  2.055   -28.146  1.00 32.78  ? 60  SER C CA  1 
ATOM   4717  C  C   . SER C  1 61  ? 76.154  3.023   -28.583  1.00 35.31  ? 60  SER C C   1 
ATOM   4718  O  O   . SER C  1 61  ? 75.231  3.318   -27.825  1.00 38.75  ? 60  SER C O   1 
ATOM   4719  C  CB  . SER C  1 61  ? 78.428  2.877   -27.593  1.00 40.38  ? 60  SER C CB  1 
ATOM   4720  O  OG  . SER C  1 61  ? 79.335  2.072   -26.854  1.00 40.05  ? 60  SER C OG  1 
ATOM   4721  N  N   . VAL C  1 62  ? 76.276  3.529   -29.803  1.00 31.83  ? 61  VAL C N   1 
ATOM   4722  C  CA  . VAL C  1 62  ? 75.294  4.478   -30.331  1.00 29.11  ? 61  VAL C CA  1 
ATOM   4723  C  C   . VAL C  1 62  ? 73.898  3.837   -30.444  1.00 36.01  ? 61  VAL C C   1 
ATOM   4724  O  O   . VAL C  1 62  ? 72.873  4.530   -30.329  1.00 36.94  ? 61  VAL C O   1 
ATOM   4725  C  CB  . VAL C  1 62  ? 75.762  5.087   -31.684  1.00 34.38  ? 61  VAL C CB  1 
ATOM   4726  C  CG1 . VAL C  1 62  ? 74.737  6.085   -32.214  1.00 42.81  ? 61  VAL C CG1 1 
ATOM   4727  C  CG2 . VAL C  1 62  ? 77.108  5.794   -31.516  1.00 40.32  ? 61  VAL C CG2 1 
ATOM   4728  N  N   . ALA C  1 63  ? 73.847  2.520   -30.653  1.00 34.06  ? 62  ALA C N   1 
ATOM   4729  C  CA  . ALA C  1 63  ? 72.557  1.817   -30.639  1.00 36.00  ? 62  ALA C CA  1 
ATOM   4730  C  C   . ALA C  1 63  ? 71.853  2.024   -29.308  1.00 40.39  ? 62  ALA C C   1 
ATOM   4731  O  O   . ALA C  1 63  ? 70.616  2.100   -29.247  1.00 34.48  ? 62  ALA C O   1 
ATOM   4732  C  CB  . ALA C  1 63  ? 72.736  0.313   -30.923  1.00 36.68  ? 62  ALA C CB  1 
ATOM   4733  N  N   . ASN C  1 64  ? 72.631  2.113   -28.234  1.00 35.45  ? 63  ASN C N   1 
ATOM   4734  C  CA  . ASN C  1 64  ? 72.027  2.306   -26.917  1.00 38.30  ? 63  ASN C CA  1 
ATOM   4735  C  C   . ASN C  1 64  ? 71.402  3.682   -26.783  1.00 37.19  ? 63  ASN C C   1 
ATOM   4736  O  O   . ASN C  1 64  ? 70.366  3.842   -26.138  1.00 36.74  ? 63  ASN C O   1 
ATOM   4737  C  CB  . ASN C  1 64  ? 73.033  2.057   -25.793  1.00 44.50  ? 63  ASN C CB  1 
ATOM   4738  C  CG  . ASN C  1 64  ? 73.437  0.602   -25.695  1.00 39.87  ? 63  ASN C CG  1 
ATOM   4739  O  OD1 . ASN C  1 64  ? 72.608  -0.294  -25.866  1.00 42.24  ? 63  ASN C OD1 1 
ATOM   4740  N  ND2 . ASN C  1 64  ? 74.714  0.357   -25.429  1.00 43.46  ? 63  ASN C ND2 1 
ATOM   4741  N  N   . ASP C  1 65  ? 72.027  4.676   -27.402  1.00 34.96  ? 64  ASP C N   1 
ATOM   4742  C  CA  . ASP C  1 65  ? 71.478  6.027   -27.363  1.00 42.65  ? 64  ASP C CA  1 
ATOM   4743  C  C   . ASP C  1 65  ? 70.186  6.137   -28.181  1.00 38.87  ? 64  ASP C C   1 
ATOM   4744  O  O   . ASP C  1 65  ? 69.273  6.880   -27.820  1.00 33.24  ? 64  ASP C O   1 
ATOM   4745  C  CB  . ASP C  1 65  ? 72.508  7.037   -27.871  1.00 41.22  ? 64  ASP C CB  1 
ATOM   4746  C  CG  . ASP C  1 65  ? 73.817  6.983   -27.094  1.00 70.53  ? 64  ASP C CG  1 
ATOM   4747  O  OD1 . ASP C  1 65  ? 73.787  6.853   -25.851  1.00 51.41  ? 64  ASP C OD1 1 
ATOM   4748  O  OD2 . ASP C  1 65  ? 74.882  7.072   -27.735  1.00 52.54  ? 64  ASP C OD2 1 
ATOM   4749  N  N   . VAL C  1 66  ? 70.112  5.409   -29.293  1.00 36.70  ? 65  VAL C N   1 
ATOM   4750  C  CA  . VAL C  1 66  ? 68.943  5.476   -30.168  1.00 43.93  ? 65  VAL C CA  1 
ATOM   4751  C  C   . VAL C  1 66  ? 67.767  4.799   -29.455  1.00 33.49  ? 65  VAL C C   1 
ATOM   4752  O  O   . VAL C  1 66  ? 66.629  5.279   -29.485  1.00 32.01  ? 65  VAL C O   1 
ATOM   4753  C  CB  . VAL C  1 66  ? 69.231  4.811   -31.539  1.00 42.16  ? 65  VAL C CB  1 
ATOM   4754  C  CG1 . VAL C  1 66  ? 67.962  4.675   -32.367  1.00 29.91  ? 65  VAL C CG1 1 
ATOM   4755  C  CG2 . VAL C  1 66  ? 70.312  5.593   -32.305  1.00 38.43  ? 65  VAL C CG2 1 
ATOM   4756  N  N   . THR C  1 67  ? 68.070  3.696   -28.785  1.00 30.79  ? 66  THR C N   1 
ATOM   4757  C  CA  . THR C  1 67  ? 67.105  3.013   -27.927  1.00 32.26  ? 66  THR C CA  1 
ATOM   4758  C  C   . THR C  1 67  ? 66.600  3.907   -26.790  1.00 36.76  ? 66  THR C C   1 
ATOM   4759  O  O   . THR C  1 67  ? 65.407  3.923   -26.478  1.00 33.91  ? 66  THR C O   1 
ATOM   4760  C  CB  . THR C  1 67  ? 67.726  1.761   -27.309  1.00 34.59  ? 66  THR C CB  1 
ATOM   4761  O  OG1 . THR C  1 67  ? 68.268  0.935   -28.348  1.00 33.87  ? 66  THR C OG1 1 
ATOM   4762  C  CG2 . THR C  1 67  ? 66.687  0.974   -26.526  1.00 34.71  ? 66  THR C CG2 1 
ATOM   4763  N  N   . ASP C  1 68  ? 67.514  4.636   -26.167  1.00 30.19  ? 67  ASP C N   1 
ATOM   4764  C  CA  . ASP C  1 68  ? 67.149  5.592   -25.119  1.00 32.40  ? 67  ASP C CA  1 
ATOM   4765  C  C   . ASP C  1 68  ? 66.166  6.627   -25.639  1.00 32.29  ? 67  ASP C C   1 
ATOM   4766  O  O   . ASP C  1 68  ? 65.220  6.994   -24.933  1.00 31.83  ? 67  ASP C O   1 
ATOM   4767  C  CB  . ASP C  1 68  ? 68.380  6.353   -24.609  1.00 34.05  ? 67  ASP C CB  1 
ATOM   4768  C  CG  . ASP C  1 68  ? 69.271  5.515   -23.700  1.00 42.34  ? 67  ASP C CG  1 
ATOM   4769  O  OD1 . ASP C  1 68  ? 68.883  4.384   -23.336  1.00 47.78  ? 67  ASP C OD1 1 
ATOM   4770  O  OD2 . ASP C  1 68  ? 70.365  6.018   -23.338  1.00 43.97  ? 67  ASP C OD2 1 
ATOM   4771  N  N   . GLU C  1 69  ? 66.399  7.121   -26.860  1.00 31.68  ? 68  GLU C N   1 
ATOM   4772  C  CA  . GLU C  1 69  ? 65.492  8.112   -27.437  1.00 30.78  ? 68  GLU C CA  1 
ATOM   4773  C  C   . GLU C  1 69  ? 64.138  7.504   -27.736  1.00 33.04  ? 68  GLU C C   1 
ATOM   4774  O  O   . GLU C  1 69  ? 63.117  8.158   -27.552  1.00 34.82  ? 68  GLU C O   1 
ATOM   4775  C  CB  . GLU C  1 69  ? 66.025  8.770   -28.724  1.00 38.01  ? 68  GLU C CB  1 
ATOM   4776  C  CG  . GLU C  1 69  ? 65.052  9.873   -29.172  1.00 39.00  ? 68  GLU C CG  1 
ATOM   4777  C  CD  . GLU C  1 69  ? 65.394  10.550  -30.497  1.00 55.92  ? 68  GLU C CD  1 
ATOM   4778  O  OE1 . GLU C  1 69  ? 66.211  10.010  -31.267  1.00 69.69  ? 68  GLU C OE1 1 
ATOM   4779  O  OE2 . GLU C  1 69  ? 64.824  11.637  -30.762  1.00 64.69  ? 68  GLU C OE2 1 
HETATM 4780  N  N   . MSE C  1 70  ? 64.133  6.266   -28.221  1.00 30.13  ? 69  MSE C N   1 
HETATM 4781  C  CA  . MSE C  1 70  ? 62.880  5.613   -28.569  1.00 35.94  ? 69  MSE C CA  1 
HETATM 4782  C  C   . MSE C  1 70  ? 61.959  5.521   -27.347  1.00 33.01  ? 69  MSE C C   1 
HETATM 4783  O  O   . MSE C  1 70  ? 60.793  5.880   -27.429  1.00 31.42  ? 69  MSE C O   1 
HETATM 4784  C  CB  . MSE C  1 70  ? 63.115  4.227   -29.175  1.00 35.11  ? 69  MSE C CB  1 
HETATM 4785  C  CG  . MSE C  1 70  ? 61.833  3.521   -29.632  1.00 36.98  ? 69  MSE C CG  1 
HETATM 4786  SE SE  . MSE C  1 70  ? 60.861  2.584   -28.203  0.64 35.75  ? 69  MSE C SE  1 
HETATM 4787  C  CE  . MSE C  1 70  ? 62.280  1.387   -27.753  1.00 42.18  ? 69  MSE C CE  1 
ATOM   4788  N  N   . VAL C  1 71  ? 62.469  5.053   -26.211  1.00 29.66  ? 70  VAL C N   1 
ATOM   4789  C  CA  . VAL C  1 71  ? 61.578  4.942   -25.054  1.00 31.34  ? 70  VAL C CA  1 
ATOM   4790  C  C   . VAL C  1 71  ? 61.155  6.271   -24.483  1.00 36.42  ? 70  VAL C C   1 
ATOM   4791  O  O   . VAL C  1 71  ? 60.069  6.388   -23.943  1.00 30.27  ? 70  VAL C O   1 
ATOM   4792  C  CB  . VAL C  1 71  ? 62.124  4.073   -23.957  1.00 33.63  ? 70  VAL C CB  1 
ATOM   4793  C  CG1 . VAL C  1 71  ? 62.069  2.702   -24.452  1.00 38.32  ? 70  VAL C CG1 1 
ATOM   4794  C  CG2 . VAL C  1 71  ? 63.545  4.514   -23.540  1.00 33.79  ? 70  VAL C CG2 1 
ATOM   4795  N  N   . ARG C  1 72  ? 62.003  7.279   -24.612  1.00 29.39  ? 71  ARG C N   1 
ATOM   4796  C  CA  . ARG C  1 72  ? 61.617  8.593   -24.119  1.00 35.85  ? 71  ARG C CA  1 
ATOM   4797  C  C   . ARG C  1 72  ? 60.593  9.260   -25.031  1.00 30.34  ? 71  ARG C C   1 
ATOM   4798  O  O   . ARG C  1 72  ? 59.692  9.938   -24.545  1.00 34.89  ? 71  ARG C O   1 
ATOM   4799  C  CB  . ARG C  1 72  ? 62.852  9.472   -23.867  1.00 26.35  ? 71  ARG C CB  1 
ATOM   4800  C  CG  . ARG C  1 72  ? 63.560  9.095   -22.557  1.00 29.98  ? 71  ARG C CG  1 
ATOM   4801  C  CD  . ARG C  1 72  ? 65.067  9.379   -22.601  1.00 35.32  ? 71  ARG C CD  1 
ATOM   4802  N  NE  . ARG C  1 72  ? 65.721  9.025   -21.340  1.00 34.61  ? 71  ARG C NE  1 
ATOM   4803  C  CZ  . ARG C  1 72  ? 66.159  7.806   -21.037  1.00 36.20  ? 71  ARG C CZ  1 
ATOM   4804  N  NH1 . ARG C  1 72  ? 66.013  6.817   -21.906  1.00 30.31  ? 71  ARG C NH1 1 
ATOM   4805  N  NH2 . ARG C  1 72  ? 66.738  7.576   -19.863  1.00 32.85  ? 71  ARG C NH2 1 
ATOM   4806  N  N   . LEU C  1 73  ? 60.708  9.044   -26.343  1.00 30.57  ? 72  LEU C N   1 
ATOM   4807  C  CA  . LEU C  1 73  ? 59.660  9.480   -27.280  1.00 33.10  ? 72  LEU C CA  1 
ATOM   4808  C  C   . LEU C  1 73  ? 58.332  8.853   -26.908  1.00 33.18  ? 72  LEU C C   1 
ATOM   4809  O  O   . LEU C  1 73  ? 57.288  9.524   -26.856  1.00 32.32  ? 72  LEU C O   1 
ATOM   4810  C  CB  . LEU C  1 73  ? 59.986  9.063   -28.717  1.00 34.65  ? 72  LEU C CB  1 
ATOM   4811  C  CG  . LEU C  1 73  ? 60.976  9.892   -29.524  1.00 38.94  ? 72  LEU C CG  1 
ATOM   4812  C  CD1 . LEU C  1 73  ? 61.284  9.187   -30.837  1.00 37.92  ? 72  LEU C CD1 1 
ATOM   4813  C  CD2 . LEU C  1 73  ? 60.401  11.283  -29.782  1.00 36.67  ? 72  LEU C CD2 1 
ATOM   4814  N  N   . ASN C  1 74  ? 58.370  7.547   -26.676  1.00 31.32  ? 73  ASN C N   1 
ATOM   4815  C  CA  . ASN C  1 74  ? 57.151  6.804   -26.367  1.00 36.62  ? 73  ASN C CA  1 
ATOM   4816  C  C   . ASN C  1 74  ? 56.478  7.312   -25.097  1.00 37.90  ? 73  ASN C C   1 
ATOM   4817  O  O   . ASN C  1 74  ? 55.257  7.460   -25.048  1.00 34.11  ? 73  ASN C O   1 
ATOM   4818  C  CB  . ASN C  1 74  ? 57.463  5.312   -26.230  1.00 34.41  ? 73  ASN C CB  1 
ATOM   4819  C  CG  . ASN C  1 74  ? 56.222  4.468   -26.039  1.00 41.00  ? 73  ASN C CG  1 
ATOM   4820  O  OD1 . ASN C  1 74  ? 55.367  4.380   -26.924  1.00 44.51  ? 73  ASN C OD1 1 
ATOM   4821  N  ND2 . ASN C  1 74  ? 56.134  3.802   -24.888  1.00 41.09  ? 73  ASN C ND2 1 
ATOM   4822  N  N   . TRP C  1 75  ? 57.276  7.589   -24.072  1.00 30.34  ? 74  TRP C N   1 
ATOM   4823  C  CA  . TRP C  1 75  ? 56.718  8.089   -22.821  1.00 31.32  ? 74  TRP C CA  1 
ATOM   4824  C  C   . TRP C  1 75  ? 56.228  9.540   -22.912  1.00 39.01  ? 74  TRP C C   1 
ATOM   4825  O  O   . TRP C  1 75  ? 55.070  9.834   -22.604  1.00 32.03  ? 74  TRP C O   1 
ATOM   4826  C  CB  . TRP C  1 75  ? 57.707  7.953   -21.650  1.00 33.80  ? 74  TRP C CB  1 
ATOM   4827  C  CG  . TRP C  1 75  ? 57.175  8.662   -20.440  1.00 38.25  ? 74  TRP C CG  1 
ATOM   4828  C  CD1 . TRP C  1 75  ? 56.157  8.238   -19.627  1.00 39.34  ? 74  TRP C CD1 1 
ATOM   4829  C  CD2 . TRP C  1 75  ? 57.571  9.954   -19.950  1.00 30.54  ? 74  TRP C CD2 1 
ATOM   4830  N  NE1 . TRP C  1 75  ? 55.910  9.172   -18.654  1.00 34.83  ? 74  TRP C NE1 1 
ATOM   4831  C  CE2 . TRP C  1 75  ? 56.762  10.236  -18.826  1.00 31.28  ? 74  TRP C CE2 1 
ATOM   4832  C  CE3 . TRP C  1 75  ? 58.541  10.889  -20.341  1.00 34.88  ? 74  TRP C CE3 1 
ATOM   4833  C  CZ2 . TRP C  1 75  ? 56.892  11.415  -18.085  1.00 31.24  ? 74  TRP C CZ2 1 
ATOM   4834  C  CZ3 . TRP C  1 75  ? 58.667  12.062  -19.611  1.00 36.42  ? 74  TRP C CZ3 1 
ATOM   4835  C  CH2 . TRP C  1 75  ? 57.843  12.320  -18.497  1.00 35.64  ? 74  TRP C CH2 1 
ATOM   4836  N  N   . LEU C  1 76  ? 57.109  10.445  -23.328  1.00 31.27  ? 75  LEU C N   1 
ATOM   4837  C  CA  . LEU C  1 76  ? 56.822  11.882  -23.256  1.00 35.65  ? 75  LEU C CA  1 
ATOM   4838  C  C   . LEU C  1 76  ? 55.730  12.346  -24.211  1.00 36.76  ? 75  LEU C C   1 
ATOM   4839  O  O   . LEU C  1 76  ? 55.081  13.387  -23.986  1.00 35.24  ? 75  LEU C O   1 
ATOM   4840  C  CB  . LEU C  1 76  ? 58.119  12.690  -23.467  1.00 28.63  ? 75  LEU C CB  1 
ATOM   4841  C  CG  . LEU C  1 76  ? 58.058  14.217  -23.415  1.00 33.42  ? 75  LEU C CG  1 
ATOM   4842  C  CD1 . LEU C  1 76  ? 57.478  14.687  -22.107  1.00 37.31  ? 75  LEU C CD1 1 
ATOM   4843  C  CD2 . LEU C  1 76  ? 59.466  14.762  -23.588  1.00 33.65  ? 75  LEU C CD2 1 
ATOM   4844  N  N   . THR C  1 77  ? 55.492  11.581  -25.275  1.00 31.02  ? 76  THR C N   1 
ATOM   4845  C  CA  . THR C  1 77  ? 54.496  12.014  -26.257  1.00 34.66  ? 76  THR C CA  1 
ATOM   4846  C  C   . THR C  1 77  ? 53.077  12.075  -25.664  1.00 30.68  ? 76  THR C C   1 
ATOM   4847  O  O   . THR C  1 77  ? 52.191  12.756  -26.188  1.00 37.47  ? 76  THR C O   1 
ATOM   4848  C  CB  . THR C  1 77  ? 54.519  11.151  -27.540  1.00 40.67  ? 76  THR C CB  1 
ATOM   4849  O  OG1 . THR C  1 77  ? 53.727  11.785  -28.555  1.00 46.31  ? 76  THR C OG1 1 
ATOM   4850  C  CG2 . THR C  1 77  ? 53.995  9.745   -27.269  1.00 37.32  ? 76  THR C CG2 1 
ATOM   4851  N  N   . ALA C  1 78  ? 52.865  11.385  -24.555  1.00 33.82  ? 77  ALA C N   1 
ATOM   4852  C  CA  . ALA C  1 78  ? 51.584  11.484  -23.871  1.00 39.04  ? 77  ALA C CA  1 
ATOM   4853  C  C   . ALA C  1 78  ? 51.375  12.887  -23.287  1.00 43.52  ? 77  ALA C C   1 
ATOM   4854  O  O   . ALA C  1 78  ? 50.254  13.260  -22.967  1.00 37.60  ? 77  ALA C O   1 
ATOM   4855  C  CB  . ALA C  1 78  ? 51.497  10.451  -22.781  1.00 46.15  ? 77  ALA C CB  1 
ATOM   4856  N  N   . PHE C  1 79  ? 52.455  13.655  -23.135  1.00 35.91  ? 78  PHE C N   1 
ATOM   4857  C  CA  . PHE C  1 79  ? 52.383  14.956  -22.458  1.00 37.81  ? 78  PHE C CA  1 
ATOM   4858  C  C   . PHE C  1 79  ? 52.754  16.152  -23.324  1.00 48.24  ? 78  PHE C C   1 
ATOM   4859  O  O   . PHE C  1 79  ? 52.403  17.279  -22.993  1.00 37.84  ? 78  PHE C O   1 
ATOM   4860  C  CB  . PHE C  1 79  ? 53.294  14.981  -21.224  1.00 35.98  ? 78  PHE C CB  1 
ATOM   4861  C  CG  . PHE C  1 79  ? 53.003  13.897  -20.226  1.00 36.37  ? 78  PHE C CG  1 
ATOM   4862  C  CD1 . PHE C  1 79  ? 52.054  14.089  -19.228  1.00 42.77  ? 78  PHE C CD1 1 
ATOM   4863  C  CD2 . PHE C  1 79  ? 53.686  12.696  -20.272  1.00 34.05  ? 78  PHE C CD2 1 
ATOM   4864  C  CE1 . PHE C  1 79  ? 51.781  13.084  -18.302  1.00 40.19  ? 78  PHE C CE1 1 
ATOM   4865  C  CE2 . PHE C  1 79  ? 53.415  11.679  -19.350  1.00 36.45  ? 78  PHE C CE2 1 
ATOM   4866  C  CZ  . PHE C  1 79  ? 52.472  11.881  -18.362  1.00 35.12  ? 78  PHE C CZ  1 
HETATM 4867  N  N   . MSE C  1 80  ? 53.498  15.921  -24.400  1.00 35.54  ? 79  MSE C N   1 
HETATM 4868  C  CA  . MSE C  1 80  ? 54.057  17.026  -25.197  1.00 33.32  ? 79  MSE C CA  1 
HETATM 4869  C  C   . MSE C  1 80  ? 54.047  16.643  -26.677  1.00 42.61  ? 79  MSE C C   1 
HETATM 4870  O  O   . MSE C  1 80  ? 54.005  15.460  -27.003  1.00 40.15  ? 79  MSE C O   1 
HETATM 4871  C  CB  . MSE C  1 80  ? 55.495  17.362  -24.740  1.00 34.87  ? 79  MSE C CB  1 
HETATM 4872  C  CG  . MSE C  1 80  ? 55.603  17.868  -23.295  1.00 40.62  ? 79  MSE C CG  1 
HETATM 4873  SE SE  . MSE C  1 80  ? 54.802  19.617  -22.998  0.63 40.43  ? 79  MSE C SE  1 
HETATM 4874  C  CE  . MSE C  1 80  ? 56.251  20.717  -23.665  1.00 41.94  ? 79  MSE C CE  1 
ATOM   4875  N  N   . PRO C  1 81  ? 54.085  17.638  -27.578  1.00 42.20  ? 80  PRO C N   1 
ATOM   4876  C  CA  . PRO C  1 81  ? 54.063  17.346  -29.018  1.00 41.71  ? 80  PRO C CA  1 
ATOM   4877  C  C   . PRO C  1 81  ? 55.440  16.897  -29.529  1.00 43.52  ? 80  PRO C C   1 
ATOM   4878  O  O   . PRO C  1 81  ? 56.370  17.700  -29.590  1.00 44.11  ? 80  PRO C O   1 
ATOM   4879  C  CB  . PRO C  1 81  ? 53.662  18.693  -29.634  1.00 43.24  ? 80  PRO C CB  1 
ATOM   4880  C  CG  . PRO C  1 81  ? 54.189  19.709  -28.672  1.00 44.94  ? 80  PRO C CG  1 
ATOM   4881  C  CD  . PRO C  1 81  ? 54.051  19.089  -27.306  1.00 49.72  ? 80  PRO C CD  1 
ATOM   4882  N  N   . LEU C  1 82  ? 55.548  15.615  -29.877  1.00 38.20  ? 81  LEU C N   1 
ATOM   4883  C  CA  . LEU C  1 82  ? 56.804  14.973  -30.254  1.00 43.65  ? 81  LEU C CA  1 
ATOM   4884  C  C   . LEU C  1 82  ? 56.628  14.282  -31.598  1.00 47.87  ? 81  LEU C C   1 
ATOM   4885  O  O   . LEU C  1 82  ? 55.504  14.079  -32.031  1.00 40.77  ? 81  LEU C O   1 
ATOM   4886  C  CB  . LEU C  1 82  ? 57.179  13.900  -29.210  1.00 35.70  ? 81  LEU C CB  1 
ATOM   4887  C  CG  . LEU C  1 82  ? 57.445  14.342  -27.771  1.00 64.03  ? 81  LEU C CG  1 
ATOM   4888  C  CD1 . LEU C  1 82  ? 58.273  13.300  -27.042  1.00 35.97  ? 81  LEU C CD1 1 
ATOM   4889  C  CD2 . LEU C  1 82  ? 58.148  15.669  -27.743  1.00 58.80  ? 81  LEU C CD2 1 
ATOM   4890  N  N   . PRO C  1 83  ? 57.733  13.890  -32.255  1.00 39.14  ? 82  PRO C N   1 
ATOM   4891  C  CA  . PRO C  1 83  ? 57.572  13.015  -33.422  1.00 31.47  ? 82  PRO C CA  1 
ATOM   4892  C  C   . PRO C  1 83  ? 56.921  11.689  -33.029  1.00 34.80  ? 82  PRO C C   1 
ATOM   4893  O  O   . PRO C  1 83  ? 57.103  11.242  -31.903  1.00 39.62  ? 82  PRO C O   1 
ATOM   4894  C  CB  . PRO C  1 83  ? 59.013  12.759  -33.859  1.00 37.63  ? 82  PRO C CB  1 
ATOM   4895  C  CG  . PRO C  1 83  ? 59.760  13.957  -33.392  1.00 33.42  ? 82  PRO C CG  1 
ATOM   4896  C  CD  . PRO C  1 83  ? 59.138  14.295  -32.067  1.00 35.03  ? 82  PRO C CD  1 
ATOM   4897  N  N   . THR C  1 84  ? 56.181  11.078  -33.951  1.00 33.85  ? 83  THR C N   1 
ATOM   4898  C  CA  . THR C  1 84  ? 55.548  9.782   -33.695  1.00 38.56  ? 83  THR C CA  1 
ATOM   4899  C  C   . THR C  1 84  ? 56.448  8.623   -34.115  1.00 41.69  ? 83  THR C C   1 
ATOM   4900  O  O   . THR C  1 84  ? 57.024  8.633   -35.205  1.00 41.80  ? 83  THR C O   1 
ATOM   4901  C  CB  . THR C  1 84  ? 54.215  9.670   -34.450  1.00 51.67  ? 83  THR C CB  1 
ATOM   4902  O  OG1 . THR C  1 84  ? 53.377  10.769  -34.078  1.00 47.15  ? 83  THR C OG1 1 
ATOM   4903  C  CG2 . THR C  1 84  ? 53.503  8.349   -34.125  1.00 44.07  ? 83  THR C CG2 1 
ATOM   4904  N  N   . ILE C  1 85  ? 56.583  7.631   -33.242  1.00 38.41  ? 84  ILE C N   1 
ATOM   4905  C  CA  . ILE C  1 85  ? 57.305  6.418   -33.598  1.00 34.91  ? 84  ILE C CA  1 
ATOM   4906  C  C   . ILE C  1 85  ? 56.504  5.590   -34.584  1.00 39.54  ? 84  ILE C C   1 
ATOM   4907  O  O   . ILE C  1 85  ? 55.382  5.170   -34.303  1.00 42.05  ? 84  ILE C O   1 
ATOM   4908  C  CB  . ILE C  1 85  ? 57.622  5.563   -32.370  1.00 38.16  ? 84  ILE C CB  1 
ATOM   4909  C  CG1 . ILE C  1 85  ? 58.419  6.388   -31.355  1.00 35.03  ? 84  ILE C CG1 1 
ATOM   4910  C  CG2 . ILE C  1 85  ? 58.399  4.322   -32.792  1.00 34.24  ? 84  ILE C CG2 1 
ATOM   4911  C  CD1 . ILE C  1 85  ? 58.418  5.794   -29.959  1.00 34.66  ? 84  ILE C CD1 1 
ATOM   4912  N  N   . LYS C  1 86  ? 57.084  5.353   -35.749  1.00 36.11  ? 85  LYS C N   1 
ATOM   4913  C  CA  . LYS C  1 86  ? 56.452  4.478   -36.728  1.00 39.44  ? 85  LYS C CA  1 
ATOM   4914  C  C   . LYS C  1 86  ? 56.987  3.054   -36.637  1.00 35.27  ? 85  LYS C C   1 
ATOM   4915  O  O   . LYS C  1 86  ? 56.260  2.093   -36.876  1.00 38.64  ? 85  LYS C O   1 
ATOM   4916  C  CB  . LYS C  1 86  ? 56.657  5.016   -38.146  1.00 47.18  ? 85  LYS C CB  1 
ATOM   4917  C  CG  . LYS C  1 86  ? 55.607  6.011   -38.585  1.00 58.60  ? 85  LYS C CG  1 
ATOM   4918  C  CD  . LYS C  1 86  ? 55.324  5.862   -40.070  1.00 89.80  ? 85  LYS C CD  1 
ATOM   4919  C  CE  . LYS C  1 86  ? 54.017  6.535   -40.458  1.00 63.40  ? 85  LYS C CE  1 
ATOM   4920  N  NZ  . LYS C  1 86  ? 53.715  6.348   -41.905  1.00 79.19  ? 85  LYS C NZ  1 
ATOM   4921  N  N   . HIS C  1 87  ? 58.261  2.922   -36.296  1.00 38.65  ? 86  HIS C N   1 
ATOM   4922  C  CA  . HIS C  1 87  ? 58.901  1.612   -36.310  1.00 35.85  ? 86  HIS C CA  1 
ATOM   4923  C  C   . HIS C  1 87  ? 60.244  1.715   -35.604  1.00 39.02  ? 86  HIS C C   1 
ATOM   4924  O  O   . HIS C  1 87  ? 60.945  2.716   -35.727  1.00 40.38  ? 86  HIS C O   1 
ATOM   4925  C  CB  . HIS C  1 87  ? 59.095  1.140   -37.757  1.00 37.35  ? 86  HIS C CB  1 
ATOM   4926  C  CG  . HIS C  1 87  ? 59.070  -0.349  -37.926  1.00 51.38  ? 86  HIS C CG  1 
ATOM   4927  N  ND1 . HIS C  1 87  ? 59.619  -1.218  -37.008  1.00 76.92  ? 86  HIS C ND1 1 
ATOM   4928  C  CD2 . HIS C  1 87  ? 58.567  -1.122  -38.919  1.00 74.83  ? 86  HIS C CD2 1 
ATOM   4929  C  CE1 . HIS C  1 87  ? 59.454  -2.462  -37.426  1.00 51.39  ? 86  HIS C CE1 1 
ATOM   4930  N  NE2 . HIS C  1 87  ? 58.814  -2.431  -38.581  1.00 59.96  ? 86  HIS C NE2 1 
ATOM   4931  N  N   . PHE C  1 88  ? 60.586  0.680   -34.843  1.00 35.95  ? 87  PHE C N   1 
ATOM   4932  C  CA  . PHE C  1 88  ? 61.871  0.621   -34.149  1.00 38.57  ? 87  PHE C CA  1 
ATOM   4933  C  C   . PHE C  1 88  ? 62.352  -0.817  -34.149  1.00 39.26  ? 87  PHE C C   1 
ATOM   4934  O  O   . PHE C  1 88  ? 61.578  -1.740  -33.878  1.00 41.33  ? 87  PHE C O   1 
ATOM   4935  C  CB  . PHE C  1 88  ? 61.765  1.140   -32.709  1.00 30.60  ? 87  PHE C CB  1 
ATOM   4936  C  CG  . PHE C  1 88  ? 63.035  0.956   -31.896  1.00 35.44  ? 87  PHE C CG  1 
ATOM   4937  C  CD1 . PHE C  1 88  ? 64.074  1.865   -31.996  1.00 35.52  ? 87  PHE C CD1 1 
ATOM   4938  C  CD2 . PHE C  1 88  ? 63.184  -0.139  -31.041  1.00 35.84  ? 87  PHE C CD2 1 
ATOM   4939  C  CE1 . PHE C  1 88  ? 65.248  1.699   -31.260  1.00 31.78  ? 87  PHE C CE1 1 
ATOM   4940  C  CE2 . PHE C  1 88  ? 64.348  -0.314  -30.301  1.00 43.94  ? 87  PHE C CE2 1 
ATOM   4941  C  CZ  . PHE C  1 88  ? 65.383  0.606   -30.412  1.00 35.19  ? 87  PHE C CZ  1 
ATOM   4942  N  N   . ILE C  1 89  ? 63.619  -1.014  -34.483  1.00 35.19  ? 88  ILE C N   1 
ATOM   4943  C  CA  . ILE C  1 89  ? 64.197  -2.345  -34.476  1.00 35.12  ? 88  ILE C CA  1 
ATOM   4944  C  C   . ILE C  1 89  ? 65.476  -2.310  -33.653  1.00 48.17  ? 88  ILE C C   1 
ATOM   4945  O  O   . ILE C  1 89  ? 66.277  -1.379  -33.779  1.00 39.33  ? 88  ILE C O   1 
ATOM   4946  C  CB  . ILE C  1 89  ? 64.508  -2.835  -35.906  1.00 40.46  ? 88  ILE C CB  1 
ATOM   4947  C  CG1 . ILE C  1 89  ? 63.222  -2.962  -36.724  1.00 46.38  ? 88  ILE C CG1 1 
ATOM   4948  C  CG2 . ILE C  1 89  ? 65.237  -4.169  -35.878  1.00 45.25  ? 88  ILE C CG2 1 
ATOM   4949  C  CD1 . ILE C  1 89  ? 63.450  -3.310  -38.189  1.00 56.16  ? 88  ILE C CD1 1 
ATOM   4950  N  N   . ARG C  1 90  ? 65.646  -3.312  -32.794  1.00 40.73  ? 89  ARG C N   1 
ATOM   4951  C  CA  . ARG C  1 90  ? 66.878  -3.499  -32.041  1.00 37.06  ? 89  ARG C CA  1 
ATOM   4952  C  C   . ARG C  1 90  ? 67.422  -4.903  -32.285  1.00 48.05  ? 89  ARG C C   1 
ATOM   4953  O  O   . ARG C  1 90  ? 66.724  -5.893  -32.081  1.00 42.56  ? 89  ARG C O   1 
ATOM   4954  C  CB  . ARG C  1 90  ? 66.632  -3.283  -30.544  1.00 38.89  ? 89  ARG C CB  1 
ATOM   4955  C  CG  . ARG C  1 90  ? 67.873  -3.457  -29.660  1.00 45.27  ? 89  ARG C CG  1 
ATOM   4956  C  CD  . ARG C  1 90  ? 68.901  -2.355  -29.923  1.00 42.56  ? 89  ARG C CD  1 
ATOM   4957  N  NE  . ARG C  1 90  ? 69.868  -2.202  -28.837  1.00 51.24  ? 89  ARG C NE  1 
ATOM   4958  C  CZ  . ARG C  1 90  ? 71.148  -2.544  -28.921  1.00 55.22  ? 89  ARG C CZ  1 
ATOM   4959  N  NH1 . ARG C  1 90  ? 71.625  -3.059  -30.046  1.00 44.71  ? 89  ARG C NH1 1 
ATOM   4960  N  NH2 . ARG C  1 90  ? 71.954  -2.363  -27.885  1.00 48.07  ? 89  ARG C NH2 1 
ATOM   4961  N  N   . THR C  1 91  ? 68.663  -4.980  -32.756  1.00 37.45  ? 90  THR C N   1 
ATOM   4962  C  CA  . THR C  1 91  ? 69.391  -6.242  -32.845  1.00 34.05  ? 90  THR C CA  1 
ATOM   4963  C  C   . THR C  1 91  ? 70.585  -6.063  -31.911  1.00 42.84  ? 90  THR C C   1 
ATOM   4964  O  O   . THR C  1 91  ? 70.760  -4.960  -31.381  1.00 38.87  ? 90  THR C O   1 
ATOM   4965  C  CB  . THR C  1 91  ? 69.835  -6.557  -34.287  1.00 40.98  ? 90  THR C CB  1 
ATOM   4966  O  OG1 . THR C  1 91  ? 70.533  -5.431  -34.836  1.00 51.88  ? 90  THR C OG1 1 
ATOM   4967  C  CG2 . THR C  1 91  ? 68.636  -6.908  -35.155  1.00 51.49  ? 90  THR C CG2 1 
ATOM   4968  N  N   . PRO C  1 92  ? 71.390  -7.126  -31.681  1.00 40.55  ? 91  PRO C N   1 
ATOM   4969  C  CA  . PRO C  1 92  ? 72.470  -7.000  -30.690  1.00 47.93  ? 91  PRO C CA  1 
ATOM   4970  C  C   . PRO C  1 92  ? 73.387  -5.793  -30.871  1.00 41.44  ? 91  PRO C C   1 
ATOM   4971  O  O   . PRO C  1 92  ? 73.745  -5.173  -29.867  1.00 44.89  ? 91  PRO C O   1 
ATOM   4972  C  CB  . PRO C  1 92  ? 73.255  -8.302  -30.868  1.00 42.57  ? 91  PRO C CB  1 
ATOM   4973  C  CG  . PRO C  1 92  ? 72.205  -9.291  -31.253  1.00 49.80  ? 91  PRO C CG  1 
ATOM   4974  C  CD  . PRO C  1 92  ? 71.208  -8.536  -32.096  1.00 44.18  ? 91  PRO C CD  1 
ATOM   4975  N  N   . ASP C  1 93  ? 73.732  -5.442  -32.110  1.00 34.09  ? 92  ASP C N   1 
ATOM   4976  C  CA  . ASP C  1 93  ? 74.640  -4.313  -32.340  1.00 40.13  ? 92  ASP C CA  1 
ATOM   4977  C  C   . ASP C  1 93  ? 74.029  -3.120  -33.076  1.00 44.94  ? 92  ASP C C   1 
ATOM   4978  O  O   . ASP C  1 93  ? 74.739  -2.160  -33.382  1.00 40.05  ? 92  ASP C O   1 
ATOM   4979  C  CB  . ASP C  1 93  ? 75.897  -4.772  -33.094  1.00 43.83  ? 92  ASP C CB  1 
ATOM   4980  C  CG  . ASP C  1 93  ? 76.541  -5.988  -32.462  1.00 59.59  ? 92  ASP C CG  1 
ATOM   4981  O  OD1 . ASP C  1 93  ? 76.985  -5.895  -31.296  1.00 50.91  ? 92  ASP C OD1 1 
ATOM   4982  O  OD2 . ASP C  1 93  ? 76.601  -7.035  -33.133  1.00 58.02  ? 92  ASP C OD2 1 
ATOM   4983  N  N   . ASP C  1 94  ? 72.732  -3.171  -33.368  1.00 38.51  ? 93  ASP C N   1 
ATOM   4984  C  CA  . ASP C  1 94  ? 72.116  -2.118  -34.170  1.00 31.31  ? 93  ASP C CA  1 
ATOM   4985  C  C   . ASP C  1 94  ? 70.752  -1.702  -33.641  1.00 34.97  ? 93  ASP C C   1 
ATOM   4986  O  O   . ASP C  1 94  ? 70.031  -2.511  -33.056  1.00 34.89  ? 93  ASP C O   1 
ATOM   4987  C  CB  . ASP C  1 94  ? 71.964  -2.566  -35.621  1.00 36.69  ? 93  ASP C CB  1 
ATOM   4988  C  CG  . ASP C  1 94  ? 73.292  -2.737  -36.318  1.00 44.62  ? 93  ASP C CG  1 
ATOM   4989  O  OD1 . ASP C  1 94  ? 73.909  -3.816  -36.173  1.00 48.27  ? 93  ASP C OD1 1 
ATOM   4990  O  OD2 . ASP C  1 94  ? 73.716  -1.790  -37.008  1.00 44.10  ? 93  ASP C OD2 1 
ATOM   4991  N  N   . ALA C  1 95  ? 70.418  -0.434  -33.863  1.00 36.87  ? 94  ALA C N   1 
ATOM   4992  C  CA  . ALA C  1 95  ? 69.105  0.114   -33.532  1.00 37.61  ? 94  ALA C CA  1 
ATOM   4993  C  C   . ALA C  1 95  ? 68.638  1.003   -34.678  1.00 41.54  ? 94  ALA C C   1 
ATOM   4994  O  O   . ALA C  1 95  ? 69.391  1.859   -35.163  1.00 35.82  ? 94  ALA C O   1 
ATOM   4995  C  CB  . ALA C  1 95  ? 69.175  0.913   -32.240  1.00 30.58  ? 94  ALA C CB  1 
ATOM   4996  N  N   . TRP C  1 96  ? 67.410  0.781   -35.132  1.00 36.52  ? 95  TRP C N   1 
ATOM   4997  C  CA  . TRP C  1 96  ? 66.820  1.598   -36.187  1.00 33.23  ? 95  TRP C CA  1 
ATOM   4998  C  C   . TRP C  1 96  ? 65.565  2.278   -35.648  1.00 40.87  ? 95  TRP C C   1 
ATOM   4999  O  O   . TRP C  1 96  ? 64.686  1.621   -35.109  1.00 41.85  ? 95  TRP C O   1 
ATOM   5000  C  CB  . TRP C  1 96  ? 66.488  0.738   -37.409  1.00 33.95  ? 95  TRP C CB  1 
ATOM   5001  C  CG  . TRP C  1 96  ? 67.688  0.072   -38.036  1.00 44.77  ? 95  TRP C CG  1 
ATOM   5002  C  CD1 . TRP C  1 96  ? 68.282  -1.098  -37.645  1.00 38.55  ? 95  TRP C CD1 1 
ATOM   5003  C  CD2 . TRP C  1 96  ? 68.433  0.541   -39.168  1.00 52.39  ? 95  TRP C CD2 1 
ATOM   5004  N  NE1 . TRP C  1 96  ? 69.349  -1.384  -38.469  1.00 55.57  ? 95  TRP C NE1 1 
ATOM   5005  C  CE2 . TRP C  1 96  ? 69.463  -0.393  -39.410  1.00 49.98  ? 95  TRP C CE2 1 
ATOM   5006  C  CE3 . TRP C  1 96  ? 68.328  1.659   -40.001  1.00 53.09  ? 95  TRP C CE3 1 
ATOM   5007  C  CZ2 . TRP C  1 96  ? 70.385  -0.239  -40.450  1.00 47.88  ? 95  TRP C CZ2 1 
ATOM   5008  C  CZ3 . TRP C  1 96  ? 69.250  1.813   -41.037  1.00 54.20  ? 95  TRP C CZ3 1 
ATOM   5009  C  CH2 . TRP C  1 96  ? 70.261  0.868   -41.251  1.00 47.36  ? 95  TRP C CH2 1 
ATOM   5010  N  N   . LEU C  1 97  ? 65.488  3.595   -35.788  1.00 36.72  ? 96  LEU C N   1 
ATOM   5011  C  CA  . LEU C  1 97  ? 64.364  4.345   -35.255  1.00 33.88  ? 96  LEU C CA  1 
ATOM   5012  C  C   . LEU C  1 97  ? 63.736  5.197   -36.349  1.00 40.35  ? 96  LEU C C   1 
ATOM   5013  O  O   . LEU C  1 97  ? 64.348  6.142   -36.843  1.00 40.55  ? 96  LEU C O   1 
ATOM   5014  C  CB  . LEU C  1 97  ? 64.807  5.218   -34.080  1.00 36.10  ? 96  LEU C CB  1 
ATOM   5015  C  CG  . LEU C  1 97  ? 63.723  6.114   -33.470  1.00 36.21  ? 96  LEU C CG  1 
ATOM   5016  C  CD1 . LEU C  1 97  ? 62.463  5.310   -33.100  1.00 31.88  ? 96  LEU C CD1 1 
ATOM   5017  C  CD2 . LEU C  1 97  ? 64.278  6.886   -32.277  1.00 35.89  ? 96  LEU C CD2 1 
ATOM   5018  N  N   . LEU C  1 98  ? 62.506  4.847   -36.716  1.00 39.58  ? 97  LEU C N   1 
ATOM   5019  C  CA  . LEU C  1 98  ? 61.787  5.518   -37.784  1.00 39.47  ? 97  LEU C CA  1 
ATOM   5020  C  C   . LEU C  1 98  ? 60.668  6.359   -37.179  1.00 41.93  ? 97  LEU C C   1 
ATOM   5021  O  O   . LEU C  1 98  ? 59.771  5.837   -36.523  1.00 35.60  ? 97  LEU C O   1 
ATOM   5022  C  CB  . LEU C  1 98  ? 61.201  4.479   -38.749  1.00 36.10  ? 97  LEU C CB  1 
ATOM   5023  C  CG  . LEU C  1 98  ? 60.433  4.989   -39.979  1.00 38.42  ? 97  LEU C CG  1 
ATOM   5024  C  CD1 . LEU C  1 98  ? 61.338  5.813   -40.904  1.00 35.59  ? 97  LEU C CD1 1 
ATOM   5025  C  CD2 . LEU C  1 98  ? 59.768  3.837   -40.734  1.00 39.23  ? 97  LEU C CD2 1 
ATOM   5026  N  N   . THR C  1 99  ? 60.724  7.661   -37.410  1.00 39.45  ? 98  THR C N   1 
ATOM   5027  C  CA  . THR C  1 99  ? 59.771  8.588   -36.827  1.00 35.97  ? 98  THR C CA  1 
ATOM   5028  C  C   . THR C  1 99  ? 59.196  9.482   -37.913  1.00 35.27  ? 98  THR C C   1 
ATOM   5029  O  O   . THR C  1 99  ? 59.801  9.640   -38.976  1.00 40.10  ? 98  THR C O   1 
ATOM   5030  C  CB  . THR C  1 99  ? 60.428  9.458   -35.721  1.00 39.50  ? 98  THR C CB  1 
ATOM   5031  O  OG1 . THR C  1 99  ? 61.512  10.225  -36.276  1.00 38.22  ? 98  THR C OG1 1 
ATOM   5032  C  CG2 . THR C  1 99  ? 60.974  8.580   -34.598  1.00 37.30  ? 98  THR C CG2 1 
ATOM   5033  N  N   . THR C  1 100 ? 58.007  10.028  -37.664  1.00 35.67  ? 99  THR C N   1 
ATOM   5034  C  CA  . THR C  1 100 ? 57.421  11.020  -38.564  1.00 34.26  ? 99  THR C CA  1 
ATOM   5035  C  C   . THR C  1 100 ? 58.093  12.362  -38.301  1.00 37.49  ? 99  THR C C   1 
ATOM   5036  O  O   . THR C  1 100 ? 58.410  12.691  -37.159  1.00 54.11  ? 99  THR C O   1 
ATOM   5037  C  CB  . THR C  1 100 ? 55.930  11.213  -38.304  1.00 40.40  ? 99  THR C CB  1 
ATOM   5038  O  OG1 . THR C  1 100 ? 55.752  11.729  -36.976  1.00 52.13  ? 99  THR C OG1 1 
ATOM   5039  C  CG2 . THR C  1 100 ? 55.174  9.898   -38.471  1.00 42.33  ? 99  THR C CG2 1 
ATOM   5040  N  N   . ALA C  1 101 ? 58.315  13.136  -39.356  1.00 41.49  ? 100 ALA C N   1 
ATOM   5041  C  CA  . ALA C  1 101 ? 58.928  14.446  -39.199  1.00 44.87  ? 100 ALA C CA  1 
ATOM   5042  C  C   . ALA C  1 101 ? 57.914  15.425  -38.627  1.00 51.81  ? 100 ALA C C   1 
ATOM   5043  O  O   . ALA C  1 101 ? 56.735  15.368  -38.952  1.00 49.69  ? 100 ALA C O   1 
ATOM   5044  C  CB  . ALA C  1 101 ? 59.442  14.951  -40.540  1.00 46.05  ? 100 ALA C CB  1 
ATOM   5045  N  N   . ILE C  1 102 ? 58.365  16.317  -37.759  1.00 36.77  ? 101 ILE C N   1 
ATOM   5046  C  CA  . ILE C  1 102 ? 57.549  17.471  -37.413  1.00 41.33  ? 101 ILE C CA  1 
ATOM   5047  C  C   . ILE C  1 102 ? 57.853  18.501  -38.484  1.00 46.37  ? 101 ILE C C   1 
ATOM   5048  O  O   . ILE C  1 102 ? 59.015  18.851  -38.678  1.00 40.08  ? 101 ILE C O   1 
ATOM   5049  C  CB  . ILE C  1 102 ? 57.926  18.022  -36.025  1.00 47.37  ? 101 ILE C CB  1 
ATOM   5050  C  CG1 . ILE C  1 102 ? 57.583  17.004  -34.937  1.00 46.55  ? 101 ILE C CG1 1 
ATOM   5051  C  CG2 . ILE C  1 102 ? 57.226  19.339  -35.758  1.00 45.82  ? 101 ILE C CG2 1 
ATOM   5052  C  CD1 . ILE C  1 102 ? 58.065  17.421  -33.572  1.00 55.56  ? 101 ILE C CD1 1 
ATOM   5053  N  N   . PRO C  1 103 ? 56.821  18.960  -39.220  1.00 44.31  ? 102 PRO C N   1 
ATOM   5054  C  CA  . PRO C  1 103 ? 57.063  19.955  -40.272  1.00 39.66  ? 102 PRO C CA  1 
ATOM   5055  C  C   . PRO C  1 103 ? 57.591  21.269  -39.705  1.00 51.57  ? 102 PRO C C   1 
ATOM   5056  O  O   . PRO C  1 103 ? 57.277  21.610  -38.568  1.00 41.60  ? 102 PRO C O   1 
ATOM   5057  C  CB  . PRO C  1 103 ? 55.668  20.174  -40.873  1.00 47.72  ? 102 PRO C CB  1 
ATOM   5058  C  CG  . PRO C  1 103 ? 54.717  19.765  -39.790  1.00 65.05  ? 102 PRO C CG  1 
ATOM   5059  C  CD  . PRO C  1 103 ? 55.393  18.614  -39.105  1.00 48.00  ? 102 PRO C CD  1 
ATOM   5060  N  N   . GLY C  1 104 ? 58.388  21.998  -40.478  1.00 36.76  ? 103 GLY C N   1 
ATOM   5061  C  CA  . GLY C  1 104 ? 58.857  23.292  -40.019  1.00 37.51  ? 103 GLY C CA  1 
ATOM   5062  C  C   . GLY C  1 104 ? 60.364  23.483  -39.952  1.00 48.88  ? 103 GLY C C   1 
ATOM   5063  O  O   . GLY C  1 104 ? 61.134  22.753  -40.580  1.00 41.22  ? 103 GLY C O   1 
ATOM   5064  N  N   . LYS C  1 105 ? 60.781  24.482  -39.183  1.00 36.12  ? 104 LYS C N   1 
ATOM   5065  C  CA  . LYS C  1 105 ? 62.189  24.842  -39.086  1.00 41.54  ? 104 LYS C CA  1 
ATOM   5066  C  C   . LYS C  1 105 ? 62.595  24.891  -37.632  1.00 39.35  ? 104 LYS C C   1 
ATOM   5067  O  O   . LYS C  1 105 ? 61.752  25.086  -36.758  1.00 36.39  ? 104 LYS C O   1 
ATOM   5068  C  CB  . LYS C  1 105 ? 62.431  26.209  -39.733  1.00 37.94  ? 104 LYS C CB  1 
ATOM   5069  C  CG  . LYS C  1 105 ? 62.172  26.227  -41.225  1.00 40.07  ? 104 LYS C CG  1 
ATOM   5070  C  CD  . LYS C  1 105 ? 62.128  27.654  -41.770  1.00 49.48  ? 104 LYS C CD  1 
ATOM   5071  C  CE  . LYS C  1 105 ? 61.949  27.653  -43.286  1.00 59.24  ? 104 LYS C CE  1 
ATOM   5072  N  NZ  . LYS C  1 105 ? 61.824  29.035  -43.835  1.00 57.28  ? 104 LYS C NZ  1 
ATOM   5073  N  N   . THR C  1 106 ? 63.885  24.714  -37.362  1.00 34.09  ? 105 THR C N   1 
ATOM   5074  C  CA  . THR C  1 106 ? 64.368  24.818  -35.986  1.00 27.43  ? 105 THR C CA  1 
ATOM   5075  C  C   . THR C  1 106 ? 64.297  26.261  -35.533  1.00 31.64  ? 105 THR C C   1 
ATOM   5076  O  O   . THR C  1 106 ? 64.292  27.170  -36.368  1.00 34.22  ? 105 THR C O   1 
ATOM   5077  C  CB  . THR C  1 106 ? 65.802  24.303  -35.855  1.00 42.27  ? 105 THR C CB  1 
ATOM   5078  O  OG1 . THR C  1 106 ? 66.695  25.215  -36.512  1.00 37.48  ? 105 THR C OG1 1 
ATOM   5079  C  CG2 . THR C  1 106 ? 65.914  22.936  -36.511  1.00 35.07  ? 105 THR C CG2 1 
ATOM   5080  N  N   . ALA C  1 107 ? 64.232  26.465  -34.215  1.00 28.31  ? 106 ALA C N   1 
ATOM   5081  C  CA  . ALA C  1 107 ? 64.232  27.809  -33.641  1.00 36.32  ? 106 ALA C CA  1 
ATOM   5082  C  C   . ALA C  1 107 ? 65.456  28.558  -34.145  1.00 33.06  ? 106 ALA C C   1 
ATOM   5083  O  O   . ALA C  1 107 ? 65.393  29.758  -34.434  1.00 33.81  ? 106 ALA C O   1 
ATOM   5084  C  CB  . ALA C  1 107 ? 64.236  27.751  -32.110  1.00 31.21  ? 106 ALA C CB  1 
ATOM   5085  N  N   . PHE C  1 108 ? 66.574  27.840  -34.247  1.00 32.54  ? 107 PHE C N   1 
ATOM   5086  C  CA  . PHE C  1 108 ? 67.813  28.443  -34.726  1.00 34.70  ? 107 PHE C CA  1 
ATOM   5087  C  C   . PHE C  1 108 ? 67.610  28.974  -36.135  1.00 39.78  ? 107 PHE C C   1 
ATOM   5088  O  O   . PHE C  1 108 ? 67.975  30.115  -36.438  1.00 36.50  ? 107 PHE C O   1 
ATOM   5089  C  CB  . PHE C  1 108 ? 68.974  27.434  -34.661  1.00 30.28  ? 107 PHE C CB  1 
ATOM   5090  C  CG  . PHE C  1 108 ? 70.303  28.005  -35.112  1.00 34.06  ? 107 PHE C CG  1 
ATOM   5091  C  CD1 . PHE C  1 108 ? 71.113  28.694  -34.220  1.00 35.14  ? 107 PHE C CD1 1 
ATOM   5092  C  CD2 . PHE C  1 108 ? 70.734  27.850  -36.425  1.00 38.75  ? 107 PHE C CD2 1 
ATOM   5093  C  CE1 . PHE C  1 108 ? 72.330  29.225  -34.629  1.00 36.95  ? 107 PHE C CE1 1 
ATOM   5094  C  CE2 . PHE C  1 108 ? 71.952  28.387  -36.845  1.00 39.98  ? 107 PHE C CE2 1 
ATOM   5095  C  CZ  . PHE C  1 108 ? 72.748  29.068  -35.943  1.00 44.82  ? 107 PHE C CZ  1 
ATOM   5096  N  N   . GLN C  1 109 ? 67.000  28.166  -37.000  1.00 35.87  ? 108 GLN C N   1 
ATOM   5097  C  CA  . GLN C  1 109 ? 66.759  28.591  -38.380  1.00 31.59  ? 108 GLN C CA  1 
ATOM   5098  C  C   . GLN C  1 109 ? 65.842  29.805  -38.477  1.00 33.35  ? 108 GLN C C   1 
ATOM   5099  O  O   . GLN C  1 109 ? 66.113  30.730  -39.235  1.00 38.21  ? 108 GLN C O   1 
ATOM   5100  C  CB  . GLN C  1 109 ? 66.156  27.458  -39.212  1.00 44.85  ? 108 GLN C CB  1 
ATOM   5101  C  CG  . GLN C  1 109 ? 67.083  26.291  -39.484  1.00 46.61  ? 108 GLN C CG  1 
ATOM   5102  C  CD  . GLN C  1 109 ? 66.398  25.185  -40.276  1.00 69.31  ? 108 GLN C CD  1 
ATOM   5103  O  OE1 . GLN C  1 109 ? 65.509  24.492  -39.768  1.00 39.22  ? 108 GLN C OE1 1 
ATOM   5104  N  NE2 . GLN C  1 109 ? 66.797  25.027  -41.531  1.00 59.62  ? 108 GLN C NE2 1 
ATOM   5105  N  N   . VAL C  1 110 ? 64.741  29.796  -37.728  1.00 32.77  ? 109 VAL C N   1 
ATOM   5106  C  CA  A VAL C  1 110 ? 63.780  30.891  -37.837  0.37 35.65  ? 109 VAL C CA  1 
ATOM   5107  C  CA  B VAL C  1 110 ? 63.758  30.880  -37.789  0.63 31.93  ? 109 VAL C CA  1 
ATOM   5108  C  C   . VAL C  1 110 ? 64.350  32.180  -37.256  1.00 33.38  ? 109 VAL C C   1 
ATOM   5109  O  O   . VAL C  1 110 ? 64.036  33.264  -37.729  1.00 38.75  ? 109 VAL C O   1 
ATOM   5110  C  CB  A VAL C  1 110 ? 62.408  30.550  -37.200  0.37 47.26  ? 109 VAL C CB  1 
ATOM   5111  C  CB  B VAL C  1 110 ? 62.479  30.523  -36.989  0.63 37.31  ? 109 VAL C CB  1 
ATOM   5112  C  CG1 A VAL C  1 110 ? 61.777  29.355  -37.909  0.37 40.70  ? 109 VAL C CG1 1 
ATOM   5113  C  CG1 B VAL C  1 110 ? 61.473  31.657  -37.039  0.63 36.95  ? 109 VAL C CG1 1 
ATOM   5114  C  CG2 A VAL C  1 110 ? 62.551  30.281  -35.717  0.37 37.49  ? 109 VAL C CG2 1 
ATOM   5115  C  CG2 B VAL C  1 110 ? 61.866  29.229  -37.525  0.63 42.03  ? 109 VAL C CG2 1 
ATOM   5116  N  N   . LEU C  1 111 ? 65.208  32.059  -36.253  1.00 34.74  ? 110 LEU C N   1 
ATOM   5117  C  CA  . LEU C  1 111 ? 65.839  33.235  -35.669  1.00 37.42  ? 110 LEU C CA  1 
ATOM   5118  C  C   . LEU C  1 111 ? 66.814  33.879  -36.670  1.00 37.07  ? 110 LEU C C   1 
ATOM   5119  O  O   . LEU C  1 111 ? 66.899  35.118  -36.781  1.00 35.28  ? 110 LEU C O   1 
ATOM   5120  C  CB  . LEU C  1 111 ? 66.521  32.827  -34.356  1.00 31.19  ? 110 LEU C CB  1 
ATOM   5121  C  CG  . LEU C  1 111 ? 67.176  33.869  -33.456  1.00 64.15  ? 110 LEU C CG  1 
ATOM   5122  C  CD1 . LEU C  1 111 ? 66.233  35.032  -33.225  1.00 63.95  ? 110 LEU C CD1 1 
ATOM   5123  C  CD2 . LEU C  1 111 ? 67.562  33.220  -32.132  1.00 52.62  ? 110 LEU C CD2 1 
ATOM   5124  N  N   . GLU C  1 112 ? 67.532  33.053  -37.425  1.00 31.91  ? 111 GLU C N   1 
ATOM   5125  C  CA  . GLU C  1 112 ? 68.398  33.582  -38.479  1.00 33.62  ? 111 GLU C CA  1 
ATOM   5126  C  C   . GLU C  1 112 ? 67.591  34.200  -39.612  1.00 45.16  ? 111 GLU C C   1 
ATOM   5127  O  O   . GLU C  1 112 ? 67.950  35.244  -40.146  1.00 38.71  ? 111 GLU C O   1 
ATOM   5128  C  CB  . GLU C  1 112 ? 69.342  32.499  -39.010  1.00 37.79  ? 111 GLU C CB  1 
ATOM   5129  C  CG  . GLU C  1 112 ? 70.303  32.030  -37.944  1.00 36.67  ? 111 GLU C CG  1 
ATOM   5130  C  CD  . GLU C  1 112 ? 71.583  31.425  -38.490  1.00 49.44  ? 111 GLU C CD  1 
ATOM   5131  O  OE1 . GLU C  1 112 ? 71.559  30.855  -39.603  1.00 44.17  ? 111 GLU C OE1 1 
ATOM   5132  O  OE2 . GLU C  1 112 ? 72.618  31.528  -37.791  1.00 52.78  ? 111 GLU C OE2 1 
ATOM   5133  N  N   . GLU C  1 113 ? 66.480  33.561  -39.957  1.00 37.11  ? 112 GLU C N   1 
ATOM   5134  C  CA  . GLU C  1 113 ? 65.644  34.020  -41.052  1.00 38.15  ? 112 GLU C CA  1 
ATOM   5135  C  C   . GLU C  1 113 ? 64.804  35.252  -40.681  1.00 38.96  ? 112 GLU C C   1 
ATOM   5136  O  O   . GLU C  1 113 ? 64.519  36.094  -41.528  1.00 36.90  ? 112 GLU C O   1 
ATOM   5137  C  CB  . GLU C  1 113 ? 64.757  32.864  -41.515  1.00 50.81  ? 112 GLU C CB  1 
ATOM   5138  C  CG  . GLU C  1 113 ? 63.813  33.172  -42.658  1.00 60.47  ? 112 GLU C CG  1 
ATOM   5139  C  CD  . GLU C  1 113 ? 63.060  31.931  -43.096  1.00 81.94  ? 112 GLU C CD  1 
ATOM   5140  O  OE1 . GLU C  1 113 ? 63.638  30.827  -42.987  1.00 67.20  ? 112 GLU C OE1 1 
ATOM   5141  O  OE2 . GLU C  1 113 ? 61.896  32.052  -43.533  1.00 74.51  ? 112 GLU C OE2 1 
ATOM   5142  N  N   . TYR C  1 114 ? 64.412  35.352  -39.417  1.00 36.29  ? 113 TYR C N   1 
ATOM   5143  C  CA  . TYR C  1 114 ? 63.631  36.497  -38.946  1.00 39.68  ? 113 TYR C CA  1 
ATOM   5144  C  C   . TYR C  1 114 ? 64.290  37.133  -37.719  1.00 31.99  ? 113 TYR C C   1 
ATOM   5145  O  O   . TYR C  1 114 ? 63.791  36.997  -36.596  1.00 39.26  ? 113 TYR C O   1 
ATOM   5146  C  CB  . TYR C  1 114 ? 62.201  36.063  -38.596  1.00 35.72  ? 113 TYR C CB  1 
ATOM   5147  C  CG  . TYR C  1 114 ? 61.491  35.346  -39.722  1.00 46.05  ? 113 TYR C CG  1 
ATOM   5148  C  CD1 . TYR C  1 114 ? 60.860  36.059  -40.739  1.00 46.82  ? 113 TYR C CD1 1 
ATOM   5149  C  CD2 . TYR C  1 114 ? 61.452  33.957  -39.767  1.00 50.66  ? 113 TYR C CD2 1 
ATOM   5150  C  CE1 . TYR C  1 114 ? 60.209  35.405  -41.772  1.00 54.80  ? 113 TYR C CE1 1 
ATOM   5151  C  CE2 . TYR C  1 114 ? 60.798  33.292  -40.794  1.00 63.93  ? 113 TYR C CE2 1 
ATOM   5152  C  CZ  . TYR C  1 114 ? 60.178  34.019  -41.792  1.00 58.50  ? 113 TYR C CZ  1 
ATOM   5153  O  OH  . TYR C  1 114 ? 59.533  33.359  -42.816  1.00 76.28  ? 113 TYR C OH  1 
ATOM   5154  N  N   . PRO C  1 115 ? 65.419  37.825  -37.926  1.00 39.25  ? 114 PRO C N   1 
ATOM   5155  C  CA  . PRO C  1 115 ? 66.144  38.416  -36.797  1.00 40.92  ? 114 PRO C CA  1 
ATOM   5156  C  C   . PRO C  1 115 ? 65.284  39.347  -35.932  1.00 45.85  ? 114 PRO C C   1 
ATOM   5157  O  O   . PRO C  1 115 ? 65.517  39.421  -34.728  1.00 47.00  ? 114 PRO C O   1 
ATOM   5158  C  CB  . PRO C  1 115 ? 67.301  39.181  -37.472  1.00 40.49  ? 114 PRO C CB  1 
ATOM   5159  C  CG  . PRO C  1 115 ? 66.945  39.257  -38.926  1.00 45.71  ? 114 PRO C CG  1 
ATOM   5160  C  CD  . PRO C  1 115 ? 66.113  38.043  -39.204  1.00 42.65  ? 114 PRO C CD  1 
ATOM   5161  N  N   . ASP C  1 116 ? 64.302  40.026  -36.521  1.00 35.89  ? 115 ASP C N   1 
ATOM   5162  C  CA  . ASP C  1 116 ? 63.423  40.897  -35.741  1.00 42.86  ? 115 ASP C CA  1 
ATOM   5163  C  C   . ASP C  1 116 ? 62.479  40.134  -34.816  1.00 60.13  ? 115 ASP C C   1 
ATOM   5164  O  O   . ASP C  1 116 ? 61.879  40.728  -33.922  1.00 51.74  ? 115 ASP C O   1 
ATOM   5165  C  CB  . ASP C  1 116 ? 62.576  41.785  -36.652  1.00 42.83  ? 115 ASP C CB  1 
ATOM   5166  C  CG  . ASP C  1 116 ? 63.410  42.739  -37.478  1.00 53.10  ? 115 ASP C CG  1 
ATOM   5167  O  OD1 . ASP C  1 116 ? 64.371  43.318  -36.929  1.00 69.54  ? 115 ASP C OD1 1 
ATOM   5168  O  OD2 . ASP C  1 116 ? 63.104  42.903  -38.678  1.00 87.16  ? 115 ASP C OD2 1 
ATOM   5169  N  N   . SER C  1 117 ? 62.326  38.833  -35.043  1.00 38.31  ? 116 SER C N   1 
ATOM   5170  C  CA  . SER C  1 117 ? 61.351  38.040  -34.292  1.00 38.87  ? 116 SER C CA  1 
ATOM   5171  C  C   . SER C  1 117 ? 61.961  37.365  -33.066  1.00 47.97  ? 116 SER C C   1 
ATOM   5172  O  O   . SER C  1 117 ? 61.310  36.555  -32.399  1.00 40.73  ? 116 SER C O   1 
ATOM   5173  C  CB  . SER C  1 117 ? 60.672  37.013  -35.205  1.00 59.35  ? 116 SER C CB  1 
ATOM   5174  O  OG  . SER C  1 117 ? 59.849  37.662  -36.170  1.00 54.19  ? 116 SER C OG  1 
ATOM   5175  N  N   . GLY C  1 118 ? 63.204  37.726  -32.765  1.00 40.37  ? 117 GLY C N   1 
ATOM   5176  C  CA  . GLY C  1 118 ? 63.932  37.131  -31.655  1.00 42.39  ? 117 GLY C CA  1 
ATOM   5177  C  C   . GLY C  1 118 ? 63.194  37.143  -30.325  1.00 37.97  ? 117 GLY C C   1 
ATOM   5178  O  O   . GLY C  1 118 ? 63.203  36.153  -29.592  1.00 32.39  ? 117 GLY C O   1 
ATOM   5179  N  N   . GLU C  1 119 ? 62.553  38.262  -30.012  1.00 35.92  ? 118 GLU C N   1 
ATOM   5180  C  CA  . GLU C  1 119 ? 61.868  38.400  -28.727  1.00 43.80  ? 118 GLU C CA  1 
ATOM   5181  C  C   . GLU C  1 119 ? 60.664  37.466  -28.645  1.00 42.31  ? 118 GLU C C   1 
ATOM   5182  O  O   . GLU C  1 119 ? 60.420  36.825  -27.617  1.00 37.59  ? 118 GLU C O   1 
ATOM   5183  C  CB  . GLU C  1 119 ? 61.449  39.858  -28.492  1.00 43.08  ? 118 GLU C CB  1 
ATOM   5184  C  CG  . GLU C  1 119 ? 62.616  40.823  -28.232  1.00 60.01  ? 118 GLU C CG  1 
ATOM   5185  C  CD  . GLU C  1 119 ? 63.381  41.236  -29.493  1.00 88.39  ? 118 GLU C CD  1 
ATOM   5186  O  OE1 . GLU C  1 119 ? 62.858  41.070  -30.623  1.00 53.74  ? 118 GLU C OE1 1 
ATOM   5187  O  OE2 . GLU C  1 119 ? 64.516  41.737  -29.348  1.00 69.07  ? 118 GLU C OE2 1 
ATOM   5188  N  N   . ASN C  1 120 ? 59.899  37.398  -29.728  1.00 32.36  ? 119 ASN C N   1 
ATOM   5189  C  CA  . ASN C  1 120 ? 58.737  36.517  -29.777  1.00 35.29  ? 119 ASN C CA  1 
ATOM   5190  C  C   . ASN C  1 120 ? 59.155  35.049  -29.729  1.00 39.95  ? 119 ASN C C   1 
ATOM   5191  O  O   . ASN C  1 120 ? 58.474  34.218  -29.120  1.00 33.71  ? 119 ASN C O   1 
ATOM   5192  C  CB  . ASN C  1 120 ? 57.882  36.798  -31.027  1.00 38.75  ? 119 ASN C CB  1 
ATOM   5193  C  CG  . ASN C  1 120 ? 57.196  38.156  -30.976  1.00 82.51  ? 119 ASN C CG  1 
ATOM   5194  O  OD1 . ASN C  1 120 ? 56.917  38.686  -29.899  1.00 73.47  ? 119 ASN C OD1 1 
ATOM   5195  N  ND2 . ASN C  1 120 ? 56.917  38.722  -32.146  1.00 60.67  ? 119 ASN C ND2 1 
ATOM   5196  N  N   . ILE C  1 121 ? 60.276  34.732  -30.368  1.00 32.83  ? 120 ILE C N   1 
ATOM   5197  C  CA  . ILE C  1 121 ? 60.803  33.371  -30.347  1.00 29.65  ? 120 ILE C CA  1 
ATOM   5198  C  C   . ILE C  1 121 ? 61.212  32.946  -28.928  1.00 35.94  ? 120 ILE C C   1 
ATOM   5199  O  O   . ILE C  1 121 ? 60.874  31.843  -28.482  1.00 32.13  ? 120 ILE C O   1 
ATOM   5200  C  CB  . ILE C  1 121 ? 62.001  33.220  -31.323  1.00 31.40  ? 120 ILE C CB  1 
ATOM   5201  C  CG1 . ILE C  1 121 ? 61.517  33.287  -32.772  1.00 40.95  ? 120 ILE C CG1 1 
ATOM   5202  C  CG2 . ILE C  1 121 ? 62.753  31.919  -31.053  1.00 33.60  ? 120 ILE C CG2 1 
ATOM   5203  C  CD1 . ILE C  1 121 ? 62.609  33.626  -33.777  1.00 34.97  ? 120 ILE C CD1 1 
ATOM   5204  N  N   . VAL C  1 122 ? 61.924  33.825  -28.218  1.00 31.88  ? 121 VAL C N   1 
ATOM   5205  C  CA  . VAL C  1 122 ? 62.353  33.521  -26.848  1.00 32.36  ? 121 VAL C CA  1 
ATOM   5206  C  C   . VAL C  1 122 ? 61.151  33.372  -25.914  1.00 27.75  ? 121 VAL C C   1 
ATOM   5207  O  O   . VAL C  1 122 ? 61.092  32.432  -25.124  1.00 29.94  ? 121 VAL C O   1 
ATOM   5208  C  CB  . VAL C  1 122 ? 63.328  34.587  -26.292  1.00 31.61  ? 121 VAL C CB  1 
ATOM   5209  C  CG1 . VAL C  1 122 ? 63.570  34.400  -24.793  1.00 37.11  ? 121 VAL C CG1 1 
ATOM   5210  C  CG2 . VAL C  1 122 ? 64.654  34.544  -27.067  1.00 33.30  ? 121 VAL C CG2 1 
ATOM   5211  N  N   . ASP C  1 123 ? 60.180  34.276  -26.017  1.00 30.51  ? 122 ASP C N   1 
ATOM   5212  C  CA  . ASP C  1 123 ? 58.986  34.134  -25.194  1.00 33.58  ? 122 ASP C CA  1 
ATOM   5213  C  C   . ASP C  1 123 ? 58.302  32.785  -25.437  1.00 30.71  ? 122 ASP C C   1 
ATOM   5214  O  O   . ASP C  1 123 ? 57.858  32.136  -24.484  1.00 32.91  ? 122 ASP C O   1 
ATOM   5215  C  CB  . ASP C  1 123 ? 57.981  35.255  -25.449  1.00 33.10  ? 122 ASP C CB  1 
ATOM   5216  C  CG  . ASP C  1 123 ? 58.435  36.599  -24.901  1.00 58.32  ? 122 ASP C CG  1 
ATOM   5217  O  OD1 . ASP C  1 123 ? 59.510  36.666  -24.271  1.00 39.52  ? 122 ASP C OD1 1 
ATOM   5218  O  OD2 . ASP C  1 123 ? 57.699  37.596  -25.091  1.00 44.04  ? 122 ASP C OD2 1 
ATOM   5219  N  N   . ALA C  1 124 ? 58.206  32.362  -26.698  1.00 32.06  ? 123 ALA C N   1 
ATOM   5220  C  CA  . ALA C  1 124 ? 57.568  31.072  -27.007  1.00 32.40  ? 123 ALA C CA  1 
ATOM   5221  C  C   . ALA C  1 124 ? 58.346  29.909  -26.414  1.00 34.97  ? 123 ALA C C   1 
ATOM   5222  O  O   . ALA C  1 124 ? 57.753  28.952  -25.904  1.00 31.13  ? 123 ALA C O   1 
ATOM   5223  C  CB  . ALA C  1 124 ? 57.383  30.881  -28.521  1.00 35.73  ? 123 ALA C CB  1 
ATOM   5224  N  N   . LEU C  1 125 ? 59.673  29.989  -26.487  1.00 30.67  ? 124 LEU C N   1 
ATOM   5225  C  CA  . LEU C  1 125 ? 60.528  28.944  -25.937  1.00 33.18  ? 124 LEU C CA  1 
ATOM   5226  C  C   . LEU C  1 125 ? 60.366  28.866  -24.423  1.00 33.66  ? 124 LEU C C   1 
ATOM   5227  O  O   . LEU C  1 125 ? 60.324  27.777  -23.856  1.00 35.87  ? 124 LEU C O   1 
ATOM   5228  C  CB  . LEU C  1 125 ? 62.005  29.209  -26.274  1.00 27.68  ? 124 LEU C CB  1 
ATOM   5229  C  CG  . LEU C  1 125 ? 62.427  29.113  -27.745  1.00 34.88  ? 124 LEU C CG  1 
ATOM   5230  C  CD1 . LEU C  1 125 ? 63.821  29.744  -27.989  1.00 28.60  ? 124 LEU C CD1 1 
ATOM   5231  C  CD2 . LEU C  1 125 ? 62.401  27.665  -28.206  1.00 44.01  ? 124 LEU C CD2 1 
ATOM   5232  N  N   . ALA C  1 126 ? 60.296  30.027  -23.772  1.00 30.02  ? 125 ALA C N   1 
ATOM   5233  C  CA  . ALA C  1 126 ? 60.172  30.071  -22.311  1.00 30.76  ? 125 ALA C CA  1 
ATOM   5234  C  C   . ALA C  1 126 ? 58.847  29.458  -21.850  1.00 39.86  ? 125 ALA C C   1 
ATOM   5235  O  O   . ALA C  1 126 ? 58.797  28.704  -20.875  1.00 30.64  ? 125 ALA C O   1 
ATOM   5236  C  CB  . ALA C  1 126 ? 60.308  31.501  -21.803  1.00 31.68  ? 125 ALA C CB  1 
ATOM   5237  N  N   . VAL C  1 127 ? 57.775  29.785  -22.560  1.00 33.01  ? 126 VAL C N   1 
ATOM   5238  C  CA  . VAL C  1 127 ? 56.450  29.251  -22.254  1.00 29.19  ? 126 VAL C CA  1 
ATOM   5239  C  C   . VAL C  1 127 ? 56.387  27.727  -22.451  1.00 30.81  ? 126 VAL C C   1 
ATOM   5240  O  O   . VAL C  1 127 ? 55.810  26.985  -21.637  1.00 29.72  ? 126 VAL C O   1 
ATOM   5241  C  CB  . VAL C  1 127 ? 55.389  29.929  -23.143  1.00 30.99  ? 126 VAL C CB  1 
ATOM   5242  C  CG1 . VAL C  1 127 ? 54.059  29.182  -23.060  1.00 33.86  ? 126 VAL C CG1 1 
ATOM   5243  C  CG2 . VAL C  1 127 ? 55.227  31.386  -22.718  1.00 29.85  ? 126 VAL C CG2 1 
ATOM   5244  N  N   . PHE C  1 128 ? 56.971  27.267  -23.547  1.00 28.89  ? 127 PHE C N   1 
ATOM   5245  C  CA  . PHE C  1 128 ? 57.017  25.846  -23.852  1.00 32.82  ? 127 PHE C CA  1 
ATOM   5246  C  C   . PHE C  1 128 ? 57.830  25.108  -22.794  1.00 30.28  ? 127 PHE C C   1 
ATOM   5247  O  O   . PHE C  1 128 ? 57.492  23.992  -22.385  1.00 30.32  ? 127 PHE C O   1 
ATOM   5248  C  CB  . PHE C  1 128 ? 57.662  25.645  -25.221  1.00 33.09  ? 127 PHE C CB  1 
ATOM   5249  C  CG  . PHE C  1 128 ? 57.595  24.235  -25.724  1.00 31.93  ? 127 PHE C CG  1 
ATOM   5250  C  CD1 . PHE C  1 128 ? 56.457  23.773  -26.377  1.00 42.68  ? 127 PHE C CD1 1 
ATOM   5251  C  CD2 . PHE C  1 128 ? 58.663  23.376  -25.560  1.00 33.67  ? 127 PHE C CD2 1 
ATOM   5252  C  CE1 . PHE C  1 128 ? 56.381  22.469  -26.850  1.00 42.39  ? 127 PHE C CE1 1 
ATOM   5253  C  CE2 . PHE C  1 128 ? 58.599  22.068  -26.035  1.00 40.43  ? 127 PHE C CE2 1 
ATOM   5254  C  CZ  . PHE C  1 128 ? 57.454  21.620  -26.688  1.00 42.43  ? 127 PHE C CZ  1 
ATOM   5255  N  N   . LEU C  1 129 ? 58.923  25.724  -22.365  1.00 25.50  ? 128 LEU C N   1 
ATOM   5256  C  CA  . LEU C  1 129 ? 59.754  25.108  -21.335  1.00 30.51  ? 128 LEU C CA  1 
ATOM   5257  C  C   . LEU C  1 129 ? 59.002  25.019  -20.010  1.00 30.16  ? 128 LEU C C   1 
ATOM   5258  O  O   . LEU C  1 129 ? 59.051  23.992  -19.321  1.00 31.52  ? 128 LEU C O   1 
ATOM   5259  C  CB  . LEU C  1 129 ? 61.087  25.854  -21.184  1.00 35.13  ? 128 LEU C CB  1 
ATOM   5260  C  CG  . LEU C  1 129 ? 62.091  25.171  -20.253  1.00 40.50  ? 128 LEU C CG  1 
ATOM   5261  C  CD1 . LEU C  1 129 ? 62.448  23.785  -20.777  1.00 31.63  ? 128 LEU C CD1 1 
ATOM   5262  C  CD2 . LEU C  1 129 ? 63.338  26.029  -20.089  1.00 36.40  ? 128 LEU C CD2 1 
ATOM   5263  N  N   . ARG C  1 130 ? 58.258  26.067  -19.670  1.00 32.03  ? 129 ARG C N   1 
ATOM   5264  C  CA  . ARG C  1 130 ? 57.403  26.004  -18.486  1.00 29.31  ? 129 ARG C CA  1 
ATOM   5265  C  C   . ARG C  1 130 ? 56.396  24.852  -18.548  1.00 35.21  ? 129 ARG C C   1 
ATOM   5266  O  O   . ARG C  1 130 ? 56.138  24.205  -17.529  1.00 38.15  ? 129 ARG C O   1 
ATOM   5267  C  CB  . ARG C  1 130 ? 56.654  27.323  -18.255  1.00 34.37  ? 129 ARG C CB  1 
ATOM   5268  C  CG  . ARG C  1 130 ? 57.420  28.344  -17.420  1.00 40.29  ? 129 ARG C CG  1 
ATOM   5269  C  CD  . ARG C  1 130 ? 57.628  27.854  -15.980  1.00 49.08  ? 129 ARG C CD  1 
ATOM   5270  N  NE  . ARG C  1 130 ? 58.172  28.909  -15.119  1.00 38.13  ? 129 ARG C NE  1 
ATOM   5271  C  CZ  . ARG C  1 130 ? 58.508  28.752  -13.844  1.00 66.96  ? 129 ARG C CZ  1 
ATOM   5272  N  NH1 . ARG C  1 130 ? 58.370  27.565  -13.254  1.00 34.94  ? 129 ARG C NH1 1 
ATOM   5273  N  NH2 . ARG C  1 130 ? 58.984  29.793  -13.163  1.00 39.63  ? 129 ARG C NH2 1 
ATOM   5274  N  N   . ARG C  1 131 ? 55.816  24.617  -19.728  1.00 34.15  ? 130 ARG C N   1 
ATOM   5275  C  CA  . ARG C  1 131 ? 54.901  23.495  -19.925  1.00 32.54  ? 130 ARG C CA  1 
ATOM   5276  C  C   . ARG C  1 131 ? 55.579  22.159  -19.606  1.00 33.08  ? 130 ARG C C   1 
ATOM   5277  O  O   . ARG C  1 131 ? 55.044  21.331  -18.872  1.00 34.45  ? 130 ARG C O   1 
ATOM   5278  C  CB  . ARG C  1 131 ? 54.371  23.444  -21.367  1.00 43.13  ? 130 ARG C CB  1 
ATOM   5279  C  CG  . ARG C  1 131 ? 53.187  24.355  -21.667  1.00 51.75  ? 130 ARG C CG  1 
ATOM   5280  C  CD  . ARG C  1 131 ? 52.898  24.396  -23.168  1.00 46.64  ? 130 ARG C CD  1 
ATOM   5281  N  NE  . ARG C  1 131 ? 52.465  23.098  -23.694  1.00 47.75  ? 130 ARG C NE  1 
ATOM   5282  C  CZ  . ARG C  1 131 ? 52.400  22.805  -24.992  1.00 53.17  ? 130 ARG C CZ  1 
ATOM   5283  N  NH1 . ARG C  1 131 ? 51.989  21.607  -25.385  1.00 44.68  ? 130 ARG C NH1 1 
ATOM   5284  N  NH2 . ARG C  1 131 ? 52.753  23.712  -25.901  1.00 45.91  ? 130 ARG C NH2 1 
ATOM   5285  N  N   . LEU C  1 132 ? 56.752  21.950  -20.184  1.00 30.74  ? 131 LEU C N   1 
ATOM   5286  C  CA  . LEU C  1 132 ? 57.481  20.716  -19.971  1.00 29.20  ? 131 LEU C CA  1 
ATOM   5287  C  C   . LEU C  1 132 ? 57.790  20.535  -18.487  1.00 30.32  ? 131 LEU C C   1 
ATOM   5288  O  O   . LEU C  1 132 ? 57.585  19.454  -17.917  1.00 30.95  ? 131 LEU C O   1 
ATOM   5289  C  CB  . LEU C  1 132 ? 58.784  20.743  -20.780  1.00 29.50  ? 131 LEU C CB  1 
ATOM   5290  C  CG  . LEU C  1 132 ? 59.672  19.506  -20.614  1.00 32.30  ? 131 LEU C CG  1 
ATOM   5291  C  CD1 . LEU C  1 132 ? 58.970  18.285  -21.169  1.00 33.65  ? 131 LEU C CD1 1 
ATOM   5292  C  CD2 . LEU C  1 132 ? 61.007  19.729  -21.313  1.00 29.92  ? 131 LEU C CD2 1 
ATOM   5293  N  N   . HIS C  1 133 ? 58.266  21.603  -17.856  1.00 30.06  ? 132 HIS C N   1 
ATOM   5294  C  CA  . HIS C  1 133 ? 58.669  21.533  -16.455  1.00 30.36  ? 132 HIS C CA  1 
ATOM   5295  C  C   . HIS C  1 133 ? 57.480  21.406  -15.516  1.00 32.41  ? 132 HIS C C   1 
ATOM   5296  O  O   . HIS C  1 133 ? 57.656  21.103  -14.335  1.00 29.15  ? 132 HIS C O   1 
ATOM   5297  C  CB  . HIS C  1 133 ? 59.538  22.745  -16.078  1.00 31.28  ? 132 HIS C CB  1 
ATOM   5298  C  CG  . HIS C  1 133 ? 60.890  22.728  -16.718  1.00 35.13  ? 132 HIS C CG  1 
ATOM   5299  N  ND1 . HIS C  1 133 ? 61.774  23.783  -16.628  1.00 33.21  ? 132 HIS C ND1 1 
ATOM   5300  C  CD2 . HIS C  1 133 ? 61.510  21.778  -17.463  1.00 24.52  ? 132 HIS C CD2 1 
ATOM   5301  C  CE1 . HIS C  1 133 ? 62.877  23.486  -17.292  1.00 30.72  ? 132 HIS C CE1 1 
ATOM   5302  N  NE2 . HIS C  1 133 ? 62.743  22.279  -17.811  1.00 29.75  ? 132 HIS C NE2 1 
ATOM   5303  N  N   . SER C  1 134 ? 56.267  21.610  -16.033  1.00 29.98  ? 133 SER C N   1 
ATOM   5304  C  CA  . SER C  1 134 ? 55.091  21.491  -15.186  1.00 33.80  ? 133 SER C CA  1 
ATOM   5305  C  C   . SER C  1 134 ? 54.546  20.057  -15.092  1.00 33.73  ? 133 SER C C   1 
ATOM   5306  O  O   . SER C  1 134 ? 53.664  19.786  -14.281  1.00 33.33  ? 133 SER C O   1 
ATOM   5307  C  CB  . SER C  1 134 ? 53.979  22.457  -15.631  1.00 34.72  ? 133 SER C CB  1 
ATOM   5308  O  OG  . SER C  1 134 ? 53.319  21.960  -16.786  1.00 38.61  ? 133 SER C OG  1 
ATOM   5309  N  N   . ILE C  1 135 ? 55.068  19.138  -15.901  1.00 31.22  ? 134 ILE C N   1 
ATOM   5310  C  CA  . ILE C  1 135 ? 54.633  17.739  -15.811  1.00 33.50  ? 134 ILE C CA  1 
ATOM   5311  C  C   . ILE C  1 135 ? 55.032  17.161  -14.451  1.00 31.91  ? 134 ILE C C   1 
ATOM   5312  O  O   . ILE C  1 135 ? 56.217  17.111  -14.140  1.00 32.43  ? 134 ILE C O   1 
ATOM   5313  C  CB  . ILE C  1 135 ? 55.302  16.876  -16.909  1.00 28.60  ? 134 ILE C CB  1 
ATOM   5314  C  CG1 . ILE C  1 135 ? 54.852  17.322  -18.295  1.00 35.23  ? 134 ILE C CG1 1 
ATOM   5315  C  CG2 . ILE C  1 135 ? 54.979  15.380  -16.676  1.00 37.05  ? 134 ILE C CG2 1 
ATOM   5316  C  CD1 . ILE C  1 135 ? 55.754  16.849  -19.428  1.00 33.72  ? 134 ILE C CD1 1 
ATOM   5317  N  N   . PRO C  1 136 ? 54.050  16.755  -13.621  1.00 33.08  ? 135 PRO C N   1 
ATOM   5318  C  CA  . PRO C  1 136 ? 54.416  16.229  -12.295  1.00 34.48  ? 135 PRO C CA  1 
ATOM   5319  C  C   . PRO C  1 136 ? 55.433  15.082  -12.399  1.00 39.64  ? 135 PRO C C   1 
ATOM   5320  O  O   . PRO C  1 136 ? 55.278  14.220  -13.257  1.00 33.93  ? 135 PRO C O   1 
ATOM   5321  C  CB  . PRO C  1 136 ? 53.069  15.742  -11.733  1.00 33.48  ? 135 PRO C CB  1 
ATOM   5322  C  CG  . PRO C  1 136 ? 52.061  16.640  -12.401  1.00 43.83  ? 135 PRO C CG  1 
ATOM   5323  C  CD  . PRO C  1 136 ? 52.582  16.843  -13.796  1.00 37.04  ? 135 PRO C CD  1 
ATOM   5324  N  N   . VAL C  1 137 ? 56.474  15.095  -11.566  1.00 33.79  ? 136 VAL C N   1 
ATOM   5325  C  CA  . VAL C  1 137 ? 57.550  14.117  -11.695  1.00 31.24  ? 136 VAL C CA  1 
ATOM   5326  C  C   . VAL C  1 137 ? 57.085  12.688  -11.392  1.00 30.49  ? 136 VAL C C   1 
ATOM   5327  O  O   . VAL C  1 137 ? 57.730  11.716  -11.812  1.00 32.25  ? 136 VAL C O   1 
ATOM   5328  C  CB  . VAL C  1 137 ? 58.782  14.460  -10.813  1.00 40.73  ? 136 VAL C CB  1 
ATOM   5329  C  CG1 . VAL C  1 137 ? 59.449  15.767  -11.279  1.00 37.39  ? 136 VAL C CG1 1 
ATOM   5330  C  CG2 . VAL C  1 137 ? 58.398  14.515  -9.350   1.00 39.98  ? 136 VAL C CG2 1 
ATOM   5331  N  N   . CYS C  1 138 ? 55.980  12.559  -10.671  1.00 31.85  ? 137 CYS C N   1 
ATOM   5332  C  CA  . CYS C  1 138 ? 55.410  11.236  -10.403  1.00 40.46  ? 137 CYS C CA  1 
ATOM   5333  C  C   . CYS C  1 138 ? 55.083  10.457  -11.683  1.00 35.46  ? 137 CYS C C   1 
ATOM   5334  O  O   . CYS C  1 138 ? 54.947  9.232   -11.646  1.00 38.84  ? 137 CYS C O   1 
ATOM   5335  C  CB  . CYS C  1 138 ? 54.169  11.334  -9.508   1.00 42.53  ? 137 CYS C CB  1 
ATOM   5336  S  SG  . CYS C  1 138 ? 52.704  12.104  -10.252  1.00 42.07  ? 137 CYS C SG  1 
ATOM   5337  N  N   . ASN C  1 139 ? 54.969  11.166  -12.808  1.00 35.51  ? 138 ASN C N   1 
ATOM   5338  C  CA  . ASN C  1 139 ? 54.705  10.545  -14.109  1.00 37.12  ? 138 ASN C CA  1 
ATOM   5339  C  C   . ASN C  1 139 ? 55.933  9.986   -14.827  1.00 32.99  ? 138 ASN C C   1 
ATOM   5340  O  O   . ASN C  1 139 ? 55.785  9.229   -15.794  1.00 36.78  ? 138 ASN C O   1 
ATOM   5341  C  CB  . ASN C  1 139 ? 54.053  11.548  -15.067  1.00 38.14  ? 138 ASN C CB  1 
ATOM   5342  C  CG  . ASN C  1 139 ? 52.667  11.951  -14.635  1.00 33.73  ? 138 ASN C CG  1 
ATOM   5343  O  OD1 . ASN C  1 139 ? 51.718  11.179  -14.749  1.00 39.34  ? 138 ASN C OD1 1 
ATOM   5344  N  ND2 . ASN C  1 139 ? 52.539  13.176  -14.143  1.00 38.53  ? 138 ASN C ND2 1 
ATOM   5345  N  N   . CYS C  1 140 ? 57.135  10.358  -14.381  1.00 27.66  ? 139 CYS C N   1 
ATOM   5346  C  CA  . CYS C  1 140 ? 58.332  10.109  -15.179  1.00 29.96  ? 139 CYS C CA  1 
ATOM   5347  C  C   . CYS C  1 140 ? 59.199  8.950   -14.665  1.00 33.59  ? 139 CYS C C   1 
ATOM   5348  O  O   . CYS C  1 140 ? 59.659  8.978   -13.527  1.00 35.07  ? 139 CYS C O   1 
ATOM   5349  C  CB  . CYS C  1 140 ? 59.163  11.399  -15.265  1.00 32.21  ? 139 CYS C CB  1 
ATOM   5350  S  SG  . CYS C  1 140 ? 60.604  11.309  -16.320  1.00 33.66  ? 139 CYS C SG  1 
ATOM   5351  N  N   . PRO C  1 141 ? 59.428  7.930   -15.515  1.00 33.72  ? 140 PRO C N   1 
ATOM   5352  C  CA  . PRO C  1 141 ? 60.218  6.753   -15.131  1.00 35.33  ? 140 PRO C CA  1 
ATOM   5353  C  C   . PRO C  1 141 ? 61.709  6.927   -15.383  1.00 31.18  ? 140 PRO C C   1 
ATOM   5354  O  O   . PRO C  1 141 ? 62.471  5.964   -15.197  1.00 32.92  ? 140 PRO C O   1 
ATOM   5355  C  CB  . PRO C  1 141 ? 59.673  5.663   -16.056  1.00 38.71  ? 140 PRO C CB  1 
ATOM   5356  C  CG  . PRO C  1 141 ? 59.329  6.425   -17.310  1.00 36.39  ? 140 PRO C CG  1 
ATOM   5357  C  CD  . PRO C  1 141 ? 58.777  7.751   -16.827  1.00 35.05  ? 140 PRO C CD  1 
ATOM   5358  N  N   . PHE C  1 142 ? 62.127  8.120   -15.807  1.00 29.37  ? 141 PHE C N   1 
ATOM   5359  C  CA  . PHE C  1 142 ? 63.532  8.339   -16.161  1.00 33.56  ? 141 PHE C CA  1 
ATOM   5360  C  C   . PHE C  1 142 ? 64.287  9.253   -15.196  1.00 39.78  ? 141 PHE C C   1 
ATOM   5361  O  O   . PHE C  1 142 ? 63.834  10.356  -14.863  1.00 32.80  ? 141 PHE C O   1 
ATOM   5362  C  CB  . PHE C  1 142 ? 63.664  8.861   -17.602  1.00 27.88  ? 141 PHE C CB  1 
ATOM   5363  C  CG  . PHE C  1 142 ? 62.910  8.030   -18.611  1.00 32.11  ? 141 PHE C CG  1 
ATOM   5364  C  CD1 . PHE C  1 142 ? 63.337  6.754   -18.929  1.00 34.62  ? 141 PHE C CD1 1 
ATOM   5365  C  CD2 . PHE C  1 142 ? 61.766  8.526   -19.227  1.00 32.25  ? 141 PHE C CD2 1 
ATOM   5366  C  CE1 . PHE C  1 142 ? 62.637  5.974   -19.844  1.00 37.47  ? 141 PHE C CE1 1 
ATOM   5367  C  CE2 . PHE C  1 142 ? 61.063  7.753   -20.154  1.00 35.56  ? 141 PHE C CE2 1 
ATOM   5368  C  CZ  . PHE C  1 142 ? 61.499  6.478   -20.458  1.00 37.07  ? 141 PHE C CZ  1 
ATOM   5369  N  N   . ASN C  1 143 ? 65.441  8.766   -14.757  1.00 30.51  ? 142 ASN C N   1 
ATOM   5370  C  CA  . ASN C  1 143 ? 66.358  9.520   -13.903  1.00 29.48  ? 142 ASN C CA  1 
ATOM   5371  C  C   . ASN C  1 143 ? 67.445  10.139  -14.756  1.00 32.55  ? 142 ASN C C   1 
ATOM   5372  O  O   . ASN C  1 143 ? 68.188  9.418   -15.411  1.00 31.13  ? 142 ASN C O   1 
ATOM   5373  C  CB  . ASN C  1 143 ? 67.012  8.576   -12.875  1.00 31.98  ? 142 ASN C CB  1 
ATOM   5374  C  CG  . ASN C  1 143 ? 68.179  9.228   -12.127  1.00 38.98  ? 142 ASN C CG  1 
ATOM   5375  O  OD1 . ASN C  1 143 ? 68.126  10.411  -11.796  1.00 34.74  ? 142 ASN C OD1 1 
ATOM   5376  N  ND2 . ASN C  1 143 ? 69.238  8.453   -11.864  1.00 36.27  ? 142 ASN C ND2 1 
ATOM   5377  N  N   . SER C  1 144 ? 67.544  11.470  -14.755  1.00 29.92  ? 143 SER C N   1 
ATOM   5378  C  CA  A SER C  1 144 ? 68.612  12.156  -15.469  0.62 32.57  ? 143 SER C CA  1 
ATOM   5379  C  CA  B SER C  1 144 ? 68.629  12.140  -15.460  0.38 31.15  ? 143 SER C CA  1 
ATOM   5380  C  C   . SER C  1 144 ? 69.303  13.157  -14.546  1.00 35.76  ? 143 SER C C   1 
ATOM   5381  O  O   . SER C  1 144 ? 69.783  14.197  -15.003  1.00 31.48  ? 143 SER C O   1 
ATOM   5382  C  CB  A SER C  1 144 ? 68.061  12.889  -16.700  0.62 31.25  ? 143 SER C CB  1 
ATOM   5383  C  CB  B SER C  1 144 ? 68.107  12.828  -16.723  0.38 32.50  ? 143 SER C CB  1 
ATOM   5384  O  OG  A SER C  1 144 ? 67.421  12.006  -17.607  0.62 29.28  ? 143 SER C OG  1 
ATOM   5385  O  OG  B SER C  1 144 ? 67.139  13.810  -16.403  0.38 32.11  ? 143 SER C OG  1 
ATOM   5386  N  N   . ASP C  1 145 ? 69.334  12.851  -13.250  1.00 31.95  ? 144 ASP C N   1 
ATOM   5387  C  CA  . ASP C  1 145 ? 69.820  13.816  -12.263  1.00 32.45  ? 144 ASP C CA  1 
ATOM   5388  C  C   . ASP C  1 145 ? 71.334  14.009  -12.307  1.00 32.38  ? 144 ASP C C   1 
ATOM   5389  O  O   . ASP C  1 145 ? 72.043  13.302  -13.031  1.00 31.79  ? 144 ASP C O   1 
ATOM   5390  C  CB  . ASP C  1 145 ? 69.284  13.545  -10.836  1.00 34.09  ? 144 ASP C CB  1 
ATOM   5391  C  CG  . ASP C  1 145 ? 69.873  12.292  -10.183  1.00 45.59  ? 144 ASP C CG  1 
ATOM   5392  O  OD1 . ASP C  1 145 ? 70.865  11.736  -10.680  1.00 35.65  ? 144 ASP C OD1 1 
ATOM   5393  O  OD2 . ASP C  1 145 ? 69.338  11.868  -9.137   1.00 42.17  ? 144 ASP C OD2 1 
ATOM   5394  N  N   . ARG C  1 146 ? 71.829  14.985  -11.560  1.00 34.37  ? 145 ARG C N   1 
ATOM   5395  C  CA  . ARG C  1 146 ? 73.233  15.359  -11.732  1.00 32.78  ? 145 ARG C CA  1 
ATOM   5396  C  C   . ARG C  1 146 ? 74.183  14.243  -11.296  1.00 32.69  ? 145 ARG C C   1 
ATOM   5397  O  O   . ARG C  1 146 ? 75.264  14.114  -11.843  1.00 37.73  ? 145 ARG C O   1 
ATOM   5398  C  CB  . ARG C  1 146 ? 73.562  16.669  -11.017  1.00 38.18  ? 145 ARG C CB  1 
ATOM   5399  C  CG  . ARG C  1 146 ? 73.808  16.549  -9.534   1.00 46.75  ? 145 ARG C CG  1 
ATOM   5400  C  CD  . ARG C  1 146 ? 74.553  17.779  -9.043   1.00 68.78  ? 145 ARG C CD  1 
ATOM   5401  N  NE  . ARG C  1 146 ? 74.822  17.757  -7.608   1.00 69.25  ? 145 ARG C NE  1 
ATOM   5402  C  CZ  . ARG C  1 146 ? 74.026  18.303  -6.696   1.00 69.23  ? 145 ARG C CZ  1 
ATOM   5403  N  NH1 . ARG C  1 146 ? 74.353  18.254  -5.406   1.00 63.04  ? 145 ARG C NH1 1 
ATOM   5404  N  NH2 . ARG C  1 146 ? 72.905  18.903  -7.076   1.00 59.79  ? 145 ARG C NH2 1 
ATOM   5405  N  N   . VAL C  1 147 ? 73.784  13.444  -10.312  1.00 33.40  ? 146 VAL C N   1 
ATOM   5406  C  CA  . VAL C  1 147 ? 74.598  12.322  -9.893   1.00 36.39  ? 146 VAL C CA  1 
ATOM   5407  C  C   . VAL C  1 147 ? 74.768  11.344  -11.062  1.00 38.51  ? 146 VAL C C   1 
ATOM   5408  O  O   . VAL C  1 147 ? 75.868  10.842  -11.330  1.00 30.12  ? 146 VAL C O   1 
ATOM   5409  C  CB  . VAL C  1 147 ? 73.975  11.642  -8.661   1.00 33.35  ? 146 VAL C CB  1 
ATOM   5410  C  CG1 . VAL C  1 147 ? 74.496  10.240  -8.489   1.00 36.41  ? 146 VAL C CG1 1 
ATOM   5411  C  CG2 . VAL C  1 147 ? 74.236  12.495  -7.415   1.00 42.22  ? 146 VAL C CG2 1 
ATOM   5412  N  N   . PHE C  1 148 ? 73.668  11.111  -11.770  1.00 30.49  ? 147 PHE C N   1 
ATOM   5413  C  CA  . PHE C  1 148 ? 73.648  10.225  -12.924  1.00 30.58  ? 147 PHE C CA  1 
ATOM   5414  C  C   . PHE C  1 148 ? 74.449  10.821  -14.078  1.00 37.31  ? 147 PHE C C   1 
ATOM   5415  O  O   . PHE C  1 148 ? 75.262  10.124  -14.709  1.00 33.44  ? 147 PHE C O   1 
ATOM   5416  C  CB  . PHE C  1 148 ? 72.200  9.982   -13.381  1.00 33.71  ? 147 PHE C CB  1 
ATOM   5417  C  CG  . PHE C  1 148 ? 72.092  9.247   -14.696  1.00 33.64  ? 147 PHE C CG  1 
ATOM   5418  C  CD1 . PHE C  1 148 ? 72.194  7.865   -14.738  1.00 32.15  ? 147 PHE C CD1 1 
ATOM   5419  C  CD2 . PHE C  1 148 ? 71.902  9.937   -15.889  1.00 35.23  ? 147 PHE C CD2 1 
ATOM   5420  C  CE1 . PHE C  1 148 ? 72.109  7.188   -15.940  1.00 37.32  ? 147 PHE C CE1 1 
ATOM   5421  C  CE2 . PHE C  1 148 ? 71.821  9.256   -17.105  1.00 35.10  ? 147 PHE C CE2 1 
ATOM   5422  C  CZ  . PHE C  1 148 ? 71.920  7.882   -17.123  1.00 36.50  ? 147 PHE C CZ  1 
ATOM   5423  N  N   . ARG C  1 149 ? 74.214  12.099  -14.372  1.00 31.35  ? 148 ARG C N   1 
ATOM   5424  C  CA  . ARG C  1 149 ? 74.928  12.743  -15.485  1.00 30.95  ? 148 ARG C CA  1 
ATOM   5425  C  C   . ARG C  1 149 ? 76.419  12.879  -15.185  1.00 30.64  ? 148 ARG C C   1 
ATOM   5426  O  O   . ARG C  1 149 ? 77.249  12.800  -16.095  1.00 30.80  ? 148 ARG C O   1 
ATOM   5427  C  CB  . ARG C  1 149 ? 74.340  14.127  -15.842  1.00 26.20  ? 148 ARG C CB  1 
ATOM   5428  C  CG  . ARG C  1 149 ? 72.844  14.151  -16.239  1.00 30.06  ? 148 ARG C CG  1 
ATOM   5429  C  CD  . ARG C  1 149 ? 72.513  13.356  -17.508  1.00 28.95  ? 148 ARG C CD  1 
ATOM   5430  N  NE  . ARG C  1 149 ? 73.320  13.700  -18.686  1.00 37.49  ? 148 ARG C NE  1 
ATOM   5431  C  CZ  . ARG C  1 149 ? 73.165  14.793  -19.431  1.00 53.00  ? 148 ARG C CZ  1 
ATOM   5432  N  NH1 . ARG C  1 149 ? 72.257  15.716  -19.112  1.00 38.37  ? 148 ARG C NH1 1 
ATOM   5433  N  NH2 . ARG C  1 149 ? 73.934  14.968  -20.499  1.00 34.99  ? 148 ARG C NH2 1 
ATOM   5434  N  N   . LEU C  1 150 ? 76.771  13.102  -13.921  1.00 26.66  ? 149 LEU C N   1 
ATOM   5435  C  CA  . LEU C  1 150 ? 78.190  13.261  -13.586  1.00 34.71  ? 149 LEU C CA  1 
ATOM   5436  C  C   . LEU C  1 150 ? 78.944  11.961  -13.807  1.00 34.05  ? 149 LEU C C   1 
ATOM   5437  O  O   . LEU C  1 150 ? 80.096  11.961  -14.266  1.00 29.40  ? 149 LEU C O   1 
ATOM   5438  C  CB  . LEU C  1 150 ? 78.386  13.753  -12.146  1.00 29.17  ? 149 LEU C CB  1 
ATOM   5439  C  CG  . LEU C  1 150 ? 78.189  15.260  -11.958  1.00 34.58  ? 149 LEU C CG  1 
ATOM   5440  C  CD1 . LEU C  1 150 ? 78.020  15.585  -10.486  1.00 36.76  ? 149 LEU C CD1 1 
ATOM   5441  C  CD2 . LEU C  1 150 ? 79.371  16.032  -12.573  1.00 31.25  ? 149 LEU C CD2 1 
ATOM   5442  N  N   . ALA C  1 151 ? 78.298  10.845  -13.491  1.00 29.00  ? 150 ALA C N   1 
ATOM   5443  C  CA  . ALA C  1 151 ? 78.951  9.548   -13.684  1.00 35.19  ? 150 ALA C CA  1 
ATOM   5444  C  C   . ALA C  1 151 ? 79.062  9.244   -15.181  1.00 34.85  ? 150 ALA C C   1 
ATOM   5445  O  O   . ALA C  1 151 ? 80.052  8.656   -15.637  1.00 31.52  ? 150 ALA C O   1 
ATOM   5446  C  CB  . ALA C  1 151 ? 78.191  8.450   -12.954  1.00 35.93  ? 150 ALA C CB  1 
ATOM   5447  N  N   . GLN C  1 152 ? 78.051  9.651   -15.947  1.00 29.65  ? 151 GLN C N   1 
ATOM   5448  C  CA  . GLN C  1 152 ? 78.118  9.544   -17.402  1.00 28.96  ? 151 GLN C CA  1 
ATOM   5449  C  C   . GLN C  1 152 ? 79.288  10.377  -17.937  1.00 36.21  ? 151 GLN C C   1 
ATOM   5450  O  O   . GLN C  1 152 ? 80.056  9.929   -18.805  1.00 30.73  ? 151 GLN C O   1 
ATOM   5451  C  CB  . GLN C  1 152 ? 76.850  10.102  -18.046  1.00 30.65  ? 151 GLN C CB  1 
ATOM   5452  C  CG  . GLN C  1 152 ? 75.625  9.207   -18.028  1.00 39.80  ? 151 GLN C CG  1 
ATOM   5453  C  CD  . GLN C  1 152 ? 74.615  9.654   -19.077  1.00 47.83  ? 151 GLN C CD  1 
ATOM   5454  O  OE1 . GLN C  1 152 ? 74.353  10.849  -19.226  1.00 38.38  ? 151 GLN C OE1 1 
ATOM   5455  N  NE2 . GLN C  1 152 ? 74.067  8.701   -19.827  1.00 47.93  ? 151 GLN C NE2 1 
ATOM   5456  N  N   . ALA C  1 153 ? 79.394  11.606  -17.432  1.00 29.79  ? 152 ALA C N   1 
ATOM   5457  C  CA  . ALA C  1 153 ? 80.462  12.522  -17.843  1.00 34.31  ? 152 ALA C CA  1 
ATOM   5458  C  C   . ALA C  1 153 ? 81.846  11.952  -17.514  1.00 31.39  ? 152 ALA C C   1 
ATOM   5459  O  O   . ALA C  1 153 ? 82.777  12.004  -18.334  1.00 32.85  ? 152 ALA C O   1 
ATOM   5460  C  CB  . ALA C  1 153 ? 80.264  13.900  -17.180  1.00 31.30  ? 152 ALA C CB  1 
ATOM   5461  N  N   . GLN C  1 154 ? 81.990  11.403  -16.316  1.00 29.11  ? 153 GLN C N   1 
ATOM   5462  C  CA  . GLN C  1 154 ? 83.259  10.795  -15.931  1.00 29.28  ? 153 GLN C CA  1 
ATOM   5463  C  C   . GLN C  1 154 ? 83.657  9.687   -16.890  1.00 38.31  ? 153 GLN C C   1 
ATOM   5464  O  O   . GLN C  1 154 ? 84.818  9.610   -17.302  1.00 38.93  ? 153 GLN C O   1 
ATOM   5465  C  CB  . GLN C  1 154 ? 83.192  10.247  -14.513  1.00 37.08  ? 153 GLN C CB  1 
ATOM   5466  C  CG  . GLN C  1 154 ? 84.538  9.797   -14.003  1.00 41.31  ? 153 GLN C CG  1 
ATOM   5467  C  CD  . GLN C  1 154 ? 84.489  9.413   -12.549  1.00 49.72  ? 153 GLN C CD  1 
ATOM   5468  O  OE1 . GLN C  1 154 ? 83.626  8.648   -12.131  1.00 75.31  ? 153 GLN C OE1 1 
ATOM   5469  N  NE2 . GLN C  1 154 ? 85.405  9.955   -11.765  1.00 52.04  ? 153 GLN C NE2 1 
ATOM   5470  N  N   . SER C  1 155 ? 82.700  8.839   -17.258  1.00 38.02  ? 154 SER C N   1 
ATOM   5471  C  CA  . SER C  1 155 ? 82.988  7.736   -18.179  1.00 32.46  ? 154 SER C CA  1 
ATOM   5472  C  C   . SER C  1 155 ? 83.339  8.258   -19.574  1.00 34.12  ? 154 SER C C   1 
ATOM   5473  O  O   . SER C  1 155 ? 84.267  7.772   -20.196  1.00 33.06  ? 154 SER C O   1 
ATOM   5474  C  CB  . SER C  1 155 ? 81.811  6.766   -18.271  1.00 40.11  ? 154 SER C CB  1 
ATOM   5475  O  OG  . SER C  1 155 ? 81.586  6.116   -17.032  1.00 57.70  ? 154 SER C OG  1 
ATOM   5476  N  N   . ARG C  1 156 ? 82.590  9.237   -20.072  1.00 34.13  ? 155 ARG C N   1 
ATOM   5477  C  CA  . ARG C  1 156 ? 82.939  9.844   -21.361  1.00 32.44  ? 155 ARG C CA  1 
ATOM   5478  C  C   . ARG C  1 156 ? 84.356  10.393  -21.356  1.00 34.42  ? 155 ARG C C   1 
ATOM   5479  O  O   . ARG C  1 156 ? 85.107  10.198  -22.314  1.00 32.55  ? 155 ARG C O   1 
ATOM   5480  C  CB  . ARG C  1 156 ? 81.958  10.959  -21.750  1.00 30.21  ? 155 ARG C CB  1 
ATOM   5481  C  CG  . ARG C  1 156 ? 80.606  10.428  -22.198  1.00 37.84  ? 155 ARG C CG  1 
ATOM   5482  C  CD  . ARG C  1 156 ? 79.958  11.361  -23.201  1.00 55.65  ? 155 ARG C CD  1 
ATOM   5483  N  NE  . ARG C  1 156 ? 80.113  10.877  -24.564  1.00 52.39  ? 155 ARG C NE  1 
ATOM   5484  C  CZ  . ARG C  1 156 ? 80.486  11.624  -25.597  1.00 43.49  ? 155 ARG C CZ  1 
ATOM   5485  N  NH1 . ARG C  1 156 ? 80.582  11.075  -26.796  1.00 59.47  ? 155 ARG C NH1 1 
ATOM   5486  N  NH2 . ARG C  1 156 ? 80.762  12.913  -25.444  1.00 40.42  ? 155 ARG C NH2 1 
HETATM 5487  N  N   . MSE C  1 157 ? 84.712  11.101  -20.291  1.00 32.53  ? 156 MSE C N   1 
HETATM 5488  C  CA  . MSE C  1 157 ? 86.076  11.602  -20.155  1.00 36.44  ? 156 MSE C CA  1 
HETATM 5489  C  C   . MSE C  1 157 ? 87.075  10.452  -20.158  1.00 47.65  ? 156 MSE C C   1 
HETATM 5490  O  O   . MSE C  1 157 ? 88.057  10.452  -20.910  1.00 36.44  ? 156 MSE C O   1 
HETATM 5491  C  CB  . MSE C  1 157 ? 86.233  12.399  -18.857  1.00 33.89  ? 156 MSE C CB  1 
HETATM 5492  C  CG  . MSE C  1 157 ? 87.666  12.884  -18.616  1.00 32.57  ? 156 MSE C CG  1 
HETATM 5493  SE SE  . MSE C  1 157 ? 87.840  14.036  -17.061  0.59 33.07  ? 156 MSE C SE  1 
HETATM 5494  C  CE  . MSE C  1 157 ? 87.141  12.786  -15.715  1.00 36.04  ? 156 MSE C CE  1 
ATOM   5495  N  N   . ASN C  1 158 ? 86.820  9.472   -19.299  1.00 34.72  ? 157 ASN C N   1 
ATOM   5496  C  CA  . ASN C  1 158 ? 87.738  8.350   -19.131  1.00 37.22  ? 157 ASN C CA  1 
ATOM   5497  C  C   . ASN C  1 158 ? 87.886  7.467   -20.368  1.00 33.09  ? 157 ASN C C   1 
ATOM   5498  O  O   . ASN C  1 158 ? 88.949  6.872   -20.603  1.00 32.58  ? 157 ASN C O   1 
ATOM   5499  C  CB  . ASN C  1 158 ? 87.323  7.524   -17.916  1.00 37.23  ? 157 ASN C CB  1 
ATOM   5500  C  CG  . ASN C  1 158 ? 87.630  8.233   -16.612  1.00 45.01  ? 157 ASN C CG  1 
ATOM   5501  O  OD1 . ASN C  1 158 ? 88.270  9.292   -16.605  1.00 41.86  ? 157 ASN C OD1 1 
ATOM   5502  N  ND2 . ASN C  1 158 ? 87.197  7.647   -15.504  1.00 50.42  ? 157 ASN C ND2 1 
ATOM   5503  N  N   . ASN C  1 159 ? 86.820  7.379   -21.155  1.00 32.97  ? 158 ASN C N   1 
ATOM   5504  C  CA  . ASN C  1 159 ? 86.835  6.590   -22.383  1.00 36.81  ? 158 ASN C CA  1 
ATOM   5505  C  C   . ASN C  1 159 ? 87.390  7.370   -23.572  1.00 40.65  ? 158 ASN C C   1 
ATOM   5506  O  O   . ASN C  1 159 ? 87.466  6.848   -24.689  1.00 44.28  ? 158 ASN C O   1 
ATOM   5507  C  CB  . ASN C  1 159 ? 85.430  6.073   -22.697  1.00 42.50  ? 158 ASN C CB  1 
ATOM   5508  C  CG  . ASN C  1 159 ? 85.001  4.961   -21.770  1.00 39.99  ? 158 ASN C CG  1 
ATOM   5509  O  OD1 . ASN C  1 159 ? 85.788  4.078   -21.446  1.00 36.88  ? 158 ASN C OD1 1 
ATOM   5510  N  ND2 . ASN C  1 159 ? 83.748  5.001   -21.329  1.00 34.47  ? 158 ASN C ND2 1 
ATOM   5511  N  N   . GLY C  1 160 ? 87.771  8.622   -23.334  1.00 32.00  ? 159 GLY C N   1 
ATOM   5512  C  CA  . GLY C  1 160 ? 88.399  9.434   -24.366  1.00 34.54  ? 159 GLY C CA  1 
ATOM   5513  C  C   . GLY C  1 160 ? 87.443  10.043  -25.385  1.00 43.25  ? 159 GLY C C   1 
ATOM   5514  O  O   . GLY C  1 160 ? 87.838  10.402  -26.496  1.00 38.42  ? 159 GLY C O   1 
ATOM   5515  N  N   . LEU C  1 161 ? 86.187  10.195  -24.996  1.00 43.21  ? 160 LEU C N   1 
ATOM   5516  C  CA  . LEU C  1 161 ? 85.145  10.585  -25.933  1.00 35.08  ? 160 LEU C CA  1 
ATOM   5517  C  C   . LEU C  1 161 ? 84.789  12.077  -25.904  1.00 36.65  ? 160 LEU C C   1 
ATOM   5518  O  O   . LEU C  1 161 ? 83.996  12.535  -26.727  1.00 40.36  ? 160 LEU C O   1 
ATOM   5519  C  CB  . LEU C  1 161 ? 83.889  9.761   -25.664  1.00 32.90  ? 160 LEU C CB  1 
ATOM   5520  C  CG  . LEU C  1 161 ? 84.217  8.271   -25.571  1.00 34.17  ? 160 LEU C CG  1 
ATOM   5521  C  CD1 . LEU C  1 161 ? 83.011  7.445   -25.176  1.00 35.16  ? 160 LEU C CD1 1 
ATOM   5522  C  CD2 . LEU C  1 161 ? 84.801  7.781   -26.881  1.00 40.72  ? 160 LEU C CD2 1 
ATOM   5523  N  N   . VAL C  1 162 ? 85.341  12.829  -24.955  1.00 34.11  ? 161 VAL C N   1 
ATOM   5524  C  CA  . VAL C  1 162 ? 84.969  14.242  -24.840  1.00 36.68  ? 161 VAL C CA  1 
ATOM   5525  C  C   . VAL C  1 162 ? 85.567  15.050  -25.987  1.00 39.59  ? 161 VAL C C   1 
ATOM   5526  O  O   . VAL C  1 162 ? 86.736  14.887  -26.320  1.00 37.28  ? 161 VAL C O   1 
ATOM   5527  C  CB  . VAL C  1 162 ? 85.375  14.856  -23.482  1.00 33.40  ? 161 VAL C CB  1 
ATOM   5528  C  CG1 . VAL C  1 162 ? 85.030  16.359  -23.441  1.00 36.83  ? 161 VAL C CG1 1 
ATOM   5529  C  CG2 . VAL C  1 162 ? 84.666  14.143  -22.355  1.00 33.72  ? 161 VAL C CG2 1 
ATOM   5530  N  N   . ASP C  1 163 ? 84.755  15.907  -26.602  1.00 35.45  ? 162 ASP C N   1 
ATOM   5531  C  CA  . ASP C  1 163 ? 85.222  16.750  -27.707  1.00 43.12  ? 162 ASP C CA  1 
ATOM   5532  C  C   . ASP C  1 163 ? 85.760  18.055  -27.142  1.00 37.77  ? 162 ASP C C   1 
ATOM   5533  O  O   . ASP C  1 163 ? 85.027  19.033  -27.022  1.00 34.69  ? 162 ASP C O   1 
ATOM   5534  C  CB  . ASP C  1 163 ? 84.077  17.037  -28.682  1.00 39.46  ? 162 ASP C CB  1 
ATOM   5535  C  CG  . ASP C  1 163 ? 84.518  17.828  -29.909  1.00 43.13  ? 162 ASP C CG  1 
ATOM   5536  O  OD1 . ASP C  1 163 ? 85.689  18.260  -29.995  1.00 45.66  ? 162 ASP C OD1 1 
ATOM   5537  O  OD2 . ASP C  1 163 ? 83.667  18.019  -30.798  1.00 49.11  ? 162 ASP C OD2 1 
ATOM   5538  N  N   . ALA C  1 164 ? 87.048  18.072  -26.816  1.00 39.19  ? 163 ALA C N   1 
ATOM   5539  C  CA  . ALA C  1 164 ? 87.625  19.210  -26.108  1.00 32.67  ? 163 ALA C CA  1 
ATOM   5540  C  C   . ALA C  1 164 ? 87.727  20.429  -27.021  1.00 41.93  ? 163 ALA C C   1 
ATOM   5541  O  O   . ALA C  1 164 ? 87.918  21.547  -26.550  1.00 49.23  ? 163 ALA C O   1 
ATOM   5542  C  CB  . ALA C  1 164 ? 88.992  18.843  -25.541  1.00 40.12  ? 163 ALA C CB  1 
ATOM   5543  N  N   . SER C  1 165 ? 87.582  20.212  -28.326  1.00 38.32  ? 164 SER C N   1 
ATOM   5544  C  CA  . SER C  1 165 ? 87.650  21.314  -29.284  1.00 43.23  ? 164 SER C CA  1 
ATOM   5545  C  C   . SER C  1 165 ? 86.320  22.049  -29.390  1.00 53.28  ? 164 SER C C   1 
ATOM   5546  O  O   . SER C  1 165 ? 86.217  23.056  -30.086  1.00 45.65  ? 164 SER C O   1 
ATOM   5547  C  CB  . SER C  1 165 ? 88.086  20.814  -30.662  1.00 55.50  ? 164 SER C CB  1 
ATOM   5548  O  OG  . SER C  1 165 ? 87.023  20.165  -31.332  1.00 51.24  ? 164 SER C OG  1 
ATOM   5549  N  N   . ASP C  1 166 ? 85.304  21.543  -28.696  1.00 37.42  ? 165 ASP C N   1 
ATOM   5550  C  CA  . ASP C  1 166 ? 83.963  22.116  -28.790  1.00 31.11  ? 165 ASP C CA  1 
ATOM   5551  C  C   . ASP C  1 166 ? 83.552  22.818  -27.483  1.00 33.28  ? 165 ASP C C   1 
ATOM   5552  O  O   . ASP C  1 166 ? 82.378  23.067  -27.268  1.00 34.98  ? 165 ASP C O   1 
ATOM   5553  C  CB  . ASP C  1 166 ? 82.958  21.016  -29.183  1.00 33.30  ? 165 ASP C CB  1 
ATOM   5554  C  CG  . ASP C  1 166 ? 81.621  21.569  -29.710  1.00 55.06  ? 165 ASP C CG  1 
ATOM   5555  O  OD1 . ASP C  1 166 ? 81.572  22.687  -30.272  1.00 43.45  ? 165 ASP C OD1 1 
ATOM   5556  O  OD2 . ASP C  1 166 ? 80.605  20.863  -29.572  1.00 43.15  ? 165 ASP C OD2 1 
ATOM   5557  N  N   . PHE C  1 167 ? 84.515  23.132  -26.611  1.00 37.25  ? 166 PHE C N   1 
ATOM   5558  C  CA  . PHE C  1 167 ? 84.197  23.791  -25.334  1.00 32.20  ? 166 PHE C CA  1 
ATOM   5559  C  C   . PHE C  1 167 ? 83.753  25.227  -25.581  1.00 42.07  ? 166 PHE C C   1 
ATOM   5560  O  O   . PHE C  1 167 ? 84.123  25.834  -26.593  1.00 39.97  ? 166 PHE C O   1 
ATOM   5561  C  CB  . PHE C  1 167 ? 85.398  23.791  -24.366  1.00 37.74  ? 166 PHE C CB  1 
ATOM   5562  C  CG  . PHE C  1 167 ? 85.790  22.410  -23.848  1.00 35.76  ? 166 PHE C CG  1 
ATOM   5563  C  CD1 . PHE C  1 167 ? 84.904  21.343  -23.896  1.00 28.63  ? 166 PHE C CD1 1 
ATOM   5564  C  CD2 . PHE C  1 167 ? 87.053  22.200  -23.294  1.00 38.52  ? 166 PHE C CD2 1 
ATOM   5565  C  CE1 . PHE C  1 167 ? 85.271  20.086  -23.428  1.00 29.64  ? 166 PHE C CE1 1 
ATOM   5566  C  CE2 . PHE C  1 167 ? 87.424  20.945  -22.816  1.00 41.79  ? 166 PHE C CE2 1 
ATOM   5567  C  CZ  . PHE C  1 167 ? 86.537  19.888  -22.880  1.00 34.99  ? 166 PHE C CZ  1 
ATOM   5568  N  N   . ASP C  1 168 ? 82.968  25.770  -24.653  1.00 32.85  ? 167 ASP C N   1 
ATOM   5569  C  CA  . ASP C  1 168 ? 82.548  27.172  -24.712  1.00 33.46  ? 167 ASP C CA  1 
ATOM   5570  C  C   . ASP C  1 168 ? 83.783  28.087  -24.630  1.00 36.07  ? 167 ASP C C   1 
ATOM   5571  O  O   . ASP C  1 168 ? 84.872  27.647  -24.249  1.00 35.92  ? 167 ASP C O   1 
ATOM   5572  C  CB  . ASP C  1 168 ? 81.578  27.498  -23.565  1.00 36.40  ? 167 ASP C CB  1 
ATOM   5573  C  CG  . ASP C  1 168 ? 80.254  26.756  -23.676  1.00 41.64  ? 167 ASP C CG  1 
ATOM   5574  O  OD1 . ASP C  1 168 ? 79.735  26.603  -24.804  1.00 36.00  ? 167 ASP C OD1 1 
ATOM   5575  O  OD2 . ASP C  1 168 ? 79.724  26.327  -22.625  1.00 38.27  ? 167 ASP C OD2 1 
ATOM   5576  N  N   . ASP C  1 169 ? 83.608  29.358  -24.977  1.00 36.78  ? 168 ASP C N   1 
ATOM   5577  C  CA  . ASP C  1 169 ? 84.746  30.283  -25.060  1.00 43.54  ? 168 ASP C CA  1 
ATOM   5578  C  C   . ASP C  1 169 ? 85.550  30.377  -23.761  1.00 39.42  ? 168 ASP C C   1 
ATOM   5579  O  O   . ASP C  1 169 ? 86.783  30.467  -23.786  1.00 46.27  ? 168 ASP C O   1 
ATOM   5580  C  CB  . ASP C  1 169 ? 84.280  31.681  -25.484  1.00 49.79  ? 168 ASP C CB  1 
ATOM   5581  C  CG  . ASP C  1 169 ? 83.809  31.727  -26.928  1.00 81.04  ? 168 ASP C CG  1 
ATOM   5582  O  OD1 . ASP C  1 169 ? 84.334  30.940  -27.744  1.00 69.69  ? 168 ASP C OD1 1 
ATOM   5583  O  OD2 . ASP C  1 169 ? 82.927  32.557  -27.249  1.00 76.69  ? 168 ASP C OD2 1 
ATOM   5584  N  N   . GLU C  1 170 ? 84.845  30.360  -22.635  1.00 40.93  ? 169 GLU C N   1 
ATOM   5585  C  CA  . GLU C  1 170 ? 85.463  30.499  -21.324  1.00 39.75  ? 169 GLU C CA  1 
ATOM   5586  C  C   . GLU C  1 170 ? 86.428  29.357  -21.086  1.00 40.89  ? 169 GLU C C   1 
ATOM   5587  O  O   . GLU C  1 170 ? 87.386  29.489  -20.328  1.00 57.13  ? 169 GLU C O   1 
ATOM   5588  C  CB  . GLU C  1 170 ? 84.402  30.474  -20.216  1.00 48.26  ? 169 GLU C CB  1 
ATOM   5589  C  CG  . GLU C  1 170 ? 83.219  31.412  -20.416  1.00 77.81  ? 169 GLU C CG  1 
ATOM   5590  C  CD  . GLU C  1 170 ? 82.081  30.780  -21.204  1.00 62.42  ? 169 GLU C CD  1 
ATOM   5591  O  OE1 . GLU C  1 170 ? 81.150  30.222  -20.580  1.00 95.93  ? 169 GLU C OE1 1 
ATOM   5592  O  OE2 . GLU C  1 170 ? 82.112  30.850  -22.449  1.00 59.32  ? 169 GLU C OE2 1 
ATOM   5593  N  N   . ARG C  1 171 ? 86.177  28.229  -21.745  1.00 37.43  ? 170 ARG C N   1 
ATOM   5594  C  CA  . ARG C  1 171 ? 86.968  27.025  -21.491  1.00 36.61  ? 170 ARG C CA  1 
ATOM   5595  C  C   . ARG C  1 171 ? 87.794  26.574  -22.688  1.00 35.52  ? 170 ARG C C   1 
ATOM   5596  O  O   . ARG C  1 171 ? 88.311  25.454  -22.711  1.00 40.12  ? 170 ARG C O   1 
ATOM   5597  C  CB  . ARG C  1 171 ? 86.040  25.894  -21.030  1.00 37.47  ? 170 ARG C CB  1 
ATOM   5598  C  CG  . ARG C  1 171 ? 85.467  26.139  -19.645  1.00 37.75  ? 170 ARG C CG  1 
ATOM   5599  C  CD  . ARG C  1 171 ? 84.358  25.154  -19.310  1.00 35.91  ? 170 ARG C CD  1 
ATOM   5600  N  NE  . ARG C  1 171 ? 83.091  25.519  -19.958  1.00 35.22  ? 170 ARG C NE  1 
ATOM   5601  C  CZ  . ARG C  1 171 ? 82.257  26.442  -19.489  1.00 49.69  ? 170 ARG C CZ  1 
ATOM   5602  N  NH1 . ARG C  1 171 ? 82.557  27.115  -18.383  1.00 41.33  ? 170 ARG C NH1 1 
ATOM   5603  N  NH2 . ARG C  1 171 ? 81.124  26.701  -20.128  1.00 33.63  ? 170 ARG C NH2 1 
ATOM   5604  N  N   . ASN C  1 172 ? 87.923  27.451  -23.676  1.00 39.95  ? 171 ASN C N   1 
ATOM   5605  C  CA  . ASN C  1 172 ? 88.679  27.122  -24.872  1.00 48.83  ? 171 ASN C CA  1 
ATOM   5606  C  C   . ASN C  1 172 ? 90.122  26.763  -24.532  1.00 44.53  ? 171 ASN C C   1 
ATOM   5607  O  O   . ASN C  1 172 ? 90.819  27.522  -23.857  1.00 43.68  ? 171 ASN C O   1 
ATOM   5608  C  CB  . ASN C  1 172 ? 88.618  28.270  -25.881  1.00 45.14  ? 171 ASN C CB  1 
ATOM   5609  C  CG  . ASN C  1 172 ? 89.345  27.948  -27.172  1.00 59.72  ? 171 ASN C CG  1 
ATOM   5610  O  OD1 . ASN C  1 172 ? 90.543  28.191  -27.291  1.00 72.20  ? 171 ASN C OD1 1 
ATOM   5611  N  ND2 . ASN C  1 172 ? 88.626  27.389  -28.141  1.00 65.47  ? 171 ASN C ND2 1 
ATOM   5612  N  N   . GLY C  1 173 ? 90.553  25.586  -24.971  1.00 51.02  ? 172 GLY C N   1 
ATOM   5613  C  CA  . GLY C  1 173 ? 91.929  25.160  -24.768  1.00 51.28  ? 172 GLY C CA  1 
ATOM   5614  C  C   . GLY C  1 173 ? 92.183  24.474  -23.438  1.00 43.17  ? 172 GLY C C   1 
ATOM   5615  O  O   . GLY C  1 173 ? 93.277  23.955  -23.201  1.00 40.07  ? 172 GLY C O   1 
ATOM   5616  N  N   . TRP C  1 174 ? 91.181  24.456  -22.560  1.00 39.01  ? 173 TRP C N   1 
ATOM   5617  C  CA  . TRP C  1 174 ? 91.333  23.764  -21.283  1.00 46.03  ? 173 TRP C CA  1 
ATOM   5618  C  C   . TRP C  1 174 ? 91.390  22.273  -21.530  1.00 44.17  ? 173 TRP C C   1 
ATOM   5619  O  O   . TRP C  1 174 ? 90.618  21.740  -22.334  1.00 41.06  ? 173 TRP C O   1 
ATOM   5620  C  CB  . TRP C  1 174 ? 90.148  24.018  -20.347  1.00 46.70  ? 173 TRP C CB  1 
ATOM   5621  C  CG  . TRP C  1 174 ? 90.049  25.381  -19.736  1.00 38.89  ? 173 TRP C CG  1 
ATOM   5622  C  CD1 . TRP C  1 174 ? 90.589  26.549  -20.204  1.00 42.05  ? 173 TRP C CD1 1 
ATOM   5623  C  CD2 . TRP C  1 174 ? 89.344  25.718  -18.537  1.00 38.58  ? 173 TRP C CD2 1 
ATOM   5624  N  NE1 . TRP C  1 174 ? 90.252  27.592  -19.369  1.00 49.10  ? 173 TRP C NE1 1 
ATOM   5625  C  CE2 . TRP C  1 174 ? 89.489  27.107  -18.339  1.00 46.81  ? 173 TRP C CE2 1 
ATOM   5626  C  CE3 . TRP C  1 174 ? 88.593  24.979  -17.615  1.00 46.08  ? 173 TRP C CE3 1 
ATOM   5627  C  CZ2 . TRP C  1 174 ? 88.919  27.770  -17.252  1.00 49.90  ? 173 TRP C CZ2 1 
ATOM   5628  C  CZ3 . TRP C  1 174 ? 88.022  25.641  -16.538  1.00 55.70  ? 173 TRP C CZ3 1 
ATOM   5629  C  CH2 . TRP C  1 174 ? 88.186  27.022  -16.368  1.00 42.42  ? 173 TRP C CH2 1 
ATOM   5630  N  N   . PRO C  1 175 ? 92.288  21.585  -20.827  1.00 36.63  ? 174 PRO C N   1 
ATOM   5631  C  CA  . PRO C  1 175 ? 92.210  20.121  -20.855  1.00 37.51  ? 174 PRO C CA  1 
ATOM   5632  C  C   . PRO C  1 175 ? 90.934  19.644  -20.161  1.00 49.45  ? 174 PRO C C   1 
ATOM   5633  O  O   . PRO C  1 175 ? 90.454  20.301  -19.235  1.00 40.62  ? 174 PRO C O   1 
ATOM   5634  C  CB  . PRO C  1 175 ? 93.465  19.683  -20.085  1.00 44.88  ? 174 PRO C CB  1 
ATOM   5635  C  CG  . PRO C  1 175 ? 93.874  20.864  -19.283  1.00 65.26  ? 174 PRO C CG  1 
ATOM   5636  C  CD  . PRO C  1 175 ? 93.437  22.077  -20.049  1.00 47.25  ? 174 PRO C CD  1 
ATOM   5637  N  N   . VAL C  1 176 ? 90.383  18.522  -20.616  1.00 32.75  ? 175 VAL C N   1 
ATOM   5638  C  CA  . VAL C  1 176 ? 89.116  18.019  -20.079  1.00 34.78  ? 175 VAL C CA  1 
ATOM   5639  C  C   . VAL C  1 176 ? 89.167  17.817  -18.563  1.00 39.71  ? 175 VAL C C   1 
ATOM   5640  O  O   . VAL C  1 176 ? 88.179  18.052  -17.855  1.00 35.50  ? 175 VAL C O   1 
ATOM   5641  C  CB  . VAL C  1 176 ? 88.654  16.721  -20.795  1.00 34.39  ? 175 VAL C CB  1 
ATOM   5642  C  CG1 . VAL C  1 176 ? 89.739  15.647  -20.734  1.00 38.50  ? 175 VAL C CG1 1 
ATOM   5643  C  CG2 . VAL C  1 176 ? 87.329  16.210  -20.182  1.00 32.75  ? 175 VAL C CG2 1 
ATOM   5644  N  N   A GLU C  1 177 ? 90.327  17.405  -18.069  0.50 36.57  ? 176 GLU C N   1 
ATOM   5645  N  N   B GLU C  1 177 ? 90.325  17.397  -18.064  0.50 37.23  ? 176 GLU C N   1 
ATOM   5646  C  CA  A GLU C  1 177 ? 90.513  17.166  -16.645  0.50 50.42  ? 176 GLU C CA  1 
ATOM   5647  C  CA  B GLU C  1 177 ? 90.509  17.159  -16.635  0.50 49.28  ? 176 GLU C CA  1 
ATOM   5648  C  C   A GLU C  1 177 ? 90.356  18.447  -15.826  0.50 47.38  ? 176 GLU C C   1 
ATOM   5649  C  C   B GLU C  1 177 ? 90.361  18.448  -15.820  0.50 47.63  ? 176 GLU C C   1 
ATOM   5650  O  O   A GLU C  1 177 ? 89.900  18.410  -14.683  0.50 46.91  ? 176 GLU C O   1 
ATOM   5651  O  O   B GLU C  1 177 ? 89.909  18.420  -14.675  0.50 40.76  ? 176 GLU C O   1 
ATOM   5652  C  CB  A GLU C  1 177 ? 91.885  16.535  -16.387  0.50 46.79  ? 176 GLU C CB  1 
ATOM   5653  C  CB  B GLU C  1 177 ? 91.875  16.506  -16.377  0.50 46.14  ? 176 GLU C CB  1 
ATOM   5654  C  CG  A GLU C  1 177 ? 92.069  15.171  -17.033  0.50 37.99  ? 176 GLU C CG  1 
ATOM   5655  C  CG  B GLU C  1 177 ? 92.207  16.267  -14.908  0.50 52.69  ? 176 GLU C CG  1 
ATOM   5656  C  CD  A GLU C  1 177 ? 92.517  15.248  -18.485  0.50 59.03  ? 176 GLU C CD  1 
ATOM   5657  C  CD  B GLU C  1 177 ? 91.178  15.399  -14.199  0.50 62.15  ? 176 GLU C CD  1 
ATOM   5658  O  OE1 A GLU C  1 177 ? 92.888  16.351  -18.957  0.50 28.04  ? 176 GLU C OE1 1 
ATOM   5659  O  OE1 B GLU C  1 177 ? 90.878  14.284  -14.685  0.50 43.27  ? 176 GLU C OE1 1 
ATOM   5660  O  OE2 A GLU C  1 177 ? 92.501  14.193  -19.153  0.50 43.77  ? 176 GLU C OE2 1 
ATOM   5661  O  OE2 B GLU C  1 177 ? 90.669  15.839  -13.150  0.50 46.87  ? 176 GLU C OE2 1 
ATOM   5662  N  N   . GLN C  1 178 ? 90.737  19.578  -16.411  1.00 34.82  ? 177 GLN C N   1 
ATOM   5663  C  CA  . GLN C  1 178 ? 90.584  20.866  -15.734  1.00 38.51  ? 177 GLN C CA  1 
ATOM   5664  C  C   . GLN C  1 178 ? 89.101  21.268  -15.626  1.00 39.31  ? 177 GLN C C   1 
ATOM   5665  O  O   . GLN C  1 178 ? 88.661  21.810  -14.613  1.00 39.07  ? 177 GLN C O   1 
ATOM   5666  C  CB  . GLN C  1 178 ? 91.388  21.960  -16.433  1.00 38.04  ? 177 GLN C CB  1 
ATOM   5667  C  CG  . GLN C  1 178 ? 91.406  23.277  -15.656  1.00 43.79  ? 177 GLN C CG  1 
ATOM   5668  C  CD  . GLN C  1 178 ? 92.092  24.412  -16.402  1.00 49.42  ? 177 GLN C CD  1 
ATOM   5669  O  OE1 . GLN C  1 178 ? 92.724  24.201  -17.435  1.00 55.96  ? 177 GLN C OE1 1 
ATOM   5670  N  NE2 . GLN C  1 178 ? 91.958  25.630  -15.879  1.00 48.42  ? 177 GLN C NE2 1 
ATOM   5671  N  N   . VAL C  1 179 ? 88.333  20.989  -16.670  1.00 35.96  ? 178 VAL C N   1 
ATOM   5672  C  CA  . VAL C  1 179 ? 86.888  21.224  -16.626  1.00 35.46  ? 178 VAL C CA  1 
ATOM   5673  C  C   . VAL C  1 179 ? 86.262  20.349  -15.546  1.00 34.21  ? 178 VAL C C   1 
ATOM   5674  O  O   . VAL C  1 179 ? 85.466  20.823  -14.728  1.00 38.21  ? 178 VAL C O   1 
ATOM   5675  C  CB  . VAL C  1 179 ? 86.235  20.964  -17.995  1.00 34.29  ? 178 VAL C CB  1 
ATOM   5676  C  CG1 . VAL C  1 179 ? 84.752  21.264  -17.945  1.00 30.37  ? 178 VAL C CG1 1 
ATOM   5677  C  CG2 . VAL C  1 179 ? 86.911  21.829  -19.084  1.00 34.31  ? 178 VAL C CG2 1 
ATOM   5678  N  N   . TRP C  1 180 ? 86.665  19.080  -15.514  1.00 33.29  ? 179 TRP C N   1 
ATOM   5679  C  CA  . TRP C  1 180 ? 86.154  18.139  -14.530  1.00 36.04  ? 179 TRP C CA  1 
ATOM   5680  C  C   . TRP C  1 180 ? 86.404  18.629  -13.108  1.00 42.09  ? 179 TRP C C   1 
ATOM   5681  O  O   . TRP C  1 180 ? 85.474  18.716  -12.311  1.00 35.58  ? 179 TRP C O   1 
ATOM   5682  C  CB  . TRP C  1 180 ? 86.780  16.761  -14.739  1.00 34.18  ? 179 TRP C CB  1 
ATOM   5683  C  CG  . TRP C  1 180 ? 86.365  15.749  -13.729  1.00 41.88  ? 179 TRP C CG  1 
ATOM   5684  C  CD1 . TRP C  1 180 ? 87.123  15.250  -12.712  1.00 41.43  ? 179 TRP C CD1 1 
ATOM   5685  C  CD2 . TRP C  1 180 ? 85.086  15.096  -13.640  1.00 34.51  ? 179 TRP C CD2 1 
ATOM   5686  N  NE1 . TRP C  1 180 ? 86.396  14.327  -11.994  1.00 39.64  ? 179 TRP C NE1 1 
ATOM   5687  C  CE2 . TRP C  1 180 ? 85.143  14.217  -12.544  1.00 35.78  ? 179 TRP C CE2 1 
ATOM   5688  C  CE3 . TRP C  1 180 ? 83.898  15.177  -14.384  1.00 36.11  ? 179 TRP C CE3 1 
ATOM   5689  C  CZ2 . TRP C  1 180 ? 84.064  13.412  -12.172  1.00 42.53  ? 179 TRP C CZ2 1 
ATOM   5690  C  CZ3 . TRP C  1 180 ? 82.822  14.386  -14.011  1.00 35.87  ? 179 TRP C CZ3 1 
ATOM   5691  C  CH2 . TRP C  1 180 ? 82.912  13.514  -12.912  1.00 35.03  ? 179 TRP C CH2 1 
ATOM   5692  N  N   . LYS C  1 181 ? 87.656  18.957  -12.796  1.00 43.43  ? 180 LYS C N   1 
ATOM   5693  C  CA  . LYS C  1 181 ? 88.017  19.413  -11.454  1.00 42.17  ? 180 LYS C CA  1 
ATOM   5694  C  C   . LYS C  1 181 ? 87.318  20.714  -11.090  1.00 45.34  ? 180 LYS C C   1 
ATOM   5695  O  O   . LYS C  1 181 ? 86.780  20.844  -9.991   1.00 40.36  ? 180 LYS C O   1 
ATOM   5696  C  CB  . LYS C  1 181 ? 89.539  19.589  -11.304  1.00 39.53  ? 180 LYS C CB  1 
ATOM   5697  C  CG  . LYS C  1 181 ? 90.306  18.290  -11.284  1.00 79.84  ? 180 LYS C CG  1 
ATOM   5698  C  CD  . LYS C  1 181 ? 91.801  18.525  -11.125  1.00 72.55  ? 180 LYS C CD  1 
ATOM   5699  C  CE  . LYS C  1 181 ? 92.531  17.214  -10.875  1.00 54.88  ? 180 LYS C CE  1 
ATOM   5700  N  NZ  . LYS C  1 181 ? 94.011  17.398  -10.817  1.00 68.30  ? 180 LYS C NZ  1 
ATOM   5701  N  N   . GLU C  1 182 ? 87.324  21.675  -12.008  1.00 37.38  ? 181 GLU C N   1 
ATOM   5702  C  CA  . GLU C  1 182 ? 86.764  22.998  -11.709  1.00 42.15  ? 181 GLU C CA  1 
ATOM   5703  C  C   . GLU C  1 182 ? 85.250  22.967  -11.554  1.00 45.67  ? 181 GLU C C   1 
ATOM   5704  O  O   . GLU C  1 182 ? 84.683  23.709  -10.751  1.00 42.15  ? 181 GLU C O   1 
ATOM   5705  C  CB  . GLU C  1 182 ? 87.165  24.020  -12.771  1.00 57.88  ? 181 GLU C CB  1 
ATOM   5706  C  CG  . GLU C  1 182 ? 88.659  24.251  -12.835  1.00 49.07  ? 181 GLU C CG  1 
ATOM   5707  C  CD  . GLU C  1 182 ? 89.058  25.626  -12.380  1.00 70.32  ? 181 GLU C CD  1 
ATOM   5708  O  OE1 . GLU C  1 182 ? 88.475  26.118  -11.391  1.00 96.04  ? 181 GLU C OE1 1 
ATOM   5709  O  OE2 . GLU C  1 182 ? 89.953  26.213  -13.021  1.00 86.93  ? 181 GLU C OE2 1 
HETATM 5710  N  N   . MSE C  1 183 ? 84.598  22.112  -12.328  1.00 35.65  ? 182 MSE C N   1 
HETATM 5711  C  CA  . MSE C  1 183 ? 83.164  21.899  -12.179  1.00 39.10  ? 182 MSE C CA  1 
HETATM 5712  C  C   . MSE C  1 183 ? 82.798  21.448  -10.763  1.00 37.27  ? 182 MSE C C   1 
HETATM 5713  O  O   . MSE C  1 183 ? 81.787  21.872  -10.205  1.00 35.92  ? 182 MSE C O   1 
HETATM 5714  C  CB  . MSE C  1 183 ? 82.680  20.864  -13.192  1.00 42.73  ? 182 MSE C CB  1 
HETATM 5715  C  CG  . MSE C  1 183 ? 81.197  20.590  -13.135  1.00 33.06  ? 182 MSE C CG  1 
HETATM 5716  SE SE  . MSE C  1 183 ? 80.617  19.499  -14.619  0.65 31.25  ? 182 MSE C SE  1 
HETATM 5717  C  CE  . MSE C  1 183 ? 81.751  17.948  -14.302  1.00 29.23  ? 182 MSE C CE  1 
ATOM   5718  N  N   . HIS C  1 184 ? 83.627  20.584  -10.188  1.00 41.98  ? 183 HIS C N   1 
ATOM   5719  C  CA  . HIS C  1 184 ? 83.344  20.032  -8.866   1.00 50.28  ? 183 HIS C CA  1 
ATOM   5720  C  C   . HIS C  1 184 ? 83.356  21.042  -7.713   1.00 57.26  ? 183 HIS C C   1 
ATOM   5721  O  O   . HIS C  1 184 ? 82.720  20.823  -6.681   1.00 52.79  ? 183 HIS C O   1 
ATOM   5722  C  CB  . HIS C  1 184 ? 84.236  18.816  -8.597   1.00 41.88  ? 183 HIS C CB  1 
ATOM   5723  C  CG  . HIS C  1 184 ? 83.716  17.579  -9.253   1.00 43.28  ? 183 HIS C CG  1 
ATOM   5724  N  ND1 . HIS C  1 184 ? 83.820  17.366  -10.611  1.00 36.13  ? 183 HIS C ND1 1 
ATOM   5725  C  CD2 . HIS C  1 184 ? 83.000  16.541  -8.761   1.00 41.99  ? 183 HIS C CD2 1 
ATOM   5726  C  CE1 . HIS C  1 184 ? 83.221  16.230  -10.920  1.00 35.83  ? 183 HIS C CE1 1 
ATOM   5727  N  NE2 . HIS C  1 184 ? 82.716  15.708  -9.816   1.00 39.15  ? 183 HIS C NE2 1 
ATOM   5728  N  N   . LYS C  1 185 ? 84.051  22.156  -7.907   1.00 40.23  ? 184 LYS C N   1 
ATOM   5729  C  CA  . LYS C  1 185 ? 84.046  23.239  -6.919   1.00 49.69  ? 184 LYS C CA  1 
ATOM   5730  C  C   . LYS C  1 185 ? 82.676  23.918  -6.753   1.00 59.11  ? 184 LYS C C   1 
ATOM   5731  O  O   . LYS C  1 185 ? 82.402  24.522  -5.720   1.00 57.16  ? 184 LYS C O   1 
ATOM   5732  C  CB  . LYS C  1 185 ? 85.110  24.283  -7.264   1.00 58.17  ? 184 LYS C CB  1 
ATOM   5733  C  CG  . LYS C  1 185 ? 86.496  23.687  -7.452   1.00 43.10  ? 184 LYS C CG  1 
ATOM   5734  C  CD  . LYS C  1 185 ? 87.612  24.680  -7.150   1.00 90.15  ? 184 LYS C CD  1 
ATOM   5735  C  CE  . LYS C  1 185 ? 87.723  25.765  -8.207   1.00 85.96  ? 184 LYS C CE  1 
ATOM   5736  N  NZ  . LYS C  1 185 ? 89.043  26.463  -8.093   1.00 72.32  ? 184 LYS C NZ  1 
ATOM   5737  N  N   . LEU C  1 186 ? 81.821  23.814  -7.764   1.00 52.90  ? 185 LEU C N   1 
ATOM   5738  C  CA  . LEU C  1 186 ? 80.495  24.430  -7.705   1.00 54.59  ? 185 LEU C CA  1 
ATOM   5739  C  C   . LEU C  1 186 ? 79.486  23.601  -6.894   1.00 63.26  ? 185 LEU C C   1 
ATOM   5740  O  O   . LEU C  1 186 ? 78.407  24.094  -6.520   1.00 58.05  ? 185 LEU C O   1 
ATOM   5741  C  CB  . LEU C  1 186 ? 79.952  24.661  -9.119   1.00 43.08  ? 185 LEU C CB  1 
ATOM   5742  C  CG  . LEU C  1 186 ? 80.866  25.372  -10.122  1.00 46.08  ? 185 LEU C CG  1 
ATOM   5743  C  CD1 . LEU C  1 186 ? 80.188  25.469  -11.490  1.00 40.92  ? 185 LEU C CD1 1 
ATOM   5744  C  CD2 . LEU C  1 186 ? 81.289  26.744  -9.624   1.00 53.87  ? 185 LEU C CD2 1 
ATOM   5745  N  N   . LEU C  1 187 ? 79.838  22.343  -6.638   1.00 55.95  ? 186 LEU C N   1 
ATOM   5746  C  CA  . LEU C  1 187 ? 79.009  21.449  -5.828   1.00 57.78  ? 186 LEU C CA  1 
ATOM   5747  C  C   . LEU C  1 187 ? 79.298  21.685  -4.346   1.00 78.87  ? 186 LEU C C   1 
ATOM   5748  O  O   . LEU C  1 187 ? 80.432  21.988  -3.976   1.00 75.76  ? 186 LEU C O   1 
ATOM   5749  C  CB  . LEU C  1 187 ? 79.268  19.981  -6.199   1.00 42.02  ? 186 LEU C CB  1 
ATOM   5750  C  CG  . LEU C  1 187 ? 78.955  19.552  -7.640   1.00 39.25  ? 186 LEU C CG  1 
ATOM   5751  C  CD1 . LEU C  1 187 ? 79.280  18.076  -7.820   1.00 61.84  ? 186 LEU C CD1 1 
ATOM   5752  C  CD2 . LEU C  1 187 ? 77.500  19.853  -8.036   1.00 44.39  ? 186 LEU C CD2 1 
ATOM   5753  N  N   . PRO C  1 188 ? 78.274  21.543  -3.489   1.00 62.54  ? 187 PRO C N   1 
ATOM   5754  C  CA  . PRO C  1 188 ? 76.921  21.117  -3.853   1.00 61.34  ? 187 PRO C CA  1 
ATOM   5755  C  C   . PRO C  1 188 ? 75.948  22.281  -4.022   1.00 62.47  ? 187 PRO C C   1 
ATOM   5756  O  O   . PRO C  1 188 ? 76.239  23.410  -3.635   1.00 57.17  ? 187 PRO C O   1 
ATOM   5757  C  CB  . PRO C  1 188 ? 76.510  20.286  -2.640   1.00 75.07  ? 187 PRO C CB  1 
ATOM   5758  C  CG  . PRO C  1 188 ? 77.160  21.021  -1.484   1.00 71.83  ? 187 PRO C CG  1 
ATOM   5759  C  CD  . PRO C  1 188 ? 78.428  21.662  -2.026   1.00 65.22  ? 187 PRO C CD  1 
ATOM   5760  N  N   . PHE C  1 189 ? 74.793  21.999  -4.612   1.00 50.35  ? 188 PHE C N   1 
ATOM   5761  C  CA  . PHE C  1 189 ? 73.691  22.943  -4.566   1.00 45.01  ? 188 PHE C CA  1 
ATOM   5762  C  C   . PHE C  1 189 ? 72.378  22.210  -4.314   1.00 48.66  ? 188 PHE C C   1 
ATOM   5763  O  O   . PHE C  1 189 ? 72.299  20.989  -4.425   1.00 55.36  ? 188 PHE C O   1 
ATOM   5764  C  CB  . PHE C  1 189 ? 73.627  23.837  -5.814   1.00 47.00  ? 188 PHE C CB  1 
ATOM   5765  C  CG  . PHE C  1 189 ? 73.647  23.090  -7.117   1.00 51.71  ? 188 PHE C CG  1 
ATOM   5766  C  CD1 . PHE C  1 189 ? 72.515  22.437  -7.584   1.00 44.15  ? 188 PHE C CD1 1 
ATOM   5767  C  CD2 . PHE C  1 189 ? 74.794  23.071  -7.893   1.00 51.40  ? 188 PHE C CD2 1 
ATOM   5768  C  CE1 . PHE C  1 189 ? 72.536  21.758  -8.799   1.00 46.81  ? 188 PHE C CE1 1 
ATOM   5769  C  CE2 . PHE C  1 189 ? 74.823  22.398  -9.094   1.00 53.08  ? 188 PHE C CE2 1 
ATOM   5770  C  CZ  . PHE C  1 189 ? 73.692  21.740  -9.551   1.00 71.62  ? 188 PHE C CZ  1 
ATOM   5771  N  N   . SER C  1 190 ? 71.355  22.971  -3.963   1.00 46.32  ? 189 SER C N   1 
ATOM   5772  C  CA  . SER C  1 190 ? 70.106  22.403  -3.480   1.00 60.73  ? 189 SER C CA  1 
ATOM   5773  C  C   . SER C  1 190 ? 69.317  21.684  -4.559   1.00 58.91  ? 189 SER C C   1 
ATOM   5774  O  O   . SER C  1 190 ? 69.145  22.202  -5.660   1.00 41.55  ? 189 SER C O   1 
ATOM   5775  C  CB  . SER C  1 190 ? 69.230  23.491  -2.859   1.00 66.25  ? 189 SER C CB  1 
ATOM   5776  O  OG  . SER C  1 190 ? 67.962  22.963  -2.515   1.00 89.14  ? 189 SER C OG  1 
ATOM   5777  N  N   . PRO C  1 191 ? 68.807  20.493  -4.221   1.00 91.51  ? 190 PRO C N   1 
ATOM   5778  C  CA  . PRO C  1 191 ? 67.972  19.678  -5.106   1.00 104.13 ? 190 PRO C CA  1 
ATOM   5779  C  C   . PRO C  1 191 ? 66.771  20.442  -5.663   1.00 72.93  ? 190 PRO C C   1 
ATOM   5780  O  O   . PRO C  1 191 ? 65.944  20.962  -4.910   1.00 58.83  ? 190 PRO C O   1 
ATOM   5781  C  CB  . PRO C  1 191 ? 67.485  18.548  -4.184   1.00 86.46  ? 190 PRO C CB  1 
ATOM   5782  C  CG  . PRO C  1 191 ? 67.695  19.061  -2.785   1.00 97.20  ? 190 PRO C CG  1 
ATOM   5783  C  CD  . PRO C  1 191 ? 68.935  19.887  -2.884   1.00 104.02 ? 190 PRO C CD  1 
ATOM   5784  N  N   . ASP C  1 192 ? 66.708  20.527  -6.983   1.00 53.34  ? 191 ASP C N   1 
ATOM   5785  C  CA  . ASP C  1 192 ? 65.490  20.918  -7.664   1.00 51.61  ? 191 ASP C CA  1 
ATOM   5786  C  C   . ASP C  1 192 ? 65.221  19.823  -8.685   1.00 67.22  ? 191 ASP C C   1 
ATOM   5787  O  O   . ASP C  1 192 ? 66.150  19.296  -9.300   1.00 58.22  ? 191 ASP C O   1 
ATOM   5788  C  CB  . ASP C  1 192 ? 65.657  22.273  -8.338   1.00 62.32  ? 191 ASP C CB  1 
ATOM   5789  C  CG  . ASP C  1 192 ? 64.559  22.563  -9.332   1.00 78.31  ? 191 ASP C CG  1 
ATOM   5790  O  OD1 . ASP C  1 192 ? 64.653  22.045  -10.469  1.00 44.51  ? 191 ASP C OD1 1 
ATOM   5791  O  OD2 . ASP C  1 192 ? 63.615  23.309  -8.981   1.00 57.60  ? 191 ASP C OD2 1 
ATOM   5792  N  N   . SER C  1 193 ? 63.962  19.447  -8.846   1.00 33.50  ? 192 SER C N   1 
ATOM   5793  C  CA  . SER C  1 193 ? 63.643  18.340  -9.736   1.00 38.19  ? 192 SER C CA  1 
ATOM   5794  C  C   . SER C  1 193 ? 62.391  18.608  -10.553  1.00 30.93  ? 192 SER C C   1 
ATOM   5795  O  O   . SER C  1 193 ? 61.311  18.794  -9.994   1.00 35.01  ? 192 SER C O   1 
ATOM   5796  C  CB  . SER C  1 193 ? 63.480  17.043  -8.937   1.00 44.60  ? 192 SER C CB  1 
ATOM   5797  O  OG  . SER C  1 193 ? 64.689  16.712  -8.278   1.00 44.28  ? 192 SER C OG  1 
ATOM   5798  N  N   . VAL C  1 194 ? 62.549  18.620  -11.870  1.00 27.54  ? 193 VAL C N   1 
ATOM   5799  C  CA  . VAL C  1 194 ? 61.416  18.724  -12.789  1.00 30.28  ? 193 VAL C CA  1 
ATOM   5800  C  C   . VAL C  1 194 ? 61.688  17.753  -13.935  1.00 27.99  ? 193 VAL C C   1 
ATOM   5801  O  O   . VAL C  1 194 ? 62.807  17.282  -14.092  1.00 32.24  ? 193 VAL C O   1 
ATOM   5802  C  CB  . VAL C  1 194 ? 61.239  20.176  -13.360  1.00 26.92  ? 193 VAL C CB  1 
ATOM   5803  C  CG1 . VAL C  1 194 ? 60.983  21.181  -12.259  1.00 33.60  ? 193 VAL C CG1 1 
ATOM   5804  C  CG2 . VAL C  1 194 ? 62.456  20.590  -14.218  1.00 25.14  ? 193 VAL C CG2 1 
ATOM   5805  N  N   . VAL C  1 195 ? 60.659  17.425  -14.708  1.00 29.95  ? 194 VAL C N   1 
ATOM   5806  C  CA  . VAL C  1 195 ? 60.863  16.750  -15.987  1.00 26.55  ? 194 VAL C CA  1 
ATOM   5807  C  C   . VAL C  1 195 ? 61.627  17.664  -16.946  1.00 28.83  ? 194 VAL C C   1 
ATOM   5808  O  O   . VAL C  1 195 ? 61.144  18.748  -17.280  1.00 31.91  ? 194 VAL C O   1 
ATOM   5809  C  CB  . VAL C  1 195 ? 59.500  16.384  -16.628  1.00 26.10  ? 194 VAL C CB  1 
ATOM   5810  C  CG1 . VAL C  1 195 ? 59.700  15.732  -17.980  1.00 31.27  ? 194 VAL C CG1 1 
ATOM   5811  C  CG2 . VAL C  1 195 ? 58.697  15.445  -15.698  1.00 28.83  ? 194 VAL C CG2 1 
ATOM   5812  N  N   . THR C  1 196 ? 62.807  17.226  -17.388  1.00 27.57  ? 195 THR C N   1 
ATOM   5813  C  CA  . THR C  1 196 ? 63.649  18.016  -18.297  1.00 29.01  ? 195 THR C CA  1 
ATOM   5814  C  C   . THR C  1 196 ? 63.819  17.329  -19.657  1.00 33.13  ? 195 THR C C   1 
ATOM   5815  O  O   . THR C  1 196 ? 63.637  16.109  -19.782  1.00 32.24  ? 195 THR C O   1 
ATOM   5816  C  CB  . THR C  1 196 ? 65.058  18.266  -17.706  1.00 29.62  ? 195 THR C CB  1 
ATOM   5817  O  OG1 . THR C  1 196 ? 65.718  17.007  -17.508  1.00 32.89  ? 195 THR C OG1 1 
ATOM   5818  C  CG2 . THR C  1 196 ? 64.969  19.001  -16.367  1.00 26.07  ? 195 THR C CG2 1 
ATOM   5819  N  N   . HIS C  1 197 ? 64.142  18.132  -20.670  1.00 26.69  ? 196 HIS C N   1 
ATOM   5820  C  CA  . HIS C  1 197 ? 64.409  17.658  -22.031  1.00 32.23  ? 196 HIS C CA  1 
ATOM   5821  C  C   . HIS C  1 197 ? 65.818  17.084  -22.127  1.00 29.85  ? 196 HIS C C   1 
ATOM   5822  O  O   . HIS C  1 197 ? 66.031  16.013  -22.712  1.00 32.69  ? 196 HIS C O   1 
ATOM   5823  C  CB  . HIS C  1 197 ? 64.293  18.825  -23.026  1.00 25.91  ? 196 HIS C CB  1 
ATOM   5824  C  CG  . HIS C  1 197 ? 64.587  18.446  -24.447  1.00 34.95  ? 196 HIS C CG  1 
ATOM   5825  N  ND1 . HIS C  1 197 ? 65.868  18.409  -24.964  1.00 30.37  ? 196 HIS C ND1 1 
ATOM   5826  C  CD2 . HIS C  1 197 ? 63.760  18.114  -25.469  1.00 28.16  ? 196 HIS C CD2 1 
ATOM   5827  C  CE1 . HIS C  1 197 ? 65.818  18.053  -26.236  1.00 32.53  ? 196 HIS C CE1 1 
ATOM   5828  N  NE2 . HIS C  1 197 ? 64.552  17.853  -26.564  1.00 29.01  ? 196 HIS C NE2 1 
ATOM   5829  N  N   . GLY C  1 198 ? 66.781  17.823  -21.587  1.00 28.20  ? 197 GLY C N   1 
ATOM   5830  C  CA  . GLY C  1 198 ? 68.157  17.333  -21.510  1.00 28.81  ? 197 GLY C CA  1 
ATOM   5831  C  C   . GLY C  1 198 ? 69.090  17.905  -22.568  1.00 38.35  ? 197 GLY C C   1 
ATOM   5832  O  O   . GLY C  1 198 ? 70.305  17.939  -22.384  1.00 32.29  ? 197 GLY C O   1 
ATOM   5833  N  N   . ASP C  1 199 ? 68.527  18.358  -23.683  1.00 32.72  ? 198 ASP C N   1 
ATOM   5834  C  CA  . ASP C  1 199 ? 69.315  19.034  -24.714  1.00 29.30  ? 198 ASP C CA  1 
ATOM   5835  C  C   . ASP C  1 199 ? 68.456  20.114  -25.365  1.00 31.80  ? 198 ASP C C   1 
ATOM   5836  O  O   . ASP C  1 199 ? 68.153  20.061  -26.553  1.00 32.26  ? 198 ASP C O   1 
ATOM   5837  C  CB  . ASP C  1 199 ? 69.840  18.024  -25.749  1.00 31.44  ? 198 ASP C CB  1 
ATOM   5838  C  CG  . ASP C  1 199 ? 70.940  18.603  -26.643  1.00 39.31  ? 198 ASP C CG  1 
ATOM   5839  O  OD1 . ASP C  1 199 ? 71.344  19.776  -26.445  1.00 36.45  ? 198 ASP C OD1 1 
ATOM   5840  O  OD2 . ASP C  1 199 ? 71.411  17.867  -27.541  1.00 40.81  ? 198 ASP C OD2 1 
ATOM   5841  N  N   . PHE C  1 200 ? 68.080  21.102  -24.564  1.00 29.31  ? 199 PHE C N   1 
ATOM   5842  C  CA  . PHE C  1 200 ? 67.067  22.079  -24.948  1.00 27.88  ? 199 PHE C CA  1 
ATOM   5843  C  C   . PHE C  1 200 ? 67.766  23.249  -25.651  1.00 28.04  ? 199 PHE C C   1 
ATOM   5844  O  O   . PHE C  1 200 ? 67.858  24.359  -25.117  1.00 32.18  ? 199 PHE C O   1 
ATOM   5845  C  CB  . PHE C  1 200 ? 66.313  22.572  -23.713  1.00 25.56  ? 199 PHE C CB  1 
ATOM   5846  C  CG  . PHE C  1 200 ? 64.947  23.167  -24.020  1.00 29.36  ? 199 PHE C CG  1 
ATOM   5847  C  CD1 . PHE C  1 200 ? 63.870  22.337  -24.299  1.00 35.79  ? 199 PHE C CD1 1 
ATOM   5848  C  CD2 . PHE C  1 200 ? 64.755  24.545  -24.018  1.00 30.44  ? 199 PHE C CD2 1 
ATOM   5849  C  CE1 . PHE C  1 200 ? 62.614  22.859  -24.569  1.00 33.11  ? 199 PHE C CE1 1 
ATOM   5850  C  CE2 . PHE C  1 200 ? 63.484  25.092  -24.285  1.00 30.76  ? 199 PHE C CE2 1 
ATOM   5851  C  CZ  . PHE C  1 200 ? 62.420  24.242  -24.562  1.00 38.78  ? 199 PHE C CZ  1 
ATOM   5852  N  N   . SER C  1 201 ? 68.250  22.967  -26.850  1.00 32.62  ? 200 SER C N   1 
ATOM   5853  C  CA  . SER C  1 201 ? 69.012  23.933  -27.647  1.00 30.75  ? 200 SER C CA  1 
ATOM   5854  C  C   . SER C  1 201 ? 68.101  24.497  -28.748  1.00 37.15  ? 200 SER C C   1 
ATOM   5855  O  O   . SER C  1 201 ? 66.990  24.006  -28.952  1.00 32.44  ? 200 SER C O   1 
ATOM   5856  C  CB  . SER C  1 201 ? 70.198  23.218  -28.280  1.00 33.02  ? 200 SER C CB  1 
ATOM   5857  O  OG  . SER C  1 201 ? 69.738  22.383  -29.333  1.00 35.89  ? 200 SER C OG  1 
ATOM   5858  N  N   . LEU C  1 202 ? 68.560  25.522  -29.463  1.00 32.76  ? 201 LEU C N   1 
ATOM   5859  C  CA  . LEU C  1 202 ? 67.755  26.088  -30.540  1.00 32.74  ? 201 LEU C CA  1 
ATOM   5860  C  C   . LEU C  1 202 ? 67.580  25.134  -31.727  1.00 34.32  ? 201 LEU C C   1 
ATOM   5861  O  O   . LEU C  1 202 ? 66.706  25.338  -32.559  1.00 33.45  ? 201 LEU C O   1 
ATOM   5862  C  CB  . LEU C  1 202 ? 68.345  27.429  -31.020  1.00 34.78  ? 201 LEU C CB  1 
ATOM   5863  C  CG  . LEU C  1 202 ? 68.425  28.573  -29.999  1.00 39.84  ? 201 LEU C CG  1 
ATOM   5864  C  CD1 . LEU C  1 202 ? 69.238  29.759  -30.569  1.00 29.42  ? 201 LEU C CD1 1 
ATOM   5865  C  CD2 . LEU C  1 202 ? 67.032  29.031  -29.533  1.00 33.80  ? 201 LEU C CD2 1 
ATOM   5866  N  N   . ASP C  1 203 ? 68.403  24.091  -31.803  1.00 29.72  ? 202 ASP C N   1 
ATOM   5867  C  CA  . ASP C  1 203 ? 68.277  23.096  -32.865  1.00 29.52  ? 202 ASP C CA  1 
ATOM   5868  C  C   . ASP C  1 203 ? 67.141  22.105  -32.616  1.00 34.88  ? 202 ASP C C   1 
ATOM   5869  O  O   . ASP C  1 203 ? 66.761  21.363  -33.521  1.00 30.52  ? 202 ASP C O   1 
ATOM   5870  C  CB  . ASP C  1 203 ? 69.561  22.272  -32.992  1.00 35.92  ? 202 ASP C CB  1 
ATOM   5871  C  CG  . ASP C  1 203 ? 70.770  23.113  -33.329  1.00 55.07  ? 202 ASP C CG  1 
ATOM   5872  O  OD1 . ASP C  1 203 ? 70.618  24.090  -34.091  1.00 45.58  ? 202 ASP C OD1 1 
ATOM   5873  O  OD2 . ASP C  1 203 ? 71.869  22.795  -32.828  1.00 51.03  ? 202 ASP C OD2 1 
ATOM   5874  N  N   . ASN C  1 204 ? 66.644  22.045  -31.384  1.00 30.94  ? 203 ASN C N   1 
ATOM   5875  C  CA  . ASN C  1 204 ? 65.750  20.941  -30.999  1.00 29.88  ? 203 ASN C CA  1 
ATOM   5876  C  C   . ASN C  1 204 ? 64.295  21.350  -30.778  1.00 33.67  ? 203 ASN C C   1 
ATOM   5877  O  O   . ASN C  1 204 ? 63.462  20.547  -30.349  1.00 33.69  ? 203 ASN C O   1 
ATOM   5878  C  CB  . ASN C  1 204 ? 66.320  20.194  -29.788  1.00 34.51  ? 203 ASN C CB  1 
ATOM   5879  C  CG  . ASN C  1 204 ? 67.522  19.358  -30.156  1.00 30.72  ? 203 ASN C CG  1 
ATOM   5880  O  OD1 . ASN C  1 204 ? 67.704  19.026  -31.332  1.00 32.42  ? 203 ASN C OD1 1 
ATOM   5881  N  ND2 . ASN C  1 204 ? 68.355  19.011  -29.169  1.00 27.26  ? 203 ASN C ND2 1 
ATOM   5882  N  N   . LEU C  1 205 ? 63.996  22.605  -31.085  1.00 31.71  ? 204 LEU C N   1 
ATOM   5883  C  CA  . LEU C  1 205 ? 62.634  23.109  -30.991  1.00 35.44  ? 204 LEU C CA  1 
ATOM   5884  C  C   . LEU C  1 205 ? 62.171  23.534  -32.375  1.00 38.08  ? 204 LEU C C   1 
ATOM   5885  O  O   . LEU C  1 205 ? 62.911  24.199  -33.092  1.00 35.48  ? 204 LEU C O   1 
ATOM   5886  C  CB  . LEU C  1 205 ? 62.588  24.259  -29.987  1.00 31.06  ? 204 LEU C CB  1 
ATOM   5887  C  CG  . LEU C  1 205 ? 62.820  23.614  -28.618  1.00 41.19  ? 204 LEU C CG  1 
ATOM   5888  C  CD1 . LEU C  1 205 ? 63.719  24.413  -27.719  1.00 50.74  ? 204 LEU C CD1 1 
ATOM   5889  C  CD2 . LEU C  1 205 ? 61.476  23.314  -27.961  1.00 36.18  ? 204 LEU C CD2 1 
ATOM   5890  N  N   . ILE C  1 206 ? 60.956  23.134  -32.757  1.00 32.29  ? 205 ILE C N   1 
ATOM   5891  C  CA  . ILE C  1 206 ? 60.509  23.301  -34.130  1.00 34.57  ? 205 ILE C CA  1 
ATOM   5892  C  C   . ILE C  1 206 ? 59.352  24.294  -34.255  1.00 46.42  ? 205 ILE C C   1 
ATOM   5893  O  O   . ILE C  1 206 ? 58.341  24.187  -33.544  1.00 33.63  ? 205 ILE C O   1 
ATOM   5894  C  CB  . ILE C  1 206 ? 60.118  21.941  -34.761  1.00 35.40  ? 205 ILE C CB  1 
ATOM   5895  C  CG1 . ILE C  1 206 ? 61.251  20.927  -34.576  1.00 33.76  ? 205 ILE C CG1 1 
ATOM   5896  C  CG2 . ILE C  1 206 ? 59.799  22.096  -36.251  1.00 33.59  ? 205 ILE C CG2 1 
ATOM   5897  C  CD1 . ILE C  1 206 ? 62.549  21.351  -35.236  1.00 41.91  ? 205 ILE C CD1 1 
ATOM   5898  N  N   . PHE C  1 207 ? 59.522  25.263  -35.158  1.00 31.35  ? 206 PHE C N   1 
ATOM   5899  C  CA  . PHE C  1 207 ? 58.508  26.285  -35.426  1.00 37.26  ? 206 PHE C CA  1 
ATOM   5900  C  C   . PHE C  1 207 ? 57.879  26.040  -36.786  1.00 35.16  ? 206 PHE C C   1 
ATOM   5901  O  O   . PHE C  1 207 ? 58.577  25.768  -37.769  1.00 38.65  ? 206 PHE C O   1 
ATOM   5902  C  CB  . PHE C  1 207 ? 59.131  27.688  -35.429  1.00 38.17  ? 206 PHE C CB  1 
ATOM   5903  C  CG  . PHE C  1 207 ? 59.354  28.271  -34.057  1.00 34.51  ? 206 PHE C CG  1 
ATOM   5904  C  CD1 . PHE C  1 207 ? 60.480  27.953  -33.331  1.00 32.06  ? 206 PHE C CD1 1 
ATOM   5905  C  CD2 . PHE C  1 207 ? 58.437  29.153  -33.506  1.00 46.49  ? 206 PHE C CD2 1 
ATOM   5906  C  CE1 . PHE C  1 207 ? 60.689  28.481  -32.063  1.00 41.42  ? 206 PHE C CE1 1 
ATOM   5907  C  CE2 . PHE C  1 207 ? 58.637  29.692  -32.245  1.00 40.51  ? 206 PHE C CE2 1 
ATOM   5908  C  CZ  . PHE C  1 207 ? 59.770  29.355  -31.519  1.00 41.52  ? 206 PHE C CZ  1 
ATOM   5909  N  N   . ASP C  1 208 ? 56.560  26.150  -36.871  1.00 42.98  ? 207 ASP C N   1 
ATOM   5910  C  CA  . ASP C  1 208 ? 55.913  26.013  -38.168  1.00 40.97  ? 207 ASP C CA  1 
ATOM   5911  C  C   . ASP C  1 208 ? 54.807  27.031  -38.293  1.00 39.15  ? 207 ASP C C   1 
ATOM   5912  O  O   . ASP C  1 208 ? 53.996  27.193  -37.374  1.00 47.79  ? 207 ASP C O   1 
ATOM   5913  C  CB  . ASP C  1 208 ? 55.362  24.607  -38.362  1.00 52.14  ? 207 ASP C CB  1 
ATOM   5914  C  CG  . ASP C  1 208 ? 54.874  24.371  -39.776  1.00 72.76  ? 207 ASP C CG  1 
ATOM   5915  O  OD1 . ASP C  1 208 ? 55.512  24.892  -40.716  1.00 49.69  ? 207 ASP C OD1 1 
ATOM   5916  O  OD2 . ASP C  1 208 ? 53.855  23.671  -39.946  1.00 61.43  ? 207 ASP C OD2 1 
ATOM   5917  N  N   . GLU C  1 209 ? 54.792  27.727  -39.422  1.00 50.49  ? 208 GLU C N   1 
ATOM   5918  C  CA  . GLU C  1 209 ? 53.849  28.816  -39.644  1.00 61.91  ? 208 GLU C CA  1 
ATOM   5919  C  C   . GLU C  1 209 ? 53.800  29.764  -38.446  1.00 55.03  ? 208 GLU C C   1 
ATOM   5920  O  O   . GLU C  1 209 ? 52.721  30.159  -38.003  1.00 51.03  ? 208 GLU C O   1 
ATOM   5921  C  CB  . GLU C  1 209 ? 52.459  28.261  -39.953  1.00 56.48  ? 208 GLU C CB  1 
ATOM   5922  C  CG  . GLU C  1 209 ? 52.464  27.246  -41.090  1.00 72.56  ? 208 GLU C CG  1 
ATOM   5923  C  CD  . GLU C  1 209 ? 51.085  26.990  -41.667  1.00 86.39  ? 208 GLU C CD  1 
ATOM   5924  O  OE1 . GLU C  1 209 ? 50.989  26.831  -42.902  1.00 99.52  ? 208 GLU C OE1 1 
ATOM   5925  O  OE2 . GLU C  1 209 ? 50.101  26.941  -40.895  1.00 70.62  ? 208 GLU C OE2 1 
ATOM   5926  N  N   . GLY C  1 210 ? 54.975  30.090  -37.911  1.00 63.74  ? 209 GLY C N   1 
ATOM   5927  C  CA  . GLY C  1 210 ? 55.107  31.092  -36.864  1.00 52.74  ? 209 GLY C CA  1 
ATOM   5928  C  C   . GLY C  1 210 ? 54.831  30.644  -35.441  1.00 66.02  ? 209 GLY C C   1 
ATOM   5929  O  O   . GLY C  1 210 ? 54.863  31.458  -34.512  1.00 48.70  ? 209 GLY C O   1 
ATOM   5930  N  N   . LYS C  1 211 ? 54.556  29.356  -35.258  1.00 42.49  ? 210 LYS C N   1 
ATOM   5931  C  CA  . LYS C  1 211 ? 54.224  28.842  -33.937  1.00 46.02  ? 210 LYS C CA  1 
ATOM   5932  C  C   . LYS C  1 211 ? 55.171  27.709  -33.552  1.00 34.54  ? 210 LYS C C   1 
ATOM   5933  O  O   . LYS C  1 211 ? 55.544  26.897  -34.392  1.00 38.42  ? 210 LYS C O   1 
ATOM   5934  C  CB  . LYS C  1 211 ? 52.786  28.325  -33.915  1.00 53.73  ? 210 LYS C CB  1 
ATOM   5935  C  CG  . LYS C  1 211 ? 51.791  29.181  -34.698  1.00 69.14  ? 210 LYS C CG  1 
ATOM   5936  C  CD  . LYS C  1 211 ? 51.554  30.540  -34.043  1.00 71.32  ? 210 LYS C CD  1 
ATOM   5937  C  CE  . LYS C  1 211 ? 50.612  31.402  -34.893  1.00 99.22  ? 210 LYS C CE  1 
ATOM   5938  N  NZ  . LYS C  1 211 ? 50.158  32.647  -34.196  1.00 73.54  ? 210 LYS C NZ  1 
ATOM   5939  N  N   . LEU C  1 212 ? 55.546  27.661  -32.280  1.00 42.94  ? 211 LEU C N   1 
ATOM   5940  C  CA  . LEU C  1 212 ? 56.367  26.570  -31.763  1.00 36.48  ? 211 LEU C CA  1 
ATOM   5941  C  C   . LEU C  1 212 ? 55.505  25.317  -31.649  1.00 51.30  ? 211 LEU C C   1 
ATOM   5942  O  O   . LEU C  1 212 ? 54.618  25.253  -30.808  1.00 49.88  ? 211 LEU C O   1 
ATOM   5943  C  CB  . LEU C  1 212 ? 56.924  26.960  -30.393  1.00 42.45  ? 211 LEU C CB  1 
ATOM   5944  C  CG  . LEU C  1 212 ? 57.854  25.976  -29.688  1.00 56.04  ? 211 LEU C CG  1 
ATOM   5945  C  CD1 . LEU C  1 212 ? 58.875  25.474  -30.660  1.00 37.63  ? 211 LEU C CD1 1 
ATOM   5946  C  CD2 . LEU C  1 212 ? 58.551  26.663  -28.524  1.00 47.41  ? 211 LEU C CD2 1 
ATOM   5947  N  N   . ILE C  1 213 ? 55.758  24.319  -32.489  1.00 37.95  ? 212 ILE C N   1 
ATOM   5948  C  CA  . ILE C  1 213 ? 54.867  23.162  -32.535  1.00 32.55  ? 212 ILE C CA  1 
ATOM   5949  C  C   . ILE C  1 213 ? 55.416  21.844  -31.987  1.00 43.53  ? 212 ILE C C   1 
ATOM   5950  O  O   . ILE C  1 213 ? 54.709  20.842  -31.981  1.00 44.43  ? 212 ILE C O   1 
ATOM   5951  C  CB  . ILE C  1 213 ? 54.279  22.920  -33.938  1.00 39.12  ? 212 ILE C CB  1 
ATOM   5952  C  CG1 . ILE C  1 213 ? 55.377  22.585  -34.951  1.00 37.72  ? 212 ILE C CG1 1 
ATOM   5953  C  CG2 . ILE C  1 213 ? 53.444  24.128  -34.394  1.00 51.66  ? 212 ILE C CG2 1 
ATOM   5954  C  CD1 . ILE C  1 213 ? 54.838  21.888  -36.176  1.00 50.87  ? 212 ILE C CD1 1 
ATOM   5955  N  N   . GLY C  1 214 ? 56.654  21.823  -31.518  1.00 37.31  ? 213 GLY C N   1 
ATOM   5956  C  CA  . GLY C  1 214 ? 57.167  20.591  -30.941  1.00 33.93  ? 213 GLY C CA  1 
ATOM   5957  C  C   . GLY C  1 214 ? 58.645  20.596  -30.638  1.00 45.37  ? 213 GLY C C   1 
ATOM   5958  O  O   . GLY C  1 214 ? 59.346  21.542  -30.976  1.00 34.80  ? 213 GLY C O   1 
ATOM   5959  N  N   . CYS C  1 215 ? 59.124  19.541  -29.984  1.00 37.75  ? 214 CYS C N   1 
ATOM   5960  C  CA  . CYS C  1 215 ? 60.561  19.401  -29.750  1.00 30.51  ? 214 CYS C CA  1 
ATOM   5961  C  C   . CYS C  1 215 ? 61.026  18.024  -30.248  1.00 35.61  ? 214 CYS C C   1 
ATOM   5962  O  O   . CYS C  1 215 ? 60.217  17.107  -30.434  1.00 34.37  ? 214 CYS C O   1 
ATOM   5963  C  CB  . CYS C  1 215 ? 60.899  19.621  -28.269  1.00 33.17  ? 214 CYS C CB  1 
ATOM   5964  S  SG  . CYS C  1 215 ? 60.088  18.436  -27.160  1.00 40.37  ? 214 CYS C SG  1 
ATOM   5965  N  N   . ILE C  1 216 ? 62.323  17.886  -30.493  1.00 30.65  ? 215 ILE C N   1 
ATOM   5966  C  CA  . ILE C  1 216 ? 62.872  16.664  -31.051  1.00 31.63  ? 215 ILE C CA  1 
ATOM   5967  C  C   . ILE C  1 216 ? 64.109  16.292  -30.245  1.00 33.08  ? 215 ILE C C   1 
ATOM   5968  O  O   . ILE C  1 216 ? 64.492  17.035  -29.350  1.00 32.62  ? 215 ILE C O   1 
ATOM   5969  C  CB  . ILE C  1 216 ? 63.264  16.864  -32.539  1.00 29.69  ? 215 ILE C CB  1 
ATOM   5970  C  CG1 . ILE C  1 216 ? 64.244  18.038  -32.670  1.00 28.29  ? 215 ILE C CG1 1 
ATOM   5971  C  CG2 . ILE C  1 216 ? 62.025  17.139  -33.411  1.00 32.28  ? 215 ILE C CG2 1 
ATOM   5972  C  CD1 . ILE C  1 216 ? 64.806  18.208  -34.086  1.00 33.13  ? 215 ILE C CD1 1 
ATOM   5973  N  N   . ASP C  1 217 ? 64.725  15.149  -30.555  1.00 30.28  ? 216 ASP C N   1 
ATOM   5974  C  CA  . ASP C  1 217 ? 65.972  14.742  -29.898  1.00 33.31  ? 216 ASP C CA  1 
ATOM   5975  C  C   . ASP C  1 217 ? 65.828  14.617  -28.387  1.00 40.10  ? 216 ASP C C   1 
ATOM   5976  O  O   . ASP C  1 217 ? 66.511  15.310  -27.636  1.00 31.59  ? 216 ASP C O   1 
ATOM   5977  C  CB  . ASP C  1 217 ? 67.107  15.729  -30.212  1.00 38.19  ? 216 ASP C CB  1 
ATOM   5978  C  CG  . ASP C  1 217 ? 67.973  15.269  -31.358  1.00 51.94  ? 216 ASP C CG  1 
ATOM   5979  O  OD1 . ASP C  1 217 ? 68.012  14.045  -31.622  1.00 55.14  ? 216 ASP C OD1 1 
ATOM   5980  O  OD2 . ASP C  1 217 ? 68.621  16.129  -31.990  1.00 85.51  ? 216 ASP C OD2 1 
ATOM   5981  N  N   . VAL C  1 218 ? 64.959  13.711  -27.948  1.00 32.47  ? 217 VAL C N   1 
ATOM   5982  C  CA  . VAL C  1 218 ? 64.591  13.640  -26.545  1.00 38.79  ? 217 VAL C CA  1 
ATOM   5983  C  C   . VAL C  1 218 ? 65.313  12.534  -25.781  1.00 45.68  ? 217 VAL C C   1 
ATOM   5984  O  O   . VAL C  1 218 ? 64.861  12.115  -24.721  1.00 33.27  ? 217 VAL C O   1 
ATOM   5985  C  CB  . VAL C  1 218 ? 63.062  13.502  -26.394  1.00 28.64  ? 217 VAL C CB  1 
ATOM   5986  C  CG1 . VAL C  1 218 ? 62.353  14.725  -26.990  1.00 29.73  ? 217 VAL C CG1 1 
ATOM   5987  C  CG2 . VAL C  1 218 ? 62.556  12.212  -27.055  1.00 32.30  ? 217 VAL C CG2 1 
ATOM   5988  N  N   . GLY C  1 219 ? 66.452  12.082  -26.303  1.00 29.26  ? 218 GLY C N   1 
ATOM   5989  C  CA  . GLY C  1 219 ? 67.160  10.973  -25.698  1.00 30.45  ? 218 GLY C CA  1 
ATOM   5990  C  C   . GLY C  1 219 ? 67.729  11.197  -24.308  1.00 35.61  ? 218 GLY C C   1 
ATOM   5991  O  O   . GLY C  1 219 ? 68.097  10.234  -23.645  1.00 30.81  ? 218 GLY C O   1 
ATOM   5992  N  N   . ARG C  1 220 ? 67.806  12.450  -23.865  1.00 32.52  ? 219 ARG C N   1 
ATOM   5993  C  CA  . ARG C  1 220 ? 68.307  12.757  -22.520  1.00 28.96  ? 219 ARG C CA  1 
ATOM   5994  C  C   . ARG C  1 220 ? 67.202  13.161  -21.549  1.00 30.55  ? 219 ARG C C   1 
ATOM   5995  O  O   . ARG C  1 220 ? 67.473  13.622  -20.438  1.00 29.45  ? 219 ARG C O   1 
ATOM   5996  C  CB  . ARG C  1 220 ? 69.414  13.820  -22.581  1.00 35.19  ? 219 ARG C CB  1 
ATOM   5997  C  CG  . ARG C  1 220 ? 70.647  13.346  -23.387  1.00 32.89  ? 219 ARG C CG  1 
ATOM   5998  C  CD  . ARG C  1 220 ? 71.695  14.450  -23.638  1.00 38.98  ? 219 ARG C CD  1 
ATOM   5999  N  NE  . ARG C  1 220 ? 72.823  13.877  -24.381  1.00 45.73  ? 219 ARG C NE  1 
ATOM   6000  C  CZ  . ARG C  1 220 ? 73.605  14.536  -25.236  1.00 83.26  ? 219 ARG C CZ  1 
ATOM   6001  N  NH1 . ARG C  1 220 ? 74.585  13.885  -25.853  1.00 59.10  ? 219 ARG C NH1 1 
ATOM   6002  N  NH2 . ARG C  1 220 ? 73.418  15.830  -25.486  1.00 43.56  ? 219 ARG C NH2 1 
ATOM   6003  N  N   . VAL C  1 221 ? 65.952  12.972  -21.970  1.00 30.90  ? 220 VAL C N   1 
ATOM   6004  C  CA  . VAL C  1 221 ? 64.801  13.303  -21.134  1.00 32.34  ? 220 VAL C CA  1 
ATOM   6005  C  C   . VAL C  1 221 ? 64.818  12.582  -19.786  1.00 44.93  ? 220 VAL C C   1 
ATOM   6006  O  O   . VAL C  1 221 ? 65.125  11.399  -19.707  1.00 34.15  ? 220 VAL C O   1 
ATOM   6007  C  CB  . VAL C  1 221 ? 63.468  12.985  -21.851  1.00 30.04  ? 220 VAL C CB  1 
ATOM   6008  C  CG1 . VAL C  1 221 ? 62.336  12.712  -20.833  1.00 30.41  ? 220 VAL C CG1 1 
ATOM   6009  C  CG2 . VAL C  1 221 ? 63.090  14.137  -22.768  1.00 30.82  ? 220 VAL C CG2 1 
ATOM   6010  N  N   . GLY C  1 222 ? 64.498  13.306  -18.723  1.00 30.80  ? 221 GLY C N   1 
ATOM   6011  C  CA  . GLY C  1 222 ? 64.310  12.676  -17.429  1.00 29.57  ? 221 GLY C CA  1 
ATOM   6012  C  C   . GLY C  1 222 ? 64.227  13.702  -16.323  1.00 30.04  ? 221 GLY C C   1 
ATOM   6013  O  O   . GLY C  1 222 ? 64.340  14.906  -16.579  1.00 31.12  ? 221 GLY C O   1 
ATOM   6014  N  N   . ILE C  1 223 ? 64.047  13.226  -15.093  1.00 28.59  ? 222 ILE C N   1 
ATOM   6015  C  CA  . ILE C  1 223 ? 63.986  14.115  -13.932  1.00 26.61  ? 222 ILE C CA  1 
ATOM   6016  C  C   . ILE C  1 223 ? 65.378  14.686  -13.618  1.00 32.72  ? 222 ILE C C   1 
ATOM   6017  O  O   . ILE C  1 223 ? 66.339  13.939  -13.458  1.00 30.44  ? 222 ILE C O   1 
ATOM   6018  C  CB  . ILE C  1 223 ? 63.407  13.404  -12.696  1.00 31.33  ? 222 ILE C CB  1 
ATOM   6019  C  CG1 . ILE C  1 223 ? 61.956  12.961  -12.962  1.00 32.13  ? 222 ILE C CG1 1 
ATOM   6020  C  CG2 . ILE C  1 223 ? 63.446  14.341  -11.482  1.00 29.23  ? 222 ILE C CG2 1 
ATOM   6021  C  CD1 . ILE C  1 223 ? 61.472  11.782  -12.067  1.00 28.58  ? 222 ILE C CD1 1 
ATOM   6022  N  N   . ALA C  1 224 ? 65.474  16.014  -13.568  1.00 30.92  ? 223 ALA C N   1 
ATOM   6023  C  CA  . ALA C  1 224 ? 66.732  16.713  -13.285  1.00 29.23  ? 223 ALA C CA  1 
ATOM   6024  C  C   . ALA C  1 224 ? 66.458  18.173  -12.829  1.00 31.20  ? 223 ALA C C   1 
ATOM   6025  O  O   . ALA C  1 224 ? 65.314  18.569  -12.703  1.00 29.57  ? 223 ALA C O   1 
ATOM   6026  C  CB  . ALA C  1 224 ? 67.630  16.681  -14.524  1.00 25.96  ? 223 ALA C CB  1 
ATOM   6027  N  N   . ASP C  1 225 ? 67.503  18.965  -12.581  1.00 25.82  ? 224 ASP C N   1 
ATOM   6028  C  CA  . ASP C  1 225 ? 67.319  20.356  -12.190  1.00 30.39  ? 224 ASP C CA  1 
ATOM   6029  C  C   . ASP C  1 225 ? 66.827  21.123  -13.414  1.00 27.98  ? 224 ASP C C   1 
ATOM   6030  O  O   . ASP C  1 225 ? 67.294  20.866  -14.540  1.00 28.85  ? 224 ASP C O   1 
ATOM   6031  C  CB  . ASP C  1 225 ? 68.657  20.941  -11.698  1.00 33.30  ? 224 ASP C CB  1 
ATOM   6032  C  CG  . ASP C  1 225 ? 68.492  22.286  -11.003  1.00 31.62  ? 224 ASP C CG  1 
ATOM   6033  O  OD1 . ASP C  1 225 ? 68.328  23.307  -11.696  1.00 36.00  ? 224 ASP C OD1 1 
ATOM   6034  O  OD2 . ASP C  1 225 ? 68.522  22.319  -9.756   1.00 39.69  ? 224 ASP C OD2 1 
ATOM   6035  N  N   . ARG C  1 226 ? 65.905  22.068  -13.218  1.00 30.00  ? 225 ARG C N   1 
ATOM   6036  C  CA  . ARG C  1 226 ? 65.399  22.850  -14.352  1.00 28.77  ? 225 ARG C CA  1 
ATOM   6037  C  C   . ARG C  1 226 ? 66.514  23.609  -15.073  1.00 28.01  ? 225 ARG C C   1 
ATOM   6038  O  O   . ARG C  1 226 ? 66.379  23.954  -16.247  1.00 30.00  ? 225 ARG C O   1 
ATOM   6039  C  CB  . ARG C  1 226 ? 64.292  23.824  -13.933  1.00 29.80  ? 225 ARG C CB  1 
ATOM   6040  C  CG  . ARG C  1 226 ? 64.705  24.960  -13.003  1.00 33.33  ? 225 ARG C CG  1 
ATOM   6041  C  CD  . ARG C  1 226 ? 63.452  25.761  -12.560  1.00 34.37  ? 225 ARG C CD  1 
ATOM   6042  N  NE  . ARG C  1 226 ? 62.739  25.098  -11.463  1.00 47.68  ? 225 ARG C NE  1 
ATOM   6043  C  CZ  . ARG C  1 226 ? 61.420  24.895  -11.412  1.00 63.23  ? 225 ARG C CZ  1 
ATOM   6044  N  NH1 . ARG C  1 226 ? 60.615  25.292  -12.402  1.00 34.17  ? 225 ARG C NH1 1 
ATOM   6045  N  NH2 . ARG C  1 226 ? 60.902  24.280  -10.355  1.00 41.21  ? 225 ARG C NH2 1 
ATOM   6046  N  N   . TYR C  1 227 ? 67.612  23.872  -14.383  1.00 30.16  ? 226 TYR C N   1 
ATOM   6047  C  CA  . TYR C  1 227 ? 68.721  24.584  -15.047  1.00 25.78  ? 226 TYR C CA  1 
ATOM   6048  C  C   . TYR C  1 227 ? 69.445  23.716  -16.087  1.00 31.45  ? 226 TYR C C   1 
ATOM   6049  O  O   . TYR C  1 227 ? 70.184  24.241  -16.922  1.00 29.48  ? 226 TYR C O   1 
ATOM   6050  C  CB  . TYR C  1 227 ? 69.695  25.179  -14.013  1.00 29.96  ? 226 TYR C CB  1 
ATOM   6051  C  CG  . TYR C  1 227 ? 69.286  26.525  -13.445  1.00 35.25  ? 226 TYR C CG  1 
ATOM   6052  C  CD1 . TYR C  1 227 ? 68.304  26.628  -12.449  1.00 33.38  ? 226 TYR C CD1 1 
ATOM   6053  C  CD2 . TYR C  1 227 ? 69.886  27.695  -13.888  1.00 36.28  ? 226 TYR C CD2 1 
ATOM   6054  C  CE1 . TYR C  1 227 ? 67.935  27.866  -11.924  1.00 32.58  ? 226 TYR C CE1 1 
ATOM   6055  C  CE2 . TYR C  1 227 ? 69.516  28.939  -13.378  1.00 25.81  ? 226 TYR C CE2 1 
ATOM   6056  C  CZ  . TYR C  1 227 ? 68.548  29.022  -12.392  1.00 30.08  ? 226 TYR C CZ  1 
ATOM   6057  O  OH  . TYR C  1 227 ? 68.196  30.258  -11.871  1.00 32.25  ? 226 TYR C OH  1 
ATOM   6058  N  N   . GLN C  1 228 ? 69.233  22.394  -16.069  1.00 28.03  ? 227 GLN C N   1 
ATOM   6059  C  CA  . GLN C  1 228 ? 69.708  21.570  -17.188  1.00 25.06  ? 227 GLN C CA  1 
ATOM   6060  C  C   . GLN C  1 228 ? 69.196  22.110  -18.536  1.00 28.33  ? 227 GLN C C   1 
ATOM   6061  O  O   . GLN C  1 228 ? 69.939  22.201  -19.516  1.00 32.47  ? 227 GLN C O   1 
ATOM   6062  C  CB  . GLN C  1 228 ? 69.292  20.099  -17.025  1.00 27.65  ? 227 GLN C CB  1 
ATOM   6063  C  CG  . GLN C  1 228 ? 69.586  19.251  -18.287  1.00 29.04  ? 227 GLN C CG  1 
ATOM   6064  C  CD  . GLN C  1 228 ? 71.079  19.122  -18.598  1.00 33.72  ? 227 GLN C CD  1 
ATOM   6065  O  OE1 . GLN C  1 228 ? 71.930  19.331  -17.735  1.00 30.55  ? 227 GLN C OE1 1 
ATOM   6066  N  NE2 . GLN C  1 228 ? 71.396  18.776  -19.837  1.00 34.15  ? 227 GLN C NE2 1 
ATOM   6067  N  N   . ASP C  1 229 ? 67.930  22.508  -18.572  1.00 28.13  ? 228 ASP C N   1 
ATOM   6068  C  CA  . ASP C  1 229 ? 67.338  23.070  -19.794  1.00 27.18  ? 228 ASP C CA  1 
ATOM   6069  C  C   . ASP C  1 229 ? 67.577  24.583  -19.929  1.00 32.19  ? 228 ASP C C   1 
ATOM   6070  O  O   . ASP C  1 229 ? 67.854  25.081  -21.023  1.00 31.67  ? 228 ASP C O   1 
ATOM   6071  C  CB  . ASP C  1 229 ? 65.826  22.782  -19.837  1.00 26.19  ? 228 ASP C CB  1 
ATOM   6072  C  CG  . ASP C  1 229 ? 65.516  21.301  -20.008  1.00 33.72  ? 228 ASP C CG  1 
ATOM   6073  O  OD1 . ASP C  1 229 ? 66.373  20.569  -20.580  1.00 32.69  ? 228 ASP C OD1 1 
ATOM   6074  O  OD2 . ASP C  1 229 ? 64.408  20.879  -19.582  1.00 30.06  ? 228 ASP C OD2 1 
ATOM   6075  N  N   . LEU C  1 230 ? 67.442  25.318  -18.833  1.00 28.82  ? 229 LEU C N   1 
ATOM   6076  C  CA  . LEU C  1 230 ? 67.682  26.755  -18.894  1.00 31.19  ? 229 LEU C CA  1 
ATOM   6077  C  C   . LEU C  1 230 ? 69.129  27.053  -19.355  1.00 31.53  ? 229 LEU C C   1 
ATOM   6078  O  O   . LEU C  1 230 ? 69.351  27.917  -20.197  1.00 28.84  ? 229 LEU C O   1 
ATOM   6079  C  CB  . LEU C  1 230 ? 67.376  27.413  -17.550  1.00 26.67  ? 229 LEU C CB  1 
ATOM   6080  C  CG  . LEU C  1 230 ? 65.873  27.421  -17.157  1.00 33.11  ? 229 LEU C CG  1 
ATOM   6081  C  CD1 . LEU C  1 230 ? 65.697  27.697  -15.678  1.00 34.11  ? 229 LEU C CD1 1 
ATOM   6082  C  CD2 . LEU C  1 230 ? 65.093  28.451  -17.958  1.00 34.34  ? 229 LEU C CD2 1 
ATOM   6083  N  N   . ALA C  1 231 ? 70.102  26.323  -18.823  1.00 28.94  ? 230 ALA C N   1 
ATOM   6084  C  CA  . ALA C  1 231 ? 71.502  26.604  -19.155  1.00 28.86  ? 230 ALA C CA  1 
ATOM   6085  C  C   . ALA C  1 231 ? 71.810  26.408  -20.635  1.00 32.06  ? 230 ALA C C   1 
ATOM   6086  O  O   . ALA C  1 231 ? 72.425  27.269  -21.264  1.00 32.74  ? 230 ALA C O   1 
ATOM   6087  C  CB  . ALA C  1 231 ? 72.448  25.760  -18.306  1.00 26.88  ? 230 ALA C CB  1 
ATOM   6088  N  N   . ILE C  1 232 ? 71.380  25.284  -21.193  1.00 29.20  ? 231 ILE C N   1 
ATOM   6089  C  CA  . ILE C  1 232 ? 71.711  24.984  -22.583  1.00 27.42  ? 231 ILE C CA  1 
ATOM   6090  C  C   . ILE C  1 232 ? 71.085  26.004  -23.536  1.00 33.55  ? 231 ILE C C   1 
ATOM   6091  O  O   . ILE C  1 232 ? 71.735  26.455  -24.476  1.00 31.18  ? 231 ILE C O   1 
ATOM   6092  C  CB  . ILE C  1 232 ? 71.349  23.533  -22.951  1.00 34.09  ? 231 ILE C CB  1 
ATOM   6093  C  CG1 . ILE C  1 232 ? 72.318  22.586  -22.213  1.00 29.81  ? 231 ILE C CG1 1 
ATOM   6094  C  CG2 . ILE C  1 232 ? 71.381  23.324  -24.455  1.00 30.88  ? 231 ILE C CG2 1 
ATOM   6095  C  CD1 . ILE C  1 232 ? 72.189  21.116  -22.587  1.00 38.92  ? 231 ILE C CD1 1 
ATOM   6096  N  N   . LEU C  1 233 ? 69.837  26.385  -23.266  1.00 29.61  ? 232 LEU C N   1 
ATOM   6097  C  CA  . LEU C  1 233 ? 69.156  27.380  -24.081  1.00 32.17  ? 232 LEU C CA  1 
ATOM   6098  C  C   . LEU C  1 233 ? 69.821  28.740  -23.928  1.00 27.09  ? 232 LEU C C   1 
ATOM   6099  O  O   . LEU C  1 233 ? 70.040  29.455  -24.918  1.00 29.54  ? 232 LEU C O   1 
ATOM   6100  C  CB  . LEU C  1 233 ? 67.673  27.479  -23.707  1.00 32.88  ? 232 LEU C CB  1 
ATOM   6101  C  CG  . LEU C  1 233 ? 66.876  28.440  -24.601  1.00 32.98  ? 232 LEU C CG  1 
ATOM   6102  C  CD1 . LEU C  1 233 ? 67.100  28.096  -26.049  1.00 30.78  ? 232 LEU C CD1 1 
ATOM   6103  C  CD2 . LEU C  1 233 ? 65.376  28.404  -24.271  1.00 25.55  ? 232 LEU C CD2 1 
ATOM   6104  N  N   . TRP C  1 234 ? 70.136  29.107  -22.687  1.00 27.12  ? 233 TRP C N   1 
ATOM   6105  C  CA  . TRP C  1 234 ? 70.764  30.404  -22.407  1.00 28.89  ? 233 TRP C CA  1 
ATOM   6106  C  C   . TRP C  1 234 ? 72.079  30.533  -23.156  1.00 34.97  ? 233 TRP C C   1 
ATOM   6107  O  O   . TRP C  1 234 ? 72.408  31.600  -23.693  1.00 31.08  ? 233 TRP C O   1 
ATOM   6108  C  CB  . TRP C  1 234 ? 70.966  30.547  -20.896  1.00 26.93  ? 233 TRP C CB  1 
ATOM   6109  C  CG  . TRP C  1 234 ? 71.595  31.816  -20.417  1.00 29.26  ? 233 TRP C CG  1 
ATOM   6110  C  CD1 . TRP C  1 234 ? 70.952  32.935  -19.988  1.00 33.17  ? 233 TRP C CD1 1 
ATOM   6111  C  CD2 . TRP C  1 234 ? 72.987  32.064  -20.252  1.00 36.60  ? 233 TRP C CD2 1 
ATOM   6112  N  NE1 . TRP C  1 234 ? 71.866  33.881  -19.587  1.00 37.16  ? 233 TRP C NE1 1 
ATOM   6113  C  CE2 . TRP C  1 234 ? 73.123  33.364  -19.733  1.00 36.21  ? 233 TRP C CE2 1 
ATOM   6114  C  CE3 . TRP C  1 234 ? 74.139  31.319  -20.510  1.00 39.23  ? 233 TRP C CE3 1 
ATOM   6115  C  CZ2 . TRP C  1 234 ? 74.369  33.941  -19.477  1.00 42.26  ? 233 TRP C CZ2 1 
ATOM   6116  C  CZ3 . TRP C  1 234 ? 75.379  31.890  -20.245  1.00 51.59  ? 233 TRP C CZ3 1 
ATOM   6117  C  CH2 . TRP C  1 234 ? 75.481  33.183  -19.732  1.00 43.32  ? 233 TRP C CH2 1 
ATOM   6118  N  N   . ASN C  1 235 ? 72.829  29.433  -23.198  1.00 29.21  ? 234 ASN C N   1 
ATOM   6119  C  CA  . ASN C  1 235 ? 74.105  29.397  -23.895  1.00 28.49  ? 234 ASN C CA  1 
ATOM   6120  C  C   . ASN C  1 235 ? 73.909  29.645  -25.397  1.00 33.54  ? 234 ASN C C   1 
ATOM   6121  O  O   . ASN C  1 235 ? 74.636  30.447  -26.007  1.00 30.91  ? 234 ASN C O   1 
ATOM   6122  C  CB  . ASN C  1 235 ? 74.777  28.037  -23.666  1.00 32.38  ? 234 ASN C CB  1 
ATOM   6123  C  CG  . ASN C  1 235 ? 76.270  28.029  -24.045  1.00 35.92  ? 234 ASN C CG  1 
ATOM   6124  O  OD1 . ASN C  1 235 ? 76.996  29.007  -23.826  1.00 38.09  ? 234 ASN C OD1 1 
ATOM   6125  N  ND2 . ASN C  1 235 ? 76.727  26.911  -24.588  1.00 44.04  ? 234 ASN C ND2 1 
ATOM   6126  N  N   . CYS C  1 236 ? 72.944  28.942  -25.987  1.00 29.53  ? 235 CYS C N   1 
ATOM   6127  C  CA  . CYS C  1 236 ? 72.629  29.109  -27.405  1.00 29.90  ? 235 CYS C CA  1 
ATOM   6128  C  C   . CYS C  1 236 ? 72.233  30.536  -27.720  1.00 34.15  ? 235 CYS C C   1 
ATOM   6129  O  O   . CYS C  1 236 ? 72.664  31.095  -28.729  1.00 34.50  ? 235 CYS C O   1 
ATOM   6130  C  CB  . CYS C  1 236 ? 71.466  28.211  -27.822  1.00 34.92  ? 235 CYS C CB  1 
ATOM   6131  S  SG  . CYS C  1 236 ? 71.834  26.442  -27.795  1.00 37.98  ? 235 CYS C SG  1 
ATOM   6132  N  N   . LEU C  1 237 ? 71.390  31.123  -26.869  1.00 32.42  ? 236 LEU C N   1 
ATOM   6133  C  CA  . LEU C  1 237 ? 70.972  32.518  -27.074  1.00 28.41  ? 236 LEU C CA  1 
ATOM   6134  C  C   . LEU C  1 237 ? 72.139  33.506  -27.021  1.00 31.64  ? 236 LEU C C   1 
ATOM   6135  O  O   . LEU C  1 237 ? 72.095  34.581  -27.623  1.00 33.96  ? 236 LEU C O   1 
ATOM   6136  C  CB  . LEU C  1 237 ? 69.874  32.905  -26.069  1.00 26.99  ? 236 LEU C CB  1 
ATOM   6137  C  CG  . LEU C  1 237 ? 68.580  32.147  -26.329  1.00 35.80  ? 236 LEU C CG  1 
ATOM   6138  C  CD1 . LEU C  1 237 ? 67.643  32.325  -25.143  1.00 31.82  ? 236 LEU C CD1 1 
ATOM   6139  C  CD2 . LEU C  1 237 ? 67.936  32.640  -27.643  1.00 26.48  ? 236 LEU C CD2 1 
ATOM   6140  N  N   . GLY C  1 238 ? 73.194  33.129  -26.314  1.00 29.61  ? 237 GLY C N   1 
ATOM   6141  C  CA  . GLY C  1 238 ? 74.395  33.939  -26.226  1.00 33.57  ? 237 GLY C CA  1 
ATOM   6142  C  C   . GLY C  1 238 ? 75.150  34.094  -27.540  1.00 35.94  ? 237 GLY C C   1 
ATOM   6143  O  O   . GLY C  1 238 ? 76.070  34.912  -27.640  1.00 37.42  ? 237 GLY C O   1 
ATOM   6144  N  N   . GLU C  1 239 ? 74.786  33.303  -28.547  1.00 34.89  ? 238 GLU C N   1 
ATOM   6145  C  CA  . GLU C  1 239 ? 75.331  33.519  -29.884  1.00 37.03  ? 238 GLU C CA  1 
ATOM   6146  C  C   . GLU C  1 239 ? 74.717  34.771  -30.484  1.00 39.62  ? 238 GLU C C   1 
ATOM   6147  O  O   . GLU C  1 239 ? 75.281  35.358  -31.405  1.00 39.07  ? 238 GLU C O   1 
ATOM   6148  C  CB  . GLU C  1 239 ? 75.006  32.358  -30.818  1.00 45.67  ? 238 GLU C CB  1 
ATOM   6149  C  CG  . GLU C  1 239 ? 75.756  31.060  -30.580  1.00 65.24  ? 238 GLU C CG  1 
ATOM   6150  C  CD  . GLU C  1 239 ? 75.159  29.916  -31.404  1.00 92.38  ? 238 GLU C CD  1 
ATOM   6151  O  OE1 . GLU C  1 239 ? 75.665  29.667  -32.521  1.00 59.07  ? 238 GLU C OE1 1 
ATOM   6152  O  OE2 . GLU C  1 239 ? 74.167  29.289  -30.947  1.00 73.10  ? 238 GLU C OE2 1 
ATOM   6153  N  N   . PHE C  1 240 ? 73.559  35.164  -29.958  1.00 34.67  ? 239 PHE C N   1 
ATOM   6154  C  CA  . PHE C  1 240 ? 72.718  36.178  -30.586  1.00 35.18  ? 239 PHE C CA  1 
ATOM   6155  C  C   . PHE C  1 240 ? 72.714  37.512  -29.840  1.00 37.36  ? 239 PHE C C   1 
ATOM   6156  O  O   . PHE C  1 240 ? 73.046  38.541  -30.427  1.00 37.24  ? 239 PHE C O   1 
ATOM   6157  C  CB  . PHE C  1 240 ? 71.284  35.656  -30.795  1.00 37.80  ? 239 PHE C CB  1 
ATOM   6158  C  CG  . PHE C  1 240 ? 71.182  34.562  -31.832  1.00 42.30  ? 239 PHE C CG  1 
ATOM   6159  C  CD1 . PHE C  1 240 ? 71.322  33.228  -31.469  1.00 40.22  ? 239 PHE C CD1 1 
ATOM   6160  C  CD2 . PHE C  1 240 ? 70.968  34.869  -33.167  1.00 49.62  ? 239 PHE C CD2 1 
ATOM   6161  C  CE1 . PHE C  1 240 ? 71.244  32.217  -32.422  1.00 37.91  ? 239 PHE C CE1 1 
ATOM   6162  C  CE2 . PHE C  1 240 ? 70.882  33.868  -34.122  1.00 37.95  ? 239 PHE C CE2 1 
ATOM   6163  C  CZ  . PHE C  1 240 ? 71.023  32.539  -33.750  1.00 37.91  ? 239 PHE C CZ  1 
ATOM   6164  N  N   . SER C  1 241 ? 72.330  37.508  -28.563  1.00 37.42  ? 240 SER C N   1 
ATOM   6165  C  CA  . SER C  1 241 ? 72.374  38.741  -27.760  1.00 39.81  ? 240 SER C CA  1 
ATOM   6166  C  C   . SER C  1 241 ? 72.156  38.532  -26.261  1.00 34.40  ? 240 SER C C   1 
ATOM   6167  O  O   . SER C  1 241 ? 71.389  37.653  -25.852  1.00 34.65  ? 240 SER C O   1 
ATOM   6168  C  CB  . SER C  1 241 ? 71.360  39.772  -28.276  1.00 46.31  ? 240 SER C CB  1 
ATOM   6169  O  OG  . SER C  1 241 ? 70.152  39.714  -27.546  1.00 45.09  ? 240 SER C OG  1 
ATOM   6170  N  N   . PRO C  1 242 ? 72.809  39.364  -25.437  1.00 35.88  ? 241 PRO C N   1 
ATOM   6171  C  CA  . PRO C  1 242 ? 72.633  39.311  -23.984  1.00 47.30  ? 241 PRO C CA  1 
ATOM   6172  C  C   . PRO C  1 242 ? 71.198  39.643  -23.597  1.00 43.44  ? 241 PRO C C   1 
ATOM   6173  O  O   . PRO C  1 242 ? 70.688  39.094  -22.617  1.00 37.99  ? 241 PRO C O   1 
ATOM   6174  C  CB  . PRO C  1 242 ? 73.564  40.417  -23.476  1.00 47.83  ? 241 PRO C CB  1 
ATOM   6175  C  CG  . PRO C  1 242 ? 74.496  40.689  -24.596  1.00 47.20  ? 241 PRO C CG  1 
ATOM   6176  C  CD  . PRO C  1 242 ? 73.704  40.465  -25.830  1.00 45.87  ? 241 PRO C CD  1 
ATOM   6177  N  N   . SER C  1 243 ? 70.547  40.520  -24.357  1.00 36.60  ? 242 SER C N   1 
ATOM   6178  C  CA  . SER C  1 243 ? 69.151  40.859  -24.063  1.00 33.20  ? 242 SER C CA  1 
ATOM   6179  C  C   . SER C  1 243 ? 68.218  39.644  -24.221  1.00 37.43  ? 242 SER C C   1 
ATOM   6180  O  O   . SER C  1 243 ? 67.301  39.448  -23.412  1.00 36.41  ? 242 SER C O   1 
ATOM   6181  C  CB  . SER C  1 243 ? 68.672  42.061  -24.900  1.00 43.37  ? 242 SER C CB  1 
ATOM   6182  O  OG  . SER C  1 243 ? 68.655  41.754  -26.281  1.00 58.16  ? 242 SER C OG  1 
ATOM   6183  N  N   . LEU C  1 244 ? 68.461  38.819  -25.238  1.00 32.75  ? 243 LEU C N   1 
ATOM   6184  C  CA  . LEU C  1 244 ? 67.665  37.605  -25.424  1.00 33.88  ? 243 LEU C CA  1 
ATOM   6185  C  C   . LEU C  1 244 ? 67.943  36.575  -24.324  1.00 42.09  ? 243 LEU C C   1 
ATOM   6186  O  O   . LEU C  1 244 ? 67.028  35.902  -23.852  1.00 32.95  ? 243 LEU C O   1 
ATOM   6187  C  CB  . LEU C  1 244 ? 67.880  36.990  -26.814  1.00 32.42  ? 243 LEU C CB  1 
ATOM   6188  C  CG  . LEU C  1 244 ? 67.251  37.757  -27.983  1.00 42.25  ? 243 LEU C CG  1 
ATOM   6189  C  CD1 . LEU C  1 244 ? 67.612  37.123  -29.322  1.00 43.15  ? 243 LEU C CD1 1 
ATOM   6190  C  CD2 . LEU C  1 244 ? 65.725  37.864  -27.832  1.00 42.24  ? 243 LEU C CD2 1 
ATOM   6191  N  N   . GLN C  1 245 ? 69.206  36.450  -23.926  1.00 33.58  ? 244 GLN C N   1 
ATOM   6192  C  CA  . GLN C  1 245 ? 69.566  35.627  -22.767  1.00 38.30  ? 244 GLN C CA  1 
ATOM   6193  C  C   . GLN C  1 245 ? 68.802  36.027  -21.495  1.00 33.95  ? 244 GLN C C   1 
ATOM   6194  O  O   . GLN C  1 245 ? 68.202  35.192  -20.824  1.00 33.70  ? 244 GLN C O   1 
ATOM   6195  C  CB  . GLN C  1 245 ? 71.067  35.740  -22.503  1.00 33.86  ? 244 GLN C CB  1 
ATOM   6196  C  CG  . GLN C  1 245 ? 71.911  34.945  -23.494  1.00 31.38  ? 244 GLN C CG  1 
ATOM   6197  C  CD  . GLN C  1 245 ? 73.391  35.061  -23.209  1.00 37.04  ? 244 GLN C CD  1 
ATOM   6198  O  OE1 . GLN C  1 245 ? 73.949  36.160  -23.204  1.00 37.66  ? 244 GLN C OE1 1 
ATOM   6199  N  NE2 . GLN C  1 245 ? 74.038  33.924  -22.953  1.00 33.02  ? 244 GLN C NE2 1 
ATOM   6200  N  N   . LYS C  1 246 ? 68.844  37.313  -21.168  1.00 35.05  ? 245 LYS C N   1 
ATOM   6201  C  CA  . LYS C  1 246 ? 68.129  37.845  -20.013  1.00 37.04  ? 245 LYS C CA  1 
ATOM   6202  C  C   . LYS C  1 246 ? 66.620  37.606  -20.133  1.00 50.82  ? 245 LYS C C   1 
ATOM   6203  O  O   . LYS C  1 246 ? 65.954  37.223  -19.167  1.00 30.77  ? 245 LYS C O   1 
ATOM   6204  C  CB  . LYS C  1 246 ? 68.417  39.342  -19.891  1.00 34.07  ? 245 LYS C CB  1 
ATOM   6205  C  CG  . LYS C  1 246 ? 67.654  40.044  -18.794  1.00 46.79  ? 245 LYS C CG  1 
ATOM   6206  C  CD  . LYS C  1 246 ? 68.254  41.413  -18.507  1.00 44.13  ? 245 LYS C CD  1 
ATOM   6207  C  CE  . LYS C  1 246 ? 67.351  42.224  -17.590  1.00 45.14  ? 245 LYS C CE  1 
ATOM   6208  N  NZ  . LYS C  1 246 ? 68.092  43.374  -17.010  1.00 67.27  ? 245 LYS C NZ  1 
ATOM   6209  N  N   . ARG C  1 247 ? 66.082  37.828  -21.326  1.00 32.01  ? 246 ARG C N   1 
ATOM   6210  C  CA  . ARG C  1 247 ? 64.637  37.697  -21.534  1.00 37.61  ? 246 ARG C CA  1 
ATOM   6211  C  C   . ARG C  1 247 ? 64.120  36.280  -21.282  1.00 31.68  ? 246 ARG C C   1 
ATOM   6212  O  O   . ARG C  1 247 ? 62.978  36.090  -20.834  1.00 34.66  ? 246 ARG C O   1 
ATOM   6213  C  CB  . ARG C  1 247 ? 64.237  38.147  -22.940  1.00 39.10  ? 246 ARG C CB  1 
ATOM   6214  C  CG  . ARG C  1 247 ? 62.724  38.215  -23.126  1.00 40.20  ? 246 ARG C CG  1 
ATOM   6215  C  CD  . ARG C  1 247 ? 62.331  38.857  -24.441  1.00 47.84  ? 246 ARG C CD  1 
ATOM   6216  N  NE  . ARG C  1 247 ? 60.880  39.007  -24.541  1.00 41.41  ? 246 ARG C NE  1 
ATOM   6217  C  CZ  . ARG C  1 247 ? 60.280  40.099  -24.986  1.00 37.68  ? 246 ARG C CZ  1 
ATOM   6218  N  NH1 . ARG C  1 247 ? 61.014  41.139  -25.370  1.00 42.76  ? 246 ARG C NH1 1 
ATOM   6219  N  NH2 . ARG C  1 247 ? 58.953  40.154  -25.052  1.00 43.72  ? 246 ARG C NH2 1 
ATOM   6220  N  N   . LEU C  1 248 ? 64.946  35.290  -21.594  1.00 27.06  ? 247 LEU C N   1 
ATOM   6221  C  CA  . LEU C  1 248 ? 64.595  33.899  -21.310  1.00 29.87  ? 247 LEU C CA  1 
ATOM   6222  C  C   . LEU C  1 248 ? 64.209  33.731  -19.842  1.00 32.36  ? 247 LEU C C   1 
ATOM   6223  O  O   . LEU C  1 248 ? 63.122  33.239  -19.546  1.00 31.85  ? 247 LEU C O   1 
ATOM   6224  C  CB  . LEU C  1 248 ? 65.743  32.947  -21.684  1.00 31.66  ? 247 LEU C CB  1 
ATOM   6225  C  CG  . LEU C  1 248 ? 65.623  31.496  -21.187  1.00 34.80  ? 247 LEU C CG  1 
ATOM   6226  C  CD1 . LEU C  1 248 ? 64.377  30.808  -21.750  1.00 29.28  ? 247 LEU C CD1 1 
ATOM   6227  C  CD2 . LEU C  1 248 ? 66.890  30.675  -21.510  1.00 27.97  ? 247 LEU C CD2 1 
ATOM   6228  N  N   . PHE C  1 249 ? 65.075  34.166  -18.926  1.00 31.96  ? 248 PHE C N   1 
ATOM   6229  C  CA  . PHE C  1 249 ? 64.776  34.033  -17.495  1.00 30.77  ? 248 PHE C CA  1 
ATOM   6230  C  C   . PHE C  1 249 ? 63.587  34.894  -17.054  1.00 32.59  ? 248 PHE C C   1 
ATOM   6231  O  O   . PHE C  1 249 ? 62.765  34.472  -16.233  1.00 33.21  ? 248 PHE C O   1 
ATOM   6232  C  CB  . PHE C  1 249 ? 66.009  34.330  -16.624  1.00 30.93  ? 248 PHE C CB  1 
ATOM   6233  C  CG  . PHE C  1 249 ? 67.013  33.191  -16.583  1.00 30.17  ? 248 PHE C CG  1 
ATOM   6234  C  CD1 . PHE C  1 249 ? 66.837  32.124  -15.712  1.00 39.05  ? 248 PHE C CD1 1 
ATOM   6235  C  CD2 . PHE C  1 249 ? 68.113  33.186  -17.425  1.00 45.03  ? 248 PHE C CD2 1 
ATOM   6236  C  CE1 . PHE C  1 249 ? 67.748  31.062  -15.684  1.00 36.09  ? 248 PHE C CE1 1 
ATOM   6237  C  CE2 . PHE C  1 249 ? 69.025  32.139  -17.402  1.00 44.44  ? 248 PHE C CE2 1 
ATOM   6238  C  CZ  . PHE C  1 249 ? 68.838  31.071  -16.535  1.00 41.68  ? 248 PHE C CZ  1 
ATOM   6239  N  N   . GLN C  1 250 ? 63.498  36.104  -17.599  1.00 31.49  ? 249 GLN C N   1 
ATOM   6240  C  CA  . GLN C  1 250 ? 62.401  36.991  -17.268  1.00 27.79  ? 249 GLN C CA  1 
ATOM   6241  C  C   . GLN C  1 250 ? 61.054  36.388  -17.646  1.00 32.71  ? 249 GLN C C   1 
ATOM   6242  O  O   . GLN C  1 250 ? 60.097  36.437  -16.853  1.00 31.06  ? 249 GLN C O   1 
ATOM   6243  C  CB  . GLN C  1 250 ? 62.579  38.358  -17.952  1.00 30.73  ? 249 GLN C CB  1 
ATOM   6244  C  CG  . GLN C  1 250 ? 63.653  39.251  -17.327  1.00 28.84  ? 249 GLN C CG  1 
ATOM   6245  C  CD  . GLN C  1 250 ? 63.863  40.529  -18.123  1.00 31.68  ? 249 GLN C CD  1 
ATOM   6246  O  OE1 . GLN C  1 250 ? 64.129  40.482  -19.324  1.00 39.35  ? 249 GLN C OE1 1 
ATOM   6247  N  NE2 . GLN C  1 250 ? 63.739  41.669  -17.465  1.00 34.41  ? 249 GLN C NE2 1 
ATOM   6248  N  N   . LYS C  1 251 ? 60.960  35.846  -18.857  1.00 31.60  ? 250 LYS C N   1 
ATOM   6249  C  CA  . LYS C  1 251 ? 59.695  35.268  -19.301  1.00 29.77  ? 250 LYS C CA  1 
ATOM   6250  C  C   . LYS C  1 251 ? 59.400  33.993  -18.523  1.00 37.41  ? 250 LYS C C   1 
ATOM   6251  O  O   . LYS C  1 251 ? 58.256  33.738  -18.171  1.00 30.59  ? 250 LYS C O   1 
ATOM   6252  C  CB  . LYS C  1 251 ? 59.692  34.969  -20.804  1.00 32.41  ? 250 LYS C CB  1 
ATOM   6253  C  CG  . LYS C  1 251 ? 58.330  34.502  -21.332  1.00 30.41  ? 250 LYS C CG  1 
ATOM   6254  C  CD  . LYS C  1 251 ? 57.268  35.610  -21.129  1.00 38.08  ? 250 LYS C CD  1 
ATOM   6255  C  CE  . LYS C  1 251 ? 55.897  35.192  -21.663  1.00 44.87  ? 250 LYS C CE  1 
ATOM   6256  N  NZ  . LYS C  1 251 ? 54.914  36.310  -21.532  1.00 38.78  ? 250 LYS C NZ  1 
ATOM   6257  N  N   . TYR C  1 252 ? 60.438  33.198  -18.264  1.00 32.57  ? 251 TYR C N   1 
ATOM   6258  C  CA  . TYR C  1 252 ? 60.288  31.924  -17.552  1.00 29.03  ? 251 TYR C CA  1 
ATOM   6259  C  C   . TYR C  1 252 ? 59.838  32.227  -16.133  1.00 34.57  ? 251 TYR C C   1 
ATOM   6260  O  O   . TYR C  1 252 ? 59.043  31.484  -15.542  1.00 32.44  ? 251 TYR C O   1 
ATOM   6261  C  CB  . TYR C  1 252 ? 61.609  31.124  -17.567  1.00 30.34  ? 251 TYR C CB  1 
ATOM   6262  C  CG  . TYR C  1 252 ? 61.509  29.730  -16.944  1.00 30.53  ? 251 TYR C CG  1 
ATOM   6263  C  CD1 . TYR C  1 252 ? 61.180  28.626  -17.711  1.00 30.40  ? 251 TYR C CD1 1 
ATOM   6264  C  CD2 . TYR C  1 252 ? 61.751  29.538  -15.592  1.00 32.42  ? 251 TYR C CD2 1 
ATOM   6265  C  CE1 . TYR C  1 252 ? 61.091  27.351  -17.141  1.00 31.94  ? 251 TYR C CE1 1 
ATOM   6266  C  CE2 . TYR C  1 252 ? 61.669  28.276  -15.013  1.00 34.55  ? 251 TYR C CE2 1 
ATOM   6267  C  CZ  . TYR C  1 252 ? 61.338  27.191  -15.788  1.00 31.83  ? 251 TYR C CZ  1 
ATOM   6268  O  OH  . TYR C  1 252 ? 61.251  25.949  -15.198  1.00 30.89  ? 251 TYR C OH  1 
ATOM   6269  N  N   . GLY C  1 253 ? 60.315  33.347  -15.593  1.00 30.25  ? 252 GLY C N   1 
ATOM   6270  C  CA  . GLY C  1 253 ? 59.818  33.814  -14.312  1.00 31.67  ? 252 GLY C CA  1 
ATOM   6271  C  C   . GLY C  1 253 ? 60.803  33.710  -13.160  1.00 49.80  ? 252 GLY C C   1 
ATOM   6272  O  O   . GLY C  1 253 ? 60.405  33.583  -12.008  1.00 32.44  ? 252 GLY C O   1 
ATOM   6273  N  N   . ILE C  1 254 ? 62.093  33.783  -13.462  1.00 32.48  ? 253 ILE C N   1 
ATOM   6274  C  CA  . ILE C  1 254 ? 63.114  33.749  -12.415  1.00 32.92  ? 253 ILE C CA  1 
ATOM   6275  C  C   . ILE C  1 254 ? 63.719  35.136  -12.209  1.00 36.44  ? 253 ILE C C   1 
ATOM   6276  O  O   . ILE C  1 254 ? 64.243  35.727  -13.157  1.00 40.15  ? 253 ILE C O   1 
ATOM   6277  C  CB  . ILE C  1 254 ? 64.192  32.697  -12.769  1.00 34.05  ? 253 ILE C CB  1 
ATOM   6278  C  CG1 . ILE C  1 254 ? 63.601  31.291  -12.600  1.00 32.12  ? 253 ILE C CG1 1 
ATOM   6279  C  CG2 . ILE C  1 254 ? 65.423  32.859  -11.894  1.00 35.52  ? 253 ILE C CG2 1 
ATOM   6280  C  CD1 . ILE C  1 254 ? 64.477  30.173  -13.179  1.00 35.55  ? 253 ILE C CD1 1 
ATOM   6281  N  N   . ASP C  1 255 ? 63.644  35.660  -10.983  1.00 29.94  ? 254 ASP C N   1 
ATOM   6282  C  CA  . ASP C  1 255 ? 64.122  37.020  -10.675  1.00 30.53  ? 254 ASP C CA  1 
ATOM   6283  C  C   . ASP C  1 255 ? 65.640  37.158  -10.700  1.00 43.36  ? 254 ASP C C   1 
ATOM   6284  O  O   . ASP C  1 255 ? 66.175  38.156  -11.183  1.00 44.26  ? 254 ASP C O   1 
ATOM   6285  C  CB  . ASP C  1 255 ? 63.640  37.479  -9.301   1.00 34.52  ? 254 ASP C CB  1 
ATOM   6286  C  CG  . ASP C  1 255 ? 62.137  37.617  -9.235   1.00 48.89  ? 254 ASP C CG  1 
ATOM   6287  O  OD1 . ASP C  1 255 ? 61.480  37.255  -10.228  1.00 55.76  ? 254 ASP C OD1 1 
ATOM   6288  O  OD2 . ASP C  1 255 ? 61.622  38.068  -8.194   1.00 49.33  ? 254 ASP C OD2 1 
ATOM   6289  N  N   . ASN C  1 256 ? 66.317  36.170  -10.127  1.00 43.64  ? 255 ASN C N   1 
ATOM   6290  C  CA  . ASN C  1 256 ? 67.759  36.213  -9.945   1.00 37.23  ? 255 ASN C CA  1 
ATOM   6291  C  C   . ASN C  1 256 ? 68.350  34.891  -10.403  1.00 38.79  ? 255 ASN C C   1 
ATOM   6292  O  O   . ASN C  1 256 ? 68.535  33.989  -9.597   1.00 40.58  ? 255 ASN C O   1 
ATOM   6293  C  CB  . ASN C  1 256 ? 68.099  36.442  -8.471   1.00 42.34  ? 255 ASN C CB  1 
ATOM   6294  C  CG  . ASN C  1 256 ? 67.505  37.720  -7.928   1.00 69.25  ? 255 ASN C CG  1 
ATOM   6295  O  OD1 . ASN C  1 256 ? 66.508  37.698  -7.202   1.00 60.30  ? 255 ASN C OD1 1 
ATOM   6296  N  ND2 . ASN C  1 256 ? 68.113  38.847  -8.278   1.00 44.61  ? 255 ASN C ND2 1 
ATOM   6297  N  N   . PRO C  1 257 ? 68.621  34.772  -11.706  1.00 35.37  ? 256 PRO C N   1 
ATOM   6298  C  CA  . PRO C  1 257 ? 69.209  33.569  -12.300  1.00 32.45  ? 256 PRO C CA  1 
ATOM   6299  C  C   . PRO C  1 257 ? 70.374  33.098  -11.444  1.00 49.31  ? 256 PRO C C   1 
ATOM   6300  O  O   . PRO C  1 257 ? 71.201  33.898  -11.029  1.00 35.52  ? 256 PRO C O   1 
ATOM   6301  C  CB  . PRO C  1 257 ? 69.681  34.055  -13.668  1.00 48.04  ? 256 PRO C CB  1 
ATOM   6302  C  CG  . PRO C  1 257 ? 68.725  35.170  -13.998  1.00 35.31  ? 256 PRO C CG  1 
ATOM   6303  C  CD  . PRO C  1 257 ? 68.452  35.855  -12.691  1.00 39.55  ? 256 PRO C CD  1 
ATOM   6304  N  N   . ASP C  1 258 ? 70.385  31.815  -11.129  1.00 36.04  ? 257 ASP C N   1 
ATOM   6305  C  CA  . ASP C  1 258 ? 71.385  31.236  -10.250  1.00 34.47  ? 257 ASP C CA  1 
ATOM   6306  C  C   . ASP C  1 258 ? 72.661  30.978  -11.074  1.00 42.25  ? 257 ASP C C   1 
ATOM   6307  O  O   . ASP C  1 258 ? 72.750  29.987  -11.784  1.00 33.62  ? 257 ASP C O   1 
ATOM   6308  C  CB  . ASP C  1 258 ? 70.820  29.926  -9.691   1.00 38.96  ? 257 ASP C CB  1 
ATOM   6309  C  CG  . ASP C  1 258 ? 71.720  29.276  -8.660   1.00 53.71  ? 257 ASP C CG  1 
ATOM   6310  O  OD1 . ASP C  1 258 ? 72.941  29.494  -8.696   1.00 38.93  ? 257 ASP C OD1 1 
ATOM   6311  O  OD2 . ASP C  1 258 ? 71.190  28.528  -7.814   1.00 42.59  ? 257 ASP C OD2 1 
HETATM 6312  N  N   . MSE C  1 259 ? 73.644  31.864  -10.976  1.00 34.28  ? 258 MSE C N   1 
HETATM 6313  C  CA  . MSE C  1 259 ? 74.801  31.792  -11.867  1.00 41.94  ? 258 MSE C CA  1 
HETATM 6314  C  C   . MSE C  1 259 ? 75.660  30.549  -11.608  1.00 38.57  ? 258 MSE C C   1 
HETATM 6315  O  O   . MSE C  1 259 ? 76.298  30.024  -12.520  1.00 33.78  ? 258 MSE C O   1 
HETATM 6316  C  CB  . MSE C  1 259 ? 75.649  33.070  -11.768  1.00 46.83  ? 258 MSE C CB  1 
HETATM 6317  C  CG  . MSE C  1 259 ? 74.883  34.355  -12.123  1.00 41.35  ? 258 MSE C CG  1 
HETATM 6318  SE SE  . MSE C  1 259 ? 73.957  34.211  -13.828  0.54 49.82  ? 258 MSE C SE  1 
HETATM 6319  C  CE  . MSE C  1 259 ? 75.439  34.665  -14.991  1.00 52.21  ? 258 MSE C CE  1 
ATOM   6320  N  N   . ASN C  1 260 ? 75.678  30.098  -10.359  1.00 38.59  ? 259 ASN C N   1 
ATOM   6321  C  CA  . ASN C  1 260 ? 76.366  28.861  -9.992   1.00 45.35  ? 259 ASN C CA  1 
ATOM   6322  C  C   . ASN C  1 260 ? 75.739  27.645  -10.670  1.00 39.98  ? 259 ASN C C   1 
ATOM   6323  O  O   . ASN C  1 260 ? 76.445  26.827  -11.271  1.00 36.39  ? 259 ASN C O   1 
ATOM   6324  C  CB  . ASN C  1 260 ? 76.364  28.678  -8.474   1.00 41.61  ? 259 ASN C CB  1 
ATOM   6325  C  CG  . ASN C  1 260 ? 77.177  27.474  -8.027   1.00 45.48  ? 259 ASN C CG  1 
ATOM   6326  O  OD1 . ASN C  1 260 ? 78.402  27.536  -7.944   1.00 62.54  ? 259 ASN C OD1 1 
ATOM   6327  N  ND2 . ASN C  1 260 ? 76.496  26.376  -7.727   1.00 64.28  ? 259 ASN C ND2 1 
ATOM   6328  N  N   . LYS C  1 261 ? 74.416  27.509  -10.562  1.00 31.01  ? 260 LYS C N   1 
ATOM   6329  C  CA  . LYS C  1 261 ? 73.727  26.428  -11.254  1.00 31.25  ? 260 LYS C CA  1 
ATOM   6330  C  C   . LYS C  1 261 ? 73.886  26.514  -12.750  1.00 26.37  ? 260 LYS C C   1 
ATOM   6331  O  O   . LYS C  1 261 ? 74.022  25.487  -13.421  1.00 30.05  ? 260 LYS C O   1 
ATOM   6332  C  CB  . LYS C  1 261 ? 72.228  26.384  -10.928  1.00 35.50  ? 260 LYS C CB  1 
ATOM   6333  C  CG  . LYS C  1 261 ? 71.916  25.756  -9.588   1.00 38.01  ? 260 LYS C CG  1 
ATOM   6334  C  CD  . LYS C  1 261 ? 70.399  25.653  -9.377   1.00 49.59  ? 260 LYS C CD  1 
ATOM   6335  C  CE  . LYS C  1 261 ? 70.088  24.942  -8.070   1.00 72.59  ? 260 LYS C CE  1 
ATOM   6336  N  NZ  . LYS C  1 261 ? 68.661  24.531  -7.969   1.00 59.26  ? 260 LYS C NZ  1 
ATOM   6337  N  N   . LEU C  1 262 ? 73.802  27.733  -13.278  1.00 32.52  ? 261 LEU C N   1 
ATOM   6338  C  CA  . LEU C  1 262 ? 73.995  27.956  -14.704  1.00 33.25  ? 261 LEU C CA  1 
ATOM   6339  C  C   . LEU C  1 262 ? 75.383  27.465  -15.127  1.00 30.94  ? 261 LEU C C   1 
ATOM   6340  O  O   . LEU C  1 262 ? 75.511  26.684  -16.059  1.00 32.72  ? 261 LEU C O   1 
ATOM   6341  C  CB  . LEU C  1 262 ? 73.833  29.445  -15.033  1.00 48.54  ? 261 LEU C CB  1 
ATOM   6342  C  CG  . LEU C  1 262 ? 73.611  29.871  -16.487  1.00 57.63  ? 261 LEU C CG  1 
ATOM   6343  C  CD1 . LEU C  1 262 ? 72.262  29.387  -17.019  1.00 43.42  ? 261 LEU C CD1 1 
ATOM   6344  C  CD2 . LEU C  1 262 ? 73.703  31.381  -16.594  1.00 71.25  ? 261 LEU C CD2 1 
ATOM   6345  N  N   . GLN C  1 263 ? 76.418  27.931  -14.440  1.00 35.52  ? 262 GLN C N   1 
ATOM   6346  C  CA  . GLN C  1 263 ? 77.776  27.542  -14.794  1.00 33.97  ? 262 GLN C CA  1 
ATOM   6347  C  C   . GLN C  1 263 ? 77.970  26.033  -14.671  1.00 33.07  ? 262 GLN C C   1 
ATOM   6348  O  O   . GLN C  1 263 ? 78.583  25.402  -15.540  1.00 33.24  ? 262 GLN C O   1 
ATOM   6349  C  CB  . GLN C  1 263 ? 78.807  28.255  -13.930  1.00 34.66  ? 262 GLN C CB  1 
ATOM   6350  C  CG  . GLN C  1 263 ? 80.233  28.022  -14.449  1.00 38.21  ? 262 GLN C CG  1 
ATOM   6351  C  CD  . GLN C  1 263 ? 81.277  28.704  -13.595  1.00 65.16  ? 262 GLN C CD  1 
ATOM   6352  O  OE1 . GLN C  1 263 ? 80.984  29.680  -12.909  1.00 51.87  ? 262 GLN C OE1 1 
ATOM   6353  N  NE2 . GLN C  1 263 ? 82.503  28.193  -13.631  1.00 67.15  ? 262 GLN C NE2 1 
ATOM   6354  N  N   . PHE C  1 264 ? 77.449  25.452  -13.595  1.00 30.98  ? 263 PHE C N   1 
ATOM   6355  C  CA  . PHE C  1 264 ? 77.556  24.000  -13.436  1.00 31.86  ? 263 PHE C CA  1 
ATOM   6356  C  C   . PHE C  1 264 ? 76.979  23.236  -14.625  1.00 35.32  ? 263 PHE C C   1 
ATOM   6357  O  O   . PHE C  1 264 ? 77.610  22.324  -15.144  1.00 29.65  ? 263 PHE C O   1 
ATOM   6358  C  CB  . PHE C  1 264 ? 76.898  23.492  -12.149  1.00 29.92  ? 263 PHE C CB  1 
ATOM   6359  C  CG  . PHE C  1 264 ? 76.838  21.988  -12.082  1.00 27.72  ? 263 PHE C CG  1 
ATOM   6360  C  CD1 . PHE C  1 264 ? 77.945  21.260  -11.672  1.00 30.41  ? 263 PHE C CD1 1 
ATOM   6361  C  CD2 . PHE C  1 264 ? 75.701  21.304  -12.479  1.00 32.18  ? 263 PHE C CD2 1 
ATOM   6362  C  CE1 . PHE C  1 264 ? 77.910  19.865  -11.627  1.00 30.73  ? 263 PHE C CE1 1 
ATOM   6363  C  CE2 . PHE C  1 264 ? 75.661  19.912  -12.440  1.00 40.67  ? 263 PHE C CE2 1 
ATOM   6364  C  CZ  . PHE C  1 264 ? 76.773  19.193  -12.013  1.00 36.22  ? 263 PHE C CZ  1 
ATOM   6365  N  N   . HIS C  1 265 ? 75.776  23.597  -15.060  1.00 27.21  ? 264 HIS C N   1 
ATOM   6366  C  CA  . HIS C  1 265 ? 75.146  22.868  -16.166  1.00 28.39  ? 264 HIS C CA  1 
ATOM   6367  C  C   . HIS C  1 265 ? 75.794  23.119  -17.525  1.00 27.96  ? 264 HIS C C   1 
ATOM   6368  O  O   . HIS C  1 265 ? 75.782  22.240  -18.396  1.00 27.79  ? 264 HIS C O   1 
ATOM   6369  C  CB  . HIS C  1 265 ? 73.629  23.133  -16.200  1.00 24.88  ? 264 HIS C CB  1 
ATOM   6370  C  CG  . HIS C  1 265 ? 72.902  22.453  -15.073  1.00 25.81  ? 264 HIS C CG  1 
ATOM   6371  N  ND1 . HIS C  1 265 ? 72.739  23.033  -13.833  1.00 30.78  ? 264 HIS C ND1 1 
ATOM   6372  C  CD2 . HIS C  1 265 ? 72.378  21.208  -14.976  1.00 29.28  ? 264 HIS C CD2 1 
ATOM   6373  C  CE1 . HIS C  1 265 ? 72.111  22.189  -13.030  1.00 30.05  ? 264 HIS C CE1 1 
ATOM   6374  N  NE2 . HIS C  1 265 ? 71.877  21.076  -13.701  1.00 36.63  ? 264 HIS C NE2 1 
ATOM   6375  N  N   . LEU C  1 266 ? 76.351  24.307  -17.718  1.00 30.27  ? 265 LEU C N   1 
ATOM   6376  C  CA  . LEU C  1 266 ? 77.142  24.556  -18.926  1.00 31.06  ? 265 LEU C CA  1 
ATOM   6377  C  C   . LEU C  1 266 ? 78.406  23.712  -18.917  1.00 28.23  ? 265 LEU C C   1 
ATOM   6378  O  O   . LEU C  1 266 ? 78.794  23.134  -19.935  1.00 27.87  ? 265 LEU C O   1 
ATOM   6379  C  CB  . LEU C  1 266 ? 77.499  26.045  -19.053  1.00 31.70  ? 265 LEU C CB  1 
ATOM   6380  C  CG  . LEU C  1 266 ? 76.255  26.901  -19.339  1.00 33.77  ? 265 LEU C CG  1 
ATOM   6381  C  CD1 . LEU C  1 266 ? 76.571  28.368  -19.401  1.00 46.52  ? 265 LEU C CD1 1 
ATOM   6382  C  CD2 . LEU C  1 266 ? 75.613  26.424  -20.628  1.00 34.17  ? 265 LEU C CD2 1 
HETATM 6383  N  N   . MSE C  1 267 ? 79.073  23.652  -17.771  1.00 29.13  ? 266 MSE C N   1 
HETATM 6384  C  CA  . MSE C  1 267 ? 80.292  22.851  -17.707  1.00 30.60  ? 266 MSE C CA  1 
HETATM 6385  C  C   . MSE C  1 267 ? 79.971  21.379  -17.915  1.00 30.71  ? 266 MSE C C   1 
HETATM 6386  O  O   . MSE C  1 267 ? 80.684  20.668  -18.615  1.00 30.89  ? 266 MSE C O   1 
HETATM 6387  C  CB  . MSE C  1 267 ? 81.025  23.080  -16.387  1.00 29.71  ? 266 MSE C CB  1 
HETATM 6388  C  CG  . MSE C  1 267 ? 81.616  24.472  -16.314  1.00 38.33  ? 266 MSE C CG  1 
HETATM 6389  SE SE  . MSE C  1 267 ? 82.522  24.833  -14.656  0.67 37.48  ? 266 MSE C SE  1 
HETATM 6390  C  CE  . MSE C  1 267 ? 84.281  24.157  -15.111  1.00 39.50  ? 266 MSE C CE  1 
ATOM   6391  N  N   . LEU C  1 268 ? 78.885  20.918  -17.309  1.00 27.76  ? 267 LEU C N   1 
ATOM   6392  C  CA  . LEU C  1 268 ? 78.500  19.524  -17.481  1.00 25.72  ? 267 LEU C CA  1 
ATOM   6393  C  C   . LEU C  1 268 ? 78.252  19.161  -18.950  1.00 30.93  ? 267 LEU C C   1 
ATOM   6394  O  O   . LEU C  1 268 ? 78.666  18.095  -19.394  1.00 28.45  ? 267 LEU C O   1 
ATOM   6395  C  CB  . LEU C  1 268 ? 77.274  19.199  -16.612  1.00 32.36  ? 267 LEU C CB  1 
ATOM   6396  C  CG  . LEU C  1 268 ? 76.670  17.792  -16.648  1.00 34.89  ? 267 LEU C CG  1 
ATOM   6397  C  CD1 . LEU C  1 268 ? 77.669  16.748  -16.204  1.00 29.20  ? 267 LEU C CD1 1 
ATOM   6398  C  CD2 . LEU C  1 268 ? 75.441  17.759  -15.749  1.00 31.19  ? 267 LEU C CD2 1 
ATOM   6399  N  N   . ASP C  1 269 ? 77.615  20.051  -19.714  1.00 27.16  ? 268 ASP C N   1 
ATOM   6400  C  CA  . ASP C  1 269 ? 77.316  19.760  -21.126  1.00 30.34  ? 268 ASP C CA  1 
ATOM   6401  C  C   . ASP C  1 269 ? 78.580  19.676  -21.999  1.00 28.14  ? 268 ASP C C   1 
ATOM   6402  O  O   . ASP C  1 269 ? 78.543  19.108  -23.102  1.00 30.52  ? 268 ASP C O   1 
ATOM   6403  C  CB  . ASP C  1 269 ? 76.330  20.796  -21.717  1.00 29.84  ? 268 ASP C CB  1 
ATOM   6404  C  CG  . ASP C  1 269 ? 75.602  20.281  -22.962  1.00 33.38  ? 268 ASP C CG  1 
ATOM   6405  O  OD1 . ASP C  1 269 ? 75.135  19.110  -22.963  1.00 33.13  ? 268 ASP C OD1 1 
ATOM   6406  O  OD2 . ASP C  1 269 ? 75.486  21.053  -23.942  1.00 31.61  ? 268 ASP C OD2 1 
ATOM   6407  N  N   . GLU C  1 270 ? 79.685  20.227  -21.498  1.00 27.49  ? 269 GLU C N   1 
ATOM   6408  C  CA  . GLU C  1 270 ? 80.977  20.127  -22.183  1.00 33.68  ? 269 GLU C CA  1 
ATOM   6409  C  C   . GLU C  1 270 ? 81.381  18.668  -22.414  1.00 36.31  ? 269 GLU C C   1 
ATOM   6410  O  O   . GLU C  1 270 ? 82.118  18.370  -23.348  1.00 30.63  ? 269 GLU C O   1 
ATOM   6411  C  CB  . GLU C  1 270 ? 82.083  20.848  -21.399  1.00 33.75  ? 269 GLU C CB  1 
ATOM   6412  C  CG  . GLU C  1 270 ? 81.814  22.337  -21.116  1.00 31.55  ? 269 GLU C CG  1 
ATOM   6413  C  CD  . GLU C  1 270 ? 81.961  23.212  -22.358  1.00 35.54  ? 269 GLU C CD  1 
ATOM   6414  O  OE1 . GLU C  1 270 ? 81.527  22.780  -23.450  1.00 33.99  ? 269 GLU C OE1 1 
ATOM   6415  O  OE2 . GLU C  1 270 ? 82.522  24.329  -22.242  1.00 35.09  ? 269 GLU C OE2 1 
ATOM   6416  N  N   . PHE C  1 271 ? 80.899  17.767  -21.565  1.00 30.19  ? 270 PHE C N   1 
ATOM   6417  C  CA  . PHE C  1 271 ? 81.312  16.349  -21.614  1.00 30.87  ? 270 PHE C CA  1 
ATOM   6418  C  C   . PHE C  1 271 ? 80.464  15.508  -22.570  1.00 38.59  ? 270 PHE C C   1 
ATOM   6419  O  O   . PHE C  1 271 ? 80.759  14.334  -22.805  1.00 31.82  ? 270 PHE C O   1 
ATOM   6420  C  CB  . PHE C  1 271 ? 81.253  15.727  -20.213  1.00 31.11  ? 270 PHE C CB  1 
ATOM   6421  C  CG  . PHE C  1 271 ? 82.242  16.326  -19.253  1.00 31.33  ? 270 PHE C CG  1 
ATOM   6422  C  CD1 . PHE C  1 271 ? 81.954  17.507  -18.592  1.00 29.21  ? 270 PHE C CD1 1 
ATOM   6423  C  CD2 . PHE C  1 271 ? 83.473  15.732  -19.045  1.00 31.91  ? 270 PHE C CD2 1 
ATOM   6424  C  CE1 . PHE C  1 271 ? 82.870  18.078  -17.734  1.00 27.49  ? 270 PHE C CE1 1 
ATOM   6425  C  CE2 . PHE C  1 271 ? 84.397  16.301  -18.174  1.00 33.20  ? 270 PHE C CE2 1 
ATOM   6426  C  CZ  . PHE C  1 271 ? 84.094  17.471  -17.523  1.00 28.68  ? 270 PHE C CZ  1 
ATOM   6427  N  N   . PHE C  1 272 ? 79.438  16.121  -23.147  1.00 32.23  ? 271 PHE C N   1 
ATOM   6428  C  CA  . PHE C  1 272 ? 78.469  15.386  -23.952  1.00 33.57  ? 271 PHE C CA  1 
ATOM   6429  C  C   . PHE C  1 272 ? 78.430  15.740  -25.437  1.00 44.92  ? 271 PHE C C   1 
ATOM   6430  O  O   . PHE C  1 272 ? 77.573  15.220  -26.154  1.00 51.63  ? 271 PHE C O   1 
ATOM   6431  C  CB  . PHE C  1 272 ? 77.076  15.506  -23.310  1.00 29.96  ? 271 PHE C CB  1 
ATOM   6432  C  CG  . PHE C  1 272 ? 76.995  14.830  -21.965  1.00 33.91  ? 271 PHE C CG  1 
ATOM   6433  C  CD1 . PHE C  1 272 ? 76.788  13.464  -21.881  1.00 41.38  ? 271 PHE C CD1 1 
ATOM   6434  C  CD2 . PHE C  1 272 ? 77.193  15.553  -20.789  1.00 29.40  ? 271 PHE C CD2 1 
ATOM   6435  C  CE1 . PHE C  1 272 ? 76.746  12.823  -20.645  1.00 41.43  ? 271 PHE C CE1 1 
ATOM   6436  C  CE2 . PHE C  1 272 ? 77.153  14.920  -19.558  1.00 30.53  ? 271 PHE C CE2 1 
ATOM   6437  C  CZ  . PHE C  1 272 ? 76.928  13.563  -19.480  1.00 37.68  ? 271 PHE C CZ  1 
ATOM   6438  O  OXT . PHE C  1 272 ? 79.239  16.516  -25.963  1.00 40.25  ? 271 PHE C OXT 1 
ATOM   6439  N  N   . HIS D  1 4   ? 74.212  22.786  -36.294  1.00 129.02 ? 3   HIS D N   1 
ATOM   6440  C  CA  . HIS D  1 4   ? 73.159  23.440  -37.066  1.00 117.49 ? 3   HIS D CA  1 
ATOM   6441  C  C   . HIS D  1 4   ? 73.625  23.937  -38.429  1.00 138.70 ? 3   HIS D C   1 
ATOM   6442  O  O   . HIS D  1 4   ? 72.834  24.498  -39.194  1.00 141.71 ? 3   HIS D O   1 
ATOM   6443  C  CB  . HIS D  1 4   ? 72.544  24.600  -36.285  1.00 118.85 ? 3   HIS D CB  1 
ATOM   6444  C  CG  . HIS D  1 4   ? 73.494  25.279  -35.348  1.00 112.40 ? 3   HIS D CG  1 
ATOM   6445  N  ND1 . HIS D  1 4   ? 74.775  25.635  -35.711  1.00 129.27 ? 3   HIS D ND1 1 
ATOM   6446  C  CD2 . HIS D  1 4   ? 73.342  25.679  -34.063  1.00 95.01  ? 3   HIS D CD2 1 
ATOM   6447  C  CE1 . HIS D  1 4   ? 75.374  26.221  -34.689  1.00 110.54 ? 3   HIS D CE1 1 
ATOM   6448  N  NE2 . HIS D  1 4   ? 74.526  26.261  -33.678  1.00 118.81 ? 3   HIS D NE2 1 
ATOM   6449  N  N   . ILE D  1 5   ? 74.908  23.746  -38.725  1.00 149.54 ? 4   ILE D N   1 
ATOM   6450  C  CA  . ILE D  1 5   ? 75.430  24.040  -40.055  1.00 146.90 ? 4   ILE D CA  1 
ATOM   6451  C  C   . ILE D  1 5   ? 75.014  22.875  -40.951  1.00 150.78 ? 4   ILE D C   1 
ATOM   6452  O  O   . ILE D  1 5   ? 75.825  22.004  -41.276  1.00 132.74 ? 4   ILE D O   1 
ATOM   6453  C  CB  . ILE D  1 5   ? 76.972  24.196  -40.060  1.00 148.31 ? 4   ILE D CB  1 
ATOM   6454  C  CG1 . ILE D  1 5   ? 77.547  24.025  -38.645  1.00 146.01 ? 4   ILE D CG1 1 
ATOM   6455  C  CG2 . ILE D  1 5   ? 77.382  25.540  -40.682  1.00 102.83 ? 4   ILE D CG2 1 
ATOM   6456  C  CD1 . ILE D  1 5   ? 77.521  25.287  -37.785  1.00 140.53 ? 4   ILE D CD1 1 
ATOM   6457  N  N   . GLN D  1 6   ? 73.737  22.866  -41.328  1.00 142.85 ? 5   GLN D N   1 
ATOM   6458  C  CA  . GLN D  1 6   ? 73.119  21.714  -41.979  1.00 131.54 ? 5   GLN D CA  1 
ATOM   6459  C  C   . GLN D  1 6   ? 73.752  21.363  -43.322  1.00 115.45 ? 5   GLN D C   1 
ATOM   6460  O  O   . GLN D  1 6   ? 73.923  22.215  -44.196  1.00 99.98  ? 5   GLN D O   1 
ATOM   6461  C  CB  . GLN D  1 6   ? 71.607  21.924  -42.130  1.00 98.31  ? 5   GLN D CB  1 
ATOM   6462  C  CG  . GLN D  1 6   ? 70.838  21.895  -40.813  1.00 115.70 ? 5   GLN D CG  1 
ATOM   6463  C  CD  . GLN D  1 6   ? 69.480  22.571  -40.910  1.00 105.07 ? 5   GLN D CD  1 
ATOM   6464  O  OE1 . GLN D  1 6   ? 69.189  23.270  -41.882  1.00 91.80  ? 5   GLN D OE1 1 
ATOM   6465  N  NE2 . GLN D  1 6   ? 68.644  22.370  -39.896  1.00 102.96 ? 5   GLN D NE2 1 
ATOM   6466  N  N   . ARG D  1 7   ? 74.111  20.091  -43.460  1.00 108.66 ? 6   ARG D N   1 
ATOM   6467  C  CA  . ARG D  1 7   ? 74.616  19.552  -44.712  1.00 113.78 ? 6   ARG D CA  1 
ATOM   6468  C  C   . ARG D  1 7   ? 73.845  18.276  -45.016  1.00 109.65 ? 6   ARG D C   1 
ATOM   6469  O  O   . ARG D  1 7   ? 73.776  17.366  -44.181  1.00 75.63  ? 6   ARG D O   1 
ATOM   6470  C  CB  . ARG D  1 7   ? 76.110  19.250  -44.609  1.00 80.54  ? 6   ARG D CB  1 
ATOM   6471  C  CG  . ARG D  1 7   ? 76.973  20.457  -44.279  1.00 127.45 ? 6   ARG D CG  1 
ATOM   6472  C  CD  . ARG D  1 7   ? 78.183  20.049  -43.447  1.00 126.45 ? 6   ARG D CD  1 
ATOM   6473  N  NE  . ARG D  1 7   ? 79.028  19.076  -44.136  1.00 114.10 ? 6   ARG D NE  1 
ATOM   6474  C  CZ  . ARG D  1 7   ? 80.020  18.404  -43.558  1.00 117.35 ? 6   ARG D CZ  1 
ATOM   6475  N  NH1 . ARG D  1 7   ? 80.290  18.589  -42.273  1.00 93.59  ? 6   ARG D NH1 1 
ATOM   6476  N  NH2 . ARG D  1 7   ? 80.739  17.540  -44.263  1.00 114.51 ? 6   ARG D NH2 1 
ATOM   6477  N  N   . GLU D  1 8   ? 73.260  18.223  -46.209  1.00 83.53  ? 7   GLU D N   1 
ATOM   6478  C  CA  . GLU D  1 8   ? 72.479  17.072  -46.633  1.00 82.51  ? 7   GLU D CA  1 
ATOM   6479  C  C   . GLU D  1 8   ? 72.934  16.589  -48.001  1.00 82.91  ? 7   GLU D C   1 
ATOM   6480  O  O   . GLU D  1 8   ? 72.944  17.350  -48.967  1.00 79.05  ? 7   GLU D O   1 
ATOM   6481  C  CB  . GLU D  1 8   ? 70.994  17.423  -46.677  1.00 95.77  ? 7   GLU D CB  1 
ATOM   6482  C  CG  . GLU D  1 8   ? 70.100  16.254  -47.032  1.00 93.01  ? 7   GLU D CG  1 
ATOM   6483  C  CD  . GLU D  1 8   ? 68.638  16.639  -47.071  1.00 79.32  ? 7   GLU D CD  1 
ATOM   6484  O  OE1 . GLU D  1 8   ? 68.121  16.894  -48.182  1.00 79.34  ? 7   GLU D OE1 1 
ATOM   6485  O  OE2 . GLU D  1 8   ? 68.011  16.690  -45.995  1.00 87.21  ? 7   GLU D OE2 1 
ATOM   6486  N  N   . THR D  1 9   ? 73.311  15.319  -48.079  1.00 78.65  ? 8   THR D N   1 
ATOM   6487  C  CA  . THR D  1 9   ? 73.730  14.735  -49.345  1.00 78.19  ? 8   THR D CA  1 
ATOM   6488  C  C   . THR D  1 9   ? 72.765  13.633  -49.764  1.00 82.47  ? 8   THR D C   1 
ATOM   6489  O  O   . THR D  1 9   ? 72.195  12.944  -48.922  1.00 78.73  ? 8   THR D O   1 
ATOM   6490  C  CB  . THR D  1 9   ? 75.168  14.170  -49.267  1.00 83.50  ? 8   THR D CB  1 
ATOM   6491  O  OG1 . THR D  1 9   ? 75.325  13.404  -48.065  1.00 90.62  ? 8   THR D OG1 1 
ATOM   6492  C  CG2 . THR D  1 9   ? 76.189  15.300  -49.283  1.00 103.57 ? 8   THR D CG2 1 
ATOM   6493  N  N   . SER D  1 10  ? 72.567  13.475  -51.067  1.00 77.16  ? 9   SER D N   1 
ATOM   6494  C  CA  . SER D  1 10  ? 71.765  12.361  -51.545  1.00 100.06 ? 9   SER D CA  1 
ATOM   6495  C  C   . SER D  1 10  ? 72.539  11.062  -51.330  1.00 94.42  ? 9   SER D C   1 
ATOM   6496  O  O   . SER D  1 10  ? 73.765  11.034  -51.424  1.00 102.63 ? 9   SER D O   1 
ATOM   6497  C  CB  . SER D  1 10  ? 71.379  12.558  -53.010  1.00 100.50 ? 9   SER D CB  1 
ATOM   6498  O  OG  . SER D  1 10  ? 70.491  13.657  -53.145  1.00 101.37 ? 9   SER D OG  1 
ATOM   6499  N  N   . CYS D  1 11  ? 71.823  9.992   -51.012  1.00 82.32  ? 10  CYS D N   1 
ATOM   6500  C  CA  . CYS D  1 11  ? 72.463  8.726   -50.688  1.00 86.41  ? 10  CYS D CA  1 
ATOM   6501  C  C   . CYS D  1 11  ? 71.658  7.553   -51.224  1.00 95.74  ? 10  CYS D C   1 
ATOM   6502  O  O   . CYS D  1 11  ? 70.560  7.725   -51.752  1.00 93.11  ? 10  CYS D O   1 
ATOM   6503  C  CB  . CYS D  1 11  ? 72.618  8.584   -49.173  1.00 78.43  ? 10  CYS D CB  1 
ATOM   6504  S  SG  . CYS D  1 11  ? 71.056  8.518   -48.269  1.00 69.60  ? 10  CYS D SG  1 
ATOM   6505  N  N   . SER D  1 12  ? 72.213  6.357   -51.079  1.00 93.62  ? 11  SER D N   1 
ATOM   6506  C  CA  . SER D  1 12  ? 71.523  5.148   -51.494  1.00 79.72  ? 11  SER D CA  1 
ATOM   6507  C  C   . SER D  1 12  ? 70.776  4.564   -50.311  1.00 65.51  ? 11  SER D C   1 
ATOM   6508  O  O   . SER D  1 12  ? 71.102  4.848   -49.158  1.00 80.61  ? 11  SER D O   1 
ATOM   6509  C  CB  . SER D  1 12  ? 72.515  4.116   -52.031  1.00 81.02  ? 11  SER D CB  1 
ATOM   6510  O  OG  . SER D  1 12  ? 73.320  3.589   -50.990  1.00 88.10  ? 11  SER D OG  1 
ATOM   6511  N  N   . ARG D  1 13  ? 69.766  3.752   -50.606  1.00 86.83  ? 12  ARG D N   1 
ATOM   6512  C  CA  . ARG D  1 13  ? 69.056  3.011   -49.577  1.00 93.03  ? 12  ARG D CA  1 
ATOM   6513  C  C   . ARG D  1 13  ? 70.068  2.098   -48.894  1.00 69.05  ? 12  ARG D C   1 
ATOM   6514  O  O   . ARG D  1 13  ? 70.766  1.329   -49.554  1.00 106.43 ? 12  ARG D O   1 
ATOM   6515  C  CB  . ARG D  1 13  ? 67.903  2.220   -50.193  1.00 65.00  ? 12  ARG D CB  1 
ATOM   6516  C  CG  . ARG D  1 13  ? 67.018  1.520   -49.185  1.00 68.73  ? 12  ARG D CG  1 
ATOM   6517  C  CD  . ARG D  1 13  ? 65.836  0.867   -49.874  1.00 86.03  ? 12  ARG D CD  1 
ATOM   6518  N  NE  . ARG D  1 13  ? 65.445  -0.366  -49.195  1.00 111.80 ? 12  ARG D NE  1 
ATOM   6519  C  CZ  . ARG D  1 13  ? 64.198  -0.680  -48.859  1.00 103.15 ? 12  ARG D CZ  1 
ATOM   6520  N  NH1 . ARG D  1 13  ? 63.200  0.151   -49.140  1.00 96.07  ? 12  ARG D NH1 1 
ATOM   6521  N  NH2 . ARG D  1 13  ? 63.952  -1.830  -48.241  1.00 95.98  ? 12  ARG D NH2 1 
ATOM   6522  N  N   . PRO D  1 14  ? 70.171  2.209   -47.567  1.00 88.45  ? 13  PRO D N   1 
ATOM   6523  C  CA  . PRO D  1 14  ? 71.284  1.672   -46.776  1.00 117.26 ? 13  PRO D CA  1 
ATOM   6524  C  C   . PRO D  1 14  ? 71.240  0.170   -46.497  1.00 119.49 ? 13  PRO D C   1 
ATOM   6525  O  O   . PRO D  1 14  ? 70.409  -0.564  -47.036  1.00 120.72 ? 13  PRO D O   1 
ATOM   6526  C  CB  . PRO D  1 14  ? 71.155  2.437   -45.457  1.00 115.76 ? 13  PRO D CB  1 
ATOM   6527  C  CG  . PRO D  1 14  ? 69.689  2.673   -45.327  1.00 93.98  ? 13  PRO D CG  1 
ATOM   6528  C  CD  . PRO D  1 14  ? 69.200  2.932   -46.729  1.00 89.13  ? 13  PRO D CD  1 
ATOM   6529  N  N   . ARG D  1 15  ? 72.156  -0.263  -45.634  1.00 121.68 ? 14  ARG D N   1 
ATOM   6530  C  CA  . ARG D  1 15  ? 72.305  -1.664  -45.261  1.00 108.50 ? 14  ARG D CA  1 
ATOM   6531  C  C   . ARG D  1 15  ? 71.314  -2.025  -44.156  1.00 84.29  ? 14  ARG D C   1 
ATOM   6532  O  O   . ARG D  1 15  ? 71.586  -1.798  -42.977  1.00 102.67 ? 14  ARG D O   1 
ATOM   6533  C  CB  . ARG D  1 15  ? 73.740  -1.918  -44.781  1.00 91.57  ? 14  ARG D CB  1 
ATOM   6534  C  CG  . ARG D  1 15  ? 74.833  -1.265  -45.661  1.00 67.80  ? 14  ARG D CG  1 
ATOM   6535  C  CD  . ARG D  1 15  ? 75.546  -2.282  -46.540  1.00 72.21  ? 14  ARG D CD  1 
ATOM   6536  N  NE  . ARG D  1 15  ? 76.704  -2.886  -45.884  1.00 93.26  ? 14  ARG D NE  1 
ATOM   6537  C  CZ  . ARG D  1 15  ? 77.322  -3.986  -46.311  1.00 115.68 ? 14  ARG D CZ  1 
ATOM   6538  N  NH1 . ARG D  1 15  ? 76.890  -4.625  -47.393  1.00 114.77 ? 14  ARG D NH1 1 
ATOM   6539  N  NH2 . ARG D  1 15  ? 78.371  -4.459  -45.650  1.00 73.53  ? 14  ARG D NH2 1 
ATOM   6540  N  N   . LEU D  1 16  ? 70.174  -2.593  -44.546  1.00 99.40  ? 15  LEU D N   1 
ATOM   6541  C  CA  . LEU D  1 16  ? 69.097  -2.922  -43.608  1.00 93.69  ? 15  LEU D CA  1 
ATOM   6542  C  C   . LEU D  1 16  ? 69.450  -4.047  -42.625  1.00 83.18  ? 15  LEU D C   1 
ATOM   6543  O  O   . LEU D  1 16  ? 70.572  -4.561  -42.633  1.00 103.34 ? 15  LEU D O   1 
ATOM   6544  C  CB  . LEU D  1 16  ? 67.815  -3.257  -44.368  1.00 108.64 ? 15  LEU D CB  1 
ATOM   6545  C  CG  . LEU D  1 16  ? 66.686  -2.251  -44.157  1.00 104.91 ? 15  LEU D CG  1 
ATOM   6546  C  CD1 . LEU D  1 16  ? 65.455  -2.661  -44.954  1.00 84.19  ? 15  LEU D CD1 1 
ATOM   6547  C  CD2 . LEU D  1 16  ? 66.367  -2.130  -42.673  1.00 95.91  ? 15  LEU D CD2 1 
ATOM   6548  N  N   . ASN D  1 17  ? 68.489  -4.435  -41.787  1.00 100.06 ? 16  ASN D N   1 
ATOM   6549  C  CA  . ASN D  1 17  ? 68.793  -5.336  -40.674  1.00 120.35 ? 16  ASN D CA  1 
ATOM   6550  C  C   . ASN D  1 17  ? 67.847  -6.535  -40.481  1.00 139.66 ? 16  ASN D C   1 
ATOM   6551  O  O   . ASN D  1 17  ? 66.969  -6.515  -39.606  1.00 123.48 ? 16  ASN D O   1 
ATOM   6552  C  CB  . ASN D  1 17  ? 68.900  -4.534  -39.372  1.00 143.49 ? 16  ASN D CB  1 
ATOM   6553  C  CG  . ASN D  1 17  ? 70.029  -5.015  -38.475  1.00 121.89 ? 16  ASN D CG  1 
ATOM   6554  O  OD1 . ASN D  1 17  ? 70.915  -5.755  -38.903  1.00 133.25 ? 16  ASN D OD1 1 
ATOM   6555  N  ND2 . ASN D  1 17  ? 70.002  -4.586  -37.223  1.00 85.69  ? 16  ASN D ND2 1 
ATOM   6556  N  N   . SER D  1 18  ? 68.051  -7.570  -41.298  1.00 112.34 ? 17  SER D N   1 
ATOM   6557  C  CA  . SER D  1 18  ? 67.380  -8.868  -41.142  1.00 121.26 ? 17  SER D CA  1 
ATOM   6558  C  C   . SER D  1 18  ? 65.849  -8.816  -41.128  1.00 121.95 ? 17  SER D C   1 
ATOM   6559  O  O   . SER D  1 18  ? 65.228  -8.054  -41.875  1.00 124.94 ? 17  SER D O   1 
ATOM   6560  C  CB  . SER D  1 18  ? 67.883  -9.590  -39.882  1.00 110.17 ? 17  SER D CB  1 
ATOM   6561  O  OG  . SER D  1 18  ? 67.451  -10.944 -39.863  1.00 94.35  ? 17  SER D OG  1 
ATOM   6562  N  N   . ASN D  1 19  ? 65.259  -9.650  -40.274  1.00 131.84 ? 18  ASN D N   1 
ATOM   6563  C  CA  . ASN D  1 19  ? 63.811  -9.794  -40.158  1.00 132.45 ? 18  ASN D CA  1 
ATOM   6564  C  C   . ASN D  1 19  ? 63.494  -10.522 -38.851  1.00 120.92 ? 18  ASN D C   1 
ATOM   6565  O  O   . ASN D  1 19  ? 64.404  -10.973 -38.154  1.00 98.21  ? 18  ASN D O   1 
ATOM   6566  C  CB  . ASN D  1 19  ? 63.263  -10.588 -41.351  1.00 130.76 ? 18  ASN D CB  1 
ATOM   6567  C  CG  . ASN D  1 19  ? 61.818  -10.242 -41.679  1.00 131.40 ? 18  ASN D CG  1 
ATOM   6568  O  OD1 . ASN D  1 19  ? 60.893  -10.635 -40.967  1.00 117.78 ? 18  ASN D OD1 1 
ATOM   6569  N  ND2 . ASN D  1 19  ? 61.619  -9.513  -42.774  1.00 126.58 ? 18  ASN D ND2 1 
ATOM   6570  N  N   . LEU D  1 20  ? 62.214  -10.631 -38.509  1.00 122.54 ? 19  LEU D N   1 
ATOM   6571  C  CA  . LEU D  1 20  ? 61.807  -11.419 -37.348  1.00 113.24 ? 19  LEU D CA  1 
ATOM   6572  C  C   . LEU D  1 20  ? 61.160  -12.716 -37.830  1.00 125.53 ? 19  LEU D C   1 
ATOM   6573  O  O   . LEU D  1 20  ? 60.506  -13.424 -37.061  1.00 130.78 ? 19  LEU D O   1 
ATOM   6574  C  CB  . LEU D  1 20  ? 60.835  -10.628 -36.462  1.00 97.96  ? 19  LEU D CB  1 
ATOM   6575  C  CG  . LEU D  1 20  ? 60.680  -10.990 -34.975  1.00 89.14  ? 19  LEU D CG  1 
ATOM   6576  C  CD1 . LEU D  1 20  ? 59.331  -11.649 -34.683  1.00 84.43  ? 19  LEU D CD1 1 
ATOM   6577  C  CD2 . LEU D  1 20  ? 61.821  -11.876 -34.498  1.00 109.40 ? 19  LEU D CD2 1 
ATOM   6578  N  N   . ASP D  1 21  ? 61.359  -13.026 -39.108  1.00 126.35 ? 20  ASP D N   1 
ATOM   6579  C  CA  . ASP D  1 21  ? 60.703  -14.173 -39.723  1.00 129.60 ? 20  ASP D CA  1 
ATOM   6580  C  C   . ASP D  1 21  ? 61.698  -15.204 -40.256  1.00 127.82 ? 20  ASP D C   1 
ATOM   6581  O  O   . ASP D  1 21  ? 61.676  -16.368 -39.849  1.00 129.24 ? 20  ASP D O   1 
ATOM   6582  C  CB  . ASP D  1 21  ? 59.776  -13.706 -40.850  1.00 127.06 ? 20  ASP D CB  1 
ATOM   6583  C  CG  . ASP D  1 21  ? 58.643  -14.681 -41.120  1.00 127.95 ? 20  ASP D CG  1 
ATOM   6584  O  OD1 . ASP D  1 21  ? 58.780  -15.874 -40.768  1.00 129.71 ? 20  ASP D OD1 1 
ATOM   6585  O  OD2 . ASP D  1 21  ? 57.613  -14.252 -41.685  1.00 124.60 ? 20  ASP D OD2 1 
ATOM   6586  N  N   . ALA D  1 22  ? 62.566  -14.773 -41.168  1.00 115.99 ? 21  ALA D N   1 
ATOM   6587  C  CA  . ALA D  1 22  ? 63.452  -15.700 -41.872  1.00 116.03 ? 21  ALA D CA  1 
ATOM   6588  C  C   . ALA D  1 22  ? 64.799  -15.912 -41.175  1.00 94.45  ? 21  ALA D C   1 
ATOM   6589  O  O   . ALA D  1 22  ? 65.782  -16.297 -41.808  1.00 101.45 ? 21  ALA D O   1 
ATOM   6590  C  CB  . ALA D  1 22  ? 63.658  -15.249 -43.319  1.00 95.85  ? 21  ALA D CB  1 
ATOM   6591  N  N   . ASP D  1 23  ? 64.838  -15.661 -39.871  1.00 107.11 ? 22  ASP D N   1 
ATOM   6592  C  CA  . ASP D  1 23  ? 66.030  -15.923 -39.071  1.00 103.74 ? 22  ASP D CA  1 
ATOM   6593  C  C   . ASP D  1 23  ? 65.715  -17.044 -38.098  1.00 114.39 ? 22  ASP D C   1 
ATOM   6594  O  O   . ASP D  1 23  ? 66.610  -17.692 -37.553  1.00 102.12 ? 22  ASP D O   1 
ATOM   6595  C  CB  . ASP D  1 23  ? 66.434  -14.668 -38.307  1.00 103.83 ? 22  ASP D CB  1 
ATOM   6596  C  CG  . ASP D  1 23  ? 65.238  -13.833 -37.903  1.00 130.71 ? 22  ASP D CG  1 
ATOM   6597  O  OD1 . ASP D  1 23  ? 64.295  -13.726 -38.719  1.00 128.40 ? 22  ASP D OD1 1 
ATOM   6598  O  OD2 . ASP D  1 23  ? 65.235  -13.290 -36.775  1.00 113.79 ? 22  ASP D OD2 1 
ATOM   6599  N  N   . LEU D  1 24  ? 64.420  -17.259 -37.894  1.00 111.45 ? 23  LEU D N   1 
ATOM   6600  C  CA  . LEU D  1 24  ? 63.923  -18.330 -37.049  1.00 93.37  ? 23  LEU D CA  1 
ATOM   6601  C  C   . LEU D  1 24  ? 63.674  -19.543 -37.930  1.00 105.18 ? 23  LEU D C   1 
ATOM   6602  O  O   . LEU D  1 24  ? 62.654  -20.223 -37.801  1.00 104.81 ? 23  LEU D O   1 
ATOM   6603  C  CB  . LEU D  1 24  ? 62.627  -17.892 -36.367  1.00 93.79  ? 23  LEU D CB  1 
ATOM   6604  C  CG  . LEU D  1 24  ? 62.622  -16.442 -35.872  1.00 95.23  ? 23  LEU D CG  1 
ATOM   6605  C  CD1 . LEU D  1 24  ? 61.267  -16.061 -35.276  1.00 86.36  ? 23  LEU D CD1 1 
ATOM   6606  C  CD2 . LEU D  1 24  ? 63.741  -16.210 -34.864  1.00 96.23  ? 23  LEU D CD2 1 
ATOM   6607  N  N   . TYR D  1 25  ? 64.617  -19.789 -38.837  1.00 105.78 ? 24  TYR D N   1 
ATOM   6608  C  CA  . TYR D  1 25  ? 64.518  -20.870 -39.804  1.00 105.57 ? 24  TYR D CA  1 
ATOM   6609  C  C   . TYR D  1 25  ? 64.344  -22.210 -39.109  1.00 116.13 ? 24  TYR D C   1 
ATOM   6610  O  O   . TYR D  1 25  ? 65.305  -22.795 -38.615  1.00 122.08 ? 24  TYR D O   1 
ATOM   6611  C  CB  . TYR D  1 25  ? 65.767  -20.906 -40.696  1.00 106.10 ? 24  TYR D CB  1 
ATOM   6612  C  CG  . TYR D  1 25  ? 65.677  -21.865 -41.872  1.00 119.01 ? 24  TYR D CG  1 
ATOM   6613  C  CD1 . TYR D  1 25  ? 64.446  -22.226 -42.416  1.00 103.58 ? 24  TYR D CD1 1 
ATOM   6614  C  CD2 . TYR D  1 25  ? 66.826  -22.412 -42.435  1.00 113.76 ? 24  TYR D CD2 1 
ATOM   6615  C  CE1 . TYR D  1 25  ? 64.362  -23.101 -43.490  1.00 110.04 ? 24  TYR D CE1 1 
ATOM   6616  C  CE2 . TYR D  1 25  ? 66.751  -23.289 -43.510  1.00 134.98 ? 24  TYR D CE2 1 
ATOM   6617  C  CZ  . TYR D  1 25  ? 65.518  -23.629 -44.032  1.00 118.91 ? 24  TYR D CZ  1 
ATOM   6618  O  OH  . TYR D  1 25  ? 65.440  -24.496 -45.097  1.00 118.27 ? 24  TYR D OH  1 
ATOM   6619  N  N   . GLY D  1 26  ? 63.107  -22.689 -39.068  1.00 115.72 ? 25  GLY D N   1 
ATOM   6620  C  CA  . GLY D  1 26  ? 62.835  -24.032 -38.596  1.00 100.50 ? 25  GLY D CA  1 
ATOM   6621  C  C   . GLY D  1 26  ? 63.045  -24.237 -37.111  1.00 79.79  ? 25  GLY D C   1 
ATOM   6622  O  O   . GLY D  1 26  ? 63.556  -25.273 -36.685  1.00 101.91 ? 25  GLY D O   1 
ATOM   6623  N  N   . TYR D  1 27  ? 62.672  -23.245 -36.316  1.00 82.61  ? 26  TYR D N   1 
ATOM   6624  C  CA  . TYR D  1 27  ? 62.518  -23.472 -34.893  1.00 64.86  ? 26  TYR D CA  1 
ATOM   6625  C  C   . TYR D  1 27  ? 61.170  -24.146 -34.740  1.00 99.48  ? 26  TYR D C   1 
ATOM   6626  O  O   . TYR D  1 27  ? 60.296  -23.978 -35.590  1.00 80.58  ? 26  TYR D O   1 
ATOM   6627  C  CB  . TYR D  1 27  ? 62.497  -22.154 -34.124  1.00 60.63  ? 26  TYR D CB  1 
ATOM   6628  C  CG  . TYR D  1 27  ? 63.830  -21.705 -33.570  1.00 84.37  ? 26  TYR D CG  1 
ATOM   6629  C  CD1 . TYR D  1 27  ? 64.305  -22.201 -32.362  1.00 85.85  ? 26  TYR D CD1 1 
ATOM   6630  C  CD2 . TYR D  1 27  ? 64.599  -20.760 -34.237  1.00 87.18  ? 26  TYR D CD2 1 
ATOM   6631  C  CE1 . TYR D  1 27  ? 65.519  -21.779 -31.841  1.00 60.03  ? 26  TYR D CE1 1 
ATOM   6632  C  CE2 . TYR D  1 27  ? 65.815  -20.333 -33.724  1.00 82.38  ? 26  TYR D CE2 1 
ATOM   6633  C  CZ  . TYR D  1 27  ? 66.269  -20.847 -32.527  1.00 78.41  ? 26  TYR D CZ  1 
ATOM   6634  O  OH  . TYR D  1 27  ? 67.477  -20.425 -32.013  1.00 69.42  ? 26  TYR D OH  1 
ATOM   6635  N  N   . ARG D  1 28  ? 60.997  -24.916 -33.673  1.00 86.78  ? 27  ARG D N   1 
ATOM   6636  C  CA  . ARG D  1 28  ? 59.672  -25.398 -33.320  1.00 80.38  ? 27  ARG D CA  1 
ATOM   6637  C  C   . ARG D  1 28  ? 59.054  -24.441 -32.314  1.00 67.57  ? 27  ARG D C   1 
ATOM   6638  O  O   . ARG D  1 28  ? 59.749  -23.892 -31.461  1.00 81.86  ? 27  ARG D O   1 
ATOM   6639  C  CB  . ARG D  1 28  ? 59.720  -26.829 -32.786  1.00 75.78  ? 27  ARG D CB  1 
ATOM   6640  C  CG  . ARG D  1 28  ? 59.605  -27.874 -33.882  1.00 89.86  ? 27  ARG D CG  1 
ATOM   6641  C  CD  . ARG D  1 28  ? 60.534  -29.049 -33.642  1.00 117.88 ? 27  ARG D CD  1 
ATOM   6642  N  NE  . ARG D  1 28  ? 60.293  -29.697 -32.357  1.00 107.80 ? 27  ARG D NE  1 
ATOM   6643  C  CZ  . ARG D  1 28  ? 59.504  -30.753 -32.185  1.00 117.12 ? 27  ARG D CZ  1 
ATOM   6644  N  NH1 . ARG D  1 28  ? 59.352  -31.275 -30.975  1.00 109.07 ? 27  ARG D NH1 1 
ATOM   6645  N  NH2 . ARG D  1 28  ? 58.870  -31.292 -33.219  1.00 123.02 ? 27  ARG D NH2 1 
ATOM   6646  N  N   . TRP D  1 29  ? 57.747  -24.231 -32.434  1.00 114.90 ? 28  TRP D N   1 
ATOM   6647  C  CA  . TRP D  1 29  ? 57.051  -23.234 -31.630  1.00 83.03  ? 28  TRP D CA  1 
ATOM   6648  C  C   . TRP D  1 29  ? 56.152  -23.867 -30.577  1.00 88.61  ? 28  TRP D C   1 
ATOM   6649  O  O   . TRP D  1 29  ? 55.773  -25.029 -30.691  1.00 101.98 ? 28  TRP D O   1 
ATOM   6650  C  CB  . TRP D  1 29  ? 56.216  -22.320 -32.529  1.00 101.40 ? 28  TRP D CB  1 
ATOM   6651  C  CG  . TRP D  1 29  ? 57.029  -21.430 -33.430  1.00 106.77 ? 28  TRP D CG  1 
ATOM   6652  C  CD1 . TRP D  1 29  ? 57.546  -21.749 -34.653  1.00 92.11  ? 28  TRP D CD1 1 
ATOM   6653  C  CD2 . TRP D  1 29  ? 57.404  -20.071 -33.179  1.00 79.07  ? 28  TRP D CD2 1 
ATOM   6654  N  NE1 . TRP D  1 29  ? 58.226  -20.674 -35.175  1.00 89.55  ? 28  TRP D NE1 1 
ATOM   6655  C  CE2 . TRP D  1 29  ? 58.152  -19.631 -34.289  1.00 93.31  ? 28  TRP D CE2 1 
ATOM   6656  C  CE3 . TRP D  1 29  ? 57.184  -19.184 -32.121  1.00 63.75  ? 28  TRP D CE3 1 
ATOM   6657  C  CZ2 . TRP D  1 29  ? 58.681  -18.346 -34.370  1.00 84.95  ? 28  TRP D CZ2 1 
ATOM   6658  C  CZ3 . TRP D  1 29  ? 57.710  -17.912 -32.205  1.00 93.70  ? 28  TRP D CZ3 1 
ATOM   6659  C  CH2 . TRP D  1 29  ? 58.449  -17.503 -33.322  1.00 91.24  ? 28  TRP D CH2 1 
ATOM   6660  N  N   . ALA D  1 30  ? 55.818  -23.082 -29.555  1.00 75.88  ? 29  ALA D N   1 
ATOM   6661  C  CA  . ALA D  1 30  ? 54.923  -23.508 -28.485  1.00 90.39  ? 29  ALA D CA  1 
ATOM   6662  C  C   . ALA D  1 30  ? 54.474  -22.287 -27.693  1.00 78.96  ? 29  ALA D C   1 
ATOM   6663  O  O   . ALA D  1 30  ? 55.282  -21.404 -27.405  1.00 81.17  ? 29  ALA D O   1 
ATOM   6664  C  CB  . ALA D  1 30  ? 55.625  -24.506 -27.565  1.00 72.55  ? 29  ALA D CB  1 
ATOM   6665  N  N   . ARG D  1 31  ? 53.190  -22.219 -27.349  1.00 93.91  ? 30  ARG D N   1 
ATOM   6666  C  CA  . ARG D  1 31  ? 52.714  -21.129 -26.497  1.00 93.01  ? 30  ARG D CA  1 
ATOM   6667  C  C   . ARG D  1 31  ? 52.804  -21.503 -25.018  1.00 77.13  ? 30  ARG D C   1 
ATOM   6668  O  O   . ARG D  1 31  ? 52.424  -22.605 -24.633  1.00 69.66  ? 30  ARG D O   1 
ATOM   6669  C  CB  . ARG D  1 31  ? 51.285  -20.701 -26.848  1.00 82.62  ? 30  ARG D CB  1 
ATOM   6670  C  CG  . ARG D  1 31  ? 50.688  -19.787 -25.781  1.00 104.92 ? 30  ARG D CG  1 
ATOM   6671  C  CD  . ARG D  1 31  ? 49.531  -18.931 -26.265  1.00 111.77 ? 30  ARG D CD  1 
ATOM   6672  N  NE  . ARG D  1 31  ? 49.246  -17.867 -25.302  1.00 93.42  ? 30  ARG D NE  1 
ATOM   6673  C  CZ  . ARG D  1 31  ? 48.353  -16.898 -25.487  1.00 106.90 ? 30  ARG D CZ  1 
ATOM   6674  N  NH1 . ARG D  1 31  ? 48.173  -15.971 -24.553  1.00 92.70  ? 30  ARG D NH1 1 
ATOM   6675  N  NH2 . ARG D  1 31  ? 47.644  -16.853 -26.607  1.00 107.77 ? 30  ARG D NH2 1 
ATOM   6676  N  N   . ASP D  1 32  ? 53.315  -20.578 -24.205  1.00 101.19 ? 31  ASP D N   1 
ATOM   6677  C  CA  . ASP D  1 32  ? 53.511  -20.804 -22.773  1.00 91.13  ? 31  ASP D CA  1 
ATOM   6678  C  C   . ASP D  1 32  ? 52.678  -19.857 -21.914  1.00 103.71 ? 31  ASP D C   1 
ATOM   6679  O  O   . ASP D  1 32  ? 52.322  -18.762 -22.352  1.00 121.77 ? 31  ASP D O   1 
ATOM   6680  C  CB  . ASP D  1 32  ? 54.987  -20.615 -22.404  1.00 94.14  ? 31  ASP D CB  1 
ATOM   6681  C  CG  . ASP D  1 32  ? 55.854  -21.783 -22.828  1.00 101.83 ? 31  ASP D CG  1 
ATOM   6682  O  OD1 . ASP D  1 32  ? 55.348  -22.680 -23.533  1.00 88.91  ? 31  ASP D OD1 1 
ATOM   6683  O  OD2 . ASP D  1 32  ? 57.049  -21.797 -22.464  1.00 103.70 ? 31  ASP D OD2 1 
ATOM   6684  N  N   . ASN D  1 33  ? 52.385  -20.296 -20.690  1.00 121.57 ? 32  ASN D N   1 
ATOM   6685  C  CA  . ASN D  1 33  ? 51.802  -19.457 -19.636  1.00 114.22 ? 32  ASN D CA  1 
ATOM   6686  C  C   . ASN D  1 33  ? 51.689  -20.219 -18.313  1.00 121.47 ? 32  ASN D C   1 
ATOM   6687  O  O   . ASN D  1 33  ? 50.668  -20.164 -17.623  1.00 108.72 ? 32  ASN D O   1 
ATOM   6688  C  CB  . ASN D  1 33  ? 50.439  -18.882 -20.039  1.00 113.36 ? 32  ASN D CB  1 
ATOM   6689  C  CG  . ASN D  1 33  ? 49.424  -19.954 -20.363  1.00 120.20 ? 32  ASN D CG  1 
ATOM   6690  O  OD1 . ASN D  1 33  ? 49.308  -20.389 -21.509  1.00 133.23 ? 32  ASN D OD1 1 
ATOM   6691  N  ND2 . ASN D  1 33  ? 48.677  -20.386 -19.353  1.00 124.84 ? 32  ASN D ND2 1 
ATOM   6692  N  N   . GLY D  1 38  ? 49.431  -10.839 -19.222  1.00 61.07  ? 37  GLY D N   1 
ATOM   6693  C  CA  . GLY D  1 38  ? 50.317  -9.864  -19.829  1.00 55.24  ? 37  GLY D CA  1 
ATOM   6694  C  C   . GLY D  1 38  ? 50.638  -10.221 -21.268  1.00 78.29  ? 37  GLY D C   1 
ATOM   6695  O  O   . GLY D  1 38  ? 49.744  -10.532 -22.056  1.00 68.04  ? 37  GLY D O   1 
ATOM   6696  N  N   . ALA D  1 39  ? 51.922  -10.181 -21.609  1.00 65.30  ? 38  ALA D N   1 
ATOM   6697  C  CA  . ALA D  1 39  ? 52.375  -10.519 -22.955  1.00 48.31  ? 38  ALA D CA  1 
ATOM   6698  C  C   . ALA D  1 39  ? 52.131  -11.985 -23.284  1.00 65.35  ? 38  ALA D C   1 
ATOM   6699  O  O   . ALA D  1 39  ? 52.164  -12.838 -22.398  1.00 63.26  ? 38  ALA D O   1 
ATOM   6700  C  CB  . ALA D  1 39  ? 53.848  -10.207 -23.096  1.00 47.30  ? 38  ALA D CB  1 
ATOM   6701  N  N   . THR D  1 40  ? 51.892  -12.271 -24.562  1.00 54.35  ? 39  THR D N   1 
ATOM   6702  C  CA  . THR D  1 40  ? 51.857  -13.648 -25.038  1.00 56.17  ? 39  THR D CA  1 
ATOM   6703  C  C   . THR D  1 40  ? 53.293  -14.161 -25.106  1.00 68.99  ? 39  THR D C   1 
ATOM   6704  O  O   . THR D  1 40  ? 54.195  -13.438 -25.540  1.00 59.35  ? 39  THR D O   1 
ATOM   6705  C  CB  . THR D  1 40  ? 51.179  -13.764 -26.423  1.00 69.51  ? 39  THR D CB  1 
ATOM   6706  O  OG1 . THR D  1 40  ? 49.826  -13.302 -26.337  1.00 72.93  ? 39  THR D OG1 1 
ATOM   6707  C  CG2 . THR D  1 40  ? 51.169  -15.210 -26.903  1.00 70.22  ? 39  THR D CG2 1 
ATOM   6708  N  N   . ILE D  1 41  ? 53.514  -15.396 -24.663  1.00 56.03  ? 40  ILE D N   1 
ATOM   6709  C  CA  . ILE D  1 41  ? 54.868  -15.931 -24.588  1.00 70.61  ? 40  ILE D CA  1 
ATOM   6710  C  C   . ILE D  1 41  ? 55.055  -17.204 -25.404  1.00 64.72  ? 40  ILE D C   1 
ATOM   6711  O  O   . ILE D  1 41  ? 54.378  -18.202 -25.179  1.00 66.38  ? 40  ILE D O   1 
ATOM   6712  C  CB  . ILE D  1 41  ? 55.283  -16.202 -23.135  1.00 84.80  ? 40  ILE D CB  1 
ATOM   6713  C  CG1 . ILE D  1 41  ? 55.021  -14.968 -22.274  1.00 68.70  ? 40  ILE D CG1 1 
ATOM   6714  C  CG2 . ILE D  1 41  ? 56.750  -16.601 -23.070  1.00 67.78  ? 40  ILE D CG2 1 
ATOM   6715  C  CD1 . ILE D  1 41  ? 55.345  -15.170 -20.828  1.00 66.53  ? 40  ILE D CD1 1 
ATOM   6716  N  N   . TYR D  1 42  ? 55.987  -17.155 -26.350  1.00 57.29  ? 41  TYR D N   1 
ATOM   6717  C  CA  . TYR D  1 42  ? 56.300  -18.302 -27.190  1.00 59.83  ? 41  TYR D CA  1 
ATOM   6718  C  C   . TYR D  1 42  ? 57.684  -18.850 -26.841  1.00 67.46  ? 41  TYR D C   1 
ATOM   6719  O  O   . TYR D  1 42  ? 58.600  -18.096 -26.507  1.00 58.68  ? 41  TYR D O   1 
ATOM   6720  C  CB  . TYR D  1 42  ? 56.262  -17.920 -28.675  1.00 66.13  ? 41  TYR D CB  1 
ATOM   6721  C  CG  . TYR D  1 42  ? 54.934  -17.376 -29.173  1.00 80.95  ? 41  TYR D CG  1 
ATOM   6722  C  CD1 . TYR D  1 42  ? 53.943  -18.232 -29.642  1.00 91.02  ? 41  TYR D CD1 1 
ATOM   6723  C  CD2 . TYR D  1 42  ? 54.683  -16.003 -29.201  1.00 64.70  ? 41  TYR D CD2 1 
ATOM   6724  C  CE1 . TYR D  1 42  ? 52.733  -17.747 -30.107  1.00 79.65  ? 41  TYR D CE1 1 
ATOM   6725  C  CE2 . TYR D  1 42  ? 53.470  -15.507 -29.668  1.00 85.34  ? 41  TYR D CE2 1 
ATOM   6726  C  CZ  . TYR D  1 42  ? 52.502  -16.389 -30.119  1.00 72.73  ? 41  TYR D CZ  1 
ATOM   6727  O  OH  . TYR D  1 42  ? 51.296  -15.919 -30.584  1.00 100.79 ? 41  TYR D OH  1 
ATOM   6728  N  N   . ARG D  1 43  ? 57.823  -20.168 -26.911  1.00 66.81  ? 42  ARG D N   1 
ATOM   6729  C  CA  . ARG D  1 43  ? 59.099  -20.828 -26.678  1.00 65.23  ? 42  ARG D CA  1 
ATOM   6730  C  C   . ARG D  1 43  ? 59.609  -21.360 -28.012  1.00 69.83  ? 42  ARG D C   1 
ATOM   6731  O  O   . ARG D  1 43  ? 58.869  -22.016 -28.742  1.00 74.60  ? 42  ARG D O   1 
ATOM   6732  C  CB  . ARG D  1 43  ? 58.921  -21.984 -25.687  1.00 66.99  ? 42  ARG D CB  1 
ATOM   6733  C  CG  . ARG D  1 43  ? 60.223  -22.522 -25.111  1.00 77.28  ? 42  ARG D CG  1 
ATOM   6734  C  CD  . ARG D  1 43  ? 59.966  -23.447 -23.927  1.00 59.40  ? 42  ARG D CD  1 
ATOM   6735  N  NE  . ARG D  1 43  ? 59.530  -24.776 -24.350  1.00 73.76  ? 42  ARG D NE  1 
ATOM   6736  C  CZ  . ARG D  1 43  ? 60.340  -25.823 -24.485  1.00 81.92  ? 42  ARG D CZ  1 
ATOM   6737  N  NH1 . ARG D  1 43  ? 59.855  -26.993 -24.875  1.00 79.86  ? 42  ARG D NH1 1 
ATOM   6738  N  NH2 . ARG D  1 43  ? 61.634  -25.702 -24.226  1.00 94.65  ? 42  ARG D NH2 1 
ATOM   6739  N  N   . LEU D  1 44  ? 60.860  -21.059 -28.342  1.00 67.22  ? 43  LEU D N   1 
ATOM   6740  C  CA  . LEU D  1 44  ? 61.453  -21.544 -29.583  1.00 62.46  ? 43  LEU D CA  1 
ATOM   6741  C  C   . LEU D  1 44  ? 62.536  -22.571 -29.274  1.00 70.31  ? 43  LEU D C   1 
ATOM   6742  O  O   . LEU D  1 44  ? 63.570  -22.238 -28.694  1.00 60.39  ? 43  LEU D O   1 
ATOM   6743  C  CB  . LEU D  1 44  ? 62.025  -20.386 -30.400  1.00 67.13  ? 43  LEU D CB  1 
ATOM   6744  C  CG  . LEU D  1 44  ? 61.060  -19.308 -30.904  1.00 90.82  ? 43  LEU D CG  1 
ATOM   6745  C  CD1 . LEU D  1 44  ? 60.800  -18.232 -29.846  1.00 62.88  ? 43  LEU D CD1 1 
ATOM   6746  C  CD2 . LEU D  1 44  ? 61.595  -18.687 -32.192  1.00 78.09  ? 43  LEU D CD2 1 
ATOM   6747  N  N   . TYR D  1 45  ? 62.290  -23.817 -29.671  1.00 67.08  ? 44  TYR D N   1 
ATOM   6748  C  CA  . TYR D  1 45  ? 63.128  -24.947 -29.272  1.00 79.19  ? 44  TYR D CA  1 
ATOM   6749  C  C   . TYR D  1 45  ? 63.321  -25.950 -30.407  1.00 90.79  ? 44  TYR D C   1 
ATOM   6750  O  O   . TYR D  1 45  ? 62.854  -25.742 -31.527  1.00 85.78  ? 44  TYR D O   1 
ATOM   6751  C  CB  . TYR D  1 45  ? 62.466  -25.678 -28.103  1.00 72.00  ? 44  TYR D CB  1 
ATOM   6752  C  CG  . TYR D  1 45  ? 61.118  -26.262 -28.475  1.00 67.21  ? 44  TYR D CG  1 
ATOM   6753  C  CD1 . TYR D  1 45  ? 61.007  -27.562 -28.945  1.00 71.47  ? 44  TYR D CD1 1 
ATOM   6754  C  CD2 . TYR D  1 45  ? 59.961  -25.501 -28.377  1.00 92.62  ? 44  TYR D CD2 1 
ATOM   6755  C  CE1 . TYR D  1 45  ? 59.779  -28.094 -29.299  1.00 103.99 ? 44  TYR D CE1 1 
ATOM   6756  C  CE2 . TYR D  1 45  ? 58.729  -26.024 -28.727  1.00 88.29  ? 44  TYR D CE2 1 
ATOM   6757  C  CZ  . TYR D  1 45  ? 58.644  -27.319 -29.186  1.00 105.26 ? 44  TYR D CZ  1 
ATOM   6758  O  OH  . TYR D  1 45  ? 57.419  -27.843 -29.534  1.00 108.74 ? 44  TYR D OH  1 
ATOM   6759  N  N   . GLY D  1 46  ? 63.995  -27.053 -30.093  1.00 98.04  ? 45  GLY D N   1 
ATOM   6760  C  CA  . GLY D  1 46  ? 64.095  -28.187 -30.995  1.00 97.28  ? 45  GLY D CA  1 
ATOM   6761  C  C   . GLY D  1 46  ? 64.896  -27.946 -32.260  1.00 104.82 ? 45  GLY D C   1 
ATOM   6762  O  O   . GLY D  1 46  ? 64.773  -28.693 -33.231  1.00 105.50 ? 45  GLY D O   1 
ATOM   6763  N  N   . LYS D  1 47  ? 65.717  -26.903 -32.257  1.00 94.12  ? 46  LYS D N   1 
ATOM   6764  C  CA  . LYS D  1 47  ? 66.551  -26.606 -33.412  1.00 94.32  ? 46  LYS D CA  1 
ATOM   6765  C  C   . LYS D  1 47  ? 67.993  -27.018 -33.135  1.00 75.78  ? 46  LYS D C   1 
ATOM   6766  O  O   . LYS D  1 47  ? 68.596  -26.567 -32.160  1.00 86.01  ? 46  LYS D O   1 
ATOM   6767  C  CB  . LYS D  1 47  ? 66.461  -25.122 -33.778  1.00 93.86  ? 46  LYS D CB  1 
ATOM   6768  C  CG  . LYS D  1 47  ? 67.161  -24.754 -35.075  1.00 92.42  ? 46  LYS D CG  1 
ATOM   6769  C  CD  . LYS D  1 47  ? 66.784  -23.349 -35.528  1.00 83.85  ? 46  LYS D CD  1 
ATOM   6770  C  CE  . LYS D  1 47  ? 67.675  -22.881 -36.672  1.00 91.47  ? 46  LYS D CE  1 
ATOM   6771  N  NZ  . LYS D  1 47  ? 67.118  -21.685 -37.370  1.00 95.02  ? 46  LYS D NZ  1 
ATOM   6772  N  N   . PRO D  1 48  ? 68.545  -27.891 -33.990  1.00 90.74  ? 47  PRO D N   1 
ATOM   6773  C  CA  . PRO D  1 48  ? 69.917  -28.379 -33.812  1.00 87.12  ? 47  PRO D CA  1 
ATOM   6774  C  C   . PRO D  1 48  ? 70.934  -27.259 -34.018  1.00 90.95  ? 47  PRO D C   1 
ATOM   6775  O  O   . PRO D  1 48  ? 70.695  -26.351 -34.816  1.00 83.15  ? 47  PRO D O   1 
ATOM   6776  C  CB  . PRO D  1 48  ? 70.054  -29.454 -34.896  1.00 90.66  ? 47  PRO D CB  1 
ATOM   6777  C  CG  . PRO D  1 48  ? 69.060  -29.079 -35.933  1.00 78.81  ? 47  PRO D CG  1 
ATOM   6778  C  CD  . PRO D  1 48  ? 67.911  -28.440 -35.201  1.00 86.36  ? 47  PRO D CD  1 
ATOM   6779  N  N   . ASN D  1 49  ? 72.035  -27.313 -33.273  1.00 105.49 ? 48  ASN D N   1 
ATOM   6780  C  CA  . ASN D  1 49  ? 73.098  -26.311 -33.355  1.00 91.12  ? 48  ASN D CA  1 
ATOM   6781  C  C   . ASN D  1 49  ? 72.666  -24.900 -32.940  1.00 119.65 ? 48  ASN D C   1 
ATOM   6782  O  O   . ASN D  1 49  ? 73.474  -23.969 -32.960  1.00 113.01 ? 48  ASN D O   1 
ATOM   6783  C  CB  . ASN D  1 49  ? 73.723  -26.285 -34.760  1.00 110.75 ? 48  ASN D CB  1 
ATOM   6784  C  CG  . ASN D  1 49  ? 74.147  -27.663 -35.241  1.00 115.77 ? 48  ASN D CG  1 
ATOM   6785  O  OD1 . ASN D  1 49  ? 73.908  -28.669 -34.570  1.00 126.32 ? 48  ASN D OD1 1 
ATOM   6786  N  ND2 . ASN D  1 49  ? 74.771  -27.717 -36.417  1.00 101.31 ? 48  ASN D ND2 1 
ATOM   6787  N  N   . ALA D  1 50  ? 71.401  -24.745 -32.557  1.00 85.59  ? 49  ALA D N   1 
ATOM   6788  C  CA  . ALA D  1 50  ? 70.856  -23.435 -32.211  1.00 89.03  ? 49  ALA D CA  1 
ATOM   6789  C  C   . ALA D  1 50  ? 70.246  -23.432 -30.809  1.00 77.36  ? 49  ALA D C   1 
ATOM   6790  O  O   . ALA D  1 50  ? 69.667  -24.432 -30.378  1.00 81.99  ? 49  ALA D O   1 
ATOM   6791  C  CB  . ALA D  1 50  ? 69.827  -23.002 -33.249  1.00 85.16  ? 49  ALA D CB  1 
ATOM   6792  N  N   . PRO D  1 51  ? 70.372  -22.299 -30.094  1.00 93.81  ? 50  PRO D N   1 
ATOM   6793  C  CA  . PRO D  1 51  ? 69.896  -22.172 -28.710  1.00 85.67  ? 50  PRO D CA  1 
ATOM   6794  C  C   . PRO D  1 51  ? 68.389  -21.958 -28.593  1.00 80.89  ? 50  PRO D C   1 
ATOM   6795  O  O   . PRO D  1 51  ? 67.742  -21.513 -29.538  1.00 84.10  ? 50  PRO D O   1 
ATOM   6796  C  CB  . PRO D  1 51  ? 70.623  -20.919 -28.216  1.00 86.86  ? 50  PRO D CB  1 
ATOM   6797  C  CG  . PRO D  1 51  ? 70.762  -20.079 -29.441  1.00 65.63  ? 50  PRO D CG  1 
ATOM   6798  C  CD  . PRO D  1 51  ? 71.044  -21.068 -30.554  1.00 69.37  ? 50  PRO D CD  1 
ATOM   6799  N  N   . GLU D  1 52  ? 67.847  -22.268 -27.422  1.00 68.89  ? 51  GLU D N   1 
ATOM   6800  C  CA  . GLU D  1 52  ? 66.437  -22.039 -27.130  1.00 57.03  ? 51  GLU D CA  1 
ATOM   6801  C  C   . GLU D  1 52  ? 66.127  -20.545 -26.971  1.00 54.34  ? 51  GLU D C   1 
ATOM   6802  O  O   . GLU D  1 52  ? 66.935  -19.784 -26.437  1.00 53.79  ? 51  GLU D O   1 
ATOM   6803  C  CB  . GLU D  1 52  ? 66.061  -22.793 -25.858  1.00 63.51  ? 51  GLU D CB  1 
ATOM   6804  C  CG  . GLU D  1 52  ? 64.636  -22.597 -25.398  1.00 76.29  ? 51  GLU D CG  1 
ATOM   6805  C  CD  . GLU D  1 52  ? 64.291  -23.514 -24.241  1.00 104.66 ? 51  GLU D CD  1 
ATOM   6806  O  OE1 . GLU D  1 52  ? 65.229  -24.050 -23.611  1.00 98.72  ? 51  GLU D OE1 1 
ATOM   6807  O  OE2 . GLU D  1 52  ? 63.089  -23.707 -23.968  1.00 97.44  ? 51  GLU D OE2 1 
ATOM   6808  N  N   . LEU D  1 53  ? 64.949  -20.129 -27.426  1.00 62.59  ? 52  LEU D N   1 
ATOM   6809  C  CA  . LEU D  1 53  ? 64.579  -18.716 -27.380  1.00 58.95  ? 52  LEU D CA  1 
ATOM   6810  C  C   . LEU D  1 53  ? 63.175  -18.501 -26.822  1.00 52.52  ? 52  LEU D C   1 
ATOM   6811  O  O   . LEU D  1 53  ? 62.335  -19.395 -26.872  1.00 62.28  ? 52  LEU D O   1 
ATOM   6812  C  CB  . LEU D  1 53  ? 64.680  -18.098 -28.778  1.00 55.02  ? 52  LEU D CB  1 
ATOM   6813  C  CG  . LEU D  1 53  ? 66.038  -18.196 -29.482  1.00 49.36  ? 52  LEU D CG  1 
ATOM   6814  C  CD1 . LEU D  1 53  ? 65.945  -17.664 -30.900  1.00 61.44  ? 52  LEU D CD1 1 
ATOM   6815  C  CD2 . LEU D  1 53  ? 67.100  -17.438 -28.707  1.00 47.08  ? 52  LEU D CD2 1 
ATOM   6816  N  N   . PHE D  1 54  ? 62.939  -17.310 -26.278  1.00 50.96  ? 53  PHE D N   1 
ATOM   6817  C  CA  . PHE D  1 54  ? 61.608  -16.893 -25.854  1.00 64.68  ? 53  PHE D CA  1 
ATOM   6818  C  C   . PHE D  1 54  ? 61.160  -15.652 -26.614  1.00 45.55  ? 53  PHE D C   1 
ATOM   6819  O  O   . PHE D  1 54  ? 61.924  -14.704 -26.797  1.00 50.30  ? 53  PHE D O   1 
ATOM   6820  C  CB  . PHE D  1 54  ? 61.562  -16.616 -24.347  1.00 55.65  ? 53  PHE D CB  1 
ATOM   6821  C  CG  . PHE D  1 54  ? 61.477  -17.853 -23.514  1.00 52.60  ? 53  PHE D CG  1 
ATOM   6822  C  CD1 . PHE D  1 54  ? 60.318  -18.616 -23.506  1.00 64.05  ? 53  PHE D CD1 1 
ATOM   6823  C  CD2 . PHE D  1 54  ? 62.553  -18.262 -22.742  1.00 47.41  ? 53  PHE D CD2 1 
ATOM   6824  C  CE1 . PHE D  1 54  ? 60.231  -19.770 -22.749  1.00 64.06  ? 53  PHE D CE1 1 
ATOM   6825  C  CE2 . PHE D  1 54  ? 62.470  -19.423 -21.975  1.00 57.05  ? 53  PHE D CE2 1 
ATOM   6826  C  CZ  . PHE D  1 54  ? 61.306  -20.171 -21.979  1.00 65.16  ? 53  PHE D CZ  1 
ATOM   6827  N  N   . LEU D  1 55  ? 59.910  -15.666 -27.052  1.00 62.38  ? 54  LEU D N   1 
ATOM   6828  C  CA  . LEU D  1 55  ? 59.337  -14.519 -27.728  1.00 56.27  ? 54  LEU D CA  1 
ATOM   6829  C  C   . LEU D  1 55  ? 58.173  -13.964 -26.905  1.00 71.05  ? 54  LEU D C   1 
ATOM   6830  O  O   . LEU D  1 55  ? 57.231  -14.693 -26.574  1.00 61.84  ? 54  LEU D O   1 
ATOM   6831  C  CB  . LEU D  1 55  ? 58.886  -14.920 -29.137  1.00 49.47  ? 54  LEU D CB  1 
ATOM   6832  C  CG  . LEU D  1 55  ? 58.263  -13.842 -30.024  1.00 58.40  ? 54  LEU D CG  1 
ATOM   6833  C  CD1 . LEU D  1 55  ? 59.204  -12.657 -30.206  1.00 59.30  ? 54  LEU D CD1 1 
ATOM   6834  C  CD2 . LEU D  1 55  ? 57.899  -14.448 -31.359  1.00 62.28  ? 54  LEU D CD2 1 
ATOM   6835  N  N   . LYS D  1 56  ? 58.269  -12.686 -26.541  1.00 52.74  ? 55  LYS D N   1 
ATOM   6836  C  CA  . LYS D  1 56  ? 57.172  -11.974 -25.893  1.00 49.21  ? 55  LYS D CA  1 
ATOM   6837  C  C   . LYS D  1 56  ? 56.478  -11.038 -26.878  1.00 47.88  ? 55  LYS D C   1 
ATOM   6838  O  O   . LYS D  1 56  ? 57.127  -10.222 -27.538  1.00 58.83  ? 55  LYS D O   1 
ATOM   6839  C  CB  . LYS D  1 56  ? 57.674  -11.152 -24.702  1.00 54.24  ? 55  LYS D CB  1 
ATOM   6840  C  CG  . LYS D  1 56  ? 57.679  -11.876 -23.366  1.00 54.39  ? 55  LYS D CG  1 
ATOM   6841  C  CD  . LYS D  1 56  ? 58.013  -10.906 -22.234  1.00 55.43  ? 55  LYS D CD  1 
ATOM   6842  C  CE  . LYS D  1 56  ? 58.082  -11.606 -20.886  1.00 73.48  ? 55  LYS D CE  1 
ATOM   6843  N  NZ  . LYS D  1 56  ? 58.501  -10.669 -19.804  1.00 60.78  ? 55  LYS D NZ  1 
ATOM   6844  N  N   . HIS D  1 57  ? 55.158  -11.159 -26.970  1.00 49.72  ? 56  HIS D N   1 
ATOM   6845  C  CA  . HIS D  1 57  ? 54.357  -10.245 -27.772  1.00 60.05  ? 56  HIS D CA  1 
ATOM   6846  C  C   . HIS D  1 57  ? 53.383  -9.477  -26.900  1.00 50.49  ? 56  HIS D C   1 
ATOM   6847  O  O   . HIS D  1 57  ? 52.525  -10.069 -26.241  1.00 59.66  ? 56  HIS D O   1 
ATOM   6848  C  CB  . HIS D  1 57  ? 53.563  -10.989 -28.844  1.00 54.51  ? 56  HIS D CB  1 
ATOM   6849  C  CG  . HIS D  1 57  ? 52.656  -10.098 -29.637  1.00 61.46  ? 56  HIS D CG  1 
ATOM   6850  N  ND1 . HIS D  1 57  ? 51.430  -10.510 -30.111  1.00 62.84  ? 56  HIS D ND1 1 
ATOM   6851  C  CD2 . HIS D  1 57  ? 52.800  -8.811  -30.034  1.00 61.31  ? 56  HIS D CD2 1 
ATOM   6852  C  CE1 . HIS D  1 57  ? 50.859  -9.516  -30.769  1.00 61.27  ? 56  HIS D CE1 1 
ATOM   6853  N  NE2 . HIS D  1 57  ? 51.670  -8.474  -30.735  1.00 54.80  ? 56  HIS D NE2 1 
ATOM   6854  N  N   . GLY D  1 58  ? 53.513  -8.157  -26.917  1.00 49.63  ? 57  GLY D N   1 
ATOM   6855  C  CA  . GLY D  1 58  ? 52.591  -7.281  -26.219  1.00 53.31  ? 57  GLY D CA  1 
ATOM   6856  C  C   . GLY D  1 58  ? 51.811  -6.401  -27.178  1.00 55.20  ? 57  GLY D C   1 
ATOM   6857  O  O   . GLY D  1 58  ? 52.370  -5.807  -28.103  1.00 46.47  ? 57  GLY D O   1 
ATOM   6858  N  N   . LYS D  1 59  ? 50.504  -6.329  -26.972  1.00 57.66  ? 58  LYS D N   1 
ATOM   6859  C  CA  . LYS D  1 59  ? 49.678  -5.450  -27.778  1.00 43.28  ? 58  LYS D CA  1 
ATOM   6860  C  C   . LYS D  1 59  ? 49.023  -4.414  -26.868  1.00 63.95  ? 58  LYS D C   1 
ATOM   6861  O  O   . LYS D  1 59  ? 48.773  -4.681  -25.690  1.00 54.08  ? 58  LYS D O   1 
ATOM   6862  C  CB  . LYS D  1 59  ? 48.642  -6.261  -28.557  1.00 47.41  ? 58  LYS D CB  1 
ATOM   6863  C  CG  . LYS D  1 59  ? 47.811  -5.447  -29.540  1.00 67.72  ? 58  LYS D CG  1 
ATOM   6864  C  CD  . LYS D  1 59  ? 46.809  -6.323  -30.284  1.00 80.52  ? 58  LYS D CD  1 
ATOM   6865  C  CE  . LYS D  1 59  ? 47.471  -7.104  -31.408  1.00 96.49  ? 58  LYS D CE  1 
ATOM   6866  N  NZ  . LYS D  1 59  ? 48.051  -6.196  -32.442  1.00 93.05  ? 58  LYS D NZ  1 
ATOM   6867  N  N   . GLY D  1 60  ? 48.769  -3.230  -27.413  1.00 52.58  ? 59  GLY D N   1 
ATOM   6868  C  CA  . GLY D  1 60  ? 48.140  -2.161  -26.662  1.00 57.29  ? 59  GLY D CA  1 
ATOM   6869  C  C   . GLY D  1 60  ? 49.011  -1.684  -25.523  1.00 68.96  ? 59  GLY D C   1 
ATOM   6870  O  O   . GLY D  1 60  ? 50.187  -1.391  -25.715  1.00 54.15  ? 59  GLY D O   1 
ATOM   6871  N  N   . SER D  1 61  ? 48.438  -1.611  -24.328  1.00 55.47  ? 60  SER D N   1 
ATOM   6872  C  CA  . SER D  1 61  ? 49.195  -1.193  -23.155  1.00 68.48  ? 60  SER D CA  1 
ATOM   6873  C  C   . SER D  1 61  ? 50.279  -2.211  -22.815  1.00 54.77  ? 60  SER D C   1 
ATOM   6874  O  O   . SER D  1 61  ? 51.298  -1.867  -22.218  1.00 53.13  ? 60  SER D O   1 
ATOM   6875  C  CB  . SER D  1 61  ? 48.265  -0.991  -21.954  1.00 61.13  ? 60  SER D CB  1 
ATOM   6876  O  OG  . SER D  1 61  ? 47.641  -2.206  -21.579  1.00 67.67  ? 60  SER D OG  1 
ATOM   6877  N  N   . VAL D  1 62  ? 50.055  -3.467  -23.193  1.00 49.40  ? 61  VAL D N   1 
ATOM   6878  C  CA  . VAL D  1 62  ? 51.026  -4.518  -22.911  1.00 45.03  ? 61  VAL D CA  1 
ATOM   6879  C  C   . VAL D  1 62  ? 52.296  -4.317  -23.741  1.00 43.99  ? 61  VAL D C   1 
ATOM   6880  O  O   . VAL D  1 62  ? 53.388  -4.691  -23.318  1.00 51.66  ? 61  VAL D O   1 
ATOM   6881  C  CB  . VAL D  1 62  ? 50.433  -5.925  -23.127  1.00 52.87  ? 61  VAL D CB  1 
ATOM   6882  C  CG1 . VAL D  1 62  ? 51.447  -6.996  -22.761  1.00 47.76  ? 61  VAL D CG1 1 
ATOM   6883  C  CG2 . VAL D  1 62  ? 49.169  -6.098  -22.289  1.00 56.09  ? 61  VAL D CG2 1 
ATOM   6884  N  N   . ALA D  1 63  ? 52.162  -3.698  -24.908  1.00 45.83  ? 62  ALA D N   1 
ATOM   6885  C  CA  . ALA D  1 63  ? 53.339  -3.377  -25.707  1.00 45.27  ? 62  ALA D CA  1 
ATOM   6886  C  C   . ALA D  1 63  ? 54.290  -2.454  -24.937  1.00 43.37  ? 62  ALA D C   1 
ATOM   6887  O  O   . ALA D  1 63  ? 55.504  -2.588  -25.033  1.00 41.64  ? 62  ALA D O   1 
ATOM   6888  C  CB  . ALA D  1 63  ? 52.939  -2.762  -27.057  1.00 39.99  ? 62  ALA D CB  1 
ATOM   6889  N  N   . ASN D  1 64  ? 53.731  -1.528  -24.164  1.00 45.19  ? 63  ASN D N   1 
ATOM   6890  C  CA  . ASN D  1 64  ? 54.547  -0.632  -23.349  1.00 36.08  ? 63  ASN D CA  1 
ATOM   6891  C  C   . ASN D  1 64  ? 55.284  -1.388  -22.258  1.00 39.92  ? 63  ASN D C   1 
ATOM   6892  O  O   . ASN D  1 64  ? 56.433  -1.079  -21.947  1.00 38.51  ? 63  ASN D O   1 
ATOM   6893  C  CB  . ASN D  1 64  ? 53.695  0.492   -22.754  1.00 45.24  ? 63  ASN D CB  1 
ATOM   6894  C  CG  . ASN D  1 64  ? 53.263  1.503   -23.800  1.00 53.08  ? 63  ASN D CG  1 
ATOM   6895  O  OD1 . ASN D  1 64  ? 53.985  1.762   -24.762  1.00 56.53  ? 63  ASN D OD1 1 
ATOM   6896  N  ND2 . ASN D  1 64  ? 52.080  2.069   -23.624  1.00 56.53  ? 63  ASN D ND2 1 
ATOM   6897  N  N   . ASP D  1 65  ? 54.615  -2.386  -21.684  1.00 47.73  ? 64  ASP D N   1 
ATOM   6898  C  CA  . ASP D  1 65  ? 55.232  -3.242  -20.681  1.00 37.74  ? 64  ASP D CA  1 
ATOM   6899  C  C   . ASP D  1 65  ? 56.417  -3.996  -21.254  1.00 41.57  ? 64  ASP D C   1 
ATOM   6900  O  O   . ASP D  1 65  ? 57.466  -4.103  -20.618  1.00 41.65  ? 64  ASP D O   1 
ATOM   6901  C  CB  . ASP D  1 65  ? 54.223  -4.258  -20.127  1.00 42.95  ? 64  ASP D CB  1 
ATOM   6902  C  CG  . ASP D  1 65  ? 53.006  -3.601  -19.504  1.00 66.51  ? 64  ASP D CG  1 
ATOM   6903  O  OD1 . ASP D  1 65  ? 53.075  -2.389  -19.203  1.00 81.35  ? 64  ASP D OD1 1 
ATOM   6904  O  OD2 . ASP D  1 65  ? 51.986  -4.304  -19.310  1.00 63.66  ? 64  ASP D OD2 1 
ATOM   6905  N  N   . VAL D  1 66  ? 56.244  -4.534  -22.454  1.00 44.05  ? 65  VAL D N   1 
ATOM   6906  C  CA  . VAL D  1 66  ? 57.312  -5.285  -23.101  1.00 38.78  ? 65  VAL D CA  1 
ATOM   6907  C  C   . VAL D  1 66  ? 58.477  -4.357  -23.502  1.00 37.80  ? 65  VAL D C   1 
ATOM   6908  O  O   . VAL D  1 66  ? 59.648  -4.733  -23.399  1.00 44.34  ? 65  VAL D O   1 
ATOM   6909  C  CB  . VAL D  1 66  ? 56.770  -6.085  -24.306  1.00 35.79  ? 65  VAL D CB  1 
ATOM   6910  C  CG1 . VAL D  1 66  ? 57.917  -6.708  -25.111  1.00 42.69  ? 65  VAL D CG1 1 
ATOM   6911  C  CG2 . VAL D  1 66  ? 55.769  -7.150  -23.838  1.00 38.74  ? 65  VAL D CG2 1 
ATOM   6912  N  N   . THR D  1 67  ? 58.147  -3.148  -23.953  1.00 39.51  ? 66  THR D N   1 
ATOM   6913  C  CA  . THR D  1 67  ? 59.150  -2.115  -24.229  1.00 36.53  ? 66  THR D CA  1 
ATOM   6914  C  C   . THR D  1 67  ? 59.931  -1.724  -22.964  1.00 38.73  ? 66  THR D C   1 
ATOM   6915  O  O   . THR D  1 67  ? 61.147  -1.599  -23.002  1.00 40.82  ? 66  THR D O   1 
ATOM   6916  C  CB  . THR D  1 67  ? 58.513  -0.852  -24.864  1.00 36.83  ? 66  THR D CB  1 
ATOM   6917  O  OG1 . THR D  1 67  ? 57.792  -1.214  -26.052  1.00 36.61  ? 66  THR D OG1 1 
ATOM   6918  C  CG2 . THR D  1 67  ? 59.588  0.171   -25.227  1.00 33.34  ? 66  THR D CG2 1 
ATOM   6919  N  N   . ASP D  1 68  ? 59.232  -1.552  -21.847  1.00 34.98  ? 67  ASP D N   1 
ATOM   6920  C  CA  . ASP D  1 68  ? 59.891  -1.309  -20.559  1.00 35.19  ? 67  ASP D CA  1 
ATOM   6921  C  C   . ASP D  1 68  ? 60.925  -2.387  -20.236  1.00 37.76  ? 67  ASP D C   1 
ATOM   6922  O  O   . ASP D  1 68  ? 62.021  -2.087  -19.753  1.00 36.56  ? 67  ASP D O   1 
ATOM   6923  C  CB  . ASP D  1 68  ? 58.869  -1.266  -19.416  1.00 36.35  ? 67  ASP D CB  1 
ATOM   6924  C  CG  . ASP D  1 68  ? 58.043  0.001   -19.418  1.00 54.27  ? 67  ASP D CG  1 
ATOM   6925  O  OD1 . ASP D  1 68  ? 58.457  0.960   -20.093  1.00 44.38  ? 67  ASP D OD1 1 
ATOM   6926  O  OD2 . ASP D  1 68  ? 56.987  0.040   -18.749  1.00 50.35  ? 67  ASP D OD2 1 
ATOM   6927  N  N   . GLU D  1 69  ? 60.570  -3.643  -20.493  1.00 36.35  ? 68  GLU D N   1 
ATOM   6928  C  CA  . GLU D  1 69  ? 61.472  -4.737  -20.168  1.00 37.48  ? 68  GLU D CA  1 
ATOM   6929  C  C   . GLU D  1 69  ? 62.675  -4.733  -21.101  1.00 34.03  ? 68  GLU D C   1 
ATOM   6930  O  O   . GLU D  1 69  ? 63.796  -4.980  -20.671  1.00 38.97  ? 68  GLU D O   1 
ATOM   6931  C  CB  . GLU D  1 69  ? 60.779  -6.107  -20.221  1.00 44.19  ? 68  GLU D CB  1 
ATOM   6932  C  CG  . GLU D  1 69  ? 61.595  -7.164  -19.486  1.00 51.02  ? 68  GLU D CG  1 
ATOM   6933  C  CD  . GLU D  1 69  ? 61.229  -8.594  -19.837  1.00 82.71  ? 68  GLU D CD  1 
ATOM   6934  O  OE1 . GLU D  1 69  ? 60.347  -8.814  -20.697  1.00 69.45  ? 68  GLU D OE1 1 
ATOM   6935  O  OE2 . GLU D  1 69  ? 61.841  -9.505  -19.239  1.00 64.88  ? 68  GLU D OE2 1 
HETATM 6936  N  N   . MSE D  1 70  ? 62.437  -4.463  -22.379  1.00 38.17  ? 69  MSE D N   1 
HETATM 6937  C  CA  . MSE D  1 70  ? 63.536  -4.439  -23.337  1.00 39.54  ? 69  MSE D CA  1 
HETATM 6938  C  C   . MSE D  1 70  ? 64.643  -3.467  -22.930  1.00 37.16  ? 69  MSE D C   1 
HETATM 6939  O  O   . MSE D  1 70  ? 65.821  -3.824  -22.934  1.00 37.56  ? 69  MSE D O   1 
HETATM 6940  C  CB  . MSE D  1 70  ? 63.041  -4.146  -24.756  1.00 38.55  ? 69  MSE D CB  1 
HETATM 6941  C  CG  . MSE D  1 70  ? 64.155  -4.191  -25.801  1.00 39.83  ? 69  MSE D CG  1 
HETATM 6942  SE SE  . MSE D  1 70  ? 65.095  -2.493  -26.008  0.64 39.81  ? 69  MSE D SE  1 
HETATM 6943  C  CE  . MSE D  1 70  ? 63.574  -1.458  -26.539  1.00 41.05  ? 69  MSE D CE  1 
ATOM   6944  N  N   . VAL D  1 71  ? 64.285  -2.242  -22.564  1.00 35.25  ? 70  VAL D N   1 
ATOM   6945  C  CA  A VAL D  1 71  ? 65.310  -1.250  -22.247  0.64 32.58  ? 70  VAL D CA  1 
ATOM   6946  C  CA  B VAL D  1 71  ? 65.303  -1.249  -22.248  0.36 35.42  ? 70  VAL D CA  1 
ATOM   6947  C  C   . VAL D  1 71  ? 65.979  -1.498  -20.912  1.00 44.17  ? 70  VAL D C   1 
ATOM   6948  O  O   . VAL D  1 71  ? 67.135  -1.139  -20.731  1.00 37.32  ? 70  VAL D O   1 
ATOM   6949  C  CB  A VAL D  1 71  ? 64.807  0.207   -22.309  0.64 27.12  ? 70  VAL D CB  1 
ATOM   6950  C  CB  B VAL D  1 71  ? 64.711  0.141   -22.253  0.36 50.28  ? 70  VAL D CB  1 
ATOM   6951  C  CG1 A VAL D  1 71  ? 64.447  0.535   -23.723  0.64 49.88  ? 70  VAL D CG1 1 
ATOM   6952  C  CG1 B VAL D  1 71  ? 65.797  1.177   -22.501  0.36 23.58  ? 70  VAL D CG1 1 
ATOM   6953  C  CG2 A VAL D  1 71  ? 63.632  0.460   -21.320  0.64 23.79  ? 70  VAL D CG2 1 
ATOM   6954  C  CG2 B VAL D  1 71  ? 63.700  0.188   -23.328  0.36 28.92  ? 70  VAL D CG2 1 
ATOM   6955  N  N   . ARG D  1 72  ? 65.250  -2.113  -19.983  1.00 36.21  ? 71  ARG D N   1 
ATOM   6956  C  CA  . ARG D  1 72  ? 65.824  -2.413  -18.675  1.00 34.76  ? 71  ARG D CA  1 
ATOM   6957  C  C   . ARG D  1 72  ? 66.789  -3.598  -18.808  1.00 34.58  ? 71  ARG D C   1 
ATOM   6958  O  O   . ARG D  1 72  ? 67.841  -3.652  -18.164  1.00 37.04  ? 71  ARG D O   1 
ATOM   6959  C  CB  . ARG D  1 72  ? 64.714  -2.637  -17.629  1.00 37.27  ? 71  ARG D CB  1 
ATOM   6960  C  CG  . ARG D  1 72  ? 64.226  -1.322  -17.020  1.00 38.36  ? 71  ARG D CG  1 
ATOM   6961  C  CD  . ARG D  1 72  ? 62.791  -1.370  -16.502  1.00 33.45  ? 71  ARG D CD  1 
ATOM   6962  N  NE  . ARG D  1 72  ? 62.325  -0.031  -16.124  1.00 36.46  ? 71  ARG D NE  1 
ATOM   6963  C  CZ  . ARG D  1 72  ? 61.836  0.879   -16.971  1.00 33.91  ? 71  ARG D CZ  1 
ATOM   6964  N  NH1 . ARG D  1 72  ? 61.731  0.613   -18.266  1.00 32.15  ? 71  ARG D NH1 1 
ATOM   6965  N  NH2 . ARG D  1 72  ? 61.439  2.073   -16.517  1.00 31.39  ? 71  ARG D NH2 1 
ATOM   6966  N  N   . LEU D  1 73  ? 66.432  -4.519  -19.697  1.00 34.34  ? 72  LEU D N   1 
ATOM   6967  C  CA  . LEU D  1 73  ? 67.262  -5.671  -20.036  1.00 39.64  ? 72  LEU D CA  1 
ATOM   6968  C  C   . LEU D  1 73  ? 68.554  -5.156  -20.672  1.00 43.33  ? 72  LEU D C   1 
ATOM   6969  O  O   . LEU D  1 73  ? 69.660  -5.563  -20.315  1.00 40.23  ? 72  LEU D O   1 
ATOM   6970  C  CB  . LEU D  1 73  ? 66.497  -6.511  -21.057  1.00 39.77  ? 72  LEU D CB  1 
ATOM   6971  C  CG  . LEU D  1 73  ? 66.535  -8.031  -21.120  1.00 71.72  ? 72  LEU D CG  1 
ATOM   6972  C  CD1 . LEU D  1 73  ? 66.566  -8.651  -19.739  1.00 61.97  ? 72  LEU D CD1 1 
ATOM   6973  C  CD2 . LEU D  1 73  ? 65.299  -8.477  -21.880  1.00 54.31  ? 72  LEU D CD2 1 
ATOM   6974  N  N   . ASN D  1 74  ? 68.388  -4.230  -21.611  1.00 44.27  ? 73  ASN D N   1 
ATOM   6975  C  CA  . ASN D  1 74  ? 69.499  -3.656  -22.366  1.00 55.37  ? 73  ASN D CA  1 
ATOM   6976  C  C   . ASN D  1 74  ? 70.492  -2.934  -21.453  1.00 45.25  ? 73  ASN D C   1 
ATOM   6977  O  O   . ASN D  1 74  ? 71.710  -3.018  -21.647  1.00 41.34  ? 73  ASN D O   1 
ATOM   6978  C  CB  . ASN D  1 74  ? 68.941  -2.708  -23.435  1.00 40.10  ? 73  ASN D CB  1 
ATOM   6979  C  CG  . ASN D  1 74  ? 69.970  -2.315  -24.477  1.00 74.06  ? 73  ASN D CG  1 
ATOM   6980  O  OD1 . ASN D  1 74  ? 70.458  -3.158  -25.233  1.00 55.68  ? 73  ASN D OD1 1 
ATOM   6981  N  ND2 . ASN D  1 74  ? 70.281  -1.020  -24.545  1.00 57.72  ? 73  ASN D ND2 1 
ATOM   6982  N  N   . TRP D  1 75  ? 69.969  -2.247  -20.444  1.00 37.01  ? 74  TRP D N   1 
ATOM   6983  C  CA  . TRP D  1 75  ? 70.805  -1.513  -19.494  1.00 43.05  ? 74  TRP D CA  1 
ATOM   6984  C  C   . TRP D  1 75  ? 71.463  -2.415  -18.446  1.00 47.41  ? 74  TRP D C   1 
ATOM   6985  O  O   . TRP D  1 75  ? 72.681  -2.368  -18.249  1.00 38.03  ? 74  TRP D O   1 
ATOM   6986  C  CB  . TRP D  1 75  ? 70.014  -0.399  -18.778  1.00 32.91  ? 74  TRP D CB  1 
ATOM   6987  C  CG  . TRP D  1 75  ? 70.832  0.185   -17.658  1.00 37.07  ? 74  TRP D CG  1 
ATOM   6988  C  CD1 . TRP D  1 75  ? 71.885  1.047   -17.782  1.00 32.83  ? 74  TRP D CD1 1 
ATOM   6989  C  CD2 . TRP D  1 75  ? 70.711  -0.101  -16.259  1.00 31.63  ? 74  TRP D CD2 1 
ATOM   6990  N  NE1 . TRP D  1 75  ? 72.416  1.330   -16.542  1.00 33.74  ? 74  TRP D NE1 1 
ATOM   6991  C  CE2 . TRP D  1 75  ? 71.714  0.631   -15.593  1.00 35.99  ? 74  TRP D CE2 1 
ATOM   6992  C  CE3 . TRP D  1 75  ? 69.844  -0.906  -15.500  1.00 35.12  ? 74  TRP D CE3 1 
ATOM   6993  C  CZ2 . TRP D  1 75  ? 71.879  0.580   -14.215  1.00 43.34  ? 74  TRP D CZ2 1 
ATOM   6994  C  CZ3 . TRP D  1 75  ? 70.007  -0.946  -14.146  1.00 31.58  ? 74  TRP D CZ3 1 
ATOM   6995  C  CH2 . TRP D  1 75  ? 71.016  -0.213  -13.507  1.00 43.68  ? 74  TRP D CH2 1 
ATOM   6996  N  N   . LEU D  1 76  ? 70.653  -3.225  -17.768  1.00 34.32  ? 75  LEU D N   1 
ATOM   6997  C  CA  . LEU D  1 76  ? 71.116  -3.994  -16.612  1.00 35.75  ? 75  LEU D CA  1 
ATOM   6998  C  C   . LEU D  1 76  ? 72.072  -5.140  -16.990  1.00 41.66  ? 75  LEU D C   1 
ATOM   6999  O  O   . LEU D  1 76  ? 72.831  -5.634  -16.148  1.00 38.04  ? 75  LEU D O   1 
ATOM   7000  C  CB  . LEU D  1 76  ? 69.914  -4.517  -15.802  1.00 34.11  ? 75  LEU D CB  1 
ATOM   7001  C  CG  . LEU D  1 76  ? 70.182  -5.272  -14.492  1.00 39.78  ? 75  LEU D CG  1 
ATOM   7002  C  CD1 . LEU D  1 76  ? 70.960  -4.430  -13.496  1.00 35.27  ? 75  LEU D CD1 1 
ATOM   7003  C  CD2 . LEU D  1 76  ? 68.878  -5.776  -13.860  1.00 40.93  ? 75  LEU D CD2 1 
ATOM   7004  N  N   . THR D  1 77  ? 72.056  -5.545  -18.259  1.00 41.23  ? 76  THR D N   1 
ATOM   7005  C  CA  . THR D  1 77  ? 72.860  -6.687  -18.691  1.00 45.39  ? 76  THR D CA  1 
ATOM   7006  C  C   . THR D  1 77  ? 74.357  -6.416  -18.518  1.00 48.76  ? 76  THR D C   1 
ATOM   7007  O  O   . THR D  1 77  ? 75.153  -7.342  -18.397  1.00 47.34  ? 76  THR D O   1 
ATOM   7008  C  CB  . THR D  1 77  ? 72.528  -7.136  -20.140  1.00 48.26  ? 76  THR D CB  1 
ATOM   7009  O  OG1 . THR D  1 77  ? 73.083  -8.437  -20.377  1.00 69.54  ? 76  THR D OG1 1 
ATOM   7010  C  CG2 . THR D  1 77  ? 73.061  -6.153  -21.171  1.00 46.12  ? 76  THR D CG2 1 
ATOM   7011  N  N   . ALA D  1 78  ? 74.721  -5.137  -18.464  1.00 40.56  ? 77  ALA D N   1 
ATOM   7012  C  CA  . ALA D  1 78  ? 76.101  -4.736  -18.221  1.00 48.95  ? 77  ALA D CA  1 
ATOM   7013  C  C   . ALA D  1 78  ? 76.544  -5.038  -16.790  1.00 58.08  ? 77  ALA D C   1 
ATOM   7014  O  O   . ALA D  1 78  ? 77.738  -5.104  -16.517  1.00 46.84  ? 77  ALA D O   1 
ATOM   7015  C  CB  . ALA D  1 78  ? 76.289  -3.248  -18.544  1.00 52.43  ? 77  ALA D CB  1 
ATOM   7016  N  N   . PHE D  1 79  ? 75.582  -5.233  -15.888  1.00 45.83  ? 78  PHE D N   1 
ATOM   7017  C  CA  . PHE D  1 79  ? 75.879  -5.400  -14.466  1.00 54.16  ? 78  PHE D CA  1 
ATOM   7018  C  C   . PHE D  1 79  ? 75.497  -6.771  -13.875  1.00 60.33  ? 78  PHE D C   1 
ATOM   7019  O  O   . PHE D  1 79  ? 76.012  -7.160  -12.824  1.00 48.44  ? 78  PHE D O   1 
ATOM   7020  C  CB  . PHE D  1 79  ? 75.167  -4.315  -13.659  1.00 51.42  ? 78  PHE D CB  1 
ATOM   7021  C  CG  . PHE D  1 79  ? 75.474  -2.908  -14.100  1.00 37.11  ? 78  PHE D CG  1 
ATOM   7022  C  CD1 . PHE D  1 79  ? 76.571  -2.228  -13.589  1.00 46.23  ? 78  PHE D CD1 1 
ATOM   7023  C  CD2 . PHE D  1 79  ? 74.652  -2.255  -15.002  1.00 44.79  ? 78  PHE D CD2 1 
ATOM   7024  C  CE1 . PHE D  1 79  ? 76.846  -0.927  -13.984  1.00 43.80  ? 78  PHE D CE1 1 
ATOM   7025  C  CE2 . PHE D  1 79  ? 74.919  -0.949  -15.397  1.00 39.86  ? 78  PHE D CE2 1 
ATOM   7026  C  CZ  . PHE D  1 79  ? 76.015  -0.287  -14.880  1.00 40.33  ? 78  PHE D CZ  1 
HETATM 7027  N  N   . MSE D  1 80  ? 74.580  -7.484  -14.531  1.00 45.93  ? 79  MSE D N   1 
HETATM 7028  C  CA  . MSE D  1 80  ? 73.985  -8.708  -13.973  1.00 43.90  ? 79  MSE D CA  1 
HETATM 7029  C  C   . MSE D  1 80  ? 73.730  -9.722  -15.083  1.00 48.84  ? 79  MSE D C   1 
HETATM 7030  O  O   . MSE D  1 80  ? 73.571  -9.338  -16.241  1.00 50.30  ? 79  MSE D O   1 
HETATM 7031  C  CB  . MSE D  1 80  ? 72.646  -8.397  -13.270  1.00 43.57  ? 79  MSE D CB  1 
HETATM 7032  C  CG  . MSE D  1 80  ? 72.735  -7.460  -12.077  1.00 52.68  ? 79  MSE D CG  1 
HETATM 7033  SE SE  . MSE D  1 80  ? 73.831  -8.118  -10.609  0.56 52.07  ? 79  MSE D SE  1 
HETATM 7034  C  CE  . MSE D  1 80  ? 72.532  -9.246  -9.721   1.00 44.27  ? 79  MSE D CE  1 
ATOM   7035  N  N   . PRO D  1 81  ? 73.673  -11.021 -14.738  1.00 47.92  ? 80  PRO D N   1 
ATOM   7036  C  CA  . PRO D  1 81  ? 73.360  -12.037 -15.754  1.00 50.76  ? 80  PRO D CA  1 
ATOM   7037  C  C   . PRO D  1 81  ? 71.868  -12.046 -16.100  1.00 60.18  ? 80  PRO D C   1 
ATOM   7038  O  O   . PRO D  1 81  ? 71.026  -12.338 -15.242  1.00 58.59  ? 80  PRO D O   1 
ATOM   7039  C  CB  . PRO D  1 81  ? 73.755  -13.353 -15.072  1.00 48.52  ? 80  PRO D CB  1 
ATOM   7040  C  CG  . PRO D  1 81  ? 73.611  -13.073 -13.609  1.00 50.91  ? 80  PRO D CG  1 
ATOM   7041  C  CD  . PRO D  1 81  ? 73.965  -11.619 -13.423  1.00 54.15  ? 80  PRO D CD  1 
ATOM   7042  N  N   . LEU D  1 82  ? 71.565  -11.752 -17.361  1.00 50.53  ? 81  LEU D N   1 
ATOM   7043  C  CA  . LEU D  1 82  ? 70.197  -11.600 -17.845  1.00 54.20  ? 81  LEU D CA  1 
ATOM   7044  C  C   . LEU D  1 82  ? 70.035  -12.338 -19.160  1.00 51.32  ? 81  LEU D C   1 
ATOM   7045  O  O   . LEU D  1 82  ? 71.023  -12.662 -19.807  1.00 44.55  ? 81  LEU D O   1 
ATOM   7046  C  CB  . LEU D  1 82  ? 69.910  -10.117 -18.103  1.00 50.18  ? 81  LEU D CB  1 
ATOM   7047  C  CG  . LEU D  1 82  ? 69.967  -9.206  -16.888  1.00 45.04  ? 81  LEU D CG  1 
ATOM   7048  C  CD1 . LEU D  1 82  ? 69.538  -7.773  -17.252  1.00 43.30  ? 81  LEU D CD1 1 
ATOM   7049  C  CD2 . LEU D  1 82  ? 69.082  -9.782  -15.820  1.00 48.67  ? 81  LEU D CD2 1 
ATOM   7050  N  N   . PRO D  1 83  ? 68.784  -12.574 -19.583  1.00 39.25  ? 82  PRO D N   1 
ATOM   7051  C  CA  . PRO D  1 83  ? 68.588  -13.051 -20.956  1.00 43.92  ? 82  PRO D CA  1 
ATOM   7052  C  C   . PRO D  1 83  ? 69.144  -12.035 -21.955  1.00 50.46  ? 82  PRO D C   1 
ATOM   7053  O  O   . PRO D  1 83  ? 69.068  -10.828 -21.695  1.00 44.99  ? 82  PRO D O   1 
ATOM   7054  C  CB  . PRO D  1 83  ? 67.061  -13.100 -21.091  1.00 45.16  ? 82  PRO D CB  1 
ATOM   7055  C  CG  . PRO D  1 83  ? 66.555  -13.217 -19.679  1.00 48.32  ? 82  PRO D CG  1 
ATOM   7056  C  CD  . PRO D  1 83  ? 67.504  -12.385 -18.877  1.00 38.98  ? 82  PRO D CD  1 
ATOM   7057  N  N   . THR D  1 84  ? 69.672  -12.528 -23.073  1.00 49.22  ? 83  THR D N   1 
ATOM   7058  C  CA  . THR D  1 84  ? 70.253  -11.702 -24.126  1.00 60.28  ? 83  THR D CA  1 
ATOM   7059  C  C   . THR D  1 84  ? 69.193  -11.330 -25.150  1.00 48.62  ? 83  THR D C   1 
ATOM   7060  O  O   . THR D  1 84  ? 68.443  -12.183 -25.610  1.00 48.32  ? 83  THR D O   1 
ATOM   7061  C  CB  . THR D  1 84  ? 71.373  -12.471 -24.852  1.00 51.26  ? 83  THR D CB  1 
ATOM   7062  O  OG1 . THR D  1 84  ? 72.462  -12.698 -23.948  1.00 63.04  ? 83  THR D OG1 1 
ATOM   7063  C  CG2 . THR D  1 84  ? 71.873  -11.701 -26.064  1.00 54.86  ? 83  THR D CG2 1 
ATOM   7064  N  N   . ILE D  1 85  ? 69.124  -10.056 -25.511  1.00 43.38  ? 84  ILE D N   1 
ATOM   7065  C  CA  . ILE D  1 85  ? 68.180  -9.632  -26.534  1.00 42.78  ? 84  ILE D CA  1 
ATOM   7066  C  C   . ILE D  1 85  ? 68.677  -10.010 -27.928  1.00 49.82  ? 84  ILE D C   1 
ATOM   7067  O  O   . ILE D  1 85  ? 69.706  -9.517  -28.381  1.00 43.42  ? 84  ILE D O   1 
ATOM   7068  C  CB  . ILE D  1 85  ? 67.933  -8.118  -26.472  1.00 48.28  ? 84  ILE D CB  1 
ATOM   7069  C  CG1 . ILE D  1 85  ? 67.331  -7.734  -25.110  1.00 41.27  ? 84  ILE D CG1 1 
ATOM   7070  C  CG2 . ILE D  1 85  ? 67.035  -7.689  -27.625  1.00 44.74  ? 84  ILE D CG2 1 
ATOM   7071  C  CD1 . ILE D  1 85  ? 67.364  -6.243  -24.815  1.00 44.84  ? 84  ILE D CD1 1 
ATOM   7072  N  N   . LYS D  1 86  ? 67.945  -10.889 -28.604  1.00 37.31  ? 85  LYS D N   1 
ATOM   7073  C  CA  . LYS D  1 86  ? 68.297  -11.283 -29.958  1.00 37.13  ? 85  LYS D CA  1 
ATOM   7074  C  C   . LYS D  1 86  ? 67.660  -10.353 -30.974  1.00 43.39  ? 85  LYS D C   1 
ATOM   7075  O  O   . LYS D  1 86  ? 68.233  -10.086 -32.019  1.00 40.63  ? 85  LYS D O   1 
ATOM   7076  C  CB  . LYS D  1 86  ? 67.848  -12.718 -30.247  1.00 44.21  ? 85  LYS D CB  1 
ATOM   7077  C  CG  . LYS D  1 86  ? 68.634  -13.810 -29.517  1.00 53.37  ? 85  LYS D CG  1 
ATOM   7078  C  CD  . LYS D  1 86  ? 70.012  -14.037 -30.119  1.00 86.46  ? 85  LYS D CD  1 
ATOM   7079  C  CE  . LYS D  1 86  ? 71.112  -13.426 -29.260  1.00 78.39  ? 85  LYS D CE  1 
ATOM   7080  N  NZ  . LYS D  1 86  ? 72.454  -13.970 -29.624  1.00 79.76  ? 85  LYS D NZ  1 
ATOM   7081  N  N   . HIS D  1 87  ? 66.460  -9.873  -30.667  1.00 43.31  ? 86  HIS D N   1 
ATOM   7082  C  CA  . HIS D  1 87  ? 65.711  -9.046  -31.598  1.00 38.66  ? 86  HIS D CA  1 
ATOM   7083  C  C   . HIS D  1 87  ? 64.569  -8.376  -30.855  1.00 45.65  ? 86  HIS D C   1 
ATOM   7084  O  O   . HIS D  1 87  ? 63.925  -8.988  -30.006  1.00 45.30  ? 86  HIS D O   1 
ATOM   7085  C  CB  . HIS D  1 87  ? 65.138  -9.904  -32.732  1.00 41.28  ? 86  HIS D CB  1 
ATOM   7086  C  CG  . HIS D  1 87  ? 64.941  -9.163  -34.020  1.00 60.30  ? 86  HIS D CG  1 
ATOM   7087  N  ND1 . HIS D  1 87  ? 65.790  -9.308  -35.098  1.00 72.34  ? 86  HIS D ND1 1 
ATOM   7088  C  CD2 . HIS D  1 87  ? 63.994  -8.275  -34.406  1.00 59.37  ? 86  HIS D CD2 1 
ATOM   7089  C  CE1 . HIS D  1 87  ? 65.375  -8.539  -36.090  1.00 60.20  ? 86  HIS D CE1 1 
ATOM   7090  N  NE2 . HIS D  1 87  ? 64.288  -7.901  -35.695  1.00 56.65  ? 86  HIS D NE2 1 
ATOM   7091  N  N   . PHE D  1 88  ? 64.322  -7.114  -31.183  1.00 37.73  ? 87  PHE D N   1 
ATOM   7092  C  CA  . PHE D  1 88  ? 63.179  -6.397  -30.647  1.00 37.91  ? 87  PHE D CA  1 
ATOM   7093  C  C   . PHE D  1 88  ? 62.553  -5.541  -31.738  1.00 43.52  ? 87  PHE D C   1 
ATOM   7094  O  O   . PHE D  1 88  ? 63.259  -4.949  -32.552  1.00 41.90  ? 87  PHE D O   1 
ATOM   7095  C  CB  . PHE D  1 88  ? 63.578  -5.515  -29.460  1.00 35.97  ? 87  PHE D CB  1 
ATOM   7096  C  CG  . PHE D  1 88  ? 62.442  -4.673  -28.931  1.00 37.58  ? 87  PHE D CG  1 
ATOM   7097  C  CD1 . PHE D  1 88  ? 61.492  -5.225  -28.081  1.00 40.61  ? 87  PHE D CD1 1 
ATOM   7098  C  CD2 . PHE D  1 88  ? 62.313  -3.341  -29.305  1.00 34.13  ? 87  PHE D CD2 1 
ATOM   7099  C  CE1 . PHE D  1 88  ? 60.436  -4.458  -27.595  1.00 41.99  ? 87  PHE D CE1 1 
ATOM   7100  C  CE2 . PHE D  1 88  ? 61.261  -2.567  -28.830  1.00 40.81  ? 87  PHE D CE2 1 
ATOM   7101  C  CZ  . PHE D  1 88  ? 60.327  -3.118  -27.971  1.00 38.75  ? 87  PHE D CZ  1 
ATOM   7102  N  N   . ILE D  1 89  ? 61.226  -5.480  -31.753  1.00 38.86  ? 88  ILE D N   1 
ATOM   7103  C  CA  . ILE D  1 89  ? 60.509  -4.681  -32.743  1.00 38.64  ? 88  ILE D CA  1 
ATOM   7104  C  C   . ILE D  1 89  ? 59.354  -3.926  -32.085  1.00 53.99  ? 88  ILE D C   1 
ATOM   7105  O  O   . ILE D  1 89  ? 58.605  -4.498  -31.289  1.00 44.79  ? 88  ILE D O   1 
ATOM   7106  C  CB  . ILE D  1 89  ? 59.960  -5.566  -33.874  1.00 47.77  ? 88  ILE D CB  1 
ATOM   7107  C  CG1 . ILE D  1 89  ? 61.113  -6.113  -34.724  1.00 42.32  ? 88  ILE D CG1 1 
ATOM   7108  C  CG2 . ILE D  1 89  ? 58.992  -4.786  -34.757  1.00 44.71  ? 88  ILE D CG2 1 
ATOM   7109  C  CD1 . ILE D  1 89  ? 60.706  -7.229  -35.639  1.00 60.88  ? 88  ILE D CD1 1 
ATOM   7110  N  N   . ARG D  1 90  ? 59.226  -2.642  -32.409  1.00 45.13  ? 89  ARG D N   1 
ATOM   7111  C  CA  . ARG D  1 90  ? 58.129  -1.823  -31.884  1.00 44.18  ? 89  ARG D CA  1 
ATOM   7112  C  C   . ARG D  1 90  ? 57.417  -1.114  -33.033  1.00 36.88  ? 89  ARG D C   1 
ATOM   7113  O  O   . ARG D  1 90  ? 58.042  -0.413  -33.831  1.00 43.30  ? 89  ARG D O   1 
ATOM   7114  C  CB  . ARG D  1 90  ? 58.649  -0.809  -30.847  1.00 43.83  ? 89  ARG D CB  1 
ATOM   7115  C  CG  . ARG D  1 90  ? 57.591  0.116   -30.226  1.00 48.24  ? 89  ARG D CG  1 
ATOM   7116  C  CD  . ARG D  1 90  ? 56.648  -0.638  -29.280  1.00 42.38  ? 89  ARG D CD  1 
ATOM   7117  N  NE  . ARG D  1 90  ? 55.353  0.034   -29.130  1.00 67.13  ? 89  ARG D NE  1 
ATOM   7118  C  CZ  . ARG D  1 90  ? 54.904  0.575   -27.998  1.00 54.26  ? 89  ARG D CZ  1 
ATOM   7119  N  NH1 . ARG D  1 90  ? 55.635  0.527   -26.894  1.00 48.45  ? 89  ARG D NH1 1 
ATOM   7120  N  NH2 . ARG D  1 90  ? 53.712  1.156   -27.967  1.00 47.99  ? 89  ARG D NH2 1 
ATOM   7121  N  N   . THR D  1 91  ? 56.111  -1.335  -33.124  1.00 41.73  ? 90  THR D N   1 
ATOM   7122  C  CA  . THR D  1 91  ? 55.244  -0.581  -34.020  1.00 50.40  ? 90  THR D CA  1 
ATOM   7123  C  C   . THR D  1 91  ? 54.270  0.167   -33.099  1.00 48.94  ? 90  THR D C   1 
ATOM   7124  O  O   . THR D  1 91  ? 54.325  -0.031  -31.889  1.00 48.28  ? 90  THR D O   1 
ATOM   7125  C  CB  . THR D  1 91  ? 54.532  -1.517  -35.026  1.00 50.46  ? 90  THR D CB  1 
ATOM   7126  O  OG1 . THR D  1 91  ? 53.825  -2.543  -34.323  1.00 52.41  ? 90  THR D OG1 1 
ATOM   7127  C  CG2 . THR D  1 91  ? 55.549  -2.165  -35.961  1.00 55.32  ? 90  THR D CG2 1 
ATOM   7128  N  N   . PRO D  1 92  ? 53.430  1.070   -33.642  1.00 55.71  ? 91  PRO D N   1 
ATOM   7129  C  CA  . PRO D  1 92  ? 52.567  1.833   -32.726  1.00 50.15  ? 91  PRO D CA  1 
ATOM   7130  C  C   . PRO D  1 92  ? 51.738  0.992   -31.735  1.00 54.81  ? 91  PRO D C   1 
ATOM   7131  O  O   . PRO D  1 92  ? 51.589  1.395   -30.582  1.00 52.86  ? 91  PRO D O   1 
ATOM   7132  C  CB  . PRO D  1 92  ? 51.663  2.614   -33.682  1.00 48.75  ? 91  PRO D CB  1 
ATOM   7133  C  CG  . PRO D  1 92  ? 52.540  2.871   -34.855  1.00 65.87  ? 91  PRO D CG  1 
ATOM   7134  C  CD  . PRO D  1 92  ? 53.415  1.646   -35.000  1.00 53.54  ? 91  PRO D CD  1 
ATOM   7135  N  N   . ASP D  1 93  ? 51.250  -0.169  -32.155  1.00 48.64  ? 92  ASP D N   1 
ATOM   7136  C  CA  . ASP D  1 93  ? 50.380  -0.962  -31.285  1.00 67.24  ? 92  ASP D CA  1 
ATOM   7137  C  C   . ASP D  1 93  ? 50.974  -2.270  -30.746  1.00 76.45  ? 92  ASP D C   1 
ATOM   7138  O  O   . ASP D  1 93  ? 50.396  -2.894  -29.851  1.00 53.31  ? 92  ASP D O   1 
ATOM   7139  C  CB  . ASP D  1 93  ? 49.053  -1.242  -31.990  1.00 60.04  ? 92  ASP D CB  1 
ATOM   7140  C  CG  . ASP D  1 93  ? 48.111  -0.064  -31.926  1.00 95.74  ? 92  ASP D CG  1 
ATOM   7141  O  OD1 . ASP D  1 93  ? 48.213  0.831   -32.793  1.00 94.37  ? 92  ASP D OD1 1 
ATOM   7142  O  OD2 . ASP D  1 93  ? 47.272  -0.033  -31.000  1.00 116.66 ? 92  ASP D OD2 1 
ATOM   7143  N  N   . ASP D  1 94  ? 52.120  -2.682  -31.280  1.00 46.89  ? 93  ASP D N   1 
ATOM   7144  C  CA  . ASP D  1 94  ? 52.707  -3.967  -30.904  1.00 41.92  ? 93  ASP D CA  1 
ATOM   7145  C  C   . ASP D  1 94  ? 54.188  -3.882  -30.530  1.00 49.01  ? 93  ASP D C   1 
ATOM   7146  O  O   . ASP D  1 94  ? 54.930  -3.049  -31.058  1.00 42.82  ? 93  ASP D O   1 
ATOM   7147  C  CB  . ASP D  1 94  ? 52.551  -4.962  -32.052  1.00 47.51  ? 93  ASP D CB  1 
ATOM   7148  C  CG  . ASP D  1 94  ? 51.111  -5.296  -32.339  1.00 76.41  ? 93  ASP D CG  1 
ATOM   7149  O  OD1 . ASP D  1 94  ? 50.389  -4.421  -32.859  1.00 59.00  ? 93  ASP D OD1 1 
ATOM   7150  O  OD2 . ASP D  1 94  ? 50.707  -6.441  -32.053  1.00 58.30  ? 93  ASP D OD2 1 
ATOM   7151  N  N   . ALA D  1 95  ? 54.599  -4.763  -29.621  1.00 47.67  ? 94  ALA D N   1 
ATOM   7152  C  CA  . ALA D  1 95  ? 56.003  -4.958  -29.275  1.00 47.07  ? 94  ALA D CA  1 
ATOM   7153  C  C   . ALA D  1 95  ? 56.318  -6.448  -29.358  1.00 41.04  ? 94  ALA D C   1 
ATOM   7154  O  O   . ALA D  1 95  ? 55.503  -7.290  -28.943  1.00 44.46  ? 94  ALA D O   1 
ATOM   7155  C  CB  . ALA D  1 95  ? 56.304  -4.419  -27.870  1.00 41.75  ? 94  ALA D CB  1 
ATOM   7156  N  N   . TRP D  1 96  ? 57.483  -6.777  -29.915  1.00 41.47  ? 95  TRP D N   1 
ATOM   7157  C  CA  . TRP D  1 96  ? 57.945  -8.162  -29.974  1.00 43.50  ? 95  TRP D CA  1 
ATOM   7158  C  C   . TRP D  1 96  ? 59.361  -8.233  -29.425  1.00 51.22  ? 95  TRP D C   1 
ATOM   7159  O  O   . TRP D  1 96  ? 60.271  -7.599  -29.961  1.00 43.29  ? 95  TRP D O   1 
ATOM   7160  C  CB  . TRP D  1 96  ? 57.934  -8.690  -31.407  1.00 41.72  ? 95  TRP D CB  1 
ATOM   7161  C  CG  . TRP D  1 96  ? 56.580  -8.740  -32.049  1.00 53.75  ? 95  TRP D CG  1 
ATOM   7162  C  CD1 . TRP D  1 96  ? 55.927  -7.713  -32.670  1.00 54.18  ? 95  TRP D CD1 1 
ATOM   7163  C  CD2 . TRP D  1 96  ? 55.723  -9.882  -32.158  1.00 50.27  ? 95  TRP D CD2 1 
ATOM   7164  N  NE1 . TRP D  1 96  ? 54.714  -8.145  -33.151  1.00 55.78  ? 95  TRP D NE1 1 
ATOM   7165  C  CE2 . TRP D  1 96  ? 54.567  -9.473  -32.852  1.00 56.17  ? 95  TRP D CE2 1 
ATOM   7166  C  CE3 . TRP D  1 96  ? 55.819  -11.211 -31.735  1.00 60.32  ? 95  TRP D CE3 1 
ATOM   7167  C  CZ2 . TRP D  1 96  ? 53.517  -10.340 -33.125  1.00 52.61  ? 95  TRP D CZ2 1 
ATOM   7168  C  CZ3 . TRP D  1 96  ? 54.777  -12.071 -32.011  1.00 66.76  ? 95  TRP D CZ3 1 
ATOM   7169  C  CH2 . TRP D  1 96  ? 53.641  -11.633 -32.700  1.00 74.67  ? 95  TRP D CH2 1 
ATOM   7170  N  N   . LEU D  1 97  ? 59.542  -9.002  -28.354  1.00 43.05  ? 96  LEU D N   1 
ATOM   7171  C  CA  . LEU D  1 97  ? 60.852  -9.146  -27.720  1.00 45.29  ? 96  LEU D CA  1 
ATOM   7172  C  C   . LEU D  1 97  ? 61.319  -10.599 -27.766  1.00 45.16  ? 96  LEU D C   1 
ATOM   7173  O  O   . LEU D  1 97  ? 60.689  -11.496 -27.180  1.00 46.75  ? 96  LEU D O   1 
ATOM   7174  C  CB  . LEU D  1 97  ? 60.816  -8.623  -26.283  1.00 38.07  ? 96  LEU D CB  1 
ATOM   7175  C  CG  . LEU D  1 97  ? 62.055  -8.749  -25.393  1.00 46.43  ? 96  LEU D CG  1 
ATOM   7176  C  CD1 . LEU D  1 97  ? 63.262  -8.024  -25.980  1.00 38.42  ? 96  LEU D CD1 1 
ATOM   7177  C  CD2 . LEU D  1 97  ? 61.731  -8.215  -23.998  1.00 44.04  ? 96  LEU D CD2 1 
ATOM   7178  N  N   . LEU D  1 98  ? 62.407  -10.818 -28.500  1.00 44.30  ? 97  LEU D N   1 
ATOM   7179  C  CA  . LEU D  1 98  ? 62.999  -12.141 -28.669  1.00 40.01  ? 97  LEU D CA  1 
ATOM   7180  C  C   . LEU D  1 98  ? 64.280  -12.199 -27.864  1.00 46.94  ? 97  LEU D C   1 
ATOM   7181  O  O   . LEU D  1 98  ? 65.194  -11.405 -28.075  1.00 43.52  ? 97  LEU D O   1 
ATOM   7182  C  CB  . LEU D  1 98  ? 63.312  -12.404 -30.144  1.00 44.52  ? 97  LEU D CB  1 
ATOM   7183  C  CG  . LEU D  1 98  ? 63.918  -13.766 -30.484  1.00 50.19  ? 97  LEU D CG  1 
ATOM   7184  C  CD1 . LEU D  1 98  ? 62.868  -14.866 -30.389  1.00 51.53  ? 97  LEU D CD1 1 
ATOM   7185  C  CD2 . LEU D  1 98  ? 64.556  -13.748 -31.881  1.00 51.60  ? 97  LEU D CD2 1 
ATOM   7186  N  N   . THR D  1 99  ? 64.345  -13.139 -26.933  1.00 44.54  ? 98  THR D N   1 
ATOM   7187  C  CA  . THR D  1 99  ? 65.483  -13.229 -26.037  1.00 49.52  ? 98  THR D CA  1 
ATOM   7188  C  C   . THR D  1 99  ? 65.955  -14.662 -25.941  1.00 48.59  ? 98  THR D C   1 
ATOM   7189  O  O   . THR D  1 99  ? 65.198  -15.596 -26.217  1.00 49.15  ? 98  THR D O   1 
ATOM   7190  C  CB  . THR D  1 99  ? 65.117  -12.770 -24.614  1.00 61.21  ? 98  THR D CB  1 
ATOM   7191  O  OG1 . THR D  1 99  ? 64.011  -13.544 -24.142  1.00 53.84  ? 98  THR D OG1 1 
ATOM   7192  C  CG2 . THR D  1 99  ? 64.749  -11.297 -24.597  1.00 48.64  ? 98  THR D CG2 1 
ATOM   7193  N  N   . THR D  1 100 ? 67.210  -14.836 -25.544  1.00 49.03  ? 99  THR D N   1 
ATOM   7194  C  CA  . THR D  1 100 ? 67.729  -16.173 -25.283  1.00 54.52  ? 99  THR D CA  1 
ATOM   7195  C  C   . THR D  1 100 ? 67.128  -16.716 -23.989  1.00 58.55  ? 99  THR D C   1 
ATOM   7196  O  O   . THR D  1 100 ? 66.743  -15.954 -23.096  1.00 57.38  ? 99  THR D O   1 
ATOM   7197  C  CB  . THR D  1 100 ? 69.253  -16.170 -25.153  1.00 66.81  ? 99  THR D CB  1 
ATOM   7198  O  OG1 . THR D  1 100 ? 69.639  -15.209 -24.161  1.00 70.39  ? 99  THR D OG1 1 
ATOM   7199  C  CG2 . THR D  1 100 ? 69.901  -15.820 -26.488  1.00 50.78  ? 99  THR D CG2 1 
ATOM   7200  N  N   . ALA D  1 101 ? 67.048  -18.037 -23.891  1.00 52.78  ? 100 ALA D N   1 
ATOM   7201  C  CA  . ALA D  1 101 ? 66.539  -18.675 -22.687  1.00 53.31  ? 100 ALA D CA  1 
ATOM   7202  C  C   . ALA D  1 101 ? 67.673  -18.957 -21.712  1.00 70.66  ? 100 ALA D C   1 
ATOM   7203  O  O   . ALA D  1 101 ? 68.732  -19.434 -22.115  1.00 63.76  ? 100 ALA D O   1 
ATOM   7204  C  CB  . ALA D  1 101 ? 65.828  -19.970 -23.050  1.00 50.51  ? 100 ALA D CB  1 
ATOM   7205  N  N   . ILE D  1 102 ? 67.457  -18.652 -20.434  1.00 63.81  ? 101 ILE D N   1 
ATOM   7206  C  CA  . ILE D  1 102 ? 68.379  -19.088 -19.392  1.00 50.47  ? 101 ILE D CA  1 
ATOM   7207  C  C   . ILE D  1 102 ? 67.981  -20.498 -18.980  1.00 51.56  ? 101 ILE D C   1 
ATOM   7208  O  O   . ILE D  1 102 ? 66.851  -20.715 -18.538  1.00 65.30  ? 101 ILE D O   1 
ATOM   7209  C  CB  . ILE D  1 102 ? 68.309  -18.197 -18.136  1.00 61.41  ? 101 ILE D CB  1 
ATOM   7210  C  CG1 . ILE D  1 102 ? 68.573  -16.733 -18.469  1.00 69.24  ? 101 ILE D CG1 1 
ATOM   7211  C  CG2 . ILE D  1 102 ? 69.312  -18.663 -17.095  1.00 58.32  ? 101 ILE D CG2 1 
ATOM   7212  C  CD1 . ILE D  1 102 ? 68.572  -15.851 -17.233  1.00 61.08  ? 101 ILE D CD1 1 
ATOM   7213  N  N   . PRO D  1 103 ? 68.900  -21.469 -19.127  1.00 59.52  ? 102 PRO D N   1 
ATOM   7214  C  CA  . PRO D  1 103 ? 68.616  -22.860 -18.761  1.00 63.22  ? 102 PRO D CA  1 
ATOM   7215  C  C   . PRO D  1 103 ? 68.506  -23.023 -17.253  1.00 62.73  ? 102 PRO D C   1 
ATOM   7216  O  O   . PRO D  1 103 ? 69.197  -22.333 -16.508  1.00 60.19  ? 102 PRO D O   1 
ATOM   7217  C  CB  . PRO D  1 103 ? 69.846  -23.613 -19.278  1.00 56.59  ? 102 PRO D CB  1 
ATOM   7218  C  CG  . PRO D  1 103 ? 70.935  -22.604 -19.220  1.00 67.18  ? 102 PRO D CG  1 
ATOM   7219  C  CD  . PRO D  1 103 ? 70.285  -21.300 -19.600  1.00 59.67  ? 102 PRO D CD  1 
ATOM   7220  N  N   . GLY D  1 104 ? 67.640  -23.922 -16.805  1.00 53.56  ? 103 GLY D N   1 
ATOM   7221  C  CA  . GLY D  1 104 ? 67.504  -24.158 -15.382  1.00 54.82  ? 103 GLY D CA  1 
ATOM   7222  C  C   . GLY D  1 104 ? 66.076  -24.092 -14.887  1.00 67.61  ? 103 GLY D C   1 
ATOM   7223  O  O   . GLY D  1 104 ? 65.129  -24.115 -15.674  1.00 52.26  ? 103 GLY D O   1 
ATOM   7224  N  N   . LYS D  1 105 ? 65.930  -24.007 -13.569  1.00 50.51  ? 104 LYS D N   1 
ATOM   7225  C  CA  . LYS D  1 105 ? 64.623  -24.009 -12.932  1.00 59.24  ? 104 LYS D CA  1 
ATOM   7226  C  C   . LYS D  1 105 ? 64.533  -22.753 -12.090  1.00 52.42  ? 104 LYS D C   1 
ATOM   7227  O  O   . LYS D  1 105 ? 65.559  -22.206 -11.677  1.00 48.80  ? 104 LYS D O   1 
ATOM   7228  C  CB  . LYS D  1 105 ? 64.463  -25.248 -12.047  1.00 62.18  ? 104 LYS D CB  1 
ATOM   7229  C  CG  . LYS D  1 105 ? 64.818  -26.566 -12.742  1.00 58.79  ? 104 LYS D CG  1 
ATOM   7230  C  CD  . LYS D  1 105 ? 64.922  -27.731 -11.745  1.00 62.80  ? 104 LYS D CD  1 
ATOM   7231  C  CE  . LYS D  1 105 ? 65.694  -28.913 -12.335  1.00 90.80  ? 104 LYS D CE  1 
ATOM   7232  N  NZ  . LYS D  1 105 ? 65.915  -30.032 -11.360  1.00 77.33  ? 104 LYS D NZ  1 
ATOM   7233  N  N   . THR D  1 106 ? 63.314  -22.283 -11.845  1.00 49.24  ? 105 THR D N   1 
ATOM   7234  C  CA  . THR D  1 106 ? 63.131  -21.097 -11.020  1.00 44.13  ? 105 THR D CA  1 
ATOM   7235  C  C   . THR D  1 106 ? 63.504  -21.463 -9.602   1.00 47.53  ? 105 THR D C   1 
ATOM   7236  O  O   . THR D  1 106 ? 63.535  -22.643 -9.254   1.00 50.66  ? 105 THR D O   1 
ATOM   7237  C  CB  . THR D  1 106 ? 61.675  -20.583 -11.042  1.00 48.66  ? 105 THR D CB  1 
ATOM   7238  O  OG1 . THR D  1 106 ? 60.804  -21.562 -10.458  1.00 48.58  ? 105 THR D OG1 1 
ATOM   7239  C  CG2 . THR D  1 106 ? 61.226  -20.292 -12.467  1.00 54.50  ? 105 THR D CG2 1 
ATOM   7240  N  N   . ALA D  1 107 ? 63.789  -20.453 -8.788   1.00 43.08  ? 106 ALA D N   1 
ATOM   7241  C  CA  . ALA D  1 107 ? 64.064  -20.663 -7.367   1.00 40.94  ? 106 ALA D CA  1 
ATOM   7242  C  C   . ALA D  1 107 ? 62.876  -21.333 -6.684   1.00 51.15  ? 106 ALA D C   1 
ATOM   7243  O  O   . ALA D  1 107 ? 63.045  -22.155 -5.783   1.00 44.72  ? 106 ALA D O   1 
ATOM   7244  C  CB  . ALA D  1 107 ? 64.385  -19.339 -6.698   1.00 33.44  ? 106 ALA D CB  1 
ATOM   7245  N  N   . PHE D  1 108 ? 61.672  -20.974 -7.121   1.00 40.72  ? 107 PHE D N   1 
ATOM   7246  C  CA  . PHE D  1 108 ? 60.466  -21.605 -6.602   1.00 50.19  ? 107 PHE D CA  1 
ATOM   7247  C  C   . PHE D  1 108 ? 60.505  -23.105 -6.879   1.00 42.42  ? 107 PHE D C   1 
ATOM   7248  O  O   . PHE D  1 108 ? 60.192  -23.921 -5.996   1.00 49.75  ? 107 PHE D O   1 
ATOM   7249  C  CB  . PHE D  1 108 ? 59.217  -20.979 -7.226   1.00 40.93  ? 107 PHE D CB  1 
ATOM   7250  C  CG  . PHE D  1 108 ? 57.928  -21.546 -6.699   1.00 45.44  ? 107 PHE D CG  1 
ATOM   7251  C  CD1 . PHE D  1 108 ? 57.403  -21.107 -5.489   1.00 42.91  ? 107 PHE D CD1 1 
ATOM   7252  C  CD2 . PHE D  1 108 ? 57.241  -22.506 -7.414   1.00 41.76  ? 107 PHE D CD2 1 
ATOM   7253  C  CE1 . PHE D  1 108 ? 56.220  -21.623 -5.001   1.00 53.90  ? 107 PHE D CE1 1 
ATOM   7254  C  CE2 . PHE D  1 108 ? 56.053  -23.038 -6.931   1.00 58.21  ? 107 PHE D CE2 1 
ATOM   7255  C  CZ  . PHE D  1 108 ? 55.540  -22.594 -5.723   1.00 58.91  ? 107 PHE D CZ  1 
ATOM   7256  N  N   . GLN D  1 109 ? 60.891  -23.470 -8.101   1.00 49.16  ? 108 GLN D N   1 
ATOM   7257  C  CA  . GLN D  1 109 ? 60.946  -24.879 -8.490   1.00 62.17  ? 108 GLN D CA  1 
ATOM   7258  C  C   . GLN D  1 109 ? 61.923  -25.675 -7.625   1.00 49.85  ? 108 GLN D C   1 
ATOM   7259  O  O   . GLN D  1 109 ? 61.612  -26.782 -7.189   1.00 45.81  ? 108 GLN D O   1 
ATOM   7260  C  CB  . GLN D  1 109 ? 61.317  -25.038 -9.971   1.00 55.58  ? 108 GLN D CB  1 
ATOM   7261  C  CG  . GLN D  1 109 ? 60.162  -24.890 -10.960  1.00 56.48  ? 108 GLN D CG  1 
ATOM   7262  C  CD  . GLN D  1 109 ? 60.621  -24.991 -12.416  1.00 77.03  ? 108 GLN D CD  1 
ATOM   7263  O  OE1 . GLN D  1 109 ? 61.286  -24.088 -12.943  1.00 49.20  ? 108 GLN D OE1 1 
ATOM   7264  N  NE2 . GLN D  1 109 ? 60.270  -26.096 -13.069  1.00 84.85  ? 108 GLN D NE2 1 
ATOM   7265  N  N   . VAL D  1 110 ? 63.105  -25.112 -7.387   1.00 50.80  ? 109 VAL D N   1 
ATOM   7266  C  CA  . VAL D  1 110 ? 64.125  -25.811 -6.608   1.00 60.87  ? 109 VAL D CA  1 
ATOM   7267  C  C   . VAL D  1 110 ? 63.809  -25.838 -5.116   1.00 39.96  ? 109 VAL D C   1 
ATOM   7268  O  O   . VAL D  1 110 ? 64.189  -26.780 -4.428   1.00 51.96  ? 109 VAL D O   1 
ATOM   7269  C  CB  . VAL D  1 110 ? 65.567  -25.253 -6.834   1.00 53.21  ? 109 VAL D CB  1 
ATOM   7270  C  CG1 . VAL D  1 110 ? 65.985  -25.398 -8.299   1.00 59.22  ? 109 VAL D CG1 1 
ATOM   7271  C  CG2 . VAL D  1 110 ? 65.675  -23.827 -6.364   1.00 62.12  ? 109 VAL D CG2 1 
ATOM   7272  N  N   . LEU D  1 111 ? 63.124  -24.814 -4.610   1.00 50.18  ? 110 LEU D N   1 
ATOM   7273  C  CA  . LEU D  1 111 ? 62.675  -24.852 -3.220   1.00 44.43  ? 110 LEU D CA  1 
ATOM   7274  C  C   . LEU D  1 111 ? 61.648  -25.961 -3.022   1.00 49.91  ? 110 LEU D C   1 
ATOM   7275  O  O   . LEU D  1 111 ? 61.714  -26.711 -2.048   1.00 50.16  ? 110 LEU D O   1 
ATOM   7276  C  CB  . LEU D  1 111 ? 62.096  -23.512 -2.782   1.00 44.86  ? 110 LEU D CB  1 
ATOM   7277  C  CG  . LEU D  1 111 ? 63.110  -22.519 -2.225   1.00 78.22  ? 110 LEU D CG  1 
ATOM   7278  C  CD1 . LEU D  1 111 ? 62.398  -21.247 -1.796   1.00 59.12  ? 110 LEU D CD1 1 
ATOM   7279  C  CD2 . LEU D  1 111 ? 63.860  -23.139 -1.060   1.00 49.68  ? 110 LEU D CD2 1 
ATOM   7280  N  N   . GLU D  1 112 ? 60.710  -26.066 -3.958   1.00 45.31  ? 111 GLU D N   1 
ATOM   7281  C  CA  . GLU D  1 112 ? 59.672  -27.097 -3.911   1.00 43.00  ? 111 GLU D CA  1 
ATOM   7282  C  C   . GLU D  1 112 ? 60.270  -28.492 -4.041   1.00 59.73  ? 111 GLU D C   1 
ATOM   7283  O  O   . GLU D  1 112 ? 59.787  -29.454 -3.436   1.00 59.66  ? 111 GLU D O   1 
ATOM   7284  C  CB  . GLU D  1 112 ? 58.676  -26.915 -5.060   1.00 56.37  ? 111 GLU D CB  1 
ATOM   7285  C  CG  . GLU D  1 112 ? 57.587  -25.875 -4.845   1.00 55.12  ? 111 GLU D CG  1 
ATOM   7286  C  CD  . GLU D  1 112 ? 56.320  -26.217 -5.622   1.00 85.42  ? 111 GLU D CD  1 
ATOM   7287  O  OE1 . GLU D  1 112 ? 56.431  -26.721 -6.763   1.00 69.41  ? 111 GLU D OE1 1 
ATOM   7288  O  OE2 . GLU D  1 112 ? 55.214  -25.996 -5.083   1.00 77.80  ? 111 GLU D OE2 1 
ATOM   7289  N  N   . GLU D  1 113 ? 61.316  -28.599 -4.853   1.00 48.42  ? 112 GLU D N   1 
ATOM   7290  C  CA  . GLU D  1 113 ? 61.885  -29.899 -5.216   1.00 61.75  ? 112 GLU D CA  1 
ATOM   7291  C  C   . GLU D  1 113 ? 62.960  -30.380 -4.236   1.00 58.10  ? 112 GLU D C   1 
ATOM   7292  O  O   . GLU D  1 113 ? 63.089  -31.572 -3.984   1.00 60.59  ? 112 GLU D O   1 
ATOM   7293  C  CB  . GLU D  1 113 ? 62.439  -29.841 -6.641   1.00 58.73  ? 112 GLU D CB  1 
ATOM   7294  C  CG  . GLU D  1 113 ? 62.925  -31.168 -7.203   1.00 74.52  ? 112 GLU D CG  1 
ATOM   7295  C  CD  . GLU D  1 113 ? 63.283  -31.072 -8.683   1.00 93.23  ? 112 GLU D CD  1 
ATOM   7296  O  OE1 . GLU D  1 113 ? 63.215  -29.950 -9.243   1.00 77.48  ? 112 GLU D OE1 1 
ATOM   7297  O  OE2 . GLU D  1 113 ? 63.624  -32.117 -9.284   1.00 78.64  ? 112 GLU D OE2 1 
ATOM   7298  N  N   . TYR D  1 114 ? 63.725  -29.446 -3.682   1.00 55.08  ? 113 TYR D N   1 
ATOM   7299  C  CA  . TYR D  1 114 ? 64.761  -29.783 -2.706   1.00 62.30  ? 113 TYR D CA  1 
ATOM   7300  C  C   . TYR D  1 114 ? 64.600  -28.945 -1.445   1.00 47.82  ? 113 TYR D C   1 
ATOM   7301  O  O   . TYR D  1 114 ? 65.293  -27.933 -1.289   1.00 56.32  ? 113 TYR D O   1 
ATOM   7302  C  CB  . TYR D  1 114 ? 66.155  -29.525 -3.294   1.00 48.98  ? 113 TYR D CB  1 
ATOM   7303  C  CG  . TYR D  1 114 ? 66.383  -30.163 -4.635   1.00 64.36  ? 113 TYR D CG  1 
ATOM   7304  C  CD1 . TYR D  1 114 ? 66.759  -31.497 -4.737   1.00 61.65  ? 113 TYR D CD1 1 
ATOM   7305  C  CD2 . TYR D  1 114 ? 66.235  -29.431 -5.802   1.00 71.27  ? 113 TYR D CD2 1 
ATOM   7306  C  CE1 . TYR D  1 114 ? 66.969  -32.085 -5.965   1.00 70.16  ? 113 TYR D CE1 1 
ATOM   7307  C  CE2 . TYR D  1 114 ? 66.447  -30.011 -7.036   1.00 67.44  ? 113 TYR D CE2 1 
ATOM   7308  C  CZ  . TYR D  1 114 ? 66.815  -31.334 -7.112   1.00 67.86  ? 113 TYR D CZ  1 
ATOM   7309  O  OH  . TYR D  1 114 ? 67.024  -31.906 -8.344   1.00 65.73  ? 113 TYR D OH  1 
ATOM   7310  N  N   . PRO D  1 115 ? 63.672  -29.343 -0.553   1.00 56.50  ? 114 PRO D N   1 
ATOM   7311  C  CA  . PRO D  1 115 ? 63.414  -28.634 0.708    1.00 62.61  ? 114 PRO D CA  1 
ATOM   7312  C  C   . PRO D  1 115 ? 64.650  -28.555 1.605    1.00 69.59  ? 114 PRO D C   1 
ATOM   7313  O  O   . PRO D  1 115 ? 64.877  -27.536 2.261    1.00 61.29  ? 114 PRO D O   1 
ATOM   7314  C  CB  . PRO D  1 115 ? 62.317  -29.483 1.379    1.00 63.02  ? 114 PRO D CB  1 
ATOM   7315  C  CG  . PRO D  1 115 ? 62.308  -30.784 0.652    1.00 58.60  ? 114 PRO D CG  1 
ATOM   7316  C  CD  . PRO D  1 115 ? 62.738  -30.464 -0.747   1.00 57.41  ? 114 PRO D CD  1 
ATOM   7317  N  N   . ASP D  1 116 ? 65.450  -29.616 1.618    1.00 62.67  ? 115 ASP D N   1 
ATOM   7318  C  CA  . ASP D  1 116 ? 66.645  -29.651 2.452    1.00 66.22  ? 115 ASP D CA  1 
ATOM   7319  C  C   . ASP D  1 116 ? 67.771  -28.792 1.883    1.00 73.57  ? 115 ASP D C   1 
ATOM   7320  O  O   . ASP D  1 116 ? 68.846  -28.701 2.470    1.00 76.81  ? 115 ASP D O   1 
ATOM   7321  C  CB  . ASP D  1 116 ? 67.113  -31.084 2.631    1.00 63.94  ? 115 ASP D CB  1 
ATOM   7322  C  CG  . ASP D  1 116 ? 65.991  -32.008 3.043    1.00 102.49 ? 115 ASP D CG  1 
ATOM   7323  O  OD1 . ASP D  1 116 ? 65.459  -32.726 2.169    1.00 126.16 ? 115 ASP D OD1 1 
ATOM   7324  O  OD2 . ASP D  1 116 ? 65.629  -32.007 4.238    1.00 101.74 ? 115 ASP D OD2 1 
ATOM   7325  N  N   . SER D  1 117 ? 67.521  -28.160 0.740    1.00 49.32  ? 116 SER D N   1 
ATOM   7326  C  CA  . SER D  1 117 ? 68.484  -27.226 0.162    1.00 54.24  ? 116 SER D CA  1 
ATOM   7327  C  C   . SER D  1 117 ? 68.126  -25.786 0.497    1.00 55.18  ? 116 SER D C   1 
ATOM   7328  O  O   . SER D  1 117 ? 68.844  -24.855 0.119    1.00 51.73  ? 116 SER D O   1 
ATOM   7329  C  CB  . SER D  1 117 ? 68.558  -27.395 -1.358   1.00 60.45  ? 116 SER D CB  1 
ATOM   7330  O  OG  . SER D  1 117 ? 69.164  -28.629 -1.706   1.00 86.10  ? 116 SER D OG  1 
ATOM   7331  N  N   . GLY D  1 118 ? 67.012  -25.613 1.203    1.00 54.40  ? 117 GLY D N   1 
ATOM   7332  C  CA  . GLY D  1 118 ? 66.457  -24.295 1.479    1.00 45.63  ? 117 GLY D CA  1 
ATOM   7333  C  C   . GLY D  1 118 ? 67.451  -23.252 1.953    1.00 47.94  ? 117 GLY D C   1 
ATOM   7334  O  O   . GLY D  1 118 ? 67.494  -22.140 1.421    1.00 47.82  ? 117 GLY D O   1 
ATOM   7335  N  N   . GLU D  1 119 ? 68.260  -23.600 2.948    1.00 48.79  ? 118 GLU D N   1 
ATOM   7336  C  CA  . GLU D  1 119 ? 69.240  -22.645 3.462    1.00 48.86  ? 118 GLU D CA  1 
ATOM   7337  C  C   . GLU D  1 119 ? 70.307  -22.270 2.433    1.00 61.77  ? 118 GLU D C   1 
ATOM   7338  O  O   . GLU D  1 119 ? 70.684  -21.109 2.337    1.00 53.05  ? 118 GLU D O   1 
ATOM   7339  C  CB  . GLU D  1 119 ? 69.877  -23.153 4.752    1.00 49.43  ? 118 GLU D CB  1 
ATOM   7340  C  CG  . GLU D  1 119 ? 68.888  -23.261 5.895    1.00 58.49  ? 118 GLU D CG  1 
ATOM   7341  C  CD  . GLU D  1 119 ? 69.525  -23.769 7.172    1.00 80.74  ? 118 GLU D CD  1 
ATOM   7342  O  OE1 . GLU D  1 119 ? 70.695  -24.211 7.124    1.00 85.45  ? 118 GLU D OE1 1 
ATOM   7343  O  OE2 . GLU D  1 119 ? 68.855  -23.726 8.226    1.00 96.70  ? 118 GLU D OE2 1 
ATOM   7344  N  N   . ASN D  1 120 ? 70.790  -23.243 1.664    1.00 54.68  ? 119 ASN D N   1 
ATOM   7345  C  CA  . ASN D  1 120 ? 71.741  -22.960 0.581    1.00 51.00  ? 119 ASN D CA  1 
ATOM   7346  C  C   . ASN D  1 120 ? 71.146  -22.062 -0.496   1.00 51.83  ? 119 ASN D C   1 
ATOM   7347  O  O   . ASN D  1 120 ? 71.800  -21.146 -1.018   1.00 39.84  ? 119 ASN D O   1 
ATOM   7348  C  CB  . ASN D  1 120 ? 72.191  -24.258 -0.074   1.00 51.88  ? 119 ASN D CB  1 
ATOM   7349  C  CG  . ASN D  1 120 ? 73.148  -25.034 0.786    1.00 60.33  ? 119 ASN D CG  1 
ATOM   7350  O  OD1 . ASN D  1 120 ? 73.557  -24.565 1.847    1.00 69.28  ? 119 ASN D OD1 1 
ATOM   7351  N  ND2 . ASN D  1 120 ? 73.508  -26.231 0.341    1.00 59.33  ? 119 ASN D ND2 1 
ATOM   7352  N  N   . ILE D  1 121 ? 69.900  -22.353 -0.840   1.00 50.06  ? 120 ILE D N   1 
ATOM   7353  C  CA  . ILE D  1 121 ? 69.180  -21.576 -1.834   1.00 48.82  ? 120 ILE D CA  1 
ATOM   7354  C  C   . ILE D  1 121 ? 69.033  -20.126 -1.358   1.00 40.01  ? 120 ILE D C   1 
ATOM   7355  O  O   . ILE D  1 121 ? 69.327  -19.182 -2.100   1.00 48.34  ? 120 ILE D O   1 
ATOM   7356  C  CB  . ILE D  1 121 ? 67.802  -22.224 -2.111   1.00 43.56  ? 120 ILE D CB  1 
ATOM   7357  C  CG1 . ILE D  1 121 ? 68.002  -23.560 -2.836   1.00 51.64  ? 120 ILE D CG1 1 
ATOM   7358  C  CG2 . ILE D  1 121 ? 66.906  -21.279 -2.912   1.00 50.86  ? 120 ILE D CG2 1 
ATOM   7359  C  CD1 . ILE D  1 121 ? 66.761  -24.433 -2.891   1.00 52.14  ? 120 ILE D CD1 1 
ATOM   7360  N  N   . VAL D  1 122 ? 68.618  -19.955 -0.105   1.00 38.57  ? 121 VAL D N   1 
ATOM   7361  C  CA  . VAL D  1 122 ? 68.422  -18.618 0.453    1.00 39.94  ? 121 VAL D CA  1 
ATOM   7362  C  C   . VAL D  1 122 ? 69.739  -17.846 0.546    1.00 43.12  ? 121 VAL D C   1 
ATOM   7363  O  O   . VAL D  1 122 ? 69.795  -16.664 0.212    1.00 42.14  ? 121 VAL D O   1 
ATOM   7364  C  CB  . VAL D  1 122 ? 67.705  -18.673 1.824    1.00 44.20  ? 121 VAL D CB  1 
ATOM   7365  C  CG1 . VAL D  1 122 ? 67.783  -17.319 2.529    1.00 42.49  ? 121 VAL D CG1 1 
ATOM   7366  C  CG2 . VAL D  1 122 ? 66.263  -19.108 1.630    1.00 44.90  ? 121 VAL D CG2 1 
ATOM   7367  N  N   . ASP D  1 123 ? 70.801  -18.527 0.968    1.00 42.53  ? 122 ASP D N   1 
ATOM   7368  C  CA  . ASP D  1 123 ? 72.131  -17.924 0.994    1.00 42.47  ? 122 ASP D CA  1 
ATOM   7369  C  C   . ASP D  1 123 ? 72.536  -17.398 -0.375   1.00 50.44  ? 122 ASP D C   1 
ATOM   7370  O  O   . ASP D  1 123 ? 73.115  -16.315 -0.490   1.00 43.20  ? 122 ASP D O   1 
ATOM   7371  C  CB  . ASP D  1 123 ? 73.163  -18.942 1.489    1.00 47.76  ? 122 ASP D CB  1 
ATOM   7372  C  CG  . ASP D  1 123 ? 72.976  -19.285 2.950    1.00 71.24  ? 122 ASP D CG  1 
ATOM   7373  O  OD1 . ASP D  1 123 ? 71.965  -18.832 3.529    1.00 69.49  ? 122 ASP D OD1 1 
ATOM   7374  O  OD2 . ASP D  1 123 ? 73.828  -20.008 3.515    1.00 59.03  ? 122 ASP D OD2 1 
ATOM   7375  N  N   . ALA D  1 124 ? 72.226  -18.175 -1.409   1.00 42.73  ? 123 ALA D N   1 
ATOM   7376  C  CA  . ALA D  1 124 ? 72.557  -17.813 -2.778   1.00 43.62  ? 123 ALA D CA  1 
ATOM   7377  C  C   . ALA D  1 124 ? 71.714  -16.615 -3.214   1.00 54.73  ? 123 ALA D C   1 
ATOM   7378  O  O   . ALA D  1 124 ? 72.209  -15.719 -3.888   1.00 42.06  ? 123 ALA D O   1 
ATOM   7379  C  CB  . ALA D  1 124 ? 72.333  -18.996 -3.709   1.00 39.34  ? 123 ALA D CB  1 
ATOM   7380  N  N   . LEU D  1 125 ? 70.440  -16.604 -2.824   1.00 41.09  ? 124 LEU D N   1 
ATOM   7381  C  CA  . LEU D  1 125 ? 69.539  -15.494 -3.152   1.00 38.85  ? 124 LEU D CA  1 
ATOM   7382  C  C   . LEU D  1 125 ? 70.044  -14.215 -2.495   1.00 41.43  ? 124 LEU D C   1 
ATOM   7383  O  O   . LEU D  1 125 ? 69.990  -13.136 -3.084   1.00 43.44  ? 124 LEU D O   1 
ATOM   7384  C  CB  . LEU D  1 125 ? 68.117  -15.796 -2.673   1.00 38.90  ? 124 LEU D CB  1 
ATOM   7385  C  CG  . LEU D  1 125 ? 67.352  -16.907 -3.404   1.00 44.71  ? 124 LEU D CG  1 
ATOM   7386  C  CD1 . LEU D  1 125 ? 66.089  -17.268 -2.659   1.00 41.07  ? 124 LEU D CD1 1 
ATOM   7387  C  CD2 . LEU D  1 125 ? 67.012  -16.487 -4.826   1.00 44.44  ? 124 LEU D CD2 1 
ATOM   7388  N  N   . ALA D  1 126 ? 70.556  -14.348 -1.275   1.00 40.98  ? 125 ALA D N   1 
ATOM   7389  C  CA  . ALA D  1 126 ? 71.056  -13.199 -0.533   1.00 50.40  ? 125 ALA D CA  1 
ATOM   7390  C  C   . ALA D  1 126 ? 72.289  -12.585 -1.197   1.00 45.13  ? 125 ALA D C   1 
ATOM   7391  O  O   . ALA D  1 126 ? 72.382  -11.363 -1.333   1.00 40.18  ? 125 ALA D O   1 
ATOM   7392  C  CB  . ALA D  1 126 ? 71.350  -13.579 0.908    1.00 38.84  ? 125 ALA D CB  1 
ATOM   7393  N  N   . VAL D  1 127 ? 73.230  -13.434 -1.611   1.00 39.04  ? 126 VAL D N   1 
ATOM   7394  C  CA  . VAL D  1 127 ? 74.424  -12.979 -2.327   1.00 43.81  ? 126 VAL D CA  1 
ATOM   7395  C  C   . VAL D  1 127 ? 74.073  -12.247 -3.632   1.00 45.93  ? 126 VAL D C   1 
ATOM   7396  O  O   . VAL D  1 127 ? 74.609  -11.167 -3.921   1.00 45.18  ? 126 VAL D O   1 
ATOM   7397  C  CB  . VAL D  1 127 ? 75.383  -14.166 -2.608   1.00 47.55  ? 126 VAL D CB  1 
ATOM   7398  C  CG1 . VAL D  1 127 ? 76.437  -13.788 -3.626   1.00 41.65  ? 126 VAL D CG1 1 
ATOM   7399  C  CG2 . VAL D  1 127 ? 76.029  -14.643 -1.314   1.00 49.08  ? 126 VAL D CG2 1 
ATOM   7400  N  N   . PHE D  1 128 ? 73.168  -12.832 -4.410   1.00 41.32  ? 127 PHE D N   1 
ATOM   7401  C  CA  . PHE D  1 128 ? 72.727  -12.244 -5.674   1.00 40.91  ? 127 PHE D CA  1 
ATOM   7402  C  C   . PHE D  1 128 ? 72.070  -10.879 -5.434   1.00 47.08  ? 127 PHE D C   1 
ATOM   7403  O  O   . PHE D  1 128 ? 72.294  -9.922  -6.178   1.00 38.61  ? 127 PHE D O   1 
ATOM   7404  C  CB  . PHE D  1 128 ? 71.746  -13.191 -6.373   1.00 41.58  ? 127 PHE D CB  1 
ATOM   7405  C  CG  . PHE D  1 128 ? 71.455  -12.832 -7.805   1.00 43.07  ? 127 PHE D CG  1 
ATOM   7406  C  CD1 . PHE D  1 128 ? 72.286  -13.265 -8.821   1.00 62.77  ? 127 PHE D CD1 1 
ATOM   7407  C  CD2 . PHE D  1 128 ? 70.345  -12.073 -8.135   1.00 54.46  ? 127 PHE D CD2 1 
ATOM   7408  C  CE1 . PHE D  1 128 ? 72.022  -12.942 -10.140  1.00 51.68  ? 127 PHE D CE1 1 
ATOM   7409  C  CE2 . PHE D  1 128 ? 70.080  -11.742 -9.454   1.00 42.86  ? 127 PHE D CE2 1 
ATOM   7410  C  CZ  . PHE D  1 128 ? 70.914  -12.183 -10.454  1.00 57.78  ? 127 PHE D CZ  1 
ATOM   7411  N  N   . LEU D  1 129 ? 71.261  -10.794 -4.385   1.00 39.31  ? 128 LEU D N   1 
ATOM   7412  C  CA  . LEU D  1 129 ? 70.535  -9.565  -4.101   1.00 42.04  ? 128 LEU D CA  1 
ATOM   7413  C  C   . LEU D  1 129 ? 71.482  -8.464  -3.613   1.00 39.09  ? 128 LEU D C   1 
ATOM   7414  O  O   . LEU D  1 129 ? 71.347  -7.294  -4.000   1.00 39.38  ? 128 LEU D O   1 
ATOM   7415  C  CB  . LEU D  1 129 ? 69.393  -9.812  -3.100   1.00 39.14  ? 128 LEU D CB  1 
ATOM   7416  C  CG  . LEU D  1 129 ? 68.531  -8.572  -2.849   1.00 49.01  ? 128 LEU D CG  1 
ATOM   7417  C  CD1 . LEU D  1 129 ? 67.886  -8.100  -4.148   1.00 37.26  ? 128 LEU D CD1 1 
ATOM   7418  C  CD2 . LEU D  1 129 ? 67.479  -8.842  -1.787   1.00 39.54  ? 128 LEU D CD2 1 
ATOM   7419  N  N   . ARG D  1 130 ? 72.444  -8.841  -2.775   1.00 40.50  ? 129 ARG D N   1 
ATOM   7420  C  CA  . ARG D  1 130 ? 73.479  -7.907  -2.348   1.00 38.05  ? 129 ARG D CA  1 
ATOM   7421  C  C   . ARG D  1 130 ? 74.242  -7.378  -3.551   1.00 60.19  ? 129 ARG D C   1 
ATOM   7422  O  O   . ARG D  1 130 ? 74.634  -6.212  -3.586   1.00 37.54  ? 129 ARG D O   1 
ATOM   7423  C  CB  . ARG D  1 130 ? 74.458  -8.573  -1.391   1.00 43.59  ? 129 ARG D CB  1 
ATOM   7424  C  CG  . ARG D  1 130 ? 73.907  -8.782  0.009    1.00 53.70  ? 129 ARG D CG  1 
ATOM   7425  C  CD  . ARG D  1 130 ? 74.844  -9.649  0.834    1.00 52.35  ? 129 ARG D CD  1 
ATOM   7426  N  NE  . ARG D  1 130 ? 76.212  -9.140  0.835    1.00 71.57  ? 129 ARG D NE  1 
ATOM   7427  C  CZ  . ARG D  1 130 ? 76.676  -8.239  1.695    1.00 76.93  ? 129 ARG D CZ  1 
ATOM   7428  N  NH1 . ARG D  1 130 ? 75.882  -7.739  2.633    1.00 55.18  ? 129 ARG D NH1 1 
ATOM   7429  N  NH2 . ARG D  1 130 ? 77.939  -7.836  1.616    1.00 63.08  ? 129 ARG D NH2 1 
ATOM   7430  N  N   . ARG D  1 131 ? 74.450  -8.243  -4.537   1.00 40.31  ? 130 ARG D N   1 
ATOM   7431  C  CA  . ARG D  1 131 ? 75.175  -7.852  -5.742   1.00 45.36  ? 130 ARG D CA  1 
ATOM   7432  C  C   . ARG D  1 131 ? 74.398  -6.787  -6.519   1.00 46.14  ? 130 ARG D C   1 
ATOM   7433  O  O   . ARG D  1 131 ? 74.954  -5.757  -6.930   1.00 36.67  ? 130 ARG D O   1 
ATOM   7434  C  CB  . ARG D  1 131 ? 75.429  -9.072  -6.624   1.00 48.32  ? 130 ARG D CB  1 
ATOM   7435  C  CG  . ARG D  1 131 ? 76.251  -8.779  -7.867   1.00 53.91  ? 130 ARG D CG  1 
ATOM   7436  C  CD  . ARG D  1 131 ? 76.489  -10.047 -8.687   1.00 50.07  ? 130 ARG D CD  1 
ATOM   7437  N  NE  . ARG D  1 131 ? 76.988  -9.719  -10.017  1.00 91.36  ? 130 ARG D NE  1 
ATOM   7438  C  CZ  . ARG D  1 131 ? 77.169  -10.605 -10.990  1.00 96.60  ? 130 ARG D CZ  1 
ATOM   7439  N  NH1 . ARG D  1 131 ? 77.626  -10.200 -12.168  1.00 71.71  ? 130 ARG D NH1 1 
ATOM   7440  N  NH2 . ARG D  1 131 ? 76.894  -11.890 -10.784  1.00 69.06  ? 130 ARG D NH2 1 
ATOM   7441  N  N   . LEU D  1 132 ? 73.110  -7.044  -6.720   1.00 34.67  ? 131 LEU D N   1 
ATOM   7442  C  CA  . LEU D  1 132 ? 72.236  -6.102  -7.411   1.00 33.50  ? 131 LEU D CA  1 
ATOM   7443  C  C   . LEU D  1 132 ? 72.230  -4.764  -6.673   1.00 38.72  ? 131 LEU D C   1 
ATOM   7444  O  O   . LEU D  1 132 ? 72.359  -3.695  -7.278   1.00 33.62  ? 131 LEU D O   1 
ATOM   7445  C  CB  . LEU D  1 132 ? 70.807  -6.665  -7.477   1.00 37.50  ? 131 LEU D CB  1 
ATOM   7446  C  CG  . LEU D  1 132 ? 69.783  -5.775  -8.198   1.00 35.88  ? 131 LEU D CG  1 
ATOM   7447  C  CD1 . LEU D  1 132 ? 70.108  -5.664  -9.696   1.00 39.06  ? 131 LEU D CD1 1 
ATOM   7448  C  CD2 . LEU D  1 132 ? 68.356  -6.276  -7.977   1.00 41.23  ? 131 LEU D CD2 1 
ATOM   7449  N  N   . HIS D  1 133 ? 72.076  -4.828  -5.356   1.00 36.28  ? 132 HIS D N   1 
ATOM   7450  C  CA  . HIS D  1 133 ? 71.982  -3.622  -4.545   1.00 37.73  ? 132 HIS D CA  1 
ATOM   7451  C  C   . HIS D  1 133 ? 73.298  -2.882  -4.368   1.00 45.63  ? 132 HIS D C   1 
ATOM   7452  O  O   . HIS D  1 133 ? 73.323  -1.790  -3.798   1.00 39.87  ? 132 HIS D O   1 
ATOM   7453  C  CB  . HIS D  1 133 ? 71.339  -3.937  -3.194   1.00 32.15  ? 132 HIS D CB  1 
ATOM   7454  C  CG  . HIS D  1 133 ? 69.882  -4.244  -3.303   1.00 39.02  ? 132 HIS D CG  1 
ATOM   7455  N  ND1 . HIS D  1 133 ? 69.080  -4.505  -2.212   1.00 33.08  ? 132 HIS D ND1 1 
ATOM   7456  C  CD2 . HIS D  1 133 ? 69.078  -4.316  -4.390   1.00 38.59  ? 132 HIS D CD2 1 
ATOM   7457  C  CE1 . HIS D  1 133 ? 67.846  -4.728  -2.623   1.00 34.65  ? 132 HIS D CE1 1 
ATOM   7458  N  NE2 . HIS D  1 133 ? 67.818  -4.628  -3.942   1.00 34.10  ? 132 HIS D NE2 1 
ATOM   7459  N  N   . SER D  1 134 ? 74.381  -3.470  -4.860   1.00 38.28  ? 133 SER D N   1 
ATOM   7460  C  CA  . SER D  1 134 ? 75.696  -2.850  -4.756   1.00 42.36  ? 133 SER D CA  1 
ATOM   7461  C  C   . SER D  1 134 ? 76.038  -1.980  -5.964   1.00 45.31  ? 133 SER D C   1 
ATOM   7462  O  O   . SER D  1 134 ? 77.020  -1.245  -5.946   1.00 36.71  ? 133 SER D O   1 
ATOM   7463  C  CB  . SER D  1 134 ? 76.779  -3.923  -4.584   1.00 50.17  ? 133 SER D CB  1 
ATOM   7464  O  OG  . SER D  1 134 ? 76.653  -4.557  -3.328   1.00 61.22  ? 133 SER D OG  1 
ATOM   7465  N  N   . ILE D  1 135 ? 75.251  -2.093  -7.024   1.00 37.33  ? 134 ILE D N   1 
ATOM   7466  C  CA  . ILE D  1 135 ? 75.456  -1.264  -8.203   1.00 36.91  ? 134 ILE D CA  1 
ATOM   7467  C  C   . ILE D  1 135 ? 75.214  0.196   -7.826   1.00 35.77  ? 134 ILE D C   1 
ATOM   7468  O  O   . ILE D  1 135 ? 74.140  0.531   -7.333   1.00 35.57  ? 134 ILE D O   1 
ATOM   7469  C  CB  . ILE D  1 135 ? 74.470  -1.648  -9.319   1.00 34.42  ? 134 ILE D CB  1 
ATOM   7470  C  CG1 . ILE D  1 135 ? 74.665  -3.107  -9.738   1.00 41.09  ? 134 ILE D CG1 1 
ATOM   7471  C  CG2 . ILE D  1 135 ? 74.600  -0.697  -10.508  1.00 36.69  ? 134 ILE D CG2 1 
ATOM   7472  C  CD1 . ILE D  1 135 ? 73.546  -3.614  -10.628  1.00 37.11  ? 134 ILE D CD1 1 
ATOM   7473  N  N   . PRO D  1 136 ? 76.215  1.066   -8.033   1.00 34.43  ? 135 PRO D N   1 
ATOM   7474  C  CA  . PRO D  1 136 ? 76.012  2.461   -7.645   1.00 38.22  ? 135 PRO D CA  1 
ATOM   7475  C  C   . PRO D  1 136 ? 74.835  3.057   -8.396   1.00 40.57  ? 135 PRO D C   1 
ATOM   7476  O  O   . PRO D  1 136 ? 74.697  2.824   -9.598   1.00 38.88  ? 135 PRO D O   1 
ATOM   7477  C  CB  . PRO D  1 136 ? 77.326  3.121   -8.057   1.00 46.82  ? 135 PRO D CB  1 
ATOM   7478  C  CG  . PRO D  1 136 ? 78.335  2.026   -7.860   1.00 44.00  ? 135 PRO D CG  1 
ATOM   7479  C  CD  . PRO D  1 136 ? 77.635  0.781   -8.323   1.00 39.71  ? 135 PRO D CD  1 
ATOM   7480  N  N   . VAL D  1 137 ? 73.972  3.783   -7.692   1.00 39.50  ? 136 VAL D N   1 
ATOM   7481  C  CA  . VAL D  1 137 ? 72.745  4.255   -8.312   1.00 34.68  ? 136 VAL D CA  1 
ATOM   7482  C  C   . VAL D  1 137 ? 73.036  5.305   -9.394   1.00 35.52  ? 136 VAL D C   1 
ATOM   7483  O  O   . VAL D  1 137 ? 72.201  5.548   -10.257  1.00 36.14  ? 136 VAL D O   1 
ATOM   7484  C  CB  . VAL D  1 137 ? 71.718  4.790   -7.287   1.00 40.88  ? 136 VAL D CB  1 
ATOM   7485  C  CG1 . VAL D  1 137 ? 71.411  3.712   -6.253   1.00 38.61  ? 136 VAL D CG1 1 
ATOM   7486  C  CG2 . VAL D  1 137 ? 72.227  6.054   -6.610   1.00 41.08  ? 136 VAL D CG2 1 
ATOM   7487  N  N   . CYS D  1 138 ? 74.230  5.885   -9.366   1.00 33.72  ? 137 CYS D N   1 
ATOM   7488  C  CA  . CYS D  1 138 ? 74.621  6.833   -10.414  1.00 35.35  ? 137 CYS D CA  1 
ATOM   7489  C  C   . CYS D  1 138 ? 74.692  6.189   -11.811  1.00 43.88  ? 137 CYS D C   1 
ATOM   7490  O  O   . CYS D  1 138 ? 74.799  6.896   -12.811  1.00 39.96  ? 137 CYS D O   1 
ATOM   7491  C  CB  . CYS D  1 138 ? 75.958  7.511   -10.079  1.00 34.03  ? 137 CYS D CB  1 
ATOM   7492  S  SG  . CYS D  1 138 ? 77.417  6.420   -10.023  1.00 41.39  ? 137 CYS D SG  1 
ATOM   7493  N  N   . ASN D  1 139 ? 74.634  4.859   -11.877  1.00 36.70  ? 138 ASN D N   1 
ATOM   7494  C  CA  . ASN D  1 139 ? 74.631  4.149   -13.160  1.00 40.12  ? 138 ASN D CA  1 
ATOM   7495  C  C   . ASN D  1 139 ? 73.244  3.971   -13.770  1.00 37.33  ? 138 ASN D C   1 
ATOM   7496  O  O   . ASN D  1 139 ? 73.115  3.713   -14.965  1.00 38.58  ? 138 ASN D O   1 
ATOM   7497  C  CB  . ASN D  1 139 ? 75.240  2.760   -13.002  1.00 38.26  ? 138 ASN D CB  1 
ATOM   7498  C  CG  . ASN D  1 139 ? 76.690  2.810   -12.618  1.00 45.73  ? 138 ASN D CG  1 
ATOM   7499  O  OD1 . ASN D  1 139 ? 77.526  3.207   -13.414  1.00 46.54  ? 138 ASN D OD1 1 
ATOM   7500  N  ND2 . ASN D  1 139 ? 76.996  2.423   -11.388  1.00 47.43  ? 138 ASN D ND2 1 
ATOM   7501  N  N   . CYS D  1 140 ? 72.218  4.098   -12.945  1.00 32.94  ? 139 CYS D N   1 
ATOM   7502  C  CA  . CYS D  1 140 ? 70.872  3.667   -13.330  1.00 35.04  ? 139 CYS D CA  1 
ATOM   7503  C  C   . CYS D  1 140 ? 69.973  4.802   -13.821  1.00 41.50  ? 139 CYS D C   1 
ATOM   7504  O  O   . CYS D  1 140 ? 69.699  5.729   -13.074  1.00 30.98  ? 139 CYS D O   1 
ATOM   7505  C  CB  . CYS D  1 140 ? 70.206  2.961   -12.158  1.00 33.33  ? 139 CYS D CB  1 
ATOM   7506  S  SG  . CYS D  1 140 ? 68.545  2.326   -12.547  1.00 34.94  ? 139 CYS D SG  1 
ATOM   7507  N  N   . PRO D  1 141 ? 69.506  4.725   -15.082  1.00 37.35  ? 140 PRO D N   1 
ATOM   7508  C  CA  . PRO D  1 141 ? 68.681  5.798   -15.647  1.00 34.04  ? 140 PRO D CA  1 
ATOM   7509  C  C   . PRO D  1 141 ? 67.175  5.615   -15.400  1.00 33.60  ? 140 PRO D C   1 
ATOM   7510  O  O   . PRO D  1 141 ? 66.371  6.346   -15.981  1.00 34.62  ? 140 PRO D O   1 
ATOM   7511  C  CB  . PRO D  1 141 ? 68.979  5.702   -17.146  1.00 32.65  ? 140 PRO D CB  1 
ATOM   7512  C  CG  . PRO D  1 141 ? 69.248  4.244   -17.365  1.00 41.35  ? 140 PRO D CG  1 
ATOM   7513  C  CD  . PRO D  1 141 ? 69.883  3.721   -16.096  1.00 38.05  ? 140 PRO D CD  1 
ATOM   7514  N  N   . PHE D  1 142 ? 66.793  4.657   -14.566  1.00 32.64  ? 141 PHE D N   1 
ATOM   7515  C  CA  . PHE D  1 142 ? 65.363  4.382   -14.359  1.00 35.74  ? 141 PHE D CA  1 
ATOM   7516  C  C   . PHE D  1 142 ? 64.921  4.734   -12.949  1.00 34.74  ? 141 PHE D C   1 
ATOM   7517  O  O   . PHE D  1 142 ? 65.582  4.373   -11.974  1.00 35.06  ? 141 PHE D O   1 
ATOM   7518  C  CB  . PHE D  1 142 ? 65.005  2.911   -14.674  1.00 33.23  ? 141 PHE D CB  1 
ATOM   7519  C  CG  . PHE D  1 142 ? 65.418  2.472   -16.057  1.00 36.47  ? 141 PHE D CG  1 
ATOM   7520  C  CD1 . PHE D  1 142 ? 64.729  2.915   -17.166  1.00 34.91  ? 141 PHE D CD1 1 
ATOM   7521  C  CD2 . PHE D  1 142 ? 66.494  1.611   -16.237  1.00 37.98  ? 141 PHE D CD2 1 
ATOM   7522  C  CE1 . PHE D  1 142 ? 65.114  2.530   -18.458  1.00 37.14  ? 141 PHE D CE1 1 
ATOM   7523  C  CE2 . PHE D  1 142 ? 66.884  1.213   -17.509  1.00 35.21  ? 141 PHE D CE2 1 
ATOM   7524  C  CZ  . PHE D  1 142 ? 66.195  1.670   -18.623  1.00 37.96  ? 141 PHE D CZ  1 
ATOM   7525  N  N   . ASN D  1 143 ? 63.793  5.438   -12.867  1.00 33.77  ? 142 ASN D N   1 
ATOM   7526  C  CA  . ASN D  1 143 ? 63.180  5.844   -11.610  1.00 33.97  ? 142 ASN D CA  1 
ATOM   7527  C  C   . ASN D  1 143 ? 62.040  4.901   -11.235  1.00 39.46  ? 142 ASN D C   1 
ATOM   7528  O  O   . ASN D  1 143 ? 61.036  4.835   -11.940  1.00 38.85  ? 142 ASN D O   1 
ATOM   7529  C  CB  . ASN D  1 143 ? 62.650  7.284   -11.756  1.00 38.20  ? 142 ASN D CB  1 
ATOM   7530  C  CG  . ASN D  1 143 ? 61.700  7.689   -10.625  1.00 35.12  ? 142 ASN D CG  1 
ATOM   7531  O  OD1 . ASN D  1 143 ? 61.861  7.259   -9.488   1.00 35.84  ? 142 ASN D OD1 1 
ATOM   7532  N  ND2 . ASN D  1 143 ? 60.712  8.539   -10.943  1.00 36.43  ? 142 ASN D ND2 1 
ATOM   7533  N  N   . SER D  1 144 ? 62.194  4.164   -10.136  1.00 32.44  ? 143 SER D N   1 
ATOM   7534  C  CA  . SER D  1 144 ? 61.120  3.313   -9.639   1.00 34.97  ? 143 SER D CA  1 
ATOM   7535  C  C   . SER D  1 144 ? 60.717  3.723   -8.233   1.00 37.22  ? 143 SER D C   1 
ATOM   7536  O  O   . SER D  1 144 ? 60.272  2.885   -7.452   1.00 36.81  ? 143 SER D O   1 
ATOM   7537  C  CB  . SER D  1 144 ? 61.547  1.831   -9.628   1.00 34.29  ? 143 SER D CB  1 
ATOM   7538  O  OG  . SER D  1 144 ? 61.569  1.305   -10.940  1.00 46.68  ? 143 SER D OG  1 
ATOM   7539  N  N   . ASP D  1 145 ? 60.877  4.998   -7.889   1.00 34.49  ? 144 ASP D N   1 
ATOM   7540  C  CA  . ASP D  1 145 ? 60.669  5.390   -6.493   1.00 39.70  ? 144 ASP D CA  1 
ATOM   7541  C  C   . ASP D  1 145 ? 59.206  5.360   -6.049   1.00 44.87  ? 144 ASP D C   1 
ATOM   7542  O  O   . ASP D  1 145 ? 58.304  5.152   -6.854   1.00 31.92  ? 144 ASP D O   1 
ATOM   7543  C  CB  . ASP D  1 145 ? 61.343  6.720   -6.144   1.00 37.88  ? 144 ASP D CB  1 
ATOM   7544  C  CG  . ASP D  1 145 ? 60.662  7.937   -6.768   1.00 41.34  ? 144 ASP D CG  1 
ATOM   7545  O  OD1 . ASP D  1 145 ? 59.504  7.858   -7.238   1.00 38.41  ? 144 ASP D OD1 1 
ATOM   7546  O  OD2 . ASP D  1 145 ? 61.305  9.011   -6.759   1.00 42.84  ? 144 ASP D OD2 1 
ATOM   7547  N  N   . ARG D  1 146 ? 58.971  5.568   -4.763   1.00 36.39  ? 145 ARG D N   1 
ATOM   7548  C  CA  . ARG D  1 146 ? 57.630  5.339   -4.247   1.00 38.13  ? 145 ARG D CA  1 
ATOM   7549  C  C   . ARG D  1 146 ? 56.610  6.366   -4.735   1.00 35.24  ? 145 ARG D C   1 
ATOM   7550  O  O   . ARG D  1 146 ? 55.450  6.034   -4.923   1.00 35.74  ? 145 ARG D O   1 
ATOM   7551  C  CB  . ARG D  1 146 ? 57.622  5.184   -2.721   1.00 41.42  ? 145 ARG D CB  1 
ATOM   7552  C  CG  . ARG D  1 146 ? 57.761  6.452   -1.928   1.00 45.72  ? 145 ARG D CG  1 
ATOM   7553  C  CD  . ARG D  1 146 ? 57.539  6.139   -0.456   1.00 37.80  ? 145 ARG D CD  1 
ATOM   7554  N  NE  . ARG D  1 146 ? 57.433  7.331   0.379    1.00 51.44  ? 145 ARG D NE  1 
ATOM   7555  C  CZ  . ARG D  1 146 ? 58.403  7.774   1.170    1.00 60.80  ? 145 ARG D CZ  1 
ATOM   7556  N  NH1 . ARG D  1 146 ? 58.209  8.858   1.913    1.00 48.68  ? 145 ARG D NH1 1 
ATOM   7557  N  NH2 . ARG D  1 146 ? 59.565  7.129   1.226    1.00 45.37  ? 145 ARG D NH2 1 
ATOM   7558  N  N   . VAL D  1 147 ? 57.045  7.600   -4.967   1.00 31.50  ? 146 VAL D N   1 
ATOM   7559  C  CA  . VAL D  1 147 ? 56.153  8.610   -5.529   1.00 36.06  ? 146 VAL D CA  1 
ATOM   7560  C  C   . VAL D  1 147 ? 55.642  8.143   -6.897   1.00 44.76  ? 146 VAL D C   1 
ATOM   7561  O  O   . VAL D  1 147 ? 54.447  8.232   -7.208   1.00 34.54  ? 146 VAL D O   1 
ATOM   7562  C  CB  . VAL D  1 147 ? 56.866  9.965   -5.665   1.00 42.71  ? 146 VAL D CB  1 
ATOM   7563  C  CG1 . VAL D  1 147 ? 56.055  10.921  -6.514   1.00 60.73  ? 146 VAL D CG1 1 
ATOM   7564  C  CG2 . VAL D  1 147 ? 57.123  10.560  -4.286   1.00 49.01  ? 146 VAL D CG2 1 
ATOM   7565  N  N   . PHE D  1 148 ? 56.562  7.624   -7.700   1.00 32.23  ? 147 PHE D N   1 
ATOM   7566  C  CA  . PHE D  1 148 ? 56.240  7.092   -9.015   1.00 32.15  ? 147 PHE D CA  1 
ATOM   7567  C  C   . PHE D  1 148 ? 55.317  5.875   -8.894   1.00 32.46  ? 147 PHE D C   1 
ATOM   7568  O  O   . PHE D  1 148 ? 54.279  5.791   -9.555   1.00 31.95  ? 147 PHE D O   1 
ATOM   7569  C  CB  . PHE D  1 148 ? 57.531  6.706   -9.745   1.00 38.46  ? 147 PHE D CB  1 
ATOM   7570  C  CG  . PHE D  1 148 ? 57.306  6.154   -11.126  1.00 37.28  ? 147 PHE D CG  1 
ATOM   7571  C  CD1 . PHE D  1 148 ? 57.054  7.002   -12.194  1.00 42.80  ? 147 PHE D CD1 1 
ATOM   7572  C  CD2 . PHE D  1 148 ? 57.358  4.791   -11.358  1.00 40.22  ? 147 PHE D CD2 1 
ATOM   7573  C  CE1 . PHE D  1 148 ? 56.848  6.502   -13.468  1.00 46.51  ? 147 PHE D CE1 1 
ATOM   7574  C  CE2 . PHE D  1 148 ? 57.153  4.281   -12.632  1.00 44.94  ? 147 PHE D CE2 1 
ATOM   7575  C  CZ  . PHE D  1 148 ? 56.901  5.141   -13.689  1.00 40.07  ? 147 PHE D CZ  1 
ATOM   7576  N  N   . ARG D  1 149 ? 55.697  4.922   -8.054   1.00 30.29  ? 148 ARG D N   1 
ATOM   7577  C  CA  . ARG D  1 149 ? 54.892  3.709   -7.911   1.00 27.21  ? 148 ARG D CA  1 
ATOM   7578  C  C   . ARG D  1 149 ? 53.522  3.968   -7.259   1.00 36.50  ? 148 ARG D C   1 
ATOM   7579  O  O   . ARG D  1 149 ? 52.529  3.345   -7.639   1.00 33.40  ? 148 ARG D O   1 
ATOM   7580  C  CB  . ARG D  1 149 ? 55.656  2.604   -7.158   1.00 31.40  ? 148 ARG D CB  1 
ATOM   7581  C  CG  . ARG D  1 149 ? 56.908  2.077   -7.898   1.00 36.02  ? 148 ARG D CG  1 
ATOM   7582  C  CD  . ARG D  1 149 ? 56.538  1.398   -9.209   1.00 47.91  ? 148 ARG D CD  1 
ATOM   7583  N  NE  . ARG D  1 149 ? 57.713  0.931   -9.946   1.00 60.40  ? 148 ARG D NE  1 
ATOM   7584  C  CZ  . ARG D  1 149 ? 57.726  0.662   -11.250  1.00 85.75  ? 148 ARG D CZ  1 
ATOM   7585  N  NH1 . ARG D  1 149 ? 56.623  0.818   -11.974  1.00 47.68  ? 148 ARG D NH1 1 
ATOM   7586  N  NH2 . ARG D  1 149 ? 58.843  0.245   -11.837  1.00 51.58  ? 148 ARG D NH2 1 
ATOM   7587  N  N   . LEU D  1 150 ? 53.445  4.883   -6.296   1.00 30.62  ? 149 LEU D N   1 
ATOM   7588  C  CA  . LEU D  1 150 ? 52.150  5.136   -5.653   1.00 31.30  ? 149 LEU D CA  1 
ATOM   7589  C  C   . LEU D  1 150 ? 51.151  5.711   -6.653   1.00 39.94  ? 149 LEU D C   1 
ATOM   7590  O  O   . LEU D  1 150 ? 49.968  5.357   -6.652   1.00 35.38  ? 149 LEU D O   1 
ATOM   7591  C  CB  . LEU D  1 150 ? 52.295  6.061   -4.441   1.00 35.92  ? 149 LEU D CB  1 
ATOM   7592  C  CG  . LEU D  1 150 ? 52.915  5.397   -3.212   1.00 33.01  ? 149 LEU D CG  1 
ATOM   7593  C  CD1 . LEU D  1 150 ? 53.447  6.452   -2.249   1.00 42.89  ? 149 LEU D CD1 1 
ATOM   7594  C  CD2 . LEU D  1 150 ? 51.883  4.485   -2.522   1.00 37.30  ? 149 LEU D CD2 1 
ATOM   7595  N  N   . ALA D  1 151 ? 51.641  6.593   -7.522   1.00 38.70  ? 150 ALA D N   1 
ATOM   7596  C  CA  . ALA D  1 151 ? 50.785  7.178   -8.555   1.00 44.35  ? 150 ALA D CA  1 
ATOM   7597  C  C   . ALA D  1 151 ? 50.247  6.103   -9.505   1.00 40.82  ? 150 ALA D C   1 
ATOM   7598  O  O   . ALA D  1 151 ? 49.089  6.156   -9.917   1.00 39.86  ? 150 ALA D O   1 
ATOM   7599  C  CB  . ALA D  1 151 ? 51.543  8.260   -9.334   1.00 50.19  ? 150 ALA D CB  1 
ATOM   7600  N  N   . GLN D  1 152 ? 51.089  5.135   -9.857   1.00 34.03  ? 151 GLN D N   1 
ATOM   7601  C  CA  . GLN D  1 152 ? 50.648  4.027   -10.694  1.00 35.89  ? 151 GLN D CA  1 
ATOM   7602  C  C   . GLN D  1 152 ? 49.623  3.199   -9.950   1.00 39.96  ? 151 GLN D C   1 
ATOM   7603  O  O   . GLN D  1 152 ? 48.618  2.788   -10.516  1.00 35.41  ? 151 GLN D O   1 
ATOM   7604  C  CB  . GLN D  1 152 ? 51.815  3.113   -11.058  1.00 31.14  ? 151 GLN D CB  1 
ATOM   7605  C  CG  . GLN D  1 152 ? 52.768  3.682   -12.082  1.00 36.61  ? 151 GLN D CG  1 
ATOM   7606  C  CD  . GLN D  1 152 ? 53.831  2.677   -12.493  1.00 49.09  ? 151 GLN D CD  1 
ATOM   7607  O  OE1 . GLN D  1 152 ? 54.176  1.781   -11.726  1.00 44.14  ? 151 GLN D OE1 1 
ATOM   7608  N  NE2 . GLN D  1 152 ? 54.342  2.814   -13.710  1.00 58.89  ? 151 GLN D NE2 1 
ATOM   7609  N  N   . ALA D  1 153 ? 49.892  2.940   -8.674   1.00 37.39  ? 152 ALA D N   1 
ATOM   7610  C  CA  . ALA D  1 153 ? 48.984  2.131   -7.869   1.00 42.55  ? 152 ALA D CA  1 
ATOM   7611  C  C   . ALA D  1 153 ? 47.611  2.797   -7.762   1.00 39.60  ? 152 ALA D C   1 
ATOM   7612  O  O   . ALA D  1 153 ? 46.581  2.140   -7.894   1.00 40.84  ? 152 ALA D O   1 
ATOM   7613  C  CB  . ALA D  1 153 ? 49.575  1.880   -6.490   1.00 38.91  ? 152 ALA D CB  1 
ATOM   7614  N  N   . GLN D  1 154 ? 47.605  4.105   -7.542   1.00 34.54  ? 153 GLN D N   1 
ATOM   7615  C  CA  . GLN D  1 154 ? 46.365  4.858   -7.453   1.00 40.53  ? 153 GLN D CA  1 
ATOM   7616  C  C   . GLN D  1 154 ? 45.593  4.773   -8.766   1.00 54.73  ? 153 GLN D C   1 
ATOM   7617  O  O   . GLN D  1 154 ? 44.369  4.685   -8.776   1.00 45.50  ? 153 GLN D O   1 
ATOM   7618  C  CB  . GLN D  1 154 ? 46.662  6.321   -7.118   1.00 40.51  ? 153 GLN D CB  1 
ATOM   7619  C  CG  . GLN D  1 154 ? 45.448  7.215   -7.137   1.00 50.46  ? 153 GLN D CG  1 
ATOM   7620  C  CD  . GLN D  1 154 ? 45.768  8.611   -6.666   1.00 57.09  ? 153 GLN D CD  1 
ATOM   7621  O  OE1 . GLN D  1 154 ? 46.590  9.305   -7.258   1.00 63.55  ? 153 GLN D OE1 1 
ATOM   7622  N  NE2 . GLN D  1 154 ? 45.128  9.025   -5.581   1.00 63.84  ? 153 GLN D NE2 1 
ATOM   7623  N  N   . SER D  1 155 ? 46.319  4.791   -9.878   1.00 44.30  ? 154 SER D N   1 
ATOM   7624  C  CA  . SER D  1 155 ? 45.681  4.668   -11.177  1.00 41.14  ? 154 SER D CA  1 
ATOM   7625  C  C   . SER D  1 155 ? 45.043  3.291   -11.355  1.00 51.37  ? 154 SER D C   1 
ATOM   7626  O  O   . SER D  1 155 ? 43.929  3.177   -11.867  1.00 43.17  ? 154 SER D O   1 
ATOM   7627  C  CB  . SER D  1 155 ? 46.680  4.969   -12.305  1.00 44.93  ? 154 SER D CB  1 
ATOM   7628  O  OG  . SER D  1 155 ? 46.029  4.935   -13.557  1.00 57.13  ? 154 SER D OG  1 
ATOM   7629  N  N   . ARG D  1 156 ? 45.735  2.248   -10.909  1.00 43.16  ? 155 ARG D N   1 
ATOM   7630  C  CA  . ARG D  1 156 ? 45.215  0.889   -11.044  1.00 52.46  ? 155 ARG D CA  1 
ATOM   7631  C  C   . ARG D  1 156 ? 43.981  0.664   -10.176  1.00 45.06  ? 155 ARG D C   1 
ATOM   7632  O  O   . ARG D  1 156 ? 43.039  -0.030  -10.576  1.00 48.01  ? 155 ARG D O   1 
ATOM   7633  C  CB  . ARG D  1 156 ? 46.302  -0.138  -10.716  1.00 45.58  ? 155 ARG D CB  1 
ATOM   7634  C  CG  . ARG D  1 156 ? 47.545  0.024   -11.582  1.00 46.22  ? 155 ARG D CG  1 
ATOM   7635  C  CD  . ARG D  1 156 ? 48.479  -1.165  -11.481  1.00 44.02  ? 155 ARG D CD  1 
ATOM   7636  N  NE  . ARG D  1 156 ? 48.186  -2.159  -12.509  1.00 73.46  ? 155 ARG D NE  1 
ATOM   7637  C  CZ  . ARG D  1 156 ? 47.460  -3.255  -12.316  1.00 51.32  ? 155 ARG D CZ  1 
ATOM   7638  N  NH1 . ARG D  1 156 ? 47.252  -4.092  -13.324  1.00 80.65  ? 155 ARG D NH1 1 
ATOM   7639  N  NH2 . ARG D  1 156 ? 46.940  -3.521  -11.125  1.00 59.90  ? 155 ARG D NH2 1 
HETATM 7640  N  N   . MSE D  1 157 ? 43.994  1.240   -8.979   1.00 40.54  ? 156 MSE D N   1 
HETATM 7641  C  CA  . MSE D  1 157 ? 42.841  1.159   -8.091   1.00 48.03  ? 156 MSE D CA  1 
HETATM 7642  C  C   . MSE D  1 157 ? 41.618  1.779   -8.752   1.00 48.84  ? 156 MSE D C   1 
HETATM 7643  O  O   . MSE D  1 157 ? 40.547  1.154   -8.852   1.00 42.44  ? 156 MSE D O   1 
HETATM 7644  C  CB  . MSE D  1 157 ? 43.130  1.886   -6.778   1.00 49.54  ? 156 MSE D CB  1 
HETATM 7645  C  CG  . MSE D  1 157 ? 41.949  1.907   -5.812   1.00 51.68  ? 156 MSE D CG  1 
HETATM 7646  SE SE  . MSE D  1 157 ? 42.476  2.589   -4.076   0.64 45.01  ? 156 MSE D SE  1 
HETATM 7647  C  CE  . MSE D  1 157 ? 43.065  4.370   -4.627   1.00 49.55  ? 156 MSE D CE  1 
ATOM   7648  N  N   . ASN D  1 158 ? 41.782  3.018   -9.197   1.00 44.12  ? 157 ASN D N   1 
ATOM   7649  C  CA  . ASN D  1 158 ? 40.668  3.779   -9.757   1.00 66.95  ? 157 ASN D CA  1 
ATOM   7650  C  C   . ASN D  1 158 ? 40.189  3.205   -11.081  1.00 50.63  ? 157 ASN D C   1 
ATOM   7651  O  O   . ASN D  1 158 ? 39.046  3.403   -11.477  1.00 55.70  ? 157 ASN D O   1 
ATOM   7652  C  CB  . ASN D  1 158 ? 41.044  5.252   -9.929   1.00 57.69  ? 157 ASN D CB  1 
ATOM   7653  C  CG  . ASN D  1 158 ? 41.351  5.934   -8.609   1.00 64.01  ? 157 ASN D CG  1 
ATOM   7654  O  OD1 . ASN D  1 158 ? 40.921  5.482   -7.546   1.00 70.68  ? 157 ASN D OD1 1 
ATOM   7655  N  ND2 . ASN D  1 158 ? 42.098  7.034   -8.671   1.00 55.57  ? 157 ASN D ND2 1 
ATOM   7656  N  N   . ASN D  1 159 ? 41.075  2.496   -11.771  1.00 45.31  ? 158 ASN D N   1 
ATOM   7657  C  CA  . ASN D  1 159 ? 40.702  1.849   -13.022  1.00 66.50  ? 158 ASN D CA  1 
ATOM   7658  C  C   . ASN D  1 159 ? 40.186  0.423   -12.825  1.00 55.05  ? 158 ASN D C   1 
ATOM   7659  O  O   . ASN D  1 159 ? 39.928  -0.297  -13.790  1.00 56.07  ? 158 ASN D O   1 
ATOM   7660  C  CB  . ASN D  1 159 ? 41.860  1.908   -14.018  1.00 55.84  ? 158 ASN D CB  1 
ATOM   7661  C  CG  . ASN D  1 159 ? 41.958  3.262   -14.698  1.00 55.68  ? 158 ASN D CG  1 
ATOM   7662  O  OD1 . ASN D  1 159 ? 40.992  3.736   -15.296  1.00 64.10  ? 158 ASN D OD1 1 
ATOM   7663  N  ND2 . ASN D  1 159 ? 43.108  3.903   -14.582  1.00 52.50  ? 158 ASN D ND2 1 
ATOM   7664  N  N   . GLY D  1 160 ? 40.029  0.036   -11.564  1.00 45.73  ? 159 GLY D N   1 
ATOM   7665  C  CA  . GLY D  1 160 ? 39.457  -1.254  -11.214  1.00 50.78  ? 159 GLY D CA  1 
ATOM   7666  C  C   . GLY D  1 160 ? 40.315  -2.430  -11.646  1.00 53.40  ? 159 GLY D C   1 
ATOM   7667  O  O   . GLY D  1 160 ? 39.806  -3.513  -11.926  1.00 61.58  ? 159 GLY D O   1 
ATOM   7668  N  N   . LEU D  1 161 ? 41.625  -2.223  -11.677  1.00 40.74  ? 160 LEU D N   1 
ATOM   7669  C  CA  . LEU D  1 161 ? 42.555  -3.239  -12.174  1.00 47.99  ? 160 LEU D CA  1 
ATOM   7670  C  C   . LEU D  1 161 ? 43.220  -4.059  -11.069  1.00 56.76  ? 160 LEU D C   1 
ATOM   7671  O  O   . LEU D  1 161 ? 43.958  -5.003  -11.344  1.00 48.39  ? 160 LEU D O   1 
ATOM   7672  C  CB  . LEU D  1 161 ? 43.630  -2.580  -13.043  1.00 49.54  ? 160 LEU D CB  1 
ATOM   7673  C  CG  . LEU D  1 161 ? 43.083  -1.753  -14.211  1.00 67.61  ? 160 LEU D CG  1 
ATOM   7674  C  CD1 . LEU D  1 161 ? 44.211  -1.173  -15.055  1.00 53.88  ? 160 LEU D CD1 1 
ATOM   7675  C  CD2 . LEU D  1 161 ? 42.137  -2.593  -15.061  1.00 55.77  ? 160 LEU D CD2 1 
ATOM   7676  N  N   . VAL D  1 162 ? 42.964  -3.706  -9.817   1.00 44.28  ? 161 VAL D N   1 
ATOM   7677  C  CA  . VAL D  1 162 ? 43.675  -4.348  -8.721   1.00 40.63  ? 161 VAL D CA  1 
ATOM   7678  C  C   . VAL D  1 162 ? 43.022  -5.699  -8.427   1.00 53.60  ? 161 VAL D C   1 
ATOM   7679  O  O   . VAL D  1 162 ? 41.798  -5.791  -8.348   1.00 46.68  ? 161 VAL D O   1 
ATOM   7680  C  CB  . VAL D  1 162 ? 43.719  -3.444  -7.473   1.00 39.97  ? 161 VAL D CB  1 
ATOM   7681  C  CG1 . VAL D  1 162 ? 44.205  -4.226  -6.247   1.00 40.54  ? 161 VAL D CG1 1 
ATOM   7682  C  CG2 . VAL D  1 162 ? 44.599  -2.197  -7.740   1.00 39.26  ? 161 VAL D CG2 1 
ATOM   7683  N  N   . ASP D  1 163 ? 43.839  -6.746  -8.305   1.00 44.57  ? 162 ASP D N   1 
ATOM   7684  C  CA  . ASP D  1 163 ? 43.334  -8.097  -8.045   1.00 57.33  ? 162 ASP D CA  1 
ATOM   7685  C  C   . ASP D  1 163 ? 43.154  -8.338  -6.542   1.00 44.55  ? 162 ASP D C   1 
ATOM   7686  O  O   . ASP D  1 163 ? 44.063  -8.821  -5.870   1.00 38.81  ? 162 ASP D O   1 
ATOM   7687  C  CB  . ASP D  1 163 ? 44.290  -9.143  -8.637   1.00 49.75  ? 162 ASP D CB  1 
ATOM   7688  C  CG  . ASP D  1 163 ? 43.701  -10.557 -8.640   1.00 54.36  ? 162 ASP D CG  1 
ATOM   7689  O  OD1 . ASP D  1 163 ? 42.597  -10.775 -8.089   1.00 56.68  ? 162 ASP D OD1 1 
ATOM   7690  O  OD2 . ASP D  1 163 ? 44.360  -11.459 -9.197   1.00 53.53  ? 162 ASP D OD2 1 
ATOM   7691  N  N   . ALA D  1 164 ? 41.976  -8.018  -6.021   1.00 46.87  ? 163 ALA D N   1 
ATOM   7692  C  CA  . ALA D  1 164 ? 41.746  -8.079  -4.583   1.00 54.67  ? 163 ALA D CA  1 
ATOM   7693  C  C   . ALA D  1 164 ? 41.715  -9.510  -4.054   1.00 45.79  ? 163 ALA D C   1 
ATOM   7694  O  O   . ALA D  1 164 ? 41.876  -9.743  -2.858   1.00 45.26  ? 163 ALA D O   1 
ATOM   7695  C  CB  . ALA D  1 164 ? 40.460  -7.334  -4.210   1.00 56.01  ? 163 ALA D CB  1 
ATOM   7696  N  N   . SER D  1 165 ? 41.517  -10.470 -4.948   1.00 39.94  ? 164 SER D N   1 
ATOM   7697  C  CA  . SER D  1 165 ? 41.461  -11.863 -4.543   1.00 39.63  ? 164 SER D CA  1 
ATOM   7698  C  C   . SER D  1 165 ? 42.872  -12.428 -4.360   1.00 50.91  ? 164 SER D C   1 
ATOM   7699  O  O   . SER D  1 165 ? 43.047  -13.527 -3.847   1.00 43.27  ? 164 SER D O   1 
ATOM   7700  C  CB  . SER D  1 165 ? 40.685  -12.689 -5.568   1.00 50.29  ? 164 SER D CB  1 
ATOM   7701  O  OG  . SER D  1 165 ? 41.453  -12.862 -6.744   1.00 55.11  ? 164 SER D OG  1 
ATOM   7702  N  N   . ASP D  1 166 ? 43.876  -11.661 -4.762   1.00 39.86  ? 165 ASP D N   1 
ATOM   7703  C  CA  . ASP D  1 166 ? 45.264  -12.127 -4.718   1.00 33.44  ? 165 ASP D CA  1 
ATOM   7704  C  C   . ASP D  1 166 ? 46.071  -11.463 -3.579   1.00 39.71  ? 165 ASP D C   1 
ATOM   7705  O  O   . ASP D  1 166 ? 47.301  -11.552 -3.550   1.00 35.04  ? 165 ASP D O   1 
ATOM   7706  C  CB  . ASP D  1 166 ? 45.924  -11.903 -6.093   1.00 40.22  ? 165 ASP D CB  1 
ATOM   7707  C  CG  . ASP D  1 166 ? 47.249  -12.650 -6.253   1.00 47.79  ? 165 ASP D CG  1 
ATOM   7708  O  OD1 . ASP D  1 166 ? 47.399  -13.741 -5.665   1.00 43.62  ? 165 ASP D OD1 1 
ATOM   7709  O  OD2 . ASP D  1 166 ? 48.144  -12.143 -6.963   1.00 43.64  ? 165 ASP D OD2 1 
ATOM   7710  N  N   . PHE D  1 167 ? 45.385  -10.808 -2.639   1.00 36.32  ? 166 PHE D N   1 
ATOM   7711  C  CA  . PHE D  1 167 ? 46.071  -10.159 -1.510   1.00 33.67  ? 166 PHE D CA  1 
ATOM   7712  C  C   . PHE D  1 167 ? 46.730  -11.186 -0.589   1.00 38.69  ? 166 PHE D C   1 
ATOM   7713  O  O   . PHE D  1 167 ? 46.284  -12.327 -0.514   1.00 35.61  ? 166 PHE D O   1 
ATOM   7714  C  CB  . PHE D  1 167 ? 45.104  -9.303  -0.682   1.00 32.75  ? 166 PHE D CB  1 
ATOM   7715  C  CG  . PHE D  1 167 ? 44.628  -8.052  -1.377   1.00 31.65  ? 166 PHE D CG  1 
ATOM   7716  C  CD1 . PHE D  1 167 ? 45.349  -7.489  -2.424   1.00 39.90  ? 166 PHE D CD1 1 
ATOM   7717  C  CD2 . PHE D  1 167 ? 43.455  -7.423  -0.956   1.00 37.76  ? 166 PHE D CD2 1 
ATOM   7718  C  CE1 . PHE D  1 167 ? 44.906  -6.324  -3.059   1.00 42.88  ? 166 PHE D CE1 1 
ATOM   7719  C  CE2 . PHE D  1 167 ? 43.004  -6.263  -1.589   1.00 39.82  ? 166 PHE D CE2 1 
ATOM   7720  C  CZ  . PHE D  1 167 ? 43.729  -5.714  -2.639   1.00 37.99  ? 166 PHE D CZ  1 
ATOM   7721  N  N   . ASP D  1 168 ? 47.783  -10.770 0.115    1.00 32.62  ? 167 ASP D N   1 
ATOM   7722  C  CA  . ASP D  1 168 ? 48.409  -11.618 1.129    1.00 32.38  ? 167 ASP D CA  1 
ATOM   7723  C  C   . ASP D  1 168 ? 47.412  -11.988 2.224    1.00 38.57  ? 167 ASP D C   1 
ATOM   7724  O  O   . ASP D  1 168 ? 46.371  -11.342 2.374    1.00 39.45  ? 167 ASP D O   1 
ATOM   7725  C  CB  . ASP D  1 168 ? 49.631  -10.918 1.746    1.00 33.40  ? 167 ASP D CB  1 
ATOM   7726  C  CG  . ASP D  1 168 ? 50.738  -10.668 0.727    1.00 40.81  ? 167 ASP D CG  1 
ATOM   7727  O  OD1 . ASP D  1 168 ? 50.968  -11.561 -0.118   1.00 44.17  ? 167 ASP D OD1 1 
ATOM   7728  O  OD2 . ASP D  1 168 ? 51.353  -9.573  0.763    1.00 40.42  ? 167 ASP D OD2 1 
ATOM   7729  N  N   . ASP D  1 169 ? 47.737  -13.033 2.985    1.00 36.99  ? 168 ASP D N   1 
ATOM   7730  C  CA  . ASP D  1 169 ? 46.843  -13.556 4.018    1.00 33.94  ? 168 ASP D CA  1 
ATOM   7731  C  C   . ASP D  1 169 ? 46.351  -12.503 5.011    1.00 38.97  ? 168 ASP D C   1 
ATOM   7732  O  O   . ASP D  1 169 ? 45.178  -12.506 5.400    1.00 40.69  ? 168 ASP D O   1 
ATOM   7733  C  CB  . ASP D  1 169 ? 47.504  -14.717 4.788    1.00 38.54  ? 168 ASP D CB  1 
ATOM   7734  C  CG  . ASP D  1 169 ? 47.539  -16.017 3.988    1.00 53.30  ? 168 ASP D CG  1 
ATOM   7735  O  OD1 . ASP D  1 169 ? 46.934  -16.077 2.899    1.00 40.72  ? 168 ASP D OD1 1 
ATOM   7736  O  OD2 . ASP D  1 169 ? 48.159  -16.994 4.457    1.00 48.73  ? 168 ASP D OD2 1 
ATOM   7737  N  N   . GLU D  1 170 ? 47.245  -11.618 5.433    1.00 38.63  ? 169 GLU D N   1 
ATOM   7738  C  CA  . GLU D  1 170 ? 46.892  -10.655 6.473    1.00 41.86  ? 169 GLU D CA  1 
ATOM   7739  C  C   . GLU D  1 170 ? 45.987  -9.534  5.971    1.00 47.75  ? 169 GLU D C   1 
ATOM   7740  O  O   . GLU D  1 170 ? 45.492  -8.734  6.770    1.00 43.36  ? 169 GLU D O   1 
ATOM   7741  C  CB  . GLU D  1 170 ? 48.143  -10.084 7.146    1.00 48.01  ? 169 GLU D CB  1 
ATOM   7742  C  CG  . GLU D  1 170 ? 49.034  -9.270  6.241    1.00 43.26  ? 169 GLU D CG  1 
ATOM   7743  C  CD  . GLU D  1 170 ? 50.305  -8.826  6.947    1.00 85.03  ? 169 GLU D CD  1 
ATOM   7744  O  OE1 . GLU D  1 170 ? 51.374  -8.804  6.300    1.00 86.47  ? 169 GLU D OE1 1 
ATOM   7745  O  OE2 . GLU D  1 170 ? 50.233  -8.506  8.156    1.00 88.05  ? 169 GLU D OE2 1 
ATOM   7746  N  N   . ARG D  1 171 ? 45.769  -9.494  4.656    1.00 40.20  ? 170 ARG D N   1 
ATOM   7747  C  CA  . ARG D  1 171 ? 44.805  -8.585  4.030    1.00 34.18  ? 170 ARG D CA  1 
ATOM   7748  C  C   . ARG D  1 171 ? 43.703  -9.324  3.255    1.00 52.54  ? 170 ARG D C   1 
ATOM   7749  O  O   . ARG D  1 171 ? 43.026  -8.749  2.405    1.00 39.48  ? 170 ARG D O   1 
ATOM   7750  C  CB  . ARG D  1 171 ? 45.530  -7.591  3.108    1.00 35.00  ? 170 ARG D CB  1 
ATOM   7751  C  CG  . ARG D  1 171 ? 46.339  -6.541  3.865    1.00 39.56  ? 170 ARG D CG  1 
ATOM   7752  C  CD  . ARG D  1 171 ? 47.290  -5.758  2.940    1.00 30.53  ? 170 ARG D CD  1 
ATOM   7753  N  NE  . ARG D  1 171 ? 48.392  -6.586  2.448    1.00 39.24  ? 170 ARG D NE  1 
ATOM   7754  C  CZ  . ARG D  1 171 ? 49.496  -6.859  3.139    1.00 39.71  ? 170 ARG D CZ  1 
ATOM   7755  N  NH1 . ARG D  1 171 ? 49.660  -6.365  4.360    1.00 39.87  ? 170 ARG D NH1 1 
ATOM   7756  N  NH2 . ARG D  1 171 ? 50.441  -7.625  2.606    1.00 40.47  ? 170 ARG D NH2 1 
ATOM   7757  N  N   . ASN D  1 172 ? 43.524  -10.603 3.557    1.00 45.44  ? 171 ASN D N   1 
ATOM   7758  C  CA  . ASN D  1 172 ? 42.492  -11.412 2.919    1.00 42.47  ? 171 ASN D CA  1 
ATOM   7759  C  C   . ASN D  1 172 ? 41.105  -10.764 2.979    1.00 48.26  ? 171 ASN D C   1 
ATOM   7760  O  O   . ASN D  1 172 ? 40.608  -10.471 4.054    1.00 41.05  ? 171 ASN D O   1 
ATOM   7761  C  CB  . ASN D  1 172 ? 42.436  -12.770 3.617    1.00 52.84  ? 171 ASN D CB  1 
ATOM   7762  C  CG  . ASN D  1 172 ? 41.914  -13.861 2.725    1.00 69.86  ? 171 ASN D CG  1 
ATOM   7763  O  OD1 . ASN D  1 172 ? 40.706  -14.005 2.547    1.00 98.08  ? 171 ASN D OD1 1 
ATOM   7764  N  ND2 . ASN D  1 172 ? 42.822  -14.654 2.168    1.00 53.15  ? 171 ASN D ND2 1 
ATOM   7765  N  N   . GLY D  1 173 ? 40.479  -10.532 1.831    1.00 51.04  ? 172 GLY D N   1 
ATOM   7766  C  CA  . GLY D  1 173 ? 39.123  -10.002 1.823    1.00 42.00  ? 172 GLY D CA  1 
ATOM   7767  C  C   . GLY D  1 173 ? 38.985  -8.494  2.022    1.00 41.37  ? 172 GLY D C   1 
ATOM   7768  O  O   . GLY D  1 173 ? 37.890  -7.944  1.900    1.00 45.65  ? 172 GLY D O   1 
ATOM   7769  N  N   . TRP D  1 174 ? 40.090  -7.817  2.316    1.00 52.73  ? 173 TRP D N   1 
ATOM   7770  C  CA  . TRP D  1 174 ? 40.077  -6.361  2.409    1.00 36.58  ? 173 TRP D CA  1 
ATOM   7771  C  C   . TRP D  1 174 ? 39.654  -5.711  1.098    1.00 43.40  ? 173 TRP D C   1 
ATOM   7772  O  O   . TRP D  1 174 ? 40.066  -6.145  0.023    1.00 42.89  ? 173 TRP D O   1 
ATOM   7773  C  CB  . TRP D  1 174 ? 41.476  -5.826  2.736    1.00 42.59  ? 173 TRP D CB  1 
ATOM   7774  C  CG  . TRP D  1 174 ? 41.959  -6.049  4.134    1.00 42.41  ? 173 TRP D CG  1 
ATOM   7775  C  CD1 . TRP D  1 174 ? 41.578  -7.033  5.008    1.00 49.80  ? 173 TRP D CD1 1 
ATOM   7776  C  CD2 . TRP D  1 174 ? 42.932  -5.257  4.815    1.00 45.06  ? 173 TRP D CD2 1 
ATOM   7777  N  NE1 . TRP D  1 174 ? 42.264  -6.897  6.199    1.00 38.03  ? 173 TRP D NE1 1 
ATOM   7778  C  CE2 . TRP D  1 174 ? 43.098  -5.809  6.101    1.00 41.58  ? 173 TRP D CE2 1 
ATOM   7779  C  CE3 . TRP D  1 174 ? 43.678  -4.122  4.460    1.00 46.70  ? 173 TRP D CE3 1 
ATOM   7780  C  CZ2 . TRP D  1 174 ? 43.982  -5.266  7.033    1.00 45.82  ? 173 TRP D CZ2 1 
ATOM   7781  C  CZ3 . TRP D  1 174 ? 44.552  -3.586  5.384    1.00 41.56  ? 173 TRP D CZ3 1 
ATOM   7782  C  CH2 . TRP D  1 174 ? 44.706  -4.164  6.653    1.00 39.48  ? 173 TRP D CH2 1 
ATOM   7783  N  N   . PRO D  1 175 ? 38.838  -4.650  1.184    1.00 44.96  ? 174 PRO D N   1 
ATOM   7784  C  CA  . PRO D  1 175 ? 38.626  -3.804  0.005    1.00 38.44  ? 174 PRO D CA  1 
ATOM   7785  C  C   . PRO D  1 175 ? 39.939  -3.112  -0.369   1.00 42.48  ? 174 PRO D C   1 
ATOM   7786  O  O   . PRO D  1 175 ? 40.775  -2.893  0.515    1.00 42.77  ? 174 PRO D O   1 
ATOM   7787  C  CB  . PRO D  1 175 ? 37.571  -2.790  0.477    1.00 51.48  ? 174 PRO D CB  1 
ATOM   7788  C  CG  . PRO D  1 175 ? 37.585  -2.860  1.970    1.00 54.39  ? 174 PRO D CG  1 
ATOM   7789  C  CD  . PRO D  1 175 ? 38.007  -4.247  2.331    1.00 43.84  ? 174 PRO D CD  1 
ATOM   7790  N  N   . VAL D  1 176 ? 40.122  -2.805  -1.651   1.00 44.89  ? 175 VAL D N   1 
ATOM   7791  C  CA  . VAL D  1 176 ? 41.352  -2.177  -2.133   1.00 45.69  ? 175 VAL D CA  1 
ATOM   7792  C  C   . VAL D  1 176 ? 41.595  -0.842  -1.447   1.00 47.06  ? 175 VAL D C   1 
ATOM   7793  O  O   . VAL D  1 176 ? 42.720  -0.534  -1.048   1.00 41.36  ? 175 VAL D O   1 
ATOM   7794  C  CB  . VAL D  1 176 ? 41.321  -1.970  -3.656   1.00 42.26  ? 175 VAL D CB  1 
ATOM   7795  C  CG1 . VAL D  1 176 ? 42.676  -1.426  -4.157   1.00 42.52  ? 175 VAL D CG1 1 
ATOM   7796  C  CG2 . VAL D  1 176 ? 40.998  -3.280  -4.343   1.00 67.30  ? 175 VAL D CG2 1 
ATOM   7797  N  N   . GLU D  1 177 ? 40.529  -0.058  -1.301   1.00 44.37  ? 176 GLU D N   1 
ATOM   7798  C  CA  . GLU D  1 177 ? 40.613  1.250   -0.668   1.00 44.35  ? 176 GLU D CA  1 
ATOM   7799  C  C   . GLU D  1 177 ? 41.163  1.158   0.756    1.00 47.92  ? 176 GLU D C   1 
ATOM   7800  O  O   . GLU D  1 177 ? 41.879  2.050   1.219    1.00 45.54  ? 176 GLU D O   1 
ATOM   7801  C  CB  . GLU D  1 177 ? 39.235  1.934   -0.669   1.00 45.54  ? 176 GLU D CB  1 
ATOM   7802  C  CG  . GLU D  1 177 ? 38.618  2.113   -2.060   1.00 67.92  ? 176 GLU D CG  1 
ATOM   7803  C  CD  . GLU D  1 177 ? 38.046  0.823   -2.663   1.00 111.44 ? 176 GLU D CD  1 
ATOM   7804  O  OE1 . GLU D  1 177 ? 37.904  -0.196  -1.938   1.00 56.58  ? 176 GLU D OE1 1 
ATOM   7805  O  OE2 . GLU D  1 177 ? 37.735  0.837   -3.877   1.00 92.27  ? 176 GLU D OE2 1 
ATOM   7806  N  N   . GLN D  1 178 ? 40.838  0.067   1.445    1.00 47.08  ? 177 GLN D N   1 
ATOM   7807  C  CA  . GLN D  1 178 ? 41.349  -0.156  2.791    1.00 37.10  ? 177 GLN D CA  1 
ATOM   7808  C  C   . GLN D  1 178 ? 42.868  -0.353  2.770    1.00 39.72  ? 177 GLN D C   1 
ATOM   7809  O  O   . GLN D  1 178 ? 43.579  0.213   3.596    1.00 46.21  ? 177 GLN D O   1 
ATOM   7810  C  CB  . GLN D  1 178 ? 40.638  -1.346  3.473    1.00 45.76  ? 177 GLN D CB  1 
ATOM   7811  C  CG  . GLN D  1 178 ? 41.072  -1.570  4.908    1.00 48.61  ? 177 GLN D CG  1 
ATOM   7812  C  CD  . GLN D  1 178 ? 40.349  -2.717  5.589    1.00 49.57  ? 177 GLN D CD  1 
ATOM   7813  O  OE1 . GLN D  1 178 ? 39.247  -3.098  5.197    1.00 70.03  ? 177 GLN D OE1 1 
ATOM   7814  N  NE2 . GLN D  1 178 ? 40.971  -3.269  6.619    1.00 49.72  ? 177 GLN D NE2 1 
ATOM   7815  N  N   . VAL D  1 179 ? 43.359  -1.149  1.823    1.00 39.50  ? 178 VAL D N   1 
ATOM   7816  C  CA  . VAL D  1 179 ? 44.793  -1.349  1.673    1.00 43.53  ? 178 VAL D CA  1 
ATOM   7817  C  C   . VAL D  1 179 ? 45.446  0.002   1.351    1.00 43.82  ? 178 VAL D C   1 
ATOM   7818  O  O   . VAL D  1 179 ? 46.473  0.346   1.912    1.00 39.73  ? 178 VAL D O   1 
ATOM   7819  C  CB  . VAL D  1 179 ? 45.123  -2.381  0.564    1.00 38.79  ? 178 VAL D CB  1 
ATOM   7820  C  CG1 . VAL D  1 179 ? 46.635  -2.477  0.335    1.00 36.33  ? 178 VAL D CG1 1 
ATOM   7821  C  CG2 . VAL D  1 179 ? 44.524  -3.749  0.907    1.00 35.07  ? 178 VAL D CG2 1 
ATOM   7822  N  N   . TRP D  1 180 ? 44.815  0.772   0.471    1.00 35.77  ? 179 TRP D N   1 
ATOM   7823  C  CA  . TRP D  1 180 ? 45.311  2.099   0.102    1.00 40.81  ? 179 TRP D CA  1 
ATOM   7824  C  C   . TRP D  1 180 ? 45.425  3.015   1.328    1.00 42.21  ? 179 TRP D C   1 
ATOM   7825  O  O   . TRP D  1 180 ? 46.490  3.566   1.609    1.00 47.13  ? 179 TRP D O   1 
ATOM   7826  C  CB  . TRP D  1 180 ? 44.407  2.715   -0.978   1.00 38.66  ? 179 TRP D CB  1 
ATOM   7827  C  CG  . TRP D  1 180 ? 44.786  4.114   -1.404   1.00 38.60  ? 179 TRP D CG  1 
ATOM   7828  C  CD1 . TRP D  1 180 ? 44.153  5.276   -1.055   1.00 43.43  ? 179 TRP D CD1 1 
ATOM   7829  C  CD2 . TRP D  1 180 ? 45.867  4.488   -2.269   1.00 43.43  ? 179 TRP D CD2 1 
ATOM   7830  N  NE1 . TRP D  1 180 ? 44.781  6.351   -1.646   1.00 41.72  ? 179 TRP D NE1 1 
ATOM   7831  C  CE2 . TRP D  1 180 ? 45.839  5.893   -2.392   1.00 55.07  ? 179 TRP D CE2 1 
ATOM   7832  C  CE3 . TRP D  1 180 ? 46.870  3.769   -2.940   1.00 42.85  ? 179 TRP D CE3 1 
ATOM   7833  C  CZ2 . TRP D  1 180 ? 46.768  6.597   -3.170   1.00 45.51  ? 179 TRP D CZ2 1 
ATOM   7834  C  CZ3 . TRP D  1 180 ? 47.790  4.471   -3.714   1.00 38.71  ? 179 TRP D CZ3 1 
ATOM   7835  C  CH2 . TRP D  1 180 ? 47.731  5.870   -3.817   1.00 46.76  ? 179 TRP D CH2 1 
ATOM   7836  N  N   . LYS D  1 181 ? 44.328  3.156   2.065    1.00 39.17  ? 180 LYS D N   1 
ATOM   7837  C  CA  . LYS D  1 181 ? 44.309  4.014   3.246    1.00 52.20  ? 180 LYS D CA  1 
ATOM   7838  C  C   . LYS D  1 181 ? 45.317  3.582   4.318    1.00 43.60  ? 180 LYS D C   1 
ATOM   7839  O  O   . LYS D  1 181 ? 46.030  4.417   4.875    1.00 42.03  ? 180 LYS D O   1 
ATOM   7840  C  CB  . LYS D  1 181 ? 42.899  4.068   3.841    1.00 49.34  ? 180 LYS D CB  1 
ATOM   7841  C  CG  . LYS D  1 181 ? 42.622  5.309   4.666    1.00 78.64  ? 180 LYS D CG  1 
ATOM   7842  C  CD  . LYS D  1 181 ? 41.315  5.183   5.446    1.00 83.63  ? 180 LYS D CD  1 
ATOM   7843  C  CE  . LYS D  1 181 ? 40.183  4.671   4.566    1.00 75.28  ? 180 LYS D CE  1 
ATOM   7844  N  NZ  . LYS D  1 181 ? 40.010  5.488   3.332    1.00 66.35  ? 180 LYS D NZ  1 
ATOM   7845  N  N   . GLU D  1 182 ? 45.369  2.282   4.604    1.00 45.20  ? 181 GLU D N   1 
ATOM   7846  C  CA  . GLU D  1 182 ? 46.261  1.735   5.638    1.00 44.83  ? 181 GLU D CA  1 
ATOM   7847  C  C   . GLU D  1 182 ? 47.744  1.829   5.275    1.00 44.62  ? 181 GLU D C   1 
ATOM   7848  O  O   . GLU D  1 182 ? 48.596  2.065   6.135    1.00 41.22  ? 181 GLU D O   1 
ATOM   7849  C  CB  . GLU D  1 182 ? 45.905  0.276   5.930    1.00 44.45  ? 181 GLU D CB  1 
ATOM   7850  C  CG  . GLU D  1 182 ? 44.566  0.094   6.633    1.00 53.92  ? 181 GLU D CG  1 
ATOM   7851  C  CD  . GLU D  1 182 ? 44.587  0.620   8.053    1.00 65.44  ? 181 GLU D CD  1 
ATOM   7852  O  OE1 . GLU D  1 182 ? 43.593  1.253   8.475    1.00 67.18  ? 181 GLU D OE1 1 
ATOM   7853  O  OE2 . GLU D  1 182 ? 45.604  0.393   8.743    1.00 53.43  ? 181 GLU D OE2 1 
HETATM 7854  N  N   . MSE D  1 183 ? 48.051  1.619   4.003    1.00 39.90  ? 182 MSE D N   1 
HETATM 7855  C  CA  . MSE D  1 183 ? 49.419  1.750   3.519    1.00 42.40  ? 182 MSE D CA  1 
HETATM 7856  C  C   . MSE D  1 183 ? 49.943  3.160   3.794    1.00 42.54  ? 182 MSE D C   1 
HETATM 7857  O  O   . MSE D  1 183 ? 51.113  3.352   4.109    1.00 38.42  ? 182 MSE D O   1 
HETATM 7858  C  CB  . MSE D  1 183 ? 49.483  1.447   2.022    1.00 31.56  ? 182 MSE D CB  1 
HETATM 7859  C  CG  . MSE D  1 183 ? 50.852  1.645   1.392    1.00 38.08  ? 182 MSE D CG  1 
HETATM 7860  SE SE  . MSE D  1 183 ? 50.857  1.010   -0.441   0.63 34.74  ? 182 MSE D SE  1 
HETATM 7861  C  CE  . MSE D  1 183 ? 49.501  2.209   -1.193   1.00 31.94  ? 182 MSE D CE  1 
ATOM   7862  N  N   . HIS D  1 184 ? 49.066  4.150   3.684    1.00 38.54  ? 183 HIS D N   1 
ATOM   7863  C  CA  . HIS D  1 184 ? 49.512  5.532   3.823    1.00 42.79  ? 183 HIS D CA  1 
ATOM   7864  C  C   . HIS D  1 184 ? 49.831  5.912   5.267    1.00 45.17  ? 183 HIS D C   1 
ATOM   7865  O  O   . HIS D  1 184 ? 50.638  6.812   5.506    1.00 45.20  ? 183 HIS D O   1 
ATOM   7866  C  CB  . HIS D  1 184 ? 48.539  6.507   3.152    1.00 40.72  ? 183 HIS D CB  1 
ATOM   7867  C  CG  . HIS D  1 184 ? 48.688  6.547   1.664    1.00 41.51  ? 183 HIS D CG  1 
ATOM   7868  N  ND1 . HIS D  1 184 ? 48.251  5.527   0.846    1.00 43.29  ? 183 HIS D ND1 1 
ATOM   7869  C  CD2 . HIS D  1 184 ? 49.274  7.456   0.850    1.00 43.98  ? 183 HIS D CD2 1 
ATOM   7870  C  CE1 . HIS D  1 184 ? 48.546  5.812   -0.410   1.00 42.79  ? 183 HIS D CE1 1 
ATOM   7871  N  NE2 . HIS D  1 184 ? 49.168  6.978   -0.436   1.00 41.87  ? 183 HIS D NE2 1 
ATOM   7872  N  N   . LYS D  1 185 ? 49.231  5.200   6.221    1.00 51.07  ? 184 LYS D N   1 
ATOM   7873  C  CA  . LYS D  1 185 ? 49.524  5.410   7.639    1.00 58.11  ? 184 LYS D CA  1 
ATOM   7874  C  C   . LYS D  1 185 ? 50.978  5.070   7.964    1.00 59.39  ? 184 LYS D C   1 
ATOM   7875  O  O   . LYS D  1 185 ? 51.475  5.421   9.029    1.00 57.52  ? 184 LYS D O   1 
ATOM   7876  C  CB  . LYS D  1 185 ? 48.594  4.572   8.528    1.00 53.22  ? 184 LYS D CB  1 
ATOM   7877  C  CG  . LYS D  1 185 ? 47.108  4.900   8.400    1.00 48.40  ? 184 LYS D CG  1 
ATOM   7878  C  CD  . LYS D  1 185 ? 46.276  4.047   9.365    1.00 62.52  ? 184 LYS D CD  1 
ATOM   7879  C  CE  . LYS D  1 185 ? 44.782  4.201   9.115    1.00 48.02  ? 184 LYS D CE  1 
ATOM   7880  N  NZ  . LYS D  1 185 ? 43.950  3.468   10.120   1.00 60.52  ? 184 LYS D NZ  1 
ATOM   7881  N  N   . LEU D  1 186 ? 51.650  4.378   7.048    1.00 55.23  ? 185 LEU D N   1 
ATOM   7882  C  CA  . LEU D  1 186 ? 53.052  4.025   7.232    1.00 47.92  ? 185 LEU D CA  1 
ATOM   7883  C  C   . LEU D  1 186 ? 54.015  5.075   6.660    1.00 71.26  ? 185 LEU D C   1 
ATOM   7884  O  O   . LEU D  1 186 ? 55.234  4.952   6.810    1.00 46.02  ? 185 LEU D O   1 
ATOM   7885  C  CB  . LEU D  1 186 ? 53.347  2.674   6.586    1.00 43.78  ? 185 LEU D CB  1 
ATOM   7886  C  CG  . LEU D  1 186 ? 52.444  1.485   6.924    1.00 50.12  ? 185 LEU D CG  1 
ATOM   7887  C  CD1 . LEU D  1 186 ? 52.915  0.275   6.139    1.00 40.60  ? 185 LEU D CD1 1 
ATOM   7888  C  CD2 . LEU D  1 186 ? 52.433  1.199   8.414    1.00 64.88  ? 185 LEU D CD2 1 
ATOM   7889  N  N   . LEU D  1 187 ? 53.476  6.097   5.997    1.00 60.05  ? 186 LEU D N   1 
ATOM   7890  C  CA  . LEU D  1 187 ? 54.311  7.145   5.404    1.00 54.23  ? 186 LEU D CA  1 
ATOM   7891  C  C   . LEU D  1 187 ? 54.428  8.356   6.323    1.00 62.90  ? 186 LEU D C   1 
ATOM   7892  O  O   . LEU D  1 187 ? 53.510  8.645   7.085    1.00 52.18  ? 186 LEU D O   1 
ATOM   7893  C  CB  . LEU D  1 187 ? 53.750  7.570   4.046    1.00 55.29  ? 186 LEU D CB  1 
ATOM   7894  C  CG  . LEU D  1 187 ? 53.762  6.486   2.970    1.00 53.56  ? 186 LEU D CG  1 
ATOM   7895  C  CD1 . LEU D  1 187 ? 52.959  6.929   1.755    1.00 46.98  ? 186 LEU D CD1 1 
ATOM   7896  C  CD2 . LEU D  1 187 ? 55.196  6.131   2.586    1.00 47.73  ? 186 LEU D CD2 1 
ATOM   7897  N  N   . PRO D  1 188 ? 55.556  9.086   6.248    1.00 56.27  ? 187 PRO D N   1 
ATOM   7898  C  CA  . PRO D  1 188 ? 56.703  8.849   5.370    1.00 55.76  ? 187 PRO D CA  1 
ATOM   7899  C  C   . PRO D  1 188 ? 57.774  8.017   6.068    1.00 59.34  ? 187 PRO D C   1 
ATOM   7900  O  O   . PRO D  1 188 ? 57.655  7.755   7.261    1.00 49.66  ? 187 PRO D O   1 
ATOM   7901  C  CB  . PRO D  1 188 ? 57.226  10.262  5.132    1.00 58.71  ? 187 PRO D CB  1 
ATOM   7902  C  CG  . PRO D  1 188 ? 56.970  10.957  6.438    1.00 57.60  ? 187 PRO D CG  1 
ATOM   7903  C  CD  . PRO D  1 188 ? 55.716  10.329  7.026    1.00 60.76  ? 187 PRO D CD  1 
ATOM   7904  N  N   . PHE D  1 189 ? 58.782  7.584   5.316    1.00 51.24  ? 188 PHE D N   1 
ATOM   7905  C  CA  . PHE D  1 189 ? 60.017  7.046   5.881    1.00 44.40  ? 188 PHE D CA  1 
ATOM   7906  C  C   . PHE D  1 189 ? 61.147  7.495   4.963    1.00 44.79  ? 188 PHE D C   1 
ATOM   7907  O  O   . PHE D  1 189 ? 60.901  7.807   3.805    1.00 42.60  ? 188 PHE D O   1 
ATOM   7908  C  CB  . PHE D  1 189 ? 59.983  5.517   5.995    1.00 42.82  ? 188 PHE D CB  1 
ATOM   7909  C  CG  . PHE D  1 189 ? 59.661  4.804   4.701    1.00 50.65  ? 188 PHE D CG  1 
ATOM   7910  C  CD1 . PHE D  1 189 ? 60.663  4.481   3.792    1.00 41.34  ? 188 PHE D CD1 1 
ATOM   7911  C  CD2 . PHE D  1 189 ? 58.356  4.434   4.404    1.00 51.69  ? 188 PHE D CD2 1 
ATOM   7912  C  CE1 . PHE D  1 189 ? 60.372  3.816   2.606    1.00 50.11  ? 188 PHE D CE1 1 
ATOM   7913  C  CE2 . PHE D  1 189 ? 58.055  3.773   3.216    1.00 37.72  ? 188 PHE D CE2 1 
ATOM   7914  C  CZ  . PHE D  1 189 ? 59.062  3.455   2.318    1.00 43.50  ? 188 PHE D CZ  1 
ATOM   7915  N  N   . SER D  1 190 ? 62.375  7.539   5.472    1.00 48.48  ? 189 SER D N   1 
ATOM   7916  C  CA  . SER D  1 190 ? 63.519  7.921   4.645    1.00 53.44  ? 189 SER D CA  1 
ATOM   7917  C  C   . SER D  1 190 ? 63.866  6.793   3.691    1.00 43.54  ? 189 SER D C   1 
ATOM   7918  O  O   . SER D  1 190 ? 64.065  5.656   4.115    1.00 51.69  ? 189 SER D O   1 
ATOM   7919  C  CB  . SER D  1 190 ? 64.742  8.251   5.507    1.00 53.69  ? 189 SER D CB  1 
ATOM   7920  O  OG  . SER D  1 190 ? 64.392  9.072   6.607    1.00 72.41  ? 189 SER D OG  1 
ATOM   7921  N  N   . PRO D  1 191 ? 63.936  7.100   2.389    1.00 42.36  ? 190 PRO D N   1 
ATOM   7922  C  CA  . PRO D  1 191 ? 64.279  6.043   1.437    1.00 42.29  ? 190 PRO D CA  1 
ATOM   7923  C  C   . PRO D  1 191 ? 65.750  5.671   1.579    1.00 53.29  ? 190 PRO D C   1 
ATOM   7924  O  O   . PRO D  1 191 ? 66.576  6.530   1.895    1.00 49.25  ? 190 PRO D O   1 
ATOM   7925  C  CB  . PRO D  1 191 ? 64.029  6.699   0.068    1.00 51.17  ? 190 PRO D CB  1 
ATOM   7926  C  CG  . PRO D  1 191 ? 63.215  7.937   0.355    1.00 62.05  ? 190 PRO D CG  1 
ATOM   7927  C  CD  . PRO D  1 191 ? 63.630  8.376   1.721    1.00 53.77  ? 190 PRO D CD  1 
ATOM   7928  N  N   . ASP D  1 192 ? 66.052  4.397   1.366    1.00 42.82  ? 191 ASP D N   1 
ATOM   7929  C  CA  . ASP D  1 192 ? 67.418  3.896   1.318    1.00 38.99  ? 191 ASP D CA  1 
ATOM   7930  C  C   . ASP D  1 192 ? 67.551  3.360   -0.094   1.00 38.16  ? 191 ASP D C   1 
ATOM   7931  O  O   . ASP D  1 192 ? 67.333  2.173   -0.345   1.00 38.21  ? 191 ASP D O   1 
ATOM   7932  C  CB  . ASP D  1 192 ? 67.571  2.756   2.323    1.00 44.56  ? 191 ASP D CB  1 
ATOM   7933  C  CG  . ASP D  1 192 ? 69.001  2.308   2.487    1.00 58.96  ? 191 ASP D CG  1 
ATOM   7934  O  OD1 . ASP D  1 192 ? 69.872  2.820   1.756    1.00 48.73  ? 191 ASP D OD1 1 
ATOM   7935  O  OD2 . ASP D  1 192 ? 69.249  1.427   3.342    1.00 50.89  ? 191 ASP D OD2 1 
ATOM   7936  N  N   . SER D  1 193 ? 67.874  4.251   -1.027   1.00 35.98  ? 192 SER D N   1 
ATOM   7937  C  CA  . SER D  1 193 ? 67.713  3.959   -2.448   1.00 32.34  ? 192 SER D CA  1 
ATOM   7938  C  C   . SER D  1 193 ? 68.841  3.104   -3.026   1.00 34.75  ? 192 SER D C   1 
ATOM   7939  O  O   . SER D  1 193 ? 70.018  3.381   -2.795   1.00 35.20  ? 192 SER D O   1 
ATOM   7940  C  CB  . SER D  1 193 ? 67.601  5.273   -3.222   1.00 39.71  ? 192 SER D CB  1 
ATOM   7941  O  OG  . SER D  1 193 ? 66.519  6.035   -2.716   1.00 43.06  ? 192 SER D OG  1 
ATOM   7942  N  N   . VAL D  1 194 ? 68.467  2.065   -3.771   1.00 33.05  ? 193 VAL D N   1 
ATOM   7943  C  CA  . VAL D  1 194 ? 69.429  1.222   -4.482   1.00 30.36  ? 193 VAL D CA  1 
ATOM   7944  C  C   . VAL D  1 194 ? 68.837  0.853   -5.839   1.00 37.69  ? 193 VAL D C   1 
ATOM   7945  O  O   . VAL D  1 194 ? 67.666  1.150   -6.118   1.00 36.55  ? 193 VAL D O   1 
ATOM   7946  C  CB  . VAL D  1 194 ? 69.747  -0.072  -3.697   1.00 28.96  ? 193 VAL D CB  1 
ATOM   7947  C  CG1 . VAL D  1 194 ? 70.312  0.242   -2.314   1.00 33.20  ? 193 VAL D CG1 1 
ATOM   7948  C  CG2 . VAL D  1 194 ? 68.500  -0.944  -3.565   1.00 34.58  ? 193 VAL D CG2 1 
ATOM   7949  N  N   . VAL D  1 195 ? 69.631  0.207   -6.689   1.00 31.84  ? 194 VAL D N   1 
ATOM   7950  C  CA  . VAL D  1 195 ? 69.091  -0.355  -7.922   1.00 36.69  ? 194 VAL D CA  1 
ATOM   7951  C  C   . VAL D  1 195 ? 68.251  -1.577  -7.570   1.00 34.29  ? 194 VAL D C   1 
ATOM   7952  O  O   . VAL D  1 195 ? 68.776  -2.543  -7.026   1.00 34.13  ? 194 VAL D O   1 
ATOM   7953  C  CB  . VAL D  1 195 ? 70.200  -0.790  -8.908   1.00 35.91  ? 194 VAL D CB  1 
ATOM   7954  C  CG1 . VAL D  1 195 ? 69.575  -1.468  -10.117  1.00 36.91  ? 194 VAL D CG1 1 
ATOM   7955  C  CG2 . VAL D  1 195 ? 71.031  0.409   -9.360   1.00 32.07  ? 194 VAL D CG2 1 
ATOM   7956  N  N   . THR D  1 196 ? 66.949  -1.539  -7.859   1.00 35.32  ? 195 THR D N   1 
ATOM   7957  C  CA  . THR D  1 196 ? 66.088  -2.682  -7.539   1.00 35.93  ? 195 THR D CA  1 
ATOM   7958  C  C   . THR D  1 196 ? 65.552  -3.388  -8.770   1.00 32.93  ? 195 THR D C   1 
ATOM   7959  O  O   . THR D  1 196 ? 65.442  -2.790  -9.838   1.00 31.95  ? 195 THR D O   1 
ATOM   7960  C  CB  . THR D  1 196 ? 64.869  -2.284  -6.665   1.00 40.46  ? 195 THR D CB  1 
ATOM   7961  O  OG1 . THR D  1 196 ? 64.027  -1.372  -7.389   1.00 37.89  ? 195 THR D OG1 1 
ATOM   7962  C  CG2 . THR D  1 196 ? 65.326  -1.658  -5.362   1.00 39.16  ? 195 THR D CG2 1 
ATOM   7963  N  N   . HIS D  1 197 ? 65.211  -4.664  -8.600   1.00 32.66  ? 196 HIS D N   1 
ATOM   7964  C  CA  . HIS D  1 197 ? 64.646  -5.488  -9.668   1.00 32.64  ? 196 HIS D CA  1 
ATOM   7965  C  C   . HIS D  1 197 ? 63.166  -5.151  -9.867   1.00 34.93  ? 196 HIS D C   1 
ATOM   7966  O  O   . HIS D  1 197 ? 62.683  -5.066  -11.002  1.00 37.47  ? 196 HIS D O   1 
ATOM   7967  C  CB  . HIS D  1 197 ? 64.792  -6.977  -9.299   1.00 30.49  ? 196 HIS D CB  1 
ATOM   7968  C  CG  . HIS D  1 197 ? 64.199  -7.918  -10.302  1.00 34.61  ? 196 HIS D CG  1 
ATOM   7969  N  ND1 . HIS D  1 197 ? 62.848  -8.170  -10.380  1.00 34.76  ? 196 HIS D ND1 1 
ATOM   7970  C  CD2 . HIS D  1 197 ? 64.777  -8.668  -11.270  1.00 31.35  ? 196 HIS D CD2 1 
ATOM   7971  C  CE1 . HIS D  1 197 ? 62.617  -9.044  -11.343  1.00 38.71  ? 196 HIS D CE1 1 
ATOM   7972  N  NE2 . HIS D  1 197 ? 63.770  -9.355  -11.909  1.00 38.95  ? 196 HIS D NE2 1 
ATOM   7973  N  N   . GLY D  1 198 ? 62.444  -4.966  -8.760   1.00 32.67  ? 197 GLY D N   1 
ATOM   7974  C  CA  . GLY D  1 198 ? 61.045  -4.566  -8.832   1.00 35.54  ? 197 GLY D CA  1 
ATOM   7975  C  C   . GLY D  1 198 ? 60.022  -5.690  -8.736   1.00 40.78  ? 197 GLY D C   1 
ATOM   7976  O  O   . GLY D  1 198 ? 58.868  -5.449  -8.374   1.00 37.84  ? 197 GLY D O   1 
ATOM   7977  N  N   . ASP D  1 199 ? 60.426  -6.911  -9.081   1.00 31.95  ? 198 ASP D N   1 
ATOM   7978  C  CA  . ASP D  1 199 ? 59.583  -8.099  -8.834   1.00 28.21  ? 198 ASP D CA  1 
ATOM   7979  C  C   . ASP D  1 199 ? 60.468  -9.292  -8.482   1.00 36.22  ? 198 ASP D C   1 
ATOM   7980  O  O   . ASP D  1 199 ? 60.495  -10.307 -9.199   1.00 33.75  ? 198 ASP D O   1 
ATOM   7981  C  CB  . ASP D  1 199 ? 58.704  -8.418  -10.052  1.00 30.97  ? 198 ASP D CB  1 
ATOM   7982  C  CG  . ASP D  1 199 ? 57.569  -9.383  -9.721   1.00 58.33  ? 198 ASP D CG  1 
ATOM   7983  O  OD1 . ASP D  1 199 ? 57.492  -9.837  -8.563   1.00 38.85  ? 198 ASP D OD1 1 
ATOM   7984  O  OD2 . ASP D  1 199 ? 56.757  -9.699  -10.616  1.00 50.92  ? 198 ASP D OD2 1 
ATOM   7985  N  N   . PHE D  1 200 ? 61.182  -9.157  -7.367   1.00 36.63  ? 199 PHE D N   1 
ATOM   7986  C  CA  . PHE D  1 200 ? 62.214  -10.112 -6.971   1.00 37.56  ? 199 PHE D CA  1 
ATOM   7987  C  C   . PHE D  1 200 ? 61.576  -11.294 -6.257   1.00 32.90  ? 199 PHE D C   1 
ATOM   7988  O  O   . PHE D  1 200 ? 61.832  -11.542 -5.078   1.00 35.54  ? 199 PHE D O   1 
ATOM   7989  C  CB  . PHE D  1 200 ? 63.228  -9.433  -6.052   1.00 34.29  ? 199 PHE D CB  1 
ATOM   7990  C  CG  . PHE D  1 200 ? 64.591  -10.081 -6.065   1.00 38.59  ? 199 PHE D CG  1 
ATOM   7991  C  CD1 . PHE D  1 200 ? 65.438  -9.909  -7.151   1.00 37.96  ? 199 PHE D CD1 1 
ATOM   7992  C  CD2 . PHE D  1 200 ? 65.027  -10.844 -4.994   1.00 48.45  ? 199 PHE D CD2 1 
ATOM   7993  C  CE1 . PHE D  1 200 ? 66.700  -10.501 -7.172   1.00 36.95  ? 199 PHE D CE1 1 
ATOM   7994  C  CE2 . PHE D  1 200 ? 66.292  -11.433 -5.000   1.00 41.30  ? 199 PHE D CE2 1 
ATOM   7995  C  CZ  . PHE D  1 200 ? 67.124  -11.266 -6.090   1.00 43.39  ? 199 PHE D CZ  1 
ATOM   7996  N  N   . SER D  1 201 ? 60.726  -12.001 -6.989   1.00 34.28  ? 200 SER D N   1 
ATOM   7997  C  CA  . SER D  1 201 ? 60.041  -13.170 -6.477   1.00 36.35  ? 200 SER D CA  1 
ATOM   7998  C  C   . SER D  1 201 ? 60.828  -14.442 -6.795   1.00 38.49  ? 200 SER D C   1 
ATOM   7999  O  O   . SER D  1 201 ? 61.823  -14.411 -7.530   1.00 45.77  ? 200 SER D O   1 
ATOM   8000  C  CB  . SER D  1 201 ? 58.648  -13.259 -7.095   1.00 42.93  ? 200 SER D CB  1 
ATOM   8001  O  OG  . SER D  1 201 ? 58.748  -13.525 -8.484   1.00 43.14  ? 200 SER D OG  1 
ATOM   8002  N  N   . LEU D  1 202 ? 60.377  -15.569 -6.251   1.00 34.27  ? 201 LEU D N   1 
ATOM   8003  C  CA  . LEU D  1 202 ? 61.033  -16.845 -6.527   1.00 36.99  ? 201 LEU D CA  1 
ATOM   8004  C  C   . LEU D  1 202 ? 60.841  -17.276 -7.982   1.00 39.94  ? 201 LEU D C   1 
ATOM   8005  O  O   . LEU D  1 202 ? 61.615  -18.081 -8.500   1.00 40.88  ? 201 LEU D O   1 
ATOM   8006  C  CB  . LEU D  1 202 ? 60.517  -17.934 -5.570   1.00 38.73  ? 201 LEU D CB  1 
ATOM   8007  C  CG  . LEU D  1 202 ? 60.845  -17.689 -4.093   1.00 40.70  ? 201 LEU D CG  1 
ATOM   8008  C  CD1 . LEU D  1 202 ? 60.086  -18.686 -3.205   1.00 44.66  ? 201 LEU D CD1 1 
ATOM   8009  C  CD2 . LEU D  1 202 ? 62.346  -17.778 -3.850   1.00 38.61  ? 201 LEU D CD2 1 
ATOM   8010  N  N   . ASP D  1 203 ? 59.824  -16.730 -8.647   1.00 38.91  ? 202 ASP D N   1 
ATOM   8011  C  CA  . ASP D  1 203 ? 59.563  -17.089 -10.042  1.00 41.67  ? 202 ASP D CA  1 
ATOM   8012  C  C   . ASP D  1 203 ? 60.569  -16.461 -11.012  1.00 47.59  ? 202 ASP D C   1 
ATOM   8013  O  O   . ASP D  1 203 ? 60.681  -16.898 -12.154  1.00 44.14  ? 202 ASP D O   1 
ATOM   8014  C  CB  . ASP D  1 203 ? 58.151  -16.681 -10.463  1.00 43.47  ? 202 ASP D CB  1 
ATOM   8015  C  CG  . ASP D  1 203 ? 57.066  -17.418 -9.687   1.00 61.59  ? 202 ASP D CG  1 
ATOM   8016  O  OD1 . ASP D  1 203 ? 57.147  -18.662 -9.554   1.00 48.64  ? 202 ASP D OD1 1 
ATOM   8017  O  OD2 . ASP D  1 203 ? 56.130  -16.745 -9.206   1.00 67.67  ? 202 ASP D OD2 1 
ATOM   8018  N  N   . ASN D  1 204 ? 61.291  -15.443 -10.556  1.00 41.05  ? 203 ASN D N   1 
ATOM   8019  C  CA  . ASN D  1 204 ? 62.107  -14.621 -11.457  1.00 41.44  ? 203 ASN D CA  1 
ATOM   8020  C  C   . ASN D  1 204 ? 63.628  -14.810 -11.331  1.00 41.16  ? 203 ASN D C   1 
ATOM   8021  O  O   . ASN D  1 204 ? 64.414  -14.082 -11.934  1.00 43.46  ? 203 ASN D O   1 
ATOM   8022  C  CB  . ASN D  1 204 ? 61.704  -13.143 -11.326  1.00 40.62  ? 203 ASN D CB  1 
ATOM   8023  C  CG  . ASN D  1 204 ? 60.316  -12.869 -11.903  1.00 35.50  ? 203 ASN D CG  1 
ATOM   8024  O  OD1 . ASN D  1 204 ? 59.853  -13.602 -12.786  1.00 45.28  ? 203 ASN D OD1 1 
ATOM   8025  N  ND2 . ASN D  1 204 ? 59.653  -11.812 -11.418  1.00 35.61  ? 203 ASN D ND2 1 
ATOM   8026  N  N   . LEU D  1 205 ? 64.035  -15.812 -10.562  1.00 38.02  ? 204 LEU D N   1 
ATOM   8027  C  CA  . LEU D  1 205 ? 65.447  -16.103 -10.363  1.00 38.04  ? 204 LEU D CA  1 
ATOM   8028  C  C   . LEU D  1 205 ? 65.716  -17.534 -10.801  1.00 45.67  ? 204 LEU D C   1 
ATOM   8029  O  O   . LEU D  1 205 ? 64.958  -18.435 -10.466  1.00 44.83  ? 204 LEU D O   1 
ATOM   8030  C  CB  . LEU D  1 205 ? 65.809  -15.886 -8.895   1.00 43.16  ? 204 LEU D CB  1 
ATOM   8031  C  CG  . LEU D  1 205 ? 65.653  -14.412 -8.509   1.00 49.69  ? 204 LEU D CG  1 
ATOM   8032  C  CD1 . LEU D  1 205 ? 65.347  -14.224 -7.037   1.00 64.38  ? 204 LEU D CD1 1 
ATOM   8033  C  CD2 . LEU D  1 205 ? 66.917  -13.655 -8.904   1.00 52.56  ? 204 LEU D CD2 1 
ATOM   8034  N  N   . ILE D  1 206 ? 66.781  -17.743 -11.567  1.00 42.18  ? 205 ILE D N   1 
ATOM   8035  C  CA  . ILE D  1 206 ? 67.016  -19.038 -12.204  1.00 44.63  ? 205 ILE D CA  1 
ATOM   8036  C  C   . ILE D  1 206 ? 68.266  -19.733 -11.681  1.00 47.92  ? 205 ILE D C   1 
ATOM   8037  O  O   . ILE D  1 206 ? 69.358  -19.162 -11.688  1.00 45.03  ? 205 ILE D O   1 
ATOM   8038  C  CB  . ILE D  1 206 ? 67.122  -18.899 -13.749  1.00 42.11  ? 205 ILE D CB  1 
ATOM   8039  C  CG1 . ILE D  1 206 ? 65.981  -18.025 -14.281  1.00 44.88  ? 205 ILE D CG1 1 
ATOM   8040  C  CG2 . ILE D  1 206 ? 67.141  -20.267 -14.428  1.00 46.15  ? 205 ILE D CG2 1 
ATOM   8041  C  CD1 . ILE D  1 206 ? 64.585  -18.581 -13.968  1.00 54.61  ? 205 ILE D CD1 1 
ATOM   8042  N  N   . PHE D  1 207 ? 68.076  -20.966 -11.221  1.00 48.20  ? 206 PHE D N   1 
ATOM   8043  C  CA  . PHE D  1 207 ? 69.156  -21.846 -10.786  1.00 50.63  ? 206 PHE D CA  1 
ATOM   8044  C  C   . PHE D  1 207 ? 69.413  -22.894 -11.845  1.00 58.88  ? 206 PHE D C   1 
ATOM   8045  O  O   . PHE D  1 207 ? 68.478  -23.459 -12.417  1.00 53.38  ? 206 PHE D O   1 
ATOM   8046  C  CB  . PHE D  1 207 ? 68.782  -22.582 -9.486   1.00 40.09  ? 206 PHE D CB  1 
ATOM   8047  C  CG  . PHE D  1 207 ? 68.857  -21.725 -8.260   1.00 53.73  ? 206 PHE D CG  1 
ATOM   8048  C  CD1 . PHE D  1 207 ? 67.859  -20.808 -7.980   1.00 51.48  ? 206 PHE D CD1 1 
ATOM   8049  C  CD2 . PHE D  1 207 ? 69.928  -21.835 -7.390   1.00 50.03  ? 206 PHE D CD2 1 
ATOM   8050  C  CE1 . PHE D  1 207 ? 67.931  -20.007 -6.859   1.00 57.92  ? 206 PHE D CE1 1 
ATOM   8051  C  CE2 . PHE D  1 207 ? 70.004  -21.044 -6.266   1.00 59.86  ? 206 PHE D CE2 1 
ATOM   8052  C  CZ  . PHE D  1 207 ? 69.005  -20.120 -6.002   1.00 48.55  ? 206 PHE D CZ  1 
ATOM   8053  N  N   . ASP D  1 208 ? 70.685  -23.167 -12.089  1.00 52.06  ? 207 ASP D N   1 
ATOM   8054  C  CA  . ASP D  1 208 ? 71.059  -24.252 -12.979  1.00 61.73  ? 207 ASP D CA  1 
ATOM   8055  C  C   . ASP D  1 208 ? 72.267  -24.959 -12.396  1.00 64.52  ? 207 ASP D C   1 
ATOM   8056  O  O   . ASP D  1 208 ? 73.245  -24.314 -12.016  1.00 61.76  ? 207 ASP D O   1 
ATOM   8057  C  CB  . ASP D  1 208 ? 71.370  -23.726 -14.376  1.00 48.90  ? 207 ASP D CB  1 
ATOM   8058  C  CG  . ASP D  1 208 ? 71.555  -24.837 -15.386  1.00 68.63  ? 207 ASP D CG  1 
ATOM   8059  O  OD1 . ASP D  1 208 ? 70.982  -25.929 -15.181  1.00 80.81  ? 207 ASP D OD1 1 
ATOM   8060  O  OD2 . ASP D  1 208 ? 72.270  -24.613 -16.384  1.00 99.65  ? 207 ASP D OD2 1 
ATOM   8061  N  N   . GLU D  1 209 ? 72.175  -26.281 -12.315  1.00 63.14  ? 208 GLU D N   1 
ATOM   8062  C  CA  . GLU D  1 209 ? 73.237  -27.116 -11.757  1.00 95.88  ? 208 GLU D CA  1 
ATOM   8063  C  C   . GLU D  1 209 ? 73.731  -26.597 -10.402  1.00 101.28 ? 208 GLU D C   1 
ATOM   8064  O  O   . GLU D  1 209 ? 74.932  -26.588 -10.133  1.00 86.12  ? 208 GLU D O   1 
ATOM   8065  C  CB  . GLU D  1 209 ? 74.407  -27.250 -12.745  1.00 91.85  ? 208 GLU D CB  1 
ATOM   8066  C  CG  . GLU D  1 209 ? 74.002  -27.517 -14.202  1.00 97.30  ? 208 GLU D CG  1 
ATOM   8067  C  CD  . GLU D  1 209 ? 73.191  -28.797 -14.391  1.00 109.19 ? 208 GLU D CD  1 
ATOM   8068  O  OE1 . GLU D  1 209 ? 73.694  -29.891 -14.052  1.00 111.17 ? 208 GLU D OE1 1 
ATOM   8069  O  OE2 . GLU D  1 209 ? 72.047  -28.708 -14.889  1.00 115.25 ? 208 GLU D OE2 1 
ATOM   8070  N  N   . GLY D  1 210 ? 72.801  -26.140 -9.566   1.00 99.47  ? 209 GLY D N   1 
ATOM   8071  C  CA  . GLY D  1 210 ? 73.119  -25.767 -8.199   1.00 77.88  ? 209 GLY D CA  1 
ATOM   8072  C  C   . GLY D  1 210 ? 73.393  -24.302 -7.909   1.00 85.33  ? 209 GLY D C   1 
ATOM   8073  O  O   . GLY D  1 210 ? 73.392  -23.896 -6.747   1.00 84.12  ? 209 GLY D O   1 
ATOM   8074  N  N   . LYS D  1 211 ? 73.626  -23.500 -8.945   1.00 59.40  ? 210 LYS D N   1 
ATOM   8075  C  CA  . LYS D  1 211 ? 73.987  -22.103 -8.738   1.00 60.00  ? 210 LYS D CA  1 
ATOM   8076  C  C   . LYS D  1 211 ? 72.982  -21.137 -9.355   1.00 63.52  ? 210 LYS D C   1 
ATOM   8077  O  O   . LYS D  1 211 ? 72.269  -21.482 -10.297  1.00 55.18  ? 210 LYS D O   1 
ATOM   8078  C  CB  . LYS D  1 211 ? 75.393  -21.824 -9.275   1.00 74.83  ? 210 LYS D CB  1 
ATOM   8079  C  CG  . LYS D  1 211 ? 76.474  -22.651 -8.591   1.00 53.91  ? 210 LYS D CG  1 
ATOM   8080  C  CD  . LYS D  1 211 ? 77.863  -22.267 -9.069   1.00 80.59  ? 210 LYS D CD  1 
ATOM   8081  C  CE  . LYS D  1 211 ? 78.928  -23.075 -8.334   1.00 87.36  ? 210 LYS D CE  1 
ATOM   8082  N  NZ  . LYS D  1 211 ? 78.818  -22.906 -6.855   1.00 93.81  ? 210 LYS D NZ  1 
ATOM   8083  N  N   . LEU D  1 212 ? 72.937  -19.924 -8.813   1.00 47.01  ? 211 LEU D N   1 
ATOM   8084  C  CA  . LEU D  1 212 ? 71.984  -18.918 -9.258   1.00 51.04  ? 211 LEU D CA  1 
ATOM   8085  C  C   . LEU D  1 212 ? 72.574  -18.159 -10.439  1.00 56.74  ? 211 LEU D C   1 
ATOM   8086  O  O   . LEU D  1 212 ? 73.421  -17.285 -10.265  1.00 62.62  ? 211 LEU D O   1 
ATOM   8087  C  CB  . LEU D  1 212 ? 71.643  -17.971 -8.099   1.00 53.96  ? 211 LEU D CB  1 
ATOM   8088  C  CG  . LEU D  1 212 ? 70.541  -16.926 -8.271   1.00 63.17  ? 211 LEU D CG  1 
ATOM   8089  C  CD1 . LEU D  1 212 ? 69.320  -17.532 -8.923   1.00 52.98  ? 211 LEU D CD1 1 
ATOM   8090  C  CD2 . LEU D  1 212 ? 70.168  -16.345 -6.917   1.00 62.13  ? 211 LEU D CD2 1 
ATOM   8091  N  N   . ILE D  1 213 ? 72.133  -18.501 -11.644  1.00 61.39  ? 212 ILE D N   1 
ATOM   8092  C  CA  . ILE D  1 213 ? 72.802  -17.997 -12.836  1.00 54.09  ? 212 ILE D CA  1 
ATOM   8093  C  C   . ILE D  1 213 ? 72.101  -16.855 -13.571  1.00 52.19  ? 212 ILE D C   1 
ATOM   8094  O  O   . ILE D  1 213 ? 72.589  -16.407 -14.602  1.00 57.32  ? 212 ILE D O   1 
ATOM   8095  C  CB  . ILE D  1 213 ? 73.130  -19.125 -13.840  1.00 57.20  ? 212 ILE D CB  1 
ATOM   8096  C  CG1 . ILE D  1 213 ? 71.848  -19.676 -14.466  1.00 50.65  ? 212 ILE D CG1 1 
ATOM   8097  C  CG2 . ILE D  1 213 ? 73.919  -20.227 -13.158  1.00 68.09  ? 212 ILE D CG2 1 
ATOM   8098  C  CD1 . ILE D  1 213 ? 72.101  -20.460 -15.734  1.00 74.48  ? 212 ILE D CD1 1 
ATOM   8099  N  N   . GLY D  1 214 ? 70.980  -16.363 -13.056  1.00 44.80  ? 213 GLY D N   1 
ATOM   8100  C  CA  . GLY D  1 214 ? 70.400  -15.178 -13.657  1.00 48.08  ? 213 GLY D CA  1 
ATOM   8101  C  C   . GLY D  1 214 ? 69.024  -14.794 -13.164  1.00 54.31  ? 213 GLY D C   1 
ATOM   8102  O  O   . GLY D  1 214 ? 68.402  -15.526 -12.406  1.00 46.51  ? 213 GLY D O   1 
ATOM   8103  N  N   . CYS D  1 215 ? 68.548  -13.626 -13.583  1.00 48.10  ? 214 CYS D N   1 
ATOM   8104  C  CA  . CYS D  1 215 ? 67.181  -13.230 -13.258  1.00 40.05  ? 214 CYS D CA  1 
ATOM   8105  C  C   . CYS D  1 215 ? 66.439  -12.843 -14.535  1.00 41.45  ? 214 CYS D C   1 
ATOM   8106  O  O   . CYS D  1 215 ? 67.051  -12.607 -15.582  1.00 51.31  ? 214 CYS D O   1 
ATOM   8107  C  CB  . CYS D  1 215 ? 67.145  -12.111 -12.210  1.00 46.21  ? 214 CYS D CB  1 
ATOM   8108  S  SG  . CYS D  1 215 ? 67.932  -10.560 -12.697  1.00 50.51  ? 214 CYS D SG  1 
ATOM   8109  N  N   . ILE D  1 216 ? 65.118  -12.810 -14.442  1.00 40.79  ? 215 ILE D N   1 
ATOM   8110  C  CA  . ILE D  1 216 ? 64.263  -12.543 -15.587  1.00 48.47  ? 215 ILE D CA  1 
ATOM   8111  C  C   . ILE D  1 216 ? 63.176  -11.553 -15.182  1.00 39.80  ? 215 ILE D C   1 
ATOM   8112  O  O   . ILE D  1 216 ? 63.080  -11.179 -14.006  1.00 43.23  ? 215 ILE D O   1 
ATOM   8113  C  CB  . ILE D  1 216 ? 63.593  -13.844 -16.085  1.00 53.93  ? 215 ILE D CB  1 
ATOM   8114  C  CG1 . ILE D  1 216 ? 62.756  -14.467 -14.961  1.00 50.90  ? 215 ILE D CG1 1 
ATOM   8115  C  CG2 . ILE D  1 216 ? 64.637  -14.838 -16.592  1.00 37.36  ? 215 ILE D CG2 1 
ATOM   8116  C  CD1 . ILE D  1 216 ? 62.023  -15.739 -15.357  1.00 42.94  ? 215 ILE D CD1 1 
ATOM   8117  N  N   . ASP D  1 217 ? 62.347  -11.155 -16.149  1.00 46.36  ? 216 ASP D N   1 
ATOM   8118  C  CA  . ASP D  1 217 ? 61.232  -10.223 -15.912  1.00 43.76  ? 216 ASP D CA  1 
ATOM   8119  C  C   . ASP D  1 217 ? 61.685  -8.939  -15.224  1.00 32.26  ? 216 ASP D C   1 
ATOM   8120  O  O   . ASP D  1 217 ? 61.264  -8.637  -14.100  1.00 35.14  ? 216 ASP D O   1 
ATOM   8121  C  CB  . ASP D  1 217 ? 60.101  -10.896 -15.119  1.00 43.42  ? 216 ASP D CB  1 
ATOM   8122  C  CG  . ASP D  1 217 ? 59.331  -11.907 -15.953  1.00 63.92  ? 216 ASP D CG  1 
ATOM   8123  O  OD1 . ASP D  1 217 ? 59.276  -11.747 -17.196  1.00 66.03  ? 216 ASP D OD1 1 
ATOM   8124  O  OD2 . ASP D  1 217 ? 58.783  -12.865 -15.368  1.00 91.10  ? 216 ASP D OD2 1 
ATOM   8125  N  N   . VAL D  1 218 ? 62.545  -8.180  -15.912  1.00 38.19  ? 217 VAL D N   1 
ATOM   8126  C  CA  . VAL D  1 218 ? 63.150  -6.998  -15.305  1.00 35.06  ? 217 VAL D CA  1 
ATOM   8127  C  C   . VAL D  1 218 ? 62.413  -5.700  -15.674  1.00 44.63  ? 217 VAL D C   1 
ATOM   8128  O  O   . VAL D  1 218 ? 62.977  -4.619  -15.567  1.00 38.08  ? 217 VAL D O   1 
ATOM   8129  C  CB  . VAL D  1 218 ? 64.659  -6.883  -15.675  1.00 39.36  ? 217 VAL D CB  1 
ATOM   8130  C  CG1 . VAL D  1 218 ? 65.449  -8.064  -15.090  1.00 40.88  ? 217 VAL D CG1 1 
ATOM   8131  C  CG2 . VAL D  1 218 ? 64.849  -6.800  -17.193  1.00 37.28  ? 217 VAL D CG2 1 
ATOM   8132  N  N   . GLY D  1 219 ? 61.150  -5.815  -16.086  1.00 35.22  ? 218 GLY D N   1 
ATOM   8133  C  CA  . GLY D  1 219 ? 60.372  -4.670  -16.540  1.00 35.13  ? 218 GLY D CA  1 
ATOM   8134  C  C   . GLY D  1 219 ? 60.171  -3.531  -15.549  1.00 38.71  ? 218 GLY D C   1 
ATOM   8135  O  O   . GLY D  1 219 ? 59.814  -2.414  -15.944  1.00 34.46  ? 218 GLY D O   1 
ATOM   8136  N  N   . ARG D  1 220 ? 60.402  -3.804  -14.269  1.00 33.80  ? 219 ARG D N   1 
ATOM   8137  C  CA  . ARG D  1 220 ? 60.155  -2.820  -13.219  1.00 32.81  ? 219 ARG D CA  1 
ATOM   8138  C  C   . ARG D  1 220 ? 61.444  -2.359  -12.557  1.00 36.88  ? 219 ARG D C   1 
ATOM   8139  O  O   . ARG D  1 220 ? 61.413  -1.702  -11.514  1.00 33.08  ? 219 ARG D O   1 
ATOM   8140  C  CB  . ARG D  1 220 ? 59.197  -3.393  -12.166  1.00 39.80  ? 219 ARG D CB  1 
ATOM   8141  C  CG  . ARG D  1 220 ? 57.817  -3.704  -12.723  1.00 44.76  ? 219 ARG D CG  1 
ATOM   8142  C  CD  . ARG D  1 220 ? 56.871  -4.233  -11.636  1.00 49.22  ? 219 ARG D CD  1 
ATOM   8143  N  NE  . ARG D  1 220 ? 56.032  -3.167  -11.081  1.00 48.57  ? 219 ARG D NE  1 
ATOM   8144  C  CZ  . ARG D  1 220 ? 56.179  -2.645  -9.866   1.00 81.65  ? 219 ARG D CZ  1 
ATOM   8145  N  NH1 . ARG D  1 220 ? 55.360  -1.681  -9.453   1.00 58.95  ? 219 ARG D NH1 1 
ATOM   8146  N  NH2 . ARG D  1 220 ? 57.140  -3.089  -9.058   1.00 58.93  ? 219 ARG D NH2 1 
ATOM   8147  N  N   . VAL D  1 221 ? 62.577  -2.706  -13.164  1.00 33.72  ? 220 VAL D N   1 
ATOM   8148  C  CA  . VAL D  1 221 ? 63.884  -2.290  -12.644  1.00 35.04  ? 220 VAL D CA  1 
ATOM   8149  C  C   . VAL D  1 221 ? 63.999  -0.763  -12.520  1.00 37.72  ? 220 VAL D C   1 
ATOM   8150  O  O   . VAL D  1 221 ? 63.563  -0.021  -13.403  1.00 35.24  ? 220 VAL D O   1 
ATOM   8151  C  CB  . VAL D  1 221 ? 65.037  -2.838  -13.532  1.00 35.87  ? 220 VAL D CB  1 
ATOM   8152  C  CG1 . VAL D  1 221 ? 66.290  -1.979  -13.420  1.00 34.19  ? 220 VAL D CG1 1 
ATOM   8153  C  CG2 . VAL D  1 221 ? 65.346  -4.302  -13.157  1.00 34.24  ? 220 VAL D CG2 1 
ATOM   8154  N  N   . GLY D  1 222 ? 64.568  -0.298  -11.417  1.00 30.56  ? 221 GLY D N   1 
ATOM   8155  C  CA  . GLY D  1 222 ? 64.826  1.125   -11.260  1.00 33.46  ? 221 GLY D CA  1 
ATOM   8156  C  C   . GLY D  1 222 ? 65.302  1.422   -9.854   1.00 28.43  ? 221 GLY D C   1 
ATOM   8157  O  O   . GLY D  1 222 ? 65.340  0.534   -8.992   1.00 35.54  ? 221 GLY D O   1 
ATOM   8158  N  N   . ILE D  1 223 ? 65.661  2.677   -9.621   1.00 29.09  ? 222 ILE D N   1 
ATOM   8159  C  CA  . ILE D  1 223 ? 66.052  3.122   -8.297   1.00 29.01  ? 222 ILE D CA  1 
ATOM   8160  C  C   . ILE D  1 223 ? 64.825  3.165   -7.384   1.00 32.80  ? 222 ILE D C   1 
ATOM   8161  O  O   . ILE D  1 223 ? 63.821  3.802   -7.710   1.00 35.70  ? 222 ILE D O   1 
ATOM   8162  C  CB  . ILE D  1 223 ? 66.714  4.510   -8.348   1.00 29.79  ? 222 ILE D CB  1 
ATOM   8163  C  CG1 . ILE D  1 223 ? 67.979  4.464   -9.214   1.00 34.64  ? 222 ILE D CG1 1 
ATOM   8164  C  CG2 . ILE D  1 223 ? 67.090  4.982   -6.953   1.00 32.84  ? 222 ILE D CG2 1 
ATOM   8165  C  CD1 . ILE D  1 223 ? 68.609  5.838   -9.450   1.00 32.53  ? 222 ILE D CD1 1 
ATOM   8166  N  N   . ALA D  1 224 ? 64.922  2.486   -6.246   1.00 30.08  ? 223 ALA D N   1 
ATOM   8167  C  CA  . ALA D  1 224 ? 63.850  2.450   -5.241   1.00 28.73  ? 223 ALA D CA  1 
ATOM   8168  C  C   . ALA D  1 224 ? 64.448  2.050   -3.892   1.00 42.00  ? 223 ALA D C   1 
ATOM   8169  O  O   . ALA D  1 224 ? 65.628  1.731   -3.808   1.00 32.69  ? 223 ALA D O   1 
ATOM   8170  C  CB  . ALA D  1 224 ? 62.756  1.444   -5.649   1.00 29.45  ? 223 ALA D CB  1 
ATOM   8171  N  N   . ASP D  1 225 ? 63.639  2.053   -2.836   1.00 32.70  ? 224 ASP D N   1 
ATOM   8172  C  CA  . ASP D  1 225 ? 64.124  1.599   -1.534   1.00 33.51  ? 224 ASP D CA  1 
ATOM   8173  C  C   . ASP D  1 225 ? 64.497  0.113   -1.600   1.00 35.14  ? 224 ASP D C   1 
ATOM   8174  O  O   . ASP D  1 225 ? 63.839  -0.661  -2.302   1.00 34.97  ? 224 ASP D O   1 
ATOM   8175  C  CB  . ASP D  1 225 ? 63.055  1.813   -0.458   1.00 31.42  ? 224 ASP D CB  1 
ATOM   8176  C  CG  . ASP D  1 225 ? 63.577  1.528   0.936    1.00 43.51  ? 224 ASP D CG  1 
ATOM   8177  O  OD1 . ASP D  1 225 ? 63.519  0.359   1.359    1.00 38.57  ? 224 ASP D OD1 1 
ATOM   8178  O  OD2 . ASP D  1 225 ? 64.058  2.466   1.603    1.00 42.50  ? 224 ASP D OD2 1 
ATOM   8179  N  N   . ARG D  1 226 ? 65.535  -0.299  -0.869   1.00 31.29  ? 225 ARG D N   1 
ATOM   8180  C  CA  . ARG D  1 226 ? 65.979  -1.689  -0.950   1.00 35.92  ? 225 ARG D CA  1 
ATOM   8181  C  C   . ARG D  1 226 ? 64.883  -2.669  -0.488   1.00 36.55  ? 225 ARG D C   1 
ATOM   8182  O  O   . ARG D  1 226 ? 64.862  -3.824  -0.904   1.00 37.05  ? 225 ARG D O   1 
ATOM   8183  C  CB  . ARG D  1 226 ? 67.289  -1.907  -0.172   1.00 34.83  ? 225 ARG D CB  1 
ATOM   8184  C  CG  . ARG D  1 226 ? 67.171  -1.710  1.328    1.00 35.61  ? 225 ARG D CG  1 
ATOM   8185  C  CD  . ARG D  1 226 ? 68.510  -1.926  2.042    1.00 46.55  ? 225 ARG D CD  1 
ATOM   8186  N  NE  . ARG D  1 226 ? 69.419  -0.790  1.894    1.00 44.64  ? 225 ARG D NE  1 
ATOM   8187  C  CZ  . ARG D  1 226 ? 70.564  -0.812  1.214    1.00 45.05  ? 225 ARG D CZ  1 
ATOM   8188  N  NH1 . ARG D  1 226 ? 70.974  -1.919  0.600    1.00 40.24  ? 225 ARG D NH1 1 
ATOM   8189  N  NH2 . ARG D  1 226 ? 71.308  0.284   1.149    1.00 43.51  ? 225 ARG D NH2 1 
ATOM   8190  N  N   . TYR D  1 227 ? 63.957  -2.209  0.346    1.00 37.30  ? 226 TYR D N   1 
ATOM   8191  C  CA  . TYR D  1 227 ? 62.879  -3.102  0.798    1.00 33.99  ? 226 TYR D CA  1 
ATOM   8192  C  C   . TYR D  1 227 ? 61.913  -3.493  -0.335   1.00 28.85  ? 226 TYR D C   1 
ATOM   8193  O  O   . TYR D  1 227 ? 61.150  -4.439  -0.199   1.00 36.28  ? 226 TYR D O   1 
ATOM   8194  C  CB  . TYR D  1 227 ? 62.155  -2.522  2.016    1.00 28.03  ? 226 TYR D CB  1 
ATOM   8195  C  CG  . TYR D  1 227 ? 62.898  -2.787  3.304    1.00 33.25  ? 226 TYR D CG  1 
ATOM   8196  C  CD1 . TYR D  1 227 ? 64.024  -2.052  3.653    1.00 46.11  ? 226 TYR D CD1 1 
ATOM   8197  C  CD2 . TYR D  1 227 ? 62.501  -3.816  4.152    1.00 42.13  ? 226 TYR D CD2 1 
ATOM   8198  C  CE1 . TYR D  1 227 ? 64.717  -2.318  4.833    1.00 44.56  ? 226 TYR D CE1 1 
ATOM   8199  C  CE2 . TYR D  1 227 ? 63.183  -4.085  5.325    1.00 38.43  ? 226 TYR D CE2 1 
ATOM   8200  C  CZ  . TYR D  1 227 ? 64.289  -3.341  5.664    1.00 35.50  ? 226 TYR D CZ  1 
ATOM   8201  O  OH  . TYR D  1 227 ? 64.961  -3.621  6.843    1.00 39.24  ? 226 TYR D OH  1 
ATOM   8202  N  N   . GLN D  1 228 ? 61.980  -2.801  -1.468   1.00 28.55  ? 227 GLN D N   1 
ATOM   8203  C  CA  . GLN D  1 228 ? 61.158  -3.193  -2.620   1.00 30.46  ? 227 GLN D CA  1 
ATOM   8204  C  C   . GLN D  1 228 ? 61.480  -4.624  -3.047   1.00 45.05  ? 227 GLN D C   1 
ATOM   8205  O  O   . GLN D  1 228 ? 60.594  -5.383  -3.427   1.00 33.52  ? 227 GLN D O   1 
ATOM   8206  C  CB  . GLN D  1 228 ? 61.342  -2.219  -3.789   1.00 34.06  ? 227 GLN D CB  1 
ATOM   8207  C  CG  . GLN D  1 228 ? 60.737  -2.703  -5.119   1.00 33.96  ? 227 GLN D CG  1 
ATOM   8208  C  CD  . GLN D  1 228 ? 59.226  -2.931  -5.022   1.00 41.35  ? 227 GLN D CD  1 
ATOM   8209  O  OE1 . GLN D  1 228 ? 58.537  -2.224  -4.299   1.00 33.98  ? 227 GLN D OE1 1 
ATOM   8210  N  NE2 . GLN D  1 228 ? 58.714  -3.930  -5.747   1.00 35.30  ? 227 GLN D NE2 1 
ATOM   8211  N  N   . ASP D  1 229 ? 62.753  -4.994  -2.962   1.00 36.75  ? 228 ASP D N   1 
ATOM   8212  C  CA  . ASP D  1 229 ? 63.179  -6.334  -3.334   1.00 34.88  ? 228 ASP D CA  1 
ATOM   8213  C  C   . ASP D  1 229 ? 63.115  -7.271  -2.146   1.00 36.18  ? 228 ASP D C   1 
ATOM   8214  O  O   . ASP D  1 229 ? 62.594  -8.378  -2.268   1.00 33.82  ? 228 ASP D O   1 
ATOM   8215  C  CB  . ASP D  1 229 ? 64.590  -6.332  -3.941   1.00 31.11  ? 228 ASP D CB  1 
ATOM   8216  C  CG  . ASP D  1 229 ? 64.619  -5.740  -5.333   1.00 37.06  ? 228 ASP D CG  1 
ATOM   8217  O  OD1 . ASP D  1 229 ? 63.564  -5.754  -6.019   1.00 34.73  ? 228 ASP D OD1 1 
ATOM   8218  O  OD2 . ASP D  1 229 ? 65.694  -5.262  -5.737   1.00 35.51  ? 228 ASP D OD2 1 
ATOM   8219  N  N   . LEU D  1 230 ? 63.640  -6.827  -1.005   1.00 33.10  ? 229 LEU D N   1 
ATOM   8220  C  CA  . LEU D  1 230 ? 63.595  -7.631  0.206    1.00 33.03  ? 229 LEU D CA  1 
ATOM   8221  C  C   . LEU D  1 230 ? 62.166  -8.061  0.541    1.00 43.84  ? 229 LEU D C   1 
ATOM   8222  O  O   . LEU D  1 230 ? 61.947  -9.207  0.885    1.00 35.18  ? 229 LEU D O   1 
ATOM   8223  C  CB  . LEU D  1 230 ? 64.205  -6.890  1.403    1.00 33.13  ? 229 LEU D CB  1 
ATOM   8224  C  CG  . LEU D  1 230 ? 65.710  -6.618  1.358    1.00 42.81  ? 229 LEU D CG  1 
ATOM   8225  C  CD1 . LEU D  1 230 ? 66.034  -5.472  2.310    1.00 40.27  ? 229 LEU D CD1 1 
ATOM   8226  C  CD2 . LEU D  1 230 ? 66.528  -7.867  1.706    1.00 34.58  ? 229 LEU D CD2 1 
ATOM   8227  N  N   . ALA D  1 231 ? 61.195  -7.160  0.427    1.00 35.01  ? 230 ALA D N   1 
ATOM   8228  C  CA  . ALA D  1 231 ? 59.832  -7.499  0.865    1.00 34.30  ? 230 ALA D CA  1 
ATOM   8229  C  C   . ALA D  1 231 ? 59.203  -8.595  0.028    1.00 36.50  ? 230 ALA D C   1 
ATOM   8230  O  O   . ALA D  1 231 ? 58.640  -9.556  0.563    1.00 39.76  ? 230 ALA D O   1 
ATOM   8231  C  CB  . ALA D  1 231 ? 58.932  -6.267  0.875    1.00 33.65  ? 230 ALA D CB  1 
ATOM   8232  N  N   . ILE D  1 232 ? 59.292  -8.444  -1.288   1.00 38.20  ? 231 ILE D N   1 
ATOM   8233  C  CA  . ILE D  1 232 ? 58.667  -9.401  -2.185   1.00 38.66  ? 231 ILE D CA  1 
ATOM   8234  C  C   . ILE D  1 232 ? 59.276  -10.799 -2.023   1.00 42.77  ? 231 ILE D C   1 
ATOM   8235  O  O   . ILE D  1 232 ? 58.551  -11.802 -1.983   1.00 38.03  ? 231 ILE D O   1 
ATOM   8236  C  CB  . ILE D  1 232 ? 58.770  -8.907  -3.634   1.00 35.37  ? 231 ILE D CB  1 
ATOM   8237  C  CG1 . ILE D  1 232 ? 57.791  -7.743  -3.846   1.00 36.57  ? 231 ILE D CG1 1 
ATOM   8238  C  CG2 . ILE D  1 232 ? 58.512  -10.046 -4.630   1.00 32.50  ? 231 ILE D CG2 1 
ATOM   8239  C  CD1 . ILE D  1 232 ? 57.781  -7.217  -5.264   1.00 43.50  ? 231 ILE D CD1 1 
ATOM   8240  N  N   . LEU D  1 233 ? 60.605  -10.858 -1.915   1.00 38.29  ? 232 LEU D N   1 
ATOM   8241  C  CA  . LEU D  1 233 ? 61.290  -12.136 -1.700   1.00 33.62  ? 232 LEU D CA  1 
ATOM   8242  C  C   . LEU D  1 233 ? 60.929  -12.740 -0.347   1.00 35.73  ? 232 LEU D C   1 
ATOM   8243  O  O   . LEU D  1 233 ? 60.615  -13.940 -0.251   1.00 36.95  ? 232 LEU D O   1 
ATOM   8244  C  CB  . LEU D  1 233 ? 62.815  -11.985 -1.818   1.00 38.05  ? 232 LEU D CB  1 
ATOM   8245  C  CG  . LEU D  1 233 ? 63.564  -13.331 -1.716   1.00 47.90  ? 232 LEU D CG  1 
ATOM   8246  C  CD1 . LEU D  1 233 ? 62.972  -14.356 -2.677   1.00 37.58  ? 232 LEU D CD1 1 
ATOM   8247  C  CD2 . LEU D  1 233 ? 65.078  -13.205 -1.954   1.00 35.80  ? 232 LEU D CD2 1 
ATOM   8248  N  N   . TRP D  1 234 ? 60.988  -11.911 0.696    1.00 37.49  ? 233 TRP D N   1 
ATOM   8249  C  CA  . TRP D  1 234 ? 60.649  -12.327 2.060    1.00 40.80  ? 233 TRP D CA  1 
ATOM   8250  C  C   . TRP D  1 234 ? 59.257  -12.952 2.116    1.00 37.78  ? 233 TRP D C   1 
ATOM   8251  O  O   . TRP D  1 234 ? 59.031  -13.982 2.765    1.00 36.96  ? 233 TRP D O   1 
ATOM   8252  C  CB  . TRP D  1 234 ? 60.703  -11.100 2.974    1.00 35.76  ? 233 TRP D CB  1 
ATOM   8253  C  CG  . TRP D  1 234 ? 60.468  -11.347 4.417    1.00 41.89  ? 233 TRP D CG  1 
ATOM   8254  C  CD1 . TRP D  1 234 ? 61.413  -11.606 5.367    1.00 52.35  ? 233 TRP D CD1 1 
ATOM   8255  C  CD2 . TRP D  1 234 ? 59.210  -11.306 5.104    1.00 34.08  ? 233 TRP D CD2 1 
ATOM   8256  N  NE1 . TRP D  1 234 ? 60.823  -11.747 6.594    1.00 49.57  ? 233 TRP D NE1 1 
ATOM   8257  C  CE2 . TRP D  1 234 ? 59.471  -11.563 6.464    1.00 35.06  ? 233 TRP D CE2 1 
ATOM   8258  C  CE3 . TRP D  1 234 ? 57.891  -11.084 4.700    1.00 41.01  ? 233 TRP D CE3 1 
ATOM   8259  C  CZ2 . TRP D  1 234 ? 58.462  -11.619 7.421    1.00 47.21  ? 233 TRP D CZ2 1 
ATOM   8260  C  CZ3 . TRP D  1 234 ? 56.888  -11.143 5.649    1.00 40.90  ? 233 TRP D CZ3 1 
ATOM   8261  C  CH2 . TRP D  1 234 ? 57.178  -11.405 6.994    1.00 45.83  ? 233 TRP D CH2 1 
ATOM   8262  N  N   . ASN D  1 235 ? 58.326  -12.301 1.433    1.00 38.58  ? 234 ASN D N   1 
ATOM   8263  C  CA  . ASN D  1 235 ? 56.943  -12.743 1.360    1.00 39.29  ? 234 ASN D CA  1 
ATOM   8264  C  C   . ASN D  1 235 ? 56.839  -14.129 0.719    1.00 39.78  ? 234 ASN D C   1 
ATOM   8265  O  O   . ASN D  1 235 ? 56.155  -15.000 1.251    1.00 38.93  ? 234 ASN D O   1 
ATOM   8266  C  CB  . ASN D  1 235 ? 56.133  -11.689 0.593    1.00 34.50  ? 234 ASN D CB  1 
ATOM   8267  C  CG  . ASN D  1 235 ? 54.643  -11.936 0.628    1.00 40.10  ? 234 ASN D CG  1 
ATOM   8268  O  OD1 . ASN D  1 235 ? 53.976  -11.861 -0.408   1.00 43.70  ? 234 ASN D OD1 1 
ATOM   8269  N  ND2 . ASN D  1 235 ? 54.101  -12.210 1.818    1.00 39.87  ? 234 ASN D ND2 1 
ATOM   8270  N  N   . CYS D  1 236 ? 57.541  -14.338 -0.398   1.00 39.00  ? 235 CYS D N   1 
ATOM   8271  C  CA  . CYS D  1 236 ? 57.553  -15.633 -1.101   1.00 36.17  ? 235 CYS D CA  1 
ATOM   8272  C  C   . CYS D  1 236 ? 58.056  -16.757 -0.209   1.00 36.18  ? 235 CYS D C   1 
ATOM   8273  O  O   . CYS D  1 236 ? 57.536  -17.891 -0.229   1.00 36.37  ? 235 CYS D O   1 
ATOM   8274  C  CB  . CYS D  1 236 ? 58.439  -15.572 -2.354   1.00 38.03  ? 235 CYS D CB  1 
ATOM   8275  S  SG  . CYS D  1 236 ? 57.829  -14.494 -3.678   1.00 42.88  ? 235 CYS D SG  1 
ATOM   8276  N  N   . LEU D  1 237 ? 59.060  -16.432 0.593    1.00 35.87  ? 236 LEU D N   1 
ATOM   8277  C  CA  . LEU D  1 237 ? 59.694  -17.414 1.460    1.00 41.23  ? 236 LEU D CA  1 
ATOM   8278  C  C   . LEU D  1 237 ? 58.790  -17.819 2.627    1.00 36.67  ? 236 LEU D C   1 
ATOM   8279  O  O   . LEU D  1 237 ? 58.973  -18.874 3.232    1.00 41.87  ? 236 LEU D O   1 
ATOM   8280  C  CB  . LEU D  1 237 ? 61.034  -16.875 1.962    1.00 39.57  ? 236 LEU D CB  1 
ATOM   8281  C  CG  . LEU D  1 237 ? 62.164  -16.811 0.932    1.00 49.25  ? 236 LEU D CG  1 
ATOM   8282  C  CD1 . LEU D  1 237 ? 63.337  -16.030 1.504    1.00 36.00  ? 236 LEU D CD1 1 
ATOM   8283  C  CD2 . LEU D  1 237 ? 62.600  -18.212 0.488    1.00 38.19  ? 236 LEU D CD2 1 
ATOM   8284  N  N   . GLY D  1 238 ? 57.791  -16.996 2.932    1.00 39.31  ? 237 GLY D N   1 
ATOM   8285  C  CA  . GLY D  1 238 ? 56.861  -17.323 4.007    1.00 32.89  ? 237 GLY D CA  1 
ATOM   8286  C  C   . GLY D  1 238 ? 56.120  -18.631 3.789    1.00 42.87  ? 237 GLY D C   1 
ATOM   8287  O  O   . GLY D  1 238 ? 55.770  -19.335 4.749    1.00 48.39  ? 237 GLY D O   1 
ATOM   8288  N  N   . GLU D  1 239 ? 55.890  -18.969 2.522    1.00 45.66  ? 238 GLU D N   1 
ATOM   8289  C  CA  . GLU D  1 239 ? 55.222  -20.227 2.165    1.00 52.59  ? 238 GLU D CA  1 
ATOM   8290  C  C   . GLU D  1 239 ? 56.113  -21.453 2.349    1.00 51.88  ? 238 GLU D C   1 
ATOM   8291  O  O   . GLU D  1 239 ? 55.637  -22.585 2.352    1.00 49.30  ? 238 GLU D O   1 
ATOM   8292  C  CB  . GLU D  1 239 ? 54.701  -20.170 0.728    1.00 58.95  ? 238 GLU D CB  1 
ATOM   8293  C  CG  . GLU D  1 239 ? 53.563  -19.182 0.530    1.00 72.02  ? 238 GLU D CG  1 
ATOM   8294  C  CD  . GLU D  1 239 ? 52.864  -19.357 -0.809   1.00 100.98 ? 238 GLU D CD  1 
ATOM   8295  O  OE1 . GLU D  1 239 ? 53.532  -19.785 -1.780   1.00 78.60  ? 238 GLU D OE1 1 
ATOM   8296  O  OE2 . GLU D  1 239 ? 51.646  -19.070 -0.887   1.00 82.90  ? 238 GLU D OE2 1 
ATOM   8297  N  N   . PHE D  1 240 ? 57.411  -21.230 2.510    1.00 46.79  ? 239 PHE D N   1 
ATOM   8298  C  CA  . PHE D  1 240 ? 58.335  -22.342 2.704    1.00 40.10  ? 239 PHE D CA  1 
ATOM   8299  C  C   . PHE D  1 240 ? 58.748  -22.484 4.171    1.00 66.99  ? 239 PHE D C   1 
ATOM   8300  O  O   . PHE D  1 240 ? 58.607  -23.550 4.757    1.00 72.66  ? 239 PHE D O   1 
ATOM   8301  C  CB  . PHE D  1 240 ? 59.538  -22.189 1.762    1.00 38.56  ? 239 PHE D CB  1 
ATOM   8302  C  CG  . PHE D  1 240 ? 59.167  -22.343 0.320    1.00 42.18  ? 239 PHE D CG  1 
ATOM   8303  C  CD1 . PHE D  1 240 ? 58.798  -21.242 -0.440   1.00 48.47  ? 239 PHE D CD1 1 
ATOM   8304  C  CD2 . PHE D  1 240 ? 59.139  -23.602 -0.265   1.00 45.58  ? 239 PHE D CD2 1 
ATOM   8305  C  CE1 . PHE D  1 240 ? 58.429  -21.392 -1.762   1.00 55.88  ? 239 PHE D CE1 1 
ATOM   8306  C  CE2 . PHE D  1 240 ? 58.771  -23.755 -1.586   1.00 62.19  ? 239 PHE D CE2 1 
ATOM   8307  C  CZ  . PHE D  1 240 ? 58.416  -22.650 -2.336   1.00 46.99  ? 239 PHE D CZ  1 
ATOM   8308  N  N   . SER D  1 241 ? 59.235  -21.398 4.765    1.00 86.17  ? 240 SER D N   1 
ATOM   8309  C  CA  . SER D  1 241 ? 59.575  -21.395 6.185    1.00 67.47  ? 240 SER D CA  1 
ATOM   8310  C  C   . SER D  1 241 ? 59.812  -19.996 6.740    1.00 79.57  ? 240 SER D C   1 
ATOM   8311  O  O   . SER D  1 241 ? 60.436  -19.153 6.086    1.00 53.48  ? 240 SER D O   1 
ATOM   8312  C  CB  . SER D  1 241 ? 60.816  -22.245 6.456    1.00 61.84  ? 240 SER D CB  1 
ATOM   8313  O  OG  . SER D  1 241 ? 61.259  -22.042 7.786    1.00 70.16  ? 240 SER D OG  1 
ATOM   8314  N  N   . PRO D  1 242 ? 59.317  -19.747 7.960    1.00 80.70  ? 241 PRO D N   1 
ATOM   8315  C  CA  . PRO D  1 242 ? 59.644  -18.507 8.669    1.00 60.48  ? 241 PRO D CA  1 
ATOM   8316  C  C   . PRO D  1 242 ? 61.133  -18.440 9.009    1.00 74.71  ? 241 PRO D C   1 
ATOM   8317  O  O   . PRO D  1 242 ? 61.698  -17.341 9.057    1.00 52.24  ? 241 PRO D O   1 
ATOM   8318  C  CB  . PRO D  1 242 ? 58.795  -18.600 9.943    1.00 87.19  ? 241 PRO D CB  1 
ATOM   8319  C  CG  . PRO D  1 242 ? 57.647  -19.489 9.562    1.00 72.56  ? 241 PRO D CG  1 
ATOM   8320  C  CD  . PRO D  1 242 ? 58.260  -20.513 8.644    1.00 84.14  ? 241 PRO D CD  1 
ATOM   8321  N  N   . SER D  1 243 ? 61.773  -19.587 9.231    1.00 56.29  ? 242 SER D N   1 
ATOM   8322  C  CA  . SER D  1 243 ? 63.214  -19.565 9.482    1.00 47.73  ? 242 SER D CA  1 
ATOM   8323  C  C   . SER D  1 243 ? 63.974  -19.122 8.232    1.00 45.89  ? 242 SER D C   1 
ATOM   8324  O  O   . SER D  1 243 ? 64.982  -18.429 8.329    1.00 49.18  ? 242 SER D O   1 
ATOM   8325  C  CB  . SER D  1 243 ? 63.745  -20.909 10.025   1.00 53.53  ? 242 SER D CB  1 
ATOM   8326  O  OG  . SER D  1 243 ? 63.951  -21.858 8.991    1.00 70.23  ? 242 SER D OG  1 
ATOM   8327  N  N   . LEU D  1 244 ? 63.473  -19.485 7.053    1.00 39.79  ? 243 LEU D N   1 
ATOM   8328  C  CA  . LEU D  1 244 ? 64.095  -19.029 5.808    1.00 41.39  ? 243 LEU D CA  1 
ATOM   8329  C  C   . LEU D  1 244 ? 63.912  -17.526 5.576    1.00 58.04  ? 243 LEU D C   1 
ATOM   8330  O  O   . LEU D  1 244 ? 64.779  -16.884 4.995    1.00 37.51  ? 243 LEU D O   1 
ATOM   8331  C  CB  . LEU D  1 244 ? 63.568  -19.812 4.604    1.00 44.28  ? 243 LEU D CB  1 
ATOM   8332  C  CG  . LEU D  1 244 ? 63.951  -21.293 4.502    1.00 53.48  ? 243 LEU D CG  1 
ATOM   8333  C  CD1 . LEU D  1 244 ? 63.503  -21.837 3.159    1.00 49.17  ? 243 LEU D CD1 1 
ATOM   8334  C  CD2 . LEU D  1 244 ? 65.453  -21.519 4.713    1.00 43.68  ? 243 LEU D CD2 1 
ATOM   8335  N  N   . GLN D  1 245 ? 62.781  -16.969 6.004    1.00 45.33  ? 244 GLN D N   1 
ATOM   8336  C  CA  . GLN D  1 245 ? 62.582  -15.518 5.919    1.00 50.50  ? 244 GLN D CA  1 
ATOM   8337  C  C   . GLN D  1 245 ? 63.650  -14.794 6.731    1.00 42.26  ? 244 GLN D C   1 
ATOM   8338  O  O   . GLN D  1 245 ? 64.289  -13.858 6.247    1.00 44.02  ? 244 GLN D O   1 
ATOM   8339  C  CB  . GLN D  1 245 ? 61.204  -15.112 6.435    1.00 43.97  ? 244 GLN D CB  1 
ATOM   8340  C  CG  . GLN D  1 245 ? 60.028  -15.531 5.560    1.00 40.63  ? 244 GLN D CG  1 
ATOM   8341  C  CD  . GLN D  1 245 ? 58.687  -15.088 6.147    1.00 45.00  ? 244 GLN D CD  1 
ATOM   8342  O  OE1 . GLN D  1 245 ? 58.430  -15.279 7.337    1.00 53.10  ? 244 GLN D OE1 1 
ATOM   8343  N  NE2 . GLN D  1 245 ? 57.845  -14.472 5.318    1.00 39.20  ? 244 GLN D NE2 1 
ATOM   8344  N  N   . LYS D  1 246 ? 63.842  -15.232 7.967    1.00 42.82  ? 245 LYS D N   1 
ATOM   8345  C  CA  . LYS D  1 246 ? 64.825  -14.598 8.835    1.00 58.83  ? 245 LYS D CA  1 
ATOM   8346  C  C   . LYS D  1 246 ? 66.235  -14.736 8.275    1.00 51.16  ? 245 LYS D C   1 
ATOM   8347  O  O   . LYS D  1 246 ? 67.034  -13.802 8.351    1.00 53.38  ? 245 LYS D O   1 
ATOM   8348  C  CB  . LYS D  1 246 ? 64.757  -15.166 10.250   1.00 44.97  ? 245 LYS D CB  1 
ATOM   8349  C  CG  . LYS D  1 246 ? 65.856  -14.630 11.157   1.00 63.97  ? 245 LYS D CG  1 
ATOM   8350  C  CD  . LYS D  1 246 ? 65.796  -15.187 12.565   1.00 69.67  ? 245 LYS D CD  1 
ATOM   8351  C  CE  . LYS D  1 246 ? 67.084  -14.867 13.314   1.00 84.58  ? 245 LYS D CE  1 
ATOM   8352  N  NZ  . LYS D  1 246 ? 67.645  -13.551 12.878   1.00 80.99  ? 245 LYS D NZ  1 
ATOM   8353  N  N   . ARG D  1 247 ? 66.529  -15.894 7.689    1.00 58.02  ? 246 ARG D N   1 
ATOM   8354  C  CA  . ARG D  1 247 ? 67.858  -16.146 7.140    1.00 57.64  ? 246 ARG D CA  1 
ATOM   8355  C  C   . ARG D  1 247 ? 68.195  -15.185 6.005    1.00 44.15  ? 246 ARG D C   1 
ATOM   8356  O  O   . ARG D  1 247 ? 69.337  -14.742 5.875    1.00 42.66  ? 246 ARG D O   1 
ATOM   8357  C  CB  . ARG D  1 247 ? 67.997  -17.590 6.661    1.00 56.29  ? 246 ARG D CB  1 
ATOM   8358  C  CG  . ARG D  1 247 ? 69.435  -17.975 6.339    1.00 48.09  ? 246 ARG D CG  1 
ATOM   8359  C  CD  . ARG D  1 247 ? 69.557  -19.457 6.014    1.00 53.60  ? 246 ARG D CD  1 
ATOM   8360  N  NE  . ARG D  1 247 ? 70.913  -19.818 5.611    1.00 55.46  ? 246 ARG D NE  1 
ATOM   8361  C  CZ  . ARG D  1 247 ? 71.830  -20.325 6.430    1.00 71.48  ? 246 ARG D CZ  1 
ATOM   8362  N  NH1 . ARG D  1 247 ? 71.541  -20.536 7.707    1.00 63.45  ? 246 ARG D NH1 1 
ATOM   8363  N  NH2 . ARG D  1 247 ? 73.036  -20.622 5.972    1.00 56.16  ? 246 ARG D NH2 1 
ATOM   8364  N  N   . LEU D  1 248 ? 67.192  -14.873 5.188    1.00 36.99  ? 247 LEU D N   1 
ATOM   8365  C  CA  . LEU D  1 248 ? 67.347  -13.919 4.106    1.00 46.15  ? 247 LEU D CA  1 
ATOM   8366  C  C   . LEU D  1 248 ? 67.925  -12.586 4.589    1.00 50.12  ? 247 LEU D C   1 
ATOM   8367  O  O   . LEU D  1 248 ? 68.943  -12.126 4.081    1.00 44.11  ? 247 LEU D O   1 
ATOM   8368  C  CB  . LEU D  1 248 ? 66.002  -13.683 3.417    1.00 40.62  ? 247 LEU D CB  1 
ATOM   8369  C  CG  . LEU D  1 248 ? 66.020  -12.567 2.374    1.00 40.75  ? 247 LEU D CG  1 
ATOM   8370  C  CD1 . LEU D  1 248 ? 66.962  -12.932 1.241    1.00 36.04  ? 247 LEU D CD1 1 
ATOM   8371  C  CD2 . LEU D  1 248 ? 64.610  -12.294 1.843    1.00 44.40  ? 247 LEU D CD2 1 
ATOM   8372  N  N   . PHE D  1 249 ? 67.268  -11.963 5.560    1.00 45.89  ? 248 PHE D N   1 
ATOM   8373  C  CA  . PHE D  1 249 ? 67.742  -10.689 6.094    1.00 46.98  ? 248 PHE D CA  1 
ATOM   8374  C  C   . PHE D  1 249 ? 69.134  -10.841 6.714    1.00 39.31  ? 248 PHE D C   1 
ATOM   8375  O  O   . PHE D  1 249 ? 70.025  -10.021 6.473    1.00 52.27  ? 248 PHE D O   1 
ATOM   8376  C  CB  . PHE D  1 249 ? 66.765  -10.142 7.143    1.00 43.61  ? 248 PHE D CB  1 
ATOM   8377  C  CG  . PHE D  1 249 ? 65.611  -9.354  6.563    1.00 43.26  ? 248 PHE D CG  1 
ATOM   8378  C  CD1 . PHE D  1 249 ? 65.813  -8.097  6.014    1.00 47.94  ? 248 PHE D CD1 1 
ATOM   8379  C  CD2 . PHE D  1 249 ? 64.315  -9.853  6.618    1.00 56.77  ? 248 PHE D CD2 1 
ATOM   8380  C  CE1 . PHE D  1 249 ? 64.744  -7.359  5.492    1.00 41.76  ? 248 PHE D CE1 1 
ATOM   8381  C  CE2 . PHE D  1 249 ? 63.250  -9.120  6.109    1.00 56.16  ? 248 PHE D CE2 1 
ATOM   8382  C  CZ  . PHE D  1 249 ? 63.467  -7.877  5.538    1.00 56.51  ? 248 PHE D CZ  1 
ATOM   8383  N  N   . GLN D  1 250 ? 69.309  -11.888 7.514    1.00 35.81  ? 249 GLN D N   1 
ATOM   8384  C  CA  . GLN D  1 250 ? 70.588  -12.150 8.181    1.00 39.27  ? 249 GLN D CA  1 
ATOM   8385  C  C   . GLN D  1 250 ? 71.750  -12.286 7.192    1.00 49.12  ? 249 GLN D C   1 
ATOM   8386  O  O   . GLN D  1 250 ? 72.808  -11.679 7.378    1.00 48.71  ? 249 GLN D O   1 
ATOM   8387  C  CB  . GLN D  1 250 ? 70.494  -13.389 9.069    1.00 44.37  ? 249 GLN D CB  1 
ATOM   8388  C  CG  . GLN D  1 250 ? 71.720  -13.605 9.955    1.00 59.87  ? 249 GLN D CG  1 
ATOM   8389  C  CD  . GLN D  1 250 ? 72.694  -14.620 9.382    1.00 95.35  ? 249 GLN D CD  1 
ATOM   8390  O  OE1 . GLN D  1 250 ? 72.288  -15.664 8.865    1.00 112.37 ? 249 GLN D OE1 1 
ATOM   8391  N  NE2 . GLN D  1 250 ? 73.989  -14.323 9.479    1.00 74.87  ? 249 GLN D NE2 1 
ATOM   8392  N  N   . LYS D  1 251 ? 71.547  -13.072 6.138    1.00 50.83  ? 250 LYS D N   1 
ATOM   8393  C  CA  . LYS D  1 251 ? 72.579  -13.252 5.115    1.00 46.03  ? 250 LYS D CA  1 
ATOM   8394  C  C   . LYS D  1 251 ? 72.731  -12.009 4.245    1.00 58.05  ? 250 LYS D C   1 
ATOM   8395  O  O   . LYS D  1 251 ? 73.811  -11.715 3.740    1.00 41.13  ? 250 LYS D O   1 
ATOM   8396  C  CB  . LYS D  1 251 ? 72.278  -14.473 4.239    1.00 58.19  ? 250 LYS D CB  1 
ATOM   8397  C  CG  . LYS D  1 251 ? 72.401  -15.808 4.955    1.00 57.25  ? 250 LYS D CG  1 
ATOM   8398  C  CD  . LYS D  1 251 ? 73.843  -16.081 5.336    1.00 52.29  ? 250 LYS D CD  1 
ATOM   8399  C  CE  . LYS D  1 251 ? 73.961  -17.285 6.244    1.00 66.35  ? 250 LYS D CE  1 
ATOM   8400  N  NZ  . LYS D  1 251 ? 75.380  -17.534 6.588    1.00 63.23  ? 250 LYS D NZ  1 
ATOM   8401  N  N   . TYR D  1 252 ? 71.645  -11.271 4.068    1.00 41.42  ? 251 TYR D N   1 
ATOM   8402  C  CA  . TYR D  1 252 ? 71.713  -10.028 3.312    1.00 40.89  ? 251 TYR D CA  1 
ATOM   8403  C  C   . TYR D  1 252 ? 72.535  -8.991  4.068    1.00 43.24  ? 251 TYR D C   1 
ATOM   8404  O  O   . TYR D  1 252 ? 73.193  -8.138  3.459    1.00 43.55  ? 251 TYR D O   1 
ATOM   8405  C  CB  . TYR D  1 252 ? 70.313  -9.497  3.053    1.00 33.73  ? 251 TYR D CB  1 
ATOM   8406  C  CG  . TYR D  1 252 ? 70.248  -8.200  2.259    1.00 34.70  ? 251 TYR D CG  1 
ATOM   8407  C  CD1 . TYR D  1 252 ? 70.291  -8.204  0.871    1.00 32.50  ? 251 TYR D CD1 1 
ATOM   8408  C  CD2 . TYR D  1 252 ? 70.105  -6.977  2.907    1.00 38.98  ? 251 TYR D CD2 1 
ATOM   8409  C  CE1 . TYR D  1 252 ? 70.210  -7.019  0.147    1.00 38.90  ? 251 TYR D CE1 1 
ATOM   8410  C  CE2 . TYR D  1 252 ? 70.020  -5.794  2.198    1.00 37.86  ? 251 TYR D CE2 1 
ATOM   8411  C  CZ  . TYR D  1 252 ? 70.076  -5.819  0.825    1.00 42.28  ? 251 TYR D CZ  1 
ATOM   8412  O  OH  . TYR D  1 252 ? 69.986  -4.635  0.136    1.00 47.95  ? 251 TYR D OH  1 
ATOM   8413  N  N   . GLY D  1 253 ? 72.485  -9.059  5.394    1.00 42.95  ? 252 GLY D N   1 
ATOM   8414  C  CA  . GLY D  1 253 ? 73.261  -8.167  6.231    1.00 43.17  ? 252 GLY D CA  1 
ATOM   8415  C  C   . GLY D  1 253 ? 72.437  -7.311  7.176    1.00 57.80  ? 252 GLY D C   1 
ATOM   8416  O  O   . GLY D  1 253 ? 72.973  -6.413  7.827    1.00 52.71  ? 252 GLY D O   1 
ATOM   8417  N  N   . ILE D  1 254 ? 71.136  -7.582  7.254    1.00 48.11  ? 253 ILE D N   1 
ATOM   8418  C  CA  . ILE D  1 254 ? 70.248  -6.835  8.144    1.00 44.13  ? 253 ILE D CA  1 
ATOM   8419  C  C   . ILE D  1 254 ? 69.844  -7.677  9.358    1.00 48.96  ? 253 ILE D C   1 
ATOM   8420  O  O   . ILE D  1 254 ? 69.111  -8.660  9.226    1.00 49.55  ? 253 ILE D O   1 
ATOM   8421  C  CB  . ILE D  1 254 ? 68.980  -6.343  7.407    1.00 44.90  ? 253 ILE D CB  1 
ATOM   8422  C  CG1 . ILE D  1 254 ? 69.346  -5.334  6.306    1.00 45.18  ? 253 ILE D CG1 1 
ATOM   8423  C  CG2 . ILE D  1 254 ? 67.993  -5.740  8.400    1.00 51.08  ? 253 ILE D CG2 1 
ATOM   8424  C  CD1 . ILE D  1 254 ? 68.251  -5.137  5.264    1.00 36.75  ? 253 ILE D CD1 1 
ATOM   8425  N  N   . ASP D  1 255 ? 70.334  -7.288  10.534   1.00 51.10  ? 254 ASP D N   1 
ATOM   8426  C  CA  . ASP D  1 255 ? 70.044  -8.003  11.771   1.00 57.90  ? 254 ASP D CA  1 
ATOM   8427  C  C   . ASP D  1 255 ? 68.642  -7.715  12.298   1.00 85.73  ? 254 ASP D C   1 
ATOM   8428  O  O   . ASP D  1 255 ? 67.939  -8.626  12.741   1.00 82.41  ? 254 ASP D O   1 
ATOM   8429  C  CB  . ASP D  1 255 ? 71.074  -7.651  12.845   1.00 79.04  ? 254 ASP D CB  1 
ATOM   8430  C  CG  . ASP D  1 255 ? 72.484  -8.046  12.453   1.00 96.24  ? 254 ASP D CG  1 
ATOM   8431  O  OD1 . ASP D  1 255 ? 72.632  -8.960  11.612   1.00 86.48  ? 254 ASP D OD1 1 
ATOM   8432  O  OD2 . ASP D  1 255 ? 73.442  -7.447  12.991   1.00 97.17  ? 254 ASP D OD2 1 
ATOM   8433  N  N   A ASN D  1 256 ? 68.245  -6.446  12.280   0.50 65.02  ? 255 ASN D N   1 
ATOM   8434  N  N   B ASN D  1 256 ? 68.240  -6.449  12.221   0.50 59.55  ? 255 ASN D N   1 
ATOM   8435  C  CA  A ASN D  1 256 ? 66.921  -6.061  12.762   0.50 60.31  ? 255 ASN D CA  1 
ATOM   8436  C  CA  B ASN D  1 256 ? 66.957  -5.999  12.746   0.50 59.81  ? 255 ASN D CA  1 
ATOM   8437  C  C   A ASN D  1 256 ? 66.099  -5.386  11.673   0.50 56.05  ? 255 ASN D C   1 
ATOM   8438  C  C   B ASN D  1 256 ? 66.099  -5.361  11.655   0.50 54.68  ? 255 ASN D C   1 
ATOM   8439  O  O   A ASN D  1 256 ? 66.126  -4.164  11.536   0.50 66.83  ? 255 ASN D O   1 
ATOM   8440  O  O   B ASN D  1 256 ? 66.104  -4.141  11.496   0.50 66.15  ? 255 ASN D O   1 
ATOM   8441  C  CB  A ASN D  1 256 ? 67.023  -5.145  13.981   0.50 63.37  ? 255 ASN D CB  1 
ATOM   8442  C  CB  B ASN D  1 256 ? 67.190  -4.998  13.879   0.50 65.55  ? 255 ASN D CB  1 
ATOM   8443  C  CG  A ASN D  1 256 ? 67.938  -5.700  15.053   0.50 48.71  ? 255 ASN D CG  1 
ATOM   8444  C  CG  B ASN D  1 256 ? 65.908  -4.583  14.569   0.50 53.55  ? 255 ASN D CG  1 
ATOM   8445  O  OD1 A ASN D  1 256 ? 67.654  -6.734  15.659   0.50 56.62  ? 255 ASN D OD1 1 
ATOM   8446  O  OD1 B ASN D  1 256 ? 64.941  -5.342  14.619   0.50 77.32  ? 255 ASN D OD1 1 
ATOM   8447  N  ND2 A ASN D  1 256 ? 69.037  -5.001  15.306   0.50 60.05  ? 255 ASN D ND2 1 
ATOM   8448  N  ND2 B ASN D  1 256 ? 65.895  -3.367  15.111   0.50 68.02  ? 255 ASN D ND2 1 
ATOM   8449  N  N   . PRO D  1 257 ? 65.365  -6.190  10.894   1.00 47.91  ? 256 PRO D N   1 
ATOM   8450  C  CA  . PRO D  1 257 ? 64.549  -5.730  9.761    1.00 61.24  ? 256 PRO D CA  1 
ATOM   8451  C  C   . PRO D  1 257 ? 63.545  -4.627  10.116   1.00 68.59  ? 256 PRO D C   1 
ATOM   8452  O  O   . PRO D  1 257 ? 62.861  -4.702  11.143   1.00 49.94  ? 256 PRO D O   1 
ATOM   8453  C  CB  . PRO D  1 257 ? 63.824  -7.000  9.310    1.00 53.31  ? 256 PRO D CB  1 
ATOM   8454  C  CG  . PRO D  1 257 ? 64.689  -8.119  9.781    1.00 55.02  ? 256 PRO D CG  1 
ATOM   8455  C  CD  . PRO D  1 257 ? 65.316  -7.655  11.057   1.00 60.21  ? 256 PRO D CD  1 
ATOM   8456  N  N   . ASP D  1 258 ? 63.477  -3.607  9.260    1.00 48.56  ? 257 ASP D N   1 
ATOM   8457  C  CA  . ASP D  1 258 ? 62.574  -2.477  9.457    1.00 61.18  ? 257 ASP D CA  1 
ATOM   8458  C  C   . ASP D  1 258 ? 61.165  -2.908  9.091    1.00 48.09  ? 257 ASP D C   1 
ATOM   8459  O  O   . ASP D  1 258 ? 60.775  -2.875  7.922    1.00 46.50  ? 257 ASP D O   1 
ATOM   8460  C  CB  . ASP D  1 258 ? 63.012  -1.288  8.591    1.00 43.36  ? 257 ASP D CB  1 
ATOM   8461  C  CG  . ASP D  1 258 ? 62.187  -0.019  8.837    1.00 47.64  ? 257 ASP D CG  1 
ATOM   8462  O  OD1 . ASP D  1 258 ? 61.001  -0.099  9.222    1.00 67.09  ? 257 ASP D OD1 1 
ATOM   8463  O  OD2 . ASP D  1 258 ? 62.733  1.083   8.618    1.00 82.32  ? 257 ASP D OD2 1 
HETATM 8464  N  N   . MSE D  1 259 ? 60.401  -3.288  10.104   1.00 43.66  ? 258 MSE D N   1 
HETATM 8465  C  CA  . MSE D  1 259 ? 59.055  -3.812  9.909    1.00 47.98  ? 258 MSE D CA  1 
HETATM 8466  C  C   . MSE D  1 259 ? 58.135  -2.873  9.131    1.00 46.18  ? 258 MSE D C   1 
HETATM 8467  O  O   . MSE D  1 259 ? 57.281  -3.326  8.366    1.00 44.60  ? 258 MSE D O   1 
HETATM 8468  C  CB  . MSE D  1 259 ? 58.442  -4.143  11.264   1.00 49.10  ? 258 MSE D CB  1 
HETATM 8469  C  CG  . MSE D  1 259 ? 59.112  -5.321  11.926   1.00 51.47  ? 258 MSE D CG  1 
HETATM 8470  SE SE  . MSE D  1 259 ? 58.732  -6.910  10.896   0.49 62.60  ? 258 MSE D SE  1 
HETATM 8471  C  CE  . MSE D  1 259 ? 60.480  -7.305  10.188   1.00 45.80  ? 258 MSE D CE  1 
ATOM   8472  N  N   . ASN D  1 260 ? 58.315  -1.573  9.331    1.00 41.48  ? 259 ASN D N   1 
ATOM   8473  C  CA  . ASN D  1 260 ? 57.518  -0.569  8.643    1.00 51.96  ? 259 ASN D CA  1 
ATOM   8474  C  C   . ASN D  1 260 ? 57.758  -0.563  7.140    1.00 54.31  ? 259 ASN D C   1 
ATOM   8475  O  O   . ASN D  1 260 ? 56.808  -0.545  6.356    1.00 37.64  ? 259 ASN D O   1 
ATOM   8476  C  CB  . ASN D  1 260 ? 57.805  0.818   9.203    1.00 44.85  ? 259 ASN D CB  1 
ATOM   8477  C  CG  . ASN D  1 260 ? 56.791  1.845   8.749    1.00 83.72  ? 259 ASN D CG  1 
ATOM   8478  O  OD1 . ASN D  1 260 ? 55.586  1.661   8.923    1.00 73.49  ? 259 ASN D OD1 1 
ATOM   8479  N  ND2 . ASN D  1 260 ? 57.273  2.927   8.146    1.00 52.24  ? 259 ASN D ND2 1 
ATOM   8480  N  N   . LYS D  1 261 ? 59.029  -0.561  6.745    1.00 43.36  ? 260 LYS D N   1 
ATOM   8481  C  CA  . LYS D  1 261 ? 59.384  -0.567  5.331    1.00 50.78  ? 260 LYS D CA  1 
ATOM   8482  C  C   . LYS D  1 261 ? 58.943  -1.871  4.687    1.00 33.44  ? 260 LYS D C   1 
ATOM   8483  O  O   . LYS D  1 261 ? 58.549  -1.909  3.517    1.00 33.01  ? 260 LYS D O   1 
ATOM   8484  C  CB  . LYS D  1 261 ? 60.894  -0.412  5.144    1.00 47.30  ? 260 LYS D CB  1 
ATOM   8485  C  CG  . LYS D  1 261 ? 61.457  0.965   5.423    1.00 47.12  ? 260 LYS D CG  1 
ATOM   8486  C  CD  . LYS D  1 261 ? 62.929  0.971   5.034    1.00 47.19  ? 260 LYS D CD  1 
ATOM   8487  C  CE  . LYS D  1 261 ? 63.460  2.359   4.787    1.00 71.16  ? 260 LYS D CE  1 
ATOM   8488  N  NZ  . LYS D  1 261 ? 64.849  2.265   4.264    1.00 51.26  ? 260 LYS D NZ  1 
ATOM   8489  N  N   . LEU D  1 262 ? 59.039  -2.957  5.445    1.00 41.89  ? 261 LEU D N   1 
ATOM   8490  C  CA  . LEU D  1 262 ? 58.636  -4.251  4.929    1.00 38.73  ? 261 LEU D CA  1 
ATOM   8491  C  C   . LEU D  1 262 ? 57.134  -4.244  4.624    1.00 35.80  ? 261 LEU D C   1 
ATOM   8492  O  O   . LEU D  1 262 ? 56.715  -4.589  3.513    1.00 37.32  ? 261 LEU D O   1 
ATOM   8493  C  CB  . LEU D  1 262 ? 59.001  -5.356  5.923    1.00 44.98  ? 261 LEU D CB  1 
ATOM   8494  C  CG  . LEU D  1 262 ? 58.435  -6.745  5.639    1.00 62.78  ? 261 LEU D CG  1 
ATOM   8495  C  CD1 . LEU D  1 262 ? 58.941  -7.244  4.312    1.00 45.49  ? 261 LEU D CD1 1 
ATOM   8496  C  CD2 . LEU D  1 262 ? 58.805  -7.715  6.754    1.00 59.96  ? 261 LEU D CD2 1 
ATOM   8497  N  N   . GLN D  1 263 ? 56.333  -3.833  5.604    1.00 38.14  ? 262 GLN D N   1 
ATOM   8498  C  CA  . GLN D  1 263 ? 54.883  -3.766  5.424    1.00 41.24  ? 262 GLN D CA  1 
ATOM   8499  C  C   . GLN D  1 263 ? 54.481  -2.796  4.315    1.00 37.99  ? 262 GLN D C   1 
ATOM   8500  O  O   . GLN D  1 263 ? 53.569  -3.082  3.536    1.00 37.67  ? 262 GLN D O   1 
ATOM   8501  C  CB  . GLN D  1 263 ? 54.177  -3.397  6.736    1.00 41.37  ? 262 GLN D CB  1 
ATOM   8502  C  CG  . GLN D  1 263 ? 54.056  -4.545  7.714    1.00 71.97  ? 262 GLN D CG  1 
ATOM   8503  C  CD  . GLN D  1 263 ? 53.121  -5.620  7.210    1.00 41.99  ? 262 GLN D CD  1 
ATOM   8504  O  OE1 . GLN D  1 263 ? 51.897  -5.489  7.307    1.00 89.79  ? 262 GLN D OE1 1 
ATOM   8505  N  NE2 . GLN D  1 263 ? 53.689  -6.683  6.648    1.00 79.06  ? 262 GLN D NE2 1 
ATOM   8506  N  N   . PHE D  1 264 ? 55.162  -1.658  4.226    1.00 37.85  ? 263 PHE D N   1 
ATOM   8507  C  CA  . PHE D  1 264 ? 54.833  -0.729  3.151    1.00 32.29  ? 263 PHE D CA  1 
ATOM   8508  C  C   . PHE D  1 264 ? 54.997  -1.365  1.772    1.00 39.97  ? 263 PHE D C   1 
ATOM   8509  O  O   . PHE D  1 264 ? 54.127  -1.225  0.913    1.00 33.78  ? 263 PHE D O   1 
ATOM   8510  C  CB  . PHE D  1 264 ? 55.655  0.562   3.216    1.00 28.97  ? 263 PHE D CB  1 
ATOM   8511  C  CG  . PHE D  1 264 ? 55.427  1.458   2.031    1.00 32.08  ? 263 PHE D CG  1 
ATOM   8512  C  CD1 . PHE D  1 264 ? 54.339  2.317   2.000    1.00 36.88  ? 263 PHE D CD1 1 
ATOM   8513  C  CD2 . PHE D  1 264 ? 56.279  1.407   0.927    1.00 32.45  ? 263 PHE D CD2 1 
ATOM   8514  C  CE1 . PHE D  1 264 ? 54.112  3.137   0.901    1.00 33.89  ? 263 PHE D CE1 1 
ATOM   8515  C  CE2 . PHE D  1 264 ? 56.055  2.208   -0.185   1.00 39.88  ? 263 PHE D CE2 1 
ATOM   8516  C  CZ  . PHE D  1 264 ? 54.969  3.075   -0.202   1.00 34.30  ? 263 PHE D CZ  1 
ATOM   8517  N  N   . HIS D  1 265 ? 56.115  -2.050  1.550    1.00 32.56  ? 264 HIS D N   1 
ATOM   8518  C  CA  . HIS D  1 265 ? 56.377  -2.601  0.222    1.00 36.34  ? 264 HIS D CA  1 
ATOM   8519  C  C   . HIS D  1 265 ? 55.513  -3.820  -0.106   1.00 27.40  ? 264 HIS D C   1 
ATOM   8520  O  O   . HIS D  1 265 ? 55.171  -4.055  -1.271   1.00 30.77  ? 264 HIS D O   1 
ATOM   8521  C  CB  . HIS D  1 265 ? 57.872  -2.870  0.023    1.00 33.99  ? 264 HIS D CB  1 
ATOM   8522  C  CG  . HIS D  1 265 ? 58.674  -1.611  -0.134   1.00 29.91  ? 264 HIS D CG  1 
ATOM   8523  N  ND1 . HIS D  1 265 ? 59.234  -0.950  0.936    1.00 33.90  ? 264 HIS D ND1 1 
ATOM   8524  C  CD2 . HIS D  1 265 ? 58.983  -0.880  -1.234   1.00 34.19  ? 264 HIS D CD2 1 
ATOM   8525  C  CE1 . HIS D  1 265 ? 59.865  0.130   0.502    1.00 29.85  ? 264 HIS D CE1 1 
ATOM   8526  N  NE2 . HIS D  1 265 ? 59.722  0.198   -0.810   1.00 30.97  ? 264 HIS D NE2 1 
ATOM   8527  N  N   . LEU D  1 266 ? 55.157  -4.585  0.918    1.00 36.64  ? 265 LEU D N   1 
ATOM   8528  C  CA  . LEU D  1 266 ? 54.223  -5.683  0.737    1.00 34.90  ? 265 LEU D CA  1 
ATOM   8529  C  C   . LEU D  1 266 ? 52.848  -5.159  0.304    1.00 38.62  ? 265 LEU D C   1 
ATOM   8530  O  O   . LEU D  1 266 ? 52.243  -5.670  -0.639   1.00 34.15  ? 265 LEU D O   1 
ATOM   8531  C  CB  . LEU D  1 266 ? 54.113  -6.507  2.019    1.00 32.66  ? 265 LEU D CB  1 
ATOM   8532  C  CG  . LEU D  1 266 ? 55.367  -7.328  2.327    1.00 41.18  ? 265 LEU D CG  1 
ATOM   8533  C  CD1 . LEU D  1 266 ? 55.201  -8.174  3.580    1.00 45.62  ? 265 LEU D CD1 1 
ATOM   8534  C  CD2 . LEU D  1 266 ? 55.702  -8.195  1.121    1.00 51.82  ? 265 LEU D CD2 1 
HETATM 8535  N  N   . MSE D  1 267 ? 52.361  -4.132  0.990    1.00 34.85  ? 266 MSE D N   1 
HETATM 8536  C  CA  . MSE D  1 267 ? 51.076  -3.529  0.626    1.00 36.96  ? 266 MSE D CA  1 
HETATM 8537  C  C   . MSE D  1 267 ? 51.099  -2.877  -0.763   1.00 40.19  ? 266 MSE D C   1 
HETATM 8538  O  O   . MSE D  1 267 ? 50.145  -2.996  -1.531   1.00 34.27  ? 266 MSE D O   1 
HETATM 8539  C  CB  . MSE D  1 267 ? 50.649  -2.523  1.690    1.00 30.35  ? 266 MSE D CB  1 
HETATM 8540  C  CG  . MSE D  1 267 ? 50.424  -3.177  3.041    1.00 32.86  ? 266 MSE D CG  1 
HETATM 8541  SE SE  . MSE D  1 267 ? 49.742  -1.931  4.343    0.75 44.00  ? 266 MSE D SE  1 
HETATM 8542  C  CE  . MSE D  1 267 ? 47.881  -1.919  3.825    1.00 46.69  ? 266 MSE D CE  1 
ATOM   8543  N  N   . LEU D  1 268 ? 52.192  -2.198  -1.087   1.00 33.14  ? 267 LEU D N   1 
ATOM   8544  C  CA  . LEU D  1 268 ? 52.314  -1.584  -2.408   1.00 33.74  ? 267 LEU D CA  1 
ATOM   8545  C  C   . LEU D  1 268 ? 52.222  -2.627  -3.521   1.00 35.56  ? 267 LEU D C   1 
ATOM   8546  O  O   . LEU D  1 268 ? 51.552  -2.399  -4.521   1.00 34.10  ? 267 LEU D O   1 
ATOM   8547  C  CB  . LEU D  1 268 ? 53.604  -0.772  -2.524   1.00 31.84  ? 267 LEU D CB  1 
ATOM   8548  C  CG  . LEU D  1 268 ? 53.868  -0.117  -3.879   1.00 30.03  ? 267 LEU D CG  1 
ATOM   8549  C  CD1 . LEU D  1 268 ? 52.808  0.933   -4.210   1.00 35.45  ? 267 LEU D CD1 1 
ATOM   8550  C  CD2 . LEU D  1 268 ? 55.246  0.529   -3.879   1.00 32.18  ? 267 LEU D CD2 1 
ATOM   8551  N  N   . ASP D  1 269 ? 52.855  -3.784  -3.332   1.00 32.06  ? 268 ASP D N   1 
ATOM   8552  C  CA  . ASP D  1 269 ? 52.798  -4.833  -4.348   1.00 33.19  ? 268 ASP D CA  1 
ATOM   8553  C  C   . ASP D  1 269 ? 51.386  -5.405  -4.527   1.00 33.43  ? 268 ASP D C   1 
ATOM   8554  O  O   . ASP D  1 269 ? 51.095  -5.991  -5.571   1.00 35.81  ? 268 ASP D O   1 
ATOM   8555  C  CB  . ASP D  1 269 ? 53.801  -5.962  -4.068   1.00 33.33  ? 268 ASP D CB  1 
ATOM   8556  C  CG  . ASP D  1 269 ? 54.172  -6.746  -5.336   1.00 47.65  ? 268 ASP D CG  1 
ATOM   8557  O  OD1 . ASP D  1 269 ? 54.361  -6.122  -6.404   1.00 38.27  ? 268 ASP D OD1 1 
ATOM   8558  O  OD2 . ASP D  1 269 ? 54.283  -7.986  -5.273   1.00 41.49  ? 268 ASP D OD2 1 
ATOM   8559  N  N   . GLU D  1 270 ? 50.510  -5.217  -3.531   1.00 30.64  ? 269 GLU D N   1 
ATOM   8560  C  CA  . GLU D  1 270 ? 49.107  -5.637  -3.665   1.00 29.68  ? 269 GLU D CA  1 
ATOM   8561  C  C   . GLU D  1 270 ? 48.412  -4.970  -4.853   1.00 39.04  ? 269 GLU D C   1 
ATOM   8562  O  O   . GLU D  1 270 ? 47.432  -5.490  -5.374   1.00 33.04  ? 269 GLU D O   1 
ATOM   8563  C  CB  . GLU D  1 270 ? 48.283  -5.350  -2.395   1.00 33.32  ? 269 GLU D CB  1 
ATOM   8564  C  CG  . GLU D  1 270 ? 48.823  -5.956  -1.104   1.00 41.24  ? 269 GLU D CG  1 
ATOM   8565  C  CD  . GLU D  1 270 ? 48.609  -7.450  -1.014   1.00 41.19  ? 269 GLU D CD  1 
ATOM   8566  O  OE1 . GLU D  1 270 ? 48.658  -8.129  -2.059   1.00 36.53  ? 269 GLU D OE1 1 
ATOM   8567  O  OE2 . GLU D  1 270 ? 48.370  -7.947  0.103    1.00 34.65  ? 269 GLU D OE2 1 
ATOM   8568  N  N   . PHE D  1 271 ? 48.922  -3.818  -5.273   1.00 33.59  ? 270 PHE D N   1 
ATOM   8569  C  CA  . PHE D  1 271 ? 48.279  -3.046  -6.324   1.00 38.51  ? 270 PHE D CA  1 
ATOM   8570  C  C   . PHE D  1 271 ? 48.722  -3.451  -7.721   1.00 47.67  ? 270 PHE D C   1 
ATOM   8571  O  O   . PHE D  1 271 ? 48.177  -2.967  -8.710   1.00 44.63  ? 270 PHE D O   1 
ATOM   8572  C  CB  . PHE D  1 271 ? 48.534  -1.548  -6.106   1.00 37.04  ? 270 PHE D CB  1 
ATOM   8573  C  CG  . PHE D  1 271 ? 47.819  -0.999  -4.906   1.00 39.96  ? 270 PHE D CG  1 
ATOM   8574  C  CD1 . PHE D  1 271 ? 48.347  -1.167  -3.633   1.00 35.20  ? 270 PHE D CD1 1 
ATOM   8575  C  CD2 . PHE D  1 271 ? 46.614  -0.327  -5.044   1.00 30.45  ? 270 PHE D CD2 1 
ATOM   8576  C  CE1 . PHE D  1 271 ? 47.689  -0.673  -2.520   1.00 36.47  ? 270 PHE D CE1 1 
ATOM   8577  C  CE2 . PHE D  1 271 ? 45.949  0.171   -3.936   1.00 38.81  ? 270 PHE D CE2 1 
ATOM   8578  C  CZ  . PHE D  1 271 ? 46.482  -0.008  -2.672   1.00 36.45  ? 270 PHE D CZ  1 
ATOM   8579  N  N   . PHE D  1 272 ? 49.700  -4.345  -7.808   1.00 42.49  ? 271 PHE D N   1 
ATOM   8580  C  CA  . PHE D  1 272 ? 50.296  -4.647  -9.108   1.00 39.09  ? 271 PHE D CA  1 
ATOM   8581  C  C   . PHE D  1 272 ? 50.123  -6.079  -9.587   1.00 54.42  ? 271 PHE D C   1 
ATOM   8582  O  O   . PHE D  1 272 ? 50.737  -6.442  -10.595  1.00 56.63  ? 271 PHE D O   1 
ATOM   8583  C  CB  . PHE D  1 272 ? 51.771  -4.238  -9.118   1.00 38.38  ? 271 PHE D CB  1 
ATOM   8584  C  CG  . PHE D  1 272 ? 51.972  -2.772  -8.924   1.00 41.95  ? 271 PHE D CG  1 
ATOM   8585  C  CD1 . PHE D  1 272 ? 51.885  -1.906  -10.000  1.00 42.82  ? 271 PHE D CD1 1 
ATOM   8586  C  CD2 . PHE D  1 272 ? 52.217  -2.250  -7.667   1.00 41.81  ? 271 PHE D CD2 1 
ATOM   8587  C  CE1 . PHE D  1 272 ? 52.048  -0.542  -9.831   1.00 46.58  ? 271 PHE D CE1 1 
ATOM   8588  C  CE2 . PHE D  1 272 ? 52.391  -0.880  -7.493   1.00 43.96  ? 271 PHE D CE2 1 
ATOM   8589  C  CZ  . PHE D  1 272 ? 52.303  -0.031  -8.580   1.00 37.95  ? 271 PHE D CZ  1 
ATOM   8590  O  OXT . PHE D  1 272 ? 49.373  -6.877  -9.004   1.00 47.82  ? 271 PHE D OXT 1 
ATOM   8591  N  N   . SER E  1 12  ? 39.732  45.177  -105.924 1.00 101.48 ? 11  SER E N   1 
ATOM   8592  C  CA  . SER E  1 12  ? 41.134  45.538  -105.728 1.00 125.21 ? 11  SER E CA  1 
ATOM   8593  C  C   . SER E  1 12  ? 41.948  44.411  -105.084 1.00 117.28 ? 11  SER E C   1 
ATOM   8594  O  O   . SER E  1 12  ? 43.017  44.658  -104.522 1.00 127.32 ? 11  SER E O   1 
ATOM   8595  C  CB  . SER E  1 12  ? 41.249  46.814  -104.883 1.00 123.34 ? 11  SER E CB  1 
ATOM   8596  O  OG  . SER E  1 12  ? 40.863  46.587  -103.536 1.00 102.67 ? 11  SER E OG  1 
ATOM   8597  N  N   . ARG E  1 13  ? 41.443  43.180  -105.174 1.00 87.58  ? 12  ARG E N   1 
ATOM   8598  C  CA  . ARG E  1 13  ? 42.112  42.013  -104.590 1.00 120.09 ? 12  ARG E CA  1 
ATOM   8599  C  C   . ARG E  1 13  ? 43.503  41.793  -105.192 1.00 95.21  ? 12  ARG E C   1 
ATOM   8600  O  O   . ARG E  1 13  ? 43.646  41.680  -106.410 1.00 127.81 ? 12  ARG E O   1 
ATOM   8601  C  CB  . ARG E  1 13  ? 41.249  40.762  -104.775 1.00 91.39  ? 12  ARG E CB  1 
ATOM   8602  C  CG  . ARG E  1 13  ? 39.848  40.899  -104.207 1.00 87.08  ? 12  ARG E CG  1 
ATOM   8603  C  CD  . ARG E  1 13  ? 38.846  40.027  -104.952 1.00 106.67 ? 12  ARG E CD  1 
ATOM   8604  N  NE  . ARG E  1 13  ? 37.466  40.467  -104.737 1.00 125.14 ? 12  ARG E NE  1 
ATOM   8605  C  CZ  . ARG E  1 13  ? 36.520  39.729  -104.163 1.00 113.42 ? 12  ARG E CZ  1 
ATOM   8606  N  NH1 . ARG E  1 13  ? 36.793  38.499  -103.745 1.00 113.88 ? 12  ARG E NH1 1 
ATOM   8607  N  NH2 . ARG E  1 13  ? 35.296  40.217  -104.011 1.00 87.37  ? 12  ARG E NH2 1 
ATOM   8608  N  N   . PRO E  1 14  ? 44.534  41.728  -104.335 1.00 106.02 ? 13  PRO E N   1 
ATOM   8609  C  CA  . PRO E  1 14  ? 45.932  41.690  -104.772 1.00 121.69 ? 13  PRO E CA  1 
ATOM   8610  C  C   . PRO E  1 14  ? 46.478  40.277  -104.987 1.00 129.75 ? 13  PRO E C   1 
ATOM   8611  O  O   . PRO E  1 14  ? 45.743  39.290  -104.885 1.00 113.13 ? 13  PRO E O   1 
ATOM   8612  C  CB  . PRO E  1 14  ? 46.676  42.353  -103.603 1.00 125.46 ? 13  PRO E CB  1 
ATOM   8613  C  CG  . PRO E  1 14  ? 45.683  42.373  -102.429 1.00 103.79 ? 13  PRO E CG  1 
ATOM   8614  C  CD  . PRO E  1 14  ? 44.437  41.659  -102.870 1.00 109.08 ? 13  PRO E CD  1 
ATOM   8615  N  N   . ARG E  1 15  ? 47.774  40.200  -105.279 1.00 135.94 ? 14  ARG E N   1 
ATOM   8616  C  CA  . ARG E  1 15  ? 48.451  38.932  -105.527 1.00 117.81 ? 14  ARG E CA  1 
ATOM   8617  C  C   . ARG E  1 15  ? 49.404  38.582  -104.390 1.00 116.97 ? 14  ARG E C   1 
ATOM   8618  O  O   . ARG E  1 15  ? 50.318  39.350  -104.076 1.00 121.19 ? 14  ARG E O   1 
ATOM   8619  C  CB  . ARG E  1 15  ? 49.218  38.996  -106.853 1.00 133.56 ? 14  ARG E CB  1 
ATOM   8620  C  CG  . ARG E  1 15  ? 50.000  40.291  -107.053 1.00 135.58 ? 14  ARG E CG  1 
ATOM   8621  C  CD  . ARG E  1 15  ? 50.778  40.300  -108.364 1.00 143.22 ? 14  ARG E CD  1 
ATOM   8622  N  NE  . ARG E  1 15  ? 51.566  41.522  -108.522 1.00 148.88 ? 14  ARG E NE  1 
ATOM   8623  C  CZ  . ARG E  1 15  ? 52.769  41.713  -107.983 1.00 140.95 ? 14  ARG E CZ  1 
ATOM   8624  N  NH1 . ARG E  1 15  ? 53.328  40.762  -107.245 1.00 104.85 ? 14  ARG E NH1 1 
ATOM   8625  N  NH2 . ARG E  1 15  ? 53.415  42.856  -108.179 1.00 126.99 ? 14  ARG E NH2 1 
ATOM   8626  N  N   . LEU E  1 16  ? 49.182  37.426  -103.768 1.00 115.54 ? 15  LEU E N   1 
ATOM   8627  C  CA  . LEU E  1 16  ? 50.090  36.922  -102.742 1.00 88.49  ? 15  LEU E CA  1 
ATOM   8628  C  C   . LEU E  1 16  ? 51.377  36.427  -103.402 1.00 105.25 ? 15  LEU E C   1 
ATOM   8629  O  O   . LEU E  1 16  ? 51.374  36.030  -104.568 1.00 122.62 ? 15  LEU E O   1 
ATOM   8630  C  CB  . LEU E  1 16  ? 49.428  35.801  -101.931 1.00 102.12 ? 15  LEU E CB  1 
ATOM   8631  C  CG  . LEU E  1 16  ? 50.265  35.068  -100.872 1.00 96.30  ? 15  LEU E CG  1 
ATOM   8632  C  CD1 . LEU E  1 16  ? 50.791  36.028  -99.818  1.00 96.86  ? 15  LEU E CD1 1 
ATOM   8633  C  CD2 . LEU E  1 16  ? 49.473  33.942  -100.216 1.00 101.61 ? 15  LEU E CD2 1 
ATOM   8634  N  N   . ASN E  1 17  ? 52.473  36.453  -102.652 1.00 139.87 ? 16  ASN E N   1 
ATOM   8635  C  CA  . ASN E  1 17  ? 53.779  36.079  -103.181 1.00 132.57 ? 16  ASN E CA  1 
ATOM   8636  C  C   . ASN E  1 17  ? 53.989  34.565  -103.328 1.00 139.75 ? 16  ASN E C   1 
ATOM   8637  O  O   . ASN E  1 17  ? 54.367  34.095  -104.408 1.00 123.98 ? 16  ASN E O   1 
ATOM   8638  C  CB  . ASN E  1 17  ? 54.880  36.707  -102.325 1.00 135.73 ? 16  ASN E CB  1 
ATOM   8639  C  CG  . ASN E  1 17  ? 54.581  38.155  -101.972 1.00 128.77 ? 16  ASN E CG  1 
ATOM   8640  O  OD1 . ASN E  1 17  ? 54.461  38.508  -100.797 1.00 96.94  ? 16  ASN E OD1 1 
ATOM   8641  N  ND2 . ASN E  1 17  ? 54.438  38.999  -102.995 1.00 125.97 ? 16  ASN E ND2 1 
ATOM   8642  N  N   . SER E  1 18  ? 53.738  33.809  -102.255 1.00 89.67  ? 17  SER E N   1 
ATOM   8643  C  CA  . SER E  1 18  ? 53.918  32.351  -102.282 1.00 85.37  ? 17  SER E CA  1 
ATOM   8644  C  C   . SER E  1 18  ? 53.252  31.609  -101.114 1.00 105.48 ? 17  SER E C   1 
ATOM   8645  O  O   . SER E  1 18  ? 52.991  32.186  -100.051 1.00 94.41  ? 17  SER E O   1 
ATOM   8646  C  CB  . SER E  1 18  ? 55.412  31.984  -102.338 1.00 100.67 ? 17  SER E CB  1 
ATOM   8647  O  OG  . SER E  1 18  ? 56.114  32.430  -101.183 1.00 63.58  ? 17  SER E OG  1 
ATOM   8648  N  N   . ASN E  1 19  ? 52.987  30.322  -101.325 1.00 76.00  ? 18  ASN E N   1 
ATOM   8649  C  CA  . ASN E  1 19  ? 52.466  29.452  -100.274 1.00 82.51  ? 18  ASN E CA  1 
ATOM   8650  C  C   . ASN E  1 19  ? 53.561  28.537  -99.736  1.00 66.29  ? 18  ASN E C   1 
ATOM   8651  O  O   . ASN E  1 19  ? 54.618  28.388  -100.358 1.00 63.91  ? 18  ASN E O   1 
ATOM   8652  C  CB  . ASN E  1 19  ? 51.294  28.612  -100.790 1.00 73.15  ? 18  ASN E CB  1 
ATOM   8653  C  CG  . ASN E  1 19  ? 50.096  29.457  -101.190 1.00 94.19  ? 18  ASN E CG  1 
ATOM   8654  O  OD1 . ASN E  1 19  ? 49.218  29.001  -101.926 1.00 101.38 ? 18  ASN E OD1 1 
ATOM   8655  N  ND2 . ASN E  1 19  ? 50.056  30.697  -100.712 1.00 97.27  ? 18  ASN E ND2 1 
ATOM   8656  N  N   . LEU E  1 20  ? 53.310  27.922  -98.585  1.00 72.70  ? 19  LEU E N   1 
ATOM   8657  C  CA  . LEU E  1 20  ? 54.302  27.038  -97.975  1.00 73.83  ? 19  LEU E CA  1 
ATOM   8658  C  C   . LEU E  1 20  ? 54.579  25.811  -98.847  1.00 46.59  ? 19  LEU E C   1 
ATOM   8659  O  O   . LEU E  1 20  ? 55.726  25.372  -98.967  1.00 87.76  ? 19  LEU E O   1 
ATOM   8660  C  CB  . LEU E  1 20  ? 53.862  26.604  -96.572  1.00 59.48  ? 19  LEU E CB  1 
ATOM   8661  C  CG  . LEU E  1 20  ? 54.931  25.920  -95.716  1.00 62.06  ? 19  LEU E CG  1 
ATOM   8662  C  CD1 . LEU E  1 20  ? 56.062  26.893  -95.405  1.00 51.62  ? 19  LEU E CD1 1 
ATOM   8663  C  CD2 . LEU E  1 20  ? 54.344  25.340  -94.430  1.00 47.18  ? 19  LEU E CD2 1 
ATOM   8664  N  N   A ASP E  1 21  ? 53.537  25.262  -99.463  0.50 67.79  ? 20  ASP E N   1 
ATOM   8665  N  N   B ASP E  1 21  ? 53.512  25.277  -99.441  0.50 67.61  ? 20  ASP E N   1 
ATOM   8666  C  CA  A ASP E  1 21  ? 53.692  24.031  -100.234 0.50 66.03  ? 20  ASP E CA  1 
ATOM   8667  C  CA  B ASP E  1 21  ? 53.580  24.092  -100.293 0.50 65.52  ? 20  ASP E CA  1 
ATOM   8668  C  C   A ASP E  1 21  ? 54.580  24.212  -101.468 0.50 65.13  ? 20  ASP E C   1 
ATOM   8669  C  C   B ASP E  1 21  ? 54.608  24.244  -101.403 0.50 65.44  ? 20  ASP E C   1 
ATOM   8670  O  O   A ASP E  1 21  ? 55.186  23.252  -101.942 0.50 74.65  ? 20  ASP E O   1 
ATOM   8671  O  O   B ASP E  1 21  ? 55.343  23.309  -101.715 0.50 64.27  ? 20  ASP E O   1 
ATOM   8672  C  CB  A ASP E  1 21  ? 52.332  23.458  -100.631 0.50 76.45  ? 20  ASP E CB  1 
ATOM   8673  C  CB  B ASP E  1 21  ? 52.206  23.811  -100.907 0.50 53.93  ? 20  ASP E CB  1 
ATOM   8674  C  CG  A ASP E  1 21  ? 51.629  24.297  -101.667 0.50 44.49  ? 20  ASP E CG  1 
ATOM   8675  C  CG  B ASP E  1 21  ? 51.204  23.312  -99.885  0.50 81.90  ? 20  ASP E CG  1 
ATOM   8676  O  OD1 A ASP E  1 21  ? 51.845  25.527  -101.686 0.50 73.14  ? 20  ASP E OD1 1 
ATOM   8677  O  OD1 B ASP E  1 21  ? 50.657  24.141  -99.125  0.50 70.10  ? 20  ASP E OD1 1 
ATOM   8678  O  OD2 A ASP E  1 21  ? 50.862  23.725  -102.470 0.50 80.18  ? 20  ASP E OD2 1 
ATOM   8679  O  OD2 B ASP E  1 21  ? 50.968  22.086  -99.840  0.50 78.78  ? 20  ASP E OD2 1 
ATOM   8680  N  N   . ALA E  1 22  ? 54.653  25.437  -101.983 1.00 64.23  ? 21  ALA E N   1 
ATOM   8681  C  CA  . ALA E  1 22  ? 55.532  25.738  -103.110 1.00 65.11  ? 21  ALA E CA  1 
ATOM   8682  C  C   . ALA E  1 22  ? 57.007  25.483  -102.782 1.00 56.92  ? 21  ALA E C   1 
ATOM   8683  O  O   . ALA E  1 22  ? 57.777  25.034  -103.634 1.00 69.47  ? 21  ALA E O   1 
ATOM   8684  C  CB  . ALA E  1 22  ? 55.334  27.178  -103.546 1.00 68.88  ? 21  ALA E CB  1 
ATOM   8685  N  N   . ASP E  1 23  ? 57.380  25.767  -101.538 1.00 56.67  ? 22  ASP E N   1 
ATOM   8686  C  CA  . ASP E  1 23  ? 58.763  25.646  -101.088 1.00 53.94  ? 22  ASP E CA  1 
ATOM   8687  C  C   . ASP E  1 23  ? 59.167  24.210  -100.744 1.00 87.20  ? 22  ASP E C   1 
ATOM   8688  O  O   . ASP E  1 23  ? 60.318  23.963  -100.389 1.00 55.79  ? 22  ASP E O   1 
ATOM   8689  C  CB  . ASP E  1 23  ? 58.993  26.520  -99.843  1.00 60.86  ? 22  ASP E CB  1 
ATOM   8690  C  CG  . ASP E  1 23  ? 58.903  28.007  -100.137 1.00 86.38  ? 22  ASP E CG  1 
ATOM   8691  O  OD1 . ASP E  1 23  ? 59.306  28.425  -101.245 1.00 79.71  ? 22  ASP E OD1 1 
ATOM   8692  O  OD2 . ASP E  1 23  ? 58.430  28.755  -99.254  1.00 61.32  ? 22  ASP E OD2 1 
ATOM   8693  N  N   . LEU E  1 24  ? 58.236  23.266  -100.837 1.00 61.08  ? 23  LEU E N   1 
ATOM   8694  C  CA  . LEU E  1 24  ? 58.483  21.940  -100.277 1.00 54.71  ? 23  LEU E CA  1 
ATOM   8695  C  C   . LEU E  1 24  ? 58.615  20.836  -101.317 1.00 72.54  ? 23  LEU E C   1 
ATOM   8696  O  O   . LEU E  1 24  ? 58.861  19.681  -100.970 1.00 58.51  ? 23  LEU E O   1 
ATOM   8697  C  CB  . LEU E  1 24  ? 57.395  21.584  -99.258  1.00 54.94  ? 23  LEU E CB  1 
ATOM   8698  C  CG  . LEU E  1 24  ? 57.203  22.594  -98.118  1.00 58.78  ? 23  LEU E CG  1 
ATOM   8699  C  CD1 . LEU E  1 24  ? 56.101  22.150  -97.162  1.00 58.67  ? 23  LEU E CD1 1 
ATOM   8700  C  CD2 . LEU E  1 24  ? 58.509  22.831  -97.368  1.00 54.14  ? 23  LEU E CD2 1 
ATOM   8701  N  N   . TYR E  1 25  ? 58.462  21.189  -102.588 1.00 43.03  ? 24  TYR E N   1 
ATOM   8702  C  CA  . TYR E  1 25  ? 58.462  20.193  -103.638 1.00 45.90  ? 24  TYR E CA  1 
ATOM   8703  C  C   . TYR E  1 25  ? 59.791  19.457  -103.689 1.00 61.47  ? 24  TYR E C   1 
ATOM   8704  O  O   . TYR E  1 25  ? 60.848  20.051  -103.475 1.00 58.06  ? 24  TYR E O   1 
ATOM   8705  C  CB  . TYR E  1 25  ? 58.171  20.853  -104.988 1.00 74.27  ? 24  TYR E CB  1 
ATOM   8706  C  CG  . TYR E  1 25  ? 56.709  20.845  -105.361 1.00 69.32  ? 24  TYR E CG  1 
ATOM   8707  C  CD1 . TYR E  1 25  ? 55.747  21.377  -104.510 1.00 67.46  ? 24  TYR E CD1 1 
ATOM   8708  C  CD2 . TYR E  1 25  ? 56.290  20.301  -106.568 1.00 82.94  ? 24  TYR E CD2 1 
ATOM   8709  C  CE1 . TYR E  1 25  ? 54.404  21.361  -104.855 1.00 63.50  ? 24  TYR E CE1 1 
ATOM   8710  C  CE2 . TYR E  1 25  ? 54.957  20.284  -106.923 1.00 95.35  ? 24  TYR E CE2 1 
ATOM   8711  C  CZ  . TYR E  1 25  ? 54.017  20.815  -106.066 1.00 95.54  ? 24  TYR E CZ  1 
ATOM   8712  O  OH  . TYR E  1 25  ? 52.688  20.791  -106.434 1.00 109.96 ? 24  TYR E OH  1 
ATOM   8713  N  N   . GLY E  1 26  ? 59.724  18.156  -103.951 1.00 59.79  ? 25  GLY E N   1 
ATOM   8714  C  CA  . GLY E  1 26  ? 60.914  17.358  -104.173 1.00 54.97  ? 25  GLY E CA  1 
ATOM   8715  C  C   . GLY E  1 26  ? 61.694  16.966  -102.931 1.00 58.90  ? 25  GLY E C   1 
ATOM   8716  O  O   . GLY E  1 26  ? 62.723  16.298  -103.046 1.00 60.29  ? 25  GLY E O   1 
ATOM   8717  N  N   . TYR E  1 27  ? 61.221  17.374  -101.752 1.00 46.94  ? 26  TYR E N   1 
ATOM   8718  C  CA  . TYR E  1 27  ? 61.918  17.069  -100.499 1.00 61.26  ? 26  TYR E CA  1 
ATOM   8719  C  C   . TYR E  1 27  ? 61.499  15.748  -99.848  1.00 47.85  ? 26  TYR E C   1 
ATOM   8720  O  O   . TYR E  1 27  ? 60.321  15.406  -99.813  1.00 54.32  ? 26  TYR E O   1 
ATOM   8721  C  CB  . TYR E  1 27  ? 61.755  18.215  -99.486  1.00 44.42  ? 26  TYR E CB  1 
ATOM   8722  C  CG  . TYR E  1 27  ? 62.720  19.363  -99.709  1.00 43.79  ? 26  TYR E CG  1 
ATOM   8723  C  CD1 . TYR E  1 27  ? 64.072  19.221  -99.417  1.00 39.65  ? 26  TYR E CD1 1 
ATOM   8724  C  CD2 . TYR E  1 27  ? 62.280  20.585  -100.207 1.00 56.19  ? 26  TYR E CD2 1 
ATOM   8725  C  CE1 . TYR E  1 27  ? 64.966  20.268  -99.617  1.00 45.99  ? 26  TYR E CE1 1 
ATOM   8726  C  CE2 . TYR E  1 27  ? 63.164  21.638  -100.414 1.00 43.57  ? 26  TYR E CE2 1 
ATOM   8727  C  CZ  . TYR E  1 27  ? 64.503  21.473  -100.119 1.00 61.04  ? 26  TYR E CZ  1 
ATOM   8728  O  OH  . TYR E  1 27  ? 65.379  22.519  -100.321 1.00 50.08  ? 26  TYR E OH  1 
ATOM   8729  N  N   . ARG E  1 28  ? 62.483  15.011  -99.341  1.00 59.90  ? 27  ARG E N   1 
ATOM   8730  C  CA  . ARG E  1 28  ? 62.219  13.876  -98.466  1.00 53.95  ? 27  ARG E CA  1 
ATOM   8731  C  C   . ARG E  1 28  ? 61.932  14.429  -97.070  1.00 64.16  ? 27  ARG E C   1 
ATOM   8732  O  O   . ARG E  1 28  ? 62.431  15.498  -96.711  1.00 48.74  ? 27  ARG E O   1 
ATOM   8733  C  CB  . ARG E  1 28  ? 63.425  12.928  -98.428  1.00 51.79  ? 27  ARG E CB  1 
ATOM   8734  C  CG  . ARG E  1 28  ? 63.665  12.161  -99.725  1.00 60.97  ? 27  ARG E CG  1 
ATOM   8735  C  CD  . ARG E  1 28  ? 65.003  11.429  -99.719  1.00 89.52  ? 27  ARG E CD  1 
ATOM   8736  N  NE  . ARG E  1 28  ? 65.107  10.409  -98.675  1.00 102.31 ? 27  ARG E NE  1 
ATOM   8737  C  CZ  . ARG E  1 28  ? 66.107  9.532   -98.588  1.00 92.80  ? 27  ARG E CZ  1 
ATOM   8738  N  NH1 . ARG E  1 28  ? 66.135  8.634   -97.609  1.00 73.00  ? 27  ARG E NH1 1 
ATOM   8739  N  NH2 . ARG E  1 28  ? 67.083  9.548   -99.486  1.00 93.92  ? 27  ARG E NH2 1 
ATOM   8740  N  N   . TRP E  1 29  ? 61.130  13.718  -96.282  1.00 39.91  ? 28  TRP E N   1 
ATOM   8741  C  CA  . TRP E  1 29  ? 60.779  14.211  -94.944  1.00 37.35  ? 28  TRP E CA  1 
ATOM   8742  C  C   . TRP E  1 29  ? 61.259  13.290  -93.828  1.00 46.19  ? 28  TRP E C   1 
ATOM   8743  O  O   . TRP E  1 29  ? 61.142  12.074  -93.923  1.00 50.36  ? 28  TRP E O   1 
ATOM   8744  C  CB  . TRP E  1 29  ? 59.269  14.376  -94.810  1.00 40.91  ? 28  TRP E CB  1 
ATOM   8745  C  CG  . TRP E  1 29  ? 58.688  15.489  -95.607  1.00 60.71  ? 28  TRP E CG  1 
ATOM   8746  C  CD1 . TRP E  1 29  ? 58.514  15.528  -96.963  1.00 56.47  ? 28  TRP E CD1 1 
ATOM   8747  C  CD2 . TRP E  1 29  ? 58.166  16.723  -95.098  1.00 53.74  ? 28  TRP E CD2 1 
ATOM   8748  N  NE1 . TRP E  1 29  ? 57.931  16.718  -97.327  1.00 57.35  ? 28  TRP E NE1 1 
ATOM   8749  C  CE2 . TRP E  1 29  ? 57.703  17.466  -96.201  1.00 46.57  ? 28  TRP E CE2 1 
ATOM   8750  C  CE3 . TRP E  1 29  ? 58.059  17.277  -93.817  1.00 43.42  ? 28  TRP E CE3 1 
ATOM   8751  C  CZ2 . TRP E  1 29  ? 57.144  18.734  -96.061  1.00 45.53  ? 28  TRP E CZ2 1 
ATOM   8752  C  CZ3 . TRP E  1 29  ? 57.497  18.533  -93.679  1.00 47.13  ? 28  TRP E CZ3 1 
ATOM   8753  C  CH2 . TRP E  1 29  ? 57.049  19.248  -94.795  1.00 51.15  ? 28  TRP E CH2 1 
ATOM   8754  N  N   . ALA E  1 30  ? 61.788  13.881  -92.767  1.00 45.44  ? 29  ALA E N   1 
ATOM   8755  C  CA  . ALA E  1 30  ? 62.128  13.137  -91.562  1.00 50.16  ? 29  ALA E CA  1 
ATOM   8756  C  C   . ALA E  1 30  ? 61.745  13.959  -90.350  1.00 47.20  ? 29  ALA E C   1 
ATOM   8757  O  O   . ALA E  1 30  ? 61.591  15.176  -90.431  1.00 40.69  ? 29  ALA E O   1 
ATOM   8758  C  CB  . ALA E  1 30  ? 63.601  12.806  -91.523  1.00 39.80  ? 29  ALA E CB  1 
ATOM   8759  N  N   . ARG E  1 31  ? 61.592  13.294  -89.219  1.00 42.08  ? 30  ARG E N   1 
ATOM   8760  C  CA  . ARG E  1 31  ? 61.164  13.972  -88.008  1.00 33.91  ? 30  ARG E CA  1 
ATOM   8761  C  C   . ARG E  1 31  ? 62.253  13.805  -86.965  1.00 37.93  ? 30  ARG E C   1 
ATOM   8762  O  O   . ARG E  1 31  ? 62.668  12.689  -86.693  1.00 36.48  ? 30  ARG E O   1 
ATOM   8763  C  CB  . ARG E  1 31  ? 59.874  13.333  -87.513  1.00 35.31  ? 30  ARG E CB  1 
ATOM   8764  C  CG  . ARG E  1 31  ? 59.370  13.918  -86.215  1.00 33.56  ? 30  ARG E CG  1 
ATOM   8765  C  CD  . ARG E  1 31  ? 58.075  13.252  -85.791  1.00 35.82  ? 30  ARG E CD  1 
ATOM   8766  N  NE  . ARG E  1 31  ? 57.610  13.781  -84.512  1.00 42.36  ? 30  ARG E NE  1 
ATOM   8767  C  CZ  . ARG E  1 31  ? 56.368  13.657  -84.063  1.00 45.96  ? 30  ARG E CZ  1 
ATOM   8768  N  NH1 . ARG E  1 31  ? 56.027  14.170  -82.888  1.00 49.61  ? 30  ARG E NH1 1 
ATOM   8769  N  NH2 . ARG E  1 31  ? 55.469  13.019  -84.798  1.00 41.60  ? 30  ARG E NH2 1 
ATOM   8770  N  N   . ASP E  1 32  ? 62.709  14.907  -86.380  1.00 31.35  ? 31  ASP E N   1 
ATOM   8771  C  CA  . ASP E  1 32  ? 63.826  14.857  -85.439  1.00 37.96  ? 31  ASP E CA  1 
ATOM   8772  C  C   . ASP E  1 32  ? 63.362  15.205  -84.032  1.00 34.65  ? 31  ASP E C   1 
ATOM   8773  O  O   . ASP E  1 32  ? 62.778  16.271  -83.813  1.00 39.83  ? 31  ASP E O   1 
ATOM   8774  C  CB  . ASP E  1 32  ? 64.922  15.849  -85.852  1.00 36.52  ? 31  ASP E CB  1 
ATOM   8775  C  CG  . ASP E  1 32  ? 65.511  15.548  -87.224  1.00 55.52  ? 31  ASP E CG  1 
ATOM   8776  O  OD1 . ASP E  1 32  ? 65.546  14.371  -87.622  1.00 49.45  ? 31  ASP E OD1 1 
ATOM   8777  O  OD2 . ASP E  1 32  ? 65.952  16.494  -87.905  1.00 52.04  ? 31  ASP E OD2 1 
ATOM   8778  N  N   . ASN E  1 33  ? 63.636  14.323  -83.078  1.00 38.31  ? 32  ASN E N   1 
ATOM   8779  C  CA  . ASN E  1 33  ? 63.354  14.615  -81.677  1.00 38.50  ? 32  ASN E CA  1 
ATOM   8780  C  C   . ASN E  1 33  ? 64.528  15.410  -81.087  1.00 37.81  ? 32  ASN E C   1 
ATOM   8781  O  O   . ASN E  1 33  ? 65.411  14.836  -80.456  1.00 53.49  ? 32  ASN E O   1 
ATOM   8782  C  CB  . ASN E  1 33  ? 63.089  13.312  -80.902  1.00 39.65  ? 32  ASN E CB  1 
ATOM   8783  C  CG  . ASN E  1 33  ? 62.663  13.551  -79.451  1.00 41.41  ? 32  ASN E CG  1 
ATOM   8784  O  OD1 . ASN E  1 33  ? 62.408  14.677  -79.049  1.00 38.34  ? 32  ASN E OD1 1 
ATOM   8785  N  ND2 . ASN E  1 33  ? 62.563  12.470  -78.668  1.00 40.46  ? 32  ASN E ND2 1 
ATOM   8786  N  N   . VAL E  1 34  ? 64.544  16.724  -81.352  1.00 46.82  ? 33  VAL E N   1 
ATOM   8787  C  CA  . VAL E  1 34  ? 65.585  17.647  -80.860  1.00 62.50  ? 33  VAL E CA  1 
ATOM   8788  C  C   . VAL E  1 34  ? 65.118  19.100  -80.590  1.00 47.63  ? 33  VAL E C   1 
ATOM   8789  O  O   . VAL E  1 34  ? 65.943  20.012  -80.544  1.00 54.42  ? 33  VAL E O   1 
ATOM   8790  C  CB  . VAL E  1 34  ? 66.806  17.766  -81.831  1.00 58.62  ? 33  VAL E CB  1 
ATOM   8791  C  CG1 . VAL E  1 34  ? 68.107  17.739  -81.046  1.00 73.63  ? 33  VAL E CG1 1 
ATOM   8792  C  CG2 . VAL E  1 34  ? 66.809  16.683  -82.899  1.00 69.10  ? 33  VAL E CG2 1 
ATOM   8793  N  N   . GLY E  1 35  ? 63.818  19.322  -80.400  1.00 69.05  ? 34  GLY E N   1 
ATOM   8794  C  CA  . GLY E  1 35  ? 63.299  20.676  -80.197  1.00 107.44 ? 34  GLY E CA  1 
ATOM   8795  C  C   . GLY E  1 35  ? 63.553  21.377  -78.862  1.00 88.85  ? 34  GLY E C   1 
ATOM   8796  O  O   . GLY E  1 35  ? 63.261  20.811  -77.806  1.00 88.90  ? 34  GLY E O   1 
ATOM   8797  N  N   . GLN E  1 36  ? 64.079  22.610  -78.909  1.00 94.60  ? 35  GLN E N   1 
ATOM   8798  C  CA  . GLN E  1 36  ? 64.238  23.443  -77.701  1.00 77.23  ? 35  GLN E CA  1 
ATOM   8799  C  C   . GLN E  1 36  ? 62.910  23.584  -76.963  1.00 51.75  ? 35  GLN E C   1 
ATOM   8800  O  O   . GLN E  1 36  ? 62.848  23.442  -75.744  1.00 43.75  ? 35  GLN E O   1 
ATOM   8801  C  CB  . GLN E  1 36  ? 64.767  24.858  -78.023  1.00 65.04  ? 35  GLN E CB  1 
ATOM   8802  C  CG  . GLN E  1 36  ? 64.720  25.827  -76.803  1.00 47.60  ? 35  GLN E CG  1 
ATOM   8803  C  CD  . GLN E  1 36  ? 65.041  27.298  -77.138  1.00 75.22  ? 35  GLN E CD  1 
ATOM   8804  O  OE1 . GLN E  1 36  ? 64.233  28.012  -77.733  1.00 47.17  ? 35  GLN E OE1 1 
ATOM   8805  N  NE2 . GLN E  1 36  ? 66.214  27.752  -76.727  1.00 42.41  ? 35  GLN E NE2 1 
ATOM   8806  N  N   . SER E  1 37  ? 61.859  23.846  -77.734  1.00 68.16  ? 36  SER E N   1 
ATOM   8807  C  CA  . SER E  1 37  ? 60.546  24.226  -77.220  1.00 70.57  ? 36  SER E CA  1 
ATOM   8808  C  C   . SER E  1 37  ? 59.553  23.069  -77.114  1.00 64.25  ? 36  SER E C   1 
ATOM   8809  O  O   . SER E  1 37  ? 58.593  23.136  -76.346  1.00 58.17  ? 36  SER E O   1 
ATOM   8810  C  CB  . SER E  1 37  ? 59.947  25.271  -78.155  1.00 70.74  ? 36  SER E CB  1 
ATOM   8811  O  OG  . SER E  1 37  ? 59.897  24.754  -79.479  1.00 46.49  ? 36  SER E OG  1 
ATOM   8812  N  N   . GLY E  1 38  ? 59.762  22.019  -77.897  1.00 52.90  ? 37  GLY E N   1 
ATOM   8813  C  CA  . GLY E  1 38  ? 58.786  20.945  -77.958  1.00 55.79  ? 37  GLY E CA  1 
ATOM   8814  C  C   . GLY E  1 38  ? 58.010  21.010  -79.260  1.00 36.71  ? 37  GLY E C   1 
ATOM   8815  O  O   . GLY E  1 38  ? 57.071  20.244  -79.483  1.00 41.13  ? 37  GLY E O   1 
ATOM   8816  N  N   . ALA E  1 39  ? 58.406  21.940  -80.121  1.00 38.46  ? 38  ALA E N   1 
ATOM   8817  C  CA  . ALA E  1 39  ? 57.905  21.978  -81.485  1.00 37.14  ? 38  ALA E CA  1 
ATOM   8818  C  C   . ALA E  1 39  ? 58.228  20.669  -82.195  1.00 48.71  ? 38  ALA E C   1 
ATOM   8819  O  O   . ALA E  1 39  ? 59.191  19.978  -81.851  1.00 40.85  ? 38  ALA E O   1 
ATOM   8820  C  CB  . ALA E  1 39  ? 58.528  23.143  -82.230  1.00 34.16  ? 38  ALA E CB  1 
ATOM   8821  N  N   . THR E  1 40  ? 57.420  20.309  -83.179  1.00 33.08  ? 39  THR E N   1 
ATOM   8822  C  CA  . THR E  1 40  ? 57.769  19.167  -84.005  1.00 32.79  ? 39  THR E CA  1 
ATOM   8823  C  C   . THR E  1 40  ? 58.754  19.674  -85.034  1.00 37.10  ? 39  THR E C   1 
ATOM   8824  O  O   . THR E  1 40  ? 58.555  20.741  -85.629  1.00 34.43  ? 39  THR E O   1 
ATOM   8825  C  CB  . THR E  1 40  ? 56.546  18.539  -84.699  1.00 37.57  ? 39  THR E CB  1 
ATOM   8826  O  OG1 . THR E  1 40  ? 55.624  18.069  -83.710  1.00 37.16  ? 39  THR E OG1 1 
ATOM   8827  C  CG2 . THR E  1 40  ? 56.985  17.350  -85.570  1.00 39.44  ? 39  THR E CG2 1 
ATOM   8828  N  N   . ILE E  1 41  ? 59.837  18.934  -85.223  1.00 33.09  ? 40  ILE E N   1 
ATOM   8829  C  CA  . ILE E  1 41  ? 60.895  19.401  -86.119  1.00 32.57  ? 40  ILE E CA  1 
ATOM   8830  C  C   . ILE E  1 41  ? 61.026  18.472  -87.304  1.00 39.16  ? 40  ILE E C   1 
ATOM   8831  O  O   . ILE E  1 41  ? 61.303  17.280  -87.145  1.00 38.22  ? 40  ILE E O   1 
ATOM   8832  C  CB  . ILE E  1 41  ? 62.235  19.471  -85.405  1.00 33.85  ? 40  ILE E CB  1 
ATOM   8833  C  CG1 . ILE E  1 41  ? 62.164  20.524  -84.299  1.00 41.45  ? 40  ILE E CG1 1 
ATOM   8834  C  CG2 . ILE E  1 41  ? 63.333  19.821  -86.403  1.00 35.45  ? 40  ILE E CG2 1 
ATOM   8835  C  CD1 . ILE E  1 41  ? 63.447  20.718  -83.594  1.00 72.60  ? 40  ILE E CD1 1 
ATOM   8836  N  N   . TYR E  1 42  ? 60.806  19.019  -88.494  1.00 33.99  ? 41  TYR E N   1 
ATOM   8837  C  CA  . TYR E  1 42  ? 60.953  18.239  -89.710  1.00 37.26  ? 41  TYR E CA  1 
ATOM   8838  C  C   . TYR E  1 42  ? 62.237  18.642  -90.424  1.00 42.08  ? 41  TYR E C   1 
ATOM   8839  O  O   . TYR E  1 42  ? 62.526  19.835  -90.584  1.00 32.90  ? 41  TYR E O   1 
ATOM   8840  C  CB  . TYR E  1 42  ? 59.748  18.430  -90.636  1.00 31.94  ? 41  TYR E CB  1 
ATOM   8841  C  CG  . TYR E  1 42  ? 58.425  18.000  -90.034  1.00 38.62  ? 41  TYR E CG  1 
ATOM   8842  C  CD1 . TYR E  1 42  ? 58.065  16.659  -89.995  1.00 29.39  ? 41  TYR E CD1 1 
ATOM   8843  C  CD2 . TYR E  1 42  ? 57.542  18.929  -89.507  1.00 41.73  ? 41  TYR E CD2 1 
ATOM   8844  C  CE1 . TYR E  1 42  ? 56.858  16.260  -89.446  1.00 39.60  ? 41  TYR E CE1 1 
ATOM   8845  C  CE2 . TYR E  1 42  ? 56.325  18.537  -88.956  1.00 38.90  ? 41  TYR E CE2 1 
ATOM   8846  C  CZ  . TYR E  1 42  ? 55.995  17.201  -88.926  1.00 39.83  ? 41  TYR E CZ  1 
ATOM   8847  O  OH  . TYR E  1 42  ? 54.789  16.802  -88.382  1.00 43.31  ? 41  TYR E OH  1 
ATOM   8848  N  N   . ARG E  1 43  ? 63.008  17.639  -90.831  1.00 34.34  ? 42  ARG E N   1 
ATOM   8849  C  CA  . ARG E  1 43  ? 64.177  17.851  -91.668  1.00 37.39  ? 42  ARG E CA  1 
ATOM   8850  C  C   . ARG E  1 43  ? 63.789  17.556  -93.121  1.00 40.07  ? 42  ARG E C   1 
ATOM   8851  O  O   . ARG E  1 43  ? 63.239  16.494  -93.423  1.00 40.55  ? 42  ARG E O   1 
ATOM   8852  C  CB  . ARG E  1 43  ? 65.327  16.939  -91.218  1.00 36.99  ? 42  ARG E CB  1 
ATOM   8853  C  CG  . ARG E  1 43  ? 66.665  17.225  -91.902  1.00 41.35  ? 42  ARG E CG  1 
ATOM   8854  C  CD  . ARG E  1 43  ? 67.814  16.427  -91.268  1.00 39.96  ? 42  ARG E CD  1 
ATOM   8855  N  NE  . ARG E  1 43  ? 67.732  14.999  -91.553  1.00 41.44  ? 42  ARG E NE  1 
ATOM   8856  C  CZ  . ARG E  1 43  ? 68.256  14.420  -92.630  1.00 63.02  ? 42  ARG E CZ  1 
ATOM   8857  N  NH1 . ARG E  1 43  ? 68.142  13.107  -92.807  1.00 51.42  ? 42  ARG E NH1 1 
ATOM   8858  N  NH2 . ARG E  1 43  ? 68.897  15.153  -93.530  1.00 52.34  ? 42  ARG E NH2 1 
ATOM   8859  N  N   . LEU E  1 44  ? 64.079  18.499  -94.013  1.00 40.01  ? 43  LEU E N   1 
ATOM   8860  C  CA  . LEU E  1 44  ? 63.770  18.355  -95.436  1.00 35.28  ? 43  LEU E CA  1 
ATOM   8861  C  C   . LEU E  1 44  ? 65.058  18.164  -96.210  1.00 37.23  ? 43  LEU E C   1 
ATOM   8862  O  O   . LEU E  1 44  ? 65.952  19.011  -96.146  1.00 38.09  ? 43  LEU E O   1 
ATOM   8863  C  CB  . LEU E  1 44  ? 63.048  19.602  -95.943  1.00 36.66  ? 43  LEU E CB  1 
ATOM   8864  C  CG  . LEU E  1 44  ? 61.686  19.809  -95.280  1.00 43.06  ? 43  LEU E CG  1 
ATOM   8865  C  CD1 . LEU E  1 44  ? 61.183  21.217  -95.492  1.00 72.29  ? 43  LEU E CD1 1 
ATOM   8866  C  CD2 . LEU E  1 44  ? 60.717  18.827  -95.862  1.00 67.63  ? 43  LEU E CD2 1 
ATOM   8867  N  N   . TYR E  1 45  ? 65.164  17.055  -96.932  1.00 43.35  ? 44  TYR E N   1 
ATOM   8868  C  CA  . TYR E  1 45  ? 66.443  16.658  -97.504  1.00 49.94  ? 44  TYR E CA  1 
ATOM   8869  C  C   . TYR E  1 45  ? 66.225  15.810  -98.755  1.00 40.72  ? 44  TYR E C   1 
ATOM   8870  O  O   . TYR E  1 45  ? 65.088  15.524  -99.137  1.00 50.81  ? 44  TYR E O   1 
ATOM   8871  C  CB  . TYR E  1 45  ? 67.259  15.867  -96.460  1.00 43.81  ? 44  TYR E CB  1 
ATOM   8872  C  CG  . TYR E  1 45  ? 66.704  14.473  -96.179  1.00 47.78  ? 44  TYR E CG  1 
ATOM   8873  C  CD1 . TYR E  1 45  ? 65.566  14.294  -95.387  1.00 48.71  ? 44  TYR E CD1 1 
ATOM   8874  C  CD2 . TYR E  1 45  ? 67.311  13.342  -96.714  1.00 47.95  ? 44  TYR E CD2 1 
ATOM   8875  C  CE1 . TYR E  1 45  ? 65.049  13.025  -95.141  1.00 46.29  ? 44  TYR E CE1 1 
ATOM   8876  C  CE2 . TYR E  1 45  ? 66.804  12.067  -96.474  1.00 53.95  ? 44  TYR E CE2 1 
ATOM   8877  C  CZ  . TYR E  1 45  ? 65.674  11.914  -95.686  1.00 57.34  ? 44  TYR E CZ  1 
ATOM   8878  O  OH  . TYR E  1 45  ? 65.174  10.647  -95.453  1.00 60.53  ? 44  TYR E OH  1 
ATOM   8879  N  N   . GLY E  1 46  ? 67.319  15.412  -99.393  1.00 61.49  ? 45  GLY E N   1 
ATOM   8880  C  CA  . GLY E  1 46  ? 67.252  14.454  -100.485 1.00 67.33  ? 45  GLY E CA  1 
ATOM   8881  C  C   . GLY E  1 46  ? 66.738  14.994  -101.808 1.00 64.18  ? 45  GLY E C   1 
ATOM   8882  O  O   . GLY E  1 46  ? 66.402  14.225  -102.711 1.00 72.69  ? 45  GLY E O   1 
ATOM   8883  N  N   . LYS E  1 47  ? 66.677  16.316  -101.929 1.00 57.33  ? 46  LYS E N   1 
ATOM   8884  C  CA  . LYS E  1 47  ? 66.227  16.948  -103.166 1.00 71.79  ? 46  LYS E CA  1 
ATOM   8885  C  C   . LYS E  1 47  ? 67.417  17.349  -104.038 1.00 70.36  ? 46  LYS E C   1 
ATOM   8886  O  O   . LYS E  1 47  ? 68.242  18.155  -103.614 1.00 56.25  ? 46  LYS E O   1 
ATOM   8887  C  CB  . LYS E  1 47  ? 65.381  18.183  -102.847 1.00 49.39  ? 46  LYS E CB  1 
ATOM   8888  C  CG  . LYS E  1 47  ? 64.882  18.932  -104.076 1.00 55.50  ? 46  LYS E CG  1 
ATOM   8889  C  CD  . LYS E  1 47  ? 64.152  20.204  -103.671 1.00 47.06  ? 46  LYS E CD  1 
ATOM   8890  C  CE  . LYS E  1 47  ? 63.596  20.944  -104.882 1.00 56.88  ? 46  LYS E CE  1 
ATOM   8891  N  NZ  . LYS E  1 47  ? 62.809  22.131  -104.445 1.00 68.52  ? 46  LYS E NZ  1 
ATOM   8892  N  N   . PRO E  1 48  ? 67.506  16.784  -105.258 1.00 83.80  ? 47  PRO E N   1 
ATOM   8893  C  CA  . PRO E  1 48  ? 68.613  17.086  -106.174 1.00 71.74  ? 47  PRO E CA  1 
ATOM   8894  C  C   . PRO E  1 48  ? 68.814  18.589  -106.371 1.00 72.69  ? 47  PRO E C   1 
ATOM   8895  O  O   . PRO E  1 48  ? 67.837  19.320  -106.540 1.00 63.25  ? 47  PRO E O   1 
ATOM   8896  C  CB  . PRO E  1 48  ? 68.166  16.438  -107.490 1.00 57.36  ? 47  PRO E CB  1 
ATOM   8897  C  CG  . PRO E  1 48  ? 67.262  15.334  -107.077 1.00 65.56  ? 47  PRO E CG  1 
ATOM   8898  C  CD  . PRO E  1 48  ? 66.553  15.821  -105.842 1.00 59.53  ? 47  PRO E CD  1 
ATOM   8899  N  N   . ASN E  1 49  ? 70.069  19.031  -106.323 1.00 82.12  ? 48  ASN E N   1 
ATOM   8900  C  CA  . ASN E  1 49  ? 70.430  20.430  -106.562 1.00 69.84  ? 48  ASN E CA  1 
ATOM   8901  C  C   . ASN E  1 49  ? 69.608  21.400  -105.708 1.00 68.26  ? 48  ASN E C   1 
ATOM   8902  O  O   . ASN E  1 49  ? 69.001  22.340  -106.223 1.00 71.30  ? 48  ASN E O   1 
ATOM   8903  C  CB  . ASN E  1 49  ? 70.334  20.762  -108.069 1.00 58.74  ? 48  ASN E CB  1 
ATOM   8904  C  CG  . ASN E  1 49  ? 71.209  21.946  -108.474 1.00 84.88  ? 48  ASN E CG  1 
ATOM   8905  O  OD1 . ASN E  1 49  ? 72.028  22.439  -107.689 1.00 72.87  ? 48  ASN E OD1 1 
ATOM   8906  N  ND2 . ASN E  1 49  ? 71.043  22.401  -109.711 1.00 81.64  ? 48  ASN E ND2 1 
ATOM   8907  N  N   . ALA E  1 50  ? 69.585  21.151  -104.397 1.00 58.75  ? 49  ALA E N   1 
ATOM   8908  C  CA  . ALA E  1 50  ? 68.822  21.974  -103.467 1.00 54.63  ? 49  ALA E CA  1 
ATOM   8909  C  C   . ALA E  1 50  ? 69.276  21.728  -102.031 1.00 51.81  ? 49  ALA E C   1 
ATOM   8910  O  O   . ALA E  1 50  ? 69.620  20.602  -101.671 1.00 67.96  ? 49  ALA E O   1 
ATOM   8911  C  CB  . ALA E  1 50  ? 67.343  21.687  -103.609 1.00 59.95  ? 49  ALA E CB  1 
ATOM   8912  N  N   . PRO E  1 51  ? 69.272  22.787  -101.206 1.00 41.97  ? 50  PRO E N   1 
ATOM   8913  C  CA  . PRO E  1 51  ? 69.758  22.732  -99.826  1.00 50.87  ? 50  PRO E CA  1 
ATOM   8914  C  C   . PRO E  1 51  ? 68.790  22.038  -98.874  1.00 59.17  ? 50  PRO E C   1 
ATOM   8915  O  O   . PRO E  1 51  ? 67.593  21.949  -99.149  1.00 52.88  ? 50  PRO E O   1 
ATOM   8916  C  CB  . PRO E  1 51  ? 69.845  24.207  -99.441  1.00 41.62  ? 50  PRO E CB  1 
ATOM   8917  C  CG  . PRO E  1 51  ? 68.754  24.845  -100.232 1.00 57.52  ? 50  PRO E CG  1 
ATOM   8918  C  CD  . PRO E  1 51  ? 68.747  24.124  -101.548 1.00 68.75  ? 50  PRO E CD  1 
ATOM   8919  N  N   . GLU E  1 52  ? 69.328  21.566  -97.755  1.00 48.27  ? 51  GLU E N   1 
ATOM   8920  C  CA  . GLU E  1 52  ? 68.527  21.041  -96.655  1.00 45.52  ? 51  GLU E CA  1 
ATOM   8921  C  C   . GLU E  1 52  ? 67.794  22.182  -95.960  1.00 43.94  ? 51  GLU E C   1 
ATOM   8922  O  O   . GLU E  1 52  ? 68.325  23.285  -95.823  1.00 39.88  ? 51  GLU E O   1 
ATOM   8923  C  CB  . GLU E  1 52  ? 69.448  20.340  -95.658  1.00 44.49  ? 51  GLU E CB  1 
ATOM   8924  C  CG  . GLU E  1 52  ? 68.757  19.581  -94.548  1.00 50.72  ? 51  GLU E CG  1 
ATOM   8925  C  CD  . GLU E  1 52  ? 69.762  19.025  -93.557  1.00 57.55  ? 51  GLU E CD  1 
ATOM   8926  O  OE1 . GLU E  1 52  ? 70.481  19.834  -92.943  1.00 49.49  ? 51  GLU E OE1 1 
ATOM   8927  O  OE2 . GLU E  1 52  ? 69.854  17.789  -93.413  1.00 49.36  ? 51  GLU E OE2 1 
ATOM   8928  N  N   . LEU E  1 53  ? 66.573  21.919  -95.510  1.00 39.39  ? 52  LEU E N   1 
ATOM   8929  C  CA  . LEU E  1 53  ? 65.804  22.927  -94.792  1.00 31.24  ? 52  LEU E CA  1 
ATOM   8930  C  C   . LEU E  1 53  ? 65.273  22.299  -93.527  1.00 33.90  ? 52  LEU E C   1 
ATOM   8931  O  O   . LEU E  1 53  ? 65.211  21.079  -93.430  1.00 33.57  ? 52  LEU E O   1 
ATOM   8932  C  CB  . LEU E  1 53  ? 64.614  23.389  -95.633  1.00 37.10  ? 52  LEU E CB  1 
ATOM   8933  C  CG  . LEU E  1 53  ? 64.893  23.900  -97.042  1.00 38.60  ? 52  LEU E CG  1 
ATOM   8934  C  CD1 . LEU E  1 53  ? 63.565  24.193  -97.773  1.00 37.88  ? 52  LEU E CD1 1 
ATOM   8935  C  CD2 . LEU E  1 53  ? 65.760  25.148  -96.955  1.00 33.73  ? 52  LEU E CD2 1 
ATOM   8936  N  N   . PHE E  1 54  ? 64.878  23.129  -92.567  1.00 33.58  ? 53  PHE E N   1 
ATOM   8937  C  CA  . PHE E  1 54  ? 64.157  22.642  -91.393  1.00 30.40  ? 53  PHE E CA  1 
ATOM   8938  C  C   . PHE E  1 54  ? 62.816  23.333  -91.284  1.00 37.89  ? 53  PHE E C   1 
ATOM   8939  O  O   . PHE E  1 54  ? 62.697  24.512  -91.593  1.00 31.02  ? 53  PHE E O   1 
ATOM   8940  C  CB  . PHE E  1 54  ? 64.946  22.879  -90.112  1.00 25.06  ? 53  PHE E CB  1 
ATOM   8941  C  CG  . PHE E  1 54  ? 66.086  21.912  -89.920  1.00 28.75  ? 53  PHE E CG  1 
ATOM   8942  C  CD1 . PHE E  1 54  ? 65.857  20.655  -89.376  1.00 29.63  ? 53  PHE E CD1 1 
ATOM   8943  C  CD2 . PHE E  1 54  ? 67.385  22.262  -90.288  1.00 34.52  ? 53  PHE E CD2 1 
ATOM   8944  C  CE1 . PHE E  1 54  ? 66.906  19.754  -89.199  1.00 31.65  ? 53  PHE E CE1 1 
ATOM   8945  C  CE2 . PHE E  1 54  ? 68.434  21.377  -90.104  1.00 40.28  ? 53  PHE E CE2 1 
ATOM   8946  C  CZ  . PHE E  1 54  ? 68.187  20.111  -89.558  1.00 35.85  ? 53  PHE E CZ  1 
ATOM   8947  N  N   . LEU E  1 55  ? 61.806  22.576  -90.863  1.00 35.09  ? 54  LEU E N   1 
ATOM   8948  C  CA  . LEU E  1 55  ? 60.460  23.103  -90.677  1.00 28.99  ? 54  LEU E CA  1 
ATOM   8949  C  C   . LEU E  1 55  ? 60.035  22.817  -89.246  1.00 36.32  ? 54  LEU E C   1 
ATOM   8950  O  O   . LEU E  1 55  ? 59.969  21.668  -88.834  1.00 33.50  ? 54  LEU E O   1 
ATOM   8951  C  CB  . LEU E  1 55  ? 59.496  22.452  -91.669  1.00 27.13  ? 54  LEU E CB  1 
ATOM   8952  C  CG  . LEU E  1 55  ? 58.044  22.889  -91.544  1.00 42.13  ? 54  LEU E CG  1 
ATOM   8953  C  CD1 . LEU E  1 55  ? 57.933  24.385  -91.803  1.00 35.68  ? 54  LEU E CD1 1 
ATOM   8954  C  CD2 . LEU E  1 55  ? 57.184  22.082  -92.521  1.00 41.00  ? 54  LEU E CD2 1 
ATOM   8955  N  N   . LYS E  1 56  ? 59.797  23.870  -88.475  1.00 30.31  ? 55  LYS E N   1 
ATOM   8956  C  CA  . LYS E  1 56  ? 59.320  23.712  -87.105  1.00 30.89  ? 55  LYS E CA  1 
ATOM   8957  C  C   . LYS E  1 56  ? 57.818  23.933  -87.085  1.00 31.84  ? 55  LYS E C   1 
ATOM   8958  O  O   . LYS E  1 56  ? 57.325  24.874  -87.698  1.00 33.83  ? 55  LYS E O   1 
ATOM   8959  C  CB  . LYS E  1 56  ? 59.963  24.745  -86.187  1.00 40.31  ? 55  LYS E CB  1 
ATOM   8960  C  CG  . LYS E  1 56  ? 61.424  24.539  -85.857  1.00 45.73  ? 55  LYS E CG  1 
ATOM   8961  C  CD  . LYS E  1 56  ? 61.759  25.342  -84.595  1.00 69.50  ? 55  LYS E CD  1 
ATOM   8962  C  CE  . LYS E  1 56  ? 63.061  24.894  -83.944  1.00 53.35  ? 55  LYS E CE  1 
ATOM   8963  N  NZ  . LYS E  1 56  ? 63.263  25.548  -82.615  1.00 56.01  ? 55  LYS E NZ  1 
ATOM   8964  N  N   . HIS E  1 57  ? 57.087  23.075  -86.379  1.00 32.72  ? 56  HIS E N   1 
ATOM   8965  C  CA  . HIS E  1 57  ? 55.656  23.285  -86.219  1.00 32.72  ? 56  HIS E CA  1 
ATOM   8966  C  C   . HIS E  1 57  ? 55.317  23.336  -84.736  1.00 31.46  ? 56  HIS E C   1 
ATOM   8967  O  O   . HIS E  1 57  ? 55.632  22.403  -83.989  1.00 33.37  ? 56  HIS E O   1 
ATOM   8968  C  CB  . HIS E  1 57  ? 54.851  22.171  -86.903  1.00 33.63  ? 56  HIS E CB  1 
ATOM   8969  C  CG  . HIS E  1 57  ? 53.376  22.258  -86.664  1.00 33.24  ? 56  HIS E CG  1 
ATOM   8970  N  ND1 . HIS E  1 57  ? 52.562  21.146  -86.612  1.00 40.38  ? 56  HIS E ND1 1 
ATOM   8971  C  CD2 . HIS E  1 57  ? 52.567  23.326  -86.469  1.00 37.41  ? 56  HIS E CD2 1 
ATOM   8972  C  CE1 . HIS E  1 57  ? 51.316  21.525  -86.386  1.00 47.53  ? 56  HIS E CE1 1 
ATOM   8973  N  NE2 . HIS E  1 57  ? 51.291  22.843  -86.300  1.00 37.15  ? 56  HIS E NE2 1 
ATOM   8974  N  N   . GLY E  1 58  ? 54.662  24.416  -84.320  1.00 32.85  ? 57  GLY E N   1 
ATOM   8975  C  CA  . GLY E  1 58  ? 54.214  24.551  -82.947  1.00 29.65  ? 57  GLY E CA  1 
ATOM   8976  C  C   . GLY E  1 58  ? 52.709  24.650  -82.898  1.00 32.56  ? 57  GLY E C   1 
ATOM   8977  O  O   . GLY E  1 58  ? 52.113  25.439  -83.632  1.00 31.74  ? 57  GLY E O   1 
ATOM   8978  N  N   . LYS E  1 59  ? 52.089  23.840  -82.041  1.00 31.45  ? 58  LYS E N   1 
ATOM   8979  C  CA  . LYS E  1 59  ? 50.635  23.879  -81.868  1.00 35.21  ? 58  LYS E CA  1 
ATOM   8980  C  C   . LYS E  1 59  ? 50.296  24.351  -80.452  1.00 40.09  ? 58  LYS E C   1 
ATOM   8981  O  O   . LYS E  1 59  ? 51.011  24.037  -79.502  1.00 30.47  ? 58  LYS E O   1 
ATOM   8982  C  CB  . LYS E  1 59  ? 50.056  22.479  -82.099  1.00 33.58  ? 58  LYS E CB  1 
ATOM   8983  C  CG  . LYS E  1 59  ? 48.541  22.419  -82.130  1.00 37.42  ? 58  LYS E CG  1 
ATOM   8984  C  CD  . LYS E  1 59  ? 48.106  20.971  -82.396  1.00 54.81  ? 58  LYS E CD  1 
ATOM   8985  C  CE  . LYS E  1 59  ? 46.863  20.909  -83.264  1.00 85.90  ? 58  LYS E CE  1 
ATOM   8986  N  NZ  . LYS E  1 59  ? 46.627  19.519  -83.755  1.00 96.60  ? 58  LYS E NZ  1 
ATOM   8987  N  N   . GLY E  1 60  ? 49.210  25.104  -80.308  1.00 31.80  ? 59  GLY E N   1 
ATOM   8988  C  CA  . GLY E  1 60  ? 48.771  25.556  -78.999  1.00 36.24  ? 59  GLY E CA  1 
ATOM   8989  C  C   . GLY E  1 60  ? 49.818  26.450  -78.362  1.00 37.20  ? 59  GLY E C   1 
ATOM   8990  O  O   . GLY E  1 60  ? 50.332  27.353  -79.016  1.00 34.39  ? 59  GLY E O   1 
ATOM   8991  N  N   . SER E  1 61  ? 50.145  26.208  -77.092  1.00 33.70  ? 60  SER E N   1 
ATOM   8992  C  CA  . SER E  1 61  ? 51.134  27.047  -76.413  1.00 31.73  ? 60  SER E CA  1 
ATOM   8993  C  C   . SER E  1 61  ? 52.429  27.101  -77.224  1.00 29.46  ? 60  SER E C   1 
ATOM   8994  O  O   . SER E  1 61  ? 53.076  28.141  -77.301  1.00 31.85  ? 60  SER E O   1 
ATOM   8995  C  CB  . SER E  1 61  ? 51.438  26.526  -75.001  1.00 33.20  ? 60  SER E CB  1 
ATOM   8996  O  OG  . SER E  1 61  ? 50.311  26.648  -74.146  1.00 35.58  ? 60  SER E OG  1 
ATOM   8997  N  N   . VAL E  1 62  ? 52.801  25.979  -77.833  1.00 31.12  ? 61  VAL E N   1 
ATOM   8998  C  CA  . VAL E  1 62  ? 54.085  25.903  -78.551  1.00 30.37  ? 61  VAL E CA  1 
ATOM   8999  C  C   . VAL E  1 62  ? 54.100  26.794  -79.797  1.00 34.76  ? 61  VAL E C   1 
ATOM   9000  O  O   . VAL E  1 62  ? 55.170  27.234  -80.252  1.00 31.76  ? 61  VAL E O   1 
ATOM   9001  C  CB  . VAL E  1 62  ? 54.465  24.436  -78.881  1.00 32.76  ? 61  VAL E CB  1 
ATOM   9002  C  CG1 . VAL E  1 62  ? 55.815  24.364  -79.613  1.00 34.97  ? 61  VAL E CG1 1 
ATOM   9003  C  CG2 . VAL E  1 62  ? 54.523  23.606  -77.594  1.00 36.54  ? 61  VAL E CG2 1 
ATOM   9004  N  N   . ALA E  1 63  ? 52.920  27.124  -80.317  1.00 28.17  ? 62  ALA E N   1 
ATOM   9005  C  CA  . ALA E  1 63  ? 52.865  28.065  -81.431  1.00 30.25  ? 62  ALA E CA  1 
ATOM   9006  C  C   . ALA E  1 63  ? 53.497  29.389  -81.032  1.00 36.50  ? 62  ALA E C   1 
ATOM   9007  O  O   . ALA E  1 63  ? 54.159  30.023  -81.849  1.00 31.08  ? 62  ALA E O   1 
ATOM   9008  C  CB  . ALA E  1 63  ? 51.443  28.272  -81.922  1.00 36.04  ? 62  ALA E CB  1 
ATOM   9009  N  N   . ASN E  1 64  ? 53.319  29.797  -79.775  1.00 29.94  ? 63  ASN E N   1 
ATOM   9010  C  CA  . ASN E  1 64  ? 53.935  31.039  -79.303  1.00 32.01  ? 63  ASN E CA  1 
ATOM   9011  C  C   . ASN E  1 64  ? 55.470  30.941  -79.261  1.00 34.31  ? 63  ASN E C   1 
ATOM   9012  O  O   . ASN E  1 64  ? 56.170  31.878  -79.647  1.00 34.57  ? 63  ASN E O   1 
ATOM   9013  C  CB  . ASN E  1 64  ? 53.378  31.439  -77.931  1.00 31.57  ? 63  ASN E CB  1 
ATOM   9014  C  CG  . ASN E  1 64  ? 51.889  31.777  -77.975  1.00 49.91  ? 63  ASN E CG  1 
ATOM   9015  O  OD1 . ASN E  1 64  ? 51.416  32.438  -78.895  1.00 35.96  ? 63  ASN E OD1 1 
ATOM   9016  N  ND2 . ASN E  1 64  ? 51.147  31.318  -76.979  1.00 43.20  ? 63  ASN E ND2 1 
ATOM   9017  N  N   . ASP E  1 65  ? 55.995  29.800  -78.817  1.00 32.56  ? 64  ASP E N   1 
ATOM   9018  C  CA  . ASP E  1 65  ? 57.449  29.608  -78.785  1.00 29.15  ? 64  ASP E CA  1 
ATOM   9019  C  C   . ASP E  1 65  ? 58.063  29.724  -80.176  1.00 30.86  ? 64  ASP E C   1 
ATOM   9020  O  O   . ASP E  1 65  ? 59.131  30.332  -80.351  1.00 34.61  ? 64  ASP E O   1 
ATOM   9021  C  CB  . ASP E  1 65  ? 57.813  28.251  -78.175  1.00 34.21  ? 64  ASP E CB  1 
ATOM   9022  C  CG  . ASP E  1 65  ? 57.230  28.063  -76.793  1.00 49.96  ? 64  ASP E CG  1 
ATOM   9023  O  OD1 . ASP E  1 65  ? 57.213  29.045  -76.014  1.00 53.19  ? 64  ASP E OD1 1 
ATOM   9024  O  OD2 . ASP E  1 65  ? 56.788  26.936  -76.488  1.00 51.76  ? 64  ASP E OD2 1 
ATOM   9025  N  N   . VAL E  1 66  ? 57.391  29.139  -81.161  1.00 26.95  ? 65  VAL E N   1 
ATOM   9026  C  CA  . VAL E  1 66  ? 57.882  29.175  -82.531  1.00 25.93  ? 65  VAL E CA  1 
ATOM   9027  C  C   . VAL E  1 66  ? 57.834  30.603  -83.094  1.00 30.33  ? 65  VAL E C   1 
ATOM   9028  O  O   . VAL E  1 66  ? 58.768  31.058  -83.770  1.00 29.56  ? 65  VAL E O   1 
ATOM   9029  C  CB  . VAL E  1 66  ? 57.125  28.151  -83.423  1.00 29.04  ? 65  VAL E CB  1 
ATOM   9030  C  CG1 . VAL E  1 66  ? 57.501  28.326  -84.895  1.00 32.30  ? 65  VAL E CG1 1 
ATOM   9031  C  CG2 . VAL E  1 66  ? 57.468  26.723  -82.965  1.00 32.26  ? 65  VAL E CG2 1 
ATOM   9032  N  N   . THR E  1 67  ? 56.759  31.316  -82.777  1.00 29.74  ? 66  THR E N   1 
ATOM   9033  C  CA  . THR E  1 67  ? 56.635  32.721  -83.137  1.00 30.57  ? 66  THR E CA  1 
ATOM   9034  C  C   . THR E  1 67  ? 57.734  33.555  -82.491  1.00 29.62  ? 66  THR E C   1 
ATOM   9035  O  O   . THR E  1 67  ? 58.281  34.462  -83.127  1.00 32.45  ? 66  THR E O   1 
ATOM   9036  C  CB  . THR E  1 67  ? 55.272  33.284  -82.709  1.00 30.88  ? 66  THR E CB  1 
ATOM   9037  O  OG1 . THR E  1 67  ? 54.237  32.541  -83.362  1.00 31.15  ? 66  THR E OG1 1 
ATOM   9038  C  CG2 . THR E  1 67  ? 55.164  34.733  -83.091  1.00 30.67  ? 66  THR E CG2 1 
ATOM   9039  N  N   . ASP E  1 68  ? 58.059  33.230  -81.238  1.00 27.48  ? 67  ASP E N   1 
ATOM   9040  C  CA  . ASP E  1 68  ? 59.121  33.920  -80.517  1.00 25.83  ? 67  ASP E CA  1 
ATOM   9041  C  C   . ASP E  1 68  ? 60.439  33.744  -81.258  1.00 31.17  ? 67  ASP E C   1 
ATOM   9042  O  O   . ASP E  1 68  ? 61.191  34.711  -81.435  1.00 33.35  ? 67  ASP E O   1 
ATOM   9043  C  CB  . ASP E  1 68  ? 59.294  33.381  -79.094  1.00 30.44  ? 67  ASP E CB  1 
ATOM   9044  C  CG  . ASP E  1 68  ? 58.176  33.796  -78.160  1.00 62.18  ? 67  ASP E CG  1 
ATOM   9045  O  OD1 . ASP E  1 68  ? 57.364  34.674  -78.527  1.00 41.60  ? 67  ASP E OD1 1 
ATOM   9046  O  OD2 . ASP E  1 68  ? 58.122  33.242  -77.041  1.00 40.24  ? 67  ASP E OD2 1 
ATOM   9047  N  N   . GLU E  1 69  ? 60.720  32.520  -81.699  1.00 32.14  ? 68  GLU E N   1 
ATOM   9048  C  CA  . GLU E  1 69  ? 61.981  32.289  -82.404  1.00 36.02  ? 68  GLU E CA  1 
ATOM   9049  C  C   . GLU E  1 69  ? 61.991  33.042  -83.714  1.00 31.86  ? 68  GLU E C   1 
ATOM   9050  O  O   . GLU E  1 69  ? 63.005  33.645  -84.089  1.00 32.23  ? 68  GLU E O   1 
ATOM   9051  C  CB  . GLU E  1 69  ? 62.292  30.804  -82.659  1.00 42.19  ? 68  GLU E CB  1 
ATOM   9052  C  CG  . GLU E  1 69  ? 63.766  30.655  -83.037  1.00 41.72  ? 68  GLU E CG  1 
ATOM   9053  C  CD  . GLU E  1 69  ? 64.171  29.306  -83.599  1.00 60.74  ? 68  GLU E CD  1 
ATOM   9054  O  OE1 . GLU E  1 69  ? 63.302  28.490  -83.969  1.00 49.30  ? 68  GLU E OE1 1 
ATOM   9055  O  OE2 . GLU E  1 69  ? 65.397  29.080  -83.682  1.00 47.04  ? 68  GLU E OE2 1 
HETATM 9056  N  N   . MSE E  1 70  ? 60.866  33.005  -84.426  1.00 25.08  ? 69  MSE E N   1 
HETATM 9057  C  CA  . MSE E  1 70  ? 60.780  33.723  -85.691  1.00 30.84  ? 69  MSE E CA  1 
HETATM 9058  C  C   . MSE E  1 70  ? 61.206  35.190  -85.591  1.00 33.02  ? 69  MSE E C   1 
HETATM 9059  O  O   . MSE E  1 70  ? 62.034  35.638  -86.377  1.00 31.32  ? 69  MSE E O   1 
HETATM 9060  C  CB  . MSE E  1 70  ? 59.378  33.598  -86.320  1.00 30.88  ? 69  MSE E CB  1 
HETATM 9061  C  CG  . MSE E  1 70  ? 59.269  34.191  -87.720  1.00 30.39  ? 69  MSE E CG  1 
HETATM 9062  SE SE  . MSE E  1 70  ? 58.983  36.129  -87.829  0.67 35.02  ? 69  MSE E SE  1 
HETATM 9063  C  CE  . MSE E  1 70  ? 57.309  36.145  -86.900  1.00 41.32  ? 69  MSE E CE  1 
ATOM   9064  N  N   . VAL E  1 71  ? 60.652  35.955  -84.654  1.00 25.55  ? 70  VAL E N   1 
ATOM   9065  C  CA  . VAL E  1 71  ? 60.987  37.376  -84.645  1.00 29.67  ? 70  VAL E CA  1 
ATOM   9066  C  C   . VAL E  1 71  ? 62.395  37.630  -84.172  1.00 30.26  ? 70  VAL E C   1 
ATOM   9067  O  O   . VAL E  1 71  ? 63.014  38.628  -84.550  1.00 29.74  ? 70  VAL E O   1 
ATOM   9068  C  CB  . VAL E  1 71  ? 60.033  38.228  -83.798  1.00 32.71  ? 70  VAL E CB  1 
ATOM   9069  C  CG1 . VAL E  1 71  ? 58.772  38.410  -84.545  1.00 48.48  ? 70  VAL E CG1 1 
ATOM   9070  C  CG2 . VAL E  1 71  ? 59.817  37.622  -82.409  1.00 30.88  ? 70  VAL E CG2 1 
ATOM   9071  N  N   . ARG E  1 72  ? 62.901  36.726  -83.342  1.00 31.01  ? 71  ARG E N   1 
ATOM   9072  C  CA  . ARG E  1 72  ? 64.268  36.872  -82.861  1.00 29.16  ? 71  ARG E CA  1 
ATOM   9073  C  C   . ARG E  1 72  ? 65.282  36.545  -83.956  1.00 37.42  ? 71  ARG E C   1 
ATOM   9074  O  O   . ARG E  1 72  ? 66.319  37.210  -84.063  1.00 28.06  ? 71  ARG E O   1 
ATOM   9075  C  CB  . ARG E  1 72  ? 64.492  36.055  -81.586  1.00 26.92  ? 71  ARG E CB  1 
ATOM   9076  C  CG  . ARG E  1 72  ? 63.882  36.757  -80.350  1.00 30.17  ? 71  ARG E CG  1 
ATOM   9077  C  CD  . ARG E  1 72  ? 63.583  35.804  -79.179  1.00 28.57  ? 71  ARG E CD  1 
ATOM   9078  N  NE  . ARG E  1 72  ? 62.980  36.546  -78.060  1.00 33.19  ? 71  ARG E NE  1 
ATOM   9079  C  CZ  . ARG E  1 72  ? 61.710  36.957  -78.027  1.00 37.39  ? 71  ARG E CZ  1 
ATOM   9080  N  NH1 . ARG E  1 72  ? 60.886  36.683  -79.040  1.00 26.48  ? 71  ARG E NH1 1 
ATOM   9081  N  NH2 . ARG E  1 72  ? 61.255  37.630  -76.973  1.00 32.35  ? 71  ARG E NH2 1 
ATOM   9082  N  N   . LEU E  1 73  ? 64.980  35.540  -84.778  1.00 31.13  ? 72  LEU E N   1 
ATOM   9083  C  CA  . LEU E  1 73  ? 65.824  35.248  -85.941  1.00 33.18  ? 72  LEU E CA  1 
ATOM   9084  C  C   . LEU E  1 73  ? 65.882  36.456  -86.855  1.00 31.73  ? 72  LEU E C   1 
ATOM   9085  O  O   . LEU E  1 73  ? 66.942  36.844  -87.331  1.00 33.23  ? 72  LEU E O   1 
ATOM   9086  C  CB  . LEU E  1 73  ? 65.264  34.084  -86.758  1.00 29.88  ? 72  LEU E CB  1 
ATOM   9087  C  CG  . LEU E  1 73  ? 65.568  32.671  -86.272  1.00 32.99  ? 72  LEU E CG  1 
ATOM   9088  C  CD1 . LEU E  1 73  ? 64.721  31.709  -87.071  1.00 39.73  ? 72  LEU E CD1 1 
ATOM   9089  C  CD2 . LEU E  1 73  ? 67.041  32.385  -86.520  1.00 40.52  ? 72  LEU E CD2 1 
ATOM   9090  N  N   . ASN E  1 74  ? 64.711  37.024  -87.109  1.00 29.87  ? 73  ASN E N   1 
ATOM   9091  C  CA  . ASN E  1 74  ? 64.593  38.146  -88.022  1.00 35.39  ? 73  ASN E CA  1 
ATOM   9092  C  C   . ASN E  1 74  ? 65.403  39.344  -87.528  1.00 36.56  ? 73  ASN E C   1 
ATOM   9093  O  O   . ASN E  1 74  ? 66.022  40.051  -88.323  1.00 36.74  ? 73  ASN E O   1 
ATOM   9094  C  CB  . ASN E  1 74  ? 63.116  38.496  -88.215  1.00 34.87  ? 73  ASN E CB  1 
ATOM   9095  C  CG  . ASN E  1 74  ? 62.900  39.649  -89.189  1.00 44.68  ? 73  ASN E CG  1 
ATOM   9096  O  OD1 . ASN E  1 74  ? 62.588  40.770  -88.785  1.00 69.18  ? 73  ASN E OD1 1 
ATOM   9097  N  ND2 . ASN E  1 74  ? 63.045  39.369  -90.478  1.00 45.15  ? 73  ASN E ND2 1 
ATOM   9098  N  N   . TRP E  1 75  ? 65.449  39.541  -86.215  1.00 30.45  ? 74  TRP E N   1 
ATOM   9099  C  CA  . TRP E  1 75  ? 66.179  40.675  -85.663  1.00 31.28  ? 74  TRP E CA  1 
ATOM   9100  C  C   . TRP E  1 75  ? 67.682  40.426  -85.626  1.00 27.64  ? 74  TRP E C   1 
ATOM   9101  O  O   . TRP E  1 75  ? 68.487  41.222  -86.141  1.00 32.67  ? 74  TRP E O   1 
ATOM   9102  C  CB  . TRP E  1 75  ? 65.686  41.037  -84.248  1.00 29.32  ? 74  TRP E CB  1 
ATOM   9103  C  CG  . TRP E  1 75  ? 66.598  42.050  -83.647  1.00 28.41  ? 74  TRP E CG  1 
ATOM   9104  C  CD1 . TRP E  1 75  ? 66.711  43.376  -84.004  1.00 30.52  ? 74  TRP E CD1 1 
ATOM   9105  C  CD2 . TRP E  1 75  ? 67.591  41.822  -82.641  1.00 37.38  ? 74  TRP E CD2 1 
ATOM   9106  N  NE1 . TRP E  1 75  ? 67.688  43.982  -83.259  1.00 36.73  ? 74  TRP E NE1 1 
ATOM   9107  C  CE2 . TRP E  1 75  ? 68.241  43.052  -82.412  1.00 33.62  ? 74  TRP E CE2 1 
ATOM   9108  C  CE3 . TRP E  1 75  ? 67.988  40.697  -81.901  1.00 33.76  ? 74  TRP E CE3 1 
ATOM   9109  C  CZ2 . TRP E  1 75  ? 69.279  43.186  -81.484  1.00 33.12  ? 74  TRP E CZ2 1 
ATOM   9110  C  CZ3 . TRP E  1 75  ? 69.006  40.841  -80.967  1.00 32.02  ? 74  TRP E CZ3 1 
ATOM   9111  C  CH2 . TRP E  1 75  ? 69.643  42.066  -80.775  1.00 35.93  ? 74  TRP E CH2 1 
ATOM   9112  N  N   . LEU E  1 76  ? 68.056  39.303  -85.028  1.00 30.17  ? 75  LEU E N   1 
ATOM   9113  C  CA  . LEU E  1 76  ? 69.460  39.031  -84.736  1.00 30.33  ? 75  LEU E CA  1 
ATOM   9114  C  C   . LEU E  1 76  ? 70.301  38.753  -85.987  1.00 35.76  ? 75  LEU E C   1 
ATOM   9115  O  O   . LEU E  1 76  ? 71.525  38.891  -85.967  1.00 35.09  ? 75  LEU E O   1 
ATOM   9116  C  CB  . LEU E  1 76  ? 69.558  37.882  -83.719  1.00 26.68  ? 75  LEU E CB  1 
ATOM   9117  C  CG  . LEU E  1 76  ? 70.945  37.460  -83.206  1.00 31.92  ? 75  LEU E CG  1 
ATOM   9118  C  CD1 . LEU E  1 76  ? 71.687  38.624  -82.593  1.00 26.66  ? 75  LEU E CD1 1 
ATOM   9119  C  CD2 . LEU E  1 76  ? 70.798  36.304  -82.178  1.00 31.26  ? 75  LEU E CD2 1 
ATOM   9120  N  N   . THR E  1 77  ? 69.643  38.419  -87.094  1.00 31.01  ? 76  THR E N   1 
ATOM   9121  C  CA  . THR E  1 77  ? 70.360  38.115  -88.332  1.00 33.45  ? 76  THR E CA  1 
ATOM   9122  C  C   . THR E  1 77  ? 71.187  39.307  -88.854  1.00 37.10  ? 76  THR E C   1 
ATOM   9123  O  O   . THR E  1 77  ? 72.121  39.127  -89.626  1.00 32.95  ? 76  THR E O   1 
ATOM   9124  C  CB  . THR E  1 77  ? 69.417  37.570  -89.429  1.00 52.50  ? 76  THR E CB  1 
ATOM   9125  O  OG1 . THR E  1 77  ? 70.155  37.354  -90.640  1.00 61.04  ? 76  THR E OG1 1 
ATOM   9126  C  CG2 . THR E  1 77  ? 68.315  38.549  -89.704  1.00 65.77  ? 76  THR E CG2 1 
ATOM   9127  N  N   . ALA E  1 78  ? 70.861  40.511  -88.397  1.00 32.94  ? 77  ALA E N   1 
ATOM   9128  C  CA  . ALA E  1 78  ? 71.650  41.695  -88.758  1.00 32.55  ? 77  ALA E CA  1 
ATOM   9129  C  C   . ALA E  1 78  ? 73.035  41.718  -88.108  1.00 53.33  ? 77  ALA E C   1 
ATOM   9130  O  O   . ALA E  1 78  ? 73.941  42.435  -88.561  1.00 40.80  ? 77  ALA E O   1 
ATOM   9131  C  CB  . ALA E  1 78  ? 70.874  42.976  -88.410  1.00 33.83  ? 77  ALA E CB  1 
ATOM   9132  N  N   . PHE E  1 79  ? 73.192  40.918  -87.058  1.00 34.28  ? 78  PHE E N   1 
ATOM   9133  C  CA  . PHE E  1 79  ? 74.375  40.962  -86.189  1.00 35.85  ? 78  PHE E CA  1 
ATOM   9134  C  C   . PHE E  1 79  ? 75.194  39.667  -86.124  1.00 46.19  ? 78  PHE E C   1 
ATOM   9135  O  O   . PHE E  1 79  ? 76.399  39.696  -85.843  1.00 33.29  ? 78  PHE E O   1 
ATOM   9136  C  CB  . PHE E  1 79  ? 73.933  41.356  -84.767  1.00 29.75  ? 78  PHE E CB  1 
ATOM   9137  C  CG  . PHE E  1 79  ? 73.258  42.696  -84.699  1.00 38.13  ? 78  PHE E CG  1 
ATOM   9138  C  CD1 . PHE E  1 79  ? 74.006  43.864  -84.703  1.00 46.06  ? 78  PHE E CD1 1 
ATOM   9139  C  CD2 . PHE E  1 79  ? 71.880  42.792  -84.652  1.00 39.51  ? 78  PHE E CD2 1 
ATOM   9140  C  CE1 . PHE E  1 79  ? 73.384  45.106  -84.646  1.00 42.73  ? 78  PHE E CE1 1 
ATOM   9141  C  CE2 . PHE E  1 79  ? 71.254  44.035  -84.598  1.00 39.11  ? 78  PHE E CE2 1 
ATOM   9142  C  CZ  . PHE E  1 79  ? 72.019  45.187  -84.595  1.00 36.94  ? 78  PHE E CZ  1 
HETATM 9143  N  N   . MSE E  1 80  ? 74.543  38.531  -86.357  1.00 34.32  ? 79  MSE E N   1 
HETATM 9144  C  CA  . MSE E  1 80  ? 75.166  37.222  -86.137  1.00 34.25  ? 79  MSE E CA  1 
HETATM 9145  C  C   . MSE E  1 80  ? 74.733  36.240  -87.226  1.00 36.40  ? 79  MSE E C   1 
HETATM 9146  O  O   . MSE E  1 80  ? 73.664  36.410  -87.808  1.00 35.32  ? 79  MSE E O   1 
HETATM 9147  C  CB  . MSE E  1 80  ? 74.760  36.685  -84.752  1.00 30.56  ? 79  MSE E CB  1 
HETATM 9148  C  CG  . MSE E  1 80  ? 75.215  37.567  -83.589  1.00 37.39  ? 79  MSE E CG  1 
HETATM 9149  SE SE  . MSE E  1 80  ? 77.149  37.697  -83.378  0.68 38.70  ? 79  MSE E SE  1 
HETATM 9150  C  CE  . MSE E  1 80  ? 77.423  35.942  -82.561  1.00 40.33  ? 79  MSE E CE  1 
ATOM   9151  N  N   . PRO E  1 81  ? 75.556  35.212  -87.510  1.00 31.56  ? 80  PRO E N   1 
ATOM   9152  C  CA  . PRO E  1 81  ? 75.172  34.188  -88.495  1.00 31.00  ? 80  PRO E CA  1 
ATOM   9153  C  C   . PRO E  1 81  ? 74.134  33.205  -87.928  1.00 34.95  ? 80  PRO E C   1 
ATOM   9154  O  O   . PRO E  1 81  ? 74.426  32.505  -86.960  1.00 34.02  ? 80  PRO E O   1 
ATOM   9155  C  CB  . PRO E  1 81  ? 76.501  33.468  -88.799  1.00 32.20  ? 80  PRO E CB  1 
ATOM   9156  C  CG  . PRO E  1 81  ? 77.321  33.666  -87.566  1.00 32.18  ? 80  PRO E CG  1 
ATOM   9157  C  CD  . PRO E  1 81  ? 76.946  35.036  -87.035  1.00 35.43  ? 80  PRO E CD  1 
ATOM   9158  N  N   . LEU E  1 82  ? 72.946  33.153  -88.536  1.00 31.96  ? 81  LEU E N   1 
ATOM   9159  C  CA  . LEU E  1 82  ? 71.819  32.331  -88.039  1.00 28.88  ? 81  LEU E CA  1 
ATOM   9160  C  C   . LEU E  1 82  ? 71.172  31.683  -89.248  1.00 35.18  ? 81  LEU E C   1 
ATOM   9161  O  O   . LEU E  1 82  ? 71.487  32.060  -90.373  1.00 32.68  ? 81  LEU E O   1 
ATOM   9162  C  CB  . LEU E  1 82  ? 70.758  33.246  -87.408  1.00 36.61  ? 81  LEU E CB  1 
ATOM   9163  C  CG  . LEU E  1 82  ? 71.180  34.277  -86.381  1.00 45.18  ? 81  LEU E CG  1 
ATOM   9164  C  CD1 . LEU E  1 82  ? 69.967  34.980  -85.810  1.00 38.04  ? 81  LEU E CD1 1 
ATOM   9165  C  CD2 . LEU E  1 82  ? 71.930  33.574  -85.304  1.00 48.12  ? 81  LEU E CD2 1 
ATOM   9166  N  N   . PRO E  1 83  ? 70.238  30.734  -89.032  1.00 29.87  ? 82  PRO E N   1 
ATOM   9167  C  CA  . PRO E  1 83  ? 69.513  30.230  -90.197  1.00 29.65  ? 82  PRO E CA  1 
ATOM   9168  C  C   . PRO E  1 83  ? 68.731  31.357  -90.839  1.00 33.86  ? 82  PRO E C   1 
ATOM   9169  O  O   . PRO E  1 83  ? 68.362  32.315  -90.153  1.00 32.78  ? 82  PRO E O   1 
ATOM   9170  C  CB  . PRO E  1 83  ? 68.526  29.231  -89.585  1.00 29.89  ? 82  PRO E CB  1 
ATOM   9171  C  CG  . PRO E  1 83  ? 69.191  28.764  -88.345  1.00 29.18  ? 82  PRO E CG  1 
ATOM   9172  C  CD  . PRO E  1 83  ? 69.890  29.986  -87.807  1.00 27.85  ? 82  PRO E CD  1 
ATOM   9173  N  N   . THR E  1 84  ? 68.477  31.234  -92.134  1.00 26.57  ? 83  THR E N   1 
ATOM   9174  C  CA  . THR E  1 84  ? 67.689  32.225  -92.853  1.00 35.60  ? 83  THR E CA  1 
ATOM   9175  C  C   . THR E  1 84  ? 66.225  31.785  -92.903  1.00 38.93  ? 83  THR E C   1 
ATOM   9176  O  O   . THR E  1 84  ? 65.938  30.649  -93.271  1.00 35.42  ? 83  THR E O   1 
ATOM   9177  C  CB  . THR E  1 84  ? 68.205  32.355  -94.291  1.00 38.23  ? 83  THR E CB  1 
ATOM   9178  O  OG1 . THR E  1 84  ? 69.544  32.877  -94.269  1.00 40.76  ? 83  THR E OG1 1 
ATOM   9179  C  CG2 . THR E  1 84  ? 67.301  33.278  -95.107  1.00 35.62  ? 83  THR E CG2 1 
ATOM   9180  N  N   . ILE E  1 85  ? 65.313  32.686  -92.549  1.00 31.30  ? 84  ILE E N   1 
ATOM   9181  C  CA  . ILE E  1 85  ? 63.872  32.433  -92.683  1.00 37.33  ? 84  ILE E CA  1 
ATOM   9182  C  C   . ILE E  1 85  ? 63.408  32.374  -94.133  1.00 35.50  ? 84  ILE E C   1 
ATOM   9183  O  O   . ILE E  1 85  ? 63.562  33.337  -94.898  1.00 36.38  ? 84  ILE E O   1 
ATOM   9184  C  CB  . ILE E  1 85  ? 63.043  33.497  -91.952  1.00 41.24  ? 84  ILE E CB  1 
ATOM   9185  C  CG1 . ILE E  1 85  ? 63.338  33.441  -90.447  1.00 33.32  ? 84  ILE E CG1 1 
ATOM   9186  C  CG2 . ILE E  1 85  ? 61.548  33.293  -92.220  1.00 36.75  ? 84  ILE E CG2 1 
ATOM   9187  C  CD1 . ILE E  1 85  ? 62.845  34.661  -89.698  1.00 44.61  ? 84  ILE E CD1 1 
ATOM   9188  N  N   . LYS E  1 86  ? 62.824  31.244  -94.516  1.00 29.59  ? 85  LYS E N   1 
ATOM   9189  C  CA  . LYS E  1 86  ? 62.253  31.122  -95.844  1.00 29.79  ? 85  LYS E CA  1 
ATOM   9190  C  C   . LYS E  1 86  ? 60.749  31.376  -95.866  1.00 28.15  ? 85  LYS E C   1 
ATOM   9191  O  O   . LYS E  1 86  ? 60.241  31.943  -96.822  1.00 33.11  ? 85  LYS E O   1 
ATOM   9192  C  CB  . LYS E  1 86  ? 62.589  29.775  -96.498  1.00 42.42  ? 85  LYS E CB  1 
ATOM   9193  C  CG  . LYS E  1 86  ? 64.067  29.604  -96.846  1.00 49.51  ? 85  LYS E CG  1 
ATOM   9194  C  CD  . LYS E  1 86  ? 64.383  29.931  -98.308  1.00 68.06  ? 85  LYS E CD  1 
ATOM   9195  C  CE  . LYS E  1 86  ? 64.200  31.409  -98.653  1.00 79.22  ? 85  LYS E CE  1 
ATOM   9196  N  NZ  . LYS E  1 86  ? 64.922  32.304  -97.703  1.00 67.41  ? 85  LYS E NZ  1 
ATOM   9197  N  N   . HIS E  1 87  ? 60.053  30.967  -94.809  1.00 36.04  ? 86  HIS E N   1 
ATOM   9198  C  CA  . HIS E  1 87  ? 58.611  31.160  -94.756  1.00 34.93  ? 86  HIS E CA  1 
ATOM   9199  C  C   . HIS E  1 87  ? 58.169  31.036  -93.321  1.00 29.20  ? 86  HIS E C   1 
ATOM   9200  O  O   . HIS E  1 87  ? 58.722  30.243  -92.542  1.00 32.47  ? 86  HIS E O   1 
ATOM   9201  C  CB  . HIS E  1 87  ? 57.910  30.090  -95.610  1.00 33.17  ? 86  HIS E CB  1 
ATOM   9202  C  CG  . HIS E  1 87  ? 56.590  30.517  -96.182  1.00 39.50  ? 86  HIS E CG  1 
ATOM   9203  N  ND1 . HIS E  1 87  ? 55.444  30.623  -95.423  1.00 78.04  ? 86  HIS E ND1 1 
ATOM   9204  C  CD2 . HIS E  1 87  ? 56.226  30.808  -97.452  1.00 39.21  ? 86  HIS E CD2 1 
ATOM   9205  C  CE1 . HIS E  1 87  ? 54.437  30.990  -96.196  1.00 59.67  ? 86  HIS E CE1 1 
ATOM   9206  N  NE2 . HIS E  1 87  ? 54.884  31.110  -97.433  1.00 61.35  ? 86  HIS E NE2 1 
ATOM   9207  N  N   . PHE E  1 88  ? 57.162  31.810  -92.939  1.00 30.83  ? 87  PHE E N   1 
ATOM   9208  C  CA  . PHE E  1 88  ? 56.587  31.620  -91.601  1.00 27.35  ? 87  PHE E CA  1 
ATOM   9209  C  C   . PHE E  1 88  ? 55.084  31.853  -91.709  1.00 29.23  ? 87  PHE E C   1 
ATOM   9210  O  O   . PHE E  1 88  ? 54.654  32.736  -92.430  1.00 32.71  ? 87  PHE E O   1 
ATOM   9211  C  CB  . PHE E  1 88  ? 57.203  32.585  -90.581  1.00 30.76  ? 87  PHE E CB  1 
ATOM   9212  C  CG  . PHE E  1 88  ? 56.493  32.590  -89.236  1.00 28.90  ? 87  PHE E CG  1 
ATOM   9213  C  CD1 . PHE E  1 88  ? 56.822  31.654  -88.262  1.00 27.70  ? 87  PHE E CD1 1 
ATOM   9214  C  CD2 . PHE E  1 88  ? 55.491  33.514  -88.962  1.00 37.50  ? 87  PHE E CD2 1 
ATOM   9215  C  CE1 . PHE E  1 88  ? 56.175  31.652  -87.028  1.00 36.43  ? 87  PHE E CE1 1 
ATOM   9216  C  CE2 . PHE E  1 88  ? 54.840  33.520  -87.732  1.00 33.50  ? 87  PHE E CE2 1 
ATOM   9217  C  CZ  . PHE E  1 88  ? 55.185  32.585  -86.764  1.00 28.80  ? 87  PHE E CZ  1 
ATOM   9218  N  N   . ILE E  1 89  ? 54.296  31.037  -91.010  1.00 32.39  ? 88  ILE E N   1 
ATOM   9219  C  CA  . ILE E  1 89  ? 52.837  31.187  -91.018  1.00 36.48  ? 88  ILE E CA  1 
ATOM   9220  C  C   . ILE E  1 89  ? 52.345  31.113  -89.577  1.00 35.01  ? 88  ILE E C   1 
ATOM   9221  O  O   . ILE E  1 89  ? 52.793  30.271  -88.821  1.00 33.41  ? 88  ILE E O   1 
ATOM   9222  C  CB  . ILE E  1 89  ? 52.140  30.051  -91.812  1.00 44.21  ? 88  ILE E CB  1 
ATOM   9223  C  CG1 . ILE E  1 89  ? 52.604  30.034  -93.270  1.00 44.88  ? 88  ILE E CG1 1 
ATOM   9224  C  CG2 . ILE E  1 89  ? 50.602  30.190  -91.742  1.00 41.29  ? 88  ILE E CG2 1 
ATOM   9225  C  CD1 . ILE E  1 89  ? 52.191  28.797  -94.022  1.00 66.41  ? 88  ILE E CD1 1 
ATOM   9226  N  N   . ARG E  1 90  ? 51.447  32.008  -89.195  1.00 37.21  ? 89  ARG E N   1 
ATOM   9227  C  CA  . ARG E  1 90  ? 50.812  31.905  -87.894  1.00 34.45  ? 89  ARG E CA  1 
ATOM   9228  C  C   . ARG E  1 90  ? 49.291  31.951  -88.071  1.00 35.53  ? 89  ARG E C   1 
ATOM   9229  O  O   . ARG E  1 90  ? 48.762  32.811  -88.773  1.00 36.59  ? 89  ARG E O   1 
ATOM   9230  C  CB  . ARG E  1 90  ? 51.281  33.026  -86.969  1.00 38.07  ? 89  ARG E CB  1 
ATOM   9231  C  CG  . ARG E  1 90  ? 50.576  33.063  -85.619  1.00 35.76  ? 89  ARG E CG  1 
ATOM   9232  C  CD  . ARG E  1 90  ? 51.004  31.876  -84.768  1.00 42.56  ? 89  ARG E CD  1 
ATOM   9233  N  NE  . ARG E  1 90  ? 50.132  31.704  -83.607  1.00 51.87  ? 89  ARG E NE  1 
ATOM   9234  C  CZ  . ARG E  1 90  ? 50.463  32.057  -82.368  1.00 42.33  ? 89  ARG E CZ  1 
ATOM   9235  N  NH1 . ARG E  1 90  ? 51.644  32.604  -82.129  1.00 41.31  ? 89  ARG E NH1 1 
ATOM   9236  N  NH2 . ARG E  1 90  ? 49.609  31.867  -81.367  1.00 42.31  ? 89  ARG E NH2 1 
ATOM   9237  N  N   . THR E  1 91  ? 48.615  30.967  -87.484  1.00 36.47  ? 90  THR E N   1 
ATOM   9238  C  CA  . THR E  1 91  ? 47.162  30.988  -87.311  1.00 40.49  ? 90  THR E CA  1 
ATOM   9239  C  C   . THR E  1 91  ? 46.922  30.956  -85.792  1.00 31.79  ? 90  THR E C   1 
ATOM   9240  O  O   . THR E  1 91  ? 47.889  30.811  -85.032  1.00 32.79  ? 90  THR E O   1 
ATOM   9241  C  CB  . THR E  1 91  ? 46.470  29.791  -88.038  1.00 44.76  ? 90  THR E CB  1 
ATOM   9242  O  OG1 . THR E  1 91  ? 47.045  28.553  -87.611  1.00 46.73  ? 90  THR E OG1 1 
ATOM   9243  C  CG2 . THR E  1 91  ? 46.607  29.913  -89.551  1.00 47.90  ? 90  THR E CG2 1 
ATOM   9244  N  N   . PRO E  1 92  ? 45.663  31.124  -85.339  1.00 43.04  ? 91  PRO E N   1 
ATOM   9245  C  CA  . PRO E  1 92  ? 45.433  31.134  -83.887  1.00 53.32  ? 91  PRO E CA  1 
ATOM   9246  C  C   . PRO E  1 92  ? 46.076  29.983  -83.105  1.00 48.75  ? 91  PRO E C   1 
ATOM   9247  O  O   . PRO E  1 92  ? 46.674  30.242  -82.064  1.00 47.17  ? 91  PRO E O   1 
ATOM   9248  C  CB  . PRO E  1 92  ? 43.908  31.087  -83.788  1.00 47.36  ? 91  PRO E CB  1 
ATOM   9249  C  CG  . PRO E  1 92  ? 43.464  31.873  -84.975  1.00 59.16  ? 91  PRO E CG  1 
ATOM   9250  C  CD  . PRO E  1 92  ? 44.472  31.610  -86.071  1.00 41.55  ? 91  PRO E CD  1 
ATOM   9251  N  N   . ASP E  1 93  ? 46.007  28.753  -83.609  1.00 37.90  ? 92  ASP E N   1 
ATOM   9252  C  CA  . ASP E  1 93  ? 46.496  27.606  -82.844  1.00 37.34  ? 92  ASP E CA  1 
ATOM   9253  C  C   . ASP E  1 93  ? 47.817  27.018  -83.359  1.00 35.63  ? 92  ASP E C   1 
ATOM   9254  O  O   . ASP E  1 93  ? 48.319  26.050  -82.807  1.00 36.17  ? 92  ASP E O   1 
ATOM   9255  C  CB  . ASP E  1 93  ? 45.428  26.504  -82.806  1.00 34.98  ? 92  ASP E CB  1 
ATOM   9256  C  CG  . ASP E  1 93  ? 44.145  26.961  -82.119  1.00 52.59  ? 92  ASP E CG  1 
ATOM   9257  O  OD1 . ASP E  1 93  ? 44.207  27.874  -81.267  1.00 58.16  ? 92  ASP E OD1 1 
ATOM   9258  O  OD2 . ASP E  1 93  ? 43.076  26.408  -82.434  1.00 50.48  ? 92  ASP E OD2 1 
ATOM   9259  N  N   . ASP E  1 94  ? 48.383  27.596  -84.413  1.00 34.39  ? 93  ASP E N   1 
ATOM   9260  C  CA  . ASP E  1 94  ? 49.480  26.930  -85.093  1.00 32.96  ? 93  ASP E CA  1 
ATOM   9261  C  C   . ASP E  1 94  ? 50.500  27.908  -85.627  1.00 34.72  ? 93  ASP E C   1 
ATOM   9262  O  O   . ASP E  1 94  ? 50.135  28.984  -86.073  1.00 32.79  ? 93  ASP E O   1 
ATOM   9263  C  CB  . ASP E  1 94  ? 48.933  26.124  -86.268  1.00 33.84  ? 93  ASP E CB  1 
ATOM   9264  C  CG  . ASP E  1 94  ? 48.177  24.901  -85.830  1.00 48.43  ? 93  ASP E CG  1 
ATOM   9265  O  OD1 . ASP E  1 94  ? 48.828  23.861  -85.552  1.00 39.62  ? 93  ASP E OD1 1 
ATOM   9266  O  OD2 . ASP E  1 94  ? 46.933  24.987  -85.771  1.00 42.78  ? 93  ASP E OD2 1 
ATOM   9267  N  N   . ALA E  1 95  ? 51.769  27.510  -85.592  1.00 26.92  ? 94  ALA E N   1 
ATOM   9268  C  CA  . ALA E  1 95  ? 52.841  28.296  -86.196  1.00 30.24  ? 94  ALA E CA  1 
ATOM   9269  C  C   . ALA E  1 95  ? 53.782  27.359  -86.938  1.00 32.96  ? 94  ALA E C   1 
ATOM   9270  O  O   . ALA E  1 95  ? 54.109  26.271  -86.452  1.00 29.16  ? 94  ALA E O   1 
ATOM   9271  C  CB  . ALA E  1 95  ? 53.597  29.084  -85.138  1.00 30.65  ? 94  ALA E CB  1 
ATOM   9272  N  N   . TRP E  1 96  ? 54.202  27.779  -88.128  1.00 31.40  ? 95  TRP E N   1 
ATOM   9273  C  CA  . TRP E  1 96  ? 55.083  26.985  -88.964  1.00 26.97  ? 95  TRP E CA  1 
ATOM   9274  C  C   . TRP E  1 96  ? 56.248  27.876  -89.351  1.00 33.67  ? 95  TRP E C   1 
ATOM   9275  O  O   . TRP E  1 96  ? 56.030  28.943  -89.924  1.00 32.27  ? 95  TRP E O   1 
ATOM   9276  C  CB  . TRP E  1 96  ? 54.367  26.578  -90.248  1.00 30.68  ? 95  TRP E CB  1 
ATOM   9277  C  CG  . TRP E  1 96  ? 53.199  25.665  -90.020  1.00 35.15  ? 95  TRP E CG  1 
ATOM   9278  C  CD1 . TRP E  1 96  ? 51.922  26.029  -89.699  1.00 42.85  ? 95  TRP E CD1 1 
ATOM   9279  C  CD2 . TRP E  1 96  ? 53.204  24.238  -90.095  1.00 35.91  ? 95  TRP E CD2 1 
ATOM   9280  N  NE1 . TRP E  1 96  ? 51.130  24.912  -89.571  1.00 39.06  ? 95  TRP E NE1 1 
ATOM   9281  C  CE2 . TRP E  1 96  ? 51.893  23.800  -89.808  1.00 48.39  ? 95  TRP E CE2 1 
ATOM   9282  C  CE3 . TRP E  1 96  ? 54.190  23.284  -90.377  1.00 38.22  ? 95  TRP E CE3 1 
ATOM   9283  C  CZ2 . TRP E  1 96  ? 51.540  22.451  -89.797  1.00 47.91  ? 95  TRP E CZ2 1 
ATOM   9284  C  CZ3 . TRP E  1 96  ? 53.834  21.943  -90.373  1.00 56.45  ? 95  TRP E CZ3 1 
ATOM   9285  C  CH2 . TRP E  1 96  ? 52.522  21.540  -90.085  1.00 50.88  ? 95  TRP E CH2 1 
ATOM   9286  N  N   . LEU E  1 97  ? 57.468  27.419  -89.083  1.00 28.31  ? 96  LEU E N   1 
ATOM   9287  C  CA  . LEU E  1 97  ? 58.679  28.201  -89.386  1.00 30.24  ? 96  LEU E CA  1 
ATOM   9288  C  C   . LEU E  1 97  ? 59.659  27.382  -90.237  1.00 34.34  ? 96  LEU E C   1 
ATOM   9289  O  O   . LEU E  1 97  ? 60.224  26.377  -89.771  1.00 32.27  ? 96  LEU E O   1 
ATOM   9290  C  CB  . LEU E  1 97  ? 59.359  28.596  -88.079  1.00 29.73  ? 96  LEU E CB  1 
ATOM   9291  C  CG  . LEU E  1 97  ? 60.707  29.330  -88.174  1.00 30.48  ? 96  LEU E CG  1 
ATOM   9292  C  CD1 . LEU E  1 97  ? 60.562  30.615  -88.998  1.00 30.89  ? 96  LEU E CD1 1 
ATOM   9293  C  CD2 . LEU E  1 97  ? 61.187  29.613  -86.749  1.00 29.00  ? 96  LEU E CD2 1 
ATOM   9294  N  N   . LEU E  1 98  ? 59.843  27.816  -91.479  1.00 31.01  ? 97  LEU E N   1 
ATOM   9295  C  CA  . LEU E  1 98  ? 60.718  27.146  -92.424  1.00 28.66  ? 97  LEU E CA  1 
ATOM   9296  C  C   . LEU E  1 98  ? 62.011  27.948  -92.562  1.00 33.86  ? 97  LEU E C   1 
ATOM   9297  O  O   . LEU E  1 98  ? 61.966  29.127  -92.945  1.00 32.12  ? 97  LEU E O   1 
ATOM   9298  C  CB  . LEU E  1 98  ? 60.020  27.054  -93.786  1.00 29.89  ? 97  LEU E CB  1 
ATOM   9299  C  CG  . LEU E  1 98  ? 60.786  26.283  -94.877  1.00 36.41  ? 97  LEU E CG  1 
ATOM   9300  C  CD1 . LEU E  1 98  ? 60.776  24.776  -94.560  1.00 33.51  ? 97  LEU E CD1 1 
ATOM   9301  C  CD2 . LEU E  1 98  ? 60.233  26.573  -96.274  1.00 40.57  ? 97  LEU E CD2 1 
ATOM   9302  N  N   . THR E  1 99  ? 63.142  27.323  -92.227  1.00 28.78  ? 98  THR E N   1 
ATOM   9303  C  CA  . THR E  1 99  ? 64.461  27.967  -92.320  1.00 30.64  ? 98  THR E CA  1 
ATOM   9304  C  C   . THR E  1 99  ? 65.452  27.115  -93.096  1.00 36.48  ? 98  THR E C   1 
ATOM   9305  O  O   . THR E  1 99  ? 65.238  25.925  -93.290  1.00 32.75  ? 98  THR E O   1 
ATOM   9306  C  CB  . THR E  1 99  ? 65.083  28.228  -90.931  1.00 36.25  ? 98  THR E CB  1 
ATOM   9307  O  OG1 . THR E  1 99  ? 65.460  26.981  -90.325  1.00 36.34  ? 98  THR E OG1 1 
ATOM   9308  C  CG2 . THR E  1 99  ? 64.104  28.974  -90.034  1.00 37.17  ? 98  THR E CG2 1 
ATOM   9309  N  N   . THR E  1 100 ? 66.546  27.735  -93.535  1.00 33.10  ? 99  THR E N   1 
ATOM   9310  C  CA  . THR E  1 100 ? 67.626  27.008  -94.177  1.00 29.48  ? 99  THR E CA  1 
ATOM   9311  C  C   . THR E  1 100 ? 68.386  26.275  -93.091  1.00 34.06  ? 99  THR E C   1 
ATOM   9312  O  O   . THR E  1 100 ? 68.379  26.695  -91.936  1.00 42.85  ? 99  THR E O   1 
ATOM   9313  C  CB  . THR E  1 100 ? 68.613  27.982  -94.843  1.00 36.92  ? 99  THR E CB  1 
ATOM   9314  O  OG1 . THR E  1 100 ? 69.171  28.839  -93.832  1.00 38.26  ? 99  THR E OG1 1 
ATOM   9315  C  CG2 . THR E  1 100 ? 67.912  28.810  -95.882  1.00 37.72  ? 99  THR E CG2 1 
ATOM   9316  N  N   . ALA E  1 101 ? 69.027  25.167  -93.449  1.00 32.74  ? 100 ALA E N   1 
ATOM   9317  C  CA  . ALA E  1 101 ? 69.898  24.457  -92.512  1.00 36.45  ? 100 ALA E CA  1 
ATOM   9318  C  C   . ALA E  1 101 ? 71.287  25.083  -92.523  1.00 32.86  ? 100 ALA E C   1 
ATOM   9319  O  O   . ALA E  1 101 ? 71.837  25.332  -93.592  1.00 41.05  ? 100 ALA E O   1 
ATOM   9320  C  CB  . ALA E  1 101 ? 70.010  23.001  -92.919  1.00 37.36  ? 100 ALA E CB  1 
ATOM   9321  N  N   . ILE E  1 102 ? 71.857  25.328  -91.348  1.00 28.98  ? 101 ILE E N   1 
ATOM   9322  C  CA  . ILE E  1 102 ? 73.273  25.643  -91.288  1.00 29.10  ? 101 ILE E CA  1 
ATOM   9323  C  C   . ILE E  1 102 ? 74.041  24.333  -91.424  1.00 32.23  ? 101 ILE E C   1 
ATOM   9324  O  O   . ILE E  1 102 ? 73.843  23.419  -90.632  1.00 32.34  ? 101 ILE E O   1 
ATOM   9325  C  CB  . ILE E  1 102 ? 73.641  26.364  -89.997  1.00 35.45  ? 101 ILE E CB  1 
ATOM   9326  C  CG1 . ILE E  1 102 ? 72.857  27.683  -89.894  1.00 35.47  ? 101 ILE E CG1 1 
ATOM   9327  C  CG2 . ILE E  1 102 ? 75.168  26.618  -89.928  1.00 28.80  ? 101 ILE E CG2 1 
ATOM   9328  C  CD1 . ILE E  1 102 ? 73.098  28.411  -88.598  1.00 39.48  ? 101 ILE E CD1 1 
ATOM   9329  N  N   . PRO E  1 103 ? 74.880  24.215  -92.469  1.00 31.22  ? 102 PRO E N   1 
ATOM   9330  C  CA  . PRO E  1 103 ? 75.609  22.964  -92.708  1.00 30.00  ? 102 PRO E CA  1 
ATOM   9331  C  C   . PRO E  1 103 ? 76.587  22.668  -91.584  1.00 37.41  ? 102 PRO E C   1 
ATOM   9332  O  O   . PRO E  1 103 ? 77.131  23.599  -91.004  1.00 32.25  ? 102 PRO E O   1 
ATOM   9333  C  CB  . PRO E  1 103 ? 76.396  23.261  -93.994  1.00 41.39  ? 102 PRO E CB  1 
ATOM   9334  C  CG  . PRO E  1 103 ? 75.604  24.353  -94.669  1.00 31.50  ? 102 PRO E CG  1 
ATOM   9335  C  CD  . PRO E  1 103 ? 75.108  25.199  -93.545  1.00 34.17  ? 102 PRO E CD  1 
ATOM   9336  N  N   . GLY E  1 104 ? 76.813  21.393  -91.290  1.00 32.23  ? 103 GLY E N   1 
ATOM   9337  C  CA  . GLY E  1 104 ? 77.828  21.017  -90.323  1.00 37.23  ? 103 GLY E CA  1 
ATOM   9338  C  C   . GLY E  1 104 ? 77.288  20.218  -89.148  1.00 42.97  ? 103 GLY E C   1 
ATOM   9339  O  O   . GLY E  1 104 ? 76.248  19.569  -89.246  1.00 34.73  ? 103 GLY E O   1 
ATOM   9340  N  N   . LYS E  1 105 ? 78.004  20.261  -88.032  1.00 34.52  ? 104 LYS E N   1 
ATOM   9341  C  CA  . LYS E  1 105 ? 77.623  19.484  -86.848  1.00 39.20  ? 104 LYS E CA  1 
ATOM   9342  C  C   . LYS E  1 105 ? 77.642  20.350  -85.603  1.00 32.46  ? 104 LYS E C   1 
ATOM   9343  O  O   . LYS E  1 105 ? 78.297  21.403  -85.587  1.00 32.43  ? 104 LYS E O   1 
ATOM   9344  C  CB  . LYS E  1 105 ? 78.594  18.315  -86.664  1.00 34.52  ? 104 LYS E CB  1 
ATOM   9345  C  CG  . LYS E  1 105 ? 78.593  17.306  -87.809  1.00 43.19  ? 104 LYS E CG  1 
ATOM   9346  C  CD  . LYS E  1 105 ? 79.468  16.103  -87.469  1.00 55.67  ? 104 LYS E CD  1 
ATOM   9347  C  CE  . LYS E  1 105 ? 79.390  15.028  -88.548  1.00 53.07  ? 104 LYS E CE  1 
ATOM   9348  N  NZ  . LYS E  1 105 ? 79.782  13.695  -88.019  1.00 84.61  ? 104 LYS E NZ  1 
ATOM   9349  N  N   . THR E  1 106 ? 76.934  19.931  -84.550  1.00 28.68  ? 105 THR E N   1 
ATOM   9350  C  CA  . THR E  1 106 ? 76.949  20.716  -83.324  1.00 24.50  ? 105 THR E CA  1 
ATOM   9351  C  C   . THR E  1 106 ? 78.323  20.671  -82.657  1.00 25.19  ? 105 THR E C   1 
ATOM   9352  O  O   . THR E  1 106 ? 79.117  19.763  -82.909  1.00 28.65  ? 105 THR E O   1 
ATOM   9353  C  CB  . THR E  1 106 ? 75.917  20.225  -82.282  1.00 32.58  ? 105 THR E CB  1 
ATOM   9354  O  OG1 . THR E  1 106 ? 76.343  18.952  -81.769  1.00 31.08  ? 105 THR E OG1 1 
ATOM   9355  C  CG2 . THR E  1 106 ? 74.534  20.093  -82.907  1.00 32.92  ? 105 THR E CG2 1 
ATOM   9356  N  N   . ALA E  1 107 ? 78.590  21.678  -81.831  1.00 26.57  ? 106 ALA E N   1 
ATOM   9357  C  CA  . ALA E  1 107 ? 79.838  21.746  -81.071  1.00 26.17  ? 106 ALA E CA  1 
ATOM   9358  C  C   . ALA E  1 107 ? 79.994  20.487  -80.225  1.00 30.78  ? 106 ALA E C   1 
ATOM   9359  O  O   . ALA E  1 107 ? 81.106  19.969  -80.048  1.00 32.12  ? 106 ALA E O   1 
ATOM   9360  C  CB  . ALA E  1 107 ? 79.824  22.981  -80.188  1.00 27.58  ? 106 ALA E CB  1 
ATOM   9361  N  N   . PHE E  1 108 ? 78.877  20.000  -79.688  1.00 30.09  ? 107 PHE E N   1 
ATOM   9362  C  CA  . PHE E  1 108 ? 78.912  18.748  -78.927  1.00 30.94  ? 107 PHE E CA  1 
ATOM   9363  C  C   . PHE E  1 108 ? 79.442  17.617  -79.801  1.00 33.56  ? 107 PHE E C   1 
ATOM   9364  O  O   . PHE E  1 108 ? 80.367  16.884  -79.418  1.00 32.68  ? 107 PHE E O   1 
ATOM   9365  C  CB  . PHE E  1 108 ? 77.522  18.409  -78.382  1.00 31.88  ? 107 PHE E CB  1 
ATOM   9366  C  CG  . PHE E  1 108 ? 77.468  17.089  -77.630  1.00 31.77  ? 107 PHE E CG  1 
ATOM   9367  C  CD1 . PHE E  1 108 ? 77.718  17.037  -76.263  1.00 35.23  ? 107 PHE E CD1 1 
ATOM   9368  C  CD2 . PHE E  1 108 ? 77.142  15.920  -78.290  1.00 33.07  ? 107 PHE E CD2 1 
ATOM   9369  C  CE1 . PHE E  1 108 ? 77.667  15.804  -75.568  1.00 32.28  ? 107 PHE E CE1 1 
ATOM   9370  C  CE2 . PHE E  1 108 ? 77.080  14.700  -77.608  1.00 43.08  ? 107 PHE E CE2 1 
ATOM   9371  C  CZ  . PHE E  1 108 ? 77.341  14.651  -76.248  1.00 32.03  ? 107 PHE E CZ  1 
ATOM   9372  N  N   . GLN E  1 109 ? 78.867  17.479  -80.991  1.00 32.30  ? 108 GLN E N   1 
ATOM   9373  C  CA  . GLN E  1 109 ? 79.288  16.435  -81.918  1.00 31.34  ? 108 GLN E CA  1 
ATOM   9374  C  C   . GLN E  1 109 ? 80.773  16.518  -82.291  1.00 29.82  ? 108 GLN E C   1 
ATOM   9375  O  O   . GLN E  1 109 ? 81.471  15.512  -82.302  1.00 31.32  ? 108 GLN E O   1 
ATOM   9376  C  CB  . GLN E  1 109 ? 78.445  16.486  -83.199  1.00 33.12  ? 108 GLN E CB  1 
ATOM   9377  C  CG  . GLN E  1 109 ? 77.029  15.954  -83.080  1.00 39.44  ? 108 GLN E CG  1 
ATOM   9378  C  CD  . GLN E  1 109 ? 76.264  16.111  -84.398  1.00 58.54  ? 108 GLN E CD  1 
ATOM   9379  O  OE1 . GLN E  1 109 ? 75.891  17.218  -84.788  1.00 37.77  ? 108 GLN E OE1 1 
ATOM   9380  N  NE2 . GLN E  1 109 ? 76.053  15.002  -85.096  1.00 61.10  ? 108 GLN E NE2 1 
ATOM   9381  N  N   . VAL E  1 110 ? 81.251  17.714  -82.615  1.00 30.72  ? 109 VAL E N   1 
ATOM   9382  C  CA  A VAL E  1 110 ? 82.632  17.826  -83.052  0.60 37.30  ? 109 VAL E CA  1 
ATOM   9383  C  CA  B VAL E  1 110 ? 82.633  17.878  -83.042  0.40 38.48  ? 109 VAL E CA  1 
ATOM   9384  C  C   . VAL E  1 110 ? 83.607  17.610  -81.894  1.00 29.73  ? 109 VAL E C   1 
ATOM   9385  O  O   . VAL E  1 110 ? 84.712  17.126  -82.099  1.00 35.83  ? 109 VAL E O   1 
ATOM   9386  C  CB  A VAL E  1 110 ? 82.913  19.147  -83.809  0.60 27.11  ? 109 VAL E CB  1 
ATOM   9387  C  CB  B VAL E  1 110 ? 82.870  19.287  -83.625  0.40 48.09  ? 109 VAL E CB  1 
ATOM   9388  C  CG1 A VAL E  1 110 ? 81.997  19.257  -85.032  0.60 34.87  ? 109 VAL E CG1 1 
ATOM   9389  C  CG1 B VAL E  1 110 ? 84.322  19.458  -84.049  0.40 28.64  ? 109 VAL E CG1 1 
ATOM   9390  C  CG2 A VAL E  1 110 ? 82.750  20.357  -82.895  0.60 35.92  ? 109 VAL E CG2 1 
ATOM   9391  C  CG2 B VAL E  1 110 ? 81.933  19.534  -84.803  0.40 43.26  ? 109 VAL E CG2 1 
ATOM   9392  N  N   . LEU E  1 111 ? 83.192  17.948  -80.681  1.00 31.24  ? 110 LEU E N   1 
ATOM   9393  C  CA  . LEU E  1 111 ? 84.033  17.716  -79.512  1.00 31.49  ? 110 LEU E CA  1 
ATOM   9394  C  C   . LEU E  1 111 ? 84.205  16.203  -79.294  1.00 30.24  ? 110 LEU E C   1 
ATOM   9395  O  O   . LEU E  1 111 ? 85.305  15.723  -78.997  1.00 33.51  ? 110 LEU E O   1 
ATOM   9396  C  CB  . LEU E  1 111 ? 83.431  18.423  -78.287  1.00 31.51  ? 110 LEU E CB  1 
ATOM   9397  C  CG  . LEU E  1 111 ? 84.202  18.443  -76.965  1.00 50.55  ? 110 LEU E CG  1 
ATOM   9398  C  CD1 . LEU E  1 111 ? 85.656  18.837  -77.189  1.00 51.11  ? 110 LEU E CD1 1 
ATOM   9399  C  CD2 . LEU E  1 111 ? 83.536  19.392  -75.979  1.00 63.91  ? 110 LEU E CD2 1 
ATOM   9400  N  N   . GLU E  1 112 ? 83.127  15.447  -79.487  1.00 34.82  ? 111 GLU E N   1 
ATOM   9401  C  CA  . GLU E  1 112 ? 83.187  13.991  -79.343  1.00 33.18  ? 111 GLU E CA  1 
ATOM   9402  C  C   . GLU E  1 112 ? 83.953  13.356  -80.488  1.00 32.82  ? 111 GLU E C   1 
ATOM   9403  O  O   . GLU E  1 112 ? 84.643  12.360  -80.302  1.00 35.06  ? 111 GLU E O   1 
ATOM   9404  C  CB  . GLU E  1 112 ? 81.781  13.389  -79.266  1.00 30.83  ? 111 GLU E CB  1 
ATOM   9405  C  CG  . GLU E  1 112 ? 81.034  13.789  -78.011  1.00 39.91  ? 111 GLU E CG  1 
ATOM   9406  C  CD  . GLU E  1 112 ? 79.981  12.786  -77.571  1.00 46.05  ? 111 GLU E CD  1 
ATOM   9407  O  OE1 . GLU E  1 112 ? 79.411  12.074  -78.428  1.00 40.80  ? 111 GLU E OE1 1 
ATOM   9408  O  OE2 . GLU E  1 112 ? 79.728  12.708  -76.347  1.00 46.97  ? 111 GLU E OE2 1 
ATOM   9409  N  N   . GLU E  1 113 ? 83.842  13.948  -81.677  1.00 32.17  ? 112 GLU E N   1 
ATOM   9410  C  CA  . GLU E  1 113 ? 84.574  13.433  -82.841  1.00 34.40  ? 112 GLU E CA  1 
ATOM   9411  C  C   . GLU E  1 113 ? 86.066  13.790  -82.789  1.00 34.51  ? 112 GLU E C   1 
ATOM   9412  O  O   . GLU E  1 113 ? 86.915  13.022  -83.260  1.00 35.14  ? 112 GLU E O   1 
ATOM   9413  C  CB  . GLU E  1 113 ? 83.939  13.956  -84.141  1.00 43.20  ? 112 GLU E CB  1 
ATOM   9414  C  CG  . GLU E  1 113 ? 84.605  13.462  -85.426  1.00 61.51  ? 112 GLU E CG  1 
ATOM   9415  C  CD  . GLU E  1 113 ? 83.850  13.889  -86.687  1.00 78.87  ? 112 GLU E CD  1 
ATOM   9416  O  OE1 . GLU E  1 113 ? 82.730  14.439  -86.559  1.00 66.27  ? 112 GLU E OE1 1 
ATOM   9417  O  OE2 . GLU E  1 113 ? 84.379  13.672  -87.803  1.00 57.39  ? 112 GLU E OE2 1 
ATOM   9418  N  N   . TYR E  1 114 ? 86.386  14.952  -82.225  1.00 32.65  ? 113 TYR E N   1 
ATOM   9419  C  CA  . TYR E  1 114 ? 87.779  15.396  -82.164  1.00 41.60  ? 113 TYR E CA  1 
ATOM   9420  C  C   . TYR E  1 114 ? 88.144  15.816  -80.747  1.00 45.19  ? 113 TYR E C   1 
ATOM   9421  O  O   . TYR E  1 114 ? 88.307  17.001  -80.468  1.00 39.03  ? 113 TYR E O   1 
ATOM   9422  C  CB  . TYR E  1 114 ? 88.032  16.556  -83.144  1.00 41.34  ? 113 TYR E CB  1 
ATOM   9423  C  CG  . TYR E  1 114 ? 87.693  16.217  -84.577  1.00 37.28  ? 113 TYR E CG  1 
ATOM   9424  C  CD1 . TYR E  1 114 ? 88.519  15.380  -85.329  1.00 38.66  ? 113 TYR E CD1 1 
ATOM   9425  C  CD2 . TYR E  1 114 ? 86.544  16.730  -85.179  1.00 42.82  ? 113 TYR E CD2 1 
ATOM   9426  C  CE1 . TYR E  1 114 ? 88.211  15.062  -86.643  1.00 44.04  ? 113 TYR E CE1 1 
ATOM   9427  C  CE2 . TYR E  1 114 ? 86.226  16.418  -86.487  1.00 61.05  ? 113 TYR E CE2 1 
ATOM   9428  C  CZ  . TYR E  1 114 ? 87.058  15.582  -87.214  1.00 52.33  ? 113 TYR E CZ  1 
ATOM   9429  O  OH  . TYR E  1 114 ? 86.746  15.273  -88.517  1.00 81.71  ? 113 TYR E OH  1 
ATOM   9430  N  N   . PRO E  1 115 ? 88.274  14.836  -79.846  1.00 40.46  ? 114 PRO E N   1 
ATOM   9431  C  CA  . PRO E  1 115 ? 88.515  15.106  -78.422  1.00 33.34  ? 114 PRO E CA  1 
ATOM   9432  C  C   . PRO E  1 115 ? 89.788  15.933  -78.215  1.00 41.14  ? 114 PRO E C   1 
ATOM   9433  O  O   . PRO E  1 115 ? 89.871  16.719  -77.273  1.00 45.25  ? 114 PRO E O   1 
ATOM   9434  C  CB  . PRO E  1 115 ? 88.669  13.700  -77.822  1.00 33.80  ? 114 PRO E CB  1 
ATOM   9435  C  CG  . PRO E  1 115 ? 89.011  12.814  -78.986  1.00 48.34  ? 114 PRO E CG  1 
ATOM   9436  C  CD  . PRO E  1 115 ? 88.241  13.393  -80.135  1.00 46.86  ? 114 PRO E CD  1 
ATOM   9437  N  N   . ASP E  1 116 ? 90.749  15.771  -79.116  1.00 39.75  ? 115 ASP E N   1 
ATOM   9438  C  CA  . ASP E  1 116 ? 92.008  16.515  -79.081  1.00 46.21  ? 115 ASP E CA  1 
ATOM   9439  C  C   . ASP E  1 116 ? 91.871  18.005  -79.438  1.00 50.24  ? 115 ASP E C   1 
ATOM   9440  O  O   . ASP E  1 116 ? 92.794  18.787  -79.215  1.00 42.94  ? 115 ASP E O   1 
ATOM   9441  C  CB  . ASP E  1 116 ? 92.992  15.881  -80.056  1.00 58.92  ? 115 ASP E CB  1 
ATOM   9442  C  CG  . ASP E  1 116 ? 94.319  15.565  -79.419  1.00 100.17 ? 115 ASP E CG  1 
ATOM   9443  O  OD1 . ASP E  1 116 ? 95.119  16.507  -79.223  1.00 105.33 ? 115 ASP E OD1 1 
ATOM   9444  O  OD2 . ASP E  1 116 ? 94.562  14.374  -79.122  1.00 97.30  ? 115 ASP E OD2 1 
ATOM   9445  N  N   . SER E  1 117 ? 90.730  18.384  -80.005  1.00 39.30  ? 116 SER E N   1 
ATOM   9446  C  CA  . SER E  1 117 ? 90.486  19.753  -80.452  1.00 41.11  ? 116 SER E CA  1 
ATOM   9447  C  C   . SER E  1 117 ? 89.690  20.573  -79.446  1.00 34.83  ? 116 SER E C   1 
ATOM   9448  O  O   . SER E  1 117 ? 89.183  21.637  -79.787  1.00 37.88  ? 116 SER E O   1 
ATOM   9449  C  CB  . SER E  1 117 ? 89.726  19.753  -81.790  1.00 41.11  ? 116 SER E CB  1 
ATOM   9450  O  OG  . SER E  1 117 ? 90.564  19.330  -82.856  1.00 46.62  ? 116 SER E OG  1 
ATOM   9451  N  N   . GLY E  1 118 ? 89.562  20.081  -78.214  1.00 40.86  ? 117 GLY E N   1 
ATOM   9452  C  CA  . GLY E  1 118 ? 88.714  20.740  -77.228  1.00 38.14  ? 117 GLY E CA  1 
ATOM   9453  C  C   . GLY E  1 118 ? 89.097  22.184  -76.936  1.00 29.99  ? 117 GLY E C   1 
ATOM   9454  O  O   . GLY E  1 118 ? 88.246  23.064  -76.845  1.00 33.47  ? 117 GLY E O   1 
ATOM   9455  N  N   . GLU E  1 119 ? 90.394  22.429  -76.764  1.00 33.26  ? 118 GLU E N   1 
ATOM   9456  C  CA  . GLU E  1 119 ? 90.855  23.792  -76.543  1.00 39.15  ? 118 GLU E CA  1 
ATOM   9457  C  C   . GLU E  1 119 ? 90.545  24.701  -77.735  1.00 34.19  ? 118 GLU E C   1 
ATOM   9458  O  O   . GLU E  1 119 ? 90.086  25.837  -77.560  1.00 34.18  ? 118 GLU E O   1 
ATOM   9459  C  CB  . GLU E  1 119 ? 92.338  23.784  -76.203  1.00 42.68  ? 118 GLU E CB  1 
ATOM   9460  C  CG  . GLU E  1 119 ? 92.608  22.875  -75.010  1.00 43.43  ? 118 GLU E CG  1 
ATOM   9461  C  CD  . GLU E  1 119 ? 94.038  22.905  -74.553  1.00 63.01  ? 118 GLU E CD  1 
ATOM   9462  O  OE1 . GLU E  1 119 ? 94.896  23.380  -75.328  1.00 65.13  ? 118 GLU E OE1 1 
ATOM   9463  O  OE2 . GLU E  1 119 ? 94.298  22.457  -73.414  1.00 63.19  ? 118 GLU E OE2 1 
ATOM   9464  N  N   . ASN E  1 120 ? 90.790  24.216  -78.949  1.00 35.65  ? 119 ASN E N   1 
ATOM   9465  C  CA  . ASN E  1 120 ? 90.450  25.015  -80.121  1.00 36.84  ? 119 ASN E CA  1 
ATOM   9466  C  C   . ASN E  1 120 ? 88.952  25.304  -80.206  1.00 36.71  ? 119 ASN E C   1 
ATOM   9467  O  O   . ASN E  1 120 ? 88.537  26.415  -80.549  1.00 36.75  ? 119 ASN E O   1 
ATOM   9468  C  CB  . ASN E  1 120 ? 90.954  24.352  -81.405  1.00 35.54  ? 119 ASN E CB  1 
ATOM   9469  C  CG  . ASN E  1 120 ? 92.464  24.483  -81.576  1.00 56.85  ? 119 ASN E CG  1 
ATOM   9470  O  OD1 . ASN E  1 120 ? 93.114  25.283  -80.902  1.00 55.77  ? 119 ASN E OD1 1 
ATOM   9471  N  ND2 . ASN E  1 120 ? 93.023  23.702  -82.491  1.00 54.01  ? 119 ASN E ND2 1 
ATOM   9472  N  N   . ILE E  1 121 ? 88.138  24.302  -79.891  1.00 30.67  ? 120 ILE E N   1 
ATOM   9473  C  CA  . ILE E  1 121 ? 86.685  24.455  -79.937  1.00 28.76  ? 120 ILE E CA  1 
ATOM   9474  C  C   . ILE E  1 121 ? 86.180  25.482  -78.924  1.00 28.92  ? 120 ILE E C   1 
ATOM   9475  O  O   . ILE E  1 121 ? 85.360  26.333  -79.246  1.00 32.19  ? 120 ILE E O   1 
ATOM   9476  C  CB  . ILE E  1 121 ? 86.003  23.090  -79.705  1.00 30.18  ? 120 ILE E CB  1 
ATOM   9477  C  CG1 . ILE E  1 121 ? 86.189  22.217  -80.954  1.00 49.79  ? 120 ILE E CG1 1 
ATOM   9478  C  CG2 . ILE E  1 121 ? 84.507  23.263  -79.353  1.00 29.87  ? 120 ILE E CG2 1 
ATOM   9479  C  CD1 . ILE E  1 121 ? 86.031  20.706  -80.712  1.00 39.43  ? 120 ILE E CD1 1 
ATOM   9480  N  N   . VAL E  1 122 ? 86.688  25.408  -77.704  1.00 31.13  ? 121 VAL E N   1 
ATOM   9481  C  CA  . VAL E  1 122 ? 86.298  26.359  -76.675  1.00 29.85  ? 121 VAL E CA  1 
ATOM   9482  C  C   . VAL E  1 122 ? 86.773  27.785  -77.009  1.00 32.62  ? 121 VAL E C   1 
ATOM   9483  O  O   . VAL E  1 122 ? 86.031  28.750  -76.803  1.00 31.34  ? 121 VAL E O   1 
ATOM   9484  C  CB  . VAL E  1 122 ? 86.832  25.916  -75.299  1.00 34.95  ? 121 VAL E CB  1 
ATOM   9485  C  CG1 . VAL E  1 122 ? 86.734  27.043  -74.286  1.00 33.96  ? 121 VAL E CG1 1 
ATOM   9486  C  CG2 . VAL E  1 122 ? 86.089  24.671  -74.826  1.00 34.11  ? 121 VAL E CG2 1 
ATOM   9487  N  N   . ASP E  1 123 ? 87.994  27.914  -77.536  1.00 30.37  ? 122 ASP E N   1 
ATOM   9488  C  CA  . ASP E  1 123 ? 88.487  29.223  -77.985  1.00 35.91  ? 122 ASP E CA  1 
ATOM   9489  C  C   . ASP E  1 123 ? 87.526  29.864  -78.975  1.00 37.54  ? 122 ASP E C   1 
ATOM   9490  O  O   . ASP E  1 123 ? 87.219  31.053  -78.872  1.00 33.02  ? 122 ASP E O   1 
ATOM   9491  C  CB  . ASP E  1 123 ? 89.884  29.117  -78.616  1.00 34.82  ? 122 ASP E CB  1 
ATOM   9492  C  CG  . ASP E  1 123 ? 90.958  28.783  -77.599  1.00 45.89  ? 122 ASP E CG  1 
ATOM   9493  O  OD1 . ASP E  1 123 ? 90.636  28.744  -76.389  1.00 50.59  ? 122 ASP E OD1 1 
ATOM   9494  O  OD2 . ASP E  1 123 ? 92.116  28.570  -78.007  1.00 48.25  ? 122 ASP E OD2 1 
ATOM   9495  N  N   . ALA E  1 124 ? 87.039  29.065  -79.920  1.00 29.89  ? 123 ALA E N   1 
ATOM   9496  C  CA  . ALA E  1 124 ? 86.120  29.566  -80.934  1.00 33.31  ? 123 ALA E CA  1 
ATOM   9497  C  C   . ALA E  1 124 ? 84.779  29.940  -80.317  1.00 42.60  ? 123 ALA E C   1 
ATOM   9498  O  O   . ALA E  1 124 ? 84.189  30.958  -80.688  1.00 30.65  ? 123 ALA E O   1 
ATOM   9499  C  CB  . ALA E  1 124 ? 85.927  28.533  -82.048  1.00 35.60  ? 123 ALA E CB  1 
ATOM   9500  N  N   . LEU E  1 125 ? 84.295  29.112  -79.389  1.00 33.21  ? 124 LEU E N   1 
ATOM   9501  C  CA  . LEU E  1 125 ? 83.064  29.420  -78.654  1.00 33.97  ? 124 LEU E CA  1 
ATOM   9502  C  C   . LEU E  1 125 ? 83.187  30.753  -77.900  1.00 31.42  ? 124 LEU E C   1 
ATOM   9503  O  O   . LEU E  1 125 ? 82.253  31.549  -77.887  1.00 31.09  ? 124 LEU E O   1 
ATOM   9504  C  CB  . LEU E  1 125 ? 82.696  28.279  -77.691  1.00 23.12  ? 124 LEU E CB  1 
ATOM   9505  C  CG  . LEU E  1 125 ? 82.271  26.947  -78.343  1.00 34.43  ? 124 LEU E CG  1 
ATOM   9506  C  CD1 . LEU E  1 125 ? 82.241  25.808  -77.310  1.00 33.67  ? 124 LEU E CD1 1 
ATOM   9507  C  CD2 . LEU E  1 125 ? 80.889  27.079  -79.035  1.00 33.80  ? 124 LEU E CD2 1 
ATOM   9508  N  N   . ALA E  1 126 ? 84.341  31.002  -77.285  1.00 30.05  ? 125 ALA E N   1 
ATOM   9509  C  CA  . ALA E  1 126 ? 84.534  32.239  -76.526  1.00 31.70  ? 125 ALA E CA  1 
ATOM   9510  C  C   . ALA E  1 126 ? 84.516  33.461  -77.440  1.00 32.23  ? 125 ALA E C   1 
ATOM   9511  O  O   . ALA E  1 126 ? 83.899  34.490  -77.111  1.00 30.98  ? 125 ALA E O   1 
ATOM   9512  C  CB  . ALA E  1 126 ? 85.826  32.197  -75.704  1.00 31.34  ? 125 ALA E CB  1 
ATOM   9513  N  N   . VAL E  1 127 ? 85.160  33.344  -78.600  1.00 35.65  ? 126 VAL E N   1 
ATOM   9514  C  CA  . VAL E  1 127 ? 85.204  34.448  -79.561  1.00 34.60  ? 126 VAL E CA  1 
ATOM   9515  C  C   . VAL E  1 127 ? 83.804  34.769  -80.057  1.00 28.69  ? 126 VAL E C   1 
ATOM   9516  O  O   . VAL E  1 127 ? 83.413  35.948  -80.162  1.00 31.59  ? 126 VAL E O   1 
ATOM   9517  C  CB  . VAL E  1 127 ? 86.079  34.117  -80.795  1.00 34.97  ? 126 VAL E CB  1 
ATOM   9518  C  CG1 . VAL E  1 127 ? 85.950  35.219  -81.838  1.00 38.02  ? 126 VAL E CG1 1 
ATOM   9519  C  CG2 . VAL E  1 127 ? 87.543  33.913  -80.399  1.00 37.57  ? 126 VAL E CG2 1 
ATOM   9520  N  N   . PHE E  1 128 ? 83.037  33.720  -80.338  1.00 28.99  ? 127 PHE E N   1 
ATOM   9521  C  CA  . PHE E  1 128 ? 81.674  33.867  -80.858  1.00 31.58  ? 127 PHE E CA  1 
ATOM   9522  C  C   . PHE E  1 128 ? 80.781  34.527  -79.816  1.00 32.37  ? 127 PHE E C   1 
ATOM   9523  O  O   . PHE E  1 128 ? 79.956  35.387  -80.143  1.00 30.62  ? 127 PHE E O   1 
ATOM   9524  C  CB  . PHE E  1 128 ? 81.111  32.493  -81.248  1.00 33.87  ? 127 PHE E CB  1 
ATOM   9525  C  CG  . PHE E  1 128 ? 79.835  32.549  -82.050  1.00 33.28  ? 127 PHE E CG  1 
ATOM   9526  C  CD1 . PHE E  1 128 ? 78.594  32.519  -81.417  1.00 41.94  ? 127 PHE E CD1 1 
ATOM   9527  C  CD2 . PHE E  1 128 ? 79.873  32.593  -83.435  1.00 36.78  ? 127 PHE E CD2 1 
ATOM   9528  C  CE1 . PHE E  1 128 ? 77.417  32.550  -82.155  1.00 37.40  ? 127 PHE E CE1 1 
ATOM   9529  C  CE2 . PHE E  1 128 ? 78.704  32.622  -84.182  1.00 44.88  ? 127 PHE E CE2 1 
ATOM   9530  C  CZ  . PHE E  1 128 ? 77.475  32.599  -83.544  1.00 34.64  ? 127 PHE E CZ  1 
ATOM   9531  N  N   . LEU E  1 129 ? 80.939  34.103  -78.568  1.00 30.14  ? 128 LEU E N   1 
ATOM   9532  C  CA  . LEU E  1 129 ? 80.167  34.630  -77.460  1.00 28.75  ? 128 LEU E CA  1 
ATOM   9533  C  C   . LEU E  1 129 ? 80.556  36.084  -77.179  1.00 34.37  ? 128 LEU E C   1 
ATOM   9534  O  O   . LEU E  1 129 ? 79.698  36.918  -76.864  1.00 32.36  ? 128 LEU E O   1 
ATOM   9535  C  CB  . LEU E  1 129 ? 80.357  33.766  -76.211  1.00 37.97  ? 128 LEU E CB  1 
ATOM   9536  C  CG  . LEU E  1 129 ? 79.369  34.032  -75.070  1.00 46.54  ? 128 LEU E CG  1 
ATOM   9537  C  CD1 . LEU E  1 129 ? 77.921  33.927  -75.558  1.00 34.24  ? 128 LEU E CD1 1 
ATOM   9538  C  CD2 . LEU E  1 129 ? 79.613  33.074  -73.900  1.00 35.45  ? 128 LEU E CD2 1 
ATOM   9539  N  N   . ARG E  1 130 ? 81.843  36.396  -77.300  1.00 30.25  ? 129 ARG E N   1 
ATOM   9540  C  CA  . ARG E  1 130 ? 82.273  37.783  -77.164  1.00 32.80  ? 129 ARG E CA  1 
ATOM   9541  C  C   . ARG E  1 130 ? 81.630  38.673  -78.242  1.00 39.80  ? 129 ARG E C   1 
ATOM   9542  O  O   . ARG E  1 130 ? 81.255  39.817  -77.959  1.00 33.64  ? 129 ARG E O   1 
ATOM   9543  C  CB  . ARG E  1 130 ? 83.810  37.913  -77.200  1.00 35.84  ? 129 ARG E CB  1 
ATOM   9544  C  CG  . ARG E  1 130 ? 84.510  37.519  -75.887  1.00 39.53  ? 129 ARG E CG  1 
ATOM   9545  C  CD  . ARG E  1 130 ? 86.038  37.482  -76.038  1.00 50.10  ? 129 ARG E CD  1 
ATOM   9546  N  NE  . ARG E  1 130 ? 86.578  38.761  -76.493  1.00 49.99  ? 129 ARG E NE  1 
ATOM   9547  C  CZ  . ARG E  1 130 ? 86.917  39.768  -75.690  1.00 82.84  ? 129 ARG E CZ  1 
ATOM   9548  N  NH1 . ARG E  1 130 ? 86.772  39.659  -74.374  1.00 46.99  ? 129 ARG E NH1 1 
ATOM   9549  N  NH2 . ARG E  1 130 ? 87.401  40.892  -76.204  1.00 72.21  ? 129 ARG E NH2 1 
ATOM   9550  N  N   . ARG E  1 131 ? 81.501  38.155  -79.466  1.00 31.50  ? 130 ARG E N   1 
ATOM   9551  C  CA  . ARG E  1 131 ? 80.852  38.927  -80.535  1.00 35.19  ? 130 ARG E CA  1 
ATOM   9552  C  C   . ARG E  1 131 ? 79.404  39.205  -80.186  1.00 28.74  ? 130 ARG E C   1 
ATOM   9553  O  O   . ARG E  1 131 ? 78.928  40.328  -80.336  1.00 32.67  ? 130 ARG E O   1 
ATOM   9554  C  CB  . ARG E  1 131 ? 80.863  38.188  -81.873  1.00 36.64  ? 130 ARG E CB  1 
ATOM   9555  C  CG  . ARG E  1 131 ? 82.176  38.185  -82.603  1.00 59.65  ? 130 ARG E CG  1 
ATOM   9556  C  CD  . ARG E  1 131 ? 82.105  37.202  -83.758  1.00 66.21  ? 130 ARG E CD  1 
ATOM   9557  N  NE  . ARG E  1 131 ? 81.069  37.534  -84.737  1.00 52.80  ? 130 ARG E NE  1 
ATOM   9558  C  CZ  . ARG E  1 131 ? 80.709  36.740  -85.745  1.00 56.88  ? 130 ARG E CZ  1 
ATOM   9559  N  NH1 . ARG E  1 131 ? 81.284  35.550  -85.903  1.00 63.89  ? 130 ARG E NH1 1 
ATOM   9560  N  NH2 . ARG E  1 131 ? 79.767  37.128  -86.593  1.00 56.28  ? 130 ARG E NH2 1 
ATOM   9561  N  N   . LEU E  1 132 ? 78.699  38.168  -79.752  1.00 29.78  ? 131 LEU E N   1 
ATOM   9562  C  CA  . LEU E  1 132 ? 77.285  38.310  -79.421  1.00 29.04  ? 131 LEU E CA  1 
ATOM   9563  C  C   . LEU E  1 132 ? 77.093  39.349  -78.325  1.00 35.82  ? 131 LEU E C   1 
ATOM   9564  O  O   . LEU E  1 132 ? 76.229  40.232  -78.413  1.00 30.99  ? 131 LEU E O   1 
ATOM   9565  C  CB  . LEU E  1 132 ? 76.727  36.966  -78.942  1.00 27.62  ? 131 LEU E CB  1 
ATOM   9566  C  CG  . LEU E  1 132 ? 75.214  36.954  -78.666  1.00 30.84  ? 131 LEU E CG  1 
ATOM   9567  C  CD1 . LEU E  1 132 ? 74.425  37.093  -79.950  1.00 37.07  ? 131 LEU E CD1 1 
ATOM   9568  C  CD2 . LEU E  1 132 ? 74.794  35.689  -77.897  1.00 27.05  ? 131 LEU E CD2 1 
ATOM   9569  N  N   . HIS E  1 133 ? 77.904  39.229  -77.284  1.00 29.50  ? 132 HIS E N   1 
ATOM   9570  C  CA  . HIS E  1 133 ? 77.841  40.147  -76.157  1.00 29.33  ? 132 HIS E CA  1 
ATOM   9571  C  C   . HIS E  1 133 ? 78.377  41.547  -76.400  1.00 31.31  ? 132 HIS E C   1 
ATOM   9572  O  O   . HIS E  1 133 ? 78.288  42.397  -75.512  1.00 35.72  ? 132 HIS E O   1 
ATOM   9573  C  CB  . HIS E  1 133 ? 78.513  39.532  -74.927  1.00 29.49  ? 132 HIS E CB  1 
ATOM   9574  C  CG  . HIS E  1 133 ? 77.776  38.351  -74.387  1.00 27.24  ? 132 HIS E CG  1 
ATOM   9575  N  ND1 . HIS E  1 133 ? 78.209  37.642  -73.290  1.00 31.83  ? 132 HIS E ND1 1 
ATOM   9576  C  CD2 . HIS E  1 133 ? 76.625  37.757  -74.793  1.00 27.16  ? 132 HIS E CD2 1 
ATOM   9577  C  CE1 . HIS E  1 133 ? 77.372  36.646  -73.053  1.00 28.84  ? 132 HIS E CE1 1 
ATOM   9578  N  NE2 . HIS E  1 133 ? 76.395  36.699  -73.945  1.00 29.37  ? 132 HIS E NE2 1 
ATOM   9579  N  N   . SER E  1 134 ? 78.914  41.804  -77.594  1.00 31.48  ? 133 SER E N   1 
ATOM   9580  C  CA  A SER E  1 134 ? 79.381  43.140  -77.942  0.51 32.67  ? 133 SER E CA  1 
ATOM   9581  C  CA  B SER E  1 134 ? 79.379  43.143  -77.933  0.49 29.08  ? 133 SER E CA  1 
ATOM   9582  C  C   . SER E  1 134 ? 78.327  43.960  -78.682  1.00 31.02  ? 133 SER E C   1 
ATOM   9583  O  O   . SER E  1 134 ? 78.532  45.145  -78.942  1.00 32.02  ? 133 SER E O   1 
ATOM   9584  C  CB  A SER E  1 134 ? 80.665  43.073  -78.783  0.51 39.70  ? 133 SER E CB  1 
ATOM   9585  C  CB  B SER E  1 134 ? 80.679  43.091  -78.756  0.49 36.89  ? 133 SER E CB  1 
ATOM   9586  O  OG  A SER E  1 134 ? 81.747  42.560  -78.027  0.51 29.24  ? 133 SER E OG  1 
ATOM   9587  O  OG  B SER E  1 134 ? 80.422  42.739  -80.105  0.49 40.54  ? 133 SER E OG  1 
ATOM   9588  N  N   . ILE E  1 135 ? 77.207  43.330  -79.038  1.00 35.07  ? 134 ILE E N   1 
ATOM   9589  C  CA  . ILE E  1 135 ? 76.124  44.063  -79.704  1.00 35.88  ? 134 ILE E CA  1 
ATOM   9590  C  C   . ILE E  1 135 ? 75.567  45.107  -78.729  1.00 35.65  ? 134 ILE E C   1 
ATOM   9591  O  O   . ILE E  1 135 ? 75.135  44.751  -77.635  1.00 33.16  ? 134 ILE E O   1 
ATOM   9592  C  CB  . ILE E  1 135 ? 74.961  43.120  -80.128  1.00 32.73  ? 134 ILE E CB  1 
ATOM   9593  C  CG1 . ILE E  1 135 ? 75.459  42.043  -81.097  1.00 35.67  ? 134 ILE E CG1 1 
ATOM   9594  C  CG2 . ILE E  1 135 ? 73.833  43.957  -80.746  1.00 32.81  ? 134 ILE E CG2 1 
ATOM   9595  C  CD1 . ILE E  1 135 ? 74.486  40.897  -81.291  1.00 32.97  ? 134 ILE E CD1 1 
ATOM   9596  N  N   . PRO E  1 136 ? 75.594  46.398  -79.100  1.00 33.67  ? 135 PRO E N   1 
ATOM   9597  C  CA  . PRO E  1 136 ? 75.058  47.384  -78.151  1.00 34.99  ? 135 PRO E CA  1 
ATOM   9598  C  C   . PRO E  1 136 ? 73.610  47.081  -77.795  1.00 39.02  ? 135 PRO E C   1 
ATOM   9599  O  O   . PRO E  1 136 ? 72.819  46.774  -78.685  1.00 39.01  ? 135 PRO E O   1 
ATOM   9600  C  CB  . PRO E  1 136 ? 75.190  48.709  -78.914  1.00 40.85  ? 135 PRO E CB  1 
ATOM   9601  C  CG  . PRO E  1 136 ? 76.363  48.469  -79.825  1.00 39.15  ? 135 PRO E CG  1 
ATOM   9602  C  CD  . PRO E  1 136 ? 76.204  47.049  -80.278  1.00 37.50  ? 135 PRO E CD  1 
ATOM   9603  N  N   . VAL E  1 137 ? 73.281  47.118  -76.505  1.00 33.83  ? 136 VAL E N   1 
ATOM   9604  C  CA  . VAL E  1 137 ? 71.957  46.691  -76.065  1.00 31.00  ? 136 VAL E CA  1 
ATOM   9605  C  C   . VAL E  1 137 ? 70.885  47.663  -76.575  1.00 30.41  ? 136 VAL E C   1 
ATOM   9606  O  O   . VAL E  1 137 ? 69.727  47.315  -76.643  1.00 33.98  ? 136 VAL E O   1 
ATOM   9607  C  CB  . VAL E  1 137 ? 71.846  46.558  -74.528  1.00 38.49  ? 136 VAL E CB  1 
ATOM   9608  C  CG1 . VAL E  1 137 ? 72.710  45.392  -74.012  1.00 32.24  ? 136 VAL E CG1 1 
ATOM   9609  C  CG2 . VAL E  1 137 ? 72.202  47.868  -73.849  1.00 38.77  ? 136 VAL E CG2 1 
ATOM   9610  N  N   . CYS E  1 138 ? 71.296  48.865  -76.950  1.00 31.97  ? 137 CYS E N   1 
ATOM   9611  C  CA  . CYS E  1 138 ? 70.343  49.836  -77.507  1.00 42.74  ? 137 CYS E CA  1 
ATOM   9612  C  C   . CYS E  1 138 ? 69.692  49.353  -78.810  1.00 39.94  ? 137 CYS E C   1 
ATOM   9613  O  O   . CYS E  1 138 ? 68.683  49.913  -79.246  1.00 40.76  ? 137 CYS E O   1 
ATOM   9614  C  CB  . CYS E  1 138 ? 71.009  51.185  -77.733  1.00 44.87  ? 137 CYS E CB  1 
ATOM   9615  S  SG  . CYS E  1 138 ? 72.270  51.199  -79.036  1.00 42.78  ? 137 CYS E SG  1 
ATOM   9616  N  N   . ASN E  1 139 ? 70.270  48.320  -79.423  1.00 34.78  ? 138 ASN E N   1 
ATOM   9617  C  CA  . ASN E  1 139 ? 69.749  47.751  -80.658  1.00 33.08  ? 138 ASN E CA  1 
ATOM   9618  C  C   . ASN E  1 139 ? 68.662  46.698  -80.438  1.00 37.56  ? 138 ASN E C   1 
ATOM   9619  O  O   . ASN E  1 139 ? 68.005  46.299  -81.389  1.00 31.82  ? 138 ASN E O   1 
ATOM   9620  C  CB  . ASN E  1 139 ? 70.872  47.053  -81.437  1.00 34.40  ? 138 ASN E CB  1 
ATOM   9621  C  CG  . ASN E  1 139 ? 71.912  48.018  -81.974  1.00 43.96  ? 138 ASN E CG  1 
ATOM   9622  O  OD1 . ASN E  1 139 ? 71.644  48.792  -82.883  1.00 45.14  ? 138 ASN E OD1 1 
ATOM   9623  N  ND2 . ASN E  1 139 ? 73.116  47.939  -81.439  1.00 38.59  ? 138 ASN E ND2 1 
ATOM   9624  N  N   . CYS E  1 140 ? 68.517  46.202  -79.210  1.00 32.17  ? 139 CYS E N   1 
ATOM   9625  C  CA  . CYS E  1 140 ? 67.754  44.969  -78.974  1.00 28.48  ? 139 CYS E CA  1 
ATOM   9626  C  C   . CYS E  1 140 ? 66.357  45.250  -78.410  1.00 32.13  ? 139 CYS E C   1 
ATOM   9627  O  O   . CYS E  1 140 ? 66.235  45.865  -77.353  1.00 30.86  ? 139 CYS E O   1 
ATOM   9628  C  CB  . CYS E  1 140 ? 68.509  44.045  -78.014  1.00 29.39  ? 139 CYS E CB  1 
ATOM   9629  S  SG  . CYS E  1 140 ? 67.687  42.439  -77.697  1.00 33.70  ? 139 CYS E SG  1 
ATOM   9630  N  N   . PRO E  1 141 ? 65.303  44.819  -79.125  1.00 31.82  ? 140 PRO E N   1 
ATOM   9631  C  CA  . PRO E  1 141 ? 63.939  45.152  -78.676  1.00 29.97  ? 140 PRO E CA  1 
ATOM   9632  C  C   . PRO E  1 141 ? 63.379  44.068  -77.764  1.00 30.20  ? 140 PRO E C   1 
ATOM   9633  O  O   . PRO E  1 141 ? 62.204  44.136  -77.397  1.00 32.14  ? 140 PRO E O   1 
ATOM   9634  C  CB  . PRO E  1 141 ? 63.152  45.196  -79.987  1.00 33.53  ? 140 PRO E CB  1 
ATOM   9635  C  CG  . PRO E  1 141 ? 63.814  44.142  -80.814  1.00 42.05  ? 140 PRO E CG  1 
ATOM   9636  C  CD  . PRO E  1 141 ? 65.297  44.179  -80.450  1.00 34.71  ? 140 PRO E CD  1 
ATOM   9637  N  N   . PHE E  1 142 ? 64.206  43.083  -77.409  1.00 26.95  ? 141 PHE E N   1 
ATOM   9638  C  CA  . PHE E  1 142 ? 63.752  41.958  -76.576  1.00 30.43  ? 141 PHE E CA  1 
ATOM   9639  C  C   . PHE E  1 142 ? 64.295  41.972  -75.155  1.00 35.09  ? 141 PHE E C   1 
ATOM   9640  O  O   . PHE E  1 142 ? 65.509  42.099  -74.929  1.00 32.69  ? 141 PHE E O   1 
ATOM   9641  C  CB  . PHE E  1 142 ? 64.068  40.591  -77.221  1.00 25.41  ? 141 PHE E CB  1 
ATOM   9642  C  CG  . PHE E  1 142 ? 63.594  40.479  -78.641  1.00 34.56  ? 141 PHE E CG  1 
ATOM   9643  C  CD1 . PHE E  1 142 ? 62.237  40.448  -78.929  1.00 35.02  ? 141 PHE E CD1 1 
ATOM   9644  C  CD2 . PHE E  1 142 ? 64.507  40.423  -79.687  1.00 32.63  ? 141 PHE E CD2 1 
ATOM   9645  C  CE1 . PHE E  1 142 ? 61.792  40.375  -80.240  1.00 38.40  ? 141 PHE E CE1 1 
ATOM   9646  C  CE2 . PHE E  1 142 ? 64.078  40.338  -80.991  1.00 32.33  ? 141 PHE E CE2 1 
ATOM   9647  C  CZ  . PHE E  1 142 ? 62.716  40.312  -81.276  1.00 29.07  ? 141 PHE E CZ  1 
ATOM   9648  N  N   . ASN E  1 143 ? 63.375  41.788  -74.213  1.00 29.28  ? 142 ASN E N   1 
ATOM   9649  C  CA  . ASN E  1 143 ? 63.678  41.696  -72.793  1.00 31.47  ? 142 ASN E CA  1 
ATOM   9650  C  C   . ASN E  1 143 ? 63.729  40.236  -72.351  1.00 34.71  ? 142 ASN E C   1 
ATOM   9651  O  O   . ASN E  1 143 ? 62.727  39.517  -72.451  1.00 31.58  ? 142 ASN E O   1 
ATOM   9652  C  CB  . ASN E  1 143 ? 62.608  42.442  -71.980  1.00 39.34  ? 142 ASN E CB  1 
ATOM   9653  C  CG  . ASN E  1 143 ? 62.706  42.161  -70.478  1.00 41.12  ? 142 ASN E CG  1 
ATOM   9654  O  OD1 . ASN E  1 143 ? 63.806  42.037  -69.939  1.00 32.43  ? 142 ASN E OD1 1 
ATOM   9655  N  ND2 . ASN E  1 143 ? 61.553  42.052  -69.803  1.00 29.99  ? 142 ASN E ND2 1 
ATOM   9656  N  N   . SER E  1 144 ? 64.890  39.793  -71.874  1.00 28.25  ? 143 SER E N   1 
ATOM   9657  C  CA  . SER E  1 144 ? 65.037  38.454  -71.311  1.00 32.91  ? 143 SER E CA  1 
ATOM   9658  C  C   . SER E  1 144 ? 65.631  38.521  -69.908  1.00 29.14  ? 143 SER E C   1 
ATOM   9659  O  O   . SER E  1 144 ? 66.344  37.594  -69.481  1.00 33.58  ? 143 SER E O   1 
ATOM   9660  C  CB  . SER E  1 144 ? 65.955  37.589  -72.202  1.00 32.00  ? 143 SER E CB  1 
ATOM   9661  O  OG  . SER E  1 144 ? 65.326  37.291  -73.445  1.00 36.94  ? 143 SER E OG  1 
ATOM   9662  N  N   . ASP E  1 145 ? 65.360  39.604  -69.188  1.00 29.27  ? 144 ASP E N   1 
ATOM   9663  C  CA  . ASP E  1 145 ? 66.066  39.820  -67.933  1.00 34.71  ? 144 ASP E CA  1 
ATOM   9664  C  C   . ASP E  1 145 ? 65.631  38.862  -66.827  1.00 44.53  ? 144 ASP E C   1 
ATOM   9665  O  O   . ASP E  1 145 ? 64.708  38.078  -67.004  1.00 28.96  ? 144 ASP E O   1 
ATOM   9666  C  CB  . ASP E  1 145 ? 66.020  41.289  -67.473  1.00 32.62  ? 144 ASP E CB  1 
ATOM   9667  C  CG  . ASP E  1 145 ? 64.639  41.750  -67.027  1.00 44.70  ? 144 ASP E CG  1 
ATOM   9668  O  OD1 . ASP E  1 145 ? 63.707  40.927  -66.882  1.00 41.30  ? 144 ASP E OD1 1 
ATOM   9669  O  OD2 . ASP E  1 145 ? 64.491  42.976  -66.820  1.00 39.60  ? 144 ASP E OD2 1 
ATOM   9670  N  N   . ARG E  1 146 ? 66.319  38.942  -65.697  1.00 37.49  ? 145 ARG E N   1 
ATOM   9671  C  CA  . ARG E  1 146 ? 66.080  38.065  -64.547  1.00 39.83  ? 145 ARG E CA  1 
ATOM   9672  C  C   . ARG E  1 146 ? 64.622  38.017  -64.081  1.00 39.83  ? 145 ARG E C   1 
ATOM   9673  O  O   . ARG E  1 146 ? 64.047  36.941  -63.916  1.00 29.32  ? 145 ARG E O   1 
ATOM   9674  C  CB  . ARG E  1 146 ? 66.963  38.519  -63.381  1.00 35.95  ? 145 ARG E CB  1 
ATOM   9675  C  CG  . ARG E  1 146 ? 66.835  37.661  -62.152  1.00 52.24  ? 145 ARG E CG  1 
ATOM   9676  C  CD  . ARG E  1 146 ? 68.020  37.871  -61.223  1.00 58.55  ? 145 ARG E CD  1 
ATOM   9677  N  NE  . ARG E  1 146 ? 67.855  39.003  -60.318  1.00 55.60  ? 145 ARG E NE  1 
ATOM   9678  C  CZ  . ARG E  1 146 ? 68.643  40.077  -60.291  1.00 79.91  ? 145 ARG E CZ  1 
ATOM   9679  N  NH1 . ARG E  1 146 ? 68.413  41.042  -59.413  1.00 63.45  ? 145 ARG E NH1 1 
ATOM   9680  N  NH2 . ARG E  1 146 ? 69.659  40.191  -61.137  1.00 64.12  ? 145 ARG E NH2 1 
ATOM   9681  N  N   . VAL E  1 147 ? 64.024  39.179  -63.857  1.00 33.89  ? 146 VAL E N   1 
ATOM   9682  C  CA  A VAL E  1 147 ? 62.647  39.262  -63.376  0.50 35.28  ? 146 VAL E CA  1 
ATOM   9683  C  CA  B VAL E  1 147 ? 62.654  39.204  -63.350  0.50 31.72  ? 146 VAL E CA  1 
ATOM   9684  C  C   . VAL E  1 147 ? 61.686  38.592  -64.362  1.00 33.87  ? 146 VAL E C   1 
ATOM   9685  O  O   . VAL E  1 147 ? 60.715  37.936  -63.971  1.00 33.80  ? 146 VAL E O   1 
ATOM   9686  C  CB  A VAL E  1 147 ? 62.241  40.737  -63.152  0.50 44.61  ? 146 VAL E CB  1 
ATOM   9687  C  CB  B VAL E  1 147 ? 62.193  40.619  -62.940  0.50 30.41  ? 146 VAL E CB  1 
ATOM   9688  C  CG1 A VAL E  1 147 ? 60.792  40.846  -62.745  0.50 39.97  ? 146 VAL E CG1 1 
ATOM   9689  C  CG1 B VAL E  1 147 ? 63.010  41.127  -61.757  0.50 42.91  ? 146 VAL E CG1 1 
ATOM   9690  C  CG2 A VAL E  1 147 ? 63.130  41.373  -62.093  0.50 48.41  ? 146 VAL E CG2 1 
ATOM   9691  C  CG2 B VAL E  1 147 ? 62.299  41.571  -64.103  0.50 36.35  ? 146 VAL E CG2 1 
ATOM   9692  N  N   . PHE E  1 148 ? 61.960  38.770  -65.654  1.00 30.83  ? 147 PHE E N   1 
ATOM   9693  C  CA  . PHE E  1 148 ? 61.130  38.171  -66.703  1.00 31.69  ? 147 PHE E CA  1 
ATOM   9694  C  C   . PHE E  1 148 ? 61.258  36.649  -66.711  1.00 38.25  ? 147 PHE E C   1 
ATOM   9695  O  O   . PHE E  1 148 ? 60.253  35.927  -66.746  1.00 31.19  ? 147 PHE E O   1 
ATOM   9696  C  CB  . PHE E  1 148 ? 61.506  38.742  -68.079  1.00 33.38  ? 147 PHE E CB  1 
ATOM   9697  C  CG  . PHE E  1 148 ? 60.839  38.045  -69.230  1.00 31.84  ? 147 PHE E CG  1 
ATOM   9698  C  CD1 . PHE E  1 148 ? 59.551  38.410  -69.629  1.00 34.13  ? 147 PHE E CD1 1 
ATOM   9699  C  CD2 . PHE E  1 148 ? 61.500  37.047  -69.931  1.00 35.63  ? 147 PHE E CD2 1 
ATOM   9700  C  CE1 . PHE E  1 148 ? 58.928  37.770  -70.697  1.00 35.24  ? 147 PHE E CE1 1 
ATOM   9701  C  CE2 . PHE E  1 148 ? 60.884  36.391  -70.992  1.00 36.01  ? 147 PHE E CE2 1 
ATOM   9702  C  CZ  . PHE E  1 148 ? 59.589  36.752  -71.375  1.00 34.38  ? 147 PHE E CZ  1 
ATOM   9703  N  N   . ARG E  1 149 ? 62.494  36.158  -66.681  1.00 29.67  ? 148 ARG E N   1 
ATOM   9704  C  CA  . ARG E  1 149 ? 62.720  34.711  -66.705  1.00 32.01  ? 148 ARG E CA  1 
ATOM   9705  C  C   . ARG E  1 149 ? 62.189  34.024  -65.436  1.00 28.38  ? 148 ARG E C   1 
ATOM   9706  O  O   . ARG E  1 149 ? 61.701  32.891  -65.483  1.00 28.99  ? 148 ARG E O   1 
ATOM   9707  C  CB  . ARG E  1 149 ? 64.218  34.380  -66.904  1.00 27.90  ? 148 ARG E CB  1 
ATOM   9708  C  CG  . ARG E  1 149 ? 64.838  34.792  -68.266  1.00 26.51  ? 148 ARG E CG  1 
ATOM   9709  C  CD  . ARG E  1 149 ? 64.123  34.220  -69.494  1.00 29.05  ? 148 ARG E CD  1 
ATOM   9710  N  NE  . ARG E  1 149 ? 64.094  32.759  -69.554  1.00 35.71  ? 148 ARG E NE  1 
ATOM   9711  C  CZ  . ARG E  1 149 ? 65.153  31.972  -69.751  1.00 41.22  ? 148 ARG E CZ  1 
ATOM   9712  N  NH1 . ARG E  1 149 ? 66.368  32.485  -69.905  1.00 36.28  ? 148 ARG E NH1 1 
ATOM   9713  N  NH2 . ARG E  1 149 ? 64.992  30.653  -69.792  1.00 35.72  ? 148 ARG E NH2 1 
ATOM   9714  N  N   . LEU E  1 150 ? 62.295  34.698  -64.302  1.00 26.16  ? 149 LEU E N   1 
ATOM   9715  C  CA  . LEU E  1 150 ? 61.846  34.095  -63.049  1.00 31.25  ? 149 LEU E CA  1 
ATOM   9716  C  C   . LEU E  1 150 ? 60.335  33.960  -63.080  1.00 37.49  ? 149 LEU E C   1 
ATOM   9717  O  O   . LEU E  1 150 ? 59.784  32.972  -62.596  1.00 28.98  ? 149 LEU E O   1 
ATOM   9718  C  CB  . LEU E  1 150 ? 62.256  34.935  -61.852  1.00 28.45  ? 149 LEU E CB  1 
ATOM   9719  C  CG  . LEU E  1 150 ? 63.709  34.789  -61.390  1.00 29.44  ? 149 LEU E CG  1 
ATOM   9720  C  CD1 . LEU E  1 150 ? 64.090  35.920  -60.467  1.00 34.52  ? 149 LEU E CD1 1 
ATOM   9721  C  CD2 . LEU E  1 150 ? 63.929  33.448  -60.682  1.00 31.82  ? 149 LEU E CD2 1 
ATOM   9722  N  N   . ALA E  1 151 ? 59.656  34.958  -63.643  1.00 29.76  ? 150 ALA E N   1 
ATOM   9723  C  CA  . ALA E  1 151 ? 58.202  34.871  -63.747  1.00 32.64  ? 150 ALA E CA  1 
ATOM   9724  C  C   . ALA E  1 151 ? 57.817  33.740  -64.692  1.00 31.79  ? 150 ALA E C   1 
ATOM   9725  O  O   . ALA E  1 151 ? 56.841  33.019  -64.449  1.00 32.54  ? 150 ALA E O   1 
ATOM   9726  C  CB  . ALA E  1 151 ? 57.605  36.213  -64.222  1.00 33.64  ? 150 ALA E CB  1 
ATOM   9727  N  N   . GLN E  1 152 ? 58.582  33.567  -65.767  1.00 27.77  ? 151 GLN E N   1 
ATOM   9728  C  CA  . GLN E  1 152 ? 58.357  32.417  -66.656  1.00 36.57  ? 151 GLN E CA  1 
ATOM   9729  C  C   . GLN E  1 152 ? 58.557  31.114  -65.905  1.00 32.90  ? 151 GLN E C   1 
ATOM   9730  O  O   . GLN E  1 152 ? 57.783  30.164  -66.068  1.00 27.97  ? 151 GLN E O   1 
ATOM   9731  C  CB  . GLN E  1 152 ? 59.319  32.405  -67.838  1.00 33.60  ? 151 GLN E CB  1 
ATOM   9732  C  CG  . GLN E  1 152 ? 58.967  33.302  -69.007  1.00 38.22  ? 151 GLN E CG  1 
ATOM   9733  C  CD  . GLN E  1 152 ? 59.927  33.092  -70.166  1.00 55.99  ? 151 GLN E CD  1 
ATOM   9734  O  OE1 . GLN E  1 152 ? 61.094  32.773  -69.962  1.00 39.28  ? 151 GLN E OE1 1 
ATOM   9735  N  NE2 . GLN E  1 152 ? 59.436  33.248  -71.383  1.00 38.49  ? 151 GLN E NE2 1 
ATOM   9736  N  N   . ALA E  1 153 ? 59.626  31.053  -65.111  1.00 26.69  ? 152 ALA E N   1 
ATOM   9737  C  CA  . ALA E  1 153 ? 59.959  29.818  -64.392  1.00 30.10  ? 152 ALA E CA  1 
ATOM   9738  C  C   . ALA E  1 153 ? 58.862  29.484  -63.383  1.00 38.86  ? 152 ALA E C   1 
ATOM   9739  O  O   . ALA E  1 153 ? 58.444  28.329  -63.244  1.00 32.49  ? 152 ALA E O   1 
ATOM   9740  C  CB  . ALA E  1 153 ? 61.293  29.961  -63.696  1.00 29.72  ? 152 ALA E CB  1 
ATOM   9741  N  N   . GLN E  1 154 ? 58.394  30.508  -62.683  1.00 29.40  ? 153 GLN E N   1 
ATOM   9742  C  CA  . GLN E  1 154 ? 57.326  30.322  -61.712  1.00 31.91  ? 153 GLN E CA  1 
ATOM   9743  C  C   . GLN E  1 154 ? 56.084  29.735  -62.404  1.00 36.61  ? 153 GLN E C   1 
ATOM   9744  O  O   . GLN E  1 154 ? 55.435  28.801  -61.898  1.00 30.02  ? 153 GLN E O   1 
ATOM   9745  C  CB  . GLN E  1 154 ? 56.985  31.666  -61.054  1.00 34.18  ? 153 GLN E CB  1 
ATOM   9746  C  CG  . GLN E  1 154 ? 55.732  31.601  -60.181  1.00 43.33  ? 153 GLN E CG  1 
ATOM   9747  C  CD  . GLN E  1 154 ? 55.851  32.439  -58.928  1.00 40.99  ? 153 GLN E CD  1 
ATOM   9748  O  OE1 . GLN E  1 154 ? 55.785  33.667  -58.974  1.00 62.70  ? 153 GLN E OE1 1 
ATOM   9749  N  NE2 . GLN E  1 154 ? 56.032  31.775  -57.798  1.00 49.43  ? 153 GLN E NE2 1 
ATOM   9750  N  N   . SER E  1 155 ? 55.755  30.285  -63.566  1.00 33.27  ? 154 SER E N   1 
ATOM   9751  C  CA  . SER E  1 155 ? 54.597  29.800  -64.307  1.00 35.34  ? 154 SER E CA  1 
ATOM   9752  C  C   . SER E  1 155 ? 54.766  28.360  -64.767  1.00 34.99  ? 154 SER E C   1 
ATOM   9753  O  O   . SER E  1 155 ? 53.840  27.562  -64.636  1.00 36.38  ? 154 SER E O   1 
ATOM   9754  C  CB  . SER E  1 155 ? 54.270  30.714  -65.485  1.00 41.84  ? 154 SER E CB  1 
ATOM   9755  O  OG  . SER E  1 155 ? 53.757  31.937  -65.001  1.00 41.07  ? 154 SER E OG  1 
ATOM   9756  N  N   . ARG E  1 156 ? 55.942  28.030  -65.299  1.00 33.27  ? 155 ARG E N   1 
ATOM   9757  C  CA  . ARG E  1 156 ? 56.219  26.649  -65.715  1.00 30.61  ? 155 ARG E CA  1 
ATOM   9758  C  C   . ARG E  1 156 ? 56.102  25.659  -64.550  1.00 28.22  ? 155 ARG E C   1 
ATOM   9759  O  O   . ARG E  1 156 ? 55.547  24.570  -64.697  1.00 34.29  ? 155 ARG E O   1 
ATOM   9760  C  CB  . ARG E  1 156 ? 57.579  26.564  -66.420  1.00 32.77  ? 155 ARG E CB  1 
ATOM   9761  C  CG  . ARG E  1 156 ? 57.568  27.293  -67.761  1.00 31.27  ? 155 ARG E CG  1 
ATOM   9762  C  CD  . ARG E  1 156 ? 58.808  27.050  -68.599  1.00 43.77  ? 155 ARG E CD  1 
ATOM   9763  N  NE  . ARG E  1 156 ? 59.424  25.740  -68.395  1.00 40.72  ? 155 ARG E NE  1 
ATOM   9764  C  CZ  . ARG E  1 156 ? 59.142  24.639  -69.085  1.00 40.54  ? 155 ARG E CZ  1 
ATOM   9765  N  NH1 . ARG E  1 156 ? 59.790  23.517  -68.823  1.00 35.18  ? 155 ARG E NH1 1 
ATOM   9766  N  NH2 . ARG E  1 156 ? 58.227  24.652  -70.040  1.00 43.73  ? 155 ARG E NH2 1 
HETATM 9767  N  N   . MSE E  1 157 ? 56.631  26.043  -63.392  1.00 30.59  ? 156 MSE E N   1 
HETATM 9768  C  CA  . MSE E  1 157 ? 56.521  25.215  -62.198  1.00 31.54  ? 156 MSE E CA  1 
HETATM 9769  C  C   . MSE E  1 157 ? 55.051  25.038  -61.805  1.00 37.71  ? 156 MSE E C   1 
HETATM 9770  O  O   . MSE E  1 157 ? 54.598  23.928  -61.550  1.00 34.41  ? 156 MSE E O   1 
HETATM 9771  C  CB  . MSE E  1 157 ? 57.301  25.840  -61.038  1.00 34.05  ? 156 MSE E CB  1 
HETATM 9772  C  CG  . MSE E  1 157 ? 57.100  25.120  -59.718  1.00 37.43  ? 156 MSE E CG  1 
HETATM 9773  SE SE  . MSE E  1 157 ? 58.239  25.780  -58.259  0.59 32.48  ? 156 MSE E SE  1 
HETATM 9774  C  CE  . MSE E  1 157 ? 57.496  27.571  -58.044  1.00 43.00  ? 156 MSE E CE  1 
ATOM   9775  N  N   . ASN E  1 158 ? 54.313  26.142  -61.766  1.00 31.24  ? 157 ASN E N   1 
ATOM   9776  C  CA  . ASN E  1 158 ? 52.905  26.112  -61.357  1.00 34.37  ? 157 ASN E CA  1 
ATOM   9777  C  C   . ASN E  1 158 ? 52.034  25.316  -62.336  1.00 31.49  ? 157 ASN E C   1 
ATOM   9778  O  O   . ASN E  1 158 ? 51.032  24.687  -61.935  1.00 33.44  ? 157 ASN E O   1 
ATOM   9779  C  CB  . ASN E  1 158 ? 52.350  27.535  -61.218  1.00 38.41  ? 157 ASN E CB  1 
ATOM   9780  C  CG  . ASN E  1 158 ? 52.857  28.246  -59.972  1.00 39.45  ? 157 ASN E CG  1 
ATOM   9781  O  OD1 . ASN E  1 158 ? 53.657  27.703  -59.218  1.00 41.72  ? 157 ASN E OD1 1 
ATOM   9782  N  ND2 . ASN E  1 158 ? 52.395  29.473  -59.763  1.00 45.01  ? 157 ASN E ND2 1 
ATOM   9783  N  N   . ASN E  1 159 ? 52.405  25.372  -63.611  1.00 32.90  ? 158 ASN E N   1 
ATOM   9784  C  CA  . ASN E  1 159 ? 51.712  24.602  -64.647  1.00 30.05  ? 158 ASN E CA  1 
ATOM   9785  C  C   . ASN E  1 159 ? 52.148  23.126  -64.725  1.00 38.03  ? 158 ASN E C   1 
ATOM   9786  O  O   . ASN E  1 159 ? 51.573  22.351  -65.481  1.00 33.95  ? 158 ASN E O   1 
ATOM   9787  C  CB  . ASN E  1 159 ? 51.847  25.308  -66.002  1.00 31.00  ? 158 ASN E CB  1 
ATOM   9788  C  CG  . ASN E  1 159 ? 50.928  26.521  -66.098  1.00 35.78  ? 158 ASN E CG  1 
ATOM   9789  O  OD1 . ASN E  1 159 ? 49.783  26.467  -65.647  1.00 35.09  ? 158 ASN E OD1 1 
ATOM   9790  N  ND2 . ASN E  1 159 ? 51.431  27.620  -66.652  1.00 31.70  ? 158 ASN E ND2 1 
ATOM   9791  N  N   . GLY E  1 160 ? 53.142  22.745  -63.921  1.00 30.57  ? 159 GLY E N   1 
ATOM   9792  C  CA  . GLY E  1 160 ? 53.595  21.358  -63.851  1.00 28.91  ? 159 GLY E CA  1 
ATOM   9793  C  C   . GLY E  1 160 ? 54.545  20.952  -64.980  1.00 33.74  ? 159 GLY E C   1 
ATOM   9794  O  O   . GLY E  1 160 ? 54.735  19.763  -65.271  1.00 32.55  ? 159 GLY E O   1 
ATOM   9795  N  N   . LEU E  1 161 ? 55.150  21.943  -65.615  1.00 28.53  ? 160 LEU E N   1 
ATOM   9796  C  CA  . LEU E  1 161 ? 55.927  21.701  -66.838  1.00 28.75  ? 160 LEU E CA  1 
ATOM   9797  C  C   . LEU E  1 161 ? 57.414  21.420  -66.608  1.00 32.40  ? 160 LEU E C   1 
ATOM   9798  O  O   . LEU E  1 161 ? 58.137  21.060  -67.546  1.00 34.95  ? 160 LEU E O   1 
ATOM   9799  C  CB  . LEU E  1 161 ? 55.798  22.910  -67.757  1.00 30.78  ? 160 LEU E CB  1 
ATOM   9800  C  CG  . LEU E  1 161 ? 54.331  23.261  -68.057  1.00 33.71  ? 160 LEU E CG  1 
ATOM   9801  C  CD1 . LEU E  1 161 ? 54.256  24.414  -69.041  1.00 34.58  ? 160 LEU E CD1 1 
ATOM   9802  C  CD2 . LEU E  1 161 ? 53.609  22.037  -68.594  1.00 32.00  ? 160 LEU E CD2 1 
ATOM   9803  N  N   . VAL E  1 162 ? 57.880  21.619  -65.384  1.00 32.00  ? 161 VAL E N   1 
ATOM   9804  C  CA  . VAL E  1 162 ? 59.313  21.469  -65.108  1.00 30.70  ? 161 VAL E CA  1 
ATOM   9805  C  C   . VAL E  1 162 ? 59.737  20.012  -65.134  1.00 36.51  ? 161 VAL E C   1 
ATOM   9806  O  O   . VAL E  1 162 ? 59.140  19.187  -64.464  1.00 32.51  ? 161 VAL E O   1 
ATOM   9807  C  CB  . VAL E  1 162 ? 59.696  22.110  -63.763  1.00 33.05  ? 161 VAL E CB  1 
ATOM   9808  C  CG1 . VAL E  1 162 ? 61.171  21.845  -63.447  1.00 34.40  ? 161 VAL E CG1 1 
ATOM   9809  C  CG2 . VAL E  1 162 ? 59.415  23.610  -63.808  1.00 28.96  ? 161 VAL E CG2 1 
ATOM   9810  N  N   . ASP E  1 163 ? 60.777  19.697  -65.904  1.00 35.56  ? 162 ASP E N   1 
ATOM   9811  C  CA  . ASP E  1 163 ? 61.261  18.325  -65.978  1.00 42.66  ? 162 ASP E CA  1 
ATOM   9812  C  C   . ASP E  1 163 ? 62.176  18.040  -64.800  1.00 33.14  ? 162 ASP E C   1 
ATOM   9813  O  O   . ASP E  1 163 ? 63.375  18.280  -64.880  1.00 32.92  ? 162 ASP E O   1 
ATOM   9814  C  CB  . ASP E  1 163 ? 62.025  18.114  -67.289  1.00 39.76  ? 162 ASP E CB  1 
ATOM   9815  C  CG  . ASP E  1 163 ? 62.429  16.665  -67.513  1.00 44.99  ? 162 ASP E CG  1 
ATOM   9816  O  OD1 . ASP E  1 163 ? 62.231  15.810  -66.614  1.00 41.91  ? 162 ASP E OD1 1 
ATOM   9817  O  OD2 . ASP E  1 163 ? 62.958  16.391  -68.608  1.00 43.47  ? 162 ASP E OD2 1 
ATOM   9818  N  N   . ALA E  1 164 ? 61.614  17.500  -63.721  1.00 35.15  ? 163 ALA E N   1 
ATOM   9819  C  CA  . ALA E  1 164 ? 62.393  17.269  -62.505  1.00 34.87  ? 163 ALA E CA  1 
ATOM   9820  C  C   . ALA E  1 164 ? 63.453  16.185  -62.660  1.00 44.57  ? 163 ALA E C   1 
ATOM   9821  O  O   . ALA E  1 164 ? 64.381  16.111  -61.859  1.00 42.68  ? 163 ALA E O   1 
ATOM   9822  C  CB  . ALA E  1 164 ? 61.475  16.937  -61.324  1.00 39.60  ? 163 ALA E CB  1 
ATOM   9823  N  N   . SER E  1 165 ? 63.323  15.342  -63.678  1.00 36.09  ? 164 SER E N   1 
ATOM   9824  C  CA  . SER E  1 165 ? 64.296  14.270  -63.874  1.00 43.20  ? 164 SER E CA  1 
ATOM   9825  C  C   . SER E  1 165 ? 65.529  14.756  -64.642  1.00 46.08  ? 164 SER E C   1 
ATOM   9826  O  O   . SER E  1 165 ? 66.490  14.007  -64.820  1.00 44.23  ? 164 SER E O   1 
ATOM   9827  C  CB  . SER E  1 165 ? 63.657  13.083  -64.602  1.00 44.72  ? 164 SER E CB  1 
ATOM   9828  O  OG  . SER E  1 165 ? 63.405  13.404  -65.962  1.00 51.23  ? 164 SER E OG  1 
ATOM   9829  N  N   . ASP E  1 166 ? 65.510  16.009  -65.089  1.00 30.49  ? 165 ASP E N   1 
ATOM   9830  C  CA  . ASP E  1 166 ? 66.602  16.518  -65.922  1.00 30.46  ? 165 ASP E CA  1 
ATOM   9831  C  C   . ASP E  1 166 ? 67.501  17.529  -65.191  1.00 37.96  ? 165 ASP E C   1 
ATOM   9832  O  O   . ASP E  1 166 ? 68.293  18.225  -65.832  1.00 32.11  ? 165 ASP E O   1 
ATOM   9833  C  CB  . ASP E  1 166 ? 66.041  17.159  -67.203  1.00 35.59  ? 165 ASP E CB  1 
ATOM   9834  C  CG  . ASP E  1 166 ? 67.072  17.253  -68.314  1.00 43.44  ? 165 ASP E CG  1 
ATOM   9835  O  OD1 . ASP E  1 166 ? 68.017  16.438  -68.322  1.00 42.44  ? 165 ASP E OD1 1 
ATOM   9836  O  OD2 . ASP E  1 166 ? 66.938  18.138  -69.189  1.00 41.11  ? 165 ASP E OD2 1 
ATOM   9837  N  N   . PHE E  1 167 ? 67.364  17.622  -63.867  1.00 35.84  ? 166 PHE E N   1 
ATOM   9838  C  CA  . PHE E  1 167 ? 68.182  18.548  -63.083  1.00 37.33  ? 166 PHE E CA  1 
ATOM   9839  C  C   . PHE E  1 167 ? 69.652  18.118  -63.110  1.00 46.68  ? 166 PHE E C   1 
ATOM   9840  O  O   . PHE E  1 167 ? 69.970  16.950  -63.315  1.00 37.65  ? 166 PHE E O   1 
ATOM   9841  C  CB  . PHE E  1 167 ? 67.731  18.612  -61.619  1.00 36.22  ? 166 PHE E CB  1 
ATOM   9842  C  CG  . PHE E  1 167 ? 66.365  19.212  -61.410  1.00 33.78  ? 166 PHE E CG  1 
ATOM   9843  C  CD1 . PHE E  1 167 ? 65.752  19.970  -62.398  1.00 30.93  ? 166 PHE E CD1 1 
ATOM   9844  C  CD2 . PHE E  1 167 ? 65.698  19.017  -60.205  1.00 41.31  ? 166 PHE E CD2 1 
ATOM   9845  C  CE1 . PHE E  1 167 ? 64.486  20.527  -62.188  1.00 29.43  ? 166 PHE E CE1 1 
ATOM   9846  C  CE2 . PHE E  1 167 ? 64.449  19.565  -59.988  1.00 39.54  ? 166 PHE E CE2 1 
ATOM   9847  C  CZ  . PHE E  1 167 ? 63.842  20.318  -60.974  1.00 30.94  ? 166 PHE E CZ  1 
ATOM   9848  N  N   . ASP E  1 168 ? 70.545  19.071  -62.888  1.00 33.49  ? 167 ASP E N   1 
ATOM   9849  C  CA  . ASP E  1 168 ? 71.966  18.763  -62.708  1.00 40.73  ? 167 ASP E CA  1 
ATOM   9850  C  C   . ASP E  1 168 ? 72.206  17.855  -61.494  1.00 37.90  ? 167 ASP E C   1 
ATOM   9851  O  O   . ASP E  1 168 ? 71.346  17.738  -60.610  1.00 36.69  ? 167 ASP E O   1 
ATOM   9852  C  CB  . ASP E  1 168 ? 72.767  20.053  -62.532  1.00 37.05  ? 167 ASP E CB  1 
ATOM   9853  C  CG  . ASP E  1 168 ? 72.658  20.984  -63.728  1.00 56.79  ? 167 ASP E CG  1 
ATOM   9854  O  OD1 . ASP E  1 168 ? 72.644  20.499  -64.879  1.00 34.46  ? 167 ASP E OD1 1 
ATOM   9855  O  OD2 . ASP E  1 168 ? 72.596  22.214  -63.511  1.00 32.31  ? 167 ASP E OD2 1 
ATOM   9856  N  N   . ASP E  1 169 ? 73.388  17.230  -61.431  1.00 34.69  ? 168 ASP E N   1 
ATOM   9857  C  CA  . ASP E  1 169 ? 73.687  16.273  -60.363  1.00 36.63  ? 168 ASP E CA  1 
ATOM   9858  C  C   . ASP E  1 169 ? 73.610  16.897  -58.969  1.00 38.62  ? 168 ASP E C   1 
ATOM   9859  O  O   . ASP E  1 169 ? 73.210  16.234  -58.016  1.00 39.79  ? 168 ASP E O   1 
ATOM   9860  C  CB  . ASP E  1 169 ? 75.075  15.648  -60.573  1.00 42.71  ? 168 ASP E CB  1 
ATOM   9861  C  CG  . ASP E  1 169 ? 75.144  14.788  -61.820  1.00 73.98  ? 168 ASP E CG  1 
ATOM   9862  O  OD1 . ASP E  1 169 ? 74.143  14.102  -62.122  1.00 85.08  ? 168 ASP E OD1 1 
ATOM   9863  O  OD2 . ASP E  1 169 ? 76.192  14.804  -62.503  1.00 80.32  ? 168 ASP E OD2 1 
ATOM   9864  N  N   . GLU E  1 170 ? 73.978  18.174  -58.855  1.00 37.45  ? 169 GLU E N   1 
ATOM   9865  C  CA  . GLU E  1 170 ? 73.886  18.896  -57.577  1.00 45.75  ? 169 GLU E CA  1 
ATOM   9866  C  C   . GLU E  1 170 ? 72.474  18.860  -57.022  1.00 47.76  ? 169 GLU E C   1 
ATOM   9867  O  O   . GLU E  1 170 ? 72.261  18.932  -55.810  1.00 47.01  ? 169 GLU E O   1 
ATOM   9868  C  CB  . GLU E  1 170 ? 74.260  20.373  -57.751  1.00 44.45  ? 169 GLU E CB  1 
ATOM   9869  C  CG  . GLU E  1 170 ? 75.701  20.629  -58.127  1.00 82.88  ? 169 GLU E CG  1 
ATOM   9870  C  CD  . GLU E  1 170 ? 75.912  20.667  -59.626  1.00 77.99  ? 169 GLU E CD  1 
ATOM   9871  O  OE1 . GLU E  1 170 ? 75.406  19.767  -60.330  1.00 57.11  ? 169 GLU E OE1 1 
ATOM   9872  O  OE2 . GLU E  1 170 ? 76.588  21.603  -60.099  1.00 116.59 ? 169 GLU E OE2 1 
ATOM   9873  N  N   . ARG E  1 171 ? 71.501  18.783  -57.921  1.00 40.15  ? 170 ARG E N   1 
ATOM   9874  C  CA  . ARG E  1 171 ? 70.103  18.870  -57.512  1.00 41.21  ? 170 ARG E CA  1 
ATOM   9875  C  C   . ARG E  1 171 ? 69.314  17.603  -57.840  1.00 46.39  ? 170 ARG E C   1 
ATOM   9876  O  O   . ARG E  1 171 ? 68.091  17.637  -57.958  1.00 42.64  ? 170 ARG E O   1 
ATOM   9877  C  CB  . ARG E  1 171 ? 69.466  20.106  -58.153  1.00 42.66  ? 170 ARG E CB  1 
ATOM   9878  C  CG  . ARG E  1 171 ? 70.023  21.415  -57.586  1.00 40.22  ? 170 ARG E CG  1 
ATOM   9879  C  CD  . ARG E  1 171 ? 69.644  22.646  -58.423  1.00 33.97  ? 170 ARG E CD  1 
ATOM   9880  N  NE  . ARG E  1 171 ? 70.413  22.737  -59.662  1.00 36.10  ? 170 ARG E NE  1 
ATOM   9881  C  CZ  . ARG E  1 171 ? 71.623  23.277  -59.742  1.00 35.07  ? 170 ARG E CZ  1 
ATOM   9882  N  NH1 . ARG E  1 171 ? 72.190  23.775  -58.653  1.00 38.80  ? 170 ARG E NH1 1 
ATOM   9883  N  NH2 . ARG E  1 171 ? 72.263  23.324  -60.906  1.00 36.33  ? 170 ARG E NH2 1 
ATOM   9884  N  N   . ASN E  1 172 ? 70.012  16.478  -57.963  1.00 46.88  ? 171 ASN E N   1 
ATOM   9885  C  CA  . ASN E  1 172 ? 69.347  15.227  -58.306  1.00 52.07  ? 171 ASN E CA  1 
ATOM   9886  C  C   . ASN E  1 172 ? 68.357  14.825  -57.215  1.00 40.97  ? 171 ASN E C   1 
ATOM   9887  O  O   . ASN E  1 172 ? 68.706  14.792  -56.042  1.00 47.56  ? 171 ASN E O   1 
ATOM   9888  C  CB  . ASN E  1 172 ? 70.370  14.116  -58.560  1.00 63.65  ? 171 ASN E CB  1 
ATOM   9889  C  CG  . ASN E  1 172 ? 69.748  12.889  -59.199  1.00 50.51  ? 171 ASN E CG  1 
ATOM   9890  O  OD1 . ASN E  1 172 ? 69.422  12.889  -60.386  1.00 67.27  ? 171 ASN E OD1 1 
ATOM   9891  N  ND2 . ASN E  1 172 ? 69.585  11.832  -58.412  1.00 56.54  ? 171 ASN E ND2 1 
ATOM   9892  N  N   . GLY E  1 173 ? 67.110  14.570  -57.600  1.00 49.48  ? 172 GLY E N   1 
ATOM   9893  C  CA  . GLY E  1 173 ? 66.089  14.159  -56.646  1.00 50.75  ? 172 GLY E CA  1 
ATOM   9894  C  C   . GLY E  1 173 ? 65.384  15.291  -55.914  1.00 54.31  ? 172 GLY E C   1 
ATOM   9895  O  O   . GLY E  1 173 ? 64.392  15.067  -55.217  1.00 50.66  ? 172 GLY E O   1 
ATOM   9896  N  N   . TRP E  1 174 ? 65.885  16.513  -56.072  1.00 41.39  ? 173 TRP E N   1 
ATOM   9897  C  CA  . TRP E  1 174 ? 65.277  17.674  -55.430  1.00 44.96  ? 173 TRP E CA  1 
ATOM   9898  C  C   . TRP E  1 174 ? 63.864  17.909  -55.951  1.00 41.65  ? 173 TRP E C   1 
ATOM   9899  O  O   . TRP E  1 174 ? 63.640  17.862  -57.161  1.00 41.13  ? 173 TRP E O   1 
ATOM   9900  C  CB  . TRP E  1 174 ? 66.081  18.938  -55.735  1.00 47.36  ? 173 TRP E CB  1 
ATOM   9901  C  CG  . TRP E  1 174 ? 67.336  19.111  -54.957  1.00 51.51  ? 173 TRP E CG  1 
ATOM   9902  C  CD1 . TRP E  1 174 ? 68.164  18.131  -54.493  1.00 49.11  ? 173 TRP E CD1 1 
ATOM   9903  C  CD2 . TRP E  1 174 ? 67.915  20.356  -54.552  1.00 45.22  ? 173 TRP E CD2 1 
ATOM   9904  N  NE1 . TRP E  1 174 ? 69.229  18.694  -53.830  1.00 50.17  ? 173 TRP E NE1 1 
ATOM   9905  C  CE2 . TRP E  1 174 ? 69.098  20.057  -53.849  1.00 62.13  ? 173 TRP E CE2 1 
ATOM   9906  C  CE3 . TRP E  1 174 ? 67.549  21.699  -54.723  1.00 43.37  ? 173 TRP E CE3 1 
ATOM   9907  C  CZ2 . TRP E  1 174 ? 69.918  21.047  -53.308  1.00 55.91  ? 173 TRP E CZ2 1 
ATOM   9908  C  CZ3 . TRP E  1 174 ? 68.365  22.683  -54.187  1.00 40.34  ? 173 TRP E CZ3 1 
ATOM   9909  C  CH2 . TRP E  1 174 ? 69.539  22.348  -53