data_4GTU
# 
_entry.id   4GTU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GTU         
RCSB  RCSB001057   
WWPDB D_1000001057 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1GTU . unspecified 
PDB 2GTU . unspecified 
PDB 3GTU . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4GTU 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-12 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patskovsky, Y.V.' 1 
'Patskovska, L.N.' 2 
'Listowsky, I.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
;
Biochemistry 38  16187 16194 1999 BICHAW US 0006-2960 0033 ? 10587441 10.1021/bi991714t 
1       'Isolation and Analysis of the Gene and cDNA for a Human MU Class Glutathione S- Transferase, GSTM4' J.Biol.Chem. 268 
16958 16965 1993 JBCHA3 US 0021-9258 0071 ? ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patskovsky, Y.V.' 1 
primary 'Patskovska, L.N.' 2 
primary 'Listowsky, I.'    3 
1       'Comstock, K.E.'   4 
1       'Johnson, K.J.'    5 
1       'Rifenbery, D.'    6 
1       'Henner, W.D.'     7 
# 
_cell.entry_id           4GTU 
_cell.length_a           51.000 
_cell.length_b           215.700 
_cell.length_c           94.560 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4GTU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'GLUTATHIONE S-TRANSFERASE' 
_entity.formula_weight             25462.164 
_entity.pdbx_number_of_molecules   8 
_entity.pdbx_ec                    2.5.1.18 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'LIGAND-FREE, HOMODIMER' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIA
RKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAY
DVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIA
RKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAY
DVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   THR n 
1 4   LEU n 
1 5   GLY n 
1 6   TYR n 
1 7   TRP n 
1 8   ASP n 
1 9   ILE n 
1 10  ARG n 
1 11  GLY n 
1 12  LEU n 
1 13  ALA n 
1 14  HIS n 
1 15  ALA n 
1 16  ILE n 
1 17  ARG n 
1 18  LEU n 
1 19  LEU n 
1 20  LEU n 
1 21  GLU n 
1 22  TYR n 
1 23  THR n 
1 24  ASP n 
1 25  SER n 
1 26  SER n 
1 27  TYR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  LYS n 
1 32  TYR n 
1 33  THR n 
1 34  MET n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  PRO n 
1 39  ASP n 
1 40  TYR n 
1 41  ASP n 
1 42  ARG n 
1 43  SER n 
1 44  GLN n 
1 45  TRP n 
1 46  LEU n 
1 47  ASN n 
1 48  GLU n 
1 49  LYS n 
1 50  PHE n 
1 51  LYS n 
1 52  LEU n 
1 53  GLY n 
1 54  LEU n 
1 55  ASP n 
1 56  PHE n 
1 57  PRO n 
1 58  ASN n 
1 59  LEU n 
1 60  PRO n 
1 61  TYR n 
1 62  LEU n 
1 63  ILE n 
1 64  ASP n 
1 65  GLY n 
1 66  ALA n 
1 67  HIS n 
1 68  LYS n 
1 69  ILE n 
1 70  THR n 
1 71  GLN n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  ILE n 
1 76  LEU n 
1 77  CYS n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  ARG n 
1 82  LYS n 
1 83  HIS n 
1 84  ASN n 
1 85  LEU n 
1 86  CYS n 
1 87  GLY n 
1 88  GLU n 
1 89  THR n 
1 90  GLU n 
1 91  GLU n 
1 92  GLU n 
1 93  LYS n 
1 94  ILE n 
1 95  ARG n 
1 96  VAL n 
1 97  ASP n 
1 98  ILE n 
1 99  LEU n 
1 100 GLU n 
1 101 ASN n 
1 102 GLN n 
1 103 ALA n 
1 104 MET n 
1 105 ASP n 
1 106 VAL n 
1 107 SER n 
1 108 ASN n 
1 109 GLN n 
1 110 LEU n 
1 111 ALA n 
1 112 ARG n 
1 113 VAL n 
1 114 CYS n 
1 115 TYR n 
1 116 SER n 
1 117 PRO n 
1 118 ASP n 
1 119 PHE n 
1 120 GLU n 
1 121 LYS n 
1 122 LEU n 
1 123 LYS n 
1 124 PRO n 
1 125 GLU n 
1 126 TYR n 
1 127 LEU n 
1 128 GLU n 
1 129 GLU n 
1 130 LEU n 
1 131 PRO n 
1 132 THR n 
1 133 MET n 
1 134 MET n 
1 135 GLN n 
1 136 HIS n 
1 137 PHE n 
1 138 SER n 
1 139 GLN n 
1 140 PHE n 
1 141 LEU n 
1 142 GLY n 
1 143 LYS n 
1 144 ARG n 
1 145 PRO n 
1 146 TRP n 
1 147 PHE n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LYS n 
1 152 ILE n 
1 153 THR n 
1 154 PHE n 
1 155 VAL n 
1 156 ASP n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 TYR n 
1 161 ASP n 
1 162 VAL n 
1 163 LEU n 
1 164 ASP n 
1 165 LEU n 
1 166 HIS n 
1 167 ARG n 
1 168 ILE n 
1 169 PHE n 
1 170 GLU n 
1 171 PRO n 
1 172 ASN n 
1 173 CYS n 
1 174 LEU n 
1 175 ASP n 
1 176 ALA n 
1 177 PHE n 
1 178 PRO n 
1 179 ASN n 
1 180 LEU n 
1 181 LYS n 
1 182 ASP n 
1 183 PHE n 
1 184 ILE n 
1 185 SER n 
1 186 ARG n 
1 187 PHE n 
1 188 GLU n 
1 189 GLY n 
1 190 LEU n 
1 191 GLU n 
1 192 LYS n 
1 193 ILE n 
1 194 SER n 
1 195 ALA n 
1 196 TYR n 
1 197 MET n 
1 198 LYS n 
1 199 SER n 
1 200 SER n 
1 201 ARG n 
1 202 PHE n 
1 203 LEU n 
1 204 PRO n 
1 205 LYS n 
1 206 PRO n 
1 207 LEU n 
1 208 TYR n 
1 209 THR n 
1 210 ARG n 
1 211 VAL n 
1 212 ALA n 
1 213 VAL n 
1 214 TRP n 
1 215 GLY n 
1 216 ASN n 
1 217 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GSTM4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            HEPG2 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 GSTM4 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET3A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A-GSTM4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'THE GSTM4 CDNA WAS AMPLIFIED USING RT-PCR AND CLONED INTO A PET3A EXPRESSION VECTOR. SYNTHETIC GENE' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSTM4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q03013 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GTU A 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
2 1 4GTU B 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
3 1 4GTU C 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
4 1 4GTU D 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
5 1 4GTU E 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
6 1 4GTU F 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
7 1 4GTU G 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
8 1 4GTU H 1 ? 217 ? Q03013 1 ? 217 ? 1 217 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4GTU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    '22% PEG4000, 0.1M NA CITRATE,0.2M AMMONIUM ACETATE, PH5.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           289 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS X1000' 
_diffrn_detector.pdbx_collection_date   1997-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     4GTU 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.4 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   30754 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         76.2 
_reflns.pdbx_Rmerge_I_obs            0.1650000 
_reflns.pdbx_Rsym_value              0.163 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.5 
_reflns_shell.percent_possible_all   68.4 
_reflns_shell.Rmerge_I_obs           0.5700000 
_reflns_shell.pdbx_Rsym_value        0.360 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4GTU 
_refine.ls_number_reflns_obs                     23295 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            3.3 
_refine.ls_percent_reflns_obs                    79.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2450000 
_refine.ls_R_factor_R_free                       0.3150000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.27 
_refine.ls_number_reflns_R_free                  2392 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1GTU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4GTU 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           10.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14352 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14352 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.279 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.36 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.222 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             2.89  1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            3.98  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             3.57  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            4.73  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.3 
_refine_ls_shell.d_res_low                        3.44 
_refine_ls_shell.number_reflns_R_work             1649 
_refine_ls_shell.R_factor_R_work                  0.2770000 
_refine_ls_shell.percent_reflns_obs               51.8 
_refine_ls_shell.R_factor_R_free                  0.3220000 
_refine_ls_shell.R_factor_R_free_error            0.01 
_refine_ls_shell.percent_reflns_R_free            11.7 
_refine_ls_shell.number_reflns_R_free             218 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.849721  -0.214994 -0.481407 -0.216414 -0.974842 0.053372  -0.480770 0.058832  -0.874871 13.15360  148.10300 -16.44440 
2 given ? 0.104001  -0.026619 -0.994221 0.020660  0.999484  -0.024599 0.994363  -0.017982 0.104497  -20.13610 -53.47210 27.02130  
3 given ? -0.399540 -0.214856 -0.891181 0.010513  -0.973156 0.229906  -0.916655 0.082487  0.391074  -7.49970  206.81100 -32.72770 
4 given ? 0.887466  -0.001526 -0.460871 -0.000426 -0.999997 0.002490  -0.460874 -0.002013 -0.887464 -43.97060 159.75780 63.22180  
5 given ? 0.980887  0.191516  0.034389  -0.192404 0.981005  0.024675  -0.029010 -0.030820 0.999104  -87.12570 5.45730   -43.16790 
6 given ? -0.395241 -0.033871 -0.917953 0.013607  -0.999426 0.031019  -0.918477 -0.000231 0.395475  39.71010  211.46170 23.03620  
7 given ? 0.104810  0.166739  -0.980415 0.021406  0.985238  0.169847  0.994262  -0.038789 0.099693  -7.02600  -64.55720 0.000000  
# 
_struct.entry_id                  4GTU 
_struct.title                     'LIGAND-FREE HOMODIMERIC HUMAN GLUTATHIONE S-TRANSFERASE M4-4' 
_struct.pdbx_descriptor           'GLUTATHIONE S-TRANSFERASE (E.C.2.5.1.18)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GTU 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, GLUTATHIONE, CONJUGATION, DETOXIFICATION, CYTOSOLIC, HOMODIMER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
# 
loop_
_struct_biol.id 
1 
2 
3 
4 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 11  ? TYR A 22  ? GLY A 11  TYR A 22  5 ? 12 
HELX_P HELX_P2  2  SER A 43  ? LEU A 52  ? SER A 43  LEU A 52  1 ? 10 
HELX_P HELX_P3  3  SER A 72  ? HIS A 83  ? SER A 72  HIS A 83  1 ? 12 
HELX_P HELX_P4  4  GLU A 90  ? TYR A 115 ? GLU A 90  TYR A 115 1 ? 26 
HELX_P HELX_P5  5  PHE A 119 ? LEU A 141 ? PHE A 119 LEU A 141 1 ? 23 
HELX_P HELX_P6  6  PHE A 154 ? PHE A 169 ? PHE A 154 PHE A 169 1 ? 16 
HELX_P HELX_P7  7  PRO A 178 ? GLY A 189 ? PRO A 178 GLY A 189 1 ? 12 
HELX_P HELX_P8  8  GLU A 191 ? MET A 197 ? GLU A 191 MET A 197 1 ? 7  
HELX_P HELX_P9  9  GLY B 11  ? TYR B 22  ? GLY B 11  TYR B 22  5 ? 12 
HELX_P HELX_P10 10 SER B 43  ? GLU B 48  ? SER B 43  GLU B 48  1 ? 6  
HELX_P HELX_P11 11 PHE B 50  ? LEU B 52  ? PHE B 50  LEU B 52  5 ? 3  
HELX_P HELX_P12 12 SER B 72  ? HIS B 83  ? SER B 72  HIS B 83  1 ? 12 
HELX_P HELX_P13 13 GLU B 90  ? CYS B 114 ? GLU B 90  CYS B 114 1 ? 25 
HELX_P HELX_P14 14 PHE B 119 ? LEU B 141 ? PHE B 119 LEU B 141 1 ? 23 
HELX_P HELX_P15 15 PHE B 154 ? PHE B 169 ? PHE B 154 PHE B 169 5 ? 16 
HELX_P HELX_P16 16 LEU B 174 ? ALA B 176 ? LEU B 174 ALA B 176 5 ? 3  
HELX_P HELX_P17 17 PRO B 178 ? GLY B 189 ? PRO B 178 GLY B 189 1 ? 12 
HELX_P HELX_P18 18 GLU B 191 ? MET B 197 ? GLU B 191 MET B 197 1 ? 7  
HELX_P HELX_P19 19 HIS C 14  ? TYR C 22  ? HIS C 14  TYR C 22  1 ? 9  
HELX_P HELX_P20 20 SER C 43  ? LEU C 52  ? SER C 43  LEU C 52  1 ? 10 
HELX_P HELX_P21 21 SER C 72  ? HIS C 83  ? SER C 72  HIS C 83  1 ? 12 
HELX_P HELX_P22 22 GLU C 90  ? CYS C 114 ? GLU C 90  CYS C 114 1 ? 25 
HELX_P HELX_P23 23 PHE C 119 ? LEU C 141 ? PHE C 119 LEU C 141 1 ? 23 
HELX_P HELX_P24 24 PHE C 154 ? PHE C 169 ? PHE C 154 PHE C 169 5 ? 16 
HELX_P HELX_P25 25 PRO C 171 ? ALA C 176 ? PRO C 171 ALA C 176 5 ? 6  
HELX_P HELX_P26 26 PRO C 178 ? GLU C 188 ? PRO C 178 GLU C 188 1 ? 11 
HELX_P HELX_P27 27 GLU C 191 ? LYS C 198 ? GLU C 191 LYS C 198 1 ? 8  
HELX_P HELX_P28 28 GLY D 11  ? TYR D 22  ? GLY D 11  TYR D 22  5 ? 12 
HELX_P HELX_P29 29 SER D 43  ? GLU D 48  ? SER D 43  GLU D 48  1 ? 6  
HELX_P HELX_P30 30 SER D 72  ? HIS D 83  ? SER D 72  HIS D 83  1 ? 12 
HELX_P HELX_P31 31 GLU D 90  ? TYR D 115 ? GLU D 90  TYR D 115 1 ? 26 
HELX_P HELX_P32 32 PHE D 119 ? SER D 138 ? PHE D 119 SER D 138 1 ? 20 
HELX_P HELX_P33 33 PHE D 154 ? PHE D 169 ? PHE D 154 PHE D 169 5 ? 16 
HELX_P HELX_P34 34 PRO D 178 ? GLY D 189 ? PRO D 178 GLY D 189 1 ? 12 
HELX_P HELX_P35 35 GLU D 191 ? MET D 197 ? GLU D 191 MET D 197 1 ? 7  
HELX_P HELX_P36 36 GLY E 11  ? TYR E 22  ? GLY E 11  TYR E 22  5 ? 12 
HELX_P HELX_P37 37 SER E 43  ? LYS E 51  ? SER E 43  LYS E 51  1 ? 9  
HELX_P HELX_P38 38 SER E 72  ? HIS E 83  ? SER E 72  HIS E 83  1 ? 12 
HELX_P HELX_P39 39 GLU E 90  ? TYR E 115 ? GLU E 90  TYR E 115 1 ? 26 
HELX_P HELX_P40 40 PHE E 119 ? LEU E 141 ? PHE E 119 LEU E 141 1 ? 23 
HELX_P HELX_P41 41 PHE E 154 ? PHE E 169 ? PHE E 154 PHE E 169 1 ? 16 
HELX_P HELX_P42 42 PRO E 171 ? LEU E 174 ? PRO E 171 LEU E 174 5 ? 4  
HELX_P HELX_P43 43 PRO E 178 ? GLY E 189 ? PRO E 178 GLY E 189 1 ? 12 
HELX_P HELX_P44 44 GLU E 191 ? MET E 197 ? GLU E 191 MET E 197 1 ? 7  
HELX_P HELX_P45 45 GLY F 11  ? GLU F 21  ? GLY F 11  GLU F 21  5 ? 11 
HELX_P HELX_P46 46 SER F 43  ? LYS F 49  ? SER F 43  LYS F 49  1 ? 7  
HELX_P HELX_P47 47 SER F 72  ? HIS F 83  ? SER F 72  HIS F 83  1 ? 12 
HELX_P HELX_P48 48 GLU F 90  ? TYR F 115 ? GLU F 90  TYR F 115 1 ? 26 
HELX_P HELX_P49 49 PHE F 119 ? LEU F 141 ? PHE F 119 LEU F 141 5 ? 23 
HELX_P HELX_P50 50 PHE F 154 ? PHE F 169 ? PHE F 154 PHE F 169 1 ? 16 
HELX_P HELX_P51 51 ASN F 172 ? ASP F 175 ? ASN F 172 ASP F 175 1 ? 4  
HELX_P HELX_P52 52 PRO F 178 ? GLU F 188 ? PRO F 178 GLU F 188 1 ? 11 
HELX_P HELX_P53 53 GLU F 191 ? MET F 197 ? GLU F 191 MET F 197 1 ? 7  
HELX_P HELX_P54 54 GLY G 11  ? TYR G 22  ? GLY G 11  TYR G 22  5 ? 12 
HELX_P HELX_P55 55 SER G 43  ? LYS G 49  ? SER G 43  LYS G 49  1 ? 7  
HELX_P HELX_P56 56 SER G 72  ? HIS G 83  ? SER G 72  HIS G 83  1 ? 12 
HELX_P HELX_P57 57 GLU G 90  ? TYR G 115 ? GLU G 90  TYR G 115 1 ? 26 
HELX_P HELX_P58 58 PHE G 119 ? LEU G 141 ? PHE G 119 LEU G 141 1 ? 23 
HELX_P HELX_P59 59 PHE G 154 ? PHE G 169 ? PHE G 154 PHE G 169 1 ? 16 
HELX_P HELX_P60 60 LEU G 174 ? ALA G 176 ? LEU G 174 ALA G 176 5 ? 3  
HELX_P HELX_P61 61 PRO G 178 ? GLY G 189 ? PRO G 178 GLY G 189 1 ? 12 
HELX_P HELX_P62 62 GLU G 191 ? LYS G 198 ? GLU G 191 LYS G 198 1 ? 8  
HELX_P HELX_P63 63 LEU H 12  ? TYR H 22  ? LEU H 12  TYR H 22  5 ? 11 
HELX_P HELX_P64 64 SER H 43  ? ASN H 47  ? SER H 43  ASN H 47  1 ? 5  
HELX_P HELX_P65 65 PHE H 50  ? LEU H 52  ? PHE H 50  LEU H 52  5 ? 3  
HELX_P HELX_P66 66 SER H 72  ? HIS H 83  ? SER H 72  HIS H 83  1 ? 12 
HELX_P HELX_P67 67 GLU H 90  ? CYS H 114 ? GLU H 90  CYS H 114 1 ? 25 
HELX_P HELX_P68 68 PHE H 119 ? LEU H 141 ? PHE H 119 LEU H 141 1 ? 23 
HELX_P HELX_P69 69 VAL H 155 ? PHE H 169 ? VAL H 155 PHE H 169 1 ? 15 
HELX_P HELX_P70 70 PRO H 171 ? ASP H 175 ? PRO H 171 ASP H 175 1 ? 5  
HELX_P HELX_P71 71 PRO H 178 ? GLY H 189 ? PRO H 178 GLY H 189 1 ? 12 
HELX_P HELX_P72 72 GLU H 191 ? MET H 197 ? GLU H 191 MET H 197 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 59  A . ? LEU 59  A PRO 60  A ? PRO 60  A 1 0.79  
2  LYS 205 A . ? LYS 205 A PRO 206 A ? PRO 206 A 1 0.28  
3  LEU 59  B . ? LEU 59  B PRO 60  B ? PRO 60  B 1 -0.33 
4  LYS 205 B . ? LYS 205 B PRO 206 B ? PRO 206 B 1 -0.20 
5  LEU 59  C . ? LEU 59  C PRO 60  C ? PRO 60  C 1 -0.86 
6  LYS 205 C . ? LYS 205 C PRO 206 C ? PRO 206 C 1 0.36  
7  LEU 59  D . ? LEU 59  D PRO 60  D ? PRO 60  D 1 -0.58 
8  LYS 205 D . ? LYS 205 D PRO 206 D ? PRO 206 D 1 0.28  
9  LEU 59  E . ? LEU 59  E PRO 60  E ? PRO 60  E 1 -0.11 
10 LYS 205 E . ? LYS 205 E PRO 206 E ? PRO 206 E 1 -1.45 
11 LEU 59  F . ? LEU 59  F PRO 60  F ? PRO 60  F 1 -0.29 
12 LYS 205 F . ? LYS 205 F PRO 206 F ? PRO 206 F 1 -0.59 
13 LEU 59  G . ? LEU 59  G PRO 60  G ? PRO 60  G 1 0.03  
14 LYS 205 G . ? LYS 205 G PRO 206 G ? PRO 206 G 1 -1.04 
15 LEU 59  H . ? LEU 59  H PRO 60  H ? PRO 60  H 1 -0.11 
16 LYS 205 H . ? LYS 205 H PRO 206 H ? PRO 206 H 1 -0.47 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 27 ? TYR A 32 ? TYR A 27 TYR A 32 
A 2 MET A 2  ? TRP A 7  ? MET A 2  TRP A 7  
A 3 TYR A 61 ? ILE A 63 ? TYR A 61 ILE A 63 
A 4 LYS A 68 ? THR A 70 ? LYS A 68 THR A 70 
B 1 TYR B 27 ? TYR B 32 ? TYR B 27 TYR B 32 
B 2 MET B 2  ? TRP B 7  ? MET B 2  TRP B 7  
B 3 TYR B 61 ? ILE B 63 ? TYR B 61 ILE B 63 
C 1 TYR C 27 ? TYR C 32 ? TYR C 27 TYR C 32 
C 2 MET C 2  ? TRP C 7  ? MET C 2  TRP C 7  
C 3 TYR C 61 ? ASP C 64 ? TYR C 61 ASP C 64 
C 4 HIS C 67 ? THR C 70 ? HIS C 67 THR C 70 
D 1 TYR D 27 ? TYR D 32 ? TYR D 27 TYR D 32 
D 2 MET D 2  ? TRP D 7  ? MET D 2  TRP D 7  
D 3 TYR D 61 ? ASP D 64 ? TYR D 61 ASP D 64 
D 4 HIS D 67 ? THR D 70 ? HIS D 67 THR D 70 
E 1 TYR E 27 ? TYR E 32 ? TYR E 27 TYR E 32 
E 2 MET E 2  ? TRP E 7  ? MET E 2  TRP E 7  
E 3 TYR E 61 ? ASP E 64 ? TYR E 61 ASP E 64 
E 4 HIS E 67 ? THR E 70 ? HIS E 67 THR E 70 
F 1 TYR F 27 ? TYR F 32 ? TYR F 27 TYR F 32 
F 2 MET F 2  ? TRP F 7  ? MET F 2  TRP F 7  
F 3 TYR F 61 ? ASP F 64 ? TYR F 61 ASP F 64 
F 4 HIS F 67 ? THR F 70 ? HIS F 67 THR F 70 
G 1 GLU G 29 ? TYR G 32 ? GLU G 29 TYR G 32 
G 2 THR G 3  ? TRP G 7  ? THR G 3  TRP G 7  
G 3 TYR G 61 ? ASP G 64 ? TYR G 61 ASP G 64 
G 4 HIS G 67 ? THR G 70 ? HIS G 67 THR G 70 
H 1 TYR H 27 ? TYR H 32 ? TYR H 27 TYR H 32 
H 2 MET H 2  ? TRP H 7  ? MET H 2  TRP H 7  
H 3 TYR H 61 ? ASP H 64 ? TYR H 61 ASP H 64 
H 4 HIS H 67 ? THR H 70 ? HIS H 67 THR H 70 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 28 ? O GLU A 28 N MET A 2  ? N MET A 2  
A 2 3 O THR A 3  ? O THR A 3  N ILE A 63 ? N ILE A 63 
A 3 4 O LEU A 62 ? O LEU A 62 N ILE A 69 ? N ILE A 69 
B 1 2 O GLU B 28 ? O GLU B 28 N MET B 2  ? N MET B 2  
B 2 3 O THR B 3  ? O THR B 3  N ILE B 63 ? N ILE B 63 
C 1 2 O GLU C 28 ? O GLU C 28 N MET C 2  ? N MET C 2  
C 2 3 O THR C 3  ? O THR C 3  N ILE C 63 ? N ILE C 63 
C 3 4 O LEU C 62 ? O LEU C 62 N ILE C 69 ? N ILE C 69 
D 1 2 O GLU D 28 ? O GLU D 28 N MET D 2  ? N MET D 2  
D 2 3 O THR D 3  ? O THR D 3  N ILE D 63 ? N ILE D 63 
D 3 4 O LEU D 62 ? O LEU D 62 N ILE D 69 ? N ILE D 69 
E 1 2 O GLU E 28 ? O GLU E 28 N MET E 2  ? N MET E 2  
E 2 3 O THR E 3  ? O THR E 3  N ILE E 63 ? N ILE E 63 
E 3 4 O LEU E 62 ? O LEU E 62 N ILE E 69 ? N ILE E 69 
F 1 2 O GLU F 28 ? O GLU F 28 N MET F 2  ? N MET F 2  
F 2 3 O THR F 3  ? O THR F 3  N ILE F 63 ? N ILE F 63 
F 3 4 O LEU F 62 ? O LEU F 62 N ILE F 69 ? N ILE F 69 
G 1 2 O LYS G 30 ? O LYS G 30 N LEU G 4  ? N LEU G 4  
G 2 3 O THR G 3  ? O THR G 3  N ILE G 63 ? N ILE G 63 
G 3 4 O LEU G 62 ? O LEU G 62 N ILE G 69 ? N ILE G 69 
H 1 2 O GLU H 28 ? O GLU H 28 N MET H 2  ? N MET H 2  
H 2 3 O THR H 3  ? O THR H 3  N ILE H 63 ? N ILE H 63 
H 3 4 O LEU H 62 ? O LEU H 62 N ILE H 69 ? N ILE H 69 
# 
_database_PDB_matrix.entry_id          4GTU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4GTU 
_atom_sites.fract_transf_matrix[1][1]   0.019608 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002546 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010664 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . SER A 1 1   ? -31.814 93.151  -18.701 1.00 18.30 ? 1   SER A N   1 
ATOM 2     C CA  . SER A 1 1   ? -32.429 93.551  -17.401 1.00 18.59 ? 1   SER A CA  1 
ATOM 3     C C   . SER A 1 1   ? -33.435 92.495  -16.946 1.00 20.30 ? 1   SER A C   1 
ATOM 4     O O   . SER A 1 1   ? -34.091 91.869  -17.793 1.00 20.82 ? 1   SER A O   1 
ATOM 5     C CB  . SER A 1 1   ? -33.114 94.911  -17.537 1.00 19.13 ? 1   SER A CB  1 
ATOM 6     O OG  . SER A 1 1   ? -32.237 95.829  -18.186 1.00 19.61 ? 1   SER A OG  1 
ATOM 7     N N   . MET A 1 2   ? -33.515 92.282  -15.658 1.00 19.01 ? 2   MET A N   1 
ATOM 8     C CA  . MET A 1 2   ? -34.419 91.307  -15.060 1.00 19.27 ? 2   MET A CA  1 
ATOM 9     C C   . MET A 1 2   ? -35.749 91.999  -14.811 1.00 22.54 ? 2   MET A C   1 
ATOM 10    O O   . MET A 1 2   ? -35.776 93.211  -14.588 1.00 25.12 ? 2   MET A O   1 
ATOM 11    C CB  . MET A 1 2   ? -33.827 90.813  -13.736 1.00 21.09 ? 2   MET A CB  1 
ATOM 12    C CG  . MET A 1 2   ? -32.921 91.845  -13.046 1.00 16.55 ? 2   MET A CG  1 
ATOM 13    S SD  . MET A 1 2   ? -32.486 91.549  -11.343 1.00 15.41 ? 2   MET A SD  1 
ATOM 14    C CE  . MET A 1 2   ? -31.654 90.000  -11.451 1.00 13.19 ? 2   MET A CE  1 
ATOM 15    N N   . THR A 1 3   ? -36.848 91.249  -14.869 1.00 20.09 ? 3   THR A N   1 
ATOM 16    C CA  . THR A 1 3   ? -38.169 91.834  -14.636 1.00 20.75 ? 3   THR A CA  1 
ATOM 17    C C   . THR A 1 3   ? -38.796 91.388  -13.323 1.00 18.64 ? 3   THR A C   1 
ATOM 18    O O   . THR A 1 3   ? -38.856 90.176  -13.033 1.00 16.02 ? 3   THR A O   1 
ATOM 19    C CB  . THR A 1 3   ? -39.142 91.543  -15.799 1.00 22.67 ? 3   THR A CB  1 
ATOM 20    O OG1 . THR A 1 3   ? -39.322 90.127  -15.938 1.00 23.08 ? 3   THR A OG1 1 
ATOM 21    C CG2 . THR A 1 3   ? -38.598 92.103  -17.108 1.00 24.69 ? 3   THR A CG2 1 
ATOM 22    N N   . LEU A 1 4   ? -39.256 92.337  -12.536 1.00 16.02 ? 4   LEU A N   1 
ATOM 23    C CA  . LEU A 1 4   ? -39.881 92.073  -11.247 1.00 13.45 ? 4   LEU A CA  1 
ATOM 24    C C   . LEU A 1 4   ? -41.384 92.298  -11.410 1.00 12.54 ? 4   LEU A C   1 
ATOM 25    O O   . LEU A 1 4   ? -41.819 93.401  -11.748 1.00 13.31 ? 4   LEU A O   1 
ATOM 26    C CB  . LEU A 1 4   ? -39.300 93.036  -10.202 1.00 7.74  ? 4   LEU A CB  1 
ATOM 27    C CG  . LEU A 1 4   ? -39.441 92.776  -8.700  1.00 5.60  ? 4   LEU A CG  1 
ATOM 28    C CD1 . LEU A 1 4   ? -38.551 93.762  -7.962  1.00 2.08  ? 4   LEU A CD1 1 
ATOM 29    C CD2 . LEU A 1 4   ? -40.883 92.904  -8.236  1.00 7.87  ? 4   LEU A CD2 1 
ATOM 30    N N   . GLY A 1 5   ? -42.175 91.262  -11.165 1.00 12.72 ? 5   GLY A N   1 
ATOM 31    C CA  . GLY A 1 5   ? -43.610 91.395  -11.300 1.00 14.27 ? 5   GLY A CA  1 
ATOM 32    C C   . GLY A 1 5   ? -44.394 91.054  -10.074 1.00 14.90 ? 5   GLY A C   1 
ATOM 33    O O   . GLY A 1 5   ? -44.259 89.963  -9.531  1.00 16.45 ? 5   GLY A O   1 
ATOM 34    N N   . TYR A 1 6   ? -45.232 91.972  -9.643  1.00 14.72 ? 6   TYR A N   1 
ATOM 35    C CA  . TYR A 1 6   ? -46.064 91.831  -8.450  1.00 13.42 ? 6   TYR A CA  1 
ATOM 36    C C   . TYR A 1 6   ? -47.249 92.784  -8.609  1.00 16.03 ? 6   TYR A C   1 
ATOM 37    O O   . TYR A 1 6   ? -47.284 93.567  -9.561  1.00 15.11 ? 6   TYR A O   1 
ATOM 38    C CB  . TYR A 1 6   ? -45.255 92.210  -7.198  1.00 10.90 ? 6   TYR A CB  1 
ATOM 39    C CG  . TYR A 1 6   ? -45.921 91.880  -5.876  1.00 8.31  ? 6   TYR A CG  1 
ATOM 40    C CD1 . TYR A 1 6   ? -46.641 90.697  -5.705  1.00 9.88  ? 6   TYR A CD1 1 
ATOM 41    C CD2 . TYR A 1 6   ? -45.822 92.747  -4.791  1.00 7.55  ? 6   TYR A CD2 1 
ATOM 42    C CE1 . TYR A 1 6   ? -47.245 90.389  -4.489  1.00 10.34 ? 6   TYR A CE1 1 
ATOM 43    C CE2 . TYR A 1 6   ? -46.418 92.445  -3.570  1.00 2.00  ? 6   TYR A CE2 1 
ATOM 44    C CZ  . TYR A 1 6   ? -47.127 91.270  -3.427  1.00 4.18  ? 6   TYR A CZ  1 
ATOM 45    O OH  . TYR A 1 6   ? -47.722 90.979  -2.224  1.00 8.85  ? 6   TYR A OH  1 
ATOM 46    N N   . TRP A 1 7   ? -48.230 92.707  -7.713  1.00 15.29 ? 7   TRP A N   1 
ATOM 47    C CA  . TRP A 1 7   ? -49.370 93.608  -7.795  1.00 17.83 ? 7   TRP A CA  1 
ATOM 48    C C   . TRP A 1 7   ? -48.860 95.027  -7.605  1.00 19.02 ? 7   TRP A C   1 
ATOM 49    O O   . TRP A 1 7   ? -47.682 95.242  -7.304  1.00 20.58 ? 7   TRP A O   1 
ATOM 50    C CB  . TRP A 1 7   ? -50.376 93.352  -6.675  1.00 20.29 ? 7   TRP A CB  1 
ATOM 51    C CG  . TRP A 1 7   ? -51.028 92.026  -6.642  1.00 19.32 ? 7   TRP A CG  1 
ATOM 52    C CD1 . TRP A 1 7   ? -51.168 91.230  -5.547  1.00 19.64 ? 7   TRP A CD1 1 
ATOM 53    C CD2 . TRP A 1 7   ? -51.716 91.364  -7.713  1.00 19.86 ? 7   TRP A CD2 1 
ATOM 54    N NE1 . TRP A 1 7   ? -51.907 90.117  -5.861  1.00 21.37 ? 7   TRP A NE1 1 
ATOM 55    C CE2 . TRP A 1 7   ? -52.256 90.169  -7.181  1.00 20.94 ? 7   TRP A CE2 1 
ATOM 56    C CE3 . TRP A 1 7   ? -51.933 91.663  -9.061  1.00 16.80 ? 7   TRP A CE3 1 
ATOM 57    C CZ2 . TRP A 1 7   ? -53.000 89.257  -7.953  1.00 20.30 ? 7   TRP A CZ2 1 
ATOM 58    C CZ3 . TRP A 1 7   ? -52.672 90.770  -9.830  1.00 19.17 ? 7   TRP A CZ3 1 
ATOM 59    C CH2 . TRP A 1 7   ? -53.197 89.589  -9.270  1.00 19.42 ? 7   TRP A CH2 1 
ATOM 60    N N   . ASP A 1 8   ? -49.778 95.986  -7.656  1.00 18.17 ? 8   ASP A N   1 
ATOM 61    C CA  . ASP A 1 8   ? -49.446 97.389  -7.428  1.00 20.58 ? 8   ASP A CA  1 
ATOM 62    C C   . ASP A 1 8   ? -49.336 97.604  -5.910  1.00 21.48 ? 8   ASP A C   1 
ATOM 63    O O   . ASP A 1 8   ? -49.216 98.739  -5.437  1.00 22.09 ? 8   ASP A O   1 
ATOM 64    C CB  . ASP A 1 8   ? -50.515 98.320  -8.046  1.00 23.38 ? 8   ASP A CB  1 
ATOM 65    C CG  . ASP A 1 8   ? -51.893 98.181  -7.389  1.00 23.67 ? 8   ASP A CG  1 
ATOM 66    O OD1 . ASP A 1 8   ? -52.590 97.149  -7.587  1.00 21.26 ? 8   ASP A OD1 1 
ATOM 67    O OD2 . ASP A 1 8   ? -52.309 99.131  -6.695  1.00 24.80 ? 8   ASP A OD2 1 
ATOM 68    N N   . ILE A 1 9   ? -49.379 96.497  -5.165  1.00 20.33 ? 9   ILE A N   1 
ATOM 69    C CA  . ILE A 1 9   ? -49.295 96.490  -3.705  1.00 18.55 ? 9   ILE A CA  1 
ATOM 70    C C   . ILE A 1 9   ? -47.846 96.248  -3.278  1.00 15.67 ? 9   ILE A C   1 
ATOM 71    O O   . ILE A 1 9   ? -47.128 95.483  -3.926  1.00 15.60 ? 9   ILE A O   1 
ATOM 72    C CB  . ILE A 1 9   ? -50.138 95.336  -3.109  1.00 21.33 ? 9   ILE A CB  1 
ATOM 73    C CG1 . ILE A 1 9   ? -51.575 95.370  -3.642  1.00 18.98 ? 9   ILE A CG1 1 
ATOM 74    C CG2 . ILE A 1 9   ? -50.098 95.383  -1.598  1.00 22.07 ? 9   ILE A CG2 1 
ATOM 75    C CD1 . ILE A 1 9   ? -52.369 96.608  -3.286  1.00 19.96 ? 9   ILE A CD1 1 
ATOM 76    N N   . ARG A 1 10  ? -47.432 96.890  -2.187  1.00 14.99 ? 10  ARG A N   1 
ATOM 77    C CA  . ARG A 1 10  ? -46.084 96.732  -1.647  1.00 12.33 ? 10  ARG A CA  1 
ATOM 78    C C   . ARG A 1 10  ? -45.877 95.259  -1.348  1.00 10.13 ? 10  ARG A C   1 
ATOM 79    O O   . ARG A 1 10  ? -44.980 94.615  -1.904  1.00 8.15  ? 10  ARG A O   1 
ATOM 80    C CB  . ARG A 1 10  ? -45.937 97.563  -0.368  1.00 15.87 ? 10  ARG A CB  1 
ATOM 81    C CG  . ARG A 1 10  ? -44.819 97.128  0.567   1.00 15.42 ? 10  ARG A CG  1 
ATOM 82    C CD  . ARG A 1 10  ? -44.758 98.032  1.789   1.00 14.13 ? 10  ARG A CD  1 
ATOM 83    N NE  . ARG A 1 10  ? -43.922 97.498  2.864   1.00 14.54 ? 10  ARG A NE  1 
ATOM 84    C CZ  . ARG A 1 10  ? -43.387 98.238  3.834   1.00 14.42 ? 10  ARG A CZ  1 
ATOM 85    N NH1 . ARG A 1 10  ? -43.587 99.548  3.866   1.00 13.72 ? 10  ARG A NH1 1 
ATOM 86    N NH2 . ARG A 1 10  ? -42.677 97.666  4.797   1.00 18.69 ? 10  ARG A NH2 1 
ATOM 87    N N   . GLY A 1 11  ? -46.729 94.738  -0.473  1.00 11.33 ? 11  GLY A N   1 
ATOM 88    C CA  . GLY A 1 11  ? -46.680 93.339  -0.099  1.00 8.12  ? 11  GLY A CA  1 
ATOM 89    C C   . GLY A 1 11  ? -45.318 92.713  0.134   1.00 7.92  ? 11  GLY A C   1 
ATOM 90    O O   . GLY A 1 11  ? -44.395 93.341  0.660   1.00 7.69  ? 11  GLY A O   1 
ATOM 91    N N   . LEU A 1 12  ? -45.192 91.470  -0.313  1.00 9.23  ? 12  LEU A N   1 
ATOM 92    C CA  . LEU A 1 12  ? -43.974 90.697  -0.144  1.00 7.67  ? 12  LEU A CA  1 
ATOM 93    C C   . LEU A 1 12  ? -42.799 91.178  -0.978  1.00 9.14  ? 12  LEU A C   1 
ATOM 94    O O   . LEU A 1 12  ? -41.644 90.968  -0.611  1.00 11.41 ? 12  LEU A O   1 
ATOM 95    C CB  . LEU A 1 12  ? -44.253 89.230  -0.459  1.00 5.42  ? 12  LEU A CB  1 
ATOM 96    C CG  . LEU A 1 12  ? -45.331 88.558  0.385   1.00 6.94  ? 12  LEU A CG  1 
ATOM 97    C CD1 . LEU A 1 12  ? -45.900 87.373  -0.366  1.00 6.33  ? 12  LEU A CD1 1 
ATOM 98    C CD2 . LEU A 1 12  ? -44.761 88.143  1.732   1.00 5.47  ? 12  LEU A CD2 1 
ATOM 99    N N   . ALA A 1 13  ? -43.077 91.831  -2.095  1.00 8.27  ? 13  ALA A N   1 
ATOM 100   C CA  . ALA A 1 13  ? -41.992 92.293  -2.949  1.00 7.95  ? 13  ALA A CA  1 
ATOM 101   C C   . ALA A 1 13  ? -41.213 93.466  -2.362  1.00 8.23  ? 13  ALA A C   1 
ATOM 102   O O   . ALA A 1 13  ? -40.120 93.789  -2.838  1.00 6.10  ? 13  ALA A O   1 
ATOM 103   C CB  . ALA A 1 13  ? -42.517 92.639  -4.334  1.00 8.66  ? 13  ALA A CB  1 
ATOM 104   N N   . HIS A 1 14  ? -41.742 94.068  -1.300  1.00 8.70  ? 14  HIS A N   1 
ATOM 105   C CA  . HIS A 1 14  ? -41.085 95.212  -0.678  1.00 8.12  ? 14  HIS A CA  1 
ATOM 106   C C   . HIS A 1 14  ? -39.623 94.973  -0.350  1.00 9.23  ? 14  HIS A C   1 
ATOM 107   O O   . HIS A 1 14  ? -38.804 95.872  -0.506  1.00 10.94 ? 14  HIS A O   1 
ATOM 108   C CB  . HIS A 1 14  ? -41.813 95.659  0.584   1.00 5.53  ? 14  HIS A CB  1 
ATOM 109   C CG  . HIS A 1 14  ? -41.307 96.959  1.131   1.00 8.60  ? 14  HIS A CG  1 
ATOM 110   N ND1 . HIS A 1 14  ? -41.466 98.154  0.465   1.00 11.20 ? 14  HIS A ND1 1 
ATOM 111   C CD2 . HIS A 1 14  ? -40.627 97.248  2.264   1.00 9.70  ? 14  HIS A CD2 1 
ATOM 112   C CE1 . HIS A 1 14  ? -40.905 99.124  1.163   1.00 11.06 ? 14  HIS A CE1 1 
ATOM 113   N NE2 . HIS A 1 14  ? -40.390 98.600  2.261   1.00 7.28  ? 14  HIS A NE2 1 
ATOM 114   N N   . ALA A 1 15  ? -39.296 93.780  0.127   1.00 8.69  ? 15  ALA A N   1 
ATOM 115   C CA  . ALA A 1 15  ? -37.911 93.475  0.456   1.00 7.03  ? 15  ALA A CA  1 
ATOM 116   C C   . ALA A 1 15  ? -37.077 93.318  -0.811  1.00 8.35  ? 15  ALA A C   1 
ATOM 117   O O   . ALA A 1 15  ? -35.931 93.757  -0.865  1.00 5.62  ? 15  ALA A O   1 
ATOM 118   C CB  . ALA A 1 15  ? -37.833 92.211  1.307   1.00 7.17  ? 15  ALA A CB  1 
ATOM 119   N N   . ILE A 1 16  ? -37.689 92.742  -1.843  1.00 10.79 ? 16  ILE A N   1 
ATOM 120   C CA  . ILE A 1 16  ? -37.027 92.498  -3.124  1.00 9.68  ? 16  ILE A CA  1 
ATOM 121   C C   . ILE A 1 16  ? -36.682 93.762  -3.889  1.00 9.36  ? 16  ILE A C   1 
ATOM 122   O O   . ILE A 1 16  ? -35.662 93.794  -4.571  1.00 9.01  ? 16  ILE A O   1 
ATOM 123   C CB  . ILE A 1 16  ? -37.879 91.633  -4.047  1.00 5.78  ? 16  ILE A CB  1 
ATOM 124   C CG1 . ILE A 1 16  ? -38.472 90.458  -3.268  1.00 2.00  ? 16  ILE A CG1 1 
ATOM 125   C CG2 . ILE A 1 16  ? -37.021 91.123  -5.193  1.00 4.87  ? 16  ILE A CG2 1 
ATOM 126   C CD1 . ILE A 1 16  ? -39.570 89.721  -3.998  1.00 3.53  ? 16  ILE A CD1 1 
ATOM 127   N N   . ARG A 1 17  ? -37.554 94.747  -3.808  1.00 12.36 ? 17  ARG A N   1 
ATOM 128   C CA  . ARG A 1 17  ? -37.333 96.047  -4.483  1.00 17.27 ? 17  ARG A CA  1 
ATOM 129   C C   . ARG A 1 17  ? -36.197 96.825  -3.817  1.00 19.20 ? 17  ARG A C   1 
ATOM 130   O O   . ARG A 1 17  ? -35.635 97.761  -4.396  1.00 21.43 ? 17  ARG A O   1 
ATOM 131   C CB  . ARG A 1 17  ? -38.619 96.879  -4.488  1.00 16.76 ? 17  ARG A CB  1 
ATOM 132   C CG  . ARG A 1 17  ? -39.700 96.295  -5.369  1.00 16.13 ? 17  ARG A CG  1 
ATOM 133   C CD  . ARG A 1 17  ? -41.063 96.878  -5.067  1.00 17.30 ? 17  ARG A CD  1 
ATOM 134   N NE  . ARG A 1 17  ? -42.107 96.191  -5.827  1.00 20.86 ? 17  ARG A NE  1 
ATOM 135   C CZ  . ARG A 1 17  ? -43.207 95.662  -5.295  1.00 20.61 ? 17  ARG A CZ  1 
ATOM 136   N NH1 . ARG A 1 17  ? -43.424 95.735  -3.988  1.00 23.15 ? 17  ARG A NH1 1 
ATOM 137   N NH2 . ARG A 1 17  ? -44.081 95.034  -6.071  1.00 15.82 ? 17  ARG A NH2 1 
ATOM 138   N N   . LEU A 1 18  ? -35.898 96.456  -2.578  1.00 17.81 ? 18  LEU A N   1 
ATOM 139   C CA  . LEU A 1 18  ? -34.817 97.078  -1.845  1.00 16.01 ? 18  LEU A CA  1 
ATOM 140   C C   . LEU A 1 18  ? -33.545 96.318  -2.200  1.00 17.63 ? 18  LEU A C   1 
ATOM 141   O O   . LEU A 1 18  ? -32.608 96.907  -2.703  1.00 18.24 ? 18  LEU A O   1 
ATOM 142   C CB  . LEU A 1 18  ? -35.083 97.014  -0.341  1.00 9.15  ? 18  LEU A CB  1 
ATOM 143   C CG  . LEU A 1 18  ? -36.267 97.858  0.136   1.00 9.02  ? 18  LEU A CG  1 
ATOM 144   C CD1 . LEU A 1 18  ? -36.560 97.561  1.593   1.00 6.26  ? 18  LEU A CD1 1 
ATOM 145   C CD2 . LEU A 1 18  ? -35.980 99.335  -0.071  1.00 7.74  ? 18  LEU A CD2 1 
ATOM 146   N N   . LEU A 1 19  ? -33.567 94.998  -2.014  1.00 17.62 ? 19  LEU A N   1 
ATOM 147   C CA  . LEU A 1 19  ? -32.412 94.147  -2.300  1.00 15.43 ? 19  LEU A CA  1 
ATOM 148   C C   . LEU A 1 19  ? -31.830 94.383  -3.695  1.00 15.70 ? 19  LEU A C   1 
ATOM 149   O O   . LEU A 1 19  ? -30.691 94.852  -3.812  1.00 16.83 ? 19  LEU A O   1 
ATOM 150   C CB  . LEU A 1 19  ? -32.766 92.665  -2.116  1.00 12.12 ? 19  LEU A CB  1 
ATOM 151   C CG  . LEU A 1 19  ? -31.648 91.607  -2.082  1.00 13.97 ? 19  LEU A CG  1 
ATOM 152   C CD1 . LEU A 1 19  ? -30.673 91.846  -0.930  1.00 8.13  ? 19  LEU A CD1 1 
ATOM 153   C CD2 . LEU A 1 19  ? -32.267 90.220  -1.955  1.00 12.67 ? 19  LEU A CD2 1 
ATOM 154   N N   . LEU A 1 20  ? -32.593 94.148  -4.757  1.00 14.20 ? 20  LEU A N   1 
ATOM 155   C CA  . LEU A 1 20  ? -32.051 94.397  -6.092  1.00 15.58 ? 20  LEU A CA  1 
ATOM 156   C C   . LEU A 1 20  ? -31.706 95.873  -6.330  1.00 18.64 ? 20  LEU A C   1 
ATOM 157   O O   . LEU A 1 20  ? -30.885 96.192  -7.195  1.00 18.75 ? 20  LEU A O   1 
ATOM 158   C CB  . LEU A 1 20  ? -32.933 93.810  -7.213  1.00 12.36 ? 20  LEU A CB  1 
ATOM 159   C CG  . LEU A 1 20  ? -34.463 93.867  -7.280  1.00 9.24  ? 20  LEU A CG  1 
ATOM 160   C CD1 . LEU A 1 20  ? -34.964 95.271  -7.399  1.00 4.88  ? 20  LEU A CD1 1 
ATOM 161   C CD2 . LEU A 1 20  ? -34.924 93.054  -8.474  1.00 2.00  ? 20  LEU A CD2 1 
ATOM 162   N N   . GLU A 1 21  ? -32.293 96.758  -5.530  1.00 21.08 ? 21  GLU A N   1 
ATOM 163   C CA  . GLU A 1 21  ? -32.011 98.182  -5.641  1.00 20.55 ? 21  GLU A CA  1 
ATOM 164   C C   . GLU A 1 21  ? -30.601 98.387  -5.100  1.00 19.77 ? 21  GLU A C   1 
ATOM 165   O O   . GLU A 1 21  ? -29.727 98.925  -5.781  1.00 20.88 ? 21  GLU A O   1 
ATOM 166   C CB  . GLU A 1 21  ? -33.020 98.986  -4.811  1.00 20.60 ? 21  GLU A CB  1 
ATOM 167   C CG  . GLU A 1 21  ? -32.646 100.444 -4.525  1.00 23.34 ? 21  GLU A CG  1 
ATOM 168   C CD  . GLU A 1 21  ? -32.582 101.301 -5.770  1.00 24.24 ? 21  GLU A CD  1 
ATOM 169   O OE1 . GLU A 1 21  ? -33.557 101.304 -6.554  1.00 27.36 ? 21  GLU A OE1 1 
ATOM 170   O OE2 . GLU A 1 21  ? -31.550 101.977 -5.958  1.00 25.88 ? 21  GLU A OE2 1 
ATOM 171   N N   . TYR A 1 22  ? -30.373 97.844  -3.910  1.00 19.80 ? 22  TYR A N   1 
ATOM 172   C CA  . TYR A 1 22  ? -29.103 97.948  -3.208  1.00 20.00 ? 22  TYR A CA  1 
ATOM 173   C C   . TYR A 1 22  ? -27.964 97.296  -3.966  1.00 19.17 ? 22  TYR A C   1 
ATOM 174   O O   . TYR A 1 22  ? -26.844 97.798  -3.975  1.00 16.70 ? 22  TYR A O   1 
ATOM 175   C CB  . TYR A 1 22  ? -29.226 97.300  -1.830  1.00 19.03 ? 22  TYR A CB  1 
ATOM 176   C CG  . TYR A 1 22  ? -28.159 97.723  -0.852  1.00 20.65 ? 22  TYR A CG  1 
ATOM 177   C CD1 . TYR A 1 22  ? -28.181 98.994  -0.278  1.00 18.45 ? 22  TYR A CD1 1 
ATOM 178   C CD2 . TYR A 1 22  ? -27.142 96.849  -0.480  1.00 21.70 ? 22  TYR A CD2 1 
ATOM 179   C CE1 . TYR A 1 22  ? -27.229 99.380  0.641   1.00 20.55 ? 22  TYR A CE1 1 
ATOM 180   C CE2 . TYR A 1 22  ? -26.177 97.229  0.444   1.00 19.14 ? 22  TYR A CE2 1 
ATOM 181   C CZ  . TYR A 1 22  ? -26.231 98.497  1.002   1.00 19.97 ? 22  TYR A CZ  1 
ATOM 182   O OH  . TYR A 1 22  ? -25.299 98.887  1.932   1.00 18.52 ? 22  TYR A OH  1 
ATOM 183   N N   . THR A 1 23  ? -28.245 96.162  -4.587  1.00 18.52 ? 23  THR A N   1 
ATOM 184   C CA  . THR A 1 23  ? -27.215 95.460  -5.330  1.00 19.30 ? 23  THR A CA  1 
ATOM 185   C C   . THR A 1 23  ? -27.035 96.005  -6.748  1.00 20.03 ? 23  THR A C   1 
ATOM 186   O O   . THR A 1 23  ? -26.339 95.398  -7.564  1.00 19.72 ? 23  THR A O   1 
ATOM 187   C CB  . THR A 1 23  ? -27.476 93.938  -5.343  1.00 20.05 ? 23  THR A CB  1 
ATOM 188   O OG1 . THR A 1 23  ? -28.750 93.644  -5.938  1.00 21.31 ? 23  THR A OG1 1 
ATOM 189   C CG2 . THR A 1 23  ? -27.471 93.390  -3.918  1.00 15.22 ? 23  THR A CG2 1 
ATOM 190   N N   . ASP A 1 24  ? -27.657 97.153  -7.023  1.00 20.30 ? 24  ASP A N   1 
ATOM 191   C CA  . ASP A 1 24  ? -27.580 97.820  -8.325  1.00 20.70 ? 24  ASP A CA  1 
ATOM 192   C C   . ASP A 1 24  ? -28.014 96.917  -9.480  1.00 21.43 ? 24  ASP A C   1 
ATOM 193   O O   . ASP A 1 24  ? -27.574 97.093  -10.619 1.00 21.01 ? 24  ASP A O   1 
ATOM 194   C CB  . ASP A 1 24  ? -26.155 98.343  -8.580  1.00 20.15 ? 24  ASP A CB  1 
ATOM 195   C CG  . ASP A 1 24  ? -25.767 99.506  -7.663  1.00 18.80 ? 24  ASP A CG  1 
ATOM 196   O OD1 . ASP A 1 24  ? -26.082 99.469  -6.453  1.00 16.22 ? 24  ASP A OD1 1 
ATOM 197   O OD2 . ASP A 1 24  ? -25.116 100.453 -8.157  1.00 14.02 ? 24  ASP A OD2 1 
ATOM 198   N N   . SER A 1 25  ? -28.897 95.968  -9.191  1.00 21.20 ? 25  SER A N   1 
ATOM 199   C CA  . SER A 1 25  ? -29.381 95.028  -10.197 1.00 21.82 ? 25  SER A CA  1 
ATOM 200   C C   . SER A 1 25  ? -30.270 95.734  -11.231 1.00 20.33 ? 25  SER A C   1 
ATOM 201   O O   . SER A 1 25  ? -31.251 96.396  -10.874 1.00 17.92 ? 25  SER A O   1 
ATOM 202   C CB  . SER A 1 25  ? -30.149 93.892  -9.509  1.00 20.45 ? 25  SER A CB  1 
ATOM 203   O OG  . SER A 1 25  ? -29.894 92.634  -10.115 1.00 21.66 ? 25  SER A OG  1 
ATOM 204   N N   . SER A 1 26  ? -29.918 95.595  -12.510 1.00 21.90 ? 26  SER A N   1 
ATOM 205   C CA  . SER A 1 26  ? -30.680 96.217  -13.596 1.00 22.07 ? 26  SER A CA  1 
ATOM 206   C C   . SER A 1 26  ? -32.068 95.587  -13.756 1.00 21.87 ? 26  SER A C   1 
ATOM 207   O O   . SER A 1 26  ? -32.284 94.719  -14.610 1.00 23.61 ? 26  SER A O   1 
ATOM 208   C CB  . SER A 1 26  ? -29.893 96.141  -14.911 1.00 24.42 ? 26  SER A CB  1 
ATOM 209   O OG  . SER A 1 26  ? -29.273 94.876  -15.078 1.00 19.39 ? 26  SER A OG  1 
ATOM 210   N N   . TYR A 1 27  ? -33.003 96.035  -12.928 1.00 19.50 ? 27  TYR A N   1 
ATOM 211   C CA  . TYR A 1 27  ? -34.365 95.516  -12.939 1.00 18.95 ? 27  TYR A CA  1 
ATOM 212   C C   . TYR A 1 27  ? -35.367 96.406  -13.680 1.00 20.36 ? 27  TYR A C   1 
ATOM 213   O O   . TYR A 1 27  ? -35.076 97.562  -14.007 1.00 19.92 ? 27  TYR A O   1 
ATOM 214   C CB  . TYR A 1 27  ? -34.846 95.281  -11.495 1.00 15.94 ? 27  TYR A CB  1 
ATOM 215   C CG  . TYR A 1 27  ? -35.122 96.527  -10.687 1.00 15.51 ? 27  TYR A CG  1 
ATOM 216   C CD1 . TYR A 1 27  ? -34.094 97.435  -10.357 1.00 17.55 ? 27  TYR A CD1 1 
ATOM 217   C CD2 . TYR A 1 27  ? -36.414 96.839  -10.242 1.00 13.63 ? 27  TYR A CD2 1 
ATOM 218   C CE1 . TYR A 1 27  ? -34.349 98.609  -9.602  1.00 15.60 ? 27  TYR A CE1 1 
ATOM 219   C CE2 . TYR A 1 27  ? -36.684 97.990  -9.490  1.00 13.43 ? 27  TYR A CE2 1 
ATOM 220   C CZ  . TYR A 1 27  ? -35.645 98.878  -9.173  1.00 14.59 ? 27  TYR A CZ  1 
ATOM 221   O OH  . TYR A 1 27  ? -35.911 99.994  -8.433  1.00 10.59 ? 27  TYR A OH  1 
ATOM 222   N N   . GLU A 1 28  ? -36.546 95.846  -13.941 1.00 21.11 ? 28  GLU A N   1 
ATOM 223   C CA  . GLU A 1 28  ? -37.635 96.557  -14.600 1.00 21.43 ? 28  GLU A CA  1 
ATOM 224   C C   . GLU A 1 28  ? -38.903 96.127  -13.864 1.00 20.75 ? 28  GLU A C   1 
ATOM 225   O O   . GLU A 1 28  ? -39.016 94.974  -13.448 1.00 20.59 ? 28  GLU A O   1 
ATOM 226   C CB  . GLU A 1 28  ? -37.703 96.185  -16.084 1.00 23.71 ? 28  GLU A CB  1 
ATOM 227   C CG  . GLU A 1 28  ? -38.414 97.224  -16.942 1.00 25.50 ? 28  GLU A CG  1 
ATOM 228   C CD  . GLU A 1 28  ? -38.270 96.974  -18.435 1.00 29.62 ? 28  GLU A CD  1 
ATOM 229   O OE1 . GLU A 1 28  ? -37.176 96.576  -18.889 1.00 29.90 ? 28  GLU A OE1 1 
ATOM 230   O OE2 . GLU A 1 28  ? -39.257 97.197  -19.163 1.00 33.33 ? 28  GLU A OE2 1 
ATOM 231   N N   . GLU A 1 29  ? -39.843 97.048  -13.676 1.00 20.21 ? 29  GLU A N   1 
ATOM 232   C CA  . GLU A 1 29  ? -41.066 96.728  -12.947 1.00 21.67 ? 29  GLU A CA  1 
ATOM 233   C C   . GLU A 1 29  ? -42.328 96.441  -13.757 1.00 22.87 ? 29  GLU A C   1 
ATOM 234   O O   . GLU A 1 29  ? -42.751 97.244  -14.597 1.00 21.85 ? 29  GLU A O   1 
ATOM 235   C CB  . GLU A 1 29  ? -41.364 97.806  -11.900 1.00 22.16 ? 29  GLU A CB  1 
ATOM 236   C CG  . GLU A 1 29  ? -40.356 97.866  -10.751 1.00 20.01 ? 29  GLU A CG  1 
ATOM 237   C CD  . GLU A 1 29  ? -40.786 98.792  -9.613  1.00 21.10 ? 29  GLU A CD  1 
ATOM 238   O OE1 . GLU A 1 29  ? -41.898 99.364  -9.662  1.00 22.18 ? 29  GLU A OE1 1 
ATOM 239   O OE2 . GLU A 1 29  ? -39.998 98.943  -8.653  1.00 21.78 ? 29  GLU A OE2 1 
ATOM 240   N N   . LYS A 1 30  ? -42.920 95.281  -13.483 1.00 24.27 ? 30  LYS A N   1 
ATOM 241   C CA  . LYS A 1 30  ? -44.158 94.839  -14.116 1.00 25.53 ? 30  LYS A CA  1 
ATOM 242   C C   . LYS A 1 30  ? -45.203 94.819  -13.010 1.00 23.71 ? 30  LYS A C   1 
ATOM 243   O O   . LYS A 1 30  ? -45.299 93.843  -12.258 1.00 23.31 ? 30  LYS A O   1 
ATOM 244   C CB  . LYS A 1 30  ? -44.024 93.417  -14.674 1.00 25.24 ? 30  LYS A CB  1 
ATOM 245   C CG  . LYS A 1 30  ? -43.229 93.286  -15.948 1.00 25.72 ? 30  LYS A CG  1 
ATOM 246   C CD  . LYS A 1 30  ? -43.253 91.845  -16.444 1.00 27.53 ? 30  LYS A CD  1 
ATOM 247   C CE  . LYS A 1 30  ? -42.475 91.681  -17.745 1.00 26.00 ? 30  LYS A CE  1 
ATOM 248   N NZ  . LYS A 1 30  ? -42.397 90.264  -18.202 1.00 24.97 ? 30  LYS A NZ  1 
ATOM 249   N N   . LYS A 1 31  ? -45.957 95.900  -12.874 1.00 22.00 ? 31  LYS A N   1 
ATOM 250   C CA  . LYS A 1 31  ? -46.974 95.950  -11.838 1.00 21.51 ? 31  LYS A CA  1 
ATOM 251   C C   . LYS A 1 31  ? -48.322 95.491  -12.389 1.00 21.52 ? 31  LYS A C   1 
ATOM 252   O O   . LYS A 1 31  ? -48.716 95.903  -13.480 1.00 22.97 ? 31  LYS A O   1 
ATOM 253   C CB  . LYS A 1 31  ? -47.073 97.363  -11.252 1.00 19.57 ? 31  LYS A CB  1 
ATOM 254   C CG  . LYS A 1 31  ? -45.863 97.791  -10.419 1.00 15.95 ? 31  LYS A CG  1 
ATOM 255   C CD  . LYS A 1 31  ? -45.485 99.245  -10.688 1.00 14.53 ? 31  LYS A CD  1 
ATOM 256   C CE  . LYS A 1 31  ? -46.623 100.200 -10.365 1.00 16.51 ? 31  LYS A CE  1 
ATOM 257   N NZ  . LYS A 1 31  ? -46.400 101.541 -10.976 1.00 15.06 ? 31  LYS A NZ  1 
ATOM 258   N N   . TYR A 1 32  ? -48.978 94.603  -11.673 1.00 17.84 ? 32  TYR A N   1 
ATOM 259   C CA  . TYR A 1 32  ? -50.291 94.118  -12.058 1.00 18.71 ? 32  TYR A CA  1 
ATOM 260   C C   . TYR A 1 32  ? -51.217 94.825  -11.075 1.00 18.96 ? 32  TYR A C   1 
ATOM 261   O O   . TYR A 1 32  ? -50.883 94.960  -9.903  1.00 19.06 ? 32  TYR A O   1 
ATOM 262   C CB  . TYR A 1 32  ? -50.383 92.592  -11.879 1.00 21.17 ? 32  TYR A CB  1 
ATOM 263   C CG  . TYR A 1 32  ? -49.560 91.758  -12.855 1.00 19.14 ? 32  TYR A CG  1 
ATOM 264   C CD1 . TYR A 1 32  ? -48.163 91.790  -12.835 1.00 20.73 ? 32  TYR A CD1 1 
ATOM 265   C CD2 . TYR A 1 32  ? -50.180 90.944  -13.804 1.00 18.42 ? 32  TYR A CD2 1 
ATOM 266   C CE1 . TYR A 1 32  ? -47.401 91.038  -13.736 1.00 19.29 ? 32  TYR A CE1 1 
ATOM 267   C CE2 . TYR A 1 32  ? -49.435 90.189  -14.706 1.00 18.59 ? 32  TYR A CE2 1 
ATOM 268   C CZ  . TYR A 1 32  ? -48.053 90.241  -14.668 1.00 18.70 ? 32  TYR A CZ  1 
ATOM 269   O OH  . TYR A 1 32  ? -47.322 89.502  -15.571 1.00 15.43 ? 32  TYR A OH  1 
ATOM 270   N N   . THR A 1 33  ? -52.366 95.292  -11.536 1.00 18.51 ? 33  THR A N   1 
ATOM 271   C CA  . THR A 1 33  ? -53.283 96.003  -10.654 1.00 21.78 ? 33  THR A CA  1 
ATOM 272   C C   . THR A 1 33  ? -54.514 95.186  -10.292 1.00 23.55 ? 33  THR A C   1 
ATOM 273   O O   . THR A 1 33  ? -55.054 94.466  -11.133 1.00 23.38 ? 33  THR A O   1 
ATOM 274   C CB  . THR A 1 33  ? -53.737 97.336  -11.295 1.00 21.23 ? 33  THR A CB  1 
ATOM 275   O OG1 . THR A 1 33  ? -52.588 98.140  -11.602 1.00 23.76 ? 33  THR A OG1 1 
ATOM 276   C CG2 . THR A 1 33  ? -54.657 98.107  -10.355 1.00 21.14 ? 33  THR A CG2 1 
ATOM 277   N N   . MET A 1 34  ? -54.953 95.292  -9.042  1.00 24.37 ? 34  MET A N   1 
ATOM 278   C CA  . MET A 1 34  ? -56.139 94.564  -8.614  1.00 23.92 ? 34  MET A CA  1 
ATOM 279   C C   . MET A 1 34  ? -57.377 95.450  -8.682  1.00 26.17 ? 34  MET A C   1 
ATOM 280   O O   . MET A 1 34  ? -57.290 96.669  -8.532  1.00 23.71 ? 34  MET A O   1 
ATOM 281   C CB  . MET A 1 34  ? -55.991 94.006  -7.197  1.00 21.75 ? 34  MET A CB  1 
ATOM 282   C CG  . MET A 1 34  ? -57.209 93.184  -6.789  1.00 20.81 ? 34  MET A CG  1 
ATOM 283   S SD  . MET A 1 34  ? -57.278 92.640  -5.080  1.00 26.90 ? 34  MET A SD  1 
ATOM 284   C CE  . MET A 1 34  ? -56.597 90.978  -5.226  1.00 23.74 ? 34  MET A CE  1 
ATOM 285   N N   . GLY A 1 35  ? -58.522 94.821  -8.912  1.00 28.03 ? 35  GLY A N   1 
ATOM 286   C CA  . GLY A 1 35  ? -59.770 95.544  -8.988  1.00 30.92 ? 35  GLY A CA  1 
ATOM 287   C C   . GLY A 1 35  ? -60.525 95.408  -7.689  1.00 30.50 ? 35  GLY A C   1 
ATOM 288   O O   . GLY A 1 35  ? -60.105 94.688  -6.791  1.00 30.89 ? 35  GLY A O   1 
ATOM 289   N N   . ASP A 1 36  ? -61.639 96.115  -7.592  1.00 30.57 ? 36  ASP A N   1 
ATOM 290   C CA  . ASP A 1 36  ? -62.470 96.086  -6.401  1.00 30.77 ? 36  ASP A CA  1 
ATOM 291   C C   . ASP A 1 36  ? -63.789 95.393  -6.723  1.00 31.73 ? 36  ASP A C   1 
ATOM 292   O O   . ASP A 1 36  ? -63.764 94.333  -7.356  1.00 30.92 ? 36  ASP A O   1 
ATOM 293   C CB  . ASP A 1 36  ? -62.680 97.504  -5.863  1.00 31.40 ? 36  ASP A CB  1 
ATOM 294   C CG  . ASP A 1 36  ? -62.737 98.533  -6.962  1.00 34.85 ? 36  ASP A CG  1 
ATOM 295   O OD1 . ASP A 1 36  ? -63.836 98.764  -7.498  1.00 31.67 ? 36  ASP A OD1 1 
ATOM 296   O OD2 . ASP A 1 36  ? -61.674 99.089  -7.307  1.00 36.09 ? 36  ASP A OD2 1 
ATOM 297   N N   . ALA A 1 37  ? -64.911 96.000  -6.333  1.00 29.87 ? 37  ALA A N   1 
ATOM 298   C CA  . ALA A 1 37  ? -66.236 95.421  -6.572  1.00 30.15 ? 37  ALA A CA  1 
ATOM 299   C C   . ALA A 1 37  ? -66.352 94.160  -5.704  1.00 30.72 ? 37  ALA A C   1 
ATOM 300   O O   . ALA A 1 37  ? -65.431 93.850  -4.942  1.00 30.58 ? 37  ALA A O   1 
ATOM 301   C CB  . ALA A 1 37  ? -66.423 95.095  -8.086  1.00 31.13 ? 37  ALA A CB  1 
ATOM 302   N N   . PRO A 1 38  ? -67.502 93.461  -5.743  1.00 29.80 ? 38  PRO A N   1 
ATOM 303   C CA  . PRO A 1 38  ? -67.616 92.252  -4.917  1.00 30.47 ? 38  PRO A CA  1 
ATOM 304   C C   . PRO A 1 38  ? -66.525 91.232  -5.250  1.00 30.30 ? 38  PRO A C   1 
ATOM 305   O O   . PRO A 1 38  ? -65.971 90.592  -4.362  1.00 29.44 ? 38  PRO A O   1 
ATOM 306   C CB  . PRO A 1 38  ? -69.005 91.732  -5.276  1.00 30.26 ? 38  PRO A CB  1 
ATOM 307   C CG  . PRO A 1 38  ? -69.766 92.988  -5.560  1.00 31.33 ? 38  PRO A CG  1 
ATOM 308   C CD  . PRO A 1 38  ? -68.787 93.764  -6.400  1.00 29.92 ? 38  PRO A CD  1 
ATOM 309   N N   . ASP A 1 39  ? -66.241 91.070  -6.539  1.00 33.17 ? 39  ASP A N   1 
ATOM 310   C CA  . ASP A 1 39  ? -65.205 90.142  -6.987  1.00 33.29 ? 39  ASP A CA  1 
ATOM 311   C C   . ASP A 1 39  ? -63.979 90.963  -7.340  1.00 30.63 ? 39  ASP A C   1 
ATOM 312   O O   . ASP A 1 39  ? -63.902 91.520  -8.435  1.00 31.60 ? 39  ASP A O   1 
ATOM 313   C CB  . ASP A 1 39  ? -65.642 89.370  -8.245  1.00 36.37 ? 39  ASP A CB  1 
ATOM 314   C CG  . ASP A 1 39  ? -66.837 88.465  -8.009  1.00 35.29 ? 39  ASP A CG  1 
ATOM 315   O OD1 . ASP A 1 39  ? -66.794 87.622  -7.088  1.00 33.81 ? 39  ASP A OD1 1 
ATOM 316   O OD2 . ASP A 1 39  ? -67.816 88.580  -8.772  1.00 31.86 ? 39  ASP A OD2 1 
ATOM 317   N N   . TYR A 1 40  ? -63.031 91.057  -6.418  1.00 29.52 ? 40  TYR A N   1 
ATOM 318   C CA  . TYR A 1 40  ? -61.815 91.819  -6.680  1.00 28.48 ? 40  TYR A CA  1 
ATOM 319   C C   . TYR A 1 40  ? -61.075 91.225  -7.872  1.00 25.35 ? 40  TYR A C   1 
ATOM 320   O O   . TYR A 1 40  ? -60.338 90.243  -7.748  1.00 22.17 ? 40  TYR A O   1 
ATOM 321   C CB  . TYR A 1 40  ? -60.949 91.882  -5.420  1.00 28.00 ? 40  TYR A CB  1 
ATOM 322   C CG  . TYR A 1 40  ? -61.625 92.690  -4.338  1.00 25.77 ? 40  TYR A CG  1 
ATOM 323   C CD1 . TYR A 1 40  ? -62.562 92.090  -3.490  1.00 24.34 ? 40  TYR A CD1 1 
ATOM 324   C CD2 . TYR A 1 40  ? -61.395 94.061  -4.221  1.00 24.30 ? 40  TYR A CD2 1 
ATOM 325   C CE1 . TYR A 1 40  ? -63.262 92.873  -2.554  1.00 24.92 ? 40  TYR A CE1 1 
ATOM 326   C CE2 . TYR A 1 40  ? -62.085 94.833  -3.296  1.00 25.02 ? 40  TYR A CE2 1 
ATOM 327   C CZ  . TYR A 1 40  ? -63.017 94.237  -2.467  1.00 25.22 ? 40  TYR A CZ  1 
ATOM 328   O OH  . TYR A 1 40  ? -63.714 95.008  -1.567  1.00 20.39 ? 40  TYR A OH  1 
ATOM 329   N N   . ASP A 1 41  ? -61.315 91.817  -9.040  1.00 25.38 ? 41  ASP A N   1 
ATOM 330   C CA  . ASP A 1 41  ? -60.728 91.341  -10.285 1.00 23.86 ? 41  ASP A CA  1 
ATOM 331   C C   . ASP A 1 41  ? -59.216 91.439  -10.397 1.00 23.04 ? 41  ASP A C   1 
ATOM 332   O O   . ASP A 1 41  ? -58.633 92.506  -10.232 1.00 22.28 ? 41  ASP A O   1 
ATOM 333   C CB  . ASP A 1 41  ? -61.378 92.027  -11.486 1.00 24.63 ? 41  ASP A CB  1 
ATOM 334   C CG  . ASP A 1 41  ? -61.096 91.301  -12.791 1.00 22.83 ? 41  ASP A CG  1 
ATOM 335   O OD1 . ASP A 1 41  ? -61.722 90.242  -13.020 1.00 18.45 ? 41  ASP A OD1 1 
ATOM 336   O OD2 . ASP A 1 41  ? -60.251 91.786  -13.579 1.00 19.36 ? 41  ASP A OD2 1 
ATOM 337   N N   . ARG A 1 42  ? -58.610 90.319  -10.769 1.00 22.35 ? 42  ARG A N   1 
ATOM 338   C CA  . ARG A 1 42  ? -57.166 90.210  -10.926 1.00 23.49 ? 42  ARG A CA  1 
ATOM 339   C C   . ARG A 1 42  ? -56.822 89.653  -12.317 1.00 24.49 ? 42  ARG A C   1 
ATOM 340   O O   . ARG A 1 42  ? -55.795 88.996  -12.526 1.00 23.15 ? 42  ARG A O   1 
ATOM 341   C CB  . ARG A 1 42  ? -56.616 89.293  -9.829  1.00 24.50 ? 42  ARG A CB  1 
ATOM 342   C CG  . ARG A 1 42  ? -57.430 88.013  -9.637  1.00 26.60 ? 42  ARG A CG  1 
ATOM 343   C CD  . ARG A 1 42  ? -56.782 87.065  -8.639  1.00 26.73 ? 42  ARG A CD  1 
ATOM 344   N NE  . ARG A 1 42  ? -56.880 87.538  -7.260  1.00 25.73 ? 42  ARG A NE  1 
ATOM 345   C CZ  . ARG A 1 42  ? -56.664 86.778  -6.191  1.00 24.97 ? 42  ARG A CZ  1 
ATOM 346   N NH1 . ARG A 1 42  ? -56.335 85.500  -6.329  1.00 23.27 ? 42  ARG A NH1 1 
ATOM 347   N NH2 . ARG A 1 42  ? -56.795 87.290  -4.976  1.00 23.23 ? 42  ARG A NH2 1 
ATOM 348   N N   . SER A 1 43  ? -57.672 89.954  -13.293 1.00 24.57 ? 43  SER A N   1 
ATOM 349   C CA  . SER A 1 43  ? -57.490 89.470  -14.660 1.00 22.81 ? 43  SER A CA  1 
ATOM 350   C C   . SER A 1 43  ? -56.113 89.709  -15.262 1.00 21.42 ? 43  SER A C   1 
ATOM 351   O O   . SER A 1 43  ? -55.570 88.811  -15.883 1.00 20.31 ? 43  SER A O   1 
ATOM 352   C CB  . SER A 1 43  ? -58.564 90.045  -15.597 1.00 26.07 ? 43  SER A CB  1 
ATOM 353   O OG  . SER A 1 43  ? -59.849 89.509  -15.315 1.00 25.81 ? 43  SER A OG  1 
ATOM 354   N N   . GLN A 1 44  ? -55.551 90.901  -15.074 1.00 21.27 ? 44  GLN A N   1 
ATOM 355   C CA  . GLN A 1 44  ? -54.236 91.200  -15.644 1.00 20.22 ? 44  GLN A CA  1 
ATOM 356   C C   . GLN A 1 44  ? -53.247 90.057  -15.390 1.00 18.72 ? 44  GLN A C   1 
ATOM 357   O O   . GLN A 1 44  ? -52.551 89.626  -16.318 1.00 18.96 ? 44  GLN A O   1 
ATOM 358   C CB  . GLN A 1 44  ? -53.663 92.511  -15.091 1.00 18.43 ? 44  GLN A CB  1 
ATOM 359   C CG  . GLN A 1 44  ? -54.389 93.760  -15.558 1.00 21.50 ? 44  GLN A CG  1 
ATOM 360   C CD  . GLN A 1 44  ? -53.585 95.038  -15.353 1.00 24.10 ? 44  GLN A CD  1 
ATOM 361   O OE1 . GLN A 1 44  ? -52.964 95.238  -14.310 1.00 23.41 ? 44  GLN A OE1 1 
ATOM 362   N NE2 . GLN A 1 44  ? -53.600 95.911  -16.356 1.00 24.30 ? 44  GLN A NE2 1 
ATOM 363   N N   . TRP A 1 45  ? -53.291 89.534  -14.166 1.00 16.44 ? 45  TRP A N   1 
ATOM 364   C CA  . TRP A 1 45  ? -52.424 88.431  -13.778 1.00 15.83 ? 45  TRP A CA  1 
ATOM 365   C C   . TRP A 1 45  ? -52.902 87.112  -14.361 1.00 14.63 ? 45  TRP A C   1 
ATOM 366   O O   . TRP A 1 45  ? -52.157 86.432  -15.063 1.00 14.09 ? 45  TRP A O   1 
ATOM 367   C CB  . TRP A 1 45  ? -52.342 88.313  -12.253 1.00 15.83 ? 45  TRP A CB  1 
ATOM 368   C CG  . TRP A 1 45  ? -51.660 87.051  -11.778 1.00 14.31 ? 45  TRP A CG  1 
ATOM 369   C CD1 . TRP A 1 45  ? -52.193 86.082  -10.972 1.00 13.33 ? 45  TRP A CD1 1 
ATOM 370   C CD2 . TRP A 1 45  ? -50.334 86.617  -12.102 1.00 13.85 ? 45  TRP A CD2 1 
ATOM 371   N NE1 . TRP A 1 45  ? -51.280 85.074  -10.779 1.00 13.53 ? 45  TRP A NE1 1 
ATOM 372   C CE2 . TRP A 1 45  ? -50.131 85.376  -11.464 1.00 14.28 ? 45  TRP A CE2 1 
ATOM 373   C CE3 . TRP A 1 45  ? -49.296 87.156  -12.876 1.00 12.97 ? 45  TRP A CE3 1 
ATOM 374   C CZ2 . TRP A 1 45  ? -48.935 84.663  -11.574 1.00 15.32 ? 45  TRP A CZ2 1 
ATOM 375   C CZ3 . TRP A 1 45  ? -48.108 86.450  -12.985 1.00 12.62 ? 45  TRP A CZ3 1 
ATOM 376   C CH2 . TRP A 1 45  ? -47.938 85.216  -12.337 1.00 15.00 ? 45  TRP A CH2 1 
ATOM 377   N N   . LEU A 1 46  ? -54.141 86.750  -14.051 1.00 15.03 ? 46  LEU A N   1 
ATOM 378   C CA  . LEU A 1 46  ? -54.728 85.501  -14.526 1.00 16.83 ? 46  LEU A CA  1 
ATOM 379   C C   . LEU A 1 46  ? -54.450 85.233  -16.005 1.00 18.61 ? 46  LEU A C   1 
ATOM 380   O O   . LEU A 1 46  ? -53.990 84.152  -16.373 1.00 21.74 ? 46  LEU A O   1 
ATOM 381   C CB  . LEU A 1 46  ? -56.233 85.509  -14.252 1.00 18.10 ? 46  LEU A CB  1 
ATOM 382   C CG  . LEU A 1 46  ? -56.607 85.546  -12.766 1.00 20.29 ? 46  LEU A CG  1 
ATOM 383   C CD1 . LEU A 1 46  ? -57.974 86.175  -12.579 1.00 20.85 ? 46  LEU A CD1 1 
ATOM 384   C CD2 . LEU A 1 46  ? -56.550 84.142  -12.173 1.00 17.06 ? 46  LEU A CD2 1 
ATOM 385   N N   . ASN A 1 47  ? -54.697 86.224  -16.834 1.00 21.57 ? 47  ASN A N   1 
ATOM 386   C CA  . ASN A 1 47  ? -54.481 86.157  -18.276 1.00 21.69 ? 47  ASN A CA  1 
ATOM 387   C C   . ASN A 1 47  ? -53.018 85.851  -18.608 1.00 22.85 ? 47  ASN A C   1 
ATOM 388   O O   . ASN A 1 47  ? -52.735 84.957  -19.408 1.00 23.94 ? 47  ASN A O   1 
ATOM 389   C CB  . ASN A 1 47  ? -54.900 87.472  -18.942 1.00 23.40 ? 47  ASN A CB  1 
ATOM 390   C CG  . ASN A 1 47  ? -56.374 87.813  -18.715 1.00 28.62 ? 47  ASN A CG  1 
ATOM 391   O OD1 . ASN A 1 47  ? -57.043 87.256  -17.834 1.00 33.19 ? 47  ASN A OD1 1 
ATOM 392   N ND2 . ASN A 1 47  ? -56.910 88.741  -19.507 1.00 27.70 ? 47  ASN A ND2 1 
ATOM 393   N N   . GLU A 1 48  ? -52.092 86.601  -18.007 1.00 20.91 ? 48  GLU A N   1 
ATOM 394   C CA  . GLU A 1 48  ? -50.664 86.391  -18.246 1.00 18.07 ? 48  GLU A CA  1 
ATOM 395   C C   . GLU A 1 48  ? -50.159 85.100  -17.598 1.00 17.39 ? 48  GLU A C   1 
ATOM 396   O O   . GLU A 1 48  ? -49.668 84.217  -18.286 1.00 20.19 ? 48  GLU A O   1 
ATOM 397   C CB  . GLU A 1 48  ? -49.832 87.600  -17.778 1.00 18.50 ? 48  GLU A CB  1 
ATOM 398   C CG  . GLU A 1 48  ? -49.858 88.782  -18.746 1.00 18.26 ? 48  GLU A CG  1 
ATOM 399   C CD  . GLU A 1 48  ? -48.743 89.786  -18.492 1.00 19.91 ? 48  GLU A CD  1 
ATOM 400   O OE1 . GLU A 1 48  ? -47.573 89.495  -18.835 1.00 13.77 ? 48  GLU A OE1 1 
ATOM 401   O OE2 . GLU A 1 48  ? -49.040 90.879  -17.964 1.00 18.18 ? 48  GLU A OE2 1 
ATOM 402   N N   . LYS A 1 49  ? -50.287 85.018  -16.278 1.00 14.22 ? 49  LYS A N   1 
ATOM 403   C CA  . LYS A 1 49  ? -49.881 83.873  -15.454 1.00 15.81 ? 49  LYS A CA  1 
ATOM 404   C C   . LYS A 1 49  ? -49.166 82.653  -16.098 1.00 15.97 ? 49  LYS A C   1 
ATOM 405   O O   . LYS A 1 49  ? -47.942 82.488  -15.998 1.00 13.81 ? 49  LYS A O   1 
ATOM 406   C CB  . LYS A 1 49  ? -51.094 83.387  -14.660 1.00 14.99 ? 49  LYS A CB  1 
ATOM 407   C CG  . LYS A 1 49  ? -50.797 82.320  -13.621 1.00 16.42 ? 49  LYS A CG  1 
ATOM 408   C CD  . LYS A 1 49  ? -52.022 82.064  -12.756 1.00 15.21 ? 49  LYS A CD  1 
ATOM 409   C CE  . LYS A 1 49  ? -51.749 81.015  -11.687 1.00 16.20 ? 49  LYS A CE  1 
ATOM 410   N NZ  . LYS A 1 49  ? -52.972 80.693  -10.897 1.00 17.58 ? 49  LYS A NZ  1 
ATOM 411   N N   . PHE A 1 50  ? -49.945 81.838  -16.771 1.00 15.54 ? 50  PHE A N   1 
ATOM 412   C CA  . PHE A 1 50  ? -49.442 80.628  -17.395 1.00 14.34 ? 50  PHE A CA  1 
ATOM 413   C C   . PHE A 1 50  ? -48.583 80.875  -18.625 1.00 15.36 ? 50  PHE A C   1 
ATOM 414   O O   . PHE A 1 50  ? -47.735 80.056  -18.970 1.00 17.09 ? 50  PHE A O   1 
ATOM 415   C CB  . PHE A 1 50  ? -50.625 79.730  -17.718 1.00 10.60 ? 50  PHE A CB  1 
ATOM 416   C CG  . PHE A 1 50  ? -51.652 79.673  -16.611 1.00 9.15  ? 50  PHE A CG  1 
ATOM 417   C CD1 . PHE A 1 50  ? -52.690 80.600  -16.553 1.00 10.58 ? 50  PHE A CD1 1 
ATOM 418   C CD2 . PHE A 1 50  ? -51.574 78.702  -15.622 1.00 10.66 ? 50  PHE A CD2 1 
ATOM 419   C CE1 . PHE A 1 50  ? -53.635 80.559  -15.528 1.00 12.49 ? 50  PHE A CE1 1 
ATOM 420   C CE2 . PHE A 1 50  ? -52.516 78.655  -14.592 1.00 11.44 ? 50  PHE A CE2 1 
ATOM 421   C CZ  . PHE A 1 50  ? -53.547 79.586  -14.546 1.00 8.22  ? 50  PHE A CZ  1 
ATOM 422   N N   . LYS A 1 51  ? -48.792 82.016  -19.270 1.00 16.22 ? 51  LYS A N   1 
ATOM 423   C CA  . LYS A 1 51  ? -48.040 82.400  -20.459 1.00 16.16 ? 51  LYS A CA  1 
ATOM 424   C C   . LYS A 1 51  ? -46.546 82.618  -20.212 1.00 16.40 ? 51  LYS A C   1 
ATOM 425   O O   . LYS A 1 51  ? -45.726 82.354  -21.088 1.00 17.86 ? 51  LYS A O   1 
ATOM 426   C CB  . LYS A 1 51  ? -48.630 83.676  -21.059 1.00 17.80 ? 51  LYS A CB  1 
ATOM 427   C CG  . LYS A 1 51  ? -50.065 83.542  -21.542 1.00 24.06 ? 51  LYS A CG  1 
ATOM 428   C CD  . LYS A 1 51  ? -50.523 84.812  -22.237 1.00 25.23 ? 51  LYS A CD  1 
ATOM 429   C CE  . LYS A 1 51  ? -51.829 84.595  -22.986 1.00 25.85 ? 51  LYS A CE  1 
ATOM 430   N NZ  . LYS A 1 51  ? -52.307 85.838  -23.655 1.00 25.41 ? 51  LYS A NZ  1 
ATOM 431   N N   . LEU A 1 52  ? -46.201 83.103  -19.023 1.00 12.77 ? 52  LEU A N   1 
ATOM 432   C CA  . LEU A 1 52  ? -44.811 83.392  -18.653 1.00 10.23 ? 52  LEU A CA  1 
ATOM 433   C C   . LEU A 1 52  ? -43.864 82.188  -18.558 1.00 9.12  ? 52  LEU A C   1 
ATOM 434   O O   . LEU A 1 52  ? -42.645 82.340  -18.649 1.00 5.87  ? 52  LEU A O   1 
ATOM 435   C CB  . LEU A 1 52  ? -44.779 84.191  -17.341 1.00 11.33 ? 52  LEU A CB  1 
ATOM 436   C CG  . LEU A 1 52  ? -45.490 85.553  -17.368 1.00 11.91 ? 52  LEU A CG  1 
ATOM 437   C CD1 . LEU A 1 52  ? -45.831 86.023  -15.962 1.00 6.70  ? 52  LEU A CD1 1 
ATOM 438   C CD2 . LEU A 1 52  ? -44.634 86.582  -18.096 1.00 5.91  ? 52  LEU A CD2 1 
ATOM 439   N N   . GLY A 1 53  ? -44.422 81.003  -18.340 1.00 10.30 ? 53  GLY A N   1 
ATOM 440   C CA  . GLY A 1 53  ? -43.600 79.808  -18.242 1.00 11.53 ? 53  GLY A CA  1 
ATOM 441   C C   . GLY A 1 53  ? -42.965 79.513  -16.890 1.00 10.03 ? 53  GLY A C   1 
ATOM 442   O O   . GLY A 1 53  ? -41.921 78.856  -16.821 1.00 12.52 ? 53  GLY A O   1 
ATOM 443   N N   . LEU A 1 54  ? -43.586 79.987  -15.814 1.00 7.39  ? 54  LEU A N   1 
ATOM 444   C CA  . LEU A 1 54  ? -43.071 79.739  -14.471 1.00 7.32  ? 54  LEU A CA  1 
ATOM 445   C C   . LEU A 1 54  ? -43.458 78.311  -14.086 1.00 6.96  ? 54  LEU A C   1 
ATOM 446   O O   . LEU A 1 54  ? -44.619 77.930  -14.242 1.00 5.81  ? 54  LEU A O   1 
ATOM 447   C CB  . LEU A 1 54  ? -43.701 80.709  -13.468 1.00 4.24  ? 54  LEU A CB  1 
ATOM 448   C CG  . LEU A 1 54  ? -43.677 82.213  -13.741 1.00 8.31  ? 54  LEU A CG  1 
ATOM 449   C CD1 . LEU A 1 54  ? -44.507 82.928  -12.682 1.00 8.26  ? 54  LEU A CD1 1 
ATOM 450   C CD2 . LEU A 1 54  ? -42.254 82.734  -13.741 1.00 9.59  ? 54  LEU A CD2 1 
ATOM 451   N N   . ASP A 1 55  ? -42.504 77.535  -13.570 1.00 6.53  ? 55  ASP A N   1 
ATOM 452   C CA  . ASP A 1 55  ? -42.763 76.149  -13.154 1.00 8.37  ? 55  ASP A CA  1 
ATOM 453   C C   . ASP A 1 55  ? -43.934 76.091  -12.178 1.00 8.66  ? 55  ASP A C   1 
ATOM 454   O O   . ASP A 1 55  ? -44.656 75.076  -12.111 1.00 6.49  ? 55  ASP A O   1 
ATOM 455   C CB  . ASP A 1 55  ? -41.531 75.540  -12.480 1.00 5.60  ? 55  ASP A CB  1 
ATOM 456   C CG  . ASP A 1 55  ? -40.348 75.407  -13.420 1.00 3.14  ? 55  ASP A CG  1 
ATOM 457   O OD1 . ASP A 1 55  ? -40.486 74.740  -14.466 1.00 2.00  ? 55  ASP A OD1 1 
ATOM 458   O OD2 . ASP A 1 55  ? -39.271 75.960  -13.104 1.00 4.85  ? 55  ASP A OD2 1 
ATOM 459   N N   . PHE A 1 56  ? -44.063 77.153  -11.388 1.00 8.44  ? 56  PHE A N   1 
ATOM 460   C CA  . PHE A 1 56  ? -45.131 77.305  -10.401 1.00 8.07  ? 56  PHE A CA  1 
ATOM 461   C C   . PHE A 1 56  ? -45.625 78.742  -10.517 1.00 5.98  ? 56  PHE A C   1 
ATOM 462   O O   . PHE A 1 56  ? -45.341 79.572  -9.657  1.00 5.14  ? 56  PHE A O   1 
ATOM 463   C CB  . PHE A 1 56  ? -44.592 77.062  -8.989  1.00 10.44 ? 56  PHE A CB  1 
ATOM 464   C CG  . PHE A 1 56  ? -44.136 75.653  -8.746  1.00 4.94  ? 56  PHE A CG  1 
ATOM 465   C CD1 . PHE A 1 56  ? -45.045 74.672  -8.392  1.00 6.94  ? 56  PHE A CD1 1 
ATOM 466   C CD2 . PHE A 1 56  ? -42.802 75.311  -8.888  1.00 6.32  ? 56  PHE A CD2 1 
ATOM 467   C CE1 . PHE A 1 56  ? -44.637 73.379  -8.187  1.00 3.44  ? 56  PHE A CE1 1 
ATOM 468   C CE2 . PHE A 1 56  ? -42.380 74.020  -8.686  1.00 6.71  ? 56  PHE A CE2 1 
ATOM 469   C CZ  . PHE A 1 56  ? -43.297 73.047  -8.336  1.00 3.67  ? 56  PHE A CZ  1 
ATOM 470   N N   . PRO A 1 57  ? -46.365 79.052  -11.592 1.00 6.92  ? 57  PRO A N   1 
ATOM 471   C CA  . PRO A 1 57  ? -46.888 80.402  -11.815 1.00 8.51  ? 57  PRO A CA  1 
ATOM 472   C C   . PRO A 1 57  ? -47.503 81.117  -10.599 1.00 6.60  ? 57  PRO A C   1 
ATOM 473   O O   . PRO A 1 57  ? -48.629 80.810  -10.175 1.00 8.80  ? 57  PRO A O   1 
ATOM 474   C CB  . PRO A 1 57  ? -47.905 80.198  -12.945 1.00 8.49  ? 57  PRO A CB  1 
ATOM 475   C CG  . PRO A 1 57  ? -48.284 78.737  -12.833 1.00 4.00  ? 57  PRO A CG  1 
ATOM 476   C CD  . PRO A 1 57  ? -46.958 78.103  -12.549 1.00 5.76  ? 57  PRO A CD  1 
ATOM 477   N N   . ASN A 1 58  ? -46.720 81.983  -9.994  1.00 6.76  ? 58  ASN A N   1 
ATOM 478   C CA  . ASN A 1 58  ? -47.176 82.769  -8.860  1.00 7.69  ? 58  ASN A CA  1 
ATOM 479   C C   . ASN A 1 58  ? -46.550 84.140  -8.951  1.00 5.60  ? 58  ASN A C   1 
ATOM 480   O O   . ASN A 1 58  ? -45.548 84.348  -9.635  1.00 5.66  ? 58  ASN A O   1 
ATOM 481   C CB  . ASN A 1 58  ? -46.826 82.146  -7.503  1.00 10.11 ? 58  ASN A CB  1 
ATOM 482   C CG  . ASN A 1 58  ? -47.114 83.107  -6.317  1.00 14.05 ? 58  ASN A CG  1 
ATOM 483   O OD1 . ASN A 1 58  ? -48.267 83.471  -6.071  1.00 16.75 ? 58  ASN A OD1 1 
ATOM 484   N ND2 . ASN A 1 58  ? -46.059 83.597  -5.690  1.00 13.54 ? 58  ASN A ND2 1 
ATOM 485   N N   . LEU A 1 59  ? -47.149 85.069  -8.248  1.00 4.70  ? 59  LEU A N   1 
ATOM 486   C CA  . LEU A 1 59  ? -46.710 86.437  -8.193  1.00 9.26  ? 59  LEU A CA  1 
ATOM 487   C C   . LEU A 1 59  ? -46.465 86.727  -6.709  1.00 13.33 ? 59  LEU A C   1 
ATOM 488   O O   . LEU A 1 59  ? -47.220 86.244  -5.858  1.00 14.82 ? 59  LEU A O   1 
ATOM 489   C CB  . LEU A 1 59  ? -47.825 87.290  -8.797  1.00 9.72  ? 59  LEU A CB  1 
ATOM 490   C CG  . LEU A 1 59  ? -47.933 88.804  -8.730  1.00 8.95  ? 59  LEU A CG  1 
ATOM 491   C CD1 . LEU A 1 59  ? -48.386 89.365  -10.069 1.00 7.52  ? 59  LEU A CD1 1 
ATOM 492   C CD2 . LEU A 1 59  ? -48.932 89.143  -7.657  1.00 10.23 ? 59  LEU A CD2 1 
ATOM 493   N N   . PRO A 1 60  ? -45.355 87.417  -6.364  1.00 11.91 ? 60  PRO A N   1 
ATOM 494   C CA  . PRO A 1 60  ? -44.316 87.964  -7.240  1.00 10.37 ? 60  PRO A CA  1 
ATOM 495   C C   . PRO A 1 60  ? -43.434 86.916  -7.886  1.00 8.88  ? 60  PRO A C   1 
ATOM 496   O O   . PRO A 1 60  ? -43.285 85.769  -7.365  1.00 6.61  ? 60  PRO A O   1 
ATOM 497   C CB  . PRO A 1 60  ? -43.515 88.850  -6.294  1.00 11.11 ? 60  PRO A CB  1 
ATOM 498   C CG  . PRO A 1 60  ? -43.570 88.103  -5.039  1.00 13.05 ? 60  PRO A CG  1 
ATOM 499   C CD  . PRO A 1 60  ? -45.017 87.686  -4.953  1.00 14.13 ? 60  PRO A CD  1 
ATOM 500   N N   . TYR A 1 61  ? -42.842 87.267  -9.015  1.00 7.14  ? 61  TYR A N   1 
ATOM 501   C CA  . TYR A 1 61  ? -41.985 86.371  -9.773  1.00 6.94  ? 61  TYR A CA  1 
ATOM 502   C C   . TYR A 1 61  ? -40.828 87.183  -10.324 1.00 6.87  ? 61  TYR A C   1 
ATOM 503   O O   . TYR A 1 61  ? -40.914 88.410  -10.419 1.00 9.61  ? 61  TYR A O   1 
ATOM 504   C CB  . TYR A 1 61  ? -42.766 85.759  -10.944 1.00 8.24  ? 61  TYR A CB  1 
ATOM 505   C CG  . TYR A 1 61  ? -43.254 86.792  -11.949 1.00 11.09 ? 61  TYR A CG  1 
ATOM 506   C CD1 . TYR A 1 61  ? -44.497 87.433  -11.777 1.00 8.81  ? 61  TYR A CD1 1 
ATOM 507   C CD2 . TYR A 1 61  ? -42.467 87.161  -13.065 1.00 9.39  ? 61  TYR A CD2 1 
ATOM 508   C CE1 . TYR A 1 61  ? -44.910 88.409  -12.663 1.00 8.18  ? 61  TYR A CE1 1 
ATOM 509   C CE2 . TYR A 1 61  ? -42.888 88.137  -13.940 1.00 7.93  ? 61  TYR A CE2 1 
ATOM 510   C CZ  . TYR A 1 61  ? -44.109 88.756  -13.739 1.00 7.54  ? 61  TYR A CZ  1 
ATOM 511   O OH  . TYR A 1 61  ? -44.534 89.738  -14.600 1.00 11.49 ? 61  TYR A OH  1 
ATOM 512   N N   . LEU A 1 62  ? -39.780 86.492  -10.754 1.00 6.77  ? 62  LEU A N   1 
ATOM 513   C CA  . LEU A 1 62  ? -38.609 87.144  -11.312 1.00 6.64  ? 62  LEU A CA  1 
ATOM 514   C C   . LEU A 1 62  ? -38.151 86.349  -12.520 1.00 10.92 ? 62  LEU A C   1 
ATOM 515   O O   . LEU A 1 62  ? -38.058 85.126  -12.470 1.00 13.10 ? 62  LEU A O   1 
ATOM 516   C CB  . LEU A 1 62  ? -37.474 87.210  -10.282 1.00 4.67  ? 62  LEU A CB  1 
ATOM 517   C CG  . LEU A 1 62  ? -36.317 88.154  -10.634 1.00 5.07  ? 62  LEU A CG  1 
ATOM 518   C CD1 . LEU A 1 62  ? -36.767 89.603  -10.474 1.00 8.50  ? 62  LEU A CD1 1 
ATOM 519   C CD2 . LEU A 1 62  ? -35.115 87.866  -9.747  1.00 6.06  ? 62  LEU A CD2 1 
ATOM 520   N N   . ILE A 1 63  ? -37.890 87.057  -13.610 1.00 11.85 ? 63  ILE A N   1 
ATOM 521   C CA  . ILE A 1 63  ? -37.439 86.442  -14.848 1.00 13.48 ? 63  ILE A CA  1 
ATOM 522   C C   . ILE A 1 63  ? -36.105 87.061  -15.252 1.00 13.95 ? 63  ILE A C   1 
ATOM 523   O O   . ILE A 1 63  ? -36.040 88.016  -16.024 1.00 14.76 ? 63  ILE A O   1 
ATOM 524   C CB  . ILE A 1 63  ? -38.475 86.642  -15.981 1.00 13.74 ? 63  ILE A CB  1 
ATOM 525   C CG1 . ILE A 1 63  ? -39.830 86.059  -15.566 1.00 14.85 ? 63  ILE A CG1 1 
ATOM 526   C CG2 . ILE A 1 63  ? -37.980 86.003  -17.275 1.00 16.87 ? 63  ILE A CG2 1 
ATOM 527   C CD1 . ILE A 1 63  ? -40.968 86.434  -16.481 1.00 13.87 ? 63  ILE A CD1 1 
ATOM 528   N N   . ASP A 1 64  ? -35.026 86.573  -14.658 1.00 16.03 ? 64  ASP A N   1 
ATOM 529   C CA  . ASP A 1 64  ? -33.704 87.077  -14.980 1.00 18.55 ? 64  ASP A CA  1 
ATOM 530   C C   . ASP A 1 64  ? -33.287 86.546  -16.341 1.00 19.23 ? 64  ASP A C   1 
ATOM 531   O O   . ASP A 1 64  ? -32.532 85.532  -16.426 1.00 18.96 ? 64  ASP A O   1 
ATOM 532   C CB  . ASP A 1 64  ? -32.699 86.659  -13.906 1.00 19.46 ? 64  ASP A CB  1 
ATOM 533   C CG  . ASP A 1 64  ? -31.324 87.241  -14.144 1.00 17.31 ? 64  ASP A CG  1 
ATOM 534   O OD1 . ASP A 1 64  ? -31.200 88.482  -14.079 1.00 19.61 ? 64  ASP A OD1 1 
ATOM 535   O OD2 . ASP A 1 64  ? -30.375 86.471  -14.418 1.00 10.44 ? 64  ASP A OD2 1 
ATOM 536   N N   . GLY A 1 65  ? -33.813 87.144  -17.400 1.00 17.43 ? 65  GLY A N   1 
ATOM 537   C CA  . GLY A 1 65  ? -33.499 86.714  -18.754 1.00 16.54 ? 65  GLY A CA  1 
ATOM 538   C C   . GLY A 1 65  ? -33.928 85.276  -19.000 1.00 19.70 ? 65  GLY A C   1 
ATOM 539   O O   . GLY A 1 65  ? -35.034 85.017  -19.485 1.00 18.58 ? 65  GLY A O   1 
ATOM 540   N N   . ALA A 1 66  ? -33.051 84.340  -18.651 1.00 17.62 ? 66  ALA A N   1 
ATOM 541   C CA  . ALA A 1 66  ? -33.330 82.922  -18.807 1.00 18.56 ? 66  ALA A CA  1 
ATOM 542   C C   . ALA A 1 66  ? -33.494 82.306  -17.424 1.00 20.90 ? 66  ALA A C   1 
ATOM 543   O O   . ALA A 1 66  ? -33.053 81.180  -17.180 1.00 18.63 ? 66  ALA A O   1 
ATOM 544   C CB  . ALA A 1 66  ? -32.187 82.249  -19.551 1.00 22.50 ? 66  ALA A CB  1 
ATOM 545   N N   . HIS A 1 67  ? -34.106 83.055  -16.511 1.00 20.11 ? 67  HIS A N   1 
ATOM 546   C CA  . HIS A 1 67  ? -34.310 82.582  -15.148 1.00 16.99 ? 67  HIS A CA  1 
ATOM 547   C C   . HIS A 1 67  ? -35.636 83.053  -14.602 1.00 17.82 ? 67  HIS A C   1 
ATOM 548   O O   . HIS A 1 67  ? -35.769 84.189  -14.231 1.00 19.97 ? 67  HIS A O   1 
ATOM 549   C CB  . HIS A 1 67  ? -33.204 83.101  -14.234 1.00 15.69 ? 67  HIS A CB  1 
ATOM 550   C CG  . HIS A 1 67  ? -31.844 82.608  -14.592 1.00 12.30 ? 67  HIS A CG  1 
ATOM 551   N ND1 . HIS A 1 67  ? -30.940 83.370  -15.305 1.00 14.20 ? 67  HIS A ND1 1 
ATOM 552   C CD2 . HIS A 1 67  ? -31.231 81.426  -14.350 1.00 10.48 ? 67  HIS A CD2 1 
ATOM 553   C CE1 . HIS A 1 67  ? -29.831 82.676  -15.486 1.00 12.20 ? 67  HIS A CE1 1 
ATOM 554   N NE2 . HIS A 1 67  ? -29.983 81.492  -14.916 1.00 10.97 ? 67  HIS A NE2 1 
ATOM 555   N N   . LYS A 1 68  ? -36.611 82.164  -14.519 1.00 17.02 ? 68  LYS A N   1 
ATOM 556   C CA  . LYS A 1 68  ? -37.911 82.550  -13.994 1.00 16.35 ? 68  LYS A CA  1 
ATOM 557   C C   . LYS A 1 68  ? -38.093 82.091  -12.551 1.00 15.96 ? 68  LYS A C   1 
ATOM 558   O O   . LYS A 1 68  ? -38.807 81.127  -12.271 1.00 15.30 ? 68  LYS A O   1 
ATOM 559   C CB  . LYS A 1 68  ? -39.036 82.018  -14.885 1.00 14.30 ? 68  LYS A CB  1 
ATOM 560   C CG  . LYS A 1 68  ? -39.199 82.753  -16.211 1.00 14.23 ? 68  LYS A CG  1 
ATOM 561   C CD  . LYS A 1 68  ? -38.186 82.316  -17.254 1.00 15.60 ? 68  LYS A CD  1 
ATOM 562   C CE  . LYS A 1 68  ? -38.871 81.629  -18.431 1.00 21.48 ? 68  LYS A CE  1 
ATOM 563   N NZ  . LYS A 1 68  ? -39.915 82.483  -19.081 1.00 18.63 ? 68  LYS A NZ  1 
ATOM 564   N N   . ILE A 1 69  ? -37.427 82.786  -11.637 1.00 16.62 ? 69  ILE A N   1 
ATOM 565   C CA  . ILE A 1 69  ? -37.505 82.457  -10.219 1.00 18.39 ? 69  ILE A CA  1 
ATOM 566   C C   . ILE A 1 69  ? -38.802 83.003  -9.597  1.00 16.10 ? 69  ILE A C   1 
ATOM 567   O O   . ILE A 1 69  ? -39.059 84.201  -9.659  1.00 13.86 ? 69  ILE A O   1 
ATOM 568   C CB  . ILE A 1 69  ? -36.265 82.990  -9.429  1.00 18.20 ? 69  ILE A CB  1 
ATOM 569   C CG1 . ILE A 1 69  ? -35.028 82.127  -9.709  1.00 19.14 ? 69  ILE A CG1 1 
ATOM 570   C CG2 . ILE A 1 69  ? -36.536 82.983  -7.933  1.00 16.07 ? 69  ILE A CG2 1 
ATOM 571   C CD1 . ILE A 1 69  ? -34.326 82.439  -10.999 1.00 16.53 ? 69  ILE A CD1 1 
ATOM 572   N N   . THR A 1 70  ? -39.577 82.113  -9.009  1.00 14.62 ? 70  THR A N   1 
ATOM 573   C CA  . THR A 1 70  ? -40.821 82.499  -8.362  1.00 12.59 ? 70  THR A CA  1 
ATOM 574   C C   . THR A 1 70  ? -40.655 82.399  -6.846  1.00 14.23 ? 70  THR A C   1 
ATOM 575   O O   . THR A 1 70  ? -39.690 81.816  -6.356  1.00 12.44 ? 70  THR A O   1 
ATOM 576   C CB  . THR A 1 70  ? -41.974 81.576  -8.784  1.00 11.66 ? 70  THR A CB  1 
ATOM 577   O OG1 . THR A 1 70  ? -41.611 80.872  -9.979  1.00 6.04  ? 70  THR A OG1 1 
ATOM 578   C CG2 . THR A 1 70  ? -43.225 82.393  -9.046  1.00 10.68 ? 70  THR A CG2 1 
ATOM 579   N N   . GLN A 1 71  ? -41.604 82.976  -6.115  1.00 14.13 ? 71  GLN A N   1 
ATOM 580   C CA  . GLN A 1 71  ? -41.613 82.955  -4.651  1.00 12.83 ? 71  GLN A CA  1 
ATOM 581   C C   . GLN A 1 71  ? -40.517 83.819  -4.038  1.00 12.34 ? 71  GLN A C   1 
ATOM 582   O O   . GLN A 1 71  ? -39.325 83.518  -4.148  1.00 14.90 ? 71  GLN A O   1 
ATOM 583   C CB  . GLN A 1 71  ? -41.536 81.521  -4.105  1.00 11.79 ? 71  GLN A CB  1 
ATOM 584   C CG  . GLN A 1 71  ? -42.139 81.351  -2.750  1.00 11.68 ? 71  GLN A CG  1 
ATOM 585   C CD  . GLN A 1 71  ? -42.889 80.045  -2.611  1.00 11.10 ? 71  GLN A CD  1 
ATOM 586   O OE1 . GLN A 1 71  ? -42.442 79.017  -3.085  1.00 11.50 ? 71  GLN A OE1 1 
ATOM 587   N NE2 . GLN A 1 71  ? -44.045 80.088  -1.963  1.00 15.29 ? 71  GLN A NE2 1 
ATOM 588   N N   . SER A 1 72  ? -40.957 84.884  -3.370  1.00 11.70 ? 72  SER A N   1 
ATOM 589   C CA  . SER A 1 72  ? -40.098 85.865  -2.715  1.00 13.87 ? 72  SER A CA  1 
ATOM 590   C C   . SER A 1 72  ? -38.788 85.348  -2.144  1.00 13.02 ? 72  SER A C   1 
ATOM 591   O O   . SER A 1 72  ? -37.717 85.812  -2.511  1.00 9.68  ? 72  SER A O   1 
ATOM 592   C CB  . SER A 1 72  ? -40.893 86.583  -1.625  1.00 15.08 ? 72  SER A CB  1 
ATOM 593   O OG  . SER A 1 72  ? -41.820 85.698  -1.016  1.00 16.20 ? 72  SER A OG  1 
ATOM 594   N N   . ASN A 1 73  ? -38.879 84.330  -1.269  1.00 12.49 ? 73  ASN A N   1 
ATOM 595   C CA  . ASN A 1 73  ? -37.700 83.731  -0.645  1.00 13.72 ? 73  ASN A CA  1 
ATOM 596   C C   . ASN A 1 73  ? -36.687 83.276  -1.677  1.00 12.30 ? 73  ASN A C   1 
ATOM 597   O O   . ASN A 1 73  ? -35.536 83.708  -1.648  1.00 14.80 ? 73  ASN A O   1 
ATOM 598   C CB  . ASN A 1 73  ? -38.086 82.550  0.249   1.00 14.39 ? 73  ASN A CB  1 
ATOM 599   C CG  . ASN A 1 73  ? -38.455 82.974  1.660   1.00 17.49 ? 73  ASN A CG  1 
ATOM 600   O OD1 . ASN A 1 73  ? -37.859 83.897  2.221   1.00 15.80 ? 73  ASN A OD1 1 
ATOM 601   N ND2 . ASN A 1 73  ? -39.413 82.276  2.258   1.00 10.50 ? 73  ASN A ND2 1 
ATOM 602   N N   . ALA A 1 74  ? -37.126 82.444  -2.616  1.00 10.69 ? 74  ALA A N   1 
ATOM 603   C CA  . ALA A 1 74  ? -36.251 81.924  -3.667  1.00 11.20 ? 74  ALA A CA  1 
ATOM 604   C C   . ALA A 1 74  ? -35.636 83.057  -4.472  1.00 11.37 ? 74  ALA A C   1 
ATOM 605   O O   . ALA A 1 74  ? -34.503 82.959  -4.956  1.00 7.67  ? 74  ALA A O   1 
ATOM 606   C CB  . ALA A 1 74  ? -37.027 81.003  -4.576  1.00 12.19 ? 74  ALA A CB  1 
ATOM 607   N N   . ILE A 1 75  ? -36.400 84.128  -4.622  1.00 12.22 ? 75  ILE A N   1 
ATOM 608   C CA  . ILE A 1 75  ? -35.939 85.291  -5.349  1.00 13.79 ? 75  ILE A CA  1 
ATOM 609   C C   . ILE A 1 75  ? -34.827 85.936  -4.532  1.00 12.29 ? 75  ILE A C   1 
ATOM 610   O O   . ILE A 1 75  ? -33.744 86.216  -5.052  1.00 12.05 ? 75  ILE A O   1 
ATOM 611   C CB  . ILE A 1 75  ? -37.106 86.267  -5.587  1.00 12.14 ? 75  ILE A CB  1 
ATOM 612   C CG1 . ILE A 1 75  ? -38.197 85.550  -6.383  1.00 10.93 ? 75  ILE A CG1 1 
ATOM 613   C CG2 . ILE A 1 75  ? -36.631 87.509  -6.346  1.00 16.06 ? 75  ILE A CG2 1 
ATOM 614   C CD1 . ILE A 1 75  ? -39.519 86.261  -6.396  1.00 11.12 ? 75  ILE A CD1 1 
ATOM 615   N N   . LEU A 1 76  ? -35.067 86.081  -3.233  1.00 13.67 ? 76  LEU A N   1 
ATOM 616   C CA  . LEU A 1 76  ? -34.090 86.681  -2.339  1.00 14.95 ? 76  LEU A CA  1 
ATOM 617   C C   . LEU A 1 76  ? -32.782 85.891  -2.377  1.00 15.25 ? 76  LEU A C   1 
ATOM 618   O O   . LEU A 1 76  ? -31.718 86.460  -2.620  1.00 13.82 ? 76  LEU A O   1 
ATOM 619   C CB  . LEU A 1 76  ? -34.672 86.796  -0.923  1.00 13.60 ? 76  LEU A CB  1 
ATOM 620   C CG  . LEU A 1 76  ? -35.844 87.797  -0.820  1.00 11.00 ? 76  LEU A CG  1 
ATOM 621   C CD1 . LEU A 1 76  ? -36.689 87.573  0.423   1.00 6.23  ? 76  LEU A CD1 1 
ATOM 622   C CD2 . LEU A 1 76  ? -35.327 89.226  -0.867  1.00 8.16  ? 76  LEU A CD2 1 
ATOM 623   N N   . CYS A 1 77  ? -32.871 84.589  -2.233  1.00 14.45 ? 77  CYS A N   1 
ATOM 624   C CA  . CYS A 1 77  ? -31.687 83.710  -2.287  1.00 13.97 ? 77  CYS A CA  1 
ATOM 625   C C   . CYS A 1 77  ? -30.904 83.893  -3.588  1.00 13.47 ? 77  CYS A C   1 
ATOM 626   O O   . CYS A 1 77  ? -29.673 83.855  -3.593  1.00 13.43 ? 77  CYS A O   1 
ATOM 627   C CB  . CYS A 1 77  ? -32.082 82.232  -2.158  1.00 13.94 ? 77  CYS A CB  1 
ATOM 628   S SG  . CYS A 1 77  ? -32.190 81.595  -0.476  1.00 15.61 ? 77  CYS A SG  1 
ATOM 629   N N   . TYR A 1 78  ? -31.632 84.087  -4.683  1.00 15.30 ? 78  TYR A N   1 
ATOM 630   C CA  . TYR A 1 78  ? -31.047 84.260  -6.010  1.00 14.30 ? 78  TYR A CA  1 
ATOM 631   C C   . TYR A 1 78  ? -30.215 85.536  -6.196  1.00 9.69  ? 78  TYR A C   1 
ATOM 632   O O   . TYR A 1 78  ? -29.087 85.495  -6.748  1.00 7.17  ? 78  TYR A O   1 
ATOM 633   C CB  . TYR A 1 78  ? -32.153 84.206  -7.073  1.00 16.26 ? 78  TYR A CB  1 
ATOM 634   C CG  . TYR A 1 78  ? -31.646 84.435  -8.476  1.00 16.86 ? 78  TYR A CG  1 
ATOM 635   C CD1 . TYR A 1 78  ? -30.706 83.574  -9.041  1.00 19.47 ? 78  TYR A CD1 1 
ATOM 636   C CD2 . TYR A 1 78  ? -32.080 85.528  -9.231  1.00 16.74 ? 78  TYR A CD2 1 
ATOM 637   C CE1 . TYR A 1 78  ? -30.208 83.792  -10.315 1.00 20.89 ? 78  TYR A CE1 1 
ATOM 638   C CE2 . TYR A 1 78  ? -31.584 85.773  -10.513 1.00 17.93 ? 78  TYR A CE2 1 
ATOM 639   C CZ  . TYR A 1 78  ? -30.647 84.883  -11.045 1.00 20.18 ? 78  TYR A CZ  1 
ATOM 640   O OH  . TYR A 1 78  ? -30.137 85.083  -12.302 1.00 16.32 ? 78  TYR A OH  1 
ATOM 641   N N   . ILE A 1 79  ? -30.776 86.666  -5.774  1.00 10.20 ? 79  ILE A N   1 
ATOM 642   C CA  . ILE A 1 79  ? -30.103 87.956  -5.900  1.00 10.64 ? 79  ILE A CA  1 
ATOM 643   C C   . ILE A 1 79  ? -28.923 87.999  -4.949  1.00 10.26 ? 79  ILE A C   1 
ATOM 644   O O   . ILE A 1 79  ? -27.793 88.268  -5.361  1.00 9.52  ? 79  ILE A O   1 
ATOM 645   C CB  . ILE A 1 79  ? -31.055 89.133  -5.569  1.00 10.55 ? 79  ILE A CB  1 
ATOM 646   C CG1 . ILE A 1 79  ? -32.251 89.124  -6.527  1.00 10.92 ? 79  ILE A CG1 1 
ATOM 647   C CG2 . ILE A 1 79  ? -30.302 90.461  -5.644  1.00 13.77 ? 79  ILE A CG2 1 
ATOM 648   C CD1 . ILE A 1 79  ? -33.357 90.096  -6.150  1.00 13.46 ? 79  ILE A CD1 1 
ATOM 649   N N   . ALA A 1 80  ? -29.197 87.709  -3.680  1.00 11.40 ? 80  ALA A N   1 
ATOM 650   C CA  . ALA A 1 80  ? -28.178 87.712  -2.639  1.00 10.20 ? 80  ALA A CA  1 
ATOM 651   C C   . ALA A 1 80  ? -26.974 86.914  -3.118  1.00 8.44  ? 80  ALA A C   1 
ATOM 652   O O   . ALA A 1 80  ? -25.893 87.468  -3.182  1.00 10.99 ? 80  ALA A O   1 
ATOM 653   C CB  . ALA A 1 80  ? -28.722 87.095  -1.365  1.00 9.50  ? 80  ALA A CB  1 
ATOM 654   N N   . ARG A 1 81  ? -27.198 85.675  -3.490  1.00 8.23  ? 81  ARG A N   1 
ATOM 655   C CA  . ARG A 1 81  ? -26.146 84.790  -3.978  1.00 7.57  ? 81  ARG A CA  1 
ATOM 656   C C   . ARG A 1 81  ? -25.191 85.500  -4.941  1.00 9.11  ? 81  ARG A C   1 
ATOM 657   O O   . ARG A 1 81  ? -24.001 85.646  -4.655  1.00 9.50  ? 81  ARG A O   1 
ATOM 658   C CB  . ARG A 1 81  ? -26.776 83.587  -4.683  1.00 4.72  ? 81  ARG A CB  1 
ATOM 659   C CG  . ARG A 1 81  ? -26.257 82.245  -4.225  1.00 9.38  ? 81  ARG A CG  1 
ATOM 660   C CD  . ARG A 1 81  ? -26.850 81.123  -5.057  1.00 10.27 ? 81  ARG A CD  1 
ATOM 661   N NE  . ARG A 1 81  ? -28.307 81.077  -4.965  1.00 19.57 ? 81  ARG A NE  1 
ATOM 662   C CZ  . ARG A 1 81  ? -29.077 80.302  -5.721  1.00 21.97 ? 81  ARG A CZ  1 
ATOM 663   N NH1 . ARG A 1 81  ? -28.536 79.505  -6.630  1.00 24.56 ? 81  ARG A NH1 1 
ATOM 664   N NH2 . ARG A 1 81  ? -30.390 80.329  -5.578  1.00 19.35 ? 81  ARG A NH2 1 
ATOM 665   N N   . LYS A 1 82  ? -25.737 85.997  -6.046  1.00 10.54 ? 82  LYS A N   1 
ATOM 666   C CA  . LYS A 1 82  ? -24.953 86.681  -7.074  1.00 15.56 ? 82  LYS A CA  1 
ATOM 667   C C   . LYS A 1 82  ? -24.231 87.959  -6.609  1.00 19.20 ? 82  LYS A C   1 
ATOM 668   O O   . LYS A 1 82  ? -23.462 88.576  -7.365  1.00 18.49 ? 82  LYS A O   1 
ATOM 669   C CB  . LYS A 1 82  ? -25.849 86.975  -8.280  1.00 14.09 ? 82  LYS A CB  1 
ATOM 670   C CG  . LYS A 1 82  ? -26.562 85.743  -8.818  1.00 13.62 ? 82  LYS A CG  1 
ATOM 671   C CD  . LYS A 1 82  ? -27.483 86.077  -9.981  1.00 15.16 ? 82  LYS A CD  1 
ATOM 672   C CE  . LYS A 1 82  ? -26.706 86.449  -11.244 1.00 17.13 ? 82  LYS A CE  1 
ATOM 673   N NZ  . LYS A 1 82  ? -27.605 86.803  -12.395 1.00 15.01 ? 82  LYS A NZ  1 
ATOM 674   N N   . HIS A 1 83  ? -24.504 88.387  -5.382  1.00 19.89 ? 83  HIS A N   1 
ATOM 675   C CA  . HIS A 1 83  ? -23.872 89.577  -4.821  1.00 20.35 ? 83  HIS A CA  1 
ATOM 676   C C   . HIS A 1 83  ? -23.314 89.219  -3.440  1.00 19.80 ? 83  HIS A C   1 
ATOM 677   O O   . HIS A 1 83  ? -23.028 90.090  -2.620  1.00 20.04 ? 83  HIS A O   1 
ATOM 678   C CB  . HIS A 1 83  ? -24.890 90.713  -4.691  1.00 25.30 ? 83  HIS A CB  1 
ATOM 679   C CG  . HIS A 1 83  ? -25.637 91.018  -5.953  1.00 27.68 ? 83  HIS A CG  1 
ATOM 680   N ND1 . HIS A 1 83  ? -25.110 91.789  -6.966  1.00 27.92 ? 83  HIS A ND1 1 
ATOM 681   C CD2 . HIS A 1 83  ? -26.891 90.688  -6.349  1.00 27.94 ? 83  HIS A CD2 1 
ATOM 682   C CE1 . HIS A 1 83  ? -26.004 91.920  -7.930  1.00 28.42 ? 83  HIS A CE1 1 
ATOM 683   N NE2 . HIS A 1 83  ? -27.093 91.262  -7.579  1.00 28.76 ? 83  HIS A NE2 1 
ATOM 684   N N   . ASN A 1 84  ? -23.185 87.919  -3.200  1.00 19.17 ? 84  ASN A N   1 
ATOM 685   C CA  . ASN A 1 84  ? -22.685 87.356  -1.946  1.00 18.71 ? 84  ASN A CA  1 
ATOM 686   C C   . ASN A 1 84  ? -23.135 87.979  -0.622  1.00 17.16 ? 84  ASN A C   1 
ATOM 687   O O   . ASN A 1 84  ? -22.328 88.183  0.284   1.00 18.67 ? 84  ASN A O   1 
ATOM 688   C CB  . ASN A 1 84  ? -21.162 87.202  -1.980  1.00 21.12 ? 84  ASN A CB  1 
ATOM 689   C CG  . ASN A 1 84  ? -20.728 85.751  -1.920  1.00 20.42 ? 84  ASN A CG  1 
ATOM 690   O OD1 . ASN A 1 84  ? -20.924 85.072  -0.912  1.00 16.33 ? 84  ASN A OD1 1 
ATOM 691   N ND2 . ASN A 1 84  ? -20.144 85.263  -3.006  1.00 20.59 ? 84  ASN A ND2 1 
ATOM 692   N N   . LEU A 1 85  ? -24.426 88.273  -0.512  1.00 15.99 ? 85  LEU A N   1 
ATOM 693   C CA  . LEU A 1 85  ? -24.982 88.812  0.721   1.00 11.52 ? 85  LEU A CA  1 
ATOM 694   C C   . LEU A 1 85  ? -25.660 87.662  1.432   1.00 12.08 ? 85  LEU A C   1 
ATOM 695   O O   . LEU A 1 85  ? -26.825 87.790  1.868   1.00 13.15 ? 85  LEU A O   1 
ATOM 696   C CB  . LEU A 1 85  ? -25.993 89.922  0.454   1.00 8.23  ? 85  LEU A CB  1 
ATOM 697   C CG  . LEU A 1 85  ? -25.458 91.275  -0.003  1.00 10.67 ? 85  LEU A CG  1 
ATOM 698   C CD1 . LEU A 1 85  ? -25.450 91.340  -1.510  1.00 6.83  ? 85  LEU A CD1 1 
ATOM 699   C CD2 . LEU A 1 85  ? -26.342 92.380  0.556   1.00 7.87  ? 85  LEU A CD2 1 
ATOM 700   N N   . CYS A 1 86  ? -24.994 86.525  1.512   1.00 9.94  ? 86  CYS A N   1 
ATOM 701   C CA  . CYS A 1 86  ? -25.544 85.342  2.160   1.00 11.80 ? 86  CYS A CA  1 
ATOM 702   C C   . CYS A 1 86  ? -24.641 84.948  3.317   1.00 10.95 ? 86  CYS A C   1 
ATOM 703   O O   . CYS A 1 86  ? -23.566 85.517  3.487   1.00 10.18 ? 86  CYS A O   1 
ATOM 704   C CB  . CYS A 1 86  ? -25.638 84.185  1.161   1.00 11.20 ? 86  CYS A CB  1 
ATOM 705   S SG  . CYS A 1 86  ? -26.769 84.458  -0.224  1.00 8.44  ? 86  CYS A SG  1 
ATOM 706   N N   . GLY A 1 87  ? -25.081 83.986  4.121   1.00 12.71 ? 87  GLY A N   1 
ATOM 707   C CA  . GLY A 1 87  ? -24.275 83.539  5.245   1.00 13.13 ? 87  GLY A CA  1 
ATOM 708   C C   . GLY A 1 87  ? -22.984 82.869  4.765   1.00 14.39 ? 87  GLY A C   1 
ATOM 709   O O   . GLY A 1 87  ? -23.052 81.836  4.105   1.00 14.04 ? 87  GLY A O   1 
ATOM 710   N N   . GLU A 1 88  ? -21.856 83.473  5.060   1.00 15.53 ? 88  GLU A N   1 
ATOM 711   C CA  . GLU A 1 88  ? -20.580 82.911  4.641   1.00 15.15 ? 88  GLU A CA  1 
ATOM 712   C C   . GLU A 1 88  ? -20.067 81.828  5.578   1.00 14.79 ? 88  GLU A C   1 
ATOM 713   O O   . GLU A 1 88  ? -19.703 80.742  5.134   1.00 14.53 ? 88  GLU A O   1 
ATOM 714   C CB  . GLU A 1 88  ? -19.528 84.008  4.485   1.00 12.69 ? 88  GLU A CB  1 
ATOM 715   C CG  . GLU A 1 88  ? -19.802 84.984  3.355   1.00 11.93 ? 88  GLU A CG  1 
ATOM 716   C CD  . GLU A 1 88  ? -18.526 85.579  2.798   1.00 13.45 ? 88  GLU A CD  1 
ATOM 717   O OE1 . GLU A 1 88  ? -17.642 85.943  3.603   1.00 11.41 ? 88  GLU A OE1 1 
ATOM 718   O OE2 . GLU A 1 88  ? -18.396 85.664  1.559   1.00 12.17 ? 88  GLU A OE2 1 
ATOM 719   N N   . THR A 1 89  ? -20.003 82.138  6.868   1.00 13.69 ? 89  THR A N   1 
ATOM 720   C CA  . THR A 1 89  ? -19.526 81.170  7.842   1.00 14.37 ? 89  THR A CA  1 
ATOM 721   C C   . THR A 1 89  ? -20.705 80.349  8.335   1.00 15.27 ? 89  THR A C   1 
ATOM 722   O O   . THR A 1 89  ? -21.811 80.872  8.471   1.00 14.01 ? 89  THR A O   1 
ATOM 723   C CB  . THR A 1 89  ? -18.804 81.854  9.032   1.00 15.12 ? 89  THR A CB  1 
ATOM 724   O OG1 . THR A 1 89  ? -19.668 82.825  9.637   1.00 7.29  ? 89  THR A OG1 1 
ATOM 725   C CG2 . THR A 1 89  ? -17.537 82.545  8.559   1.00 15.31 ? 89  THR A CG2 1 
ATOM 726   N N   . GLU A 1 90  ? -20.462 79.068  8.605   1.00 15.55 ? 90  GLU A N   1 
ATOM 727   C CA  . GLU A 1 90  ? -21.500 78.151  9.071   1.00 14.28 ? 90  GLU A CA  1 
ATOM 728   C C   . GLU A 1 90  ? -22.370 78.712  10.181  1.00 14.37 ? 90  GLU A C   1 
ATOM 729   O O   . GLU A 1 90  ? -23.554 78.403  10.248  1.00 15.35 ? 90  GLU A O   1 
ATOM 730   C CB  . GLU A 1 90  ? -20.897 76.818  9.516   1.00 18.70 ? 90  GLU A CB  1 
ATOM 731   C CG  . GLU A 1 90  ? -21.922 75.780  9.979   1.00 19.12 ? 90  GLU A CG  1 
ATOM 732   C CD  . GLU A 1 90  ? -22.941 75.431  8.913   1.00 14.62 ? 90  GLU A CD  1 
ATOM 733   O OE1 . GLU A 1 90  ? -22.564 75.318  7.724   1.00 13.44 ? 90  GLU A OE1 1 
ATOM 734   O OE2 . GLU A 1 90  ? -24.122 75.265  9.275   1.00 10.13 ? 90  GLU A OE2 1 
ATOM 735   N N   . GLU A 1 91  ? -21.788 79.510  11.067  1.00 15.71 ? 91  GLU A N   1 
ATOM 736   C CA  . GLU A 1 91  ? -22.570 80.098  12.148  1.00 16.37 ? 91  GLU A CA  1 
ATOM 737   C C   . GLU A 1 91  ? -23.503 81.152  11.564  1.00 15.30 ? 91  GLU A C   1 
ATOM 738   O O   . GLU A 1 91  ? -24.636 81.323  12.021  1.00 14.60 ? 91  GLU A O   1 
ATOM 739   C CB  . GLU A 1 91  ? -21.662 80.703  13.225  1.00 18.91 ? 91  GLU A CB  1 
ATOM 740   C CG  . GLU A 1 91  ? -20.791 81.867  12.772  1.00 22.26 ? 91  GLU A CG  1 
ATOM 741   C CD  . GLU A 1 91  ? -20.067 82.521  13.932  1.00 24.52 ? 91  GLU A CD  1 
ATOM 742   O OE1 . GLU A 1 91  ? -20.753 83.040  14.840  1.00 24.11 ? 91  GLU A OE1 1 
ATOM 743   O OE2 . GLU A 1 91  ? -18.815 82.506  13.944  1.00 25.45 ? 91  GLU A OE2 1 
ATOM 744   N N   . GLU A 1 92  ? -23.018 81.843  10.536  1.00 15.97 ? 92  GLU A N   1 
ATOM 745   C CA  . GLU A 1 92  ? -23.803 82.864  9.868   1.00 15.63 ? 92  GLU A CA  1 
ATOM 746   C C   . GLU A 1 92  ? -24.926 82.186  9.093   1.00 16.26 ? 92  GLU A C   1 
ATOM 747   O O   . GLU A 1 92  ? -26.063 82.662  9.099   1.00 17.31 ? 92  GLU A O   1 
ATOM 748   C CB  . GLU A 1 92  ? -22.923 83.711  8.944   1.00 19.22 ? 92  GLU A CB  1 
ATOM 749   C CG  . GLU A 1 92  ? -21.957 84.618  9.706   1.00 22.46 ? 92  GLU A CG  1 
ATOM 750   C CD  . GLU A 1 92  ? -21.113 85.506  8.805   1.00 22.86 ? 92  GLU A CD  1 
ATOM 751   O OE1 . GLU A 1 92  ? -20.479 84.985  7.859   1.00 23.50 ? 92  GLU A OE1 1 
ATOM 752   O OE2 . GLU A 1 92  ? -21.072 86.730  9.058   1.00 19.85 ? 92  GLU A OE2 1 
ATOM 753   N N   . LYS A 1 93  ? -24.624 81.043  8.478   1.00 14.80 ? 93  LYS A N   1 
ATOM 754   C CA  . LYS A 1 93  ? -25.618 80.293  7.712   1.00 10.09 ? 93  LYS A CA  1 
ATOM 755   C C   . LYS A 1 93  ? -26.815 79.938  8.584   1.00 11.08 ? 93  LYS A C   1 
ATOM 756   O O   . LYS A 1 93  ? -27.954 80.049  8.148   1.00 13.65 ? 93  LYS A O   1 
ATOM 757   C CB  . LYS A 1 93  ? -25.021 79.012  7.129   1.00 8.03  ? 93  LYS A CB  1 
ATOM 758   C CG  . LYS A 1 93  ? -23.999 79.261  6.039   1.00 3.53  ? 93  LYS A CG  1 
ATOM 759   C CD  . LYS A 1 93  ? -23.581 77.970  5.348   1.00 2.00  ? 93  LYS A CD  1 
ATOM 760   C CE  . LYS A 1 93  ? -22.472 78.228  4.337   1.00 6.83  ? 93  LYS A CE  1 
ATOM 761   N NZ  . LYS A 1 93  ? -22.228 77.083  3.416   1.00 4.00  ? 93  LYS A NZ  1 
ATOM 762   N N   . ILE A 1 94  ? -26.575 79.579  9.812   1.00 12.52 ? 94  ILE A N   1 
ATOM 763   C CA  . ILE A 1 94  ? -27.636 79.254  10.746  1.00 14.65 ? 94  ILE A CA  1 
ATOM 764   C C   . ILE A 1 94  ? -28.439 80.515  11.075  1.00 14.26 ? 94  ILE A C   1 
ATOM 765   O O   . ILE A 1 94  ? -29.667 80.478  11.125  1.00 12.97 ? 94  ILE A O   1 
ATOM 766   C CB  . ILE A 1 94  ? -27.090 78.584  12.032  1.00 11.57 ? 94  ILE A CB  1 
ATOM 767   C CG1 . ILE A 1 94  ? -26.478 77.218  11.691  1.00 8.36  ? 94  ILE A CG1 1 
ATOM 768   C CG2 . ILE A 1 94  ? -28.190 78.431  13.062  1.00 10.31 ? 94  ILE A CG2 1 
ATOM 769   C CD1 . ILE A 1 94  ? -25.792 76.544  12.856  1.00 13.49 ? 94  ILE A CD1 1 
ATOM 770   N N   . ARG A 1 95  ? -27.753 81.638  11.260  1.00 15.28 ? 95  ARG A N   1 
ATOM 771   C CA  . ARG A 1 95  ? -28.440 82.889  11.564  1.00 17.71 ? 95  ARG A CA  1 
ATOM 772   C C   . ARG A 1 95  ? -29.323 83.300  10.402  1.00 16.69 ? 95  ARG A C   1 
ATOM 773   O O   . ARG A 1 95  ? -30.452 83.755  10.592  1.00 19.31 ? 95  ARG A O   1 
ATOM 774   C CB  . ARG A 1 95  ? -27.444 84.010  11.878  1.00 18.28 ? 95  ARG A CB  1 
ATOM 775   C CG  . ARG A 1 95  ? -26.855 83.911  13.269  1.00 14.19 ? 95  ARG A CG  1 
ATOM 776   C CD  . ARG A 1 95  ? -26.179 85.195  13.717  1.00 13.59 ? 95  ARG A CD  1 
ATOM 777   N NE  . ARG A 1 95  ? -26.134 85.225  15.175  1.00 14.70 ? 95  ARG A NE  1 
ATOM 778   C CZ  . ARG A 1 95  ? -26.995 85.893  15.935  1.00 12.52 ? 95  ARG A CZ  1 
ATOM 779   N NH1 . ARG A 1 95  ? -27.957 86.614  15.375  1.00 13.54 ? 95  ARG A NH1 1 
ATOM 780   N NH2 . ARG A 1 95  ? -26.950 85.768  17.257  1.00 12.20 ? 95  ARG A NH2 1 
ATOM 781   N N   . VAL A 1 96  ? -28.806 83.104  9.196   1.00 16.13 ? 96  VAL A N   1 
ATOM 782   C CA  . VAL A 1 96  ? -29.522 83.444  7.974   1.00 15.63 ? 96  VAL A CA  1 
ATOM 783   C C   . VAL A 1 96  ? -30.769 82.573  7.789   1.00 11.67 ? 96  VAL A C   1 
ATOM 784   O O   . VAL A 1 96  ? -31.832 83.078  7.434   1.00 8.14  ? 96  VAL A O   1 
ATOM 785   C CB  . VAL A 1 96  ? -28.596 83.324  6.748   1.00 17.06 ? 96  VAL A CB  1 
ATOM 786   C CG1 . VAL A 1 96  ? -29.367 83.595  5.479   1.00 15.43 ? 96  VAL A CG1 1 
ATOM 787   C CG2 . VAL A 1 96  ? -27.433 84.299  6.877   1.00 12.99 ? 96  VAL A CG2 1 
ATOM 788   N N   . ASP A 1 97  ? -30.640 81.275  8.048   1.00 11.42 ? 97  ASP A N   1 
ATOM 789   C CA  . ASP A 1 97  ? -31.760 80.343  7.918   1.00 12.62 ? 97  ASP A CA  1 
ATOM 790   C C   . ASP A 1 97  ? -32.862 80.687  8.908   1.00 13.86 ? 97  ASP A C   1 
ATOM 791   O O   . ASP A 1 97  ? -34.040 80.750  8.548   1.00 17.65 ? 97  ASP A O   1 
ATOM 792   C CB  . ASP A 1 97  ? -31.308 78.895  8.170   1.00 10.13 ? 97  ASP A CB  1 
ATOM 793   C CG  . ASP A 1 97  ? -30.605 78.270  6.976   1.00 12.83 ? 97  ASP A CG  1 
ATOM 794   O OD1 . ASP A 1 97  ? -30.422 78.946  5.939   1.00 8.72  ? 97  ASP A OD1 1 
ATOM 795   O OD2 . ASP A 1 97  ? -30.240 77.082  7.080   1.00 14.80 ? 97  ASP A OD2 1 
ATOM 796   N N   . ILE A 1 98  ? -32.467 80.913  10.154  1.00 14.12 ? 98  ILE A N   1 
ATOM 797   C CA  . ILE A 1 98  ? -33.404 81.231  11.220  1.00 10.96 ? 98  ILE A CA  1 
ATOM 798   C C   . ILE A 1 98  ? -34.145 82.548  11.001  1.00 10.55 ? 98  ILE A C   1 
ATOM 799   O O   . ILE A 1 98  ? -35.375 82.589  11.061  1.00 8.80  ? 98  ILE A O   1 
ATOM 800   C CB  . ILE A 1 98  ? -32.688 81.255  12.589  1.00 9.18  ? 98  ILE A CB  1 
ATOM 801   C CG1 . ILE A 1 98  ? -32.089 79.881  12.884  1.00 8.21  ? 98  ILE A CG1 1 
ATOM 802   C CG2 . ILE A 1 98  ? -33.659 81.632  13.696  1.00 3.99  ? 98  ILE A CG2 1 
ATOM 803   C CD1 . ILE A 1 98  ? -33.111 78.764  12.979  1.00 7.68  ? 98  ILE A CD1 1 
ATOM 804   N N   . LEU A 1 99  ? -33.400 83.614  10.725  1.00 11.92 ? 99  LEU A N   1 
ATOM 805   C CA  . LEU A 1 99  ? -33.989 84.931  10.515  1.00 15.61 ? 99  LEU A CA  1 
ATOM 806   C C   . LEU A 1 99  ? -34.936 84.983  9.314   1.00 17.29 ? 99  LEU A C   1 
ATOM 807   O O   . LEU A 1 99  ? -36.083 85.401  9.449   1.00 17.24 ? 99  LEU A O   1 
ATOM 808   C CB  . LEU A 1 99  ? -32.888 85.988  10.393  1.00 13.73 ? 99  LEU A CB  1 
ATOM 809   C CG  . LEU A 1 99  ? -33.235 87.382  10.940  1.00 13.96 ? 99  LEU A CG  1 
ATOM 810   C CD1 . LEU A 1 99  ? -33.969 88.237  9.919   1.00 11.21 ? 99  LEU A CD1 1 
ATOM 811   C CD2 . LEU A 1 99  ? -34.055 87.250  12.219  1.00 15.00 ? 99  LEU A CD2 1 
ATOM 812   N N   . GLU A 1 100 ? -34.457 84.551  8.151   1.00 19.29 ? 100 GLU A N   1 
ATOM 813   C CA  . GLU A 1 100 ? -35.254 84.527  6.922   1.00 21.05 ? 100 GLU A CA  1 
ATOM 814   C C   . GLU A 1 100 ? -36.648 83.931  7.175   1.00 20.20 ? 100 GLU A C   1 
ATOM 815   O O   . GLU A 1 100 ? -37.668 84.602  6.998   1.00 20.59 ? 100 GLU A O   1 
ATOM 816   C CB  . GLU A 1 100 ? -34.524 83.693  5.858   1.00 22.38 ? 100 GLU A CB  1 
ATOM 817   C CG  . GLU A 1 100 ? -35.294 83.454  4.559   1.00 25.22 ? 100 GLU A CG  1 
ATOM 818   C CD  . GLU A 1 100 ? -34.708 82.314  3.734   1.00 27.34 ? 100 GLU A CD  1 
ATOM 819   O OE1 . GLU A 1 100 ? -34.942 81.137  4.092   1.00 29.92 ? 100 GLU A OE1 1 
ATOM 820   O OE2 . GLU A 1 100 ? -34.015 82.593  2.732   1.00 26.63 ? 100 GLU A OE2 1 
ATOM 821   N N   . ASN A 1 101 ? -36.666 82.679  7.631   1.00 18.63 ? 101 ASN A N   1 
ATOM 822   C CA  . ASN A 1 101 ? -37.897 81.945  7.919   1.00 18.67 ? 101 ASN A CA  1 
ATOM 823   C C   . ASN A 1 101 ? -38.729 82.568  9.019   1.00 18.63 ? 101 ASN A C   1 
ATOM 824   O O   . ASN A 1 101 ? -39.933 82.762  8.868   1.00 24.53 ? 101 ASN A O   1 
ATOM 825   C CB  . ASN A 1 101 ? -37.568 80.508  8.304   1.00 10.59 ? 101 ASN A CB  1 
ATOM 826   C CG  . ASN A 1 101 ? -37.158 79.675  7.122   1.00 10.15 ? 101 ASN A CG  1 
ATOM 827   O OD1 . ASN A 1 101 ? -37.797 78.670  6.816   1.00 15.38 ? 101 ASN A OD1 1 
ATOM 828   N ND2 . ASN A 1 101 ? -36.083 80.074  6.450   1.00 8.96  ? 101 ASN A ND2 1 
ATOM 829   N N   . GLN A 1 102 ? -38.081 82.954  10.115  1.00 18.50 ? 102 GLN A N   1 
ATOM 830   C CA  . GLN A 1 102 ? -38.769 83.573  11.238  1.00 15.91 ? 102 GLN A CA  1 
ATOM 831   C C   . GLN A 1 102 ? -39.449 84.871  10.803  1.00 16.71 ? 102 GLN A C   1 
ATOM 832   O O   . GLN A 1 102 ? -40.610 85.117  11.136  1.00 17.56 ? 102 GLN A O   1 
ATOM 833   C CB  . GLN A 1 102 ? -37.782 83.841  12.374  1.00 9.73  ? 102 GLN A CB  1 
ATOM 834   C CG  . GLN A 1 102 ? -38.452 84.038  13.722  1.00 6.92  ? 102 GLN A CG  1 
ATOM 835   C CD  . GLN A 1 102 ? -39.295 82.842  14.146  1.00 4.76  ? 102 GLN A CD  1 
ATOM 836   O OE1 . GLN A 1 102 ? -38.928 81.682  13.925  1.00 12.82 ? 102 GLN A OE1 1 
ATOM 837   N NE2 . GLN A 1 102 ? -40.429 83.123  14.772  1.00 2.00  ? 102 GLN A NE2 1 
ATOM 838   N N   . ALA A 1 103 ? -38.736 85.679  10.026  1.00 17.72 ? 103 ALA A N   1 
ATOM 839   C CA  . ALA A 1 103 ? -39.274 86.941  9.533   1.00 15.87 ? 103 ALA A CA  1 
ATOM 840   C C   . ALA A 1 103 ? -40.430 86.641  8.592   1.00 15.98 ? 103 ALA A C   1 
ATOM 841   O O   . ALA A 1 103 ? -41.392 87.400  8.520   1.00 14.39 ? 103 ALA A O   1 
ATOM 842   C CB  . ALA A 1 103 ? -38.198 87.736  8.815   1.00 11.15 ? 103 ALA A CB  1 
ATOM 843   N N   . MET A 1 104 ? -40.331 85.522  7.880   1.00 16.09 ? 104 MET A N   1 
ATOM 844   C CA  . MET A 1 104 ? -41.379 85.104  6.959   1.00 16.82 ? 104 MET A CA  1 
ATOM 845   C C   . MET A 1 104 ? -42.576 84.560  7.744   1.00 16.35 ? 104 MET A C   1 
ATOM 846   O O   . MET A 1 104 ? -43.729 84.703  7.330   1.00 18.15 ? 104 MET A O   1 
ATOM 847   C CB  . MET A 1 104 ? -40.830 84.043  5.999   1.00 20.05 ? 104 MET A CB  1 
ATOM 848   C CG  . MET A 1 104 ? -41.724 83.730  4.807   1.00 23.79 ? 104 MET A CG  1 
ATOM 849   S SD  . MET A 1 104 ? -42.077 85.188  3.808   1.00 24.13 ? 104 MET A SD  1 
ATOM 850   C CE  . MET A 1 104 ? -40.507 85.466  3.029   1.00 27.08 ? 104 MET A CE  1 
ATOM 851   N N   . ASP A 1 105 ? -42.310 83.973  8.902   1.00 10.86 ? 105 ASP A N   1 
ATOM 852   C CA  . ASP A 1 105 ? -43.328 83.411  9.763   1.00 8.32  ? 105 ASP A CA  1 
ATOM 853   C C   . ASP A 1 105 ? -44.204 84.517  10.336  1.00 12.24 ? 105 ASP A C   1 
ATOM 854   O O   . ASP A 1 105 ? -45.430 84.454  10.248  1.00 14.74 ? 105 ASP A O   1 
ATOM 855   C CB  . ASP A 1 105 ? -42.680 82.627  10.904  1.00 9.06  ? 105 ASP A CB  1 
ATOM 856   C CG  . ASP A 1 105 ? -43.695 82.034  11.872  1.00 9.24  ? 105 ASP A CG  1 
ATOM 857   O OD1 . ASP A 1 105 ? -44.338 82.804  12.623  1.00 2.00  ? 105 ASP A OD1 1 
ATOM 858   O OD2 . ASP A 1 105 ? -43.825 80.788  11.902  1.00 12.20 ? 105 ASP A OD2 1 
ATOM 859   N N   . VAL A 1 106 ? -43.568 85.515  10.946  1.00 15.71 ? 106 VAL A N   1 
ATOM 860   C CA  . VAL A 1 106 ? -44.281 86.638  11.551  1.00 13.36 ? 106 VAL A CA  1 
ATOM 861   C C   . VAL A 1 106 ? -45.020 87.499  10.527  1.00 15.20 ? 106 VAL A C   1 
ATOM 862   O O   . VAL A 1 106 ? -46.125 87.973  10.802  1.00 17.25 ? 106 VAL A O   1 
ATOM 863   C CB  . VAL A 1 106 ? -43.343 87.515  12.426  1.00 14.41 ? 106 VAL A CB  1 
ATOM 864   C CG1 . VAL A 1 106 ? -42.132 87.972  11.639  1.00 13.00 ? 106 VAL A CG1 1 
ATOM 865   C CG2 . VAL A 1 106 ? -44.105 88.709  12.976  1.00 11.58 ? 106 VAL A CG2 1 
ATOM 866   N N   . SER A 1 107 ? -44.440 87.660  9.339   1.00 14.11 ? 107 SER A N   1 
ATOM 867   C CA  . SER A 1 107 ? -45.060 88.460  8.286   1.00 18.07 ? 107 SER A CA  1 
ATOM 868   C C   . SER A 1 107 ? -46.388 87.845  7.882   1.00 17.80 ? 107 SER A C   1 
ATOM 869   O O   . SER A 1 107 ? -47.396 88.546  7.766   1.00 19.22 ? 107 SER A O   1 
ATOM 870   C CB  . SER A 1 107 ? -44.142 88.563  7.066   1.00 21.15 ? 107 SER A CB  1 
ATOM 871   O OG  . SER A 1 107 ? -43.986 87.308  6.426   1.00 24.75 ? 107 SER A OG  1 
ATOM 872   N N   . ASN A 1 108 ? -46.390 86.534  7.660   1.00 15.99 ? 108 ASN A N   1 
ATOM 873   C CA  . ASN A 1 108 ? -47.620 85.841  7.289   1.00 19.62 ? 108 ASN A CA  1 
ATOM 874   C C   . ASN A 1 108 ? -48.567 85.786  8.470   1.00 21.93 ? 108 ASN A C   1 
ATOM 875   O O   . ASN A 1 108 ? -49.780 85.759  8.288   1.00 23.56 ? 108 ASN A O   1 
ATOM 876   C CB  . ASN A 1 108 ? -47.349 84.471  6.707   1.00 14.92 ? 108 ASN A CB  1 
ATOM 877   C CG  . ASN A 1 108 ? -47.302 84.489  5.188   1.00 13.75 ? 108 ASN A CG  1 
ATOM 878   O OD1 . ASN A 1 108 ? -48.116 83.850  4.524   1.00 4.61  ? 108 ASN A OD1 1 
ATOM 879   N ND2 . ASN A 1 108 ? -46.366 85.247  4.630   1.00 13.78 ? 108 ASN A ND2 1 
ATOM 880   N N   . GLN A 1 109 ? -48.016 85.813  9.680   1.00 22.04 ? 109 GLN A N   1 
ATOM 881   C CA  . GLN A 1 109 ? -48.838 85.791  10.882  1.00 21.97 ? 109 GLN A CA  1 
ATOM 882   C C   . GLN A 1 109 ? -49.641 87.078  10.981  1.00 21.40 ? 109 GLN A C   1 
ATOM 883   O O   . GLN A 1 109 ? -50.797 87.070  11.399  1.00 20.68 ? 109 GLN A O   1 
ATOM 884   C CB  . GLN A 1 109 ? -47.992 85.588  12.132  1.00 23.27 ? 109 GLN A CB  1 
ATOM 885   C CG  . GLN A 1 109 ? -47.590 84.146  12.357  1.00 23.93 ? 109 GLN A CG  1 
ATOM 886   C CD  . GLN A 1 109 ? -47.184 83.884  13.782  1.00 26.68 ? 109 GLN A CD  1 
ATOM 887   O OE1 . GLN A 1 109 ? -46.418 84.647  14.374  1.00 26.37 ? 109 GLN A OE1 1 
ATOM 888   N NE2 . GLN A 1 109 ? -47.705 82.806  14.351  1.00 30.34 ? 109 GLN A NE2 1 
ATOM 889   N N   . LEU A 1 110 ? -49.023 88.192  10.610  1.00 22.11 ? 110 LEU A N   1 
ATOM 890   C CA  . LEU A 1 110 ? -49.729 89.466  10.613  1.00 20.20 ? 110 LEU A CA  1 
ATOM 891   C C   . LEU A 1 110 ? -50.685 89.395  9.423   1.00 21.69 ? 110 LEU A C   1 
ATOM 892   O O   . LEU A 1 110 ? -51.810 89.891  9.486   1.00 22.50 ? 110 LEU A O   1 
ATOM 893   C CB  . LEU A 1 110 ? -48.750 90.637  10.452  1.00 17.59 ? 110 LEU A CB  1 
ATOM 894   C CG  . LEU A 1 110 ? -49.332 92.054  10.470  1.00 17.86 ? 110 LEU A CG  1 
ATOM 895   C CD1 . LEU A 1 110 ? -50.105 92.294  11.753  1.00 20.23 ? 110 LEU A CD1 1 
ATOM 896   C CD2 . LEU A 1 110 ? -48.211 93.072  10.319  1.00 19.26 ? 110 LEU A CD2 1 
ATOM 897   N N   . ALA A 1 111 ? -50.236 88.720  8.363   1.00 20.99 ? 111 ALA A N   1 
ATOM 898   C CA  . ALA A 1 111 ? -51.023 88.540  7.147   1.00 21.07 ? 111 ALA A CA  1 
ATOM 899   C C   . ALA A 1 111 ? -52.251 87.660  7.402   1.00 19.59 ? 111 ALA A C   1 
ATOM 900   O O   . ALA A 1 111 ? -53.244 87.759  6.682   1.00 18.33 ? 111 ALA A O   1 
ATOM 901   C CB  . ALA A 1 111 ? -50.172 87.926  6.049   1.00 16.97 ? 111 ALA A CB  1 
ATOM 902   N N   . ARG A 1 112 ? -52.174 86.834  8.423   1.00 19.65 ? 112 ARG A N   1 
ATOM 903   C CA  . ARG A 1 112 ? -53.287 85.975  8.775   1.00 20.30 ? 112 ARG A CA  1 
ATOM 904   C C   . ARG A 1 112 ? -54.348 86.897  9.356   1.00 21.93 ? 112 ARG A C   1 
ATOM 905   O O   . ARG A 1 112 ? -55.515 86.857  8.963   1.00 22.80 ? 112 ARG A O   1 
ATOM 906   C CB  . ARG A 1 112 ? -52.853 84.955  9.836   1.00 18.31 ? 112 ARG A CB  1 
ATOM 907   C CG  . ARG A 1 112 ? -53.398 83.546  9.640   1.00 26.53 ? 112 ARG A CG  1 
ATOM 908   C CD  . ARG A 1 112 ? -52.630 82.791  8.561   1.00 31.64 ? 112 ARG A CD  1 
ATOM 909   N NE  . ARG A 1 112 ? -51.277 82.423  8.981   1.00 35.14 ? 112 ARG A NE  1 
ATOM 910   C CZ  . ARG A 1 112 ? -50.209 82.455  8.186   1.00 38.49 ? 112 ARG A CZ  1 
ATOM 911   N NH1 . ARG A 1 112 ? -50.326 82.846  6.926   1.00 38.26 ? 112 ARG A NH1 1 
ATOM 912   N NH2 . ARG A 1 112 ? -49.024 82.076  8.644   1.00 40.00 ? 112 ARG A NH2 1 
ATOM 913   N N   . VAL A 1 113 ? -53.900 87.777  10.248  1.00 21.56 ? 113 VAL A N   1 
ATOM 914   C CA  . VAL A 1 113 ? -54.758 88.741  10.932  1.00 20.40 ? 113 VAL A CA  1 
ATOM 915   C C   . VAL A 1 113 ? -55.469 89.699  9.971   1.00 22.79 ? 113 VAL A C   1 
ATOM 916   O O   . VAL A 1 113 ? -56.696 89.744  9.935   1.00 21.67 ? 113 VAL A O   1 
ATOM 917   C CB  . VAL A 1 113 ? -53.952 89.563  11.969  1.00 18.78 ? 113 VAL A CB  1 
ATOM 918   C CG1 . VAL A 1 113 ? -54.880 90.459  12.774  1.00 24.25 ? 113 VAL A CG1 1 
ATOM 919   C CG2 . VAL A 1 113 ? -53.169 88.637  12.886  1.00 17.27 ? 113 VAL A CG2 1 
ATOM 920   N N   . CYS A 1 114 ? -54.703 90.447  9.183   1.00 23.88 ? 114 CYS A N   1 
ATOM 921   C CA  . CYS A 1 114 ? -55.284 91.395  8.233   1.00 23.37 ? 114 CYS A CA  1 
ATOM 922   C C   . CYS A 1 114 ? -56.092 90.758  7.098   1.00 23.43 ? 114 CYS A C   1 
ATOM 923   O O   . CYS A 1 114 ? -56.734 91.460  6.313   1.00 23.45 ? 114 CYS A O   1 
ATOM 924   C CB  . CYS A 1 114 ? -54.207 92.321  7.671   1.00 24.54 ? 114 CYS A CB  1 
ATOM 925   S SG  . CYS A 1 114 ? -53.878 93.740  8.743   1.00 29.49 ? 114 CYS A SG  1 
ATOM 926   N N   . TYR A 1 115 ? -56.058 89.433  7.011   1.00 23.23 ? 115 TYR A N   1 
ATOM 927   C CA  . TYR A 1 115 ? -56.805 88.717  5.983   1.00 26.56 ? 115 TYR A CA  1 
ATOM 928   C C   . TYR A 1 115 ? -57.972 87.917  6.564   1.00 27.54 ? 115 TYR A C   1 
ATOM 929   O O   . TYR A 1 115 ? -58.709 87.264  5.823   1.00 27.62 ? 115 TYR A O   1 
ATOM 930   C CB  . TYR A 1 115 ? -55.877 87.803  5.171   1.00 28.34 ? 115 TYR A CB  1 
ATOM 931   C CG  . TYR A 1 115 ? -55.050 88.517  4.112   1.00 28.68 ? 115 TYR A CG  1 
ATOM 932   C CD1 . TYR A 1 115 ? -55.485 89.710  3.535   1.00 28.59 ? 115 TYR A CD1 1 
ATOM 933   C CD2 . TYR A 1 115 ? -53.839 87.983  3.675   1.00 30.72 ? 115 TYR A CD2 1 
ATOM 934   C CE1 . TYR A 1 115 ? -54.735 90.352  2.550   1.00 31.30 ? 115 TYR A CE1 1 
ATOM 935   C CE2 . TYR A 1 115 ? -53.082 88.619  2.688   1.00 33.09 ? 115 TYR A CE2 1 
ATOM 936   C CZ  . TYR A 1 115 ? -53.536 89.805  2.131   1.00 33.82 ? 115 TYR A CZ  1 
ATOM 937   O OH  . TYR A 1 115 ? -52.792 90.446  1.161   1.00 35.39 ? 115 TYR A OH  1 
ATOM 938   N N   . SER A 1 116 ? -58.130 87.951  7.884   1.00 24.76 ? 116 SER A N   1 
ATOM 939   C CA  . SER A 1 116 ? -59.233 87.246  8.526   1.00 23.94 ? 116 SER A CA  1 
ATOM 940   C C   . SER A 1 116 ? -60.385 88.228  8.735   1.00 22.53 ? 116 SER A C   1 
ATOM 941   O O   . SER A 1 116 ? -60.162 89.392  9.052   1.00 19.63 ? 116 SER A O   1 
ATOM 942   C CB  . SER A 1 116 ? -58.785 86.606  9.848   1.00 22.71 ? 116 SER A CB  1 
ATOM 943   O OG  . SER A 1 116 ? -58.078 87.512  10.670  1.00 23.19 ? 116 SER A OG  1 
ATOM 944   N N   . PRO A 1 117 ? -61.633 87.771  8.541   1.00 23.53 ? 117 PRO A N   1 
ATOM 945   C CA  . PRO A 1 117 ? -62.851 88.581  8.689   1.00 25.85 ? 117 PRO A CA  1 
ATOM 946   C C   . PRO A 1 117 ? -62.940 89.475  9.930   1.00 26.82 ? 117 PRO A C   1 
ATOM 947   O O   . PRO A 1 117 ? -63.122 90.691  9.814   1.00 24.66 ? 117 PRO A O   1 
ATOM 948   C CB  . PRO A 1 117 ? -63.957 87.527  8.678   1.00 24.21 ? 117 PRO A CB  1 
ATOM 949   C CG  . PRO A 1 117 ? -63.413 86.504  7.744   1.00 24.71 ? 117 PRO A CG  1 
ATOM 950   C CD  . PRO A 1 117 ? -61.976 86.380  8.193   1.00 24.04 ? 117 PRO A CD  1 
ATOM 951   N N   . ASP A 1 118 ? -62.825 88.877  11.112  1.00 28.02 ? 118 ASP A N   1 
ATOM 952   C CA  . ASP A 1 118 ? -62.911 89.638  12.352  1.00 31.26 ? 118 ASP A CA  1 
ATOM 953   C C   . ASP A 1 118 ? -61.589 90.271  12.772  1.00 30.73 ? 118 ASP A C   1 
ATOM 954   O O   . ASP A 1 118 ? -60.959 89.841  13.744  1.00 32.37 ? 118 ASP A O   1 
ATOM 955   C CB  . ASP A 1 118 ? -63.473 88.763  13.475  1.00 35.81 ? 118 ASP A CB  1 
ATOM 956   C CG  . ASP A 1 118 ? -64.923 88.377  13.245  1.00 40.58 ? 118 ASP A CG  1 
ATOM 957   O OD1 . ASP A 1 118 ? -65.518 88.822  12.240  1.00 40.61 ? 118 ASP A OD1 1 
ATOM 958   O OD2 . ASP A 1 118 ? -65.471 87.624  14.077  1.00 41.80 ? 118 ASP A OD2 1 
ATOM 959   N N   . PHE A 1 119 ? -61.197 91.324  12.061  1.00 27.76 ? 119 PHE A N   1 
ATOM 960   C CA  . PHE A 1 119 ? -59.954 92.020  12.360  1.00 26.74 ? 119 PHE A CA  1 
ATOM 961   C C   . PHE A 1 119 ? -59.925 92.556  13.790  1.00 26.59 ? 119 PHE A C   1 
ATOM 962   O O   . PHE A 1 119 ? -59.109 92.118  14.597  1.00 26.96 ? 119 PHE A O   1 
ATOM 963   C CB  . PHE A 1 119 ? -59.713 93.160  11.371  1.00 26.36 ? 119 PHE A CB  1 
ATOM 964   C CG  . PHE A 1 119 ? -58.431 93.905  11.619  1.00 25.81 ? 119 PHE A CG  1 
ATOM 965   C CD1 . PHE A 1 119 ? -57.201 93.334  11.301  1.00 27.14 ? 119 PHE A CD1 1 
ATOM 966   C CD2 . PHE A 1 119 ? -58.450 95.166  12.202  1.00 25.63 ? 119 PHE A CD2 1 
ATOM 967   C CE1 . PHE A 1 119 ? -56.015 94.003  11.564  1.00 24.13 ? 119 PHE A CE1 1 
ATOM 968   C CE2 . PHE A 1 119 ? -57.268 95.844  12.469  1.00 24.42 ? 119 PHE A CE2 1 
ATOM 969   C CZ  . PHE A 1 119 ? -56.048 95.259  12.149  1.00 21.87 ? 119 PHE A CZ  1 
ATOM 970   N N   . GLU A 1 120 ? -60.839 93.468  14.115  1.00 26.08 ? 120 GLU A N   1 
ATOM 971   C CA  . GLU A 1 120 ? -60.891 94.058  15.456  1.00 25.97 ? 120 GLU A CA  1 
ATOM 972   C C   . GLU A 1 120 ? -61.102 93.074  16.606  1.00 25.36 ? 120 GLU A C   1 
ATOM 973   O O   . GLU A 1 120 ? -61.096 93.472  17.767  1.00 25.97 ? 120 GLU A O   1 
ATOM 974   C CB  . GLU A 1 120 ? -61.937 95.175  15.538  1.00 23.28 ? 120 GLU A CB  1 
ATOM 975   C CG  . GLU A 1 120 ? -61.458 96.537  15.043  1.00 23.38 ? 120 GLU A CG  1 
ATOM 976   C CD  . GLU A 1 120 ? -61.817 96.814  13.589  1.00 25.70 ? 120 GLU A CD  1 
ATOM 977   O OE1 . GLU A 1 120 ? -63.026 96.795  13.264  1.00 25.41 ? 120 GLU A OE1 1 
ATOM 978   O OE2 . GLU A 1 120 ? -60.896 97.072  12.778  1.00 24.71 ? 120 GLU A OE2 1 
ATOM 979   N N   . LYS A 1 121 ? -61.310 91.803  16.288  1.00 26.02 ? 121 LYS A N   1 
ATOM 980   C CA  . LYS A 1 121 ? -61.494 90.793  17.322  1.00 29.03 ? 121 LYS A CA  1 
ATOM 981   C C   . LYS A 1 121 ? -60.192 90.044  17.541  1.00 28.95 ? 121 LYS A C   1 
ATOM 982   O O   . LYS A 1 121 ? -59.827 89.713  18.668  1.00 31.37 ? 121 LYS A O   1 
ATOM 983   C CB  . LYS A 1 121 ? -62.589 89.804  16.930  1.00 30.83 ? 121 LYS A CB  1 
ATOM 984   C CG  . LYS A 1 121 ? -63.999 90.255  17.246  1.00 27.79 ? 121 LYS A CG  1 
ATOM 985   C CD  . LYS A 1 121 ? -64.991 89.191  16.819  1.00 27.57 ? 121 LYS A CD  1 
ATOM 986   C CE  . LYS A 1 121 ? -66.422 89.552  17.178  1.00 29.92 ? 121 LYS A CE  1 
ATOM 987   N NZ  . LYS A 1 121 ? -67.373 88.553  16.624  1.00 30.44 ? 121 LYS A NZ  1 
ATOM 988   N N   . LEU A 1 122 ? -59.493 89.782  16.446  1.00 29.15 ? 122 LEU A N   1 
ATOM 989   C CA  . LEU A 1 122 ? -58.234 89.064  16.499  1.00 29.25 ? 122 LEU A CA  1 
ATOM 990   C C   . LEU A 1 122 ? -57.056 89.987  16.791  1.00 26.73 ? 122 LEU A C   1 
ATOM 991   O O   . LEU A 1 122 ? -56.051 89.566  17.366  1.00 27.64 ? 122 LEU A O   1 
ATOM 992   C CB  . LEU A 1 122 ? -58.009 88.321  15.184  1.00 31.23 ? 122 LEU A CB  1 
ATOM 993   C CG  . LEU A 1 122 ? -58.789 87.021  14.961  1.00 31.62 ? 122 LEU A CG  1 
ATOM 994   C CD1 . LEU A 1 122 ? -60.282 87.214  15.182  1.00 28.54 ? 122 LEU A CD1 1 
ATOM 995   C CD2 . LEU A 1 122 ? -58.512 86.520  13.556  1.00 31.73 ? 122 LEU A CD2 1 
ATOM 996   N N   . LYS A 1 123 ? -57.199 91.255  16.419  1.00 26.32 ? 123 LYS A N   1 
ATOM 997   C CA  . LYS A 1 123 ? -56.148 92.246  16.624  1.00 25.15 ? 123 LYS A CA  1 
ATOM 998   C C   . LYS A 1 123 ? -55.652 92.332  18.072  1.00 25.91 ? 123 LYS A C   1 
ATOM 999   O O   . LYS A 1 123 ? -54.429 92.227  18.319  1.00 25.96 ? 123 LYS A O   1 
ATOM 1000  C CB  . LYS A 1 123 ? -56.600 93.620  16.114  1.00 19.07 ? 123 LYS A CB  1 
ATOM 1001  C CG  . LYS A 1 123 ? -55.551 94.711  16.241  1.00 12.47 ? 123 LYS A CG  1 
ATOM 1002  C CD  . LYS A 1 123 ? -56.103 96.044  15.789  1.00 9.37  ? 123 LYS A CD  1 
ATOM 1003  C CE  . LYS A 1 123 ? -55.197 97.173  16.230  1.00 7.56  ? 123 LYS A CE  1 
ATOM 1004  N NZ  . LYS A 1 123 ? -53.821 97.019  15.699  1.00 4.95  ? 123 LYS A NZ  1 
ATOM 1005  N N   . PRO A 1 124 ? -56.565 92.528  19.048  1.00 28.25 ? 124 PRO A N   1 
ATOM 1006  C CA  . PRO A 1 124 ? -56.133 92.610  20.447  1.00 29.75 ? 124 PRO A CA  1 
ATOM 1007  C C   . PRO A 1 124 ? -55.286 91.403  20.856  1.00 28.94 ? 124 PRO A C   1 
ATOM 1008  O O   . PRO A 1 124 ? -54.379 91.531  21.677  1.00 26.81 ? 124 PRO A O   1 
ATOM 1009  C CB  . PRO A 1 124 ? -57.456 92.651  21.206  1.00 28.18 ? 124 PRO A CB  1 
ATOM 1010  C CG  . PRO A 1 124 ? -58.335 93.402  20.276  1.00 27.50 ? 124 PRO A CG  1 
ATOM 1011  C CD  . PRO A 1 124 ? -58.018 92.758  18.965  1.00 28.37 ? 124 PRO A CD  1 
ATOM 1012  N N   . GLU A 1 125 ? -55.574 90.240  20.273  1.00 29.20 ? 125 GLU A N   1 
ATOM 1013  C CA  . GLU A 1 125 ? -54.817 89.030  20.578  1.00 30.07 ? 125 GLU A CA  1 
ATOM 1014  C C   . GLU A 1 125 ? -53.395 89.115  20.039  1.00 29.98 ? 125 GLU A C   1 
ATOM 1015  O O   . GLU A 1 125 ? -52.466 88.580  20.643  1.00 30.35 ? 125 GLU A O   1 
ATOM 1016  C CB  . GLU A 1 125 ? -55.511 87.778  20.033  1.00 29.40 ? 125 GLU A CB  1 
ATOM 1017  C CG  . GLU A 1 125 ? -56.730 87.340  20.846  1.00 30.78 ? 125 GLU A CG  1 
ATOM 1018  C CD  . GLU A 1 125 ? -57.079 85.870  20.657  1.00 31.99 ? 125 GLU A CD  1 
ATOM 1019  O OE1 . GLU A 1 125 ? -56.150 85.039  20.617  1.00 32.08 ? 125 GLU A OE1 1 
ATOM 1020  O OE2 . GLU A 1 125 ? -58.278 85.539  20.571  1.00 32.04 ? 125 GLU A OE2 1 
ATOM 1021  N N   . TYR A 1 126 ? -53.223 89.783  18.902  1.00 27.58 ? 126 TYR A N   1 
ATOM 1022  C CA  . TYR A 1 126 ? -51.894 89.935  18.322  1.00 26.03 ? 126 TYR A CA  1 
ATOM 1023  C C   . TYR A 1 126 ? -51.113 90.925  19.166  1.00 25.84 ? 126 TYR A C   1 
ATOM 1024  O O   . TYR A 1 126 ? -49.940 90.716  19.455  1.00 26.98 ? 126 TYR A O   1 
ATOM 1025  C CB  . TYR A 1 126 ? -51.951 90.426  16.870  1.00 25.76 ? 126 TYR A CB  1 
ATOM 1026  C CG  . TYR A 1 126 ? -50.623 90.269  16.140  1.00 24.13 ? 126 TYR A CG  1 
ATOM 1027  C CD1 . TYR A 1 126 ? -50.159 88.993  15.759  1.00 20.84 ? 126 TYR A CD1 1 
ATOM 1028  C CD2 . TYR A 1 126 ? -49.817 91.389  15.863  1.00 23.92 ? 126 TYR A CD2 1 
ATOM 1029  C CE1 . TYR A 1 126 ? -48.929 88.843  15.130  1.00 18.70 ? 126 TYR A CE1 1 
ATOM 1030  C CE2 . TYR A 1 126 ? -48.581 91.220  15.230  1.00 23.08 ? 126 TYR A CE2 1 
ATOM 1031  C CZ  . TYR A 1 126 ? -48.144 89.952  14.868  1.00 19.87 ? 126 TYR A CZ  1 
ATOM 1032  O OH  . TYR A 1 126 ? -46.920 89.793  14.249  1.00 17.74 ? 126 TYR A OH  1 
ATOM 1033  N N   . LEU A 1 127 ? -51.772 92.006  19.560  1.00 26.74 ? 127 LEU A N   1 
ATOM 1034  C CA  . LEU A 1 127 ? -51.136 93.017  20.395  1.00 25.52 ? 127 LEU A CA  1 
ATOM 1035  C C   . LEU A 1 127 ? -50.742 92.369  21.720  1.00 22.82 ? 127 LEU A C   1 
ATOM 1036  O O   . LEU A 1 127 ? -49.675 92.628  22.270  1.00 22.78 ? 127 LEU A O   1 
ATOM 1037  C CB  . LEU A 1 127 ? -52.096 94.184  20.649  1.00 23.96 ? 127 LEU A CB  1 
ATOM 1038  C CG  . LEU A 1 127 ? -52.766 94.800  19.420  1.00 18.35 ? 127 LEU A CG  1 
ATOM 1039  C CD1 . LEU A 1 127 ? -53.335 96.162  19.792  1.00 20.08 ? 127 LEU A CD1 1 
ATOM 1040  C CD2 . LEU A 1 127 ? -51.768 94.931  18.279  1.00 14.97 ? 127 LEU A CD2 1 
ATOM 1041  N N   . GLU A 1 128 ? -51.613 91.481  22.179  1.00 24.74 ? 128 GLU A N   1 
ATOM 1042  C CA  . GLU A 1 128 ? -51.465 90.728  23.417  1.00 27.30 ? 128 GLU A CA  1 
ATOM 1043  C C   . GLU A 1 128 ? -50.141 89.944  23.482  1.00 30.04 ? 128 GLU A C   1 
ATOM 1044  O O   . GLU A 1 128 ? -49.542 89.804  24.550  1.00 31.35 ? 128 GLU A O   1 
ATOM 1045  C CB  . GLU A 1 128 ? -52.658 89.769  23.505  1.00 25.74 ? 128 GLU A CB  1 
ATOM 1046  C CG  . GLU A 1 128 ? -52.827 88.941  24.760  1.00 26.98 ? 128 GLU A CG  1 
ATOM 1047  C CD  . GLU A 1 128 ? -53.923 87.890  24.584  1.00 27.12 ? 128 GLU A CD  1 
ATOM 1048  O OE1 . GLU A 1 128 ? -55.136 88.252  24.542  1.00 21.09 ? 128 GLU A OE1 1 
ATOM 1049  O OE2 . GLU A 1 128 ? -53.584 86.697  24.448  1.00 24.84 ? 128 GLU A OE2 1 
ATOM 1050  N N   . GLU A 1 129 ? -49.677 89.457  22.334  1.00 28.77 ? 129 GLU A N   1 
ATOM 1051  C CA  . GLU A 1 129 ? -48.442 88.675  22.266  1.00 26.87 ? 129 GLU A CA  1 
ATOM 1052  C C   . GLU A 1 129 ? -47.325 89.362  21.470  1.00 24.58 ? 129 GLU A C   1 
ATOM 1053  O O   . GLU A 1 129 ? -46.195 88.871  21.418  1.00 23.63 ? 129 GLU A O   1 
ATOM 1054  C CB  . GLU A 1 129 ? -48.754 87.300  21.660  1.00 28.50 ? 129 GLU A CB  1 
ATOM 1055  C CG  . GLU A 1 129 ? -49.710 86.455  22.505  1.00 27.98 ? 129 GLU A CG  1 
ATOM 1056  C CD  . GLU A 1 129 ? -50.724 85.662  21.680  1.00 30.51 ? 129 GLU A CD  1 
ATOM 1057  O OE1 . GLU A 1 129 ? -50.375 85.184  20.578  1.00 29.63 ? 129 GLU A OE1 1 
ATOM 1058  O OE2 . GLU A 1 129 ? -51.878 85.508  22.142  1.00 28.70 ? 129 GLU A OE2 1 
ATOM 1059  N N   . LEU A 1 130 ? -47.637 90.513  20.884  1.00 23.43 ? 130 LEU A N   1 
ATOM 1060  C CA  . LEU A 1 130 ? -46.685 91.268  20.071  1.00 20.42 ? 130 LEU A CA  1 
ATOM 1061  C C   . LEU A 1 130 ? -45.338 91.602  20.729  1.00 19.78 ? 130 LEU A C   1 
ATOM 1062  O O   . LEU A 1 130 ? -44.281 91.285  20.176  1.00 19.59 ? 130 LEU A O   1 
ATOM 1063  C CB  . LEU A 1 130 ? -47.351 92.536  19.533  1.00 14.83 ? 130 LEU A CB  1 
ATOM 1064  C CG  . LEU A 1 130 ? -46.552 93.457  18.615  1.00 12.48 ? 130 LEU A CG  1 
ATOM 1065  C CD1 . LEU A 1 130 ? -45.930 92.690  17.461  1.00 6.47  ? 130 LEU A CD1 1 
ATOM 1066  C CD2 . LEU A 1 130 ? -47.481 94.541  18.104  1.00 9.87  ? 130 LEU A CD2 1 
ATOM 1067  N N   . PRO A 1 131 ? -45.352 92.219  21.923  1.00 22.75 ? 131 PRO A N   1 
ATOM 1068  C CA  . PRO A 1 131 ? -44.078 92.550  22.570  1.00 23.56 ? 131 PRO A CA  1 
ATOM 1069  C C   . PRO A 1 131 ? -43.110 91.372  22.715  1.00 25.11 ? 131 PRO A C   1 
ATOM 1070  O O   . PRO A 1 131 ? -41.966 91.455  22.273  1.00 28.39 ? 131 PRO A O   1 
ATOM 1071  C CB  . PRO A 1 131 ? -44.516 93.106  23.928  1.00 20.16 ? 131 PRO A CB  1 
ATOM 1072  C CG  . PRO A 1 131 ? -45.852 92.469  24.155  1.00 18.10 ? 131 PRO A CG  1 
ATOM 1073  C CD  . PRO A 1 131 ? -46.480 92.569  22.801  1.00 21.12 ? 131 PRO A CD  1 
ATOM 1074  N N   . THR A 1 132 ? -43.583 90.259  23.272  1.00 24.36 ? 132 THR A N   1 
ATOM 1075  C CA  . THR A 1 132 ? -42.723 89.099  23.463  1.00 23.49 ? 132 THR A CA  1 
ATOM 1076  C C   . THR A 1 132 ? -42.081 88.623  22.163  1.00 27.40 ? 132 THR A C   1 
ATOM 1077  O O   . THR A 1 132 ? -40.894 88.280  22.142  1.00 29.58 ? 132 THR A O   1 
ATOM 1078  C CB  . THR A 1 132 ? -43.454 87.928  24.171  1.00 24.04 ? 132 THR A CB  1 
ATOM 1079  O OG1 . THR A 1 132 ? -42.538 86.843  24.362  1.00 24.25 ? 132 THR A OG1 1 
ATOM 1080  C CG2 . THR A 1 132 ? -44.636 87.440  23.361  1.00 21.93 ? 132 THR A CG2 1 
ATOM 1081  N N   . MET A 1 133 ? -42.846 88.616  21.075  1.00 29.07 ? 133 MET A N   1 
ATOM 1082  C CA  . MET A 1 133 ? -42.305 88.192  19.787  1.00 27.42 ? 133 MET A CA  1 
ATOM 1083  C C   . MET A 1 133 ? -41.195 89.158  19.395  1.00 28.00 ? 133 MET A C   1 
ATOM 1084  O O   . MET A 1 133 ? -40.121 88.716  18.956  1.00 30.15 ? 133 MET A O   1 
ATOM 1085  C CB  . MET A 1 133 ? -43.391 88.182  18.711  1.00 26.85 ? 133 MET A CB  1 
ATOM 1086  C CG  . MET A 1 133 ? -44.489 87.169  18.943  1.00 24.26 ? 133 MET A CG  1 
ATOM 1087  S SD  . MET A 1 133 ? -45.731 87.231  17.644  1.00 31.71 ? 133 MET A SD  1 
ATOM 1088  C CE  . MET A 1 133 ? -47.209 87.507  18.571  1.00 25.97 ? 133 MET A CE  1 
ATOM 1089  N N   . MET A 1 134 ? -41.439 90.447  19.626  1.00 25.34 ? 134 MET A N   1 
ATOM 1090  C CA  . MET A 1 134 ? -40.476 91.492  19.307  1.00 23.93 ? 134 MET A CA  1 
ATOM 1091  C C   . MET A 1 134 ? -39.191 91.320  20.114  1.00 24.72 ? 134 MET A C   1 
ATOM 1092  O O   . MET A 1 134 ? -38.084 91.490  19.585  1.00 26.87 ? 134 MET A O   1 
ATOM 1093  C CB  . MET A 1 134 ? -41.075 92.872  19.581  1.00 23.01 ? 134 MET A CB  1 
ATOM 1094  C CG  . MET A 1 134 ? -42.366 93.175  18.834  1.00 28.02 ? 134 MET A CG  1 
ATOM 1095  S SD  . MET A 1 134 ? -42.217 93.189  17.030  1.00 32.95 ? 134 MET A SD  1 
ATOM 1096  C CE  . MET A 1 134 ? -41.605 94.848  16.744  1.00 27.55 ? 134 MET A CE  1 
ATOM 1097  N N   . GLN A 1 135 ? -39.345 90.966  21.389  1.00 22.01 ? 135 GLN A N   1 
ATOM 1098  C CA  . GLN A 1 135 ? -38.211 90.768  22.287  1.00 22.68 ? 135 GLN A CA  1 
ATOM 1099  C C   . GLN A 1 135 ? -37.137 89.938  21.621  1.00 22.75 ? 135 GLN A C   1 
ATOM 1100  O O   . GLN A 1 135 ? -35.990 90.366  21.482  1.00 19.95 ? 135 GLN A O   1 
ATOM 1101  C CB  . GLN A 1 135 ? -38.650 90.041  23.558  1.00 21.69 ? 135 GLN A CB  1 
ATOM 1102  C CG  . GLN A 1 135 ? -39.334 90.910  24.586  1.00 23.76 ? 135 GLN A CG  1 
ATOM 1103  C CD  . GLN A 1 135 ? -38.665 90.847  25.946  1.00 24.60 ? 135 GLN A CD  1 
ATOM 1104  O OE1 . GLN A 1 135 ? -39.333 90.917  26.977  1.00 27.16 ? 135 GLN A OE1 1 
ATOM 1105  N NE2 . GLN A 1 135 ? -37.341 90.718  25.957  1.00 26.05 ? 135 GLN A NE2 1 
ATOM 1106  N N   . HIS A 1 136 ? -37.547 88.759  21.173  1.00 25.64 ? 136 HIS A N   1 
ATOM 1107  C CA  . HIS A 1 136 ? -36.661 87.807  20.525  1.00 25.13 ? 136 HIS A CA  1 
ATOM 1108  C C   . HIS A 1 136 ? -35.890 88.412  19.368  1.00 23.48 ? 136 HIS A C   1 
ATOM 1109  O O   . HIS A 1 136 ? -34.710 88.108  19.178  1.00 23.01 ? 136 HIS A O   1 
ATOM 1110  C CB  . HIS A 1 136 ? -37.460 86.594  20.075  1.00 24.67 ? 136 HIS A CB  1 
ATOM 1111  C CG  . HIS A 1 136 ? -38.225 85.953  21.185  1.00 26.95 ? 136 HIS A CG  1 
ATOM 1112  N ND1 . HIS A 1 136 ? -39.586 86.114  21.344  1.00 21.63 ? 136 HIS A ND1 1 
ATOM 1113  C CD2 . HIS A 1 136 ? -37.814 85.188  22.224  1.00 28.90 ? 136 HIS A CD2 1 
ATOM 1114  C CE1 . HIS A 1 136 ? -39.980 85.479  22.431  1.00 25.75 ? 136 HIS A CE1 1 
ATOM 1115  N NE2 . HIS A 1 136 ? -38.923 84.908  22.986  1.00 30.14 ? 136 HIS A NE2 1 
ATOM 1116  N N   . PHE A 1 137 ? -36.537 89.291  18.615  1.00 20.52 ? 137 PHE A N   1 
ATOM 1117  C CA  . PHE A 1 137 ? -35.855 89.929  17.508  1.00 20.96 ? 137 PHE A CA  1 
ATOM 1118  C C   . PHE A 1 137 ? -34.713 90.765  18.062  1.00 19.88 ? 137 PHE A C   1 
ATOM 1119  O O   . PHE A 1 137 ? -33.588 90.719  17.553  1.00 20.93 ? 137 PHE A O   1 
ATOM 1120  C CB  . PHE A 1 137 ? -36.827 90.771  16.690  1.00 20.87 ? 137 PHE A CB  1 
ATOM 1121  C CG  . PHE A 1 137 ? -37.628 89.967  15.708  1.00 17.76 ? 137 PHE A CG  1 
ATOM 1122  C CD1 . PHE A 1 137 ? -37.002 89.353  14.625  1.00 18.04 ? 137 PHE A CD1 1 
ATOM 1123  C CD2 . PHE A 1 137 ? -38.999 89.813  15.865  1.00 16.64 ? 137 PHE A CD2 1 
ATOM 1124  C CE1 . PHE A 1 137 ? -37.727 88.598  13.720  1.00 14.78 ? 137 PHE A CE1 1 
ATOM 1125  C CE2 . PHE A 1 137 ? -39.735 89.061  14.965  1.00 20.18 ? 137 PHE A CE2 1 
ATOM 1126  C CZ  . PHE A 1 137 ? -39.097 88.452  13.889  1.00 16.05 ? 137 PHE A CZ  1 
ATOM 1127  N N   . SER A 1 138 ? -34.983 91.459  19.161  1.00 20.19 ? 138 SER A N   1 
ATOM 1128  C CA  . SER A 1 138 ? -33.966 92.287  19.790  1.00 19.51 ? 138 SER A CA  1 
ATOM 1129  C C   . SER A 1 138 ? -32.797 91.395  20.214  1.00 20.74 ? 138 SER A C   1 
ATOM 1130  O O   . SER A 1 138 ? -31.652 91.670  19.863  1.00 21.63 ? 138 SER A O   1 
ATOM 1131  C CB  . SER A 1 138 ? -34.545 93.027  21.001  1.00 19.49 ? 138 SER A CB  1 
ATOM 1132  O OG  . SER A 1 138 ? -33.833 94.246  21.257  1.00 16.42 ? 138 SER A OG  1 
ATOM 1133  N N   . GLN A 1 139 ? -33.098 90.302  20.914  1.00 20.65 ? 139 GLN A N   1 
ATOM 1134  C CA  . GLN A 1 139 ? -32.074 89.360  21.376  1.00 22.73 ? 139 GLN A CA  1 
ATOM 1135  C C   . GLN A 1 139 ? -31.118 89.027  20.233  1.00 21.06 ? 139 GLN A C   1 
ATOM 1136  O O   . GLN A 1 139 ? -29.915 89.266  20.330  1.00 19.68 ? 139 GLN A O   1 
ATOM 1137  C CB  . GLN A 1 139 ? -32.710 88.045  21.855  1.00 23.08 ? 139 GLN A CB  1 
ATOM 1138  C CG  . GLN A 1 139 ? -33.833 88.172  22.869  1.00 24.53 ? 139 GLN A CG  1 
ATOM 1139  C CD  . GLN A 1 139 ? -33.395 88.792  24.182  1.00 23.02 ? 139 GLN A CD  1 
ATOM 1140  O OE1 . GLN A 1 139 ? -34.136 89.572  24.781  1.00 21.55 ? 139 GLN A OE1 1 
ATOM 1141  N NE2 . GLN A 1 139 ? -32.209 88.430  24.651  1.00 22.72 ? 139 GLN A NE2 1 
ATOM 1142  N N   . PHE A 1 140 ? -31.686 88.505  19.146  1.00 18.76 ? 140 PHE A N   1 
ATOM 1143  C CA  . PHE A 1 140 ? -30.948 88.086  17.953  1.00 16.23 ? 140 PHE A CA  1 
ATOM 1144  C C   . PHE A 1 140 ? -29.933 89.108  17.455  1.00 15.13 ? 140 PHE A C   1 
ATOM 1145  O O   . PHE A 1 140 ? -28.784 88.768  17.180  1.00 14.27 ? 140 PHE A O   1 
ATOM 1146  C CB  . PHE A 1 140 ? -31.934 87.764  16.831  1.00 15.23 ? 140 PHE A CB  1 
ATOM 1147  C CG  . PHE A 1 140 ? -31.426 86.756  15.844  1.00 11.85 ? 140 PHE A CG  1 
ATOM 1148  C CD1 . PHE A 1 140 ? -31.325 85.390  16.195  1.00 9.12  ? 140 PHE A CD1 1 
ATOM 1149  C CD2 . PHE A 1 140 ? -31.094 87.156  14.551  1.00 11.77 ? 140 PHE A CD2 1 
ATOM 1150  C CE1 . PHE A 1 140 ? -30.907 84.443  15.273  1.00 8.86  ? 140 PHE A CE1 1 
ATOM 1151  C CE2 . PHE A 1 140 ? -30.675 86.199  13.621  1.00 9.19  ? 140 PHE A CE2 1 
ATOM 1152  C CZ  . PHE A 1 140 ? -30.583 84.855  13.983  1.00 12.95 ? 140 PHE A CZ  1 
ATOM 1153  N N   . LEU A 1 141 ? -30.363 90.352  17.300  1.00 11.46 ? 141 LEU A N   1 
ATOM 1154  C CA  . LEU A 1 141 ? -29.464 91.395  16.837  1.00 11.32 ? 141 LEU A CA  1 
ATOM 1155  C C   . LEU A 1 141 ? -28.413 91.585  17.926  1.00 14.92 ? 141 LEU A C   1 
ATOM 1156  O O   . LEU A 1 141 ? -27.188 91.573  17.671  1.00 13.34 ? 141 LEU A O   1 
ATOM 1157  C CB  . LEU A 1 141 ? -30.244 92.694  16.603  1.00 7.76  ? 141 LEU A CB  1 
ATOM 1158  C CG  . LEU A 1 141 ? -29.471 93.894  16.041  1.00 6.21  ? 141 LEU A CG  1 
ATOM 1159  C CD1 . LEU A 1 141 ? -28.751 93.529  14.750  1.00 2.00  ? 141 LEU A CD1 1 
ATOM 1160  C CD2 . LEU A 1 141 ? -30.420 95.059  15.808  1.00 5.37  ? 141 LEU A CD2 1 
ATOM 1161  N N   . GLY A 1 142 ? -28.898 91.700  19.155  1.00 16.37 ? 142 GLY A N   1 
ATOM 1162  C CA  . GLY A 1 142 ? -28.024 91.884  20.288  1.00 18.77 ? 142 GLY A CA  1 
ATOM 1163  C C   . GLY A 1 142 ? -27.234 93.168  20.225  1.00 20.24 ? 142 GLY A C   1 
ATOM 1164  O O   . GLY A 1 142 ? -27.763 94.249  20.462  1.00 18.99 ? 142 GLY A O   1 
ATOM 1165  N N   . LYS A 1 143 ? -25.959 93.046  19.881  1.00 22.54 ? 143 LYS A N   1 
ATOM 1166  C CA  . LYS A 1 143 ? -25.072 94.200  19.823  1.00 23.90 ? 143 LYS A CA  1 
ATOM 1167  C C   . LYS A 1 143 ? -24.631 94.474  18.393  1.00 22.26 ? 143 LYS A C   1 
ATOM 1168  O O   . LYS A 1 143 ? -24.088 95.550  18.096  1.00 23.52 ? 143 LYS A O   1 
ATOM 1169  C CB  . LYS A 1 143 ? -23.837 93.951  20.708  1.00 23.92 ? 143 LYS A CB  1 
ATOM 1170  C CG  . LYS A 1 143 ? -24.073 93.036  21.921  1.00 25.37 ? 143 LYS A CG  1 
ATOM 1171  C CD  . LYS A 1 143 ? -24.912 93.695  23.020  1.00 27.58 ? 143 LYS A CD  1 
ATOM 1172  C CE  . LYS A 1 143 ? -25.224 92.729  24.170  1.00 27.34 ? 143 LYS A CE  1 
ATOM 1173  N NZ  . LYS A 1 143 ? -24.007 92.203  24.860  1.00 29.60 ? 143 LYS A NZ  1 
ATOM 1174  N N   . ARG A 1 144 ? -24.805 93.492  17.517  1.00 19.68 ? 144 ARG A N   1 
ATOM 1175  C CA  . ARG A 1 144 ? -24.382 93.601  16.124  1.00 17.18 ? 144 ARG A CA  1 
ATOM 1176  C C   . ARG A 1 144 ? -25.077 94.732  15.367  1.00 17.14 ? 144 ARG A C   1 
ATOM 1177  O O   . ARG A 1 144 ? -26.117 95.243  15.794  1.00 17.62 ? 144 ARG A O   1 
ATOM 1178  C CB  . ARG A 1 144 ? -24.675 92.293  15.387  1.00 14.38 ? 144 ARG A CB  1 
ATOM 1179  C CG  . ARG A 1 144 ? -24.221 91.043  16.085  1.00 11.59 ? 144 ARG A CG  1 
ATOM 1180  C CD  . ARG A 1 144 ? -24.774 89.831  15.364  1.00 10.35 ? 144 ARG A CD  1 
ATOM 1181  N NE  . ARG A 1 144 ? -24.394 88.585  16.022  1.00 9.31  ? 144 ARG A NE  1 
ATOM 1182  C CZ  . ARG A 1 144 ? -24.990 88.102  17.107  1.00 5.70  ? 144 ARG A CZ  1 
ATOM 1183  N NH1 . ARG A 1 144 ? -26.006 88.758  17.663  1.00 5.99  ? 144 ARG A NH1 1 
ATOM 1184  N NH2 . ARG A 1 144 ? -24.567 86.962  17.641  1.00 2.00  ? 144 ARG A NH2 1 
ATOM 1185  N N   . PRO A 1 145 ? -24.460 95.193  14.269  1.00 16.67 ? 145 PRO A N   1 
ATOM 1186  C CA  . PRO A 1 145 ? -25.046 96.259  13.458  1.00 16.35 ? 145 PRO A CA  1 
ATOM 1187  C C   . PRO A 1 145 ? -26.072 95.617  12.518  1.00 16.34 ? 145 PRO A C   1 
ATOM 1188  O O   . PRO A 1 145 ? -27.097 96.220  12.216  1.00 12.75 ? 145 PRO A O   1 
ATOM 1189  C CB  . PRO A 1 145 ? -23.845 96.802  12.679  1.00 21.05 ? 145 PRO A CB  1 
ATOM 1190  C CG  . PRO A 1 145 ? -22.668 96.438  13.544  1.00 17.00 ? 145 PRO A CG  1 
ATOM 1191  C CD  . PRO A 1 145 ? -23.032 95.040  13.952  1.00 16.06 ? 145 PRO A CD  1 
ATOM 1192  N N   . TRP A 1 146 ? -25.782 94.399  12.053  1.00 15.80 ? 146 TRP A N   1 
ATOM 1193  C CA  . TRP A 1 146 ? -26.685 93.659  11.168  1.00 15.31 ? 146 TRP A CA  1 
ATOM 1194  C C   . TRP A 1 146 ? -27.022 92.302  11.799  1.00 14.45 ? 146 TRP A C   1 
ATOM 1195  O O   . TRP A 1 146 ? -26.133 91.595  12.256  1.00 14.20 ? 146 TRP A O   1 
ATOM 1196  C CB  . TRP A 1 146 ? -26.050 93.440  9.789   1.00 14.90 ? 146 TRP A CB  1 
ATOM 1197  C CG  . TRP A 1 146 ? -25.522 94.681  9.112   1.00 14.40 ? 146 TRP A CG  1 
ATOM 1198  C CD1 . TRP A 1 146 ? -24.266 94.856  8.609   1.00 13.63 ? 146 TRP A CD1 1 
ATOM 1199  C CD2 . TRP A 1 146 ? -26.228 95.892  8.845   1.00 15.20 ? 146 TRP A CD2 1 
ATOM 1200  N NE1 . TRP A 1 146 ? -24.143 96.102  8.047   1.00 14.81 ? 146 TRP A NE1 1 
ATOM 1201  C CE2 . TRP A 1 146 ? -25.317 96.772  8.177   1.00 14.76 ? 146 TRP A CE2 1 
ATOM 1202  C CE3 . TRP A 1 146 ? -27.534 96.358  9.109   1.00 10.96 ? 146 TRP A CE3 1 
ATOM 1203  C CZ2 . TRP A 1 146 ? -25.695 98.068  7.761   1.00 12.06 ? 146 TRP A CZ2 1 
ATOM 1204  C CZ3 . TRP A 1 146 ? -27.898 97.649  8.694   1.00 6.08  ? 146 TRP A CZ3 1 
ATOM 1205  C CH2 . TRP A 1 146 ? -26.977 98.500  8.030   1.00 8.91  ? 146 TRP A CH2 1 
ATOM 1206  N N   . PHE A 1 147 ? -28.303 91.942  11.783  1.00 11.12 ? 147 PHE A N   1 
ATOM 1207  C CA  . PHE A 1 147 ? -28.818 90.694  12.355  1.00 11.22 ? 147 PHE A CA  1 
ATOM 1208  C C   . PHE A 1 147 ? -27.949 89.456  12.315  1.00 11.85 ? 147 PHE A C   1 
ATOM 1209  O O   . PHE A 1 147 ? -28.105 88.583  13.166  1.00 14.89 ? 147 PHE A O   1 
ATOM 1210  C CB  . PHE A 1 147 ? -30.161 90.337  11.748  1.00 7.59  ? 147 PHE A CB  1 
ATOM 1211  C CG  . PHE A 1 147 ? -31.330 90.850  12.491  1.00 2.00  ? 147 PHE A CG  1 
ATOM 1212  C CD1 . PHE A 1 147 ? -31.796 92.137  12.280  1.00 2.00  ? 147 PHE A CD1 1 
ATOM 1213  C CD2 . PHE A 1 147 ? -31.957 90.048  13.418  1.00 2.00  ? 147 PHE A CD2 1 
ATOM 1214  C CE1 . PHE A 1 147 ? -32.894 92.624  12.983  1.00 3.19  ? 147 PHE A CE1 1 
ATOM 1215  C CE2 . PHE A 1 147 ? -33.075 90.518  14.128  1.00 4.92  ? 147 PHE A CE2 1 
ATOM 1216  C CZ  . PHE A 1 147 ? -33.538 91.812  13.911  1.00 2.00  ? 147 PHE A CZ  1 
ATOM 1217  N N   . VAL A 1 148 ? -27.155 89.325  11.273  1.00 14.20 ? 148 VAL A N   1 
ATOM 1218  C CA  . VAL A 1 148 ? -26.255 88.174  11.150  1.00 13.46 ? 148 VAL A CA  1 
ATOM 1219  C C   . VAL A 1 148 ? -24.933 88.436  11.874  1.00 17.90 ? 148 VAL A C   1 
ATOM 1220  O O   . VAL A 1 148 ? -24.365 87.530  12.487  1.00 13.12 ? 148 VAL A O   1 
ATOM 1221  C CB  . VAL A 1 148 ? -26.011 87.811  9.667   1.00 10.09 ? 148 VAL A CB  1 
ATOM 1222  C CG1 . VAL A 1 148 ? -25.011 86.673  9.543   1.00 7.53  ? 148 VAL A CG1 1 
ATOM 1223  C CG2 . VAL A 1 148 ? -27.315 87.405  9.022   1.00 9.12  ? 148 VAL A CG2 1 
ATOM 1224  N N   . GLY A 1 149 ? -24.454 89.676  11.807  1.00 18.17 ? 149 GLY A N   1 
ATOM 1225  C CA  . GLY A 1 149 ? -23.213 90.017  12.473  1.00 15.47 ? 149 GLY A CA  1 
ATOM 1226  C C   . GLY A 1 149 ? -22.574 91.307  12.006  1.00 14.86 ? 149 GLY A C   1 
ATOM 1227  O O   . GLY A 1 149 ? -23.165 92.388  12.096  1.00 13.35 ? 149 GLY A O   1 
ATOM 1228  N N   . ASP A 1 150 ? -21.346 91.177  11.511  1.00 16.45 ? 150 ASP A N   1 
ATOM 1229  C CA  . ASP A 1 150 ? -20.559 92.302  11.017  1.00 16.89 ? 150 ASP A CA  1 
ATOM 1230  C C   . ASP A 1 150 ? -20.944 92.712  9.606   1.00 17.66 ? 150 ASP A C   1 
ATOM 1231  O O   . ASP A 1 150 ? -20.730 93.855  9.202   1.00 18.06 ? 150 ASP A O   1 
ATOM 1232  C CB  . ASP A 1 150 ? -19.068 91.948  11.007  1.00 19.71 ? 150 ASP A CB  1 
ATOM 1233  C CG  . ASP A 1 150 ? -18.524 91.639  12.384  1.00 22.66 ? 150 ASP A CG  1 
ATOM 1234  O OD1 . ASP A 1 150 ? -19.012 92.201  13.392  1.00 26.25 ? 150 ASP A OD1 1 
ATOM 1235  O OD2 . ASP A 1 150 ? -17.578 90.834  12.449  1.00 23.36 ? 150 ASP A OD2 1 
ATOM 1236  N N   . LYS A 1 151 ? -21.480 91.772  8.842   1.00 17.79 ? 151 LYS A N   1 
ATOM 1237  C CA  . LYS A 1 151 ? -21.845 92.069  7.471   1.00 18.17 ? 151 LYS A CA  1 
ATOM 1238  C C   . LYS A 1 151 ? -23.337 92.170  7.211   1.00 16.01 ? 151 LYS A C   1 
ATOM 1239  O O   . LYS A 1 151 ? -24.161 91.725  8.014   1.00 20.15 ? 151 LYS A O   1 
ATOM 1240  C CB  . LYS A 1 151 ? -21.215 91.044  6.527   1.00 22.48 ? 151 LYS A CB  1 
ATOM 1241  C CG  . LYS A 1 151 ? -21.552 89.583  6.816   1.00 18.52 ? 151 LYS A CG  1 
ATOM 1242  C CD  . LYS A 1 151 ? -20.799 88.689  5.853   1.00 22.17 ? 151 LYS A CD  1 
ATOM 1243  C CE  . LYS A 1 151 ? -19.309 88.881  6.028   1.00 19.16 ? 151 LYS A CE  1 
ATOM 1244  N NZ  . LYS A 1 151 ? -18.512 88.336  4.908   1.00 22.64 ? 151 LYS A NZ  1 
ATOM 1245  N N   . ILE A 1 152 ? -23.667 92.814  6.098   1.00 13.26 ? 152 ILE A N   1 
ATOM 1246  C CA  . ILE A 1 152 ? -25.042 92.978  5.664   1.00 10.97 ? 152 ILE A CA  1 
ATOM 1247  C C   . ILE A 1 152 ? -25.366 91.770  4.785   1.00 9.47  ? 152 ILE A C   1 
ATOM 1248  O O   . ILE A 1 152 ? -24.525 91.349  3.966   1.00 8.78  ? 152 ILE A O   1 
ATOM 1249  C CB  . ILE A 1 152 ? -25.225 94.290  4.848   1.00 7.55  ? 152 ILE A CB  1 
ATOM 1250  C CG1 . ILE A 1 152 ? -26.631 94.366  4.259   1.00 8.46  ? 152 ILE A CG1 1 
ATOM 1251  C CG2 . ILE A 1 152 ? -24.194 94.381  3.726   1.00 8.90  ? 152 ILE A CG2 1 
ATOM 1252  C CD1 . ILE A 1 152 ? -27.702 94.646  5.258   1.00 7.45  ? 152 ILE A CD1 1 
ATOM 1253  N N   . THR A 1 153 ? -26.526 91.171  5.025   1.00 9.10  ? 153 THR A N   1 
ATOM 1254  C CA  . THR A 1 153 ? -26.993 90.019  4.258   1.00 11.79 ? 153 THR A CA  1 
ATOM 1255  C C   . THR A 1 153 ? -28.438 90.310  3.848   1.00 11.03 ? 153 THR A C   1 
ATOM 1256  O O   . THR A 1 153 ? -29.030 91.280  4.351   1.00 14.17 ? 153 THR A O   1 
ATOM 1257  C CB  . THR A 1 153 ? -26.934 88.701  5.083   1.00 12.63 ? 153 THR A CB  1 
ATOM 1258  O OG1 . THR A 1 153 ? -27.544 88.902  6.364   1.00 13.74 ? 153 THR A OG1 1 
ATOM 1259  C CG2 . THR A 1 153 ? -25.502 88.229  5.273   1.00 6.50  ? 153 THR A CG2 1 
ATOM 1260  N N   . PHE A 1 154 ? -29.023 89.474  3.015   1.00 10.86 ? 154 PHE A N   1 
ATOM 1261  C CA  . PHE A 1 154 ? -30.394 89.705  2.593   1.00 11.74 ? 154 PHE A CA  1 
ATOM 1262  C C   . PHE A 1 154 ? -31.395 89.722  3.740   1.00 13.62 ? 154 PHE A C   1 
ATOM 1263  O O   . PHE A 1 154 ? -32.333 90.520  3.730   1.00 14.27 ? 154 PHE A O   1 
ATOM 1264  C CB  . PHE A 1 154 ? -30.821 88.709  1.512   1.00 9.36  ? 154 PHE A CB  1 
ATOM 1265  C CG  . PHE A 1 154 ? -30.990 87.293  1.998   1.00 6.78  ? 154 PHE A CG  1 
ATOM 1266  C CD1 . PHE A 1 154 ? -29.906 86.415  2.006   1.00 8.75  ? 154 PHE A CD1 1 
ATOM 1267  C CD2 . PHE A 1 154 ? -32.247 86.815  2.369   1.00 6.40  ? 154 PHE A CD2 1 
ATOM 1268  C CE1 . PHE A 1 154 ? -30.082 85.074  2.371   1.00 7.96  ? 154 PHE A CE1 1 
ATOM 1269  C CE2 . PHE A 1 154 ? -32.430 85.481  2.736   1.00 7.64  ? 154 PHE A CE2 1 
ATOM 1270  C CZ  . PHE A 1 154 ? -31.347 84.590  2.735   1.00 2.45  ? 154 PHE A CZ  1 
ATOM 1271  N N   . VAL A 1 155 ? -31.165 88.889  4.752   1.00 12.82 ? 155 VAL A N   1 
ATOM 1272  C CA  . VAL A 1 155 ? -32.077 88.823  5.896   1.00 11.55 ? 155 VAL A CA  1 
ATOM 1273  C C   . VAL A 1 155 ? -32.267 90.154  6.635   1.00 12.62 ? 155 VAL A C   1 
ATOM 1274  O O   . VAL A 1 155 ? -33.206 90.298  7.409   1.00 10.77 ? 155 VAL A O   1 
ATOM 1275  C CB  . VAL A 1 155 ? -31.695 87.709  6.903   1.00 12.35 ? 155 VAL A CB  1 
ATOM 1276  C CG1 . VAL A 1 155 ? -31.646 86.370  6.200   1.00 10.24 ? 155 VAL A CG1 1 
ATOM 1277  C CG2 . VAL A 1 155 ? -30.378 88.021  7.585   1.00 13.39 ? 155 VAL A CG2 1 
ATOM 1278  N N   . ASP A 1 156 ? -31.384 91.122  6.400   1.00 13.14 ? 156 ASP A N   1 
ATOM 1279  C CA  . ASP A 1 156 ? -31.520 92.431  7.036   1.00 13.98 ? 156 ASP A CA  1 
ATOM 1280  C C   . ASP A 1 156 ? -32.697 93.160  6.391   1.00 15.18 ? 156 ASP A C   1 
ATOM 1281  O O   . ASP A 1 156 ? -33.547 93.725  7.085   1.00 13.47 ? 156 ASP A O   1 
ATOM 1282  C CB  . ASP A 1 156 ? -30.247 93.263  6.871   1.00 17.23 ? 156 ASP A CB  1 
ATOM 1283  C CG  . ASP A 1 156 ? -29.157 92.861  7.841   1.00 20.12 ? 156 ASP A CG  1 
ATOM 1284  O OD1 . ASP A 1 156 ? -29.232 93.257  9.020   1.00 15.35 ? 156 ASP A OD1 1 
ATOM 1285  O OD2 . ASP A 1 156 ? -28.215 92.160  7.423   1.00 23.19 ? 156 ASP A OD2 1 
ATOM 1286  N N   . PHE A 1 157 ? -32.749 93.117  5.062   1.00 16.87 ? 157 PHE A N   1 
ATOM 1287  C CA  . PHE A 1 157 ? -33.819 93.757  4.304   1.00 14.91 ? 157 PHE A CA  1 
ATOM 1288  C C   . PHE A 1 157 ? -35.152 93.166  4.765   1.00 12.05 ? 157 PHE A C   1 
ATOM 1289  O O   . PHE A 1 157 ? -36.073 93.895  5.143   1.00 10.96 ? 157 PHE A O   1 
ATOM 1290  C CB  . PHE A 1 157 ? -33.639 93.494  2.808   1.00 15.08 ? 157 PHE A CB  1 
ATOM 1291  C CG  . PHE A 1 157 ? -32.373 94.058  2.237   1.00 12.51 ? 157 PHE A CG  1 
ATOM 1292  C CD1 . PHE A 1 157 ? -31.151 93.453  2.495   1.00 13.69 ? 157 PHE A CD1 1 
ATOM 1293  C CD2 . PHE A 1 157 ? -32.404 95.184  1.427   1.00 13.13 ? 157 PHE A CD2 1 
ATOM 1294  C CE1 . PHE A 1 157 ? -29.978 93.963  1.953   1.00 13.47 ? 157 PHE A CE1 1 
ATOM 1295  C CE2 . PHE A 1 157 ? -31.239 95.701  0.880   1.00 10.93 ? 157 PHE A CE2 1 
ATOM 1296  C CZ  . PHE A 1 157 ? -30.024 95.088  1.143   1.00 11.36 ? 157 PHE A CZ  1 
ATOM 1297  N N   . LEU A 1 158 ? -35.228 91.837  4.745   1.00 12.52 ? 158 LEU A N   1 
ATOM 1298  C CA  . LEU A 1 158 ? -36.413 91.098  5.169   1.00 12.54 ? 158 LEU A CA  1 
ATOM 1299  C C   . LEU A 1 158 ? -36.856 91.622  6.534   1.00 13.66 ? 158 LEU A C   1 
ATOM 1300  O O   . LEU A 1 158 ? -37.988 92.085  6.694   1.00 14.52 ? 158 LEU A O   1 
ATOM 1301  C CB  . LEU A 1 158 ? -36.063 89.612  5.284   1.00 9.48  ? 158 LEU A CB  1 
ATOM 1302  C CG  . LEU A 1 158 ? -36.937 88.538  4.637   1.00 10.23 ? 158 LEU A CG  1 
ATOM 1303  C CD1 . LEU A 1 158 ? -36.209 87.202  4.725   1.00 9.67  ? 158 LEU A CD1 1 
ATOM 1304  C CD2 . LEU A 1 158 ? -38.302 88.461  5.311   1.00 2.59  ? 158 LEU A CD2 1 
ATOM 1305  N N   . ALA A 1 159 ? -35.931 91.595  7.494   1.00 15.28 ? 159 ALA A N   1 
ATOM 1306  C CA  . ALA A 1 159 ? -36.180 92.045  8.865   1.00 13.52 ? 159 ALA A CA  1 
ATOM 1307  C C   . ALA A 1 159 ? -36.687 93.477  8.921   1.00 10.91 ? 159 ALA A C   1 
ATOM 1308  O O   . ALA A 1 159 ? -37.651 93.767  9.627   1.00 10.67 ? 159 ALA A O   1 
ATOM 1309  C CB  . ALA A 1 159 ? -34.922 91.906  9.697   1.00 11.79 ? 159 ALA A CB  1 
ATOM 1310  N N   . TYR A 1 160 ? -36.044 94.361  8.168   1.00 8.66  ? 160 TYR A N   1 
ATOM 1311  C CA  . TYR A 1 160 ? -36.433 95.765  8.117   1.00 12.55 ? 160 TYR A CA  1 
ATOM 1312  C C   . TYR A 1 160 ? -37.873 95.913  7.620   1.00 12.51 ? 160 TYR A C   1 
ATOM 1313  O O   . TYR A 1 160 ? -38.632 96.755  8.113   1.00 11.47 ? 160 TYR A O   1 
ATOM 1314  C CB  . TYR A 1 160 ? -35.461 96.534  7.218   1.00 9.85  ? 160 TYR A CB  1 
ATOM 1315  C CG  . TYR A 1 160 ? -35.959 97.877  6.740   1.00 8.11  ? 160 TYR A CG  1 
ATOM 1316  C CD1 . TYR A 1 160 ? -36.121 98.939  7.632   1.00 5.28  ? 160 TYR A CD1 1 
ATOM 1317  C CD2 . TYR A 1 160 ? -36.243 98.091  5.392   1.00 8.49  ? 160 TYR A CD2 1 
ATOM 1318  C CE1 . TYR A 1 160 ? -36.554 100.190 7.172   1.00 10.28 ? 160 TYR A CE1 1 
ATOM 1319  C CE2 . TYR A 1 160 ? -36.670 99.330  4.931   1.00 6.00  ? 160 TYR A CE2 1 
ATOM 1320  C CZ  . TYR A 1 160 ? -36.825 100.377 5.821   1.00 8.49  ? 160 TYR A CZ  1 
ATOM 1321  O OH  . TYR A 1 160 ? -37.247 101.603 5.350   1.00 4.87  ? 160 TYR A OH  1 
ATOM 1322  N N   . ASP A 1 161 ? -38.239 95.078  6.651   1.00 13.53 ? 161 ASP A N   1 
ATOM 1323  C CA  . ASP A 1 161 ? -39.582 95.085  6.082   1.00 16.87 ? 161 ASP A CA  1 
ATOM 1324  C C   . ASP A 1 161 ? -40.602 94.739  7.164   1.00 19.18 ? 161 ASP A C   1 
ATOM 1325  O O   . ASP A 1 161 ? -41.510 95.548  7.448   1.00 18.23 ? 161 ASP A O   1 
ATOM 1326  C CB  . ASP A 1 161 ? -39.660 94.079  4.923   1.00 12.98 ? 161 ASP A CB  1 
ATOM 1327  C CG  . ASP A 1 161 ? -41.038 94.016  4.279   1.00 12.43 ? 161 ASP A CG  1 
ATOM 1328  O OD1 . ASP A 1 161 ? -41.683 95.071  4.121   1.00 9.21  ? 161 ASP A OD1 1 
ATOM 1329  O OD2 . ASP A 1 161 ? -41.472 92.901  3.918   1.00 12.49 ? 161 ASP A OD2 1 
ATOM 1330  N N   . VAL A 1 162 ? -40.416 93.578  7.791   1.00 18.17 ? 162 VAL A N   1 
ATOM 1331  C CA  . VAL A 1 162 ? -41.310 93.102  8.844   1.00 18.26 ? 162 VAL A CA  1 
ATOM 1332  C C   . VAL A 1 162 ? -41.342 94.040  10.049  1.00 19.70 ? 162 VAL A C   1 
ATOM 1333  O O   . VAL A 1 162 ? -42.376 94.172  10.710  1.00 20.83 ? 162 VAL A O   1 
ATOM 1334  C CB  . VAL A 1 162 ? -40.924 91.685  9.315   1.00 19.22 ? 162 VAL A CB  1 
ATOM 1335  C CG1 . VAL A 1 162 ? -41.889 91.199  10.387  1.00 20.88 ? 162 VAL A CG1 1 
ATOM 1336  C CG2 . VAL A 1 162 ? -40.922 90.727  8.133   1.00 18.41 ? 162 VAL A CG2 1 
ATOM 1337  N N   . LEU A 1 163 ? -40.219 94.700  10.322  1.00 18.57 ? 163 LEU A N   1 
ATOM 1338  C CA  . LEU A 1 163 ? -40.128 95.635  11.440  1.00 17.68 ? 163 LEU A CA  1 
ATOM 1339  C C   . LEU A 1 163 ? -40.934 96.891  11.152  1.00 18.69 ? 163 LEU A C   1 
ATOM 1340  O O   . LEU A 1 163 ? -41.756 97.302  11.974  1.00 20.22 ? 163 LEU A O   1 
ATOM 1341  C CB  . LEU A 1 163 ? -38.669 96.009  11.725  1.00 16.98 ? 163 LEU A CB  1 
ATOM 1342  C CG  . LEU A 1 163 ? -38.112 95.644  13.109  1.00 19.19 ? 163 LEU A CG  1 
ATOM 1343  C CD1 . LEU A 1 163 ? -38.260 94.150  13.374  1.00 16.93 ? 163 LEU A CD1 1 
ATOM 1344  C CD2 . LEU A 1 163 ? -36.650 96.057  13.214  1.00 16.61 ? 163 LEU A CD2 1 
ATOM 1345  N N   . ASP A 1 164 ? -40.721 97.476  9.974   1.00 17.76 ? 164 ASP A N   1 
ATOM 1346  C CA  . ASP A 1 164 ? -41.430 98.691  9.585   1.00 13.07 ? 164 ASP A CA  1 
ATOM 1347  C C   . ASP A 1 164 ? -42.926 98.437  9.546   1.00 10.52 ? 164 ASP A C   1 
ATOM 1348  O O   . ASP A 1 164 ? -43.717 99.273  9.976   1.00 8.31  ? 164 ASP A O   1 
ATOM 1349  C CB  . ASP A 1 164 ? -40.958 99.200  8.224   1.00 11.66 ? 164 ASP A CB  1 
ATOM 1350  C CG  . ASP A 1 164 ? -41.413 100.629 7.948   1.00 11.97 ? 164 ASP A CG  1 
ATOM 1351  O OD1 . ASP A 1 164 ? -41.006 101.534 8.708   1.00 10.55 ? 164 ASP A OD1 1 
ATOM 1352  O OD2 . ASP A 1 164 ? -42.173 100.851 6.977   1.00 16.47 ? 164 ASP A OD2 1 
ATOM 1353  N N   . LEU A 1 165 ? -43.306 97.271  9.038   1.00 12.23 ? 165 LEU A N   1 
ATOM 1354  C CA  . LEU A 1 165 ? -44.709 96.883  8.952   1.00 13.00 ? 165 LEU A CA  1 
ATOM 1355  C C   . LEU A 1 165 ? -45.396 97.138  10.291  1.00 15.96 ? 165 LEU A C   1 
ATOM 1356  O O   . LEU A 1 165 ? -46.406 97.837  10.367  1.00 14.45 ? 165 LEU A O   1 
ATOM 1357  C CB  . LEU A 1 165 ? -44.810 95.397  8.597   1.00 8.82  ? 165 LEU A CB  1 
ATOM 1358  C CG  . LEU A 1 165 ? -45.488 95.016  7.280   1.00 4.40  ? 165 LEU A CG  1 
ATOM 1359  C CD1 . LEU A 1 165 ? -46.988 95.241  7.380   1.00 4.20  ? 165 LEU A CD1 1 
ATOM 1360  C CD2 . LEU A 1 165 ? -44.889 95.804  6.127   1.00 3.22  ? 165 LEU A CD2 1 
ATOM 1361  N N   . HIS A 1 166 ? -44.788 96.630  11.355  1.00 17.43 ? 166 HIS A N   1 
ATOM 1362  C CA  . HIS A 1 166 ? -45.338 96.776  12.695  1.00 19.75 ? 166 HIS A CA  1 
ATOM 1363  C C   . HIS A 1 166 ? -45.260 98.194  13.259  1.00 21.27 ? 166 HIS A C   1 
ATOM 1364  O O   . HIS A 1 166 ? -45.928 98.490  14.257  1.00 21.71 ? 166 HIS A O   1 
ATOM 1365  C CB  . HIS A 1 166 ? -44.661 95.793  13.647  1.00 17.78 ? 166 HIS A CB  1 
ATOM 1366  C CG  . HIS A 1 166 ? -44.928 94.357  13.317  1.00 14.77 ? 166 HIS A CG  1 
ATOM 1367  N ND1 . HIS A 1 166 ? -46.048 93.684  13.757  1.00 8.56  ? 166 HIS A ND1 1 
ATOM 1368  C CD2 . HIS A 1 166 ? -44.227 93.467  12.575  1.00 12.78 ? 166 HIS A CD2 1 
ATOM 1369  C CE1 . HIS A 1 166 ? -46.020 92.446  13.303  1.00 14.90 ? 166 HIS A CE1 1 
ATOM 1370  N NE2 . HIS A 1 166 ? -44.926 92.303  12.583  1.00 16.55 ? 166 HIS A NE2 1 
ATOM 1371  N N   . ARG A 1 167 ? -44.526 99.073  12.605  1.00 20.82 ? 167 ARG A N   1 
ATOM 1372  C CA  . ARG A 1 167 ? -44.394 100.464 13.044  1.00 23.09 ? 167 ARG A CA  1 
ATOM 1373  C C   . ARG A 1 167 ? -45.628 101.297 12.680  1.00 23.53 ? 167 ARG A C   1 
ATOM 1374  O O   . ARG A 1 167 ? -45.970 102.246 13.388  1.00 26.00 ? 167 ARG A O   1 
ATOM 1375  C CB  . ARG A 1 167 ? -43.162 101.102 12.408  1.00 21.23 ? 167 ARG A CB  1 
ATOM 1376  C CG  . ARG A 1 167 ? -41.927 100.257 12.520  1.00 18.41 ? 167 ARG A CG  1 
ATOM 1377  C CD  . ARG A 1 167 ? -41.003 100.750 13.561  1.00 14.14 ? 167 ARG A CD  1 
ATOM 1378  N NE  . ARG A 1 167 ? -40.371 102.030 13.216  1.00 15.09 ? 167 ARG A NE  1 
ATOM 1379  C CZ  . ARG A 1 167 ? -39.619 102.249 12.139  1.00 13.00 ? 167 ARG A CZ  1 
ATOM 1380  N NH1 . ARG A 1 167 ? -39.375 101.271 11.274  1.00 6.80  ? 167 ARG A NH1 1 
ATOM 1381  N NH2 . ARG A 1 167 ? -39.104 103.455 11.930  1.00 9.46  ? 167 ARG A NH2 1 
ATOM 1382  N N   . ILE A 1 168 ? -46.255 100.983 11.546  1.00 20.95 ? 168 ILE A N   1 
ATOM 1383  C CA  . ILE A 1 168 ? -47.455 101.702 11.106  1.00 18.54 ? 168 ILE A CA  1 
ATOM 1384  C C   . ILE A 1 168 ? -48.670 101.074 11.805  1.00 20.20 ? 168 ILE A C   1 
ATOM 1385  O O   . ILE A 1 168 ? -49.675 101.743 12.063  1.00 16.95 ? 168 ILE A O   1 
ATOM 1386  C CB  . ILE A 1 168 ? -47.674 101.607 9.564   1.00 16.16 ? 168 ILE A CB  1 
ATOM 1387  C CG1 . ILE A 1 168 ? -46.352 101.709 8.794   1.00 17.87 ? 168 ILE A CG1 1 
ATOM 1388  C CG2 . ILE A 1 168 ? -48.613 102.706 9.104   1.00 15.62 ? 168 ILE A CG2 1 
ATOM 1389  C CD1 . ILE A 1 168 ? -45.668 103.034 8.905   1.00 19.25 ? 168 ILE A CD1 1 
ATOM 1390  N N   . PHE A 1 169 ? -48.565 99.776  12.088  1.00 22.85 ? 169 PHE A N   1 
ATOM 1391  C CA  . PHE A 1 169 ? -49.622 99.022  12.756  1.00 23.79 ? 169 PHE A CA  1 
ATOM 1392  C C   . PHE A 1 169 ? -49.745 99.473  14.209  1.00 24.31 ? 169 PHE A C   1 
ATOM 1393  O O   . PHE A 1 169 ? -50.841 99.765  14.689  1.00 22.74 ? 169 PHE A O   1 
ATOM 1394  C CB  . PHE A 1 169 ? -49.313 97.519  12.686  1.00 23.93 ? 169 PHE A CB  1 
ATOM 1395  C CG  . PHE A 1 169 ? -50.468 96.630  13.073  1.00 22.64 ? 169 PHE A CG  1 
ATOM 1396  C CD1 . PHE A 1 169 ? -51.557 96.467  12.219  1.00 21.03 ? 169 PHE A CD1 1 
ATOM 1397  C CD2 . PHE A 1 169 ? -50.448 95.926  14.285  1.00 21.01 ? 169 PHE A CD2 1 
ATOM 1398  C CE1 . PHE A 1 169 ? -52.605 95.615  12.554  1.00 19.71 ? 169 PHE A CE1 1 
ATOM 1399  C CE2 . PHE A 1 169 ? -51.494 95.073  14.620  1.00 19.30 ? 169 PHE A CE2 1 
ATOM 1400  C CZ  . PHE A 1 169 ? -52.572 94.917  13.757  1.00 19.63 ? 169 PHE A CZ  1 
ATOM 1401  N N   . GLU A 1 170 ? -48.614 99.517  14.904  1.00 27.43 ? 170 GLU A N   1 
ATOM 1402  C CA  . GLU A 1 170 ? -48.576 99.942  16.296  1.00 29.67 ? 170 GLU A CA  1 
ATOM 1403  C C   . GLU A 1 170 ? -47.240 100.638 16.554  1.00 28.66 ? 170 GLU A C   1 
ATOM 1404  O O   . GLU A 1 170 ? -46.273 100.010 16.987  1.00 29.72 ? 170 GLU A O   1 
ATOM 1405  C CB  . GLU A 1 170 ? -48.746 98.741  17.224  1.00 29.75 ? 170 GLU A CB  1 
ATOM 1406  C CG  . GLU A 1 170 ? -48.816 99.118  18.694  1.00 33.56 ? 170 GLU A CG  1 
ATOM 1407  C CD  . GLU A 1 170 ? -49.147 97.940  19.590  1.00 33.55 ? 170 GLU A CD  1 
ATOM 1408  O OE1 . GLU A 1 170 ? -50.213 97.324  19.387  1.00 32.68 ? 170 GLU A OE1 1 
ATOM 1409  O OE2 . GLU A 1 170 ? -48.350 97.638  20.505  1.00 32.23 ? 170 GLU A OE2 1 
ATOM 1410  N N   . PRO A 1 171 ? -47.195 101.966 16.355  1.00 28.59 ? 171 PRO A N   1 
ATOM 1411  C CA  . PRO A 1 171 ? -46.014 102.820 16.533  1.00 29.57 ? 171 PRO A CA  1 
ATOM 1412  C C   . PRO A 1 171 ? -45.209 102.622 17.818  1.00 28.90 ? 171 PRO A C   1 
ATOM 1413  O O   . PRO A 1 171 ? -44.072 103.089 17.917  1.00 27.78 ? 171 PRO A O   1 
ATOM 1414  C CB  . PRO A 1 171 ? -46.606 104.231 16.480  1.00 30.70 ? 171 PRO A CB  1 
ATOM 1415  C CG  . PRO A 1 171 ? -47.776 104.076 15.566  1.00 25.87 ? 171 PRO A CG  1 
ATOM 1416  C CD  . PRO A 1 171 ? -48.383 102.792 16.067  1.00 28.60 ? 171 PRO A CD  1 
ATOM 1417  N N   . ASN A 1 172 ? -45.780 101.927 18.797  1.00 29.08 ? 172 ASN A N   1 
ATOM 1418  C CA  . ASN A 1 172 ? -45.090 101.725 20.069  1.00 27.04 ? 172 ASN A CA  1 
ATOM 1419  C C   . ASN A 1 172 ? -44.576 100.328 20.374  1.00 25.26 ? 172 ASN A C   1 
ATOM 1420  O O   . ASN A 1 172 ? -43.938 100.129 21.406  1.00 24.62 ? 172 ASN A O   1 
ATOM 1421  C CB  . ASN A 1 172 ? -45.964 102.235 21.207  1.00 26.24 ? 172 ASN A CB  1 
ATOM 1422  C CG  . ASN A 1 172 ? -46.370 103.672 21.001  1.00 25.97 ? 172 ASN A CG  1 
ATOM 1423  O OD1 . ASN A 1 172 ? -47.417 103.948 20.415  1.00 18.68 ? 172 ASN A OD1 1 
ATOM 1424  N ND2 . ASN A 1 172 ? -45.511 104.598 21.417  1.00 24.10 ? 172 ASN A ND2 1 
ATOM 1425  N N   . CYS A 1 173 ? -44.804 99.386  19.463  1.00 23.34 ? 173 CYS A N   1 
ATOM 1426  C CA  . CYS A 1 173 ? -44.345 98.015  19.652  1.00 24.70 ? 173 CYS A CA  1 
ATOM 1427  C C   . CYS A 1 173 ? -42.822 98.000  19.689  1.00 24.44 ? 173 CYS A C   1 
ATOM 1428  O O   . CYS A 1 173 ? -42.210 97.323  20.521  1.00 24.32 ? 173 CYS A O   1 
ATOM 1429  C CB  . CYS A 1 173 ? -44.811 97.141  18.496  1.00 25.71 ? 173 CYS A CB  1 
ATOM 1430  S SG  . CYS A 1 173 ? -43.997 97.552  16.943  1.00 25.98 ? 173 CYS A SG  1 
ATOM 1431  N N   . LEU A 1 174 ? -42.222 98.747  18.767  1.00 22.44 ? 174 LEU A N   1 
ATOM 1432  C CA  . LEU A 1 174 ? -40.772 98.834  18.662  1.00 22.19 ? 174 LEU A CA  1 
ATOM 1433  C C   . LEU A 1 174 ? -40.209 99.832  19.676  1.00 22.39 ? 174 LEU A C   1 
ATOM 1434  O O   . LEU A 1 174 ? -39.000 99.883  19.923  1.00 21.46 ? 174 LEU A O   1 
ATOM 1435  C CB  . LEU A 1 174 ? -40.386 99.258  17.246  1.00 19.46 ? 174 LEU A CB  1 
ATOM 1436  C CG  . LEU A 1 174 ? -38.985 98.832  16.824  1.00 18.33 ? 174 LEU A CG  1 
ATOM 1437  C CD1 . LEU A 1 174 ? -38.966 97.353  16.632  1.00 21.31 ? 174 LEU A CD1 1 
ATOM 1438  C CD2 . LEU A 1 174 ? -38.588 99.530  15.579  1.00 16.68 ? 174 LEU A CD2 1 
ATOM 1439  N N   . ASP A 1 175 ? -41.109 100.588 20.293  1.00 24.01 ? 175 ASP A N   1 
ATOM 1440  C CA  . ASP A 1 175 ? -40.764 101.605 21.278  1.00 23.73 ? 175 ASP A CA  1 
ATOM 1441  C C   . ASP A 1 175 ? -40.452 101.000 22.649  1.00 25.15 ? 175 ASP A C   1 
ATOM 1442  O O   . ASP A 1 175 ? -40.805 101.557 23.686  1.00 24.73 ? 175 ASP A O   1 
ATOM 1443  C CB  . ASP A 1 175 ? -41.921 102.604 21.380  1.00 24.13 ? 175 ASP A CB  1 
ATOM 1444  C CG  . ASP A 1 175 ? -41.504 103.933 21.965  1.00 23.83 ? 175 ASP A CG  1 
ATOM 1445  O OD1 . ASP A 1 175 ? -40.293 104.243 21.963  1.00 17.94 ? 175 ASP A OD1 1 
ATOM 1446  O OD2 . ASP A 1 175 ? -42.401 104.677 22.416  1.00 24.67 ? 175 ASP A OD2 1 
ATOM 1447  N N   . ALA A 1 176 ? -39.763 99.866  22.642  1.00 27.15 ? 176 ALA A N   1 
ATOM 1448  C CA  . ALA A 1 176 ? -39.394 99.178  23.867  1.00 25.16 ? 176 ALA A CA  1 
ATOM 1449  C C   . ALA A 1 176 ? -37.992 98.604  23.734  1.00 23.34 ? 176 ALA A C   1 
ATOM 1450  O O   . ALA A 1 176 ? -37.302 98.386  24.724  1.00 24.11 ? 176 ALA A O   1 
ATOM 1451  C CB  . ALA A 1 176 ? -40.386 98.071  24.155  1.00 25.18 ? 176 ALA A CB  1 
ATOM 1452  N N   . PHE A 1 177 ? -37.571 98.370  22.497  1.00 21.61 ? 177 PHE A N   1 
ATOM 1453  C CA  . PHE A 1 177 ? -36.250 97.816  22.230  1.00 20.02 ? 177 PHE A CA  1 
ATOM 1454  C C   . PHE A 1 177 ? -35.464 98.742  21.299  1.00 17.72 ? 177 PHE A C   1 
ATOM 1455  O O   . PHE A 1 177 ? -35.428 98.529  20.084  1.00 17.84 ? 177 PHE A O   1 
ATOM 1456  C CB  . PHE A 1 177 ? -36.376 96.427  21.589  1.00 18.85 ? 177 PHE A CB  1 
ATOM 1457  C CG  . PHE A 1 177 ? -37.414 95.545  22.235  1.00 16.21 ? 177 PHE A CG  1 
ATOM 1458  C CD1 . PHE A 1 177 ? -37.155 94.903  23.439  1.00 18.75 ? 177 PHE A CD1 1 
ATOM 1459  C CD2 . PHE A 1 177 ? -38.654 95.359  21.636  1.00 15.10 ? 177 PHE A CD2 1 
ATOM 1460  C CE1 . PHE A 1 177 ? -38.116 94.093  24.036  1.00 17.06 ? 177 PHE A CE1 1 
ATOM 1461  C CE2 . PHE A 1 177 ? -39.621 94.550  22.227  1.00 13.24 ? 177 PHE A CE2 1 
ATOM 1462  C CZ  . PHE A 1 177 ? -39.350 93.918  23.428  1.00 13.95 ? 177 PHE A CZ  1 
ATOM 1463  N N   . PRO A 1 178 ? -34.780 99.754  21.863  1.00 18.15 ? 178 PRO A N   1 
ATOM 1464  C CA  . PRO A 1 178 ? -33.987 100.713 21.084  1.00 16.11 ? 178 PRO A CA  1 
ATOM 1465  C C   . PRO A 1 178 ? -32.993 100.030 20.147  1.00 15.88 ? 178 PRO A C   1 
ATOM 1466  O O   . PRO A 1 178 ? -32.663 100.563 19.089  1.00 18.79 ? 178 PRO A O   1 
ATOM 1467  C CB  . PRO A 1 178 ? -33.278 101.528 22.166  1.00 14.94 ? 178 PRO A CB  1 
ATOM 1468  C CG  . PRO A 1 178 ? -33.189 100.569 23.316  1.00 17.58 ? 178 PRO A CG  1 
ATOM 1469  C CD  . PRO A 1 178 ? -34.559 99.958  23.304  1.00 21.13 ? 178 PRO A CD  1 
ATOM 1470  N N   . ASN A 1 179 ? -32.540 98.842  20.541  1.00 13.88 ? 179 ASN A N   1 
ATOM 1471  C CA  . ASN A 1 179 ? -31.603 98.038  19.761  1.00 10.35 ? 179 ASN A CA  1 
ATOM 1472  C C   . ASN A 1 179 ? -32.144 97.834  18.342  1.00 13.80 ? 179 ASN A C   1 
ATOM 1473  O O   . ASN A 1 179 ? -31.425 97.986  17.330  1.00 12.49 ? 179 ASN A O   1 
ATOM 1474  C CB  . ASN A 1 179 ? -31.414 96.686  20.460  1.00 4.24  ? 179 ASN A CB  1 
ATOM 1475  C CG  . ASN A 1 179 ? -30.692 95.667  19.597  1.00 3.44  ? 179 ASN A CG  1 
ATOM 1476  O OD1 . ASN A 1 179 ? -29.612 95.927  19.071  1.00 4.71  ? 179 ASN A OD1 1 
ATOM 1477  N ND2 . ASN A 1 179 ? -31.293 94.497  19.446  1.00 2.00  ? 179 ASN A ND2 1 
ATOM 1478  N N   . LEU A 1 180 ? -33.433 97.526  18.265  1.00 15.29 ? 180 LEU A N   1 
ATOM 1479  C CA  . LEU A 1 180 ? -34.092 97.310  16.993  1.00 17.68 ? 180 LEU A CA  1 
ATOM 1480  C C   . LEU A 1 180 ? -34.231 98.631  16.247  1.00 18.61 ? 180 LEU A C   1 
ATOM 1481  O O   . LEU A 1 180 ? -33.973 98.708  15.046  1.00 17.65 ? 180 LEU A O   1 
ATOM 1482  C CB  . LEU A 1 180 ? -35.455 96.664  17.225  1.00 14.28 ? 180 LEU A CB  1 
ATOM 1483  C CG  . LEU A 1 180 ? -35.326 95.256  17.810  1.00 12.59 ? 180 LEU A CG  1 
ATOM 1484  C CD1 . LEU A 1 180 ? -36.671 94.709  18.265  1.00 14.99 ? 180 LEU A CD1 1 
ATOM 1485  C CD2 . LEU A 1 180 ? -34.693 94.346  16.771  1.00 19.38 ? 180 LEU A CD2 1 
ATOM 1486  N N   . LYS A 1 181 ? -34.584 99.682  16.977  1.00 17.03 ? 181 LYS A N   1 
ATOM 1487  C CA  . LYS A 1 181 ? -34.750 100.998 16.380  1.00 20.00 ? 181 LYS A CA  1 
ATOM 1488  C C   . LYS A 1 181 ? -33.506 101.480 15.628  1.00 19.38 ? 181 LYS A C   1 
ATOM 1489  O O   . LYS A 1 181 ? -33.600 101.867 14.461  1.00 20.93 ? 181 LYS A O   1 
ATOM 1490  C CB  . LYS A 1 181 ? -35.157 102.019 17.440  1.00 18.31 ? 181 LYS A CB  1 
ATOM 1491  C CG  . LYS A 1 181 ? -36.535 101.784 18.019  1.00 17.05 ? 181 LYS A CG  1 
ATOM 1492  C CD  . LYS A 1 181 ? -36.917 102.916 18.940  1.00 17.71 ? 181 LYS A CD  1 
ATOM 1493  C CE  . LYS A 1 181 ? -38.327 102.767 19.450  1.00 16.91 ? 181 LYS A CE  1 
ATOM 1494  N NZ  . LYS A 1 181 ? -39.334 102.778 18.358  1.00 17.44 ? 181 LYS A NZ  1 
ATOM 1495  N N   . ASP A 1 182 ? -32.349 101.448 16.284  1.00 18.64 ? 182 ASP A N   1 
ATOM 1496  C CA  . ASP A 1 182 ? -31.098 101.880 15.657  1.00 16.88 ? 182 ASP A CA  1 
ATOM 1497  C C   . ASP A 1 182 ? -30.845 101.116 14.363  1.00 18.14 ? 182 ASP A C   1 
ATOM 1498  O O   . ASP A 1 182 ? -30.412 101.698 13.370  1.00 16.98 ? 182 ASP A O   1 
ATOM 1499  C CB  . ASP A 1 182 ? -29.916 101.692 16.617  1.00 20.98 ? 182 ASP A CB  1 
ATOM 1500  C CG  . ASP A 1 182 ? -29.895 102.728 17.735  1.00 15.27 ? 182 ASP A CG  1 
ATOM 1501  O OD1 . ASP A 1 182 ? -30.888 102.819 18.492  1.00 9.57  ? 182 ASP A OD1 1 
ATOM 1502  O OD2 . ASP A 1 182 ? -28.880 103.453 17.849  1.00 12.56 ? 182 ASP A OD2 1 
ATOM 1503  N N   . PHE A 1 183 ? -31.139 99.816  14.389  1.00 20.37 ? 183 PHE A N   1 
ATOM 1504  C CA  . PHE A 1 183 ? -30.982 98.933  13.233  1.00 19.29 ? 183 PHE A CA  1 
ATOM 1505  C C   . PHE A 1 183 ? -31.734 99.533  12.057  1.00 19.46 ? 183 PHE A C   1 
ATOM 1506  O O   . PHE A 1 183 ? -31.197 99.675  10.958  1.00 18.42 ? 183 PHE A O   1 
ATOM 1507  C CB  . PHE A 1 183 ? -31.553 97.547  13.563  1.00 21.83 ? 183 PHE A CB  1 
ATOM 1508  C CG  . PHE A 1 183 ? -31.801 96.676  12.359  1.00 20.68 ? 183 PHE A CG  1 
ATOM 1509  C CD1 . PHE A 1 183 ? -30.741 96.122  11.658  1.00 18.71 ? 183 PHE A CD1 1 
ATOM 1510  C CD2 . PHE A 1 183 ? -33.098 96.404  11.938  1.00 20.02 ? 183 PHE A CD2 1 
ATOM 1511  C CE1 . PHE A 1 183 ? -30.965 95.310  10.560  1.00 11.41 ? 183 PHE A CE1 1 
ATOM 1512  C CE2 . PHE A 1 183 ? -33.332 95.596  10.844  1.00 14.61 ? 183 PHE A CE2 1 
ATOM 1513  C CZ  . PHE A 1 183 ? -32.262 95.045  10.150  1.00 10.30 ? 183 PHE A CZ  1 
ATOM 1514  N N   . ILE A 1 184 ? -32.978 99.913  12.312  1.00 18.97 ? 184 ILE A N   1 
ATOM 1515  C CA  . ILE A 1 184 ? -33.821 100.508 11.291  1.00 17.36 ? 184 ILE A CA  1 
ATOM 1516  C C   . ILE A 1 184 ? -33.199 101.790 10.741  1.00 16.20 ? 184 ILE A C   1 
ATOM 1517  O O   . ILE A 1 184 ? -32.957 101.894 9.534   1.00 12.65 ? 184 ILE A O   1 
ATOM 1518  C CB  . ILE A 1 184 ? -35.245 100.753 11.846  1.00 18.01 ? 184 ILE A CB  1 
ATOM 1519  C CG1 . ILE A 1 184 ? -35.858 99.405  12.240  1.00 17.95 ? 184 ILE A CG1 1 
ATOM 1520  C CG2 . ILE A 1 184 ? -36.108 101.497 10.826  1.00 17.77 ? 184 ILE A CG2 1 
ATOM 1521  C CD1 . ILE A 1 184 ? -37.254 99.476  12.681  1.00 17.71 ? 184 ILE A CD1 1 
ATOM 1522  N N   . SER A 1 185 ? -32.862 102.717 11.634  1.00 15.40 ? 185 SER A N   1 
ATOM 1523  C CA  . SER A 1 185 ? -32.267 103.988 11.230  1.00 14.92 ? 185 SER A CA  1 
ATOM 1524  C C   . SER A 1 185 ? -30.965 103.789 10.466  1.00 15.18 ? 185 SER A C   1 
ATOM 1525  O O   . SER A 1 185 ? -30.657 104.547 9.544   1.00 15.75 ? 185 SER A O   1 
ATOM 1526  C CB  . SER A 1 185 ? -32.029 104.888 12.439  1.00 13.68 ? 185 SER A CB  1 
ATOM 1527  O OG  . SER A 1 185 ? -31.692 106.203 12.032  1.00 11.00 ? 185 SER A OG  1 
ATOM 1528  N N   . ARG A 1 186 ? -30.203 102.771 10.848  1.00 14.68 ? 186 ARG A N   1 
ATOM 1529  C CA  . ARG A 1 186 ? -28.951 102.470 10.169  1.00 17.20 ? 186 ARG A CA  1 
ATOM 1530  C C   . ARG A 1 186 ? -29.310 102.062 8.745   1.00 17.60 ? 186 ARG A C   1 
ATOM 1531  O O   . ARG A 1 186 ? -28.801 102.634 7.772   1.00 19.71 ? 186 ARG A O   1 
ATOM 1532  C CB  . ARG A 1 186 ? -28.229 101.307 10.860  1.00 15.64 ? 186 ARG A CB  1 
ATOM 1533  C CG  . ARG A 1 186 ? -26.815 101.606 11.328  1.00 15.11 ? 186 ARG A CG  1 
ATOM 1534  C CD  . ARG A 1 186 ? -26.056 100.326 11.646  1.00 17.64 ? 186 ARG A CD  1 
ATOM 1535  N NE  . ARG A 1 186 ? -26.854 99.385  12.427  1.00 21.10 ? 186 ARG A NE  1 
ATOM 1536  C CZ  . ARG A 1 186 ? -27.090 99.490  13.730  1.00 20.87 ? 186 ARG A CZ  1 
ATOM 1537  N NH1 . ARG A 1 186 ? -26.591 100.500 14.429  1.00 19.61 ? 186 ARG A NH1 1 
ATOM 1538  N NH2 . ARG A 1 186 ? -27.835 98.579  14.337  1.00 18.58 ? 186 ARG A NH2 1 
ATOM 1539  N N   . PHE A 1 187 ? -30.252 101.115 8.641   1.00 17.25 ? 187 PHE A N   1 
ATOM 1540  C CA  . PHE A 1 187 ? -30.689 100.600 7.357   1.00 16.80 ? 187 PHE A CA  1 
ATOM 1541  C C   . PHE A 1 187 ? -31.097 101.726 6.413   1.00 19.62 ? 187 PHE A C   1 
ATOM 1542  O O   . PHE A 1 187 ? -30.644 101.796 5.274   1.00 18.93 ? 187 PHE A O   1 
ATOM 1543  C CB  . PHE A 1 187 ? -31.855 99.629  7.544   1.00 14.82 ? 187 PHE A CB  1 
ATOM 1544  C CG  . PHE A 1 187 ? -32.101 98.759  6.351   1.00 12.80 ? 187 PHE A CG  1 
ATOM 1545  C CD1 . PHE A 1 187 ? -31.389 97.580  6.184   1.00 10.32 ? 187 PHE A CD1 1 
ATOM 1546  C CD2 . PHE A 1 187 ? -32.993 99.144  5.359   1.00 7.16  ? 187 PHE A CD2 1 
ATOM 1547  C CE1 . PHE A 1 187 ? -31.560 96.803  5.049   1.00 9.85  ? 187 PHE A CE1 1 
ATOM 1548  C CE2 . PHE A 1 187 ? -33.168 98.370  4.219   1.00 3.23  ? 187 PHE A CE2 1 
ATOM 1549  C CZ  . PHE A 1 187 ? -32.449 97.200  4.064   1.00 8.23  ? 187 PHE A CZ  1 
ATOM 1550  N N   . GLU A 1 188 ? -31.931 102.628 6.904   1.00 22.27 ? 188 GLU A N   1 
ATOM 1551  C CA  . GLU A 1 188 ? -32.388 103.743 6.100   1.00 21.24 ? 188 GLU A CA  1 
ATOM 1552  C C   . GLU A 1 188 ? -31.268 104.700 5.719   1.00 21.40 ? 188 GLU A C   1 
ATOM 1553  O O   . GLU A 1 188 ? -31.326 105.326 4.664   1.00 21.23 ? 188 GLU A O   1 
ATOM 1554  C CB  . GLU A 1 188 ? -33.491 104.500 6.829   1.00 23.01 ? 188 GLU A CB  1 
ATOM 1555  C CG  . GLU A 1 188 ? -34.731 103.668 7.054   1.00 27.23 ? 188 GLU A CG  1 
ATOM 1556  C CD  . GLU A 1 188 ? -35.942 104.499 7.404   1.00 29.16 ? 188 GLU A CD  1 
ATOM 1557  O OE1 . GLU A 1 188 ? -35.933 105.722 7.133   1.00 24.52 ? 188 GLU A OE1 1 
ATOM 1558  O OE2 . GLU A 1 188 ? -36.908 103.917 7.943   1.00 31.21 ? 188 GLU A OE2 1 
ATOM 1559  N N   . GLY A 1 189 ? -30.256 104.808 6.574   1.00 20.12 ? 189 GLY A N   1 
ATOM 1560  C CA  . GLY A 1 189 ? -29.142 105.703 6.311   1.00 18.90 ? 189 GLY A CA  1 
ATOM 1561  C C   . GLY A 1 189 ? -28.179 105.252 5.225   1.00 18.25 ? 189 GLY A C   1 
ATOM 1562  O O   . GLY A 1 189 ? -27.266 106.014 4.832   1.00 17.88 ? 189 GLY A O   1 
ATOM 1563  N N   . LEU A 1 190 ? -28.323 104.008 4.776   1.00 16.77 ? 190 LEU A N   1 
ATOM 1564  C CA  . LEU A 1 190 ? -27.466 103.464 3.728   1.00 15.66 ? 190 LEU A CA  1 
ATOM 1565  C C   . LEU A 1 190 ? -27.660 104.296 2.461   1.00 16.77 ? 190 LEU A C   1 
ATOM 1566  O O   . LEU A 1 190 ? -28.771 104.386 1.939   1.00 17.07 ? 190 LEU A O   1 
ATOM 1567  C CB  . LEU A 1 190 ? -27.815 101.995 3.459   1.00 15.69 ? 190 LEU A CB  1 
ATOM 1568  C CG  . LEU A 1 190 ? -27.498 100.944 4.532   1.00 13.12 ? 190 LEU A CG  1 
ATOM 1569  C CD1 . LEU A 1 190 ? -28.102 99.592  4.159   1.00 15.40 ? 190 LEU A CD1 1 
ATOM 1570  C CD2 . LEU A 1 190 ? -25.997 100.821 4.697   1.00 10.77 ? 190 LEU A CD2 1 
ATOM 1571  N N   . GLU A 1 191 ? -26.574 104.901 1.982   1.00 17.67 ? 191 GLU A N   1 
ATOM 1572  C CA  . GLU A 1 191 ? -26.580 105.755 0.789   1.00 20.16 ? 191 GLU A CA  1 
ATOM 1573  C C   . GLU A 1 191 ? -27.599 105.392 -0.313  1.00 19.79 ? 191 GLU A C   1 
ATOM 1574  O O   . GLU A 1 191 ? -28.607 106.082 -0.469  1.00 19.95 ? 191 GLU A O   1 
ATOM 1575  C CB  . GLU A 1 191 ? -25.163 105.842 0.196   1.00 22.41 ? 191 GLU A CB  1 
ATOM 1576  C CG  . GLU A 1 191 ? -24.138 106.503 1.136   1.00 25.02 ? 191 GLU A CG  1 
ATOM 1577  C CD  . GLU A 1 191 ? -22.717 106.548 0.575   1.00 25.11 ? 191 GLU A CD  1 
ATOM 1578  O OE1 . GLU A 1 191 ? -21.958 105.550 0.716   1.00 25.62 ? 191 GLU A OE1 1 
ATOM 1579  O OE2 . GLU A 1 191 ? -22.335 107.599 0.017   1.00 27.69 ? 191 GLU A OE2 1 
ATOM 1580  N N   . LYS A 1 192 ? -27.368 104.277 -0.983  1.00 19.29 ? 192 LYS A N   1 
ATOM 1581  C CA  . LYS A 1 192 ? -28.260 103.829 -2.047  1.00 20.16 ? 192 LYS A CA  1 
ATOM 1582  C C   . LYS A 1 192 ? -29.632 103.340 -1.583  1.00 21.65 ? 192 LYS A C   1 
ATOM 1583  O O   . LYS A 1 192 ? -30.402 102.798 -2.371  1.00 26.21 ? 192 LYS A O   1 
ATOM 1584  C CB  . LYS A 1 192 ? -27.567 102.789 -2.937  1.00 22.44 ? 192 LYS A CB  1 
ATOM 1585  C CG  . LYS A 1 192 ? -26.800 101.692 -2.212  1.00 19.50 ? 192 LYS A CG  1 
ATOM 1586  C CD  . LYS A 1 192 ? -25.929 100.926 -3.201  1.00 22.28 ? 192 LYS A CD  1 
ATOM 1587  C CE  . LYS A 1 192 ? -25.079 99.857  -2.537  1.00 26.12 ? 192 LYS A CE  1 
ATOM 1588  N NZ  . LYS A 1 192 ? -24.021 100.397 -1.647  1.00 28.54 ? 192 LYS A NZ  1 
ATOM 1589  N N   . ILE A 1 193 ? -29.942 103.546 -0.310  1.00 19.11 ? 193 ILE A N   1 
ATOM 1590  C CA  . ILE A 1 193 ? -31.229 103.153 0.242   1.00 19.86 ? 193 ILE A CA  1 
ATOM 1591  C C   . ILE A 1 193 ? -32.044 104.417 0.476   1.00 20.61 ? 193 ILE A C   1 
ATOM 1592  O O   . ILE A 1 193 ? -33.240 104.464 0.168   1.00 19.45 ? 193 ILE A O   1 
ATOM 1593  C CB  . ILE A 1 193 ? -31.067 102.345 1.551   1.00 19.70 ? 193 ILE A CB  1 
ATOM 1594  C CG1 . ILE A 1 193 ? -30.489 100.958 1.241   1.00 17.64 ? 193 ILE A CG1 1 
ATOM 1595  C CG2 . ILE A 1 193 ? -32.402 102.222 2.281   1.00 17.85 ? 193 ILE A CG2 1 
ATOM 1596  C CD1 . ILE A 1 193 ? -31.334 100.120 0.291   1.00 23.23 ? 193 ILE A CD1 1 
ATOM 1597  N N   . SER A 1 194 ? -31.380 105.456 0.973   1.00 24.25 ? 194 SER A N   1 
ATOM 1598  C CA  . SER A 1 194 ? -32.029 106.744 1.218   1.00 24.23 ? 194 SER A CA  1 
ATOM 1599  C C   . SER A 1 194 ? -32.476 107.330 -0.128  1.00 24.68 ? 194 SER A C   1 
ATOM 1600  O O   . SER A 1 194 ? -33.550 107.936 -0.240  1.00 22.87 ? 194 SER A O   1 
ATOM 1601  C CB  . SER A 1 194 ? -31.053 107.719 1.888   1.00 21.88 ? 194 SER A CB  1 
ATOM 1602  O OG  . SER A 1 194 ? -30.448 107.153 3.036   1.00 16.64 ? 194 SER A OG  1 
ATOM 1603  N N   . ALA A 1 195 ? -31.636 107.142 -1.144  1.00 26.73 ? 195 ALA A N   1 
ATOM 1604  C CA  . ALA A 1 195 ? -31.915 107.629 -2.489  1.00 27.28 ? 195 ALA A CA  1 
ATOM 1605  C C   . ALA A 1 195 ? -33.183 106.976 -3.019  1.00 27.62 ? 195 ALA A C   1 
ATOM 1606  O O   . ALA A 1 195 ? -34.068 107.650 -3.535  1.00 28.94 ? 195 ALA A O   1 
ATOM 1607  C CB  . ALA A 1 195 ? -30.745 107.329 -3.412  1.00 26.96 ? 195 ALA A CB  1 
ATOM 1608  N N   . TYR A 1 196 ? -33.277 105.662 -2.876  1.00 27.51 ? 196 TYR A N   1 
ATOM 1609  C CA  . TYR A 1 196 ? -34.451 104.947 -3.340  1.00 27.43 ? 196 TYR A CA  1 
ATOM 1610  C C   . TYR A 1 196 ? -35.694 105.398 -2.575  1.00 26.63 ? 196 TYR A C   1 
ATOM 1611  O O   . TYR A 1 196 ? -36.747 105.616 -3.173  1.00 25.69 ? 196 TYR A O   1 
ATOM 1612  C CB  . TYR A 1 196 ? -34.252 103.438 -3.192  1.00 28.76 ? 196 TYR A CB  1 
ATOM 1613  C CG  . TYR A 1 196 ? -35.489 102.643 -3.532  1.00 30.68 ? 196 TYR A CG  1 
ATOM 1614  C CD1 . TYR A 1 196 ? -36.090 102.751 -4.786  1.00 29.65 ? 196 TYR A CD1 1 
ATOM 1615  C CD2 . TYR A 1 196 ? -36.083 101.811 -2.588  1.00 32.85 ? 196 TYR A CD2 1 
ATOM 1616  C CE1 . TYR A 1 196 ? -37.250 102.054 -5.085  1.00 30.44 ? 196 TYR A CE1 1 
ATOM 1617  C CE2 . TYR A 1 196 ? -37.242 101.109 -2.880  1.00 33.00 ? 196 TYR A CE2 1 
ATOM 1618  C CZ  . TYR A 1 196 ? -37.823 101.237 -4.126  1.00 32.54 ? 196 TYR A CZ  1 
ATOM 1619  O OH  . TYR A 1 196 ? -38.996 100.568 -4.376  1.00 34.68 ? 196 TYR A OH  1 
ATOM 1620  N N   . MET A 1 197 ? -35.558 105.560 -1.262  1.00 25.15 ? 197 MET A N   1 
ATOM 1621  C CA  . MET A 1 197 ? -36.669 105.979 -0.411  1.00 25.48 ? 197 MET A CA  1 
ATOM 1622  C C   . MET A 1 197 ? -37.283 107.326 -0.774  1.00 25.89 ? 197 MET A C   1 
ATOM 1623  O O   . MET A 1 197 ? -38.451 107.575 -0.487  1.00 26.81 ? 197 MET A O   1 
ATOM 1624  C CB  . MET A 1 197 ? -36.258 105.962 1.060   1.00 22.32 ? 197 MET A CB  1 
ATOM 1625  C CG  . MET A 1 197 ? -36.064 104.568 1.612   1.00 20.19 ? 197 MET A CG  1 
ATOM 1626  S SD  . MET A 1 197 ? -35.767 104.563 3.380   1.00 21.22 ? 197 MET A SD  1 
ATOM 1627  C CE  . MET A 1 197 ? -37.408 104.500 4.026   1.00 14.53 ? 197 MET A CE  1 
ATOM 1628  N N   . LYS A 1 198 ? -36.494 108.210 -1.370  1.00 25.93 ? 198 LYS A N   1 
ATOM 1629  C CA  . LYS A 1 198 ? -37.005 109.511 -1.788  1.00 26.97 ? 198 LYS A CA  1 
ATOM 1630  C C   . LYS A 1 198 ? -36.959 109.575 -3.314  1.00 27.35 ? 198 LYS A C   1 
ATOM 1631  O O   . LYS A 1 198 ? -36.698 110.645 -3.910  1.00 26.23 ? 198 LYS A O   1 
ATOM 1632  C CB  . LYS A 1 198 ? -36.192 110.644 -1.153  1.00 29.99 ? 198 LYS A CB  1 
ATOM 1633  C CG  . LYS A 1 198 ? -36.206 110.603 0.371   1.00 30.93 ? 198 LYS A CG  1 
ATOM 1634  C CD  . LYS A 1 198 ? -35.663 111.873 1.000   1.00 30.65 ? 198 LYS A CD  1 
ATOM 1635  C CE  . LYS A 1 198 ? -35.576 111.718 2.510   1.00 32.05 ? 198 LYS A CE  1 
ATOM 1636  N NZ  . LYS A 1 198 ? -35.263 112.997 3.201   1.00 32.95 ? 198 LYS A NZ  1 
ATOM 1637  N N   . SER A 1 199 ? -37.211 108.418 -3.926  1.00 25.35 ? 199 SER A N   1 
ATOM 1638  C CA  . SER A 1 199 ? -37.215 108.255 -5.372  1.00 24.79 ? 199 SER A CA  1 
ATOM 1639  C C   . SER A 1 199 ? -38.622 107.888 -5.822  1.00 26.54 ? 199 SER A C   1 
ATOM 1640  O O   . SER A 1 199 ? -39.405 107.337 -5.046  1.00 28.08 ? 199 SER A O   1 
ATOM 1641  C CB  . SER A 1 199 ? -36.222 107.163 -5.776  1.00 24.08 ? 199 SER A CB  1 
ATOM 1642  O OG  . SER A 1 199 ? -36.183 106.996 -7.178  1.00 20.21 ? 199 SER A OG  1 
ATOM 1643  N N   . SER A 1 200 ? -38.916 108.153 -7.091  1.00 28.08 ? 200 SER A N   1 
ATOM 1644  C CA  . SER A 1 200 ? -40.227 107.882 -7.675  1.00 28.84 ? 200 SER A CA  1 
ATOM 1645  C C   . SER A 1 200 ? -40.625 106.402 -7.749  1.00 26.94 ? 200 SER A C   1 
ATOM 1646  O O   . SER A 1 200 ? -41.775 106.090 -8.072  1.00 27.08 ? 200 SER A O   1 
ATOM 1647  C CB  . SER A 1 200 ? -40.305 108.508 -9.070  1.00 27.43 ? 200 SER A CB  1 
ATOM 1648  O OG  . SER A 1 200 ? -39.767 109.821 -9.074  1.00 29.51 ? 200 SER A OG  1 
ATOM 1649  N N   . ARG A 1 201 ? -39.690 105.496 -7.468  1.00 25.39 ? 201 ARG A N   1 
ATOM 1650  C CA  . ARG A 1 201 ? -39.988 104.067 -7.530  1.00 25.18 ? 201 ARG A CA  1 
ATOM 1651  C C   . ARG A 1 201 ? -40.209 103.435 -6.160  1.00 24.90 ? 201 ARG A C   1 
ATOM 1652  O O   . ARG A 1 201 ? -40.405 102.224 -6.058  1.00 24.16 ? 201 ARG A O   1 
ATOM 1653  C CB  . ARG A 1 201 ? -38.871 103.297 -8.236  1.00 24.91 ? 201 ARG A CB  1 
ATOM 1654  C CG  . ARG A 1 201 ? -38.419 103.854 -9.570  1.00 27.14 ? 201 ARG A CG  1 
ATOM 1655  C CD  . ARG A 1 201 ? -37.446 104.993 -9.371  1.00 27.92 ? 201 ARG A CD  1 
ATOM 1656  N NE  . ARG A 1 201 ? -36.482 104.695 -8.313  1.00 29.39 ? 201 ARG A NE  1 
ATOM 1657  C CZ  . ARG A 1 201 ? -35.404 103.929 -8.457  1.00 27.60 ? 201 ARG A CZ  1 
ATOM 1658  N NH1 . ARG A 1 201 ? -35.131 103.360 -9.623  1.00 26.79 ? 201 ARG A NH1 1 
ATOM 1659  N NH2 . ARG A 1 201 ? -34.575 103.763 -7.437  1.00 24.18 ? 201 ARG A NH2 1 
ATOM 1660  N N   . PHE A 1 202 ? -40.154 104.233 -5.104  1.00 26.07 ? 202 PHE A N   1 
ATOM 1661  C CA  . PHE A 1 202 ? -40.334 103.686 -3.770  1.00 26.78 ? 202 PHE A CA  1 
ATOM 1662  C C   . PHE A 1 202 ? -41.787 103.317 -3.494  1.00 25.31 ? 202 PHE A C   1 
ATOM 1663  O O   . PHE A 1 202 ? -42.674 104.169 -3.560  1.00 25.19 ? 202 PHE A O   1 
ATOM 1664  C CB  . PHE A 1 202 ? -39.822 104.668 -2.715  1.00 26.27 ? 202 PHE A CB  1 
ATOM 1665  C CG  . PHE A 1 202 ? -39.768 104.091 -1.333  1.00 23.79 ? 202 PHE A CG  1 
ATOM 1666  C CD1 . PHE A 1 202 ? -39.171 102.855 -1.110  1.00 23.55 ? 202 PHE A CD1 1 
ATOM 1667  C CD2 . PHE A 1 202 ? -40.341 104.767 -0.261  1.00 20.45 ? 202 PHE A CD2 1 
ATOM 1668  C CE1 . PHE A 1 202 ? -39.144 102.282 0.158   1.00 25.43 ? 202 PHE A CE1 1 
ATOM 1669  C CE2 . PHE A 1 202 ? -40.322 104.212 1.014   1.00 23.66 ? 202 PHE A CE2 1 
ATOM 1670  C CZ  . PHE A 1 202 ? -39.722 102.969 1.225   1.00 23.34 ? 202 PHE A CZ  1 
ATOM 1671  N N   . LEU A 1 203 ? -42.023 102.044 -3.184  1.00 24.48 ? 203 LEU A N   1 
ATOM 1672  C CA  . LEU A 1 203 ? -43.373 101.562 -2.889  1.00 26.71 ? 203 LEU A CA  1 
ATOM 1673  C C   . LEU A 1 203 ? -43.519 101.151 -1.417  1.00 27.96 ? 203 LEU A C   1 
ATOM 1674  O O   . LEU A 1 203 ? -43.179 100.027 -1.032  1.00 26.01 ? 203 LEU A O   1 
ATOM 1675  C CB  . LEU A 1 203 ? -43.734 100.397 -3.821  1.00 26.66 ? 203 LEU A CB  1 
ATOM 1676  C CG  . LEU A 1 203 ? -45.138 99.776  -3.805  1.00 22.23 ? 203 LEU A CG  1 
ATOM 1677  C CD1 . LEU A 1 203 ? -46.232 100.842 -3.877  1.00 20.67 ? 203 LEU A CD1 1 
ATOM 1678  C CD2 . LEU A 1 203 ? -45.246 98.804  -4.976  1.00 18.51 ? 203 LEU A CD2 1 
ATOM 1679  N N   . PRO A 1 204 ? -43.964 102.090 -0.562  1.00 27.46 ? 204 PRO A N   1 
ATOM 1680  C CA  . PRO A 1 204 ? -44.152 101.844 0.870   1.00 26.31 ? 204 PRO A CA  1 
ATOM 1681  C C   . PRO A 1 204 ? -45.593 101.499 1.255   1.00 25.71 ? 204 PRO A C   1 
ATOM 1682  O O   . PRO A 1 204 ? -45.846 101.014 2.353   1.00 26.03 ? 204 PRO A O   1 
ATOM 1683  C CB  . PRO A 1 204 ? -43.724 103.171 1.482   1.00 25.37 ? 204 PRO A CB  1 
ATOM 1684  C CG  . PRO A 1 204 ? -44.293 104.160 0.506   1.00 27.04 ? 204 PRO A CG  1 
ATOM 1685  C CD  . PRO A 1 204 ? -44.023 103.537 -0.856  1.00 26.91 ? 204 PRO A CD  1 
ATOM 1686  N N   . LYS A 1 205 ? -46.533 101.765 0.354   1.00 26.42 ? 205 LYS A N   1 
ATOM 1687  C CA  . LYS A 1 205 ? -47.948 101.501 0.602   1.00 24.95 ? 205 LYS A CA  1 
ATOM 1688  C C   . LYS A 1 205 ? -48.665 101.657 -0.743  1.00 24.06 ? 205 LYS A C   1 
ATOM 1689  O O   . LYS A 1 205 ? -48.196 102.399 -1.606  1.00 24.37 ? 205 LYS A O   1 
ATOM 1690  C CB  . LYS A 1 205 ? -48.476 102.509 1.631   1.00 23.88 ? 205 LYS A CB  1 
ATOM 1691  C CG  . LYS A 1 205 ? -49.742 102.096 2.352   1.00 22.51 ? 205 LYS A CG  1 
ATOM 1692  C CD  . LYS A 1 205 ? -49.684 102.431 3.843   1.00 22.15 ? 205 LYS A CD  1 
ATOM 1693  C CE  . LYS A 1 205 ? -49.472 103.923 4.117   1.00 23.65 ? 205 LYS A CE  1 
ATOM 1694  N NZ  . LYS A 1 205 ? -50.582 104.778 3.609   1.00 20.00 ? 205 LYS A NZ  1 
ATOM 1695  N N   . PRO A 1 206 ? -49.802 100.964 -0.946  1.00 24.10 ? 206 PRO A N   1 
ATOM 1696  C CA  . PRO A 1 206 ? -50.524 100.036 -0.059  1.00 22.66 ? 206 PRO A CA  1 
ATOM 1697  C C   . PRO A 1 206 ? -49.707 98.875  0.501   1.00 23.07 ? 206 PRO A C   1 
ATOM 1698  O O   . PRO A 1 206 ? -48.839 98.325  -0.171  1.00 23.30 ? 206 PRO A O   1 
ATOM 1699  C CB  . PRO A 1 206 ? -51.674 99.543  -0.943  1.00 22.71 ? 206 PRO A CB  1 
ATOM 1700  C CG  . PRO A 1 206 ? -51.109 99.658  -2.336  1.00 21.78 ? 206 PRO A CG  1 
ATOM 1701  C CD  . PRO A 1 206 ? -50.438 100.997 -2.275  1.00 22.77 ? 206 PRO A CD  1 
ATOM 1702  N N   . LEU A 1 207 ? -49.998 98.520  1.748   1.00 24.35 ? 207 LEU A N   1 
ATOM 1703  C CA  . LEU A 1 207 ? -49.312 97.430  2.430   1.00 22.84 ? 207 LEU A CA  1 
ATOM 1704  C C   . LEU A 1 207 ? -49.833 96.088  1.937   1.00 24.12 ? 207 LEU A C   1 
ATOM 1705  O O   . LEU A 1 207 ? -49.086 95.291  1.364   1.00 24.67 ? 207 LEU A O   1 
ATOM 1706  C CB  . LEU A 1 207 ? -49.528 97.524  3.948   1.00 20.49 ? 207 LEU A CB  1 
ATOM 1707  C CG  . LEU A 1 207 ? -48.998 98.723  4.740   1.00 19.90 ? 207 LEU A CG  1 
ATOM 1708  C CD1 . LEU A 1 207 ? -49.497 98.643  6.171   1.00 18.46 ? 207 LEU A CD1 1 
ATOM 1709  C CD2 . LEU A 1 207 ? -47.478 98.748  4.710   1.00 20.66 ? 207 LEU A CD2 1 
ATOM 1710  N N   . TYR A 1 208 ? -51.125 95.863  2.149   1.00 22.28 ? 208 TYR A N   1 
ATOM 1711  C CA  . TYR A 1 208 ? -51.782 94.623  1.762   1.00 22.21 ? 208 TYR A CA  1 
ATOM 1712  C C   . TYR A 1 208 ? -52.570 94.793  0.474   1.00 22.07 ? 208 TYR A C   1 
ATOM 1713  O O   . TYR A 1 208 ? -52.713 95.908  -0.027  1.00 21.79 ? 208 TYR A O   1 
ATOM 1714  C CB  . TYR A 1 208 ? -52.702 94.160  2.889   1.00 22.58 ? 208 TYR A CB  1 
ATOM 1715  C CG  . TYR A 1 208 ? -51.948 93.726  4.124   1.00 23.45 ? 208 TYR A CG  1 
ATOM 1716  C CD1 . TYR A 1 208 ? -51.264 94.649  4.916   1.00 24.09 ? 208 TYR A CD1 1 
ATOM 1717  C CD2 . TYR A 1 208 ? -51.874 92.382  4.471   1.00 25.74 ? 208 TYR A CD2 1 
ATOM 1718  C CE1 . TYR A 1 208 ? -50.515 94.241  6.018   1.00 25.23 ? 208 TYR A CE1 1 
ATOM 1719  C CE2 . TYR A 1 208 ? -51.131 91.962  5.570   1.00 24.88 ? 208 TYR A CE2 1 
ATOM 1720  C CZ  . TYR A 1 208 ? -50.451 92.894  6.336   1.00 24.86 ? 208 TYR A CZ  1 
ATOM 1721  O OH  . TYR A 1 208 ? -49.684 92.466  7.397   1.00 26.24 ? 208 TYR A OH  1 
ATOM 1722  N N   . THR A 1 209 ? -53.059 93.689  -0.082  1.00 20.93 ? 209 THR A N   1 
ATOM 1723  C CA  . THR A 1 209 ? -53.830 93.755  -1.321  1.00 20.53 ? 209 THR A CA  1 
ATOM 1724  C C   . THR A 1 209 ? -55.112 94.554  -1.141  1.00 20.69 ? 209 THR A C   1 
ATOM 1725  O O   . THR A 1 209 ? -55.538 94.783  0.008   1.00 18.02 ? 209 THR A O   1 
ATOM 1726  C CB  . THR A 1 209 ? -54.169 92.353  -1.869  1.00 21.06 ? 209 THR A CB  1 
ATOM 1727  O OG1 . THR A 1 209 ? -54.783 91.561  -0.844  1.00 14.38 ? 209 THR A OG1 1 
ATOM 1728  C CG2 . THR A 1 209 ? -52.916 91.662  -2.365  1.00 20.28 ? 209 THR A CG2 1 
ATOM 1729  N N   . ARG A 1 210 ? -55.756 94.914  -2.229  1.00 20.13 ? 210 ARG A N   1 
ATOM 1730  C CA  . ARG A 1 210 ? -56.989 95.703  -2.204  1.00 22.30 ? 210 ARG A CA  1 
ATOM 1731  C C   . ARG A 1 210 ? -58.234 94.977  -1.678  1.00 21.78 ? 210 ARG A C   1 
ATOM 1732  O O   . ARG A 1 210 ? -59.359 95.325  -2.025  1.00 21.93 ? 210 ARG A O   1 
ATOM 1733  C CB  . ARG A 1 210 ? -57.253 96.263  -3.603  1.00 24.72 ? 210 ARG A CB  1 
ATOM 1734  C CG  . ARG A 1 210 ? -56.049 97.008  -4.175  1.00 28.48 ? 210 ARG A CG  1 
ATOM 1735  C CD  . ARG A 1 210 ? -56.394 97.782  -5.428  1.00 29.55 ? 210 ARG A CD  1 
ATOM 1736  N NE  . ARG A 1 210 ? -57.473 98.737  -5.194  1.00 31.69 ? 210 ARG A NE  1 
ATOM 1737  C CZ  . ARG A 1 210 ? -57.793 99.720  -6.028  1.00 28.48 ? 210 ARG A CZ  1 
ATOM 1738  N NH1 . ARG A 1 210 ? -57.118 99.894  -7.154  1.00 26.23 ? 210 ARG A NH1 1 
ATOM 1739  N NH2 . ARG A 1 210 ? -58.816 100.512 -5.751  1.00 27.00 ? 210 ARG A NH2 1 
ATOM 1740  N N   . VAL A 1 211 ? -58.027 94.018  -0.785  1.00 19.20 ? 211 VAL A N   1 
ATOM 1741  C CA  . VAL A 1 211 ? -59.113 93.235  -0.219  1.00 16.31 ? 211 VAL A CA  1 
ATOM 1742  C C   . VAL A 1 211 ? -58.909 93.033  1.287   1.00 16.89 ? 211 VAL A C   1 
ATOM 1743  O O   . VAL A 1 211 ? -59.837 92.679  2.019   1.00 18.94 ? 211 VAL A O   1 
ATOM 1744  C CB  . VAL A 1 211 ? -59.182 91.862  -0.928  1.00 14.34 ? 211 VAL A CB  1 
ATOM 1745  C CG1 . VAL A 1 211 ? -57.891 91.085  -0.705  1.00 12.34 ? 211 VAL A CG1 1 
ATOM 1746  C CG2 . VAL A 1 211 ? -60.397 91.072  -0.464  1.00 11.89 ? 211 VAL A CG2 1 
ATOM 1747  N N   . ALA A 1 212 ? -57.690 93.284  1.747   1.00 17.15 ? 212 ALA A N   1 
ATOM 1748  C CA  . ALA A 1 212 ? -57.343 93.114  3.150   1.00 14.83 ? 212 ALA A CA  1 
ATOM 1749  C C   . ALA A 1 212 ? -58.162 94.000  4.076   1.00 14.44 ? 212 ALA A C   1 
ATOM 1750  O O   . ALA A 1 212 ? -58.291 95.201  3.833   1.00 12.80 ? 212 ALA A O   1 
ATOM 1751  C CB  . ALA A 1 212 ? -55.869 93.386  3.347   1.00 11.77 ? 212 ALA A CB  1 
ATOM 1752  N N   . VAL A 1 213 ? -58.648 93.419  5.174   1.00 16.31 ? 213 VAL A N   1 
ATOM 1753  C CA  . VAL A 1 213 ? -59.444 94.161  6.154   1.00 19.16 ? 213 VAL A CA  1 
ATOM 1754  C C   . VAL A 1 213 ? -58.622 95.303  6.753   1.00 21.26 ? 213 VAL A C   1 
ATOM 1755  O O   . VAL A 1 213 ? -59.169 96.240  7.334   1.00 22.54 ? 213 VAL A O   1 
ATOM 1756  C CB  . VAL A 1 213 ? -59.992 93.247  7.291   1.00 17.37 ? 213 VAL A CB  1 
ATOM 1757  C CG1 . VAL A 1 213 ? -60.954 92.211  6.728   1.00 17.54 ? 213 VAL A CG1 1 
ATOM 1758  C CG2 . VAL A 1 213 ? -58.865 92.570  8.020   1.00 16.33 ? 213 VAL A CG2 1 
ATOM 1759  N N   . TRP A 1 214 ? -57.304 95.213  6.621   1.00 23.60 ? 214 TRP A N   1 
ATOM 1760  C CA  . TRP A 1 214 ? -56.397 96.237  7.092   1.00 24.20 ? 214 TRP A CA  1 
ATOM 1761  C C   . TRP A 1 214 ? -55.151 96.278  6.215   1.00 24.44 ? 214 TRP A C   1 
ATOM 1762  O O   . TRP A 1 214 ? -54.549 95.249  5.929   1.00 25.68 ? 214 TRP A O   1 
ATOM 1763  C CB  . TRP A 1 214 ? -56.002 95.976  8.546   1.00 22.58 ? 214 TRP A CB  1 
ATOM 1764  C CG  . TRP A 1 214 ? -55.220 97.113  9.132   1.00 22.33 ? 214 TRP A CG  1 
ATOM 1765  C CD1 . TRP A 1 214 ? -55.726 98.196  9.799   1.00 20.49 ? 214 TRP A CD1 1 
ATOM 1766  C CD2 . TRP A 1 214 ? -53.799 97.319  9.057   1.00 22.99 ? 214 TRP A CD2 1 
ATOM 1767  N NE1 . TRP A 1 214 ? -54.713 99.063  10.134  1.00 21.57 ? 214 TRP A NE1 1 
ATOM 1768  C CE2 . TRP A 1 214 ? -53.522 98.551  9.691   1.00 24.01 ? 214 TRP A CE2 1 
ATOM 1769  C CE3 . TRP A 1 214 ? -52.739 96.582  8.509   1.00 21.82 ? 214 TRP A CE3 1 
ATOM 1770  C CZ2 . TRP A 1 214 ? -52.219 99.070  9.793   1.00 23.85 ? 214 TRP A CZ2 1 
ATOM 1771  C CZ3 . TRP A 1 214 ? -51.441 97.100  8.610   1.00 22.35 ? 214 TRP A CZ3 1 
ATOM 1772  C CH2 . TRP A 1 214 ? -51.181 98.332  9.248   1.00 21.77 ? 214 TRP A CH2 1 
ATOM 1773  N N   . GLY A 1 215 ? -54.771 97.475  5.787   1.00 24.90 ? 215 GLY A N   1 
ATOM 1774  C CA  . GLY A 1 215 ? -53.593 97.625  4.953   1.00 26.49 ? 215 GLY A CA  1 
ATOM 1775  C C   . GLY A 1 215 ? -53.890 97.800  3.478   1.00 27.83 ? 215 GLY A C   1 
ATOM 1776  O O   . GLY A 1 215 ? -52.965 98.103  2.698   1.00 26.75 ? 215 GLY A O   1 
ATOM 1777  N N   . ASN A 1 216 ? -55.151 97.602  3.094   1.00 28.97 ? 216 ASN A N   1 
ATOM 1778  C CA  . ASN A 1 216 ? -55.573 97.738  1.696   1.00 29.98 ? 216 ASN A CA  1 
ATOM 1779  C C   . ASN A 1 216 ? -55.856 99.186  1.265   1.00 29.97 ? 216 ASN A C   1 
ATOM 1780  O O   . ASN A 1 216 ? -56.222 100.018 2.118   1.00 32.48 ? 216 ASN A O   1 
ATOM 1781  C CB  . ASN A 1 216 ? -56.791 96.847  1.407   1.00 28.76 ? 216 ASN A CB  1 
ATOM 1782  C CG  . ASN A 1 216 ? -58.074 97.320  2.094   1.00 31.01 ? 216 ASN A CG  1 
ATOM 1783  O OD1 . ASN A 1 216 ? -59.168 96.977  1.653   1.00 31.32 ? 216 ASN A OD1 1 
ATOM 1784  N ND2 . ASN A 1 216 ? -57.950 98.072  3.195   1.00 29.99 ? 216 ASN A ND2 1 
ATOM 1785  N N   . LYS A 1 217 ? -55.689 99.471  -0.010  1.00 29.60 ? 217 LYS A N   1 
ATOM 1786  C CA  . LYS A 1 217 ? -55.912 100.808 -0.565  1.00 29.05 ? 217 LYS A CA  1 
ATOM 1787  C C   . LYS A 1 217 ? -55.971 100.776 -2.102  1.00 29.06 ? 217 LYS A C   1 
ATOM 1788  O O   . LYS A 1 217 ? -56.922 100.165 -2.629  1.00 26.94 ? 217 LYS A O   1 
ATOM 1789  C CB  . LYS A 1 217 ? -54.812 101.771 -0.091  1.00 28.61 ? 217 LYS A CB  1 
ATOM 1790  C CG  . LYS A 1 217 ? -55.220 102.676 1.063   1.00 25.33 ? 217 LYS A CG  1 
ATOM 1791  C CD  . LYS A 1 217 ? -54.006 103.196 1.801   1.00 26.63 ? 217 LYS A CD  1 
ATOM 1792  C CE  . LYS A 1 217 ? -53.269 102.060 2.485   1.00 26.06 ? 217 LYS A CE  1 
ATOM 1793  N NZ  . LYS A 1 217 ? -54.118 101.375 3.498   1.00 24.16 ? 217 LYS A NZ  1 
ATOM 1794  O OXT . LYS A 1 217 ? -55.080 101.357 -2.780  1.00 27.43 ? 217 LYS A OXT 1 
ATOM 1795  N N   . SER B 1 1   ? -24.746 62.771  19.854  1.00 5.27  ? 1   SER B N   1 
ATOM 1796  C CA  . SER B 1 1   ? -26.141 62.632  19.369  1.00 11.95 ? 1   SER B CA  1 
ATOM 1797  C C   . SER B 1 1   ? -26.817 64.000  19.385  1.00 17.21 ? 1   SER B C   1 
ATOM 1798  O O   . SER B 1 1   ? -26.214 64.983  19.846  1.00 16.31 ? 1   SER B O   1 
ATOM 1799  C CB  . SER B 1 1   ? -26.922 61.665  20.265  1.00 13.41 ? 1   SER B CB  1 
ATOM 1800  O OG  . SER B 1 1   ? -26.850 62.067  21.620  1.00 14.11 ? 1   SER B OG  1 
ATOM 1801  N N   . MET B 1 2   ? -28.026 64.051  18.886  1.00 17.83 ? 2   MET B N   1 
ATOM 1802  C CA  . MET B 1 2   ? -28.775 65.289  18.827  1.00 16.32 ? 2   MET B CA  1 
ATOM 1803  C C   . MET B 1 2   ? -30.192 64.969  19.232  1.00 17.23 ? 2   MET B C   1 
ATOM 1804  O O   . MET B 1 2   ? -30.580 63.784  19.215  1.00 17.70 ? 2   MET B O   1 
ATOM 1805  C CB  . MET B 1 2   ? -28.756 65.810  17.399  1.00 18.10 ? 2   MET B CB  1 
ATOM 1806  C CG  . MET B 1 2   ? -29.616 65.057  16.434  1.00 14.66 ? 2   MET B CG  1 
ATOM 1807  S SD  . MET B 1 2   ? -29.112 65.349  14.769  1.00 10.85 ? 2   MET B SD  1 
ATOM 1808  C CE  . MET B 1 2   ? -28.867 67.078  14.749  1.00 12.91 ? 2   MET B CE  1 
ATOM 1809  N N   . THR B 1 3   ? -30.962 65.953  19.628  1.00 19.77 ? 3   THR B N   1 
ATOM 1810  C CA  . THR B 1 3   ? -32.336 65.693  20.012  1.00 18.54 ? 3   THR B CA  1 
ATOM 1811  C C   . THR B 1 3   ? -33.219 66.520  19.105  1.00 17.57 ? 3   THR B C   1 
ATOM 1812  O O   . THR B 1 3   ? -32.788 67.578  18.605  1.00 16.05 ? 3   THR B O   1 
ATOM 1813  C CB  . THR B 1 3   ? -32.598 65.970  21.539  1.00 19.20 ? 3   THR B CB  1 
ATOM 1814  O OG1 . THR B 1 3   ? -33.387 67.153  21.739  1.00 16.04 ? 3   THR B OG1 1 
ATOM 1815  C CG2 . THR B 1 3   ? -31.282 66.124  22.294  1.00 21.84 ? 3   THR B CG2 1 
ATOM 1816  N N   . LEU B 1 4   ? -34.415 66.037  18.837  1.00 15.42 ? 4   LEU B N   1 
ATOM 1817  C CA  . LEU B 1 4   ? -35.370 66.753  18.008  1.00 12.69 ? 4   LEU B CA  1 
ATOM 1818  C C   . LEU B 1 4   ? -36.617 66.833  18.865  1.00 11.05 ? 4   LEU B C   1 
ATOM 1819  O O   . LEU B 1 4   ? -37.012 65.844  19.486  1.00 4.20  ? 4   LEU B O   1 
ATOM 1820  C CB  . LEU B 1 4   ? -35.657 65.965  16.725  1.00 10.62 ? 4   LEU B CB  1 
ATOM 1821  C CG  . LEU B 1 4   ? -36.255 66.673  15.502  1.00 8.77  ? 4   LEU B CG  1 
ATOM 1822  C CD1 . LEU B 1 4   ? -36.350 65.671  14.366  1.00 6.57  ? 4   LEU B CD1 1 
ATOM 1823  C CD2 . LEU B 1 4   ? -37.620 67.270  15.791  1.00 6.93  ? 4   LEU B CD2 1 
ATOM 1824  N N   . GLY B 1 5   ? -37.200 68.020  18.947  1.00 10.03 ? 5   GLY B N   1 
ATOM 1825  C CA  . GLY B 1 5   ? -38.394 68.184  19.745  1.00 11.90 ? 5   GLY B CA  1 
ATOM 1826  C C   . GLY B 1 5   ? -39.580 68.528  18.901  1.00 14.36 ? 5   GLY B C   1 
ATOM 1827  O O   . GLY B 1 5   ? -39.431 69.177  17.839  1.00 17.08 ? 5   GLY B O   1 
ATOM 1828  N N   . TYR B 1 6   ? -40.756 68.113  19.321  1.00 14.09 ? 6   TYR B N   1 
ATOM 1829  C CA  . TYR B 1 6   ? -42.023 68.375  18.640  1.00 15.91 ? 6   TYR B CA  1 
ATOM 1830  C C   . TYR B 1 6   ? -43.066 67.609  19.449  1.00 18.62 ? 6   TYR B C   1 
ATOM 1831  O O   . TYR B 1 6   ? -42.799 67.203  20.582  1.00 18.20 ? 6   TYR B O   1 
ATOM 1832  C CB  . TYR B 1 6   ? -41.993 67.875  17.183  1.00 11.66 ? 6   TYR B CB  1 
ATOM 1833  C CG  . TYR B 1 6   ? -43.064 68.497  16.304  1.00 6.67  ? 6   TYR B CG  1 
ATOM 1834  C CD1 . TYR B 1 6   ? -43.157 69.875  16.174  1.00 8.49  ? 6   TYR B CD1 1 
ATOM 1835  C CD2 . TYR B 1 6   ? -44.004 67.710  15.633  1.00 7.18  ? 6   TYR B CD2 1 
ATOM 1836  C CE1 . TYR B 1 6   ? -44.150 70.461  15.410  1.00 8.02  ? 6   TYR B CE1 1 
ATOM 1837  C CE2 . TYR B 1 6   ? -45.007 68.288  14.859  1.00 2.22  ? 6   TYR B CE2 1 
ATOM 1838  C CZ  . TYR B 1 6   ? -45.070 69.668  14.757  1.00 8.57  ? 6   TYR B CZ  1 
ATOM 1839  O OH  . TYR B 1 6   ? -46.051 70.279  14.012  1.00 10.98 ? 6   TYR B OH  1 
ATOM 1840  N N   . TRP B 1 7   ? -44.258 67.432  18.901  1.00 19.14 ? 7   TRP B N   1 
ATOM 1841  C CA  . TRP B 1 7   ? -45.292 66.691  19.610  1.00 19.76 ? 7   TRP B CA  1 
ATOM 1842  C C   . TRP B 1 7   ? -45.232 65.241  19.100  1.00 18.02 ? 7   TRP B C   1 
ATOM 1843  O O   . TRP B 1 7   ? -44.381 64.917  18.269  1.00 13.98 ? 7   TRP B O   1 
ATOM 1844  C CB  . TRP B 1 7   ? -46.664 67.314  19.323  1.00 20.82 ? 7   TRP B CB  1 
ATOM 1845  C CG  . TRP B 1 7   ? -46.684 68.822  19.411  1.00 18.35 ? 7   TRP B CG  1 
ATOM 1846  C CD1 . TRP B 1 7   ? -46.246 69.702  18.463  1.00 18.82 ? 7   TRP B CD1 1 
ATOM 1847  C CD2 . TRP B 1 7   ? -47.194 69.619  20.489  1.00 19.62 ? 7   TRP B CD2 1 
ATOM 1848  N NE1 . TRP B 1 7   ? -46.454 70.991  18.878  1.00 18.49 ? 7   TRP B NE1 1 
ATOM 1849  C CE2 . TRP B 1 7   ? -47.033 70.972  20.107  1.00 17.78 ? 7   TRP B CE2 1 
ATOM 1850  C CE3 . TRP B 1 7   ? -47.769 69.321  21.733  1.00 19.69 ? 7   TRP B CE3 1 
ATOM 1851  C CZ2 . TRP B 1 7   ? -47.427 72.028  20.944  1.00 16.55 ? 7   TRP B CZ2 1 
ATOM 1852  C CZ3 . TRP B 1 7   ? -48.163 70.373  22.556  1.00 19.45 ? 7   TRP B CZ3 1 
ATOM 1853  C CH2 . TRP B 1 7   ? -47.988 71.710  22.156  1.00 19.58 ? 7   TRP B CH2 1 
ATOM 1854  N N   . ASP B 1 8   ? -46.094 64.361  19.610  1.00 19.05 ? 8   ASP B N   1 
ATOM 1855  C CA  . ASP B 1 8   ? -46.119 62.976  19.125  1.00 20.65 ? 8   ASP B CA  1 
ATOM 1856  C C   . ASP B 1 8   ? -47.053 62.918  17.914  1.00 20.99 ? 8   ASP B C   1 
ATOM 1857  O O   . ASP B 1 8   ? -47.706 61.910  17.642  1.00 21.55 ? 8   ASP B O   1 
ATOM 1858  C CB  . ASP B 1 8   ? -46.541 61.979  20.222  1.00 21.98 ? 8   ASP B CB  1 
ATOM 1859  C CG  . ASP B 1 8   ? -47.730 62.453  21.041  1.00 22.85 ? 8   ASP B CG  1 
ATOM 1860  O OD1 . ASP B 1 8   ? -48.772 62.813  20.462  1.00 21.85 ? 8   ASP B OD1 1 
ATOM 1861  O OD2 . ASP B 1 8   ? -47.626 62.445  22.281  1.00 23.13 ? 8   ASP B OD2 1 
ATOM 1862  N N   . ILE B 1 9   ? -47.087 64.041  17.204  1.00 20.66 ? 9   ILE B N   1 
ATOM 1863  C CA  . ILE B 1 9   ? -47.898 64.264  16.019  1.00 18.12 ? 9   ILE B CA  1 
ATOM 1864  C C   . ILE B 1 9   ? -46.921 64.409  14.849  1.00 16.65 ? 9   ILE B C   1 
ATOM 1865  O O   . ILE B 1 9   ? -45.778 64.827  15.042  1.00 14.82 ? 9   ILE B O   1 
ATOM 1866  C CB  . ILE B 1 9   ? -48.725 65.589  16.182  1.00 20.45 ? 9   ILE B CB  1 
ATOM 1867  C CG1 . ILE B 1 9   ? -50.041 65.332  16.932  1.00 19.83 ? 9   ILE B CG1 1 
ATOM 1868  C CG2 . ILE B 1 9   ? -48.975 66.274  14.843  1.00 21.05 ? 9   ILE B CG2 1 
ATOM 1869  C CD1 . ILE B 1 9   ? -49.992 65.614  18.433  1.00 21.41 ? 9   ILE B CD1 1 
ATOM 1870  N N   . ARG B 1 10  ? -47.365 64.033  13.652  1.00 15.03 ? 10  ARG B N   1 
ATOM 1871  C CA  . ARG B 1 10  ? -46.560 64.137  12.434  1.00 14.57 ? 10  ARG B CA  1 
ATOM 1872  C C   . ARG B 1 10  ? -46.121 65.594  12.257  1.00 11.55 ? 10  ARG B C   1 
ATOM 1873  O O   . ARG B 1 10  ? -44.921 65.932  12.392  1.00 9.35  ? 10  ARG B O   1 
ATOM 1874  C CB  . ARG B 1 10  ? -47.412 63.701  11.235  1.00 13.94 ? 10  ARG B CB  1 
ATOM 1875  C CG  . ARG B 1 10  ? -46.786 63.901  9.863   1.00 15.45 ? 10  ARG B CG  1 
ATOM 1876  C CD  . ARG B 1 10  ? -47.866 64.237  8.838   1.00 9.10  ? 10  ARG B CD  1 
ATOM 1877  N NE  . ARG B 1 10  ? -47.519 63.838  7.478   1.00 11.65 ? 10  ARG B NE  1 
ATOM 1878  C CZ  . ARG B 1 10  ? -47.686 62.611  6.996   1.00 12.53 ? 10  ARG B CZ  1 
ATOM 1879  N NH1 . ARG B 1 10  ? -48.191 61.654  7.758   1.00 12.21 ? 10  ARG B NH1 1 
ATOM 1880  N NH2 . ARG B 1 10  ? -47.357 62.340  5.745   1.00 14.06 ? 10  ARG B NH2 1 
ATOM 1881  N N   . GLY B 1 11  ? -47.095 66.444  11.950  1.00 10.59 ? 11  GLY B N   1 
ATOM 1882  C CA  . GLY B 1 11  ? -46.848 67.861  11.774  1.00 8.74  ? 11  GLY B CA  1 
ATOM 1883  C C   . GLY B 1 11  ? -45.698 68.216  10.862  1.00 7.34  ? 11  GLY B C   1 
ATOM 1884  O O   . GLY B 1 11  ? -45.391 67.495  9.911   1.00 12.29 ? 11  GLY B O   1 
ATOM 1885  N N   . LEU B 1 12  ? -45.034 69.319  11.188  1.00 5.34  ? 12  LEU B N   1 
ATOM 1886  C CA  . LEU B 1 12  ? -43.910 69.807  10.407  1.00 6.70  ? 12  LEU B CA  1 
ATOM 1887  C C   . LEU B 1 12  ? -42.631 69.052  10.737  1.00 6.51  ? 12  LEU B C   1 
ATOM 1888  O O   . LEU B 1 12  ? -41.573 69.332  10.171  1.00 10.11 ? 12  LEU B O   1 
ATOM 1889  C CB  . LEU B 1 12  ? -43.722 71.301  10.656  1.00 4.77  ? 12  LEU B CB  1 
ATOM 1890  C CG  . LEU B 1 12  ? -44.977 72.153  10.439  1.00 5.83  ? 12  LEU B CG  1 
ATOM 1891  C CD1 . LEU B 1 12  ? -45.435 72.735  11.765  1.00 2.99  ? 12  LEU B CD1 1 
ATOM 1892  C CD2 . LEU B 1 12  ? -44.707 73.256  9.429   1.00 2.90  ? 12  LEU B CD2 1 
ATOM 1893  N N   . ALA B 1 13  ? -42.749 68.066  11.622  1.00 5.94  ? 13  ALA B N   1 
ATOM 1894  C CA  . ALA B 1 13  ? -41.610 67.263  12.047  1.00 4.93  ? 13  ALA B CA  1 
ATOM 1895  C C   . ALA B 1 13  ? -41.302 66.089  11.139  1.00 4.22  ? 13  ALA B C   1 
ATOM 1896  O O   . ALA B 1 13  ? -40.133 65.766  10.915  1.00 3.21  ? 13  ALA B O   1 
ATOM 1897  C CB  . ALA B 1 13  ? -41.825 66.762  13.458  1.00 5.08  ? 13  ALA B CB  1 
ATOM 1898  N N   . HIS B 1 14  ? -42.344 65.466  10.596  1.00 7.47  ? 14  HIS B N   1 
ATOM 1899  C CA  . HIS B 1 14  ? -42.178 64.292  9.744   1.00 9.15  ? 14  HIS B CA  1 
ATOM 1900  C C   . HIS B 1 14  ? -41.112 64.399  8.660   1.00 9.16  ? 14  HIS B C   1 
ATOM 1901  O O   . HIS B 1 14  ? -40.518 63.361  8.287   1.00 8.23  ? 14  HIS B O   1 
ATOM 1902  C CB  . HIS B 1 14  ? -43.509 63.864  9.126   1.00 5.81  ? 14  HIS B CB  1 
ATOM 1903  C CG  . HIS B 1 14  ? -43.471 62.501  8.500   1.00 3.44  ? 14  HIS B CG  1 
ATOM 1904  N ND1 . HIS B 1 14  ? -42.399 61.648  8.640   1.00 5.45  ? 14  HIS B ND1 1 
ATOM 1905  C CD2 . HIS B 1 14  ? -44.369 61.852  7.725   1.00 6.30  ? 14  HIS B CD2 1 
ATOM 1906  C CE1 . HIS B 1 14  ? -42.635 60.533  7.977   1.00 9.45  ? 14  HIS B CE1 1 
ATOM 1907  N NE2 . HIS B 1 14  ? -43.823 60.630  7.411   1.00 10.11 ? 14  HIS B NE2 1 
ATOM 1908  N N   . ALA B 1 15  ? -40.868 65.602  8.160   1.00 7.05  ? 15  ALA B N   1 
ATOM 1909  C CA  . ALA B 1 15  ? -39.859 65.804  7.123   1.00 8.43  ? 15  ALA B CA  1 
ATOM 1910  C C   . ALA B 1 15  ? -38.436 65.663  7.691   1.00 10.85 ? 15  ALA B C   1 
ATOM 1911  O O   . ALA B 1 15  ? -37.606 64.923  7.146   1.00 11.63 ? 15  ALA B O   1 
ATOM 1912  C CB  . ALA B 1 15  ? -40.043 67.173  6.466   1.00 6.17  ? 15  ALA B CB  1 
ATOM 1913  N N   . ILE B 1 16  ? -38.177 66.355  8.801   1.00 10.67 ? 16  ILE B N   1 
ATOM 1914  C CA  . ILE B 1 16  ? -36.872 66.331  9.460   1.00 7.42  ? 16  ILE B CA  1 
ATOM 1915  C C   . ILE B 1 16  ? -36.579 64.924  9.989   1.00 9.45  ? 16  ILE B C   1 
ATOM 1916  O O   . ILE B 1 16  ? -35.481 64.387  9.805   1.00 10.02 ? 16  ILE B O   1 
ATOM 1917  C CB  . ILE B 1 16  ? -36.797 67.367  10.625  1.00 4.55  ? 16  ILE B CB  1 
ATOM 1918  C CG1 . ILE B 1 16  ? -37.062 68.783  10.119  1.00 2.62  ? 16  ILE B CG1 1 
ATOM 1919  C CG2 . ILE B 1 16  ? -35.426 67.357  11.264  1.00 3.89  ? 16  ILE B CG2 1 
ATOM 1920  C CD1 . ILE B 1 16  ? -38.518 69.170  10.080  1.00 6.59  ? 16  ILE B CD1 1 
ATOM 1921  N N   . ARG B 1 17  ? -37.596 64.320  10.594  1.00 9.22  ? 17  ARG B N   1 
ATOM 1922  C CA  . ARG B 1 17  ? -37.508 62.975  11.158  1.00 14.20 ? 17  ARG B CA  1 
ATOM 1923  C C   . ARG B 1 17  ? -37.094 61.970  10.075  1.00 15.74 ? 17  ARG B C   1 
ATOM 1924  O O   . ARG B 1 17  ? -36.453 60.953  10.362  1.00 16.05 ? 17  ARG B O   1 
ATOM 1925  C CB  . ARG B 1 17  ? -38.862 62.601  11.779  1.00 16.82 ? 17  ARG B CB  1 
ATOM 1926  C CG  . ARG B 1 17  ? -38.829 61.575  12.900  1.00 14.69 ? 17  ARG B CG  1 
ATOM 1927  C CD  . ARG B 1 17  ? -40.154 61.571  13.664  1.00 18.58 ? 17  ARG B CD  1 
ATOM 1928  N NE  . ARG B 1 17  ? -40.385 62.838  14.367  1.00 20.28 ? 17  ARG B NE  1 
ATOM 1929  C CZ  . ARG B 1 17  ? -41.512 63.169  15.001  1.00 19.32 ? 17  ARG B CZ  1 
ATOM 1930  N NH1 . ARG B 1 17  ? -42.545 62.331  15.033  1.00 15.28 ? 17  ARG B NH1 1 
ATOM 1931  N NH2 . ARG B 1 17  ? -41.602 64.344  15.620  1.00 18.61 ? 17  ARG B NH2 1 
ATOM 1932  N N   . LEU B 1 18  ? -37.453 62.276  8.830   1.00 15.94 ? 18  LEU B N   1 
ATOM 1933  C CA  . LEU B 1 18  ? -37.105 61.438  7.687   1.00 15.38 ? 18  LEU B CA  1 
ATOM 1934  C C   . LEU B 1 18  ? -35.648 61.686  7.309   1.00 17.12 ? 18  LEU B C   1 
ATOM 1935  O O   . LEU B 1 18  ? -34.857 60.748  7.163   1.00 21.06 ? 18  LEU B O   1 
ATOM 1936  C CB  . LEU B 1 18  ? -38.002 61.772  6.490   1.00 12.02 ? 18  LEU B CB  1 
ATOM 1937  C CG  . LEU B 1 18  ? -39.192 60.859  6.203   1.00 6.73  ? 18  LEU B CG  1 
ATOM 1938  C CD1 . LEU B 1 18  ? -40.172 61.557  5.269   1.00 8.44  ? 18  LEU B CD1 1 
ATOM 1939  C CD2 . LEU B 1 18  ? -38.694 59.544  5.608   1.00 2.00  ? 18  LEU B CD2 1 
ATOM 1940  N N   . LEU B 1 19  ? -35.300 62.965  7.193   1.00 16.20 ? 19  LEU B N   1 
ATOM 1941  C CA  . LEU B 1 19  ? -33.953 63.383  6.822   1.00 15.93 ? 19  LEU B CA  1 
ATOM 1942  C C   . LEU B 1 19  ? -32.872 62.838  7.740   1.00 17.03 ? 19  LEU B C   1 
ATOM 1943  O O   . LEU B 1 19  ? -31.849 62.336  7.264   1.00 16.49 ? 19  LEU B O   1 
ATOM 1944  C CB  . LEU B 1 19  ? -33.861 64.906  6.758   1.00 13.73 ? 19  LEU B CB  1 
ATOM 1945  C CG  . LEU B 1 19  ? -32.533 65.486  6.277   1.00 9.71  ? 19  LEU B CG  1 
ATOM 1946  C CD1 . LEU B 1 19  ? -32.121 64.817  4.978   1.00 7.37  ? 19  LEU B CD1 1 
ATOM 1947  C CD2 . LEU B 1 19  ? -32.675 66.986  6.087   1.00 7.76  ? 19  LEU B CD2 1 
ATOM 1948  N N   . LEU B 1 20  ? -33.088 62.941  9.048   1.00 14.37 ? 20  LEU B N   1 
ATOM 1949  C CA  . LEU B 1 20  ? -32.115 62.438  10.014  1.00 14.77 ? 20  LEU B CA  1 
ATOM 1950  C C   . LEU B 1 20  ? -31.965 60.921  9.930   1.00 17.00 ? 20  LEU B C   1 
ATOM 1951  O O   . LEU B 1 20  ? -30.857 60.390  10.053  1.00 18.81 ? 20  LEU B O   1 
ATOM 1952  C CB  . LEU B 1 20  ? -32.498 62.864  11.431  1.00 13.30 ? 20  LEU B CB  1 
ATOM 1953  C CG  . LEU B 1 20  ? -32.344 64.362  11.709  1.00 12.24 ? 20  LEU B CG  1 
ATOM 1954  C CD1 . LEU B 1 20  ? -32.985 64.723  13.037  1.00 6.73  ? 20  LEU B CD1 1 
ATOM 1955  C CD2 . LEU B 1 20  ? -30.875 64.747  11.698  1.00 3.30  ? 20  LEU B CD2 1 
ATOM 1956  N N   . GLU B 1 21  ? -33.073 60.231  9.683   1.00 18.26 ? 21  GLU B N   1 
ATOM 1957  C CA  . GLU B 1 21  ? -33.040 58.784  9.580   1.00 18.75 ? 21  GLU B CA  1 
ATOM 1958  C C   . GLU B 1 21  ? -32.240 58.348  8.354   1.00 19.26 ? 21  GLU B C   1 
ATOM 1959  O O   . GLU B 1 21  ? -31.301 57.561  8.470   1.00 18.07 ? 21  GLU B O   1 
ATOM 1960  C CB  . GLU B 1 21  ? -34.458 58.216  9.531   1.00 21.09 ? 21  GLU B CB  1 
ATOM 1961  C CG  . GLU B 1 21  ? -34.531 56.701  9.733   1.00 22.80 ? 21  GLU B CG  1 
ATOM 1962  C CD  . GLU B 1 21  ? -34.041 56.251  11.107  1.00 20.15 ? 21  GLU B CD  1 
ATOM 1963  O OE1 . GLU B 1 21  ? -34.504 56.813  12.122  1.00 18.28 ? 21  GLU B OE1 1 
ATOM 1964  O OE2 . GLU B 1 21  ? -33.198 55.327  11.173  1.00 21.90 ? 21  GLU B OE2 1 
ATOM 1965  N N   . TYR B 1 22  ? -32.578 58.904  7.194   1.00 20.05 ? 22  TYR B N   1 
ATOM 1966  C CA  . TYR B 1 22  ? -31.888 58.564  5.949   1.00 19.57 ? 22  TYR B CA  1 
ATOM 1967  C C   . TYR B 1 22  ? -30.372 58.747  6.022   1.00 17.63 ? 22  TYR B C   1 
ATOM 1968  O O   . TYR B 1 22  ? -29.627 58.076  5.314   1.00 16.22 ? 22  TYR B O   1 
ATOM 1969  C CB  . TYR B 1 22  ? -32.443 59.383  4.777   1.00 17.21 ? 22  TYR B CB  1 
ATOM 1970  C CG  . TYR B 1 22  ? -31.646 59.242  3.488   1.00 19.07 ? 22  TYR B CG  1 
ATOM 1971  C CD1 . TYR B 1 22  ? -31.652 58.049  2.765   1.00 17.87 ? 22  TYR B CD1 1 
ATOM 1972  C CD2 . TYR B 1 22  ? -30.876 60.296  3.002   1.00 18.07 ? 22  TYR B CD2 1 
ATOM 1973  C CE1 . TYR B 1 22  ? -30.913 57.911  1.596   1.00 16.22 ? 22  TYR B CE1 1 
ATOM 1974  C CE2 . TYR B 1 22  ? -30.134 60.168  1.833   1.00 15.18 ? 22  TYR B CE2 1 
ATOM 1975  C CZ  . TYR B 1 22  ? -30.156 58.974  1.136   1.00 14.72 ? 22  TYR B CZ  1 
ATOM 1976  O OH  . TYR B 1 22  ? -29.419 58.849  -0.020  1.00 17.42 ? 22  TYR B OH  1 
ATOM 1977  N N   . THR B 1 23  ? -29.916 59.649  6.878   1.00 16.33 ? 23  THR B N   1 
ATOM 1978  C CA  . THR B 1 23  ? -28.492 59.897  6.991   1.00 17.74 ? 23  THR B CA  1 
ATOM 1979  C C   . THR B 1 23  ? -27.822 59.303  8.231   1.00 18.34 ? 23  THR B C   1 
ATOM 1980  O O   . THR B 1 23  ? -26.822 59.832  8.727   1.00 18.36 ? 23  THR B O   1 
ATOM 1981  C CB  . THR B 1 23  ? -28.203 61.392  6.866   1.00 18.69 ? 23  THR B CB  1 
ATOM 1982  O OG1 . THR B 1 23  ? -29.146 62.136  7.656   1.00 17.24 ? 23  THR B OG1 1 
ATOM 1983  C CG2 . THR B 1 23  ? -28.313 61.821  5.407   1.00 14.73 ? 23  THR B CG2 1 
ATOM 1984  N N   . ASP B 1 24  ? -28.390 58.205  8.725   1.00 18.94 ? 24  ASP B N   1 
ATOM 1985  C CA  . ASP B 1 24  ? -27.875 57.481  9.888   1.00 19.60 ? 24  ASP B CA  1 
ATOM 1986  C C   . ASP B 1 24  ? -27.605 58.349  11.104  1.00 21.26 ? 24  ASP B C   1 
ATOM 1987  O O   . ASP B 1 24  ? -26.876 57.948  12.013  1.00 23.56 ? 24  ASP B O   1 
ATOM 1988  C CB  . ASP B 1 24  ? -26.590 56.736  9.521   1.00 21.02 ? 24  ASP B CB  1 
ATOM 1989  C CG  . ASP B 1 24  ? -26.765 55.828  8.326   1.00 22.66 ? 24  ASP B CG  1 
ATOM 1990  O OD1 . ASP B 1 24  ? -27.310 54.717  8.490   1.00 24.13 ? 24  ASP B OD1 1 
ATOM 1991  O OD2 . ASP B 1 24  ? -26.361 56.232  7.218   1.00 15.55 ? 24  ASP B OD2 1 
ATOM 1992  N N   . SER B 1 25  ? -28.217 59.523  11.139  1.00 20.39 ? 25  SER B N   1 
ATOM 1993  C CA  . SER B 1 25  ? -28.014 60.442  12.243  1.00 17.35 ? 25  SER B CA  1 
ATOM 1994  C C   . SER B 1 25  ? -28.606 59.907  13.551  1.00 18.37 ? 25  SER B C   1 
ATOM 1995  O O   . SER B 1 25  ? -29.810 59.648  13.649  1.00 18.15 ? 25  SER B O   1 
ATOM 1996  C CB  . SER B 1 25  ? -28.583 61.819  11.890  1.00 19.29 ? 25  SER B CB  1 
ATOM 1997  O OG  . SER B 1 25  ? -27.952 62.348  10.730  1.00 22.66 ? 25  SER B OG  1 
ATOM 1998  N N   . SER B 1 26  ? -27.729 59.678  14.525  1.00 18.31 ? 26  SER B N   1 
ATOM 1999  C CA  . SER B 1 26  ? -28.124 59.193  15.841  1.00 17.86 ? 26  SER B CA  1 
ATOM 2000  C C   . SER B 1 26  ? -28.789 60.361  16.567  1.00 20.46 ? 26  SER B C   1 
ATOM 2001  O O   . SER B 1 26  ? -28.108 61.293  17.052  1.00 20.63 ? 26  SER B O   1 
ATOM 2002  C CB  . SER B 1 26  ? -26.889 58.733  16.620  1.00 15.96 ? 26  SER B CB  1 
ATOM 2003  O OG  . SER B 1 26  ? -25.961 58.082  15.768  1.00 13.13 ? 26  SER B OG  1 
ATOM 2004  N N   . TYR B 1 27  ? -30.117 60.348  16.598  1.00 18.48 ? 27  TYR B N   1 
ATOM 2005  C CA  . TYR B 1 27  ? -30.875 61.411  17.243  1.00 17.68 ? 27  TYR B CA  1 
ATOM 2006  C C   . TYR B 1 27  ? -31.716 60.892  18.407  1.00 18.97 ? 27  TYR B C   1 
ATOM 2007  O O   . TYR B 1 27  ? -31.808 59.662  18.631  1.00 20.51 ? 27  TYR B O   1 
ATOM 2008  C CB  . TYR B 1 27  ? -31.760 62.135  16.214  1.00 18.23 ? 27  TYR B CB  1 
ATOM 2009  C CG  . TYR B 1 27  ? -32.817 61.275  15.579  1.00 18.86 ? 27  TYR B CG  1 
ATOM 2010  C CD1 . TYR B 1 27  ? -34.055 61.063  16.200  1.00 17.70 ? 27  TYR B CD1 1 
ATOM 2011  C CD2 . TYR B 1 27  ? -32.569 60.594  14.376  1.00 20.34 ? 27  TYR B CD2 1 
ATOM 2012  C CE1 . TYR B 1 27  ? -35.035 60.219  15.646  1.00 18.55 ? 27  TYR B CE1 1 
ATOM 2013  C CE2 . TYR B 1 27  ? -33.533 59.746  13.792  1.00 19.34 ? 27  TYR B CE2 1 
ATOM 2014  C CZ  . TYR B 1 27  ? -34.754 59.563  14.452  1.00 13.37 ? 27  TYR B CZ  1 
ATOM 2015  O OH  . TYR B 1 27  ? -35.700 58.713  13.921  1.00 14.36 ? 27  TYR B OH  1 
ATOM 2016  N N   . GLU B 1 28  ? -32.324 61.826  19.134  1.00 20.49 ? 28  GLU B N   1 
ATOM 2017  C CA  . GLU B 1 28  ? -33.167 61.525  20.284  1.00 20.66 ? 28  GLU B CA  1 
ATOM 2018  C C   . GLU B 1 28  ? -34.534 62.166  20.076  1.00 22.06 ? 28  GLU B C   1 
ATOM 2019  O O   . GLU B 1 28  ? -34.626 63.303  19.601  1.00 25.39 ? 28  GLU B O   1 
ATOM 2020  C CB  . GLU B 1 28  ? -32.542 62.098  21.556  1.00 24.05 ? 28  GLU B CB  1 
ATOM 2021  C CG  . GLU B 1 28  ? -31.176 61.529  21.915  1.00 25.91 ? 28  GLU B CG  1 
ATOM 2022  C CD  . GLU B 1 28  ? -30.430 62.394  22.925  1.00 27.57 ? 28  GLU B CD  1 
ATOM 2023  O OE1 . GLU B 1 28  ? -30.786 62.358  24.126  1.00 26.62 ? 28  GLU B OE1 1 
ATOM 2024  O OE2 . GLU B 1 28  ? -29.493 63.120  22.515  1.00 27.36 ? 28  GLU B OE2 1 
ATOM 2025  N N   . GLU B 1 29  ? -35.588 61.452  20.460  1.00 21.94 ? 29  GLU B N   1 
ATOM 2026  C CA  . GLU B 1 29  ? -36.961 61.937  20.317  1.00 21.28 ? 29  GLU B CA  1 
ATOM 2027  C C   . GLU B 1 29  ? -37.456 62.713  21.539  1.00 21.88 ? 29  GLU B C   1 
ATOM 2028  O O   . GLU B 1 29  ? -37.576 62.158  22.632  1.00 22.83 ? 29  GLU B O   1 
ATOM 2029  C CB  . GLU B 1 29  ? -37.908 60.760  20.049  1.00 21.34 ? 29  GLU B CB  1 
ATOM 2030  C CG  . GLU B 1 29  ? -37.786 60.127  18.664  1.00 17.41 ? 29  GLU B CG  1 
ATOM 2031  C CD  . GLU B 1 29  ? -38.616 60.832  17.604  1.00 17.39 ? 29  GLU B CD  1 
ATOM 2032  O OE1 . GLU B 1 29  ? -39.548 61.587  17.951  1.00 19.73 ? 29  GLU B OE1 1 
ATOM 2033  O OE2 . GLU B 1 29  ? -38.342 60.612  16.409  1.00 11.94 ? 29  GLU B OE2 1 
ATOM 2034  N N   . LYS B 1 30  ? -37.762 63.989  21.340  1.00 23.80 ? 30  LYS B N   1 
ATOM 2035  C CA  . LYS B 1 30  ? -38.261 64.850  22.411  1.00 26.05 ? 30  LYS B CA  1 
ATOM 2036  C C   . LYS B 1 30  ? -39.693 65.216  22.041  1.00 24.41 ? 30  LYS B C   1 
ATOM 2037  O O   . LYS B 1 30  ? -39.925 66.183  21.312  1.00 21.84 ? 30  LYS B O   1 
ATOM 2038  C CB  . LYS B 1 30  ? -37.407 66.127  22.508  1.00 26.38 ? 30  LYS B CB  1 
ATOM 2039  C CG  . LYS B 1 30  ? -37.840 67.119  23.581  1.00 25.63 ? 30  LYS B CG  1 
ATOM 2040  C CD  . LYS B 1 30  ? -37.271 66.753  24.934  1.00 22.60 ? 30  LYS B CD  1 
ATOM 2041  C CE  . LYS B 1 30  ? -35.755 66.859  24.926  1.00 22.69 ? 30  LYS B CE  1 
ATOM 2042  N NZ  . LYS B 1 30  ? -35.298 68.239  24.604  1.00 24.02 ? 30  LYS B NZ  1 
ATOM 2043  N N   . LYS B 1 31  ? -40.652 64.440  22.534  1.00 24.29 ? 31  LYS B N   1 
ATOM 2044  C CA  . LYS B 1 31  ? -42.048 64.693  22.210  1.00 22.34 ? 31  LYS B CA  1 
ATOM 2045  C C   . LYS B 1 31  ? -42.892 65.120  23.410  1.00 21.83 ? 31  LYS B C   1 
ATOM 2046  O O   . LYS B 1 31  ? -42.785 64.543  24.496  1.00 21.80 ? 31  LYS B O   1 
ATOM 2047  C CB  . LYS B 1 31  ? -42.642 63.467  21.506  1.00 18.61 ? 31  LYS B CB  1 
ATOM 2048  C CG  . LYS B 1 31  ? -41.821 63.020  20.289  1.00 15.79 ? 31  LYS B CG  1 
ATOM 2049  C CD  . LYS B 1 31  ? -42.476 61.918  19.461  1.00 15.54 ? 31  LYS B CD  1 
ATOM 2050  C CE  . LYS B 1 31  ? -42.458 60.553  20.141  1.00 12.76 ? 31  LYS B CE  1 
ATOM 2051  N NZ  . LYS B 1 31  ? -43.472 60.428  21.226  1.00 13.08 ? 31  LYS B NZ  1 
ATOM 2052  N N   . TYR B 1 32  ? -43.689 66.171  23.211  1.00 21.88 ? 32  TYR B N   1 
ATOM 2053  C CA  . TYR B 1 32  ? -44.573 66.722  24.244  1.00 19.75 ? 32  TYR B CA  1 
ATOM 2054  C C   . TYR B 1 32  ? -46.029 66.462  23.890  1.00 20.27 ? 32  TYR B C   1 
ATOM 2055  O O   . TYR B 1 32  ? -46.439 66.652  22.739  1.00 15.22 ? 32  TYR B O   1 
ATOM 2056  C CB  . TYR B 1 32  ? -44.384 68.231  24.381  1.00 17.95 ? 32  TYR B CB  1 
ATOM 2057  C CG  . TYR B 1 32  ? -42.966 68.651  24.656  1.00 18.46 ? 32  TYR B CG  1 
ATOM 2058  C CD1 . TYR B 1 32  ? -42.482 68.727  25.958  1.00 18.77 ? 32  TYR B CD1 1 
ATOM 2059  C CD2 . TYR B 1 32  ? -42.101 68.972  23.610  1.00 21.40 ? 32  TYR B CD2 1 
ATOM 2060  C CE1 . TYR B 1 32  ? -41.176 69.116  26.212  1.00 20.42 ? 32  TYR B CE1 1 
ATOM 2061  C CE2 . TYR B 1 32  ? -40.798 69.357  23.854  1.00 21.26 ? 32  TYR B CE2 1 
ATOM 2062  C CZ  . TYR B 1 32  ? -40.342 69.427  25.154  1.00 18.98 ? 32  TYR B CZ  1 
ATOM 2063  O OH  . TYR B 1 32  ? -39.052 69.818  25.384  1.00 19.03 ? 32  TYR B OH  1 
ATOM 2064  N N   . THR B 1 33  ? -46.821 66.129  24.903  1.00 20.07 ? 33  THR B N   1 
ATOM 2065  C CA  . THR B 1 33  ? -48.229 65.823  24.704  1.00 21.83 ? 33  THR B CA  1 
ATOM 2066  C C   . THR B 1 33  ? -49.160 66.913  25.262  1.00 21.17 ? 33  THR B C   1 
ATOM 2067  O O   . THR B 1 33  ? -48.860 67.553  26.301  1.00 21.45 ? 33  THR B O   1 
ATOM 2068  C CB  . THR B 1 33  ? -48.573 64.461  25.353  1.00 23.47 ? 33  THR B CB  1 
ATOM 2069  O OG1 . THR B 1 33  ? -47.481 63.553  25.156  1.00 25.60 ? 33  THR B OG1 1 
ATOM 2070  C CG2 . THR B 1 33  ? -49.820 63.868  24.722  1.00 22.66 ? 33  THR B CG2 1 
ATOM 2071  N N   . MET B 1 34  ? -50.275 67.135  24.568  1.00 21.36 ? 34  MET B N   1 
ATOM 2072  C CA  . MET B 1 34  ? -51.275 68.116  24.983  1.00 22.06 ? 34  MET B CA  1 
ATOM 2073  C C   . MET B 1 34  ? -52.552 67.333  25.243  1.00 23.95 ? 34  MET B C   1 
ATOM 2074  O O   . MET B 1 34  ? -52.797 66.299  24.613  1.00 23.01 ? 34  MET B O   1 
ATOM 2075  C CB  . MET B 1 34  ? -51.529 69.163  23.893  1.00 21.52 ? 34  MET B CB  1 
ATOM 2076  C CG  . MET B 1 34  ? -52.403 68.704  22.748  1.00 22.45 ? 34  MET B CG  1 
ATOM 2077  S SD  . MET B 1 34  ? -52.679 69.941  21.499  1.00 25.40 ? 34  MET B SD  1 
ATOM 2078  C CE  . MET B 1 34  ? -51.104 69.965  20.715  1.00 20.48 ? 34  MET B CE  1 
ATOM 2079  N N   . GLY B 1 35  ? -53.350 67.809  26.187  1.00 26.38 ? 35  GLY B N   1 
ATOM 2080  C CA  . GLY B 1 35  ? -54.584 67.125  26.509  1.00 28.32 ? 35  GLY B CA  1 
ATOM 2081  C C   . GLY B 1 35  ? -55.680 67.399  25.507  1.00 30.18 ? 35  GLY B C   1 
ATOM 2082  O O   . GLY B 1 35  ? -55.514 68.251  24.630  1.00 29.50 ? 35  GLY B O   1 
ATOM 2083  N N   . ASP B 1 36  ? -56.765 66.640  25.618  1.00 31.73 ? 36  ASP B N   1 
ATOM 2084  C CA  . ASP B 1 36  ? -57.924 66.805  24.750  1.00 32.43 ? 36  ASP B CA  1 
ATOM 2085  C C   . ASP B 1 36  ? -58.854 67.719  25.534  1.00 30.80 ? 36  ASP B C   1 
ATOM 2086  O O   . ASP B 1 36  ? -58.453 68.842  25.848  1.00 31.27 ? 36  ASP B O   1 
ATOM 2087  C CB  . ASP B 1 36  ? -58.584 65.449  24.457  1.00 33.04 ? 36  ASP B CB  1 
ATOM 2088  C CG  . ASP B 1 36  ? -57.648 64.481  23.743  1.00 35.41 ? 36  ASP B CG  1 
ATOM 2089  O OD1 . ASP B 1 36  ? -57.536 64.561  22.500  1.00 36.71 ? 36  ASP B OD1 1 
ATOM 2090  O OD2 . ASP B 1 36  ? -57.027 63.640  24.427  1.00 37.42 ? 36  ASP B OD2 1 
ATOM 2091  N N   . ALA B 1 37  ? -60.032 67.226  25.918  1.00 29.77 ? 37  ALA B N   1 
ATOM 2092  C CA  . ALA B 1 37  ? -60.988 68.026  26.682  1.00 31.06 ? 37  ALA B CA  1 
ATOM 2093  C C   . ALA B 1 37  ? -61.299 69.323  25.916  1.00 31.78 ? 37  ALA B C   1 
ATOM 2094  O O   . ALA B 1 37  ? -60.869 69.485  24.751  1.00 30.93 ? 37  ALA B O   1 
ATOM 2095  C CB  . ALA B 1 37  ? -60.415 68.308  28.093  1.00 30.52 ? 37  ALA B CB  1 
ATOM 2096  N N   . PRO B 1 38  ? -62.098 70.233  26.502  1.00 31.30 ? 38  PRO B N   1 
ATOM 2097  C CA  . PRO B 1 38  ? -62.382 71.466  25.757  1.00 30.89 ? 38  PRO B CA  1 
ATOM 2098  C C   . PRO B 1 38  ? -61.181 72.411  25.684  1.00 31.93 ? 38  PRO B C   1 
ATOM 2099  O O   . PRO B 1 38  ? -60.995 73.117  24.690  1.00 32.76 ? 38  PRO B O   1 
ATOM 2100  C CB  . PRO B 1 38  ? -63.542 72.075  26.545  1.00 31.19 ? 38  PRO B CB  1 
ATOM 2101  C CG  . PRO B 1 38  ? -63.259 71.633  27.947  1.00 31.69 ? 38  PRO B CG  1 
ATOM 2102  C CD  . PRO B 1 38  ? -62.887 70.183  27.745  1.00 29.61 ? 38  PRO B CD  1 
ATOM 2103  N N   . ASP B 1 39  ? -60.381 72.427  26.745  1.00 31.77 ? 39  ASP B N   1 
ATOM 2104  C CA  . ASP B 1 39  ? -59.205 73.280  26.791  1.00 32.57 ? 39  ASP B CA  1 
ATOM 2105  C C   . ASP B 1 39  ? -57.977 72.389  26.620  1.00 30.19 ? 39  ASP B C   1 
ATOM 2106  O O   . ASP B 1 39  ? -57.492 71.771  27.573  1.00 31.09 ? 39  ASP B O   1 
ATOM 2107  C CB  . ASP B 1 39  ? -59.154 74.065  28.113  1.00 33.84 ? 39  ASP B CB  1 
ATOM 2108  C CG  . ASP B 1 39  ? -58.892 75.561  27.907  1.00 35.66 ? 39  ASP B CG  1 
ATOM 2109  O OD1 . ASP B 1 39  ? -57.856 75.917  27.304  1.00 37.67 ? 39  ASP B OD1 1 
ATOM 2110  O OD2 . ASP B 1 39  ? -59.721 76.383  28.358  1.00 36.77 ? 39  ASP B OD2 1 
ATOM 2111  N N   . TYR B 1 40  ? -57.511 72.308  25.381  1.00 28.44 ? 40  TYR B N   1 
ATOM 2112  C CA  . TYR B 1 40  ? -56.353 71.506  25.019  1.00 27.27 ? 40  TYR B CA  1 
ATOM 2113  C C   . TYR B 1 40  ? -55.111 71.939  25.776  1.00 25.84 ? 40  TYR B C   1 
ATOM 2114  O O   . TYR B 1 40  ? -54.388 72.830  25.349  1.00 24.58 ? 40  TYR B O   1 
ATOM 2115  C CB  . TYR B 1 40  ? -56.153 71.569  23.510  1.00 26.89 ? 40  TYR B CB  1 
ATOM 2116  C CG  . TYR B 1 40  ? -57.382 71.080  22.791  1.00 25.13 ? 40  TYR B CG  1 
ATOM 2117  C CD1 . TYR B 1 40  ? -58.440 71.941  22.516  1.00 21.61 ? 40  TYR B CD1 1 
ATOM 2118  C CD2 . TYR B 1 40  ? -57.531 69.732  22.482  1.00 26.67 ? 40  TYR B CD2 1 
ATOM 2119  C CE1 . TYR B 1 40  ? -59.619 71.471  21.960  1.00 23.88 ? 40  TYR B CE1 1 
ATOM 2120  C CE2 . TYR B 1 40  ? -58.703 69.249  21.925  1.00 25.66 ? 40  TYR B CE2 1 
ATOM 2121  C CZ  . TYR B 1 40  ? -59.747 70.120  21.667  1.00 24.69 ? 40  TYR B CZ  1 
ATOM 2122  O OH  . TYR B 1 40  ? -60.919 69.633  21.127  1.00 18.10 ? 40  TYR B OH  1 
ATOM 2123  N N   . ASP B 1 41  ? -54.909 71.318  26.933  1.00 26.66 ? 41  ASP B N   1 
ATOM 2124  C CA  . ASP B 1 41  ? -53.787 71.606  27.822  1.00 26.05 ? 41  ASP B CA  1 
ATOM 2125  C C   . ASP B 1 41  ? -52.414 71.483  27.141  1.00 25.07 ? 41  ASP B C   1 
ATOM 2126  O O   . ASP B 1 41  ? -51.827 70.396  27.091  1.00 24.82 ? 41  ASP B O   1 
ATOM 2127  C CB  . ASP B 1 41  ? -53.861 70.673  29.040  1.00 23.91 ? 41  ASP B CB  1 
ATOM 2128  C CG  . ASP B 1 41  ? -53.143 71.230  30.259  1.00 26.03 ? 41  ASP B CG  1 
ATOM 2129  O OD1 . ASP B 1 41  ? -53.767 72.006  31.013  1.00 23.60 ? 41  ASP B OD1 1 
ATOM 2130  O OD2 . ASP B 1 41  ? -51.964 70.881  30.474  1.00 24.37 ? 41  ASP B OD2 1 
ATOM 2131  N N   . ARG B 1 42  ? -51.893 72.605  26.652  1.00 25.49 ? 42  ARG B N   1 
ATOM 2132  C CA  . ARG B 1 42  ? -50.590 72.633  25.984  1.00 24.79 ? 42  ARG B CA  1 
ATOM 2133  C C   . ARG B 1 42  ? -49.498 73.027  26.988  1.00 23.57 ? 42  ARG B C   1 
ATOM 2134  O O   . ARG B 1 42  ? -48.727 73.930  26.733  1.00 21.99 ? 42  ARG B O   1 
ATOM 2135  C CB  . ARG B 1 42  ? -50.604 73.660  24.834  1.00 24.95 ? 42  ARG B CB  1 
ATOM 2136  C CG  . ARG B 1 42  ? -51.917 73.776  24.047  1.00 26.72 ? 42  ARG B CG  1 
ATOM 2137  C CD  . ARG B 1 42  ? -52.050 72.772  22.906  1.00 28.18 ? 42  ARG B CD  1 
ATOM 2138  N NE  . ARG B 1 42  ? -51.448 73.241  21.657  1.00 27.94 ? 42  ARG B NE  1 
ATOM 2139  C CZ  . ARG B 1 42  ? -52.117 73.846  20.677  1.00 29.06 ? 42  ARG B CZ  1 
ATOM 2140  N NH1 . ARG B 1 42  ? -53.421 74.067  20.784  1.00 30.24 ? 42  ARG B NH1 1 
ATOM 2141  N NH2 . ARG B 1 42  ? -51.481 74.217  19.574  1.00 27.69 ? 42  ARG B NH2 1 
ATOM 2142  N N   . SER B 1 43  ? -49.406 72.327  28.112  1.00 22.99 ? 43  SER B N   1 
ATOM 2143  C CA  . SER B 1 43  ? -48.412 72.670  29.133  1.00 22.14 ? 43  SER B CA  1 
ATOM 2144  C C   . SER B 1 43  ? -47.051 71.996  28.955  1.00 21.02 ? 43  SER B C   1 
ATOM 2145  O O   . SER B 1 43  ? -46.019 72.685  28.950  1.00 21.89 ? 43  SER B O   1 
ATOM 2146  C CB  . SER B 1 43  ? -48.960 72.370  30.535  1.00 21.51 ? 43  SER B CB  1 
ATOM 2147  O OG  . SER B 1 43  ? -48.105 72.883  31.543  1.00 18.37 ? 43  SER B OG  1 
ATOM 2148  N N   . GLN B 1 44  ? -47.070 70.673  28.805  1.00 21.07 ? 44  GLN B N   1 
ATOM 2149  C CA  . GLN B 1 44  ? -45.879 69.837  28.634  1.00 20.88 ? 44  GLN B CA  1 
ATOM 2150  C C   . GLN B 1 44  ? -44.699 70.573  27.973  1.00 19.49 ? 44  GLN B C   1 
ATOM 2151  O O   . GLN B 1 44  ? -43.572 70.538  28.453  1.00 18.65 ? 44  GLN B O   1 
ATOM 2152  C CB  . GLN B 1 44  ? -46.253 68.615  27.789  1.00 21.69 ? 44  GLN B CB  1 
ATOM 2153  C CG  . GLN B 1 44  ? -45.351 67.402  27.962  1.00 23.21 ? 44  GLN B CG  1 
ATOM 2154  C CD  . GLN B 1 44  ? -45.987 66.312  28.805  1.00 26.34 ? 44  GLN B CD  1 
ATOM 2155  O OE1 . GLN B 1 44  ? -45.307 65.632  29.570  1.00 23.34 ? 44  GLN B OE1 1 
ATOM 2156  N NE2 . GLN B 1 44  ? -47.291 66.129  28.657  1.00 25.13 ? 44  GLN B NE2 1 
ATOM 2157  N N   . TRP B 1 45  ? -44.994 71.236  26.862  1.00 18.67 ? 45  TRP B N   1 
ATOM 2158  C CA  . TRP B 1 45  ? -43.989 71.978  26.124  1.00 16.76 ? 45  TRP B CA  1 
ATOM 2159  C C   . TRP B 1 45  ? -43.759 73.378  26.708  1.00 14.58 ? 45  TRP B C   1 
ATOM 2160  O O   . TRP B 1 45  ? -42.612 73.815  26.839  1.00 14.68 ? 45  TRP B O   1 
ATOM 2161  C CB  . TRP B 1 45  ? -44.395 72.045  24.645  1.00 17.65 ? 45  TRP B CB  1 
ATOM 2162  C CG  . TRP B 1 45  ? -43.652 73.056  23.837  1.00 18.18 ? 45  TRP B CG  1 
ATOM 2163  C CD1 . TRP B 1 45  ? -44.196 74.021  23.037  1.00 18.15 ? 45  TRP B CD1 1 
ATOM 2164  C CD2 . TRP B 1 45  ? -42.233 73.243  23.780  1.00 17.68 ? 45  TRP B CD2 1 
ATOM 2165  N NE1 . TRP B 1 45  ? -43.206 74.801  22.492  1.00 20.46 ? 45  TRP B NE1 1 
ATOM 2166  C CE2 . TRP B 1 45  ? -41.992 74.345  22.929  1.00 19.03 ? 45  TRP B CE2 1 
ATOM 2167  C CE3 . TRP B 1 45  ? -41.144 72.591  24.366  1.00 16.58 ? 45  TRP B CE3 1 
ATOM 2168  C CZ2 . TRP B 1 45  ? -40.710 74.811  22.658  1.00 17.97 ? 45  TRP B CZ2 1 
ATOM 2169  C CZ3 . TRP B 1 45  ? -39.874 73.055  24.100  1.00 16.99 ? 45  TRP B CZ3 1 
ATOM 2170  C CH2 . TRP B 1 45  ? -39.665 74.157  23.264  1.00 17.67 ? 45  TRP B CH2 1 
ATOM 2171  N N   . LEU B 1 46  ? -44.841 74.053  27.095  1.00 15.36 ? 46  LEU B N   1 
ATOM 2172  C CA  . LEU B 1 46  ? -44.775 75.408  27.649  1.00 17.79 ? 46  LEU B CA  1 
ATOM 2173  C C   . LEU B 1 46  ? -43.829 75.596  28.829  1.00 19.23 ? 46  LEU B C   1 
ATOM 2174  O O   . LEU B 1 46  ? -43.089 76.586  28.891  1.00 19.41 ? 46  LEU B O   1 
ATOM 2175  C CB  . LEU B 1 46  ? -46.169 75.899  28.037  1.00 17.91 ? 46  LEU B CB  1 
ATOM 2176  C CG  . LEU B 1 46  ? -47.090 76.312  26.889  1.00 16.33 ? 46  LEU B CG  1 
ATOM 2177  C CD1 . LEU B 1 46  ? -48.428 76.802  27.442  1.00 16.29 ? 46  LEU B CD1 1 
ATOM 2178  C CD2 . LEU B 1 46  ? -46.423 77.402  26.066  1.00 17.32 ? 46  LEU B CD2 1 
ATOM 2179  N N   . ASN B 1 47  ? -43.831 74.644  29.756  1.00 20.04 ? 47  ASN B N   1 
ATOM 2180  C CA  . ASN B 1 47  ? -42.965 74.715  30.932  1.00 20.33 ? 47  ASN B CA  1 
ATOM 2181  C C   . ASN B 1 47  ? -41.490 74.504  30.598  1.00 19.95 ? 47  ASN B C   1 
ATOM 2182  O O   . ASN B 1 47  ? -40.628 74.636  31.464  1.00 21.31 ? 47  ASN B O   1 
ATOM 2183  C CB  . ASN B 1 47  ? -43.408 73.699  31.998  1.00 21.15 ? 47  ASN B CB  1 
ATOM 2184  C CG  . ASN B 1 47  ? -43.360 72.262  31.499  1.00 23.34 ? 47  ASN B CG  1 
ATOM 2185  O OD1 . ASN B 1 47  ? -44.383 71.692  31.125  1.00 24.17 ? 47  ASN B OD1 1 
ATOM 2186  N ND2 . ASN B 1 47  ? -42.172 71.673  31.493  1.00 23.37 ? 47  ASN B ND2 1 
ATOM 2187  N N   . GLU B 1 48  ? -41.186 74.156  29.350  1.00 19.07 ? 48  GLU B N   1 
ATOM 2188  C CA  . GLU B 1 48  ? -39.831 73.924  28.938  1.00 16.57 ? 48  GLU B CA  1 
ATOM 2189  C C   . GLU B 1 48  ? -39.401 74.867  27.819  1.00 16.23 ? 48  GLU B C   1 
ATOM 2190  O O   . GLU B 1 48  ? -38.259 74.822  27.366  1.00 16.52 ? 48  GLU B O   1 
ATOM 2191  C CB  . GLU B 1 48  ? -39.655 72.467  28.516  1.00 15.27 ? 48  GLU B CB  1 
ATOM 2192  C CG  . GLU B 1 48  ? -38.212 71.982  28.549  1.00 14.89 ? 48  GLU B CG  1 
ATOM 2193  C CD  . GLU B 1 48  ? -38.074 70.501  28.246  1.00 11.88 ? 48  GLU B CD  1 
ATOM 2194  O OE1 . GLU B 1 48  ? -38.983 69.714  28.594  1.00 11.87 ? 48  GLU B OE1 1 
ATOM 2195  O OE2 . GLU B 1 48  ? -37.044 70.121  27.656  1.00 11.50 ? 48  GLU B OE2 1 
ATOM 2196  N N   . LYS B 1 49  ? -40.307 75.753  27.414  1.00 13.35 ? 49  LYS B N   1 
ATOM 2197  C CA  . LYS B 1 49  ? -40.037 76.725  26.352  1.00 12.67 ? 49  LYS B CA  1 
ATOM 2198  C C   . LYS B 1 49  ? -38.731 77.475  26.570  1.00 11.32 ? 49  LYS B C   1 
ATOM 2199  O O   . LYS B 1 49  ? -37.766 77.311  25.813  1.00 8.96  ? 49  LYS B O   1 
ATOM 2200  C CB  . LYS B 1 49  ? -41.169 77.756  26.253  1.00 11.15 ? 49  LYS B CB  1 
ATOM 2201  C CG  . LYS B 1 49  ? -42.125 77.534  25.111  1.00 14.56 ? 49  LYS B CG  1 
ATOM 2202  C CD  . LYS B 1 49  ? -42.722 78.847  24.636  1.00 15.11 ? 49  LYS B CD  1 
ATOM 2203  C CE  . LYS B 1 49  ? -43.598 78.634  23.407  1.00 9.19  ? 49  LYS B CE  1 
ATOM 2204  N NZ  . LYS B 1 49  ? -43.894 79.892  22.663  1.00 11.56 ? 49  LYS B NZ  1 
ATOM 2205  N N   . PHE B 1 50  ? -38.715 78.278  27.633  1.00 11.85 ? 50  PHE B N   1 
ATOM 2206  C CA  . PHE B 1 50  ? -37.570 79.108  28.011  1.00 11.11 ? 50  PHE B CA  1 
ATOM 2207  C C   . PHE B 1 50  ? -36.323 78.329  28.473  1.00 14.36 ? 50  PHE B C   1 
ATOM 2208  O O   . PHE B 1 50  ? -35.196 78.715  28.161  1.00 12.70 ? 50  PHE B O   1 
ATOM 2209  C CB  . PHE B 1 50  ? -38.002 80.111  29.095  1.00 10.02 ? 50  PHE B CB  1 
ATOM 2210  C CG  . PHE B 1 50  ? -39.300 80.835  28.781  1.00 12.60 ? 50  PHE B CG  1 
ATOM 2211  C CD1 . PHE B 1 50  ? -39.400 81.697  27.662  1.00 11.64 ? 50  PHE B CD1 1 
ATOM 2212  C CD2 . PHE B 1 50  ? -40.426 80.645  29.601  1.00 9.25  ? 50  PHE B CD2 1 
ATOM 2213  C CE1 . PHE B 1 50  ? -40.603 82.372  27.373  1.00 13.94 ? 50  PHE B CE1 1 
ATOM 2214  C CE2 . PHE B 1 50  ? -41.631 81.297  29.300  1.00 11.98 ? 50  PHE B CE2 1 
ATOM 2215  C CZ  . PHE B 1 50  ? -41.719 82.154  28.198  1.00 14.28 ? 50  PHE B CZ  1 
ATOM 2216  N N   . LYS B 1 51  ? -36.532 77.206  29.161  1.00 12.95 ? 51  LYS B N   1 
ATOM 2217  C CA  . LYS B 1 51  ? -35.438 76.367  29.685  1.00 13.23 ? 51  LYS B CA  1 
ATOM 2218  C C   . LYS B 1 51  ? -34.436 75.839  28.671  1.00 11.07 ? 51  LYS B C   1 
ATOM 2219  O O   . LYS B 1 51  ? -33.419 75.269  29.052  1.00 12.80 ? 51  LYS B O   1 
ATOM 2220  C CB  . LYS B 1 51  ? -35.978 75.146  30.432  1.00 16.29 ? 51  LYS B CB  1 
ATOM 2221  C CG  . LYS B 1 51  ? -36.762 75.416  31.691  1.00 18.74 ? 51  LYS B CG  1 
ATOM 2222  C CD  . LYS B 1 51  ? -37.163 74.083  32.306  1.00 22.15 ? 51  LYS B CD  1 
ATOM 2223  C CE  . LYS B 1 51  ? -38.104 74.253  33.479  1.00 24.86 ? 51  LYS B CE  1 
ATOM 2224  N NZ  . LYS B 1 51  ? -38.459 72.929  34.070  1.00 25.16 ? 51  LYS B NZ  1 
ATOM 2225  N N   . LEU B 1 52  ? -34.751 75.945  27.389  1.00 9.91  ? 52  LEU B N   1 
ATOM 2226  C CA  . LEU B 1 52  ? -33.853 75.447  26.360  1.00 7.40  ? 52  LEU B CA  1 
ATOM 2227  C C   . LEU B 1 52  ? -32.954 76.522  25.780  1.00 7.03  ? 52  LEU B C   1 
ATOM 2228  O O   . LEU B 1 52  ? -32.039 76.223  25.009  1.00 5.66  ? 52  LEU B O   1 
ATOM 2229  C CB  . LEU B 1 52  ? -34.658 74.770  25.251  1.00 8.73  ? 52  LEU B CB  1 
ATOM 2230  C CG  . LEU B 1 52  ? -35.189 73.369  25.561  1.00 9.45  ? 52  LEU B CG  1 
ATOM 2231  C CD1 . LEU B 1 52  ? -36.353 73.063  24.659  1.00 8.25  ? 52  LEU B CD1 1 
ATOM 2232  C CD2 . LEU B 1 52  ? -34.085 72.331  25.401  1.00 12.87 ? 52  LEU B CD2 1 
ATOM 2233  N N   . GLY B 1 53  ? -33.225 77.771  26.139  1.00 5.77  ? 53  GLY B N   1 
ATOM 2234  C CA  . GLY B 1 53  ? -32.423 78.867  25.632  1.00 8.21  ? 53  GLY B CA  1 
ATOM 2235  C C   . GLY B 1 53  ? -32.393 78.964  24.114  1.00 12.34 ? 53  GLY B C   1 
ATOM 2236  O O   . GLY B 1 53  ? -31.328 79.122  23.508  1.00 10.68 ? 53  GLY B O   1 
ATOM 2237  N N   . LEU B 1 54  ? -33.561 78.833  23.492  1.00 13.00 ? 54  LEU B N   1 
ATOM 2238  C CA  . LEU B 1 54  ? -33.667 78.949  22.042  1.00 8.47  ? 54  LEU B CA  1 
ATOM 2239  C C   . LEU B 1 54  ? -33.779 80.432  21.671  1.00 4.80  ? 54  LEU B C   1 
ATOM 2240  O O   . LEU B 1 54  ? -34.358 81.217  22.420  1.00 3.15  ? 54  LEU B O   1 
ATOM 2241  C CB  . LEU B 1 54  ? -34.921 78.216  21.565  1.00 8.78  ? 54  LEU B CB  1 
ATOM 2242  C CG  . LEU B 1 54  ? -35.122 76.761  21.986  1.00 4.69  ? 54  LEU B CG  1 
ATOM 2243  C CD1 . LEU B 1 54  ? -36.591 76.382  21.842  1.00 6.40  ? 54  LEU B CD1 1 
ATOM 2244  C CD2 . LEU B 1 54  ? -34.231 75.850  21.154  1.00 9.31  ? 54  LEU B CD2 1 
ATOM 2245  N N   . ASP B 1 55  ? -33.211 80.813  20.531  1.00 5.70  ? 55  ASP B N   1 
ATOM 2246  C CA  . ASP B 1 55  ? -33.291 82.196  20.069  1.00 8.30  ? 55  ASP B CA  1 
ATOM 2247  C C   . ASP B 1 55  ? -34.766 82.548  19.937  1.00 11.00 ? 55  ASP B C   1 
ATOM 2248  O O   . ASP B 1 55  ? -35.233 83.575  20.433  1.00 10.65 ? 55  ASP B O   1 
ATOM 2249  C CB  . ASP B 1 55  ? -32.641 82.339  18.686  1.00 8.26  ? 55  ASP B CB  1 
ATOM 2250  C CG  . ASP B 1 55  ? -31.260 82.962  18.737  1.00 8.71  ? 55  ASP B CG  1 
ATOM 2251  O OD1 . ASP B 1 55  ? -31.062 83.939  19.493  1.00 10.60 ? 55  ASP B OD1 1 
ATOM 2252  O OD2 . ASP B 1 55  ? -30.376 82.490  17.992  1.00 10.49 ? 55  ASP B OD2 1 
ATOM 2253  N N   . PHE B 1 56  ? -35.487 81.674  19.247  1.00 10.82 ? 56  PHE B N   1 
ATOM 2254  C CA  . PHE B 1 56  ? -36.908 81.847  19.012  1.00 7.18  ? 56  PHE B CA  1 
ATOM 2255  C C   . PHE B 1 56  ? -37.629 80.603  19.506  1.00 6.66  ? 56  PHE B C   1 
ATOM 2256  O O   . PHE B 1 56  ? -37.531 79.531  18.902  1.00 8.60  ? 56  PHE B O   1 
ATOM 2257  C CB  . PHE B 1 56  ? -37.164 82.059  17.518  1.00 7.25  ? 56  PHE B CB  1 
ATOM 2258  C CG  . PHE B 1 56  ? -36.578 83.334  16.980  1.00 3.83  ? 56  PHE B CG  1 
ATOM 2259  C CD1 . PHE B 1 56  ? -37.235 84.545  17.160  1.00 3.85  ? 56  PHE B CD1 1 
ATOM 2260  C CD2 . PHE B 1 56  ? -35.370 83.326  16.293  1.00 2.59  ? 56  PHE B CD2 1 
ATOM 2261  C CE1 . PHE B 1 56  ? -36.701 85.727  16.669  1.00 2.00  ? 56  PHE B CE1 1 
ATOM 2262  C CE2 . PHE B 1 56  ? -34.828 84.508  15.798  1.00 2.00  ? 56  PHE B CE2 1 
ATOM 2263  C CZ  . PHE B 1 56  ? -35.497 85.710  15.987  1.00 2.00  ? 56  PHE B CZ  1 
ATOM 2264  N N   . PRO B 1 57  ? -38.321 80.717  20.649  1.00 7.48  ? 57  PRO B N   1 
ATOM 2265  C CA  . PRO B 1 57  ? -39.062 79.600  21.245  1.00 8.05  ? 57  PRO B CA  1 
ATOM 2266  C C   . PRO B 1 57  ? -40.161 79.030  20.352  1.00 5.74  ? 57  PRO B C   1 
ATOM 2267  O O   . PRO B 1 57  ? -41.107 79.738  19.988  1.00 3.05  ? 57  PRO B O   1 
ATOM 2268  C CB  . PRO B 1 57  ? -39.623 80.209  22.541  1.00 4.81  ? 57  PRO B CB  1 
ATOM 2269  C CG  . PRO B 1 57  ? -39.705 81.672  22.236  1.00 10.00 ? 57  PRO B CG  1 
ATOM 2270  C CD  . PRO B 1 57  ? -38.426 81.921  21.487  1.00 11.30 ? 57  PRO B CD  1 
ATOM 2271  N N   . ASN B 1 58  ? -40.013 77.754  19.997  1.00 5.15  ? 58  ASN B N   1 
ATOM 2272  C CA  . ASN B 1 58  ? -40.973 77.040  19.154  1.00 9.19  ? 58  ASN B CA  1 
ATOM 2273  C C   . ASN B 1 58  ? -40.429 75.660  18.796  1.00 8.66  ? 58  ASN B C   1 
ATOM 2274  O O   . ASN B 1 58  ? -39.214 75.391  18.950  1.00 2.00  ? 58  ASN B O   1 
ATOM 2275  C CB  . ASN B 1 58  ? -41.247 77.823  17.856  1.00 11.47 ? 58  ASN B CB  1 
ATOM 2276  C CG  . ASN B 1 58  ? -42.096 77.038  16.848  1.00 11.12 ? 58  ASN B CG  1 
ATOM 2277  O OD1 . ASN B 1 58  ? -43.320 76.977  16.961  1.00 11.18 ? 58  ASN B OD1 1 
ATOM 2278  N ND2 . ASN B 1 58  ? -41.439 76.430  15.871  1.00 11.85 ? 58  ASN B ND2 1 
ATOM 2279  N N   . LEU B 1 59  ? -41.332 74.783  18.365  1.00 10.11 ? 59  LEU B N   1 
ATOM 2280  C CA  . LEU B 1 59  ? -40.999 73.435  17.927  1.00 12.09 ? 59  LEU B CA  1 
ATOM 2281  C C   . LEU B 1 59  ? -41.673 73.149  16.590  1.00 12.10 ? 59  LEU B C   1 
ATOM 2282  O O   . LEU B 1 59  ? -42.749 73.680  16.318  1.00 12.54 ? 59  LEU B O   1 
ATOM 2283  C CB  . LEU B 1 59  ? -41.324 72.374  18.985  1.00 8.59  ? 59  LEU B CB  1 
ATOM 2284  C CG  . LEU B 1 59  ? -42.528 72.439  19.919  1.00 8.97  ? 59  LEU B CG  1 
ATOM 2285  C CD1 . LEU B 1 59  ? -43.832 72.607  19.160  1.00 6.47  ? 59  LEU B CD1 1 
ATOM 2286  C CD2 . LEU B 1 59  ? -42.542 71.162  20.742  1.00 5.69  ? 59  LEU B CD2 1 
ATOM 2287  N N   . PRO B 1 60  ? -41.080 72.284  15.752  1.00 12.08 ? 60  PRO B N   1 
ATOM 2288  C CA  . PRO B 1 60  ? -39.823 71.576  15.990  1.00 11.83 ? 60  PRO B CA  1 
ATOM 2289  C C   . PRO B 1 60  ? -38.587 72.467  16.152  1.00 12.02 ? 60  PRO B C   1 
ATOM 2290  O O   . PRO B 1 60  ? -38.539 73.596  15.610  1.00 11.22 ? 60  PRO B O   1 
ATOM 2291  C CB  . PRO B 1 60  ? -39.700 70.697  14.751  1.00 14.02 ? 60  PRO B CB  1 
ATOM 2292  C CG  . PRO B 1 60  ? -40.238 71.581  13.691  1.00 15.33 ? 60  PRO B CG  1 
ATOM 2293  C CD  . PRO B 1 60  ? -41.491 72.131  14.344  1.00 13.52 ? 60  PRO B CD  1 
ATOM 2294  N N   . TYR B 1 61  ? -37.671 71.982  16.963  1.00 10.26 ? 61  TYR B N   1 
ATOM 2295  C CA  . TYR B 1 61  ? -36.413 72.662  17.222  1.00 10.42 ? 61  TYR B CA  1 
ATOM 2296  C C   . TYR B 1 61  ? -35.397 71.531  17.324  1.00 10.31 ? 61  TYR B C   1 
ATOM 2297  O O   . TYR B 1 61  ? -35.721 70.420  17.828  1.00 14.39 ? 61  TYR B O   1 
ATOM 2298  C CB  . TYR B 1 61  ? -36.473 73.541  18.494  1.00 12.28 ? 61  TYR B CB  1 
ATOM 2299  C CG  . TYR B 1 61  ? -36.807 72.817  19.769  1.00 11.90 ? 61  TYR B CG  1 
ATOM 2300  C CD1 . TYR B 1 61  ? -35.890 71.925  20.358  1.00 14.22 ? 61  TYR B CD1 1 
ATOM 2301  C CD2 . TYR B 1 61  ? -38.051 72.949  20.369  1.00 13.28 ? 61  TYR B CD2 1 
ATOM 2302  C CE1 . TYR B 1 61  ? -36.203 71.195  21.484  1.00 13.20 ? 61  TYR B CE1 1 
ATOM 2303  C CE2 . TYR B 1 61  ? -38.371 72.202  21.491  1.00 13.72 ? 61  TYR B CE2 1 
ATOM 2304  C CZ  . TYR B 1 61  ? -37.442 71.336  22.058  1.00 12.76 ? 61  TYR B CZ  1 
ATOM 2305  O OH  . TYR B 1 61  ? -37.737 70.601  23.180  1.00 6.60  ? 61  TYR B OH  1 
ATOM 2306  N N   . LEU B 1 62  ? -34.200 71.775  16.822  1.00 11.17 ? 62  LEU B N   1 
ATOM 2307  C CA  . LEU B 1 62  ? -33.137 70.786  16.827  1.00 10.65 ? 62  LEU B CA  1 
ATOM 2308  C C   . LEU B 1 62  ? -32.033 71.143  17.801  1.00 10.59 ? 62  LEU B C   1 
ATOM 2309  O O   . LEU B 1 62  ? -31.757 72.317  18.040  1.00 11.82 ? 62  LEU B O   1 
ATOM 2310  C CB  . LEU B 1 62  ? -32.549 70.670  15.424  1.00 6.79  ? 62  LEU B CB  1 
ATOM 2311  C CG  . LEU B 1 62  ? -31.466 69.619  15.190  1.00 5.25  ? 62  LEU B CG  1 
ATOM 2312  C CD1 . LEU B 1 62  ? -32.041 68.211  15.340  1.00 7.45  ? 62  LEU B CD1 1 
ATOM 2313  C CD2 . LEU B 1 62  ? -30.893 69.812  13.807  1.00 8.01  ? 62  LEU B CD2 1 
ATOM 2314  N N   . ILE B 1 63  ? -31.419 70.115  18.371  1.00 14.11 ? 63  ILE B N   1 
ATOM 2315  C CA  . ILE B 1 63  ? -30.313 70.287  19.300  1.00 15.88 ? 63  ILE B CA  1 
ATOM 2316  C C   . ILE B 1 63  ? -29.147 69.448  18.770  1.00 15.30 ? 63  ILE B C   1 
ATOM 2317  O O   . ILE B 1 63  ? -29.332 68.289  18.432  1.00 14.65 ? 63  ILE B O   1 
ATOM 2318  C CB  . ILE B 1 63  ? -30.682 69.820  20.741  1.00 17.39 ? 63  ILE B CB  1 
ATOM 2319  C CG1 . ILE B 1 63  ? -31.738 70.744  21.348  1.00 18.54 ? 63  ILE B CG1 1 
ATOM 2320  C CG2 . ILE B 1 63  ? -29.441 69.774  21.642  1.00 17.26 ? 63  ILE B CG2 1 
ATOM 2321  C CD1 . ILE B 1 63  ? -33.133 70.373  20.977  1.00 15.26 ? 63  ILE B CD1 1 
ATOM 2322  N N   . ASP B 1 64  ? -27.966 70.055  18.709  1.00 19.30 ? 64  ASP B N   1 
ATOM 2323  C CA  . ASP B 1 64  ? -26.738 69.400  18.288  1.00 20.71 ? 64  ASP B CA  1 
ATOM 2324  C C   . ASP B 1 64  ? -25.604 70.122  19.014  1.00 18.27 ? 64  ASP B C   1 
ATOM 2325  O O   . ASP B 1 64  ? -24.788 70.832  18.398  1.00 14.04 ? 64  ASP B O   1 
ATOM 2326  C CB  . ASP B 1 64  ? -26.550 69.505  16.770  1.00 19.71 ? 64  ASP B CB  1 
ATOM 2327  C CG  . ASP B 1 64  ? -25.409 68.630  16.262  1.00 19.39 ? 64  ASP B CG  1 
ATOM 2328  O OD1 . ASP B 1 64  ? -25.476 67.396  16.440  1.00 14.18 ? 64  ASP B OD1 1 
ATOM 2329  O OD2 . ASP B 1 64  ? -24.441 69.179  15.694  1.00 20.41 ? 64  ASP B OD2 1 
ATOM 2330  N N   . GLY B 1 65  ? -25.602 69.978  20.337  1.00 17.32 ? 65  GLY B N   1 
ATOM 2331  C CA  . GLY B 1 65  ? -24.601 70.615  21.173  1.00 18.34 ? 65  GLY B CA  1 
ATOM 2332  C C   . GLY B 1 65  ? -24.776 72.123  21.214  1.00 20.13 ? 65  GLY B C   1 
ATOM 2333  O O   . GLY B 1 65  ? -25.803 72.646  21.648  1.00 18.28 ? 65  GLY B O   1 
ATOM 2334  N N   . ALA B 1 66  ? -23.781 72.824  20.670  1.00 17.84 ? 66  ALA B N   1 
ATOM 2335  C CA  . ALA B 1 66  ? -23.813 74.274  20.605  1.00 16.28 ? 66  ALA B CA  1 
ATOM 2336  C C   . ALA B 1 66  ? -24.639 74.670  19.404  1.00 19.08 ? 66  ALA B C   1 
ATOM 2337  O O   . ALA B 1 66  ? -24.366 75.677  18.738  1.00 19.45 ? 66  ALA B O   1 
ATOM 2338  C CB  . ALA B 1 66  ? -22.399 74.819  20.483  1.00 17.34 ? 66  ALA B CB  1 
ATOM 2339  N N   . HIS B 1 67  ? -25.637 73.854  19.067  1.00 20.55 ? 67  HIS B N   1 
ATOM 2340  C CA  . HIS B 1 67  ? -26.507 74.088  17.925  1.00 16.12 ? 67  HIS B CA  1 
ATOM 2341  C C   . HIS B 1 67  ? -27.917 73.747  18.302  1.00 14.56 ? 67  HIS B C   1 
ATOM 2342  O O   . HIS B 1 67  ? -28.263 72.599  18.440  1.00 10.61 ? 67  HIS B O   1 
ATOM 2343  C CB  . HIS B 1 67  ? -26.137 73.184  16.756  1.00 14.83 ? 67  HIS B CB  1 
ATOM 2344  C CG  . HIS B 1 67  ? -24.754 73.390  16.240  1.00 10.61 ? 67  HIS B CG  1 
ATOM 2345  N ND1 . HIS B 1 67  ? -23.802 72.397  16.266  1.00 9.87  ? 67  HIS B ND1 1 
ATOM 2346  C CD2 . HIS B 1 67  ? -24.176 74.455  15.637  1.00 3.85  ? 67  HIS B CD2 1 
ATOM 2347  C CE1 . HIS B 1 67  ? -22.693 72.837  15.694  1.00 5.14  ? 67  HIS B CE1 1 
ATOM 2348  N NE2 . HIS B 1 67  ? -22.895 74.083  15.303  1.00 6.39  ? 67  HIS B NE2 1 
ATOM 2349  N N   . LYS B 1 68  ? -28.725 74.747  18.508  1.00 16.96 ? 68  LYS B N   1 
ATOM 2350  C CA  . LYS B 1 68  ? -30.116 74.547  18.821  1.00 15.42 ? 68  LYS B CA  1 
ATOM 2351  C C   . LYS B 1 68  ? -30.799 75.511  17.896  1.00 16.13 ? 68  LYS B C   1 
ATOM 2352  O O   . LYS B 1 68  ? -30.517 76.726  17.923  1.00 17.52 ? 68  LYS B O   1 
ATOM 2353  C CB  . LYS B 1 68  ? -30.409 74.833  20.285  1.00 14.69 ? 68  LYS B CB  1 
ATOM 2354  C CG  . LYS B 1 68  ? -29.681 73.928  21.256  1.00 12.30 ? 68  LYS B CG  1 
ATOM 2355  C CD  . LYS B 1 68  ? -30.167 74.167  22.669  1.00 8.17  ? 68  LYS B CD  1 
ATOM 2356  C CE  . LYS B 1 68  ? -29.395 73.338  23.680  1.00 13.22 ? 68  LYS B CE  1 
ATOM 2357  N NZ  . LYS B 1 68  ? -30.005 73.452  25.043  1.00 11.96 ? 68  LYS B NZ  1 
ATOM 2358  N N   . ILE B 1 69  ? -31.609 75.001  16.996  1.00 17.76 ? 69  ILE B N   1 
ATOM 2359  C CA  . ILE B 1 69  ? -32.287 75.845  16.036  1.00 18.11 ? 69  ILE B CA  1 
ATOM 2360  C C   . ILE B 1 69  ? -33.778 75.555  15.935  1.00 17.90 ? 69  ILE B C   1 
ATOM 2361  O O   . ILE B 1 69  ? -34.244 74.505  16.383  1.00 16.54 ? 69  ILE B O   1 
ATOM 2362  C CB  . ILE B 1 69  ? -31.600 75.748  14.654  1.00 19.28 ? 69  ILE B CB  1 
ATOM 2363  C CG1 . ILE B 1 69  ? -31.038 74.340  14.426  1.00 19.43 ? 69  ILE B CG1 1 
ATOM 2364  C CG2 . ILE B 1 69  ? -30.491 76.772  14.555  1.00 17.59 ? 69  ILE B CG2 1 
ATOM 2365  C CD1 . ILE B 1 69  ? -30.198 74.210  13.172  1.00 19.85 ? 69  ILE B CD1 1 
ATOM 2366  N N   . THR B 1 70  ? -34.521 76.509  15.386  1.00 13.75 ? 70  THR B N   1 
ATOM 2367  C CA  . THR B 1 70  ? -35.957 76.369  15.229  1.00 12.87 ? 70  THR B CA  1 
ATOM 2368  C C   . THR B 1 70  ? -36.285 76.506  13.737  1.00 14.70 ? 70  THR B C   1 
ATOM 2369  O O   . THR B 1 70  ? -35.414 76.292  12.905  1.00 9.54  ? 70  THR B O   1 
ATOM 2370  C CB  . THR B 1 70  ? -36.694 77.447  16.052  1.00 7.34  ? 70  THR B CB  1 
ATOM 2371  O OG1 . THR B 1 70  ? -35.879 77.856  17.159  1.00 2.00  ? 70  THR B OG1 1 
ATOM 2372  C CG2 . THR B 1 70  ? -38.000 76.898  16.591  1.00 11.63 ? 70  THR B CG2 1 
ATOM 2373  N N   . GLN B 1 71  ? -37.526 76.862  13.404  1.00 15.73 ? 71  GLN B N   1 
ATOM 2374  C CA  . GLN B 1 71  ? -37.969 77.037  12.018  1.00 13.64 ? 71  GLN B CA  1 
ATOM 2375  C C   . GLN B 1 71  ? -37.616 75.913  11.053  1.00 13.27 ? 71  GLN B C   1 
ATOM 2376  O O   . GLN B 1 71  ? -36.508 75.847  10.524  1.00 13.15 ? 71  GLN B O   1 
ATOM 2377  C CB  . GLN B 1 71  ? -37.500 78.382  11.456  1.00 16.74 ? 71  GLN B CB  1 
ATOM 2378  C CG  . GLN B 1 71  ? -38.518 79.516  11.613  1.00 15.29 ? 71  GLN B CG  1 
ATOM 2379  C CD  . GLN B 1 71  ? -39.822 79.260  10.868  1.00 16.66 ? 71  GLN B CD  1 
ATOM 2380  O OE1 . GLN B 1 71  ? -39.864 79.282  9.641   1.00 17.42 ? 71  GLN B OE1 1 
ATOM 2381  N NE2 . GLN B 1 71  ? -40.891 79.010  11.613  1.00 13.15 ? 71  GLN B NE2 1 
ATOM 2382  N N   . SER B 1 72  ? -38.628 75.105  10.759  1.00 14.67 ? 72  SER B N   1 
ATOM 2383  C CA  . SER B 1 72  ? -38.551 73.943  9.883   1.00 12.17 ? 72  SER B CA  1 
ATOM 2384  C C   . SER B 1 72  ? -37.466 73.901  8.802   1.00 12.76 ? 72  SER B C   1 
ATOM 2385  O O   . SER B 1 72  ? -36.687 72.942  8.734   1.00 12.24 ? 72  SER B O   1 
ATOM 2386  C CB  . SER B 1 72  ? -39.922 73.720  9.260   1.00 10.17 ? 72  SER B CB  1 
ATOM 2387  O OG  . SER B 1 72  ? -40.936 73.871  10.244  1.00 15.02 ? 72  SER B OG  1 
ATOM 2388  N N   . ASN B 1 73  ? -37.406 74.933  7.968   1.00 12.78 ? 73  ASN B N   1 
ATOM 2389  C CA  . ASN B 1 73  ? -36.423 74.976  6.893   1.00 10.63 ? 73  ASN B CA  1 
ATOM 2390  C C   . ASN B 1 73  ? -34.996 75.121  7.370   1.00 12.13 ? 73  ASN B C   1 
ATOM 2391  O O   . ASN B 1 73  ? -34.078 74.570  6.752   1.00 13.30 ? 73  ASN B O   1 
ATOM 2392  C CB  . ASN B 1 73  ? -36.739 76.094  5.907   1.00 10.06 ? 73  ASN B CB  1 
ATOM 2393  C CG  . ASN B 1 73  ? -37.913 75.763  5.014   1.00 13.07 ? 73  ASN B CG  1 
ATOM 2394  O OD1 . ASN B 1 73  ? -38.366 74.615  4.960   1.00 7.59  ? 73  ASN B OD1 1 
ATOM 2395  N ND2 . ASN B 1 73  ? -38.412 76.765  4.301   1.00 11.46 ? 73  ASN B ND2 1 
ATOM 2396  N N   . ALA B 1 74  ? -34.804 75.819  8.467   1.00 13.19 ? 74  ALA B N   1 
ATOM 2397  C CA  . ALA B 1 74  ? -33.473 75.994  9.021   1.00 13.16 ? 74  ALA B CA  1 
ATOM 2398  C C   . ALA B 1 74  ? -32.891 74.644  9.465   1.00 12.81 ? 74  ALA B C   1 
ATOM 2399  O O   . ALA B 1 74  ? -31.712 74.356  9.218   1.00 14.31 ? 74  ALA B O   1 
ATOM 2400  C CB  . ALA B 1 74  ? -33.527 76.962  10.159  1.00 13.07 ? 74  ALA B CB  1 
ATOM 2401  N N   . ILE B 1 75  ? -33.738 73.815  10.078  1.00 12.44 ? 75  ILE B N   1 
ATOM 2402  C CA  . ILE B 1 75  ? -33.354 72.486  10.564  1.00 12.56 ? 75  ILE B CA  1 
ATOM 2403  C C   . ILE B 1 75  ? -33.000 71.519  9.435   1.00 15.36 ? 75  ILE B C   1 
ATOM 2404  O O   . ILE B 1 75  ? -31.984 70.822  9.501   1.00 16.37 ? 75  ILE B O   1 
ATOM 2405  C CB  . ILE B 1 75  ? -34.478 71.831  11.398  1.00 12.81 ? 75  ILE B CB  1 
ATOM 2406  C CG1 . ILE B 1 75  ? -34.881 72.735  12.562  1.00 13.94 ? 75  ILE B CG1 1 
ATOM 2407  C CG2 . ILE B 1 75  ? -34.008 70.488  11.935  1.00 12.35 ? 75  ILE B CG2 1 
ATOM 2408  C CD1 . ILE B 1 75  ? -36.024 72.187  13.386  1.00 9.16  ? 75  ILE B CD1 1 
ATOM 2409  N N   . LEU B 1 76  ? -33.868 71.432  8.430   1.00 19.40 ? 76  LEU B N   1 
ATOM 2410  C CA  . LEU B 1 76  ? -33.625 70.544  7.293   1.00 16.31 ? 76  LEU B CA  1 
ATOM 2411  C C   . LEU B 1 76  ? -32.306 70.925  6.634   1.00 17.37 ? 76  LEU B C   1 
ATOM 2412  O O   . LEU B 1 76  ? -31.394 70.102  6.529   1.00 17.18 ? 76  LEU B O   1 
ATOM 2413  C CB  . LEU B 1 76  ? -34.768 70.629  6.270   1.00 10.82 ? 76  LEU B CB  1 
ATOM 2414  C CG  . LEU B 1 76  ? -36.106 69.954  6.594   1.00 8.49  ? 76  LEU B CG  1 
ATOM 2415  C CD1 . LEU B 1 76  ? -37.134 70.375  5.566   1.00 8.69  ? 76  LEU B CD1 1 
ATOM 2416  C CD2 . LEU B 1 76  ? -35.964 68.441  6.610   1.00 10.46 ? 76  LEU B CD2 1 
ATOM 2417  N N   . CYS B 1 77  ? -32.195 72.190  6.240   1.00 16.35 ? 77  CYS B N   1 
ATOM 2418  C CA  . CYS B 1 77  ? -30.987 72.699  5.602   1.00 16.12 ? 77  CYS B CA  1 
ATOM 2419  C C   . CYS B 1 77  ? -29.715 72.299  6.354   1.00 15.03 ? 77  CYS B C   1 
ATOM 2420  O O   . CYS B 1 77  ? -28.816 71.679  5.784   1.00 9.79  ? 77  CYS B O   1 
ATOM 2421  C CB  . CYS B 1 77  ? -31.050 74.227  5.487   1.00 18.60 ? 77  CYS B CB  1 
ATOM 2422  S SG  . CYS B 1 77  ? -32.093 74.868  4.158   1.00 19.81 ? 77  CYS B SG  1 
ATOM 2423  N N   . TYR B 1 78  ? -29.661 72.635  7.640   1.00 15.77 ? 78  TYR B N   1 
ATOM 2424  C CA  . TYR B 1 78  ? -28.513 72.343  8.500   1.00 14.45 ? 78  TYR B CA  1 
ATOM 2425  C C   . TYR B 1 78  ? -28.022 70.877  8.470   1.00 12.10 ? 78  TYR B C   1 
ATOM 2426  O O   . TYR B 1 78  ? -26.814 70.629  8.458   1.00 12.06 ? 78  TYR B O   1 
ATOM 2427  C CB  . TYR B 1 78  ? -28.835 72.803  9.925   1.00 13.79 ? 78  TYR B CB  1 
ATOM 2428  C CG  . TYR B 1 78  ? -27.743 72.583  10.940  1.00 18.56 ? 78  TYR B CG  1 
ATOM 2429  C CD1 . TYR B 1 78  ? -26.509 73.219  10.817  1.00 20.01 ? 78  TYR B CD1 1 
ATOM 2430  C CD2 . TYR B 1 78  ? -27.954 71.749  12.039  1.00 20.86 ? 78  TYR B CD2 1 
ATOM 2431  C CE1 . TYR B 1 78  ? -25.512 73.029  11.762  1.00 19.37 ? 78  TYR B CE1 1 
ATOM 2432  C CE2 . TYR B 1 78  ? -26.967 71.552  12.990  1.00 20.67 ? 78  TYR B CE2 1 
ATOM 2433  C CZ  . TYR B 1 78  ? -25.747 72.191  12.844  1.00 20.19 ? 78  TYR B CZ  1 
ATOM 2434  O OH  . TYR B 1 78  ? -24.753 71.973  13.769  1.00 21.46 ? 78  TYR B OH  1 
ATOM 2435  N N   . ILE B 1 79  ? -28.942 69.914  8.455   1.00 7.50  ? 79  ILE B N   1 
ATOM 2436  C CA  . ILE B 1 79  ? -28.567 68.498  8.393   1.00 8.31  ? 79  ILE B CA  1 
ATOM 2437  C C   . ILE B 1 79  ? -28.046 68.209  6.989   1.00 9.89  ? 79  ILE B C   1 
ATOM 2438  O O   . ILE B 1 79  ? -27.095 67.448  6.802   1.00 11.82 ? 79  ILE B O   1 
ATOM 2439  C CB  . ILE B 1 79  ? -29.773 67.580  8.636   1.00 6.98  ? 79  ILE B CB  1 
ATOM 2440  C CG1 . ILE B 1 79  ? -30.448 67.942  9.956   1.00 13.09 ? 79  ILE B CG1 1 
ATOM 2441  C CG2 . ILE B 1 79  ? -29.333 66.126  8.634   1.00 4.18  ? 79  ILE B CG2 1 
ATOM 2442  C CD1 . ILE B 1 79  ? -31.931 67.664  9.968   1.00 14.06 ? 79  ILE B CD1 1 
ATOM 2443  N N   . ALA B 1 80  ? -28.684 68.836  6.005   1.00 12.02 ? 80  ALA B N   1 
ATOM 2444  C CA  . ALA B 1 80  ? -28.315 68.679  4.603   1.00 11.05 ? 80  ALA B CA  1 
ATOM 2445  C C   . ALA B 1 80  ? -26.892 69.161  4.350   1.00 11.08 ? 80  ALA B C   1 
ATOM 2446  O O   . ALA B 1 80  ? -26.153 68.554  3.568   1.00 10.05 ? 80  ALA B O   1 
ATOM 2447  C CB  . ALA B 1 80  ? -29.292 69.443  3.713   1.00 11.41 ? 80  ALA B CB  1 
ATOM 2448  N N   . ARG B 1 81  ? -26.512 70.242  5.025   1.00 11.39 ? 81  ARG B N   1 
ATOM 2449  C CA  . ARG B 1 81  ? -25.183 70.825  4.885   1.00 10.91 ? 81  ARG B CA  1 
ATOM 2450  C C   . ARG B 1 81  ? -24.059 69.827  5.105   1.00 13.95 ? 81  ARG B C   1 
ATOM 2451  O O   . ARG B 1 81  ? -23.209 69.628  4.217   1.00 14.72 ? 81  ARG B O   1 
ATOM 2452  C CB  . ARG B 1 81  ? -25.009 71.995  5.850   1.00 11.54 ? 81  ARG B CB  1 
ATOM 2453  C CG  . ARG B 1 81  ? -25.729 73.269  5.454   1.00 11.09 ? 81  ARG B CG  1 
ATOM 2454  C CD  . ARG B 1 81  ? -25.481 74.338  6.492   1.00 12.27 ? 81  ARG B CD  1 
ATOM 2455  N NE  . ARG B 1 81  ? -25.978 75.642  6.080   1.00 21.02 ? 81  ARG B NE  1 
ATOM 2456  C CZ  . ARG B 1 81  ? -27.264 75.967  6.004   1.00 22.30 ? 81  ARG B CZ  1 
ATOM 2457  N NH1 . ARG B 1 81  ? -28.198 75.081  6.310   1.00 18.15 ? 81  ARG B NH1 1 
ATOM 2458  N NH2 . ARG B 1 81  ? -27.621 77.190  5.642   1.00 19.77 ? 81  ARG B NH2 1 
ATOM 2459  N N   . LYS B 1 82  ? -24.075 69.117  6.231   1.00 14.88 ? 82  LYS B N   1 
ATOM 2460  C CA  . LYS B 1 82  ? -23.038 68.123  6.516   1.00 15.32 ? 82  LYS B CA  1 
ATOM 2461  C C   . LYS B 1 82  ? -23.224 66.862  5.709   1.00 18.77 ? 82  LYS B C   1 
ATOM 2462  O O   . LYS B 1 82  ? -22.691 65.792  6.063   1.00 16.36 ? 82  LYS B O   1 
ATOM 2463  C CB  . LYS B 1 82  ? -22.977 67.793  8.010   1.00 15.77 ? 82  LYS B CB  1 
ATOM 2464  C CG  . LYS B 1 82  ? -24.239 67.195  8.591   1.00 10.51 ? 82  LYS B CG  1 
ATOM 2465  C CD  . LYS B 1 82  ? -24.080 66.965  10.085  1.00 11.97 ? 82  LYS B CD  1 
ATOM 2466  C CE  . LYS B 1 82  ? -23.722 68.259  10.805  1.00 15.42 ? 82  LYS B CE  1 
ATOM 2467  N NZ  . LYS B 1 82  ? -23.454 68.052  12.251  1.00 19.91 ? 82  LYS B NZ  1 
ATOM 2468  N N   . HIS B 1 83  ? -23.985 66.920  4.625   1.00 21.35 ? 83  HIS B N   1 
ATOM 2469  C CA  . HIS B 1 83  ? -24.239 65.790  3.773   1.00 20.06 ? 83  HIS B CA  1 
ATOM 2470  C C   . HIS B 1 83  ? -24.247 66.190  2.297   1.00 18.86 ? 83  HIS B C   1 
ATOM 2471  O O   . HIS B 1 83  ? -24.245 65.327  1.418   1.00 19.27 ? 83  HIS B O   1 
ATOM 2472  C CB  . HIS B 1 83  ? -25.585 65.163  4.148   1.00 22.64 ? 83  HIS B CB  1 
ATOM 2473  C CG  . HIS B 1 83  ? -25.664 64.705  5.570   1.00 24.35 ? 83  HIS B CG  1 
ATOM 2474  N ND1 . HIS B 1 83  ? -24.620 64.074  6.209   1.00 28.39 ? 83  HIS B ND1 1 
ATOM 2475  C CD2 . HIS B 1 83  ? -26.671 64.772  6.474   1.00 26.65 ? 83  HIS B CD2 1 
ATOM 2476  C CE1 . HIS B 1 83  ? -24.977 63.765  7.443   1.00 29.07 ? 83  HIS B CE1 1 
ATOM 2477  N NE2 . HIS B 1 83  ? -26.218 64.180  7.630   1.00 29.20 ? 83  HIS B NE2 1 
ATOM 2478  N N   . ASN B 1 84  ? -24.229 67.495  2.032   1.00 19.96 ? 84  ASN B N   1 
ATOM 2479  C CA  . ASN B 1 84  ? -24.255 68.044  0.671   1.00 20.52 ? 84  ASN B CA  1 
ATOM 2480  C C   . ASN B 1 84  ? -25.594 67.826  -0.038  1.00 18.90 ? 84  ASN B C   1 
ATOM 2481  O O   . ASN B 1 84  ? -25.689 67.929  -1.267  1.00 14.83 ? 84  ASN B O   1 
ATOM 2482  C CB  . ASN B 1 84  ? -23.101 67.490  -0.178  1.00 22.02 ? 84  ASN B CB  1 
ATOM 2483  C CG  . ASN B 1 84  ? -21.807 68.253  0.029   1.00 19.32 ? 84  ASN B CG  1 
ATOM 2484  O OD1 . ASN B 1 84  ? -21.816 69.428  0.398   1.00 17.87 ? 84  ASN B OD1 1 
ATOM 2485  N ND2 . ASN B 1 84  ? -20.682 67.593  -0.220  1.00 13.76 ? 84  ASN B ND2 1 
ATOM 2486  N N   . LEU B 1 85  ? -26.639 67.584  0.753   1.00 15.38 ? 85  LEU B N   1 
ATOM 2487  C CA  . LEU B 1 85  ? -27.986 67.358  0.231   1.00 11.88 ? 85  LEU B CA  1 
ATOM 2488  C C   . LEU B 1 85  ? -28.681 68.664  -0.167  1.00 10.84 ? 85  LEU B C   1 
ATOM 2489  O O   . LEU B 1 85  ? -29.903 68.849  0.074   1.00 9.81  ? 85  LEU B O   1 
ATOM 2490  C CB  . LEU B 1 85  ? -28.842 66.588  1.249   1.00 8.07  ? 85  LEU B CB  1 
ATOM 2491  C CG  . LEU B 1 85  ? -28.385 65.232  1.715   1.00 4.92  ? 85  LEU B CG  1 
ATOM 2492  C CD1 . LEU B 1 85  ? -29.514 64.631  2.522   1.00 7.17  ? 85  LEU B CD1 1 
ATOM 2493  C CD2 . LEU B 1 85  ? -28.039 64.338  0.537   1.00 3.05  ? 85  LEU B CD2 1 
ATOM 2494  N N   . CYS B 1 86  ? -27.904 69.576  -0.709  1.00 8.54  ? 86  CYS B N   1 
ATOM 2495  C CA  . CYS B 1 86  ? -28.411 70.857  -1.147  1.00 9.88  ? 86  CYS B CA  1 
ATOM 2496  C C   . CYS B 1 86  ? -28.017 70.887  -2.600  1.00 11.29 ? 86  CYS B C   1 
ATOM 2497  O O   . CYS B 1 86  ? -27.604 69.852  -3.157  1.00 13.76 ? 86  CYS B O   1 
ATOM 2498  C CB  . CYS B 1 86  ? -27.717 72.005  -0.405  1.00 12.63 ? 86  CYS B CB  1 
ATOM 2499  S SG  . CYS B 1 86  ? -28.272 72.274  1.288   1.00 14.42 ? 86  CYS B SG  1 
ATOM 2500  N N   . GLY B 1 87  ? -28.160 72.045  -3.224  1.00 9.94  ? 87  GLY B N   1 
ATOM 2501  C CA  . GLY B 1 87  ? -27.774 72.159  -4.611  1.00 7.17  ? 87  GLY B CA  1 
ATOM 2502  C C   . GLY B 1 87  ? -26.263 72.200  -4.698  1.00 6.91  ? 87  GLY B C   1 
ATOM 2503  O O   . GLY B 1 87  ? -25.571 72.338  -3.687  1.00 6.57  ? 87  GLY B O   1 
ATOM 2504  N N   . GLU B 1 88  ? -25.756 72.024  -5.909  1.00 7.42  ? 88  GLU B N   1 
ATOM 2505  C CA  . GLU B 1 88  ? -24.328 72.076  -6.169  1.00 11.05 ? 88  GLU B CA  1 
ATOM 2506  C C   . GLU B 1 88  ? -24.163 73.187  -7.207  1.00 14.31 ? 88  GLU B C   1 
ATOM 2507  O O   . GLU B 1 88  ? -23.555 74.247  -6.936  1.00 11.77 ? 88  GLU B O   1 
ATOM 2508  C CB  . GLU B 1 88  ? -23.834 70.721  -6.685  1.00 9.55  ? 88  GLU B CB  1 
ATOM 2509  C CG  . GLU B 1 88  ? -24.262 69.566  -5.769  1.00 13.21 ? 88  GLU B CG  1 
ATOM 2510  C CD  . GLU B 1 88  ? -23.449 68.293  -5.934  1.00 13.94 ? 88  GLU B CD  1 
ATOM 2511  O OE1 . GLU B 1 88  ? -23.401 67.735  -7.053  1.00 12.20 ? 88  GLU B OE1 1 
ATOM 2512  O OE2 . GLU B 1 88  ? -22.889 67.831  -4.918  1.00 12.38 ? 88  GLU B OE2 1 
ATOM 2513  N N   . THR B 1 89  ? -24.788 72.992  -8.363  1.00 14.15 ? 89  THR B N   1 
ATOM 2514  C CA  . THR B 1 89  ? -24.742 73.973  -9.444  1.00 13.55 ? 89  THR B CA  1 
ATOM 2515  C C   . THR B 1 89  ? -25.850 75.024  -9.241  1.00 14.52 ? 89  THR B C   1 
ATOM 2516  O O   . THR B 1 89  ? -26.853 74.746  -8.567  1.00 13.49 ? 89  THR B O   1 
ATOM 2517  C CB  . THR B 1 89  ? -24.891 73.271  -10.819 1.00 13.66 ? 89  THR B CB  1 
ATOM 2518  O OG1 . THR B 1 89  ? -26.127 72.544  -10.864 1.00 17.49 ? 89  THR B OG1 1 
ATOM 2519  C CG2 . THR B 1 89  ? -23.746 72.286  -11.043 1.00 9.46  ? 89  THR B CG2 1 
ATOM 2520  N N   . GLU B 1 90  ? -25.673 76.214  -9.821  1.00 16.44 ? 90  GLU B N   1 
ATOM 2521  C CA  . GLU B 1 90  ? -26.652 77.306  -9.692  1.00 16.69 ? 90  GLU B CA  1 
ATOM 2522  C C   . GLU B 1 90  ? -28.076 76.879  -10.052 1.00 17.17 ? 90  GLU B C   1 
ATOM 2523  O O   . GLU B 1 90  ? -29.049 77.311  -9.422  1.00 19.20 ? 90  GLU B O   1 
ATOM 2524  C CB  . GLU B 1 90  ? -26.232 78.505  -10.550 1.00 14.99 ? 90  GLU B CB  1 
ATOM 2525  C CG  . GLU B 1 90  ? -27.165 79.724  -10.465 1.00 16.98 ? 90  GLU B CG  1 
ATOM 2526  C CD  . GLU B 1 90  ? -27.083 80.476  -9.138  1.00 18.61 ? 90  GLU B CD  1 
ATOM 2527  O OE1 . GLU B 1 90  ? -26.117 80.270  -8.370  1.00 20.90 ? 90  GLU B OE1 1 
ATOM 2528  O OE2 . GLU B 1 90  ? -27.986 81.297  -8.868  1.00 12.65 ? 90  GLU B OE2 1 
ATOM 2529  N N   . GLU B 1 91  ? -28.190 76.033  -11.071 1.00 16.94 ? 91  GLU B N   1 
ATOM 2530  C CA  . GLU B 1 91  ? -29.487 75.542  -11.495 1.00 17.95 ? 91  GLU B CA  1 
ATOM 2531  C C   . GLU B 1 91  ? -30.077 74.685  -10.383 1.00 18.49 ? 91  GLU B C   1 
ATOM 2532  O O   . GLU B 1 91  ? -31.135 74.980  -9.875  1.00 20.80 ? 91  GLU B O   1 
ATOM 2533  C CB  . GLU B 1 91  ? -29.375 74.742  -12.801 1.00 20.43 ? 91  GLU B CB  1 
ATOM 2534  C CG  . GLU B 1 91  ? -28.466 73.519  -12.745 1.00 25.45 ? 91  GLU B CG  1 
ATOM 2535  C CD  . GLU B 1 91  ? -28.497 72.687  -14.012 1.00 27.18 ? 91  GLU B CD  1 
ATOM 2536  O OE1 . GLU B 1 91  ? -29.600 72.476  -14.561 1.00 28.24 ? 91  GLU B OE1 1 
ATOM 2537  O OE2 . GLU B 1 91  ? -27.418 72.235  -14.455 1.00 27.47 ? 91  GLU B OE2 1 
ATOM 2538  N N   . GLU B 1 92  ? -29.329 73.683  -9.928  1.00 18.23 ? 92  GLU B N   1 
ATOM 2539  C CA  . GLU B 1 92  ? -29.798 72.795  -8.891  1.00 17.45 ? 92  GLU B CA  1 
ATOM 2540  C C   . GLU B 1 92  ? -30.213 73.577  -7.666  1.00 16.11 ? 92  GLU B C   1 
ATOM 2541  O O   . GLU B 1 92  ? -31.284 73.357  -7.107  1.00 14.10 ? 92  GLU B O   1 
ATOM 2542  C CB  . GLU B 1 92  ? -28.699 71.834  -8.476  1.00 16.95 ? 92  GLU B CB  1 
ATOM 2543  C CG  . GLU B 1 92  ? -28.203 70.942  -9.568  1.00 16.28 ? 92  GLU B CG  1 
ATOM 2544  C CD  . GLU B 1 92  ? -27.094 70.055  -9.084  1.00 17.16 ? 92  GLU B CD  1 
ATOM 2545  O OE1 . GLU B 1 92  ? -27.385 69.142  -8.289  1.00 20.13 ? 92  GLU B OE1 1 
ATOM 2546  O OE2 . GLU B 1 92  ? -25.931 70.285  -9.472  1.00 16.71 ? 92  GLU B OE2 1 
ATOM 2547  N N   . LYS B 1 93  ? -29.362 74.505  -7.261  1.00 13.91 ? 93  LYS B N   1 
ATOM 2548  C CA  . LYS B 1 93  ? -29.634 75.298  -6.083  1.00 14.96 ? 93  LYS B CA  1 
ATOM 2549  C C   . LYS B 1 93  ? -30.930 76.113  -6.163  1.00 14.95 ? 93  LYS B C   1 
ATOM 2550  O O   . LYS B 1 93  ? -31.696 76.117  -5.198  1.00 15.56 ? 93  LYS B O   1 
ATOM 2551  C CB  . LYS B 1 93  ? -28.423 76.153  -5.736  1.00 12.61 ? 93  LYS B CB  1 
ATOM 2552  C CG  . LYS B 1 93  ? -28.108 76.214  -4.239  1.00 7.11  ? 93  LYS B CG  1 
ATOM 2553  C CD  . LYS B 1 93  ? -26.619 75.993  -3.953  1.00 6.85  ? 93  LYS B CD  1 
ATOM 2554  C CE  . LYS B 1 93  ? -25.736 76.971  -4.719  1.00 10.29 ? 93  LYS B CE  1 
ATOM 2555  N NZ  . LYS B 1 93  ? -24.294 76.837  -4.385  1.00 8.79  ? 93  LYS B NZ  1 
ATOM 2556  N N   . ILE B 1 94  ? -31.211 76.753  -7.303  1.00 10.94 ? 94  ILE B N   1 
ATOM 2557  C CA  . ILE B 1 94  ? -32.446 77.542  -7.425  1.00 12.12 ? 94  ILE B CA  1 
ATOM 2558  C C   . ILE B 1 94  ? -33.702 76.674  -7.428  1.00 13.47 ? 94  ILE B C   1 
ATOM 2559  O O   . ILE B 1 94  ? -34.735 77.067  -6.884  1.00 12.07 ? 94  ILE B O   1 
ATOM 2560  C CB  . ILE B 1 94  ? -32.467 78.460  -8.669  1.00 14.13 ? 94  ILE B CB  1 
ATOM 2561  C CG1 . ILE B 1 94  ? -32.384 77.659  -9.955  1.00 15.54 ? 94  ILE B CG1 1 
ATOM 2562  C CG2 . ILE B 1 94  ? -31.340 79.457  -8.597  1.00 11.99 ? 94  ILE B CG2 1 
ATOM 2563  C CD1 . ILE B 1 94  ? -32.567 78.453  -11.208 1.00 12.17 ? 94  ILE B CD1 1 
ATOM 2564  N N   . ARG B 1 95  ? -33.601 75.482  -8.011  1.00 14.96 ? 95  ARG B N   1 
ATOM 2565  C CA  . ARG B 1 95  ? -34.728 74.554  -8.068  1.00 13.45 ? 95  ARG B CA  1 
ATOM 2566  C C   . ARG B 1 95  ? -35.000 74.047  -6.667  1.00 13.30 ? 95  ARG B C   1 
ATOM 2567  O O   . ARG B 1 95  ? -36.120 73.658  -6.336  1.00 13.74 ? 95  ARG B O   1 
ATOM 2568  C CB  . ARG B 1 95  ? -34.431 73.375  -8.993  1.00 8.65  ? 95  ARG B CB  1 
ATOM 2569  C CG  . ARG B 1 95  ? -33.857 73.774  -10.336 1.00 5.56  ? 95  ARG B CG  1 
ATOM 2570  C CD  . ARG B 1 95  ? -34.112 72.720  -11.392 1.00 15.63 ? 95  ARG B CD  1 
ATOM 2571  N NE  . ARG B 1 95  ? -35.365 72.982  -12.093 1.00 12.03 ? 95  ARG B NE  1 
ATOM 2572  C CZ  . ARG B 1 95  ? -36.396 72.146  -12.137 1.00 13.89 ? 95  ARG B CZ  1 
ATOM 2573  N NH1 . ARG B 1 95  ? -36.348 70.968  -11.523 1.00 13.53 ? 95  ARG B NH1 1 
ATOM 2574  N NH2 . ARG B 1 95  ? -37.493 72.505  -12.787 1.00 10.91 ? 95  ARG B NH2 1 
ATOM 2575  N N   . VAL B 1 96  ? -33.956 74.045  -5.846  1.00 13.23 ? 96  VAL B N   1 
ATOM 2576  C CA  . VAL B 1 96  ? -34.084 73.617  -4.467  1.00 13.53 ? 96  VAL B CA  1 
ATOM 2577  C C   . VAL B 1 96  ? -34.836 74.699  -3.679  1.00 12.95 ? 96  VAL B C   1 
ATOM 2578  O O   . VAL B 1 96  ? -35.747 74.391  -2.907  1.00 11.62 ? 96  VAL B O   1 
ATOM 2579  C CB  . VAL B 1 96  ? -32.688 73.313  -3.844  1.00 11.10 ? 96  VAL B CB  1 
ATOM 2580  C CG1 . VAL B 1 96  ? -32.789 73.153  -2.344  1.00 8.79  ? 96  VAL B CG1 1 
ATOM 2581  C CG2 . VAL B 1 96  ? -32.117 72.040  -4.438  1.00 8.84  ? 96  VAL B CG2 1 
ATOM 2582  N N   . ASP B 1 97  ? -34.501 75.963  -3.935  1.00 11.14 ? 97  ASP B N   1 
ATOM 2583  C CA  . ASP B 1 97  ? -35.134 77.090  -3.254  1.00 12.66 ? 97  ASP B CA  1 
ATOM 2584  C C   . ASP B 1 97  ? -36.610 77.204  -3.604  1.00 13.97 ? 97  ASP B C   1 
ATOM 2585  O O   . ASP B 1 97  ? -37.452 77.372  -2.719  1.00 16.45 ? 97  ASP B O   1 
ATOM 2586  C CB  . ASP B 1 97  ? -34.430 78.400  -3.606  1.00 8.15  ? 97  ASP B CB  1 
ATOM 2587  C CG  . ASP B 1 97  ? -32.925 78.312  -3.463  1.00 10.37 ? 97  ASP B CG  1 
ATOM 2588  O OD1 . ASP B 1 97  ? -32.425 77.463  -2.689  1.00 12.34 ? 97  ASP B OD1 1 
ATOM 2589  O OD2 . ASP B 1 97  ? -32.238 79.092  -4.145  1.00 10.16 ? 97  ASP B OD2 1 
ATOM 2590  N N   . ILE B 1 98  ? -36.913 77.160  -4.900  1.00 11.99 ? 98  ILE B N   1 
ATOM 2591  C CA  . ILE B 1 98  ? -38.293 77.237  -5.371  1.00 9.17  ? 98  ILE B CA  1 
ATOM 2592  C C   . ILE B 1 98  ? -39.087 76.159  -4.640  1.00 9.41  ? 98  ILE B C   1 
ATOM 2593  O O   . ILE B 1 98  ? -39.923 76.452  -3.789  1.00 7.65  ? 98  ILE B O   1 
ATOM 2594  C CB  . ILE B 1 98  ? -38.382 77.018  -6.921  1.00 10.50 ? 98  ILE B CB  1 
ATOM 2595  C CG1 . ILE B 1 98  ? -38.275 78.349  -7.663  1.00 9.70  ? 98  ILE B CG1 1 
ATOM 2596  C CG2 . ILE B 1 98  ? -39.695 76.375  -7.330  1.00 8.93  ? 98  ILE B CG2 1 
ATOM 2597  C CD1 . ILE B 1 98  ? -36.880 78.872  -7.827  1.00 6.99  ? 98  ILE B CD1 1 
ATOM 2598  N N   . LEU B 1 99  ? -38.728 74.909  -4.883  1.00 10.65 ? 99  LEU B N   1 
ATOM 2599  C CA  . LEU B 1 99  ? -39.391 73.772  -4.294  1.00 14.18 ? 99  LEU B CA  1 
ATOM 2600  C C   . LEU B 1 99  ? -39.486 73.894  -2.780  1.00 16.06 ? 99  LEU B C   1 
ATOM 2601  O O   . LEU B 1 99  ? -40.523 73.582  -2.218  1.00 19.18 ? 99  LEU B O   1 
ATOM 2602  C CB  . LEU B 1 99  ? -38.664 72.487  -4.670  1.00 13.93 ? 99  LEU B CB  1 
ATOM 2603  C CG  . LEU B 1 99  ? -39.487 71.236  -4.407  1.00 6.95  ? 99  LEU B CG  1 
ATOM 2604  C CD1 . LEU B 1 99  ? -40.869 71.373  -5.027  1.00 10.32 ? 99  LEU B CD1 1 
ATOM 2605  C CD2 . LEU B 1 99  ? -38.761 70.063  -4.972  1.00 9.45  ? 99  LEU B CD2 1 
ATOM 2606  N N   . GLU B 1 100 ? -38.408 74.362  -2.154  1.00 17.25 ? 100 GLU B N   1 
ATOM 2607  C CA  . GLU B 1 100 ? -38.348 74.533  -0.703  1.00 18.36 ? 100 GLU B CA  1 
ATOM 2608  C C   . GLU B 1 100 ? -39.598 75.244  -0.203  1.00 17.79 ? 100 GLU B C   1 
ATOM 2609  O O   . GLU B 1 100 ? -40.443 74.666  0.486   1.00 15.82 ? 100 GLU B O   1 
ATOM 2610  C CB  . GLU B 1 100 ? -37.119 75.370  -0.320  1.00 20.29 ? 100 GLU B CB  1 
ATOM 2611  C CG  . GLU B 1 100 ? -37.055 75.794  1.172   1.00 24.19 ? 100 GLU B CG  1 
ATOM 2612  C CD  . GLU B 1 100 ? -36.337 77.134  1.421   1.00 24.92 ? 100 GLU B CD  1 
ATOM 2613  O OE1 . GLU B 1 100 ? -35.866 77.796  0.457   1.00 21.84 ? 100 GLU B OE1 1 
ATOM 2614  O OE2 . GLU B 1 100 ? -36.261 77.548  2.600   1.00 26.25 ? 100 GLU B OE2 1 
ATOM 2615  N N   . ASN B 1 101 ? -39.717 76.498  -0.610  1.00 17.60 ? 101 ASN B N   1 
ATOM 2616  C CA  . ASN B 1 101 ? -40.820 77.350  -0.209  1.00 16.48 ? 101 ASN B CA  1 
ATOM 2617  C C   . ASN B 1 101 ? -42.157 76.900  -0.778  1.00 18.95 ? 101 ASN B C   1 
ATOM 2618  O O   . ASN B 1 101 ? -43.199 77.061  -0.135  1.00 21.03 ? 101 ASN B O   1 
ATOM 2619  C CB  . ASN B 1 101 ? -40.516 78.786  -0.627  1.00 12.94 ? 101 ASN B CB  1 
ATOM 2620  C CG  . ASN B 1 101 ? -39.195 79.286  -0.068  1.00 13.72 ? 101 ASN B CG  1 
ATOM 2621  O OD1 . ASN B 1 101 ? -39.131 79.770  1.061   1.00 15.54 ? 101 ASN B OD1 1 
ATOM 2622  N ND2 . ASN B 1 101 ? -38.132 79.163  -0.852  1.00 8.33  ? 101 ASN B ND2 1 
ATOM 2623  N N   . GLN B 1 102 ? -42.126 76.315  -1.971  1.00 18.93 ? 102 GLN B N   1 
ATOM 2624  C CA  . GLN B 1 102 ? -43.346 75.853  -2.617  1.00 15.83 ? 102 GLN B CA  1 
ATOM 2625  C C   . GLN B 1 102 ? -43.966 74.715  -1.827  1.00 16.84 ? 102 GLN B C   1 
ATOM 2626  O O   . GLN B 1 102 ? -45.168 74.716  -1.560  1.00 19.77 ? 102 GLN B O   1 
ATOM 2627  C CB  . GLN B 1 102 ? -43.070 75.418  -4.061  1.00 14.13 ? 102 GLN B CB  1 
ATOM 2628  C CG  . GLN B 1 102 ? -44.301 75.434  -4.959  1.00 10.16 ? 102 GLN B CG  1 
ATOM 2629  C CD  . GLN B 1 102 ? -44.966 76.799  -5.001  1.00 7.21  ? 102 GLN B CD  1 
ATOM 2630  O OE1 . GLN B 1 102 ? -44.646 77.627  -5.826  1.00 5.86  ? 102 GLN B OE1 1 
ATOM 2631  N NE2 . GLN B 1 102 ? -45.888 77.040  -4.083  1.00 2.41  ? 102 GLN B NE2 1 
ATOM 2632  N N   . ALA B 1 103 ? -43.135 73.768  -1.418  1.00 18.46 ? 103 ALA B N   1 
ATOM 2633  C CA  . ALA B 1 103 ? -43.603 72.624  -0.649  1.00 17.25 ? 103 ALA B CA  1 
ATOM 2634  C C   . ALA B 1 103 ? -44.334 73.134  0.584   1.00 15.31 ? 103 ALA B C   1 
ATOM 2635  O O   . ALA B 1 103 ? -45.525 72.882  0.764   1.00 12.38 ? 103 ALA B O   1 
ATOM 2636  C CB  . ALA B 1 103 ? -42.422 71.736  -0.241  1.00 13.88 ? 103 ALA B CB  1 
ATOM 2637  N N   . MET B 1 104 ? -43.628 73.915  1.393   1.00 16.83 ? 104 MET B N   1 
ATOM 2638  C CA  . MET B 1 104 ? -44.204 74.477  2.611   1.00 17.57 ? 104 MET B CA  1 
ATOM 2639  C C   . MET B 1 104 ? -45.444 75.328  2.327   1.00 16.74 ? 104 MET B C   1 
ATOM 2640  O O   . MET B 1 104 ? -46.337 75.437  3.173   1.00 17.08 ? 104 MET B O   1 
ATOM 2641  C CB  . MET B 1 104 ? -43.158 75.296  3.374   1.00 19.23 ? 104 MET B CB  1 
ATOM 2642  C CG  . MET B 1 104 ? -41.971 74.480  3.875   1.00 20.94 ? 104 MET B CG  1 
ATOM 2643  S SD  . MET B 1 104 ? -42.407 73.237  5.106   1.00 27.17 ? 104 MET B SD  1 
ATOM 2644  C CE  . MET B 1 104 ? -42.275 74.177  6.603   1.00 28.65 ? 104 MET B CE  1 
ATOM 2645  N N   . ASP B 1 105 ? -45.518 75.893  1.126   1.00 13.26 ? 105 ASP B N   1 
ATOM 2646  C CA  . ASP B 1 105 ? -46.655 76.716  0.750   1.00 12.36 ? 105 ASP B CA  1 
ATOM 2647  C C   . ASP B 1 105 ? -47.927 75.875  0.642   1.00 14.15 ? 105 ASP B C   1 
ATOM 2648  O O   . ASP B 1 105 ? -48.987 76.268  1.143   1.00 15.74 ? 105 ASP B O   1 
ATOM 2649  C CB  . ASP B 1 105 ? -46.372 77.430  -0.575  1.00 8.55  ? 105 ASP B CB  1 
ATOM 2650  C CG  . ASP B 1 105 ? -47.279 78.629  -0.807  1.00 10.53 ? 105 ASP B CG  1 
ATOM 2651  O OD1 . ASP B 1 105 ? -47.900 79.116  0.162   1.00 11.42 ? 105 ASP B OD1 1 
ATOM 2652  O OD2 . ASP B 1 105 ? -47.355 79.100  -1.961  1.00 14.94 ? 105 ASP B OD2 1 
ATOM 2653  N N   . VAL B 1 106 ? -47.816 74.707  0.013   1.00 11.28 ? 106 VAL B N   1 
ATOM 2654  C CA  . VAL B 1 106 ? -48.965 73.821  -0.161  1.00 12.91 ? 106 VAL B CA  1 
ATOM 2655  C C   . VAL B 1 106 ? -49.295 73.033  1.103   1.00 15.66 ? 106 VAL B C   1 
ATOM 2656  O O   . VAL B 1 106 ? -50.466 72.630  1.301   1.00 17.65 ? 106 VAL B O   1 
ATOM 2657  C CB  . VAL B 1 106 ? -48.795 72.853  -1.363  1.00 11.18 ? 106 VAL B CB  1 
ATOM 2658  C CG1 . VAL B 1 106 ? -48.409 73.626  -2.611  1.00 11.02 ? 106 VAL B CG1 1 
ATOM 2659  C CG2 . VAL B 1 106 ? -47.779 71.790  -1.076  1.00 11.10 ? 106 VAL B CG2 1 
ATOM 2660  N N   . SER B 1 107 ? -48.287 72.791  1.942   1.00 16.51 ? 107 SER B N   1 
ATOM 2661  C CA  . SER B 1 107 ? -48.503 72.084  3.200   1.00 17.71 ? 107 SER B CA  1 
ATOM 2662  C C   . SER B 1 107 ? -49.385 73.007  4.030   1.00 18.15 ? 107 SER B C   1 
ATOM 2663  O O   . SER B 1 107 ? -50.416 72.597  4.559   1.00 16.30 ? 107 SER B O   1 
ATOM 2664  C CB  . SER B 1 107 ? -47.181 71.841  3.939   1.00 17.29 ? 107 SER B CB  1 
ATOM 2665  O OG  . SER B 1 107 ? -46.305 71.016  3.199   1.00 14.15 ? 107 SER B OG  1 
ATOM 2666  N N   . ASN B 1 108 ? -48.987 74.272  4.092   1.00 17.44 ? 108 ASN B N   1 
ATOM 2667  C CA  . ASN B 1 108 ? -49.728 75.273  4.833   1.00 21.09 ? 108 ASN B CA  1 
ATOM 2668  C C   . ASN B 1 108 ? -51.149 75.454  4.305   1.00 23.56 ? 108 ASN B C   1 
ATOM 2669  O O   . ASN B 1 108 ? -52.099 75.515  5.091   1.00 22.52 ? 108 ASN B O   1 
ATOM 2670  C CB  . ASN B 1 108 ? -48.981 76.601  4.813   1.00 21.21 ? 108 ASN B CB  1 
ATOM 2671  C CG  . ASN B 1 108 ? -48.263 76.871  6.106   1.00 21.08 ? 108 ASN B CG  1 
ATOM 2672  O OD1 . ASN B 1 108 ? -47.708 75.959  6.726   1.00 17.66 ? 108 ASN B OD1 1 
ATOM 2673  N ND2 . ASN B 1 108 ? -48.283 78.125  6.539   1.00 21.09 ? 108 ASN B ND2 1 
ATOM 2674  N N   . GLN B 1 109 ? -51.293 75.533  2.981   1.00 25.51 ? 109 GLN B N   1 
ATOM 2675  C CA  . GLN B 1 109 ? -52.608 75.689  2.351   1.00 22.70 ? 109 GLN B CA  1 
ATOM 2676  C C   . GLN B 1 109 ? -53.595 74.654  2.888   1.00 22.91 ? 109 GLN B C   1 
ATOM 2677  O O   . GLN B 1 109 ? -54.716 74.992  3.290   1.00 21.53 ? 109 GLN B O   1 
ATOM 2678  C CB  . GLN B 1 109 ? -52.504 75.520  0.838   1.00 23.39 ? 109 GLN B CB  1 
ATOM 2679  C CG  . GLN B 1 109 ? -52.005 76.728  0.096   1.00 24.07 ? 109 GLN B CG  1 
ATOM 2680  C CD  . GLN B 1 109 ? -52.805 76.981  -1.165  1.00 23.47 ? 109 GLN B CD  1 
ATOM 2681  O OE1 . GLN B 1 109 ? -53.998 76.701  -1.213  1.00 22.06 ? 109 GLN B OE1 1 
ATOM 2682  N NE2 . GLN B 1 109 ? -52.155 77.510  -2.192  1.00 25.20 ? 109 GLN B NE2 1 
ATOM 2683  N N   . LEU B 1 110 ? -53.157 73.396  2.890   1.00 20.85 ? 110 LEU B N   1 
ATOM 2684  C CA  . LEU B 1 110 ? -53.959 72.278  3.371   1.00 21.57 ? 110 LEU B CA  1 
ATOM 2685  C C   . LEU B 1 110 ? -54.203 72.376  4.882   1.00 21.18 ? 110 LEU B C   1 
ATOM 2686  O O   . LEU B 1 110 ? -55.285 72.030  5.371   1.00 21.61 ? 110 LEU B O   1 
ATOM 2687  C CB  . LEU B 1 110 ? -53.255 70.961  3.019   1.00 19.01 ? 110 LEU B CB  1 
ATOM 2688  C CG  . LEU B 1 110 ? -53.920 69.624  3.348   1.00 14.85 ? 110 LEU B CG  1 
ATOM 2689  C CD1 . LEU B 1 110 ? -55.267 69.513  2.663   1.00 11.87 ? 110 LEU B CD1 1 
ATOM 2690  C CD2 . LEU B 1 110 ? -53.005 68.501  2.904   1.00 14.46 ? 110 LEU B CD2 1 
ATOM 2691  N N   . ALA B 1 111 ? -53.206 72.881  5.605   1.00 20.18 ? 111 ALA B N   1 
ATOM 2692  C CA  . ALA B 1 111 ? -53.288 73.032  7.051   1.00 21.61 ? 111 ALA B CA  1 
ATOM 2693  C C   . ALA B 1 111 ? -54.371 74.018  7.463   1.00 22.56 ? 111 ALA B C   1 
ATOM 2694  O O   . ALA B 1 111 ? -55.208 73.722  8.326   1.00 18.11 ? 111 ALA B O   1 
ATOM 2695  C CB  . ALA B 1 111 ? -51.941 73.469  7.602   1.00 21.95 ? 111 ALA B CB  1 
ATOM 2696  N N   . ARG B 1 112 ? -54.367 75.176  6.813   1.00 22.86 ? 112 ARG B N   1 
ATOM 2697  C CA  . ARG B 1 112 ? -55.331 76.234  7.090   1.00 24.28 ? 112 ARG B CA  1 
ATOM 2698  C C   . ARG B 1 112 ? -56.752 75.724  6.974   1.00 24.03 ? 112 ARG B C   1 
ATOM 2699  O O   . ARG B 1 112 ? -57.562 75.987  7.842   1.00 25.69 ? 112 ARG B O   1 
ATOM 2700  C CB  . ARG B 1 112 ? -55.126 77.410  6.134   1.00 24.91 ? 112 ARG B CB  1 
ATOM 2701  C CG  . ARG B 1 112 ? -53.765 78.058  6.266   1.00 26.65 ? 112 ARG B CG  1 
ATOM 2702  C CD  . ARG B 1 112 ? -53.586 79.230  5.326   1.00 25.70 ? 112 ARG B CD  1 
ATOM 2703  N NE  . ARG B 1 112 ? -52.181 79.617  5.281   1.00 33.09 ? 112 ARG B NE  1 
ATOM 2704  C CZ  . ARG B 1 112 ? -51.382 79.415  4.237   1.00 37.94 ? 112 ARG B CZ  1 
ATOM 2705  N NH1 . ARG B 1 112 ? -51.850 78.840  3.136   1.00 38.84 ? 112 ARG B NH1 1 
ATOM 2706  N NH2 . ARG B 1 112 ? -50.096 79.733  4.313   1.00 37.41 ? 112 ARG B NH2 1 
ATOM 2707  N N   . VAL B 1 113 ? -57.021 74.984  5.903   1.00 24.23 ? 113 VAL B N   1 
ATOM 2708  C CA  . VAL B 1 113 ? -58.342 74.413  5.646   1.00 22.25 ? 113 VAL B CA  1 
ATOM 2709  C C   . VAL B 1 113 ? -58.696 73.360  6.689   1.00 21.62 ? 113 VAL B C   1 
ATOM 2710  O O   . VAL B 1 113 ? -59.861 73.222  7.070   1.00 21.23 ? 113 VAL B O   1 
ATOM 2711  C CB  . VAL B 1 113 ? -58.410 73.782  4.235   1.00 22.50 ? 113 VAL B CB  1 
ATOM 2712  C CG1 . VAL B 1 113 ? -59.721 73.030  4.044   1.00 22.88 ? 113 VAL B CG1 1 
ATOM 2713  C CG2 . VAL B 1 113 ? -58.244 74.860  3.170   1.00 22.70 ? 113 VAL B CG2 1 
ATOM 2714  N N   . CYS B 1 114 ? -57.687 72.631  7.161   1.00 24.08 ? 114 CYS B N   1 
ATOM 2715  C CA  . CYS B 1 114 ? -57.898 71.591  8.159   1.00 24.27 ? 114 CYS B CA  1 
ATOM 2716  C C   . CYS B 1 114 ? -57.947 72.141  9.583   1.00 24.01 ? 114 CYS B C   1 
ATOM 2717  O O   . CYS B 1 114 ? -58.455 71.485  10.496  1.00 21.81 ? 114 CYS B O   1 
ATOM 2718  C CB  . CYS B 1 114 ? -56.836 70.509  8.034   1.00 21.33 ? 114 CYS B CB  1 
ATOM 2719  S SG  . CYS B 1 114 ? -57.520 68.883  8.126   1.00 12.34 ? 114 CYS B SG  1 
ATOM 2720  N N   . TYR B 1 115 ? -57.395 73.334  9.779   1.00 22.22 ? 115 TYR B N   1 
ATOM 2721  C CA  . TYR B 1 115 ? -57.424 73.979  11.089  1.00 23.66 ? 115 TYR B CA  1 
ATOM 2722  C C   . TYR B 1 115 ? -58.550 75.014  11.120  1.00 24.41 ? 115 TYR B C   1 
ATOM 2723  O O   . TYR B 1 115 ? -58.488 76.028  11.848  1.00 22.49 ? 115 TYR B O   1 
ATOM 2724  C CB  . TYR B 1 115 ? -56.079 74.634  11.430  1.00 26.08 ? 115 TYR B CB  1 
ATOM 2725  C CG  . TYR B 1 115 ? -55.083 73.670  12.028  1.00 27.56 ? 115 TYR B CG  1 
ATOM 2726  C CD1 . TYR B 1 115 ? -55.479 72.743  12.991  1.00 28.05 ? 115 TYR B CD1 1 
ATOM 2727  C CD2 . TYR B 1 115 ? -53.755 73.672  11.610  1.00 31.22 ? 115 TYR B CD2 1 
ATOM 2728  C CE1 . TYR B 1 115 ? -54.580 71.822  13.520  1.00 29.73 ? 115 TYR B CE1 1 
ATOM 2729  C CE2 . TYR B 1 115 ? -52.846 72.737  12.135  1.00 31.07 ? 115 TYR B CE2 1 
ATOM 2730  C CZ  . TYR B 1 115 ? -53.267 71.822  13.089  1.00 31.44 ? 115 TYR B CZ  1 
ATOM 2731  O OH  . TYR B 1 115 ? -52.381 70.898  13.603  1.00 31.26 ? 115 TYR B OH  1 
ATOM 2732  N N   . SER B 1 116 ? -59.570 74.767  10.304  1.00 23.56 ? 116 SER B N   1 
ATOM 2733  C CA  . SER B 1 116 ? -60.726 75.642  10.212  1.00 24.62 ? 116 SER B CA  1 
ATOM 2734  C C   . SER B 1 116 ? -61.961 74.783  10.412  1.00 24.96 ? 116 SER B C   1 
ATOM 2735  O O   . SER B 1 116 ? -62.155 73.787  9.712   1.00 24.91 ? 116 SER B O   1 
ATOM 2736  C CB  . SER B 1 116 ? -60.776 76.332  8.840   1.00 26.10 ? 116 SER B CB  1 
ATOM 2737  O OG  . SER B 1 116 ? -61.921 77.182  8.705   1.00 24.86 ? 116 SER B OG  1 
ATOM 2738  N N   . PRO B 1 117 ? -62.807 75.148  11.385  1.00 24.96 ? 117 PRO B N   1 
ATOM 2739  C CA  . PRO B 1 117 ? -64.036 74.406  11.676  1.00 25.29 ? 117 PRO B CA  1 
ATOM 2740  C C   . PRO B 1 117 ? -64.948 74.391  10.454  1.00 28.99 ? 117 PRO B C   1 
ATOM 2741  O O   . PRO B 1 117 ? -65.792 73.509  10.308  1.00 28.93 ? 117 PRO B O   1 
ATOM 2742  C CB  . PRO B 1 117 ? -64.648 75.204  12.829  1.00 22.92 ? 117 PRO B CB  1 
ATOM 2743  C CG  . PRO B 1 117 ? -64.147 76.608  12.584  1.00 25.02 ? 117 PRO B CG  1 
ATOM 2744  C CD  . PRO B 1 117 ? -62.706 76.349  12.232  1.00 24.67 ? 117 PRO B CD  1 
ATOM 2745  N N   . ASP B 1 118 ? -64.730 75.343  9.546   1.00 29.07 ? 118 ASP B N   1 
ATOM 2746  C CA  . ASP B 1 118 ? -65.508 75.452  8.317   1.00 29.72 ? 118 ASP B CA  1 
ATOM 2747  C C   . ASP B 1 118 ? -64.960 74.466  7.292   1.00 29.25 ? 118 ASP B C   1 
ATOM 2748  O O   . ASP B 1 118 ? -65.141 74.640  6.089   1.00 29.33 ? 118 ASP B O   1 
ATOM 2749  C CB  . ASP B 1 118 ? -65.423 76.878  7.760   1.00 36.58 ? 118 ASP B CB  1 
ATOM 2750  C CG  . ASP B 1 118 ? -65.788 77.936  8.792   1.00 40.21 ? 118 ASP B CG  1 
ATOM 2751  O OD1 . ASP B 1 118 ? -66.999 78.170  9.007   1.00 42.89 ? 118 ASP B OD1 1 
ATOM 2752  O OD2 . ASP B 1 118 ? -64.863 78.532  9.389   1.00 39.02 ? 118 ASP B OD2 1 
ATOM 2753  N N   . PHE B 1 119 ? -64.295 73.432  7.776   1.00 27.10 ? 119 PHE B N   1 
ATOM 2754  C CA  . PHE B 1 119 ? -63.691 72.377  6.991   1.00 26.50 ? 119 PHE B CA  1 
ATOM 2755  C C   . PHE B 1 119 ? -64.467 72.034  5.725   1.00 26.23 ? 119 PHE B C   1 
ATOM 2756  O O   . PHE B 1 119 ? -64.092 72.451  4.628   1.00 25.10 ? 119 PHE B O   1 
ATOM 2757  C CB  . PHE B 1 119 ? -63.516 71.122  7.861   1.00 26.59 ? 119 PHE B CB  1 
ATOM 2758  C CG  . PHE B 1 119 ? -62.973 69.936  7.120   1.00 25.98 ? 119 PHE B CG  1 
ATOM 2759  C CD1 . PHE B 1 119 ? -61.755 70.009  6.460   1.00 26.82 ? 119 PHE B CD1 1 
ATOM 2760  C CD2 . PHE B 1 119 ? -63.676 68.740  7.092   1.00 27.50 ? 119 PHE B CD2 1 
ATOM 2761  C CE1 . PHE B 1 119 ? -61.239 68.910  5.780   1.00 26.76 ? 119 PHE B CE1 1 
ATOM 2762  C CE2 . PHE B 1 119 ? -63.171 67.634  6.416   1.00 29.06 ? 119 PHE B CE2 1 
ATOM 2763  C CZ  . PHE B 1 119 ? -61.947 67.720  5.758   1.00 27.00 ? 119 PHE B CZ  1 
ATOM 2764  N N   . GLU B 1 120 ? -65.577 71.320  5.890   1.00 26.64 ? 120 GLU B N   1 
ATOM 2765  C CA  . GLU B 1 120 ? -66.403 70.901  4.759   1.00 26.07 ? 120 GLU B CA  1 
ATOM 2766  C C   . GLU B 1 120 ? -66.825 72.016  3.813   1.00 25.21 ? 120 GLU B C   1 
ATOM 2767  O O   . GLU B 1 120 ? -67.148 71.752  2.656   1.00 27.15 ? 120 GLU B O   1 
ATOM 2768  C CB  . GLU B 1 120 ? -67.624 70.116  5.243   1.00 25.02 ? 120 GLU B CB  1 
ATOM 2769  C CG  . GLU B 1 120 ? -67.307 68.661  5.548   1.00 22.81 ? 120 GLU B CG  1 
ATOM 2770  C CD  . GLU B 1 120 ? -68.514 67.881  6.009   1.00 23.14 ? 120 GLU B CD  1 
ATOM 2771  O OE1 . GLU B 1 120 ? -69.533 67.889  5.290   1.00 21.49 ? 120 GLU B OE1 1 
ATOM 2772  O OE2 . GLU B 1 120 ? -68.445 67.257  7.088   1.00 24.01 ? 120 GLU B OE2 1 
ATOM 2773  N N   . LYS B 1 121 ? -66.796 73.255  4.296   1.00 25.11 ? 121 LYS B N   1 
ATOM 2774  C CA  . LYS B 1 121 ? -67.172 74.407  3.482   1.00 27.17 ? 121 LYS B CA  1 
ATOM 2775  C C   . LYS B 1 121 ? -66.050 74.715  2.487   1.00 27.59 ? 121 LYS B C   1 
ATOM 2776  O O   . LYS B 1 121 ? -66.302 74.914  1.295   1.00 26.73 ? 121 LYS B O   1 
ATOM 2777  C CB  . LYS B 1 121 ? -67.433 75.623  4.376   1.00 26.98 ? 121 LYS B CB  1 
ATOM 2778  C CG  . LYS B 1 121 ? -68.331 76.684  3.762   1.00 26.85 ? 121 LYS B CG  1 
ATOM 2779  C CD  . LYS B 1 121 ? -69.790 76.230  3.693   1.00 29.82 ? 121 LYS B CD  1 
ATOM 2780  C CE  . LYS B 1 121 ? -70.426 76.075  5.078   1.00 28.44 ? 121 LYS B CE  1 
ATOM 2781  N NZ  . LYS B 1 121 ? -70.541 77.363  5.811   1.00 25.49 ? 121 LYS B NZ  1 
ATOM 2782  N N   . LEU B 1 122 ? -64.811 74.734  2.974   1.00 26.65 ? 122 LEU B N   1 
ATOM 2783  C CA  . LEU B 1 122 ? -63.667 75.013  2.111   1.00 26.68 ? 122 LEU B CA  1 
ATOM 2784  C C   . LEU B 1 122 ? -63.096 73.751  1.489   1.00 25.66 ? 122 LEU B C   1 
ATOM 2785  O O   . LEU B 1 122 ? -62.429 73.820  0.439   1.00 25.64 ? 122 LEU B O   1 
ATOM 2786  C CB  . LEU B 1 122 ? -62.554 75.736  2.875   1.00 27.71 ? 122 LEU B CB  1 
ATOM 2787  C CG  . LEU B 1 122 ? -62.846 77.100  3.494   1.00 29.67 ? 122 LEU B CG  1 
ATOM 2788  C CD1 . LEU B 1 122 ? -63.315 76.918  4.924   1.00 30.84 ? 122 LEU B CD1 1 
ATOM 2789  C CD2 . LEU B 1 122 ? -61.581 77.936  3.466   1.00 29.72 ? 122 LEU B CD2 1 
ATOM 2790  N N   . LYS B 1 123 ? -63.389 72.602  2.072   1.00 22.38 ? 123 LYS B N   1 
ATOM 2791  C CA  . LYS B 1 123 ? -62.900 71.311  1.588   1.00 20.54 ? 123 LYS B CA  1 
ATOM 2792  C C   . LYS B 1 123 ? -63.018 71.122  0.064   1.00 22.20 ? 123 LYS B C   1 
ATOM 2793  O O   . LYS B 1 123 ? -62.020 70.759  -0.598  1.00 18.46 ? 123 LYS B O   1 
ATOM 2794  C CB  . LYS B 1 123 ? -63.612 70.167  2.327   1.00 16.68 ? 123 LYS B CB  1 
ATOM 2795  C CG  . LYS B 1 123 ? -63.178 68.781  1.900   1.00 9.15  ? 123 LYS B CG  1 
ATOM 2796  C CD  . LYS B 1 123 ? -64.189 67.742  2.346   1.00 2.00  ? 123 LYS B CD  1 
ATOM 2797  C CE  . LYS B 1 123 ? -63.931 66.392  1.691   1.00 2.00  ? 123 LYS B CE  1 
ATOM 2798  N NZ  . LYS B 1 123 ? -62.601 65.819  2.042   1.00 2.00  ? 123 LYS B NZ  1 
ATOM 2799  N N   . PRO B 1 124 ? -64.208 71.394  -0.518  1.00 25.37 ? 124 PRO B N   1 
ATOM 2800  C CA  . PRO B 1 124 ? -64.402 71.236  -1.964  1.00 27.46 ? 124 PRO B CA  1 
ATOM 2801  C C   . PRO B 1 124 ? -63.573 72.206  -2.799  1.00 29.21 ? 124 PRO B C   1 
ATOM 2802  O O   . PRO B 1 124 ? -63.034 71.840  -3.844  1.00 26.50 ? 124 PRO B O   1 
ATOM 2803  C CB  . PRO B 1 124 ? -65.898 71.506  -2.130  1.00 26.85 ? 124 PRO B CB  1 
ATOM 2804  C CG  . PRO B 1 124 ? -66.181 72.491  -1.042  1.00 26.86 ? 124 PRO B CG  1 
ATOM 2805  C CD  . PRO B 1 124 ? -65.472 71.863  0.097   1.00 27.38 ? 124 PRO B CD  1 
ATOM 2806  N N   . GLU B 1 125 ? -63.464 73.437  -2.317  1.00 29.27 ? 125 GLU B N   1 
ATOM 2807  C CA  . GLU B 1 125 ? -62.715 74.483  -3.000  1.00 28.48 ? 125 GLU B CA  1 
ATOM 2808  C C   . GLU B 1 125 ? -61.274 74.051  -3.211  1.00 27.99 ? 125 GLU B C   1 
ATOM 2809  O O   . GLU B 1 125 ? -60.689 74.310  -4.264  1.00 30.44 ? 125 GLU B O   1 
ATOM 2810  C CB  . GLU B 1 125 ? -62.752 75.764  -2.176  1.00 30.04 ? 125 GLU B CB  1 
ATOM 2811  C CG  . GLU B 1 125 ? -64.161 76.218  -1.830  1.00 30.54 ? 125 GLU B CG  1 
ATOM 2812  C CD  . GLU B 1 125 ? -64.192 77.328  -0.802  1.00 25.20 ? 125 GLU B CD  1 
ATOM 2813  O OE1 . GLU B 1 125 ? -63.125 77.677  -0.253  1.00 24.44 ? 125 GLU B OE1 1 
ATOM 2814  O OE2 . GLU B 1 125 ? -65.293 77.846  -0.535  1.00 28.35 ? 125 GLU B OE2 1 
ATOM 2815  N N   . TYR B 1 126 ? -60.704 73.398  -2.204  1.00 26.44 ? 126 TYR B N   1 
ATOM 2816  C CA  . TYR B 1 126 ? -59.332 72.915  -2.291  1.00 25.76 ? 126 TYR B CA  1 
ATOM 2817  C C   . TYR B 1 126 ? -59.286 71.736  -3.251  1.00 25.36 ? 126 TYR B C   1 
ATOM 2818  O O   . TYR B 1 126 ? -58.413 71.661  -4.117  1.00 24.66 ? 126 TYR B O   1 
ATOM 2819  C CB  . TYR B 1 126 ? -58.817 72.478  -0.916  1.00 24.19 ? 126 TYR B CB  1 
ATOM 2820  C CG  . TYR B 1 126 ? -57.323 72.215  -0.882  1.00 21.41 ? 126 TYR B CG  1 
ATOM 2821  C CD1 . TYR B 1 126 ? -56.407 73.261  -1.043  1.00 20.95 ? 126 TYR B CD1 1 
ATOM 2822  C CD2 . TYR B 1 126 ? -56.823 70.919  -0.679  1.00 18.31 ? 126 TYR B CD2 1 
ATOM 2823  C CE1 . TYR B 1 126 ? -55.036 73.033  -0.998  1.00 17.46 ? 126 TYR B CE1 1 
ATOM 2824  C CE2 . TYR B 1 126 ? -55.446 70.690  -0.636  1.00 19.74 ? 126 TYR B CE2 1 
ATOM 2825  C CZ  . TYR B 1 126 ? -54.557 71.748  -0.793  1.00 18.66 ? 126 TYR B CZ  1 
ATOM 2826  O OH  . TYR B 1 126 ? -53.188 71.530  -0.727  1.00 12.48 ? 126 TYR B OH  1 
ATOM 2827  N N   . LEU B 1 127 ? -60.244 70.826  -3.102  1.00 26.30 ? 127 LEU B N   1 
ATOM 2828  C CA  . LEU B 1 127 ? -60.321 69.643  -3.946  1.00 24.99 ? 127 LEU B CA  1 
ATOM 2829  C C   . LEU B 1 127 ? -60.452 69.953  -5.434  1.00 23.38 ? 127 LEU B C   1 
ATOM 2830  O O   . LEU B 1 127 ? -59.962 69.192  -6.267  1.00 22.32 ? 127 LEU B O   1 
ATOM 2831  C CB  . LEU B 1 127 ? -61.468 68.741  -3.491  1.00 23.41 ? 127 LEU B CB  1 
ATOM 2832  C CG  . LEU B 1 127 ? -61.263 68.034  -2.148  1.00 20.05 ? 127 LEU B CG  1 
ATOM 2833  C CD1 . LEU B 1 127 ? -62.516 67.258  -1.761  1.00 12.94 ? 127 LEU B CD1 1 
ATOM 2834  C CD2 . LEU B 1 127 ? -60.057 67.106  -2.235  1.00 20.46 ? 127 LEU B CD2 1 
ATOM 2835  N N   . GLU B 1 128 ? -61.100 71.066  -5.771  1.00 23.27 ? 128 GLU B N   1 
ATOM 2836  C CA  . GLU B 1 128 ? -61.269 71.448  -7.174  1.00 26.49 ? 128 GLU B CA  1 
ATOM 2837  C C   . GLU B 1 128 ? -59.999 72.038  -7.805  1.00 28.47 ? 128 GLU B C   1 
ATOM 2838  O O   . GLU B 1 128 ? -59.701 71.788  -8.974  1.00 29.68 ? 128 GLU B O   1 
ATOM 2839  C CB  . GLU B 1 128 ? -62.467 72.400  -7.347  1.00 26.66 ? 128 GLU B CB  1 
ATOM 2840  C CG  . GLU B 1 128 ? -62.337 73.765  -6.679  1.00 26.01 ? 128 GLU B CG  1 
ATOM 2841  C CD  . GLU B 1 128 ? -63.598 74.612  -6.807  1.00 24.55 ? 128 GLU B CD  1 
ATOM 2842  O OE1 . GLU B 1 128 ? -64.609 74.292  -6.147  1.00 20.65 ? 128 GLU B OE1 1 
ATOM 2843  O OE2 . GLU B 1 128 ? -63.577 75.601  -7.571  1.00 24.99 ? 128 GLU B OE2 1 
ATOM 2844  N N   . GLU B 1 129 ? -59.251 72.816  -7.032  1.00 26.80 ? 129 GLU B N   1 
ATOM 2845  C CA  . GLU B 1 129 ? -58.015 73.415  -7.527  1.00 26.24 ? 129 GLU B CA  1 
ATOM 2846  C C   . GLU B 1 129 ? -56.842 72.428  -7.442  1.00 24.35 ? 129 GLU B C   1 
ATOM 2847  O O   . GLU B 1 129 ? -55.892 72.506  -8.225  1.00 25.88 ? 129 GLU B O   1 
ATOM 2848  C CB  . GLU B 1 129 ? -57.681 74.675  -6.726  1.00 26.67 ? 129 GLU B CB  1 
ATOM 2849  C CG  . GLU B 1 129 ? -58.684 75.808  -6.868  1.00 26.65 ? 129 GLU B CG  1 
ATOM 2850  C CD  . GLU B 1 129 ? -58.512 76.886  -5.805  1.00 28.78 ? 129 GLU B CD  1 
ATOM 2851  O OE1 . GLU B 1 129 ? -57.376 77.065  -5.305  1.00 30.14 ? 129 GLU B OE1 1 
ATOM 2852  O OE2 . GLU B 1 129 ? -59.512 77.548  -5.457  1.00 27.08 ? 129 GLU B OE2 1 
ATOM 2853  N N   . LEU B 1 130 ? -56.932 71.485  -6.505  1.00 21.19 ? 130 LEU B N   1 
ATOM 2854  C CA  . LEU B 1 130 ? -55.892 70.476  -6.275  1.00 20.04 ? 130 LEU B CA  1 
ATOM 2855  C C   . LEU B 1 130 ? -55.284 69.798  -7.519  1.00 22.43 ? 130 LEU B C   1 
ATOM 2856  O O   . LEU B 1 130 ? -54.064 69.622  -7.596  1.00 21.13 ? 130 LEU B O   1 
ATOM 2857  C CB  . LEU B 1 130 ? -56.396 69.421  -5.275  1.00 14.80 ? 130 LEU B CB  1 
ATOM 2858  C CG  . LEU B 1 130 ? -55.433 68.352  -4.745  1.00 7.75  ? 130 LEU B CG  1 
ATOM 2859  C CD1 . LEU B 1 130 ? -54.228 68.993  -4.075  1.00 9.55  ? 130 LEU B CD1 1 
ATOM 2860  C CD2 . LEU B 1 130 ? -56.172 67.451  -3.763  1.00 8.82  ? 130 LEU B CD2 1 
ATOM 2861  N N   . PRO B 1 131 ? -56.118 69.401  -8.504  1.00 25.75 ? 131 PRO B N   1 
ATOM 2862  C CA  . PRO B 1 131 ? -55.578 68.753  -9.709  1.00 24.49 ? 131 PRO B CA  1 
ATOM 2863  C C   . PRO B 1 131 ? -54.541 69.594  -10.444 1.00 24.87 ? 131 PRO B C   1 
ATOM 2864  O O   . PRO B 1 131 ? -53.528 69.071  -10.902 1.00 27.44 ? 131 PRO B O   1 
ATOM 2865  C CB  . PRO B 1 131 ? -56.822 68.531  -10.559 1.00 22.96 ? 131 PRO B CB  1 
ATOM 2866  C CG  . PRO B 1 131 ? -57.882 68.283  -9.528  1.00 25.22 ? 131 PRO B CG  1 
ATOM 2867  C CD  . PRO B 1 131 ? -57.593 69.377  -8.544  1.00 25.14 ? 131 PRO B CD  1 
ATOM 2868  N N   . THR B 1 132 ? -54.779 70.897  -10.542 1.00 23.71 ? 132 THR B N   1 
ATOM 2869  C CA  . THR B 1 132 ? -53.835 71.778  -11.224 1.00 25.69 ? 132 THR B CA  1 
ATOM 2870  C C   . THR B 1 132 ? -52.558 71.851  -10.377 1.00 28.14 ? 132 THR B C   1 
ATOM 2871  O O   . THR B 1 132 ? -51.444 71.913  -10.907 1.00 29.26 ? 132 THR B O   1 
ATOM 2872  C CB  . THR B 1 132 ? -54.434 73.201  -11.446 1.00 26.22 ? 132 THR B CB  1 
ATOM 2873  O OG1 . THR B 1 132 ? -54.036 74.104  -10.387 1.00 21.69 ? 132 THR B OG1 1 
ATOM 2874  C CG2 . THR B 1 132 ? -55.952 73.130  -11.488 1.00 24.09 ? 132 THR B CG2 1 
ATOM 2875  N N   . MET B 1 133 ? -52.746 71.794  -9.059  1.00 28.63 ? 133 MET B N   1 
ATOM 2876  C CA  . MET B 1 133 ? -51.664 71.845  -8.076  1.00 29.46 ? 133 MET B CA  1 
ATOM 2877  C C   . MET B 1 133 ? -50.714 70.672  -8.279  1.00 29.08 ? 133 MET B C   1 
ATOM 2878  O O   . MET B 1 133 ? -49.519 70.862  -8.525  1.00 31.83 ? 133 MET B O   1 
ATOM 2879  C CB  . MET B 1 133 ? -52.262 71.796  -6.666  1.00 28.75 ? 133 MET B CB  1 
ATOM 2880  C CG  . MET B 1 133 ? -51.265 71.840  -5.519  1.00 27.58 ? 133 MET B CG  1 
ATOM 2881  S SD  . MET B 1 133 ? -52.105 71.663  -3.922  1.00 30.08 ? 133 MET B SD  1 
ATOM 2882  C CE  . MET B 1 133 ? -52.945 73.254  -3.798  1.00 25.16 ? 133 MET B CE  1 
ATOM 2883  N N   . MET B 1 134 ? -51.266 69.465  -8.202  1.00 26.96 ? 134 MET B N   1 
ATOM 2884  C CA  . MET B 1 134 ? -50.497 68.238  -8.374  1.00 24.73 ? 134 MET B CA  1 
ATOM 2885  C C   . MET B 1 134 ? -49.835 68.231  -9.736  1.00 23.21 ? 134 MET B C   1 
ATOM 2886  O O   . MET B 1 134 ? -48.674 67.846  -9.875  1.00 23.88 ? 134 MET B O   1 
ATOM 2887  C CB  . MET B 1 134 ? -51.412 67.019  -8.258  1.00 25.29 ? 134 MET B CB  1 
ATOM 2888  C CG  . MET B 1 134 ? -51.928 66.749  -6.866  1.00 26.21 ? 134 MET B CG  1 
ATOM 2889  S SD  . MET B 1 134 ? -50.576 66.312  -5.787  1.00 25.47 ? 134 MET B SD  1 
ATOM 2890  C CE  . MET B 1 134 ? -50.402 67.795  -4.854  1.00 25.51 ? 134 MET B CE  1 
ATOM 2891  N N   . GLN B 1 135 ? -50.589 68.682  -10.731 1.00 21.58 ? 135 GLN B N   1 
ATOM 2892  C CA  . GLN B 1 135 ? -50.133 68.749  -12.112 1.00 22.94 ? 135 GLN B CA  1 
ATOM 2893  C C   . GLN B 1 135 ? -48.734 69.347  -12.227 1.00 22.36 ? 135 GLN B C   1 
ATOM 2894  O O   . GLN B 1 135 ? -47.862 68.800  -12.911 1.00 21.00 ? 135 GLN B O   1 
ATOM 2895  C CB  . GLN B 1 135 ? -51.122 69.592  -12.921 1.00 24.98 ? 135 GLN B CB  1 
ATOM 2896  C CG  . GLN B 1 135 ? -50.689 69.913  -14.340 1.00 25.48 ? 135 GLN B CG  1 
ATOM 2897  C CD  . GLN B 1 135 ? -51.327 71.191  -14.854 1.00 26.06 ? 135 GLN B CD  1 
ATOM 2898  O OE1 . GLN B 1 135 ? -50.685 72.243  -14.899 1.00 23.59 ? 135 GLN B OE1 1 
ATOM 2899  N NE2 . GLN B 1 135 ? -52.603 71.117  -15.211 1.00 27.67 ? 135 GLN B NE2 1 
ATOM 2900  N N   . HIS B 1 136 ? -48.519 70.451  -11.517 1.00 23.34 ? 136 HIS B N   1 
ATOM 2901  C CA  . HIS B 1 136 ? -47.244 71.160  -11.550 1.00 23.80 ? 136 HIS B CA  1 
ATOM 2902  C C   . HIS B 1 136 ? -46.067 70.443  -10.922 1.00 20.71 ? 136 HIS B C   1 
ATOM 2903  O O   . HIS B 1 136 ? -44.941 70.587  -11.392 1.00 20.64 ? 136 HIS B O   1 
ATOM 2904  C CB  . HIS B 1 136 ? -47.422 72.565  -11.002 1.00 24.38 ? 136 HIS B CB  1 
ATOM 2905  C CG  . HIS B 1 136 ? -48.424 73.353  -11.772 1.00 27.37 ? 136 HIS B CG  1 
ATOM 2906  N ND1 . HIS B 1 136 ? -49.691 73.611  -11.298 1.00 25.49 ? 136 HIS B ND1 1 
ATOM 2907  C CD2 . HIS B 1 136 ? -48.383 73.848  -13.030 1.00 29.89 ? 136 HIS B CD2 1 
ATOM 2908  C CE1 . HIS B 1 136 ? -50.387 74.234  -12.230 1.00 28.75 ? 136 HIS B CE1 1 
ATOM 2909  N NE2 . HIS B 1 136 ? -49.618 74.391  -13.293 1.00 29.87 ? 136 HIS B NE2 1 
ATOM 2910  N N   . PHE B 1 137 ? -46.319 69.638  -9.895  1.00 18.87 ? 137 PHE B N   1 
ATOM 2911  C CA  . PHE B 1 137 ? -45.239 68.888  -9.270  1.00 19.52 ? 137 PHE B CA  1 
ATOM 2912  C C   . PHE B 1 137 ? -44.667 67.960  -10.325 1.00 19.68 ? 137 PHE B C   1 
ATOM 2913  O O   . PHE B 1 137 ? -43.450 67.814  -10.440 1.00 21.34 ? 137 PHE B O   1 
ATOM 2914  C CB  . PHE B 1 137 ? -45.729 68.114  -8.046  1.00 20.08 ? 137 PHE B CB  1 
ATOM 2915  C CG  . PHE B 1 137 ? -45.817 68.955  -6.802  1.00 17.44 ? 137 PHE B CG  1 
ATOM 2916  C CD1 . PHE B 1 137 ? -45.022 70.088  -6.661  1.00 17.42 ? 137 PHE B CD1 1 
ATOM 2917  C CD2 . PHE B 1 137 ? -46.695 68.623  -5.781  1.00 19.16 ? 137 PHE B CD2 1 
ATOM 2918  C CE1 . PHE B 1 137 ? -45.100 70.876  -5.525  1.00 14.63 ? 137 PHE B CE1 1 
ATOM 2919  C CE2 . PHE B 1 137 ? -46.782 69.407  -4.635  1.00 19.39 ? 137 PHE B CE2 1 
ATOM 2920  C CZ  . PHE B 1 137 ? -45.982 70.536  -4.508  1.00 17.24 ? 137 PHE B CZ  1 
ATOM 2921  N N   . SER B 1 138 ? -45.548 67.375  -11.129 1.00 19.27 ? 138 SER B N   1 
ATOM 2922  C CA  . SER B 1 138 ? -45.113 66.509  -12.213 1.00 16.65 ? 138 SER B CA  1 
ATOM 2923  C C   . SER B 1 138 ? -44.402 67.358  -13.274 1.00 17.41 ? 138 SER B C   1 
ATOM 2924  O O   . SER B 1 138 ? -43.364 66.955  -13.797 1.00 15.73 ? 138 SER B O   1 
ATOM 2925  C CB  . SER B 1 138 ? -46.294 65.746  -12.823 1.00 15.63 ? 138 SER B CB  1 
ATOM 2926  O OG  . SER B 1 138 ? -46.322 64.408  -12.357 1.00 10.42 ? 138 SER B OG  1 
ATOM 2927  N N   . GLN B 1 139 ? -44.943 68.545  -13.558 1.00 19.79 ? 139 GLN B N   1 
ATOM 2928  C CA  . GLN B 1 139 ? -44.341 69.459  -14.538 1.00 20.84 ? 139 GLN B CA  1 
ATOM 2929  C C   . GLN B 1 139 ? -42.900 69.779  -14.121 1.00 19.49 ? 139 GLN B C   1 
ATOM 2930  O O   . GLN B 1 139 ? -42.046 70.037  -14.973 1.00 19.23 ? 139 GLN B O   1 
ATOM 2931  C CB  . GLN B 1 139 ? -45.123 70.788  -14.625 1.00 21.61 ? 139 GLN B CB  1 
ATOM 2932  C CG  . GLN B 1 139 ? -46.584 70.705  -15.102 1.00 22.71 ? 139 GLN B CG  1 
ATOM 2933  C CD  . GLN B 1 139 ? -46.738 70.574  -16.618 1.00 25.26 ? 139 GLN B CD  1 
ATOM 2934  O OE1 . GLN B 1 139 ? -47.460 69.706  -17.100 1.00 24.76 ? 139 GLN B OE1 1 
ATOM 2935  N NE2 . GLN B 1 139 ? -46.095 71.461  -17.370 1.00 24.08 ? 139 GLN B NE2 1 
ATOM 2936  N N   . PHE B 1 140 ? -42.657 69.787  -12.807 1.00 18.27 ? 140 PHE B N   1 
ATOM 2937  C CA  . PHE B 1 140 ? -41.339 70.086  -12.236 1.00 17.61 ? 140 PHE B CA  1 
ATOM 2938  C C   . PHE B 1 140 ? -40.421 68.865  -12.270 1.00 14.84 ? 140 PHE B C   1 
ATOM 2939  O O   . PHE B 1 140 ? -39.292 68.941  -12.758 1.00 17.71 ? 140 PHE B O   1 
ATOM 2940  C CB  . PHE B 1 140 ? -41.488 70.585  -10.791 1.00 17.54 ? 140 PHE B CB  1 
ATOM 2941  C CG  . PHE B 1 140 ? -40.365 71.475  -10.335 1.00 17.36 ? 140 PHE B CG  1 
ATOM 2942  C CD1 . PHE B 1 140 ? -40.180 72.736  -10.907 1.00 13.62 ? 140 PHE B CD1 1 
ATOM 2943  C CD2 . PHE B 1 140 ? -39.490 71.041  -9.334  1.00 14.61 ? 140 PHE B CD2 1 
ATOM 2944  C CE1 . PHE B 1 140 ? -39.141 73.568  -10.487 1.00 13.67 ? 140 PHE B CE1 1 
ATOM 2945  C CE2 . PHE B 1 140 ? -38.448 71.884  -8.911  1.00 12.24 ? 140 PHE B CE2 1 
ATOM 2946  C CZ  . PHE B 1 140 ? -38.277 73.140  -9.491  1.00 13.14 ? 140 PHE B CZ  1 
ATOM 2947  N N   . LEU B 1 141 ? -40.903 67.752  -11.725 1.00 12.46 ? 141 LEU B N   1 
ATOM 2948  C CA  . LEU B 1 141 ? -40.136 66.516  -11.705 1.00 11.31 ? 141 LEU B CA  1 
ATOM 2949  C C   . LEU B 1 141 ? -39.861 66.140  -13.153 1.00 13.75 ? 141 LEU B C   1 
ATOM 2950  O O   . LEU B 1 141 ? -38.720 66.130  -13.605 1.00 13.76 ? 141 LEU B O   1 
ATOM 2951  C CB  . LEU B 1 141 ? -40.935 65.423  -10.992 1.00 7.52  ? 141 LEU B CB  1 
ATOM 2952  C CG  . LEU B 1 141 ? -40.230 64.097  -10.690 1.00 8.15  ? 141 LEU B CG  1 
ATOM 2953  C CD1 . LEU B 1 141 ? -38.914 64.348  -9.973  1.00 4.23  ? 141 LEU B CD1 1 
ATOM 2954  C CD2 . LEU B 1 141 ? -41.141 63.207  -9.851  1.00 2.92  ? 141 LEU B CD2 1 
ATOM 2955  N N   . GLY B 1 142 ? -40.928 65.860  -13.883 1.00 15.68 ? 142 GLY B N   1 
ATOM 2956  C CA  . GLY B 1 142 ? -40.808 65.524  -15.283 1.00 15.14 ? 142 GLY B CA  1 
ATOM 2957  C C   . GLY B 1 142 ? -39.812 64.457  -15.675 1.00 16.81 ? 142 GLY B C   1 
ATOM 2958  O O   . GLY B 1 142 ? -40.104 63.271  -15.602 1.00 16.13 ? 142 GLY B O   1 
ATOM 2959  N N   . LYS B 1 143 ? -38.622 64.890  -16.073 1.00 18.04 ? 143 LYS B N   1 
ATOM 2960  C CA  . LYS B 1 143 ? -37.572 63.986  -16.541 1.00 19.58 ? 143 LYS B CA  1 
ATOM 2961  C C   . LYS B 1 143 ? -36.740 63.268  -15.465 1.00 19.86 ? 143 LYS B C   1 
ATOM 2962  O O   . LYS B 1 143 ? -36.540 62.051  -15.528 1.00 21.33 ? 143 LYS B O   1 
ATOM 2963  C CB  . LYS B 1 143 ? -36.616 64.741  -17.481 1.00 18.90 ? 143 LYS B CB  1 
ATOM 2964  C CG  . LYS B 1 143 ? -37.257 65.788  -18.399 1.00 20.78 ? 143 LYS B CG  1 
ATOM 2965  C CD  . LYS B 1 143 ? -38.202 65.194  -19.440 1.00 22.83 ? 143 LYS B CD  1 
ATOM 2966  C CE  . LYS B 1 143 ? -39.669 65.326  -19.030 1.00 24.72 ? 143 LYS B CE  1 
ATOM 2967  N NZ  . LYS B 1 143 ? -40.604 64.884  -20.104 1.00 29.37 ? 143 LYS B NZ  1 
ATOM 2968  N N   . ARG B 1 144 ? -36.229 64.025  -14.503 1.00 16.38 ? 144 ARG B N   1 
ATOM 2969  C CA  . ARG B 1 144 ? -35.384 63.467  -13.449 1.00 15.07 ? 144 ARG B CA  1 
ATOM 2970  C C   . ARG B 1 144 ? -36.073 62.613  -12.389 1.00 16.16 ? 144 ARG B C   1 
ATOM 2971  O O   . ARG B 1 144 ? -37.272 62.758  -12.150 1.00 16.50 ? 144 ARG B O   1 
ATOM 2972  C CB  . ARG B 1 144 ? -34.579 64.578  -12.773 1.00 12.40 ? 144 ARG B CB  1 
ATOM 2973  C CG  . ARG B 1 144 ? -35.252 65.936  -12.755 1.00 12.75 ? 144 ARG B CG  1 
ATOM 2974  C CD  . ARG B 1 144 ? -34.727 66.805  -13.888 1.00 10.98 ? 144 ARG B CD  1 
ATOM 2975  N NE  . ARG B 1 144 ? -35.783 67.236  -14.802 1.00 8.73  ? 144 ARG B NE  1 
ATOM 2976  C CZ  . ARG B 1 144 ? -36.643 68.220  -14.549 1.00 5.64  ? 144 ARG B CZ  1 
ATOM 2977  N NH1 . ARG B 1 144 ? -36.578 68.888  -13.403 1.00 5.10  ? 144 ARG B NH1 1 
ATOM 2978  N NH2 . ARG B 1 144 ? -37.583 68.523  -15.435 1.00 8.30  ? 144 ARG B NH2 1 
ATOM 2979  N N   . PRO B 1 145 ? -35.319 61.685  -11.759 1.00 14.78 ? 145 PRO B N   1 
ATOM 2980  C CA  . PRO B 1 145 ? -35.831 60.791  -10.712 1.00 13.70 ? 145 PRO B CA  1 
ATOM 2981  C C   . PRO B 1 145 ? -36.120 61.578  -9.441  1.00 12.91 ? 145 PRO B C   1 
ATOM 2982  O O   . PRO B 1 145 ? -37.043 61.261  -8.690  1.00 8.35  ? 145 PRO B O   1 
ATOM 2983  C CB  . PRO B 1 145 ? -34.656 59.832  -10.475 1.00 13.89 ? 145 PRO B CB  1 
ATOM 2984  C CG  . PRO B 1 145 ? -33.915 59.849  -11.768 1.00 14.29 ? 145 PRO B CG  1 
ATOM 2985  C CD  . PRO B 1 145 ? -33.938 61.312  -12.113 1.00 13.59 ? 145 PRO B CD  1 
ATOM 2986  N N   . TRP B 1 146 ? -35.292 62.590  -9.204  1.00 15.00 ? 146 TRP B N   1 
ATOM 2987  C CA  . TRP B 1 146 ? -35.407 63.441  -8.034  1.00 12.53 ? 146 TRP B CA  1 
ATOM 2988  C C   . TRP B 1 146 ? -35.661 64.845  -8.496  1.00 9.45  ? 146 TRP B C   1 
ATOM 2989  O O   . TRP B 1 146 ? -34.952 65.362  -9.348  1.00 6.25  ? 146 TRP B O   1 
ATOM 2990  C CB  . TRP B 1 146 ? -34.116 63.376  -7.216  1.00 12.56 ? 146 TRP B CB  1 
ATOM 2991  C CG  . TRP B 1 146 ? -33.706 61.972  -6.854  1.00 9.39  ? 146 TRP B CG  1 
ATOM 2992  C CD1 . TRP B 1 146 ? -32.660 61.265  -7.368  1.00 10.76 ? 146 TRP B CD1 1 
ATOM 2993  C CD2 . TRP B 1 146 ? -34.336 61.113  -5.898  1.00 6.31  ? 146 TRP B CD2 1 
ATOM 2994  N NE1 . TRP B 1 146 ? -32.597 60.022  -6.793  1.00 11.09 ? 146 TRP B NE1 1 
ATOM 2995  C CE2 . TRP B 1 146 ? -33.616 59.901  -5.885  1.00 7.03  ? 146 TRP B CE2 1 
ATOM 2996  C CE3 . TRP B 1 146 ? -35.442 61.250  -5.048  1.00 5.51  ? 146 TRP B CE3 1 
ATOM 2997  C CZ2 . TRP B 1 146 ? -33.963 58.831  -5.058  1.00 9.77  ? 146 TRP B CZ2 1 
ATOM 2998  C CZ3 . TRP B 1 146 ? -35.789 60.184  -4.223  1.00 2.00  ? 146 TRP B CZ3 1 
ATOM 2999  C CH2 . TRP B 1 146 ? -35.050 58.992  -4.235  1.00 7.61  ? 146 TRP B CH2 1 
ATOM 3000  N N   . PHE B 1 147 ? -36.659 65.486  -7.896  1.00 9.17  ? 147 PHE B N   1 
ATOM 3001  C CA  . PHE B 1 147 ? -37.106 66.853  -8.195  1.00 12.23 ? 147 PHE B CA  1 
ATOM 3002  C C   . PHE B 1 147 ? -36.103 67.908  -8.636  1.00 13.61 ? 147 PHE B C   1 
ATOM 3003  O O   . PHE B 1 147 ? -36.479 68.896  -9.265  1.00 13.73 ? 147 PHE B O   1 
ATOM 3004  C CB  . PHE B 1 147 ? -37.889 67.407  -7.007  1.00 10.30 ? 147 PHE B CB  1 
ATOM 3005  C CG  . PHE B 1 147 ? -39.292 66.900  -6.924  1.00 5.55  ? 147 PHE B CG  1 
ATOM 3006  C CD1 . PHE B 1 147 ? -39.547 65.565  -6.653  1.00 2.63  ? 147 PHE B CD1 1 
ATOM 3007  C CD2 . PHE B 1 147 ? -40.359 67.757  -7.141  1.00 4.43  ? 147 PHE B CD2 1 
ATOM 3008  C CE1 . PHE B 1 147 ? -40.845 65.086  -6.599  1.00 2.00  ? 147 PHE B CE1 1 
ATOM 3009  C CE2 . PHE B 1 147 ? -41.665 67.290  -7.088  1.00 2.00  ? 147 PHE B CE2 1 
ATOM 3010  C CZ  . PHE B 1 147 ? -41.909 65.948  -6.816  1.00 2.46  ? 147 PHE B CZ  1 
ATOM 3011  N N   . VAL B 1 148 ? -34.843 67.729  -8.268  1.00 15.99 ? 148 VAL B N   1 
ATOM 3012  C CA  . VAL B 1 148 ? -33.810 68.688  -8.619  1.00 14.79 ? 148 VAL B CA  1 
ATOM 3013  C C   . VAL B 1 148 ? -32.887 68.172  -9.729  1.00 14.64 ? 148 VAL B C   1 
ATOM 3014  O O   . VAL B 1 148 ? -32.362 68.955  -10.524 1.00 14.16 ? 148 VAL B O   1 
ATOM 3015  C CB  . VAL B 1 148 ? -32.994 69.074  -7.360  1.00 13.32 ? 148 VAL B CB  1 
ATOM 3016  C CG1 . VAL B 1 148 ? -32.180 67.889  -6.852  1.00 12.98 ? 148 VAL B CG1 1 
ATOM 3017  C CG2 . VAL B 1 148 ? -32.116 70.267  -7.640  1.00 8.89  ? 148 VAL B CG2 1 
ATOM 3018  N N   . GLY B 1 149 ? -32.715 66.854  -9.791  1.00 13.33 ? 149 GLY B N   1 
ATOM 3019  C CA  . GLY B 1 149 ? -31.860 66.250  -10.797 1.00 15.38 ? 149 GLY B CA  1 
ATOM 3020  C C   . GLY B 1 149 ? -31.708 64.755  -10.583 1.00 17.22 ? 149 GLY B C   1 
ATOM 3021  O O   . GLY B 1 149 ? -32.662 64.069  -10.205 1.00 19.19 ? 149 GLY B O   1 
ATOM 3022  N N   . ASP B 1 150 ? -30.508 64.259  -10.830 1.00 16.04 ? 150 ASP B N   1 
ATOM 3023  C CA  . ASP B 1 150 ? -30.233 62.819  -10.651 1.00 19.30 ? 150 ASP B CA  1 
ATOM 3024  C C   . ASP B 1 150 ? -29.793 62.518  -9.219  1.00 19.20 ? 150 ASP B C   1 
ATOM 3025  O O   . ASP B 1 150 ? -29.669 61.353  -8.826  1.00 15.24 ? 150 ASP B O   1 
ATOM 3026  C CB  . ASP B 1 150 ? -29.146 62.345  -11.626 1.00 21.33 ? 150 ASP B CB  1 
ATOM 3027  C CG  . ASP B 1 150 ? -29.582 62.426  -13.082 1.00 24.18 ? 150 ASP B CG  1 
ATOM 3028  O OD1 . ASP B 1 150 ? -30.802 62.402  -13.350 1.00 21.74 ? 150 ASP B OD1 1 
ATOM 3029  O OD2 . ASP B 1 150 ? -28.697 62.506  -13.962 1.00 27.61 ? 150 ASP B OD2 1 
ATOM 3030  N N   . LYS B 1 151 ? -29.571 63.571  -8.441  1.00 15.78 ? 151 LYS B N   1 
ATOM 3031  C CA  . LYS B 1 151 ? -29.125 63.419  -7.065  1.00 15.36 ? 151 LYS B CA  1 
ATOM 3032  C C   . LYS B 1 151 ? -30.213 63.754  -6.055  1.00 14.36 ? 151 LYS B C   1 
ATOM 3033  O O   . LYS B 1 151 ? -31.041 64.639  -6.286  1.00 15.75 ? 151 LYS B O   1 
ATOM 3034  C CB  . LYS B 1 151 ? -27.878 64.272  -6.822  1.00 15.82 ? 151 LYS B CB  1 
ATOM 3035  C CG  . LYS B 1 151 ? -27.879 65.611  -7.559  1.00 18.07 ? 151 LYS B CG  1 
ATOM 3036  C CD  . LYS B 1 151 ? -26.574 66.362  -7.352  1.00 20.59 ? 151 LYS B CD  1 
ATOM 3037  C CE  . LYS B 1 151 ? -26.431 66.828  -5.914  1.00 19.57 ? 151 LYS B CE  1 
ATOM 3038  N NZ  . LYS B 1 151 ? -27.470 67.821  -5.522  1.00 20.84 ? 151 LYS B NZ  1 
ATOM 3039  N N   . ILE B 1 152 ? -30.218 63.019  -4.948  1.00 11.03 ? 152 ILE B N   1 
ATOM 3040  C CA  . ILE B 1 152 ? -31.191 63.220  -3.879  1.00 10.12 ? 152 ILE B CA  1 
ATOM 3041  C C   . ILE B 1 152 ? -30.813 64.451  -3.066  1.00 11.53 ? 152 ILE B C   1 
ATOM 3042  O O   . ILE B 1 152 ? -29.633 64.708  -2.852  1.00 12.28 ? 152 ILE B O   1 
ATOM 3043  C CB  . ILE B 1 152 ? -31.241 61.987  -2.944  1.00 9.57  ? 152 ILE B CB  1 
ATOM 3044  C CG1 . ILE B 1 152 ? -32.126 62.264  -1.724  1.00 7.29  ? 152 ILE B CG1 1 
ATOM 3045  C CG2 . ILE B 1 152 ? -29.829 61.581  -2.514  1.00 9.70  ? 152 ILE B CG2 1 
ATOM 3046  C CD1 . ILE B 1 152 ? -33.599 62.211  -2.003  1.00 4.86  ? 152 ILE B CD1 1 
ATOM 3047  N N   . THR B 1 153 ? -31.810 65.216  -2.634  1.00 9.95  ? 153 THR B N   1 
ATOM 3048  C CA  . THR B 1 153 ? -31.580 66.420  -1.834  1.00 8.26  ? 153 THR B CA  1 
ATOM 3049  C C   . THR B 1 153 ? -32.647 66.498  -0.742  1.00 8.82  ? 153 THR B C   1 
ATOM 3050  O O   . THR B 1 153 ? -33.623 65.744  -0.772  1.00 4.66  ? 153 THR B O   1 
ATOM 3051  C CB  . THR B 1 153 ? -31.607 67.717  -2.700  1.00 10.19 ? 153 THR B CB  1 
ATOM 3052  O OG1 . THR B 1 153 ? -32.692 67.653  -3.629  1.00 11.37 ? 153 THR B OG1 1 
ATOM 3053  C CG2 . THR B 1 153 ? -30.299 67.891  -3.471  1.00 10.74 ? 153 THR B CG2 1 
ATOM 3054  N N   . PHE B 1 154 ? -32.474 67.410  0.213   1.00 12.68 ? 154 PHE B N   1 
ATOM 3055  C CA  . PHE B 1 154 ? -33.435 67.552  1.309   1.00 11.32 ? 154 PHE B CA  1 
ATOM 3056  C C   . PHE B 1 154 ? -34.847 67.863  0.804   1.00 12.76 ? 154 PHE B C   1 
ATOM 3057  O O   . PHE B 1 154 ? -35.843 67.455  1.410   1.00 12.30 ? 154 PHE B O   1 
ATOM 3058  C CB  . PHE B 1 154 ? -32.967 68.612  2.318   1.00 3.97  ? 154 PHE B CB  1 
ATOM 3059  C CG  . PHE B 1 154 ? -33.184 70.025  1.870   1.00 3.20  ? 154 PHE B CG  1 
ATOM 3060  C CD1 . PHE B 1 154 ? -32.321 70.612  0.956   1.00 3.31  ? 154 PHE B CD1 1 
ATOM 3061  C CD2 . PHE B 1 154 ? -34.247 70.778  2.379   1.00 4.93  ? 154 PHE B CD2 1 
ATOM 3062  C CE1 . PHE B 1 154 ? -32.515 71.934  0.557   1.00 2.93  ? 154 PHE B CE1 1 
ATOM 3063  C CE2 . PHE B 1 154 ? -34.463 72.100  1.984   1.00 2.00  ? 154 PHE B CE2 1 
ATOM 3064  C CZ  . PHE B 1 154 ? -33.579 72.678  1.073   1.00 2.00  ? 154 PHE B CZ  1 
ATOM 3065  N N   . VAL B 1 155 ? -34.927 68.567  -0.320  1.00 13.39 ? 155 VAL B N   1 
ATOM 3066  C CA  . VAL B 1 155 ? -36.209 68.925  -0.904  1.00 10.95 ? 155 VAL B CA  1 
ATOM 3067  C C   . VAL B 1 155 ? -37.003 67.692  -1.328  1.00 11.50 ? 155 VAL B C   1 
ATOM 3068  O O   . VAL B 1 155 ? -38.233 67.697  -1.293  1.00 7.39  ? 155 VAL B O   1 
ATOM 3069  C CB  . VAL B 1 155 ? -36.038 69.896  -2.081  1.00 10.30 ? 155 VAL B CB  1 
ATOM 3070  C CG1 . VAL B 1 155 ? -35.748 71.290  -1.560  1.00 11.90 ? 155 VAL B CG1 1 
ATOM 3071  C CG2 . VAL B 1 155 ? -34.907 69.446  -2.978  1.00 9.64  ? 155 VAL B CG2 1 
ATOM 3072  N N   . ASP B 1 156 ? -36.302 66.617  -1.671  1.00 10.49 ? 156 ASP B N   1 
ATOM 3073  C CA  . ASP B 1 156 ? -36.972 65.382  -2.068  1.00 13.58 ? 156 ASP B CA  1 
ATOM 3074  C C   . ASP B 1 156 ? -37.674 64.754  -0.867  1.00 14.42 ? 156 ASP B C   1 
ATOM 3075  O O   . ASP B 1 156 ? -38.509 63.864  -1.018  1.00 15.99 ? 156 ASP B O   1 
ATOM 3076  C CB  . ASP B 1 156 ? -35.994 64.392  -2.710  1.00 15.60 ? 156 ASP B CB  1 
ATOM 3077  C CG  . ASP B 1 156 ? -35.591 64.798  -4.125  1.00 16.97 ? 156 ASP B CG  1 
ATOM 3078  O OD1 . ASP B 1 156 ? -36.481 64.884  -4.993  1.00 17.57 ? 156 ASP B OD1 1 
ATOM 3079  O OD2 . ASP B 1 156 ? -34.389 65.022  -4.377  1.00 19.33 ? 156 ASP B OD2 1 
ATOM 3080  N N   . PHE B 1 157 ? -37.319 65.212  0.329   1.00 12.73 ? 157 PHE B N   1 
ATOM 3081  C CA  . PHE B 1 157 ? -37.948 64.726  1.549   1.00 10.69 ? 157 PHE B CA  1 
ATOM 3082  C C   . PHE B 1 157 ? -39.239 65.519  1.720   1.00 7.76  ? 157 PHE B C   1 
ATOM 3083  O O   . PHE B 1 157 ? -40.304 64.931  1.991   1.00 6.28  ? 157 PHE B O   1 
ATOM 3084  C CB  . PHE B 1 157 ? -37.013 64.902  2.753   1.00 9.20  ? 157 PHE B CB  1 
ATOM 3085  C CG  . PHE B 1 157 ? -35.860 63.938  2.759   1.00 8.92  ? 157 PHE B CG  1 
ATOM 3086  C CD1 . PHE B 1 157 ? -34.767 64.138  1.923   1.00 9.83  ? 157 PHE B CD1 1 
ATOM 3087  C CD2 . PHE B 1 157 ? -35.898 62.795  3.550   1.00 12.80 ? 157 PHE B CD2 1 
ATOM 3088  C CE1 . PHE B 1 157 ? -33.734 63.213  1.865   1.00 10.93 ? 157 PHE B CE1 1 
ATOM 3089  C CE2 . PHE B 1 157 ? -34.866 61.839  3.502   1.00 14.08 ? 157 PHE B CE2 1 
ATOM 3090  C CZ  . PHE B 1 157 ? -33.783 62.066  2.655   1.00 16.31 ? 157 PHE B CZ  1 
ATOM 3091  N N   . LEU B 1 158 ? -39.141 66.829  1.492   1.00 10.07 ? 158 LEU B N   1 
ATOM 3092  C CA  . LEU B 1 158 ? -40.284 67.733  1.579   1.00 12.38 ? 158 LEU B CA  1 
ATOM 3093  C C   . LEU B 1 158 ? -41.346 67.300  0.575   1.00 14.25 ? 158 LEU B C   1 
ATOM 3094  O O   . LEU B 1 158 ? -42.544 67.296  0.878   1.00 12.06 ? 158 LEU B O   1 
ATOM 3095  C CB  . LEU B 1 158 ? -39.855 69.167  1.258   1.00 9.78  ? 158 LEU B CB  1 
ATOM 3096  C CG  . LEU B 1 158 ? -39.275 70.061  2.350   1.00 6.31  ? 158 LEU B CG  1 
ATOM 3097  C CD1 . LEU B 1 158 ? -38.646 71.298  1.724   1.00 2.90  ? 158 LEU B CD1 1 
ATOM 3098  C CD2 . LEU B 1 158 ? -40.380 70.455  3.315   1.00 2.00  ? 158 LEU B CD2 1 
ATOM 3099  N N   . ALA B 1 159 ? -40.892 66.940  -0.622  1.00 13.93 ? 159 ALA B N   1 
ATOM 3100  C CA  . ALA B 1 159 ? -41.775 66.497  -1.685  1.00 11.67 ? 159 ALA B CA  1 
ATOM 3101  C C   . ALA B 1 159 ? -42.530 65.227  -1.300  1.00 8.83  ? 159 ALA B C   1 
ATOM 3102  O O   . ALA B 1 159 ? -43.739 65.149  -1.479  1.00 4.12  ? 159 ALA B O   1 
ATOM 3103  C CB  . ALA B 1 159 ? -40.986 66.280  -2.962  1.00 12.53 ? 159 ALA B CB  1 
ATOM 3104  N N   . TYR B 1 160 ? -41.833 64.251  -0.726  1.00 10.27 ? 160 TYR B N   1 
ATOM 3105  C CA  . TYR B 1 160 ? -42.472 62.998  -0.335  1.00 11.83 ? 160 TYR B CA  1 
ATOM 3106  C C   . TYR B 1 160 ? -43.617 63.207  0.647   1.00 12.58 ? 160 TYR B C   1 
ATOM 3107  O O   . TYR B 1 160 ? -44.742 62.774  0.409   1.00 15.56 ? 160 TYR B O   1 
ATOM 3108  C CB  . TYR B 1 160 ? -41.456 62.032  0.287   1.00 9.09  ? 160 TYR B CB  1 
ATOM 3109  C CG  . TYR B 1 160 ? -42.090 60.726  0.724   1.00 11.01 ? 160 TYR B CG  1 
ATOM 3110  C CD1 . TYR B 1 160 ? -42.208 59.657  -0.179  1.00 10.26 ? 160 TYR B CD1 1 
ATOM 3111  C CD2 . TYR B 1 160 ? -42.637 60.582  2.002   1.00 8.26  ? 160 TYR B CD2 1 
ATOM 3112  C CE1 . TYR B 1 160 ? -42.863 58.480  0.212   1.00 9.45  ? 160 TYR B CE1 1 
ATOM 3113  C CE2 . TYR B 1 160 ? -43.296 59.412  2.381   1.00 5.86  ? 160 TYR B CE2 1 
ATOM 3114  C CZ  . TYR B 1 160 ? -43.407 58.369  1.481   1.00 9.27  ? 160 TYR B CZ  1 
ATOM 3115  O OH  . TYR B 1 160 ? -44.086 57.230  1.835   1.00 13.29 ? 160 TYR B OH  1 
ATOM 3116  N N   . ASP B 1 161 ? -43.291 63.829  1.772   1.00 13.30 ? 161 ASP B N   1 
ATOM 3117  C CA  . ASP B 1 161 ? -44.235 64.113  2.845   1.00 14.41 ? 161 ASP B CA  1 
ATOM 3118  C C   . ASP B 1 161 ? -45.503 64.837  2.364   1.00 14.40 ? 161 ASP B C   1 
ATOM 3119  O O   . ASP B 1 161 ? -46.620 64.388  2.637   1.00 11.84 ? 161 ASP B O   1 
ATOM 3120  C CB  . ASP B 1 161 ? -43.503 64.914  3.938   1.00 15.86 ? 161 ASP B CB  1 
ATOM 3121  C CG  . ASP B 1 161 ? -44.442 65.526  4.965   1.00 15.43 ? 161 ASP B CG  1 
ATOM 3122  O OD1 . ASP B 1 161 ? -45.160 64.775  5.659   1.00 8.81  ? 161 ASP B OD1 1 
ATOM 3123  O OD2 . ASP B 1 161 ? -44.442 66.771  5.088   1.00 16.29 ? 161 ASP B OD2 1 
ATOM 3124  N N   . VAL B 1 162 ? -45.323 65.933  1.628   1.00 12.65 ? 162 VAL B N   1 
ATOM 3125  C CA  . VAL B 1 162 ? -46.444 66.716  1.115   1.00 15.71 ? 162 VAL B CA  1 
ATOM 3126  C C   . VAL B 1 162 ? -47.290 65.901  0.134   1.00 17.86 ? 162 VAL B C   1 
ATOM 3127  O O   . VAL B 1 162 ? -48.513 66.133  -0.011  1.00 19.85 ? 162 VAL B O   1 
ATOM 3128  C CB  . VAL B 1 162 ? -45.961 68.042  0.472   1.00 15.93 ? 162 VAL B CB  1 
ATOM 3129  C CG1 . VAL B 1 162 ? -45.580 67.868  -0.994  1.00 19.21 ? 162 VAL B CG1 1 
ATOM 3130  C CG2 . VAL B 1 162 ? -47.019 69.084  0.642   1.00 18.24 ? 162 VAL B CG2 1 
ATOM 3131  N N   . LEU B 1 163 ? -46.652 64.938  -0.524  1.00 18.90 ? 163 LEU B N   1 
ATOM 3132  C CA  . LEU B 1 163 ? -47.337 64.063  -1.462  1.00 19.53 ? 163 LEU B CA  1 
ATOM 3133  C C   . LEU B 1 163 ? -48.158 63.032  -0.707  1.00 16.97 ? 163 LEU B C   1 
ATOM 3134  O O   . LEU B 1 163 ? -49.322 62.774  -1.066  1.00 20.08 ? 163 LEU B O   1 
ATOM 3135  C CB  . LEU B 1 163 ? -46.334 63.364  -2.389  1.00 16.43 ? 163 LEU B CB  1 
ATOM 3136  C CG  . LEU B 1 163 ? -45.594 64.256  -3.393  1.00 19.30 ? 163 LEU B CG  1 
ATOM 3137  C CD1 . LEU B 1 163 ? -44.637 63.441  -4.243  1.00 16.97 ? 163 LEU B CD1 1 
ATOM 3138  C CD2 . LEU B 1 163 ? -46.586 64.991  -4.269  1.00 19.99 ? 163 LEU B CD2 1 
ATOM 3139  N N   . ASP B 1 164 ? -47.617 62.481  0.369   1.00 14.72 ? 164 ASP B N   1 
ATOM 3140  C CA  . ASP B 1 164 ? -48.326 61.482  1.164   1.00 13.91 ? 164 ASP B CA  1 
ATOM 3141  C C   . ASP B 1 164 ? -49.511 62.090  1.916   1.00 14.17 ? 164 ASP B C   1 
ATOM 3142  O O   . ASP B 1 164 ? -50.498 61.406  2.180   1.00 11.65 ? 164 ASP B O   1 
ATOM 3143  C CB  . ASP B 1 164 ? -47.374 60.788  2.138   1.00 14.29 ? 164 ASP B CB  1 
ATOM 3144  C CG  . ASP B 1 164 ? -47.859 59.407  2.547   1.00 13.42 ? 164 ASP B CG  1 
ATOM 3145  O OD1 . ASP B 1 164 ? -48.764 59.314  3.402   1.00 5.26  ? 164 ASP B OD1 1 
ATOM 3146  O OD2 . ASP B 1 164 ? -47.323 58.412  2.014   1.00 13.12 ? 164 ASP B OD2 1 
ATOM 3147  N N   . LEU B 1 165 ? -49.407 63.370  2.264   1.00 14.40 ? 165 LEU B N   1 
ATOM 3148  C CA  . LEU B 1 165 ? -50.486 64.075  2.959   1.00 12.57 ? 165 LEU B CA  1 
ATOM 3149  C C   . LEU B 1 165 ? -51.738 64.079  2.097   1.00 14.35 ? 165 LEU B C   1 
ATOM 3150  O O   . LEU B 1 165 ? -52.819 63.683  2.539   1.00 19.62 ? 165 LEU B O   1 
ATOM 3151  C CB  . LEU B 1 165 ? -50.092 65.525  3.230   1.00 11.15 ? 165 LEU B CB  1 
ATOM 3152  C CG  . LEU B 1 165 ? -49.012 65.768  4.275   1.00 8.28  ? 165 LEU B CG  1 
ATOM 3153  C CD1 . LEU B 1 165 ? -48.688 67.250  4.324   1.00 2.82  ? 165 LEU B CD1 1 
ATOM 3154  C CD2 . LEU B 1 165 ? -49.497 65.265  5.630   1.00 8.16  ? 165 LEU B CD2 1 
ATOM 3155  N N   . HIS B 1 166 ? -51.579 64.561  0.866   1.00 15.80 ? 166 HIS B N   1 
ATOM 3156  C CA  . HIS B 1 166 ? -52.671 64.627  -0.102  1.00 17.36 ? 166 HIS B CA  1 
ATOM 3157  C C   . HIS B 1 166 ? -53.162 63.244  -0.515  1.00 17.21 ? 166 HIS B C   1 
ATOM 3158  O O   . HIS B 1 166 ? -54.341 63.037  -0.674  1.00 19.79 ? 166 HIS B O   1 
ATOM 3159  C CB  . HIS B 1 166 ? -52.233 65.406  -1.337  1.00 15.17 ? 166 HIS B CB  1 
ATOM 3160  C CG  . HIS B 1 166 ? -52.171 66.884  -1.124  1.00 9.38  ? 166 HIS B CG  1 
ATOM 3161  N ND1 . HIS B 1 166 ? -51.147 67.665  -1.607  1.00 8.11  ? 166 HIS B ND1 1 
ATOM 3162  C CD2 . HIS B 1 166 ? -53.024 67.728  -0.495  1.00 8.47  ? 166 HIS B CD2 1 
ATOM 3163  C CE1 . HIS B 1 166 ? -51.370 68.928  -1.288  1.00 10.38 ? 166 HIS B CE1 1 
ATOM 3164  N NE2 . HIS B 1 166 ? -52.502 68.974  -0.611  1.00 9.46  ? 166 HIS B NE2 1 
ATOM 3165  N N   . ARG B 1 167 ? -52.229 62.306  -0.624  1.00 18.67 ? 167 ARG B N   1 
ATOM 3166  C CA  . ARG B 1 167 ? -52.535 60.924  -0.975  1.00 21.40 ? 167 ARG B CA  1 
ATOM 3167  C C   . ARG B 1 167 ? -53.573 60.326  -0.025  1.00 21.38 ? 167 ARG B C   1 
ATOM 3168  O O   . ARG B 1 167 ? -54.446 59.572  -0.444  1.00 19.34 ? 167 ARG B O   1 
ATOM 3169  C CB  . ARG B 1 167 ? -51.253 60.087  -0.927  1.00 20.58 ? 167 ARG B CB  1 
ATOM 3170  C CG  . ARG B 1 167 ? -51.457 58.648  -0.486  1.00 17.14 ? 167 ARG B CG  1 
ATOM 3171  C CD  . ARG B 1 167 ? -50.198 58.069  0.112   1.00 16.09 ? 167 ARG B CD  1 
ATOM 3172  N NE  . ARG B 1 167 ? -49.220 57.719  -0.911  1.00 13.97 ? 167 ARG B NE  1 
ATOM 3173  C CZ  . ARG B 1 167 ? -48.293 56.782  -0.758  1.00 13.30 ? 167 ARG B CZ  1 
ATOM 3174  N NH1 . ARG B 1 167 ? -48.207 56.105  0.379   1.00 5.84  ? 167 ARG B NH1 1 
ATOM 3175  N NH2 . ARG B 1 167 ? -47.489 56.482  -1.766  1.00 15.86 ? 167 ARG B NH2 1 
ATOM 3176  N N   . ILE B 1 168 ? -53.443 60.624  1.263   1.00 19.99 ? 168 ILE B N   1 
ATOM 3177  C CA  . ILE B 1 168 ? -54.378 60.105  2.249   1.00 19.30 ? 168 ILE B CA  1 
ATOM 3178  C C   . ILE B 1 168 ? -55.628 60.980  2.326   1.00 18.71 ? 168 ILE B C   1 
ATOM 3179  O O   . ILE B 1 168 ? -56.723 60.478  2.584   1.00 18.03 ? 168 ILE B O   1 
ATOM 3180  C CB  . ILE B 1 168 ? -53.712 59.950  3.643   1.00 20.35 ? 168 ILE B CB  1 
ATOM 3181  C CG1 . ILE B 1 168 ? -52.504 59.007  3.545   1.00 18.10 ? 168 ILE B CG1 1 
ATOM 3182  C CG2 . ILE B 1 168 ? -54.707 59.378  4.649   1.00 16.02 ? 168 ILE B CG2 1 
ATOM 3183  C CD1 . ILE B 1 168 ? -51.763 58.791  4.854   1.00 18.83 ? 168 ILE B CD1 1 
ATOM 3184  N N   . PHE B 1 169 ? -55.468 62.281  2.092   1.00 20.87 ? 169 PHE B N   1 
ATOM 3185  C CA  . PHE B 1 169 ? -56.603 63.199  2.118   1.00 25.04 ? 169 PHE B CA  1 
ATOM 3186  C C   . PHE B 1 169 ? -57.552 62.784  0.993   1.00 25.62 ? 169 PHE B C   1 
ATOM 3187  O O   . PHE B 1 169 ? -58.742 62.543  1.219   1.00 24.31 ? 169 PHE B O   1 
ATOM 3188  C CB  . PHE B 1 169 ? -56.132 64.649  1.908   1.00 20.16 ? 169 PHE B CB  1 
ATOM 3189  C CG  . PHE B 1 169 ? -57.205 65.694  2.154   1.00 20.68 ? 169 PHE B CG  1 
ATOM 3190  C CD1 . PHE B 1 169 ? -57.887 65.749  3.368   1.00 18.50 ? 169 PHE B CD1 1 
ATOM 3191  C CD2 . PHE B 1 169 ? -57.504 66.647  1.184   1.00 22.03 ? 169 PHE B CD2 1 
ATOM 3192  C CE1 . PHE B 1 169 ? -58.844 66.734  3.613   1.00 21.95 ? 169 PHE B CE1 1 
ATOM 3193  C CE2 . PHE B 1 169 ? -58.462 67.638  1.421   1.00 21.21 ? 169 PHE B CE2 1 
ATOM 3194  C CZ  . PHE B 1 169 ? -59.131 67.679  2.638   1.00 19.19 ? 169 PHE B CZ  1 
ATOM 3195  N N   . GLU B 1 170 ? -56.996 62.645  -0.205  1.00 26.52 ? 170 GLU B N   1 
ATOM 3196  C CA  . GLU B 1 170 ? -57.759 62.264  -1.381  1.00 25.73 ? 170 GLU B CA  1 
ATOM 3197  C C   . GLU B 1 170 ? -56.893 61.436  -2.328  1.00 26.66 ? 170 GLU B C   1 
ATOM 3198  O O   . GLU B 1 170 ? -56.375 61.950  -3.321  1.00 25.95 ? 170 GLU B O   1 
ATOM 3199  C CB  . GLU B 1 170 ? -58.267 63.519  -2.097  1.00 27.14 ? 170 GLU B CB  1 
ATOM 3200  C CG  . GLU B 1 170 ? -59.173 63.227  -3.283  1.00 30.07 ? 170 GLU B CG  1 
ATOM 3201  C CD  . GLU B 1 170 ? -60.311 62.289  -2.912  1.00 31.98 ? 170 GLU B CD  1 
ATOM 3202  O OE1 . GLU B 1 170 ? -61.105 62.641  -2.013  1.00 29.21 ? 170 GLU B OE1 1 
ATOM 3203  O OE2 . GLU B 1 170 ? -60.402 61.176  -3.504  1.00 30.86 ? 170 GLU B OE2 1 
ATOM 3204  N N   . PRO B 1 171 ? -56.808 60.120  -2.086  1.00 27.54 ? 171 PRO B N   1 
ATOM 3205  C CA  . PRO B 1 171 ? -56.013 59.188  -2.898  1.00 28.47 ? 171 PRO B CA  1 
ATOM 3206  C C   . PRO B 1 171 ? -56.070 59.410  -4.405  1.00 27.99 ? 171 PRO B C   1 
ATOM 3207  O O   . PRO B 1 171 ? -55.058 59.280  -5.100  1.00 27.69 ? 171 PRO B O   1 
ATOM 3208  C CB  . PRO B 1 171 ? -56.579 57.818  -2.504  1.00 28.28 ? 171 PRO B CB  1 
ATOM 3209  C CG  . PRO B 1 171 ? -57.937 58.133  -1.917  1.00 29.94 ? 171 PRO B CG  1 
ATOM 3210  C CD  . PRO B 1 171 ? -57.668 59.383  -1.148  1.00 27.49 ? 171 PRO B CD  1 
ATOM 3211  N N   . ASN B 1 172 ? -57.247 59.776  -4.899  1.00 28.56 ? 172 ASN B N   1 
ATOM 3212  C CA  . ASN B 1 172 ? -57.462 60.002  -6.325  1.00 27.27 ? 172 ASN B CA  1 
ATOM 3213  C C   . ASN B 1 172 ? -56.844 61.304  -6.829  1.00 25.50 ? 172 ASN B C   1 
ATOM 3214  O O   . ASN B 1 172 ? -57.522 62.145  -7.422  1.00 25.84 ? 172 ASN B O   1 
ATOM 3215  C CB  . ASN B 1 172 ? -58.962 59.972  -6.628  1.00 26.37 ? 172 ASN B CB  1 
ATOM 3216  C CG  . ASN B 1 172 ? -59.622 58.720  -6.120  1.00 27.09 ? 172 ASN B CG  1 
ATOM 3217  O OD1 . ASN B 1 172 ? -60.222 58.717  -5.045  1.00 28.36 ? 172 ASN B OD1 1 
ATOM 3218  N ND2 . ASN B 1 172 ? -59.483 57.632  -6.865  1.00 25.33 ? 172 ASN B ND2 1 
ATOM 3219  N N   . CYS B 1 173 ? -55.540 61.440  -6.641  1.00 23.32 ? 173 CYS B N   1 
ATOM 3220  C CA  . CYS B 1 173 ? -54.839 62.632  -7.071  1.00 23.89 ? 173 CYS B CA  1 
ATOM 3221  C C   . CYS B 1 173 ? -53.607 62.263  -7.873  1.00 21.30 ? 173 CYS B C   1 
ATOM 3222  O O   . CYS B 1 173 ? -53.561 62.475  -9.080  1.00 21.77 ? 173 CYS B O   1 
ATOM 3223  C CB  . CYS B 1 173 ? -54.466 63.477  -5.853  1.00 26.78 ? 173 CYS B CB  1 
ATOM 3224  S SG  . CYS B 1 173 ? -54.005 62.488  -4.411  1.00 28.64 ? 173 CYS B SG  1 
ATOM 3225  N N   . LEU B 1 174 ? -52.656 61.632  -7.224  1.00 19.29 ? 174 LEU B N   1 
ATOM 3226  C CA  . LEU B 1 174 ? -51.403 61.255  -7.903  1.00 19.82 ? 174 LEU B CA  1 
ATOM 3227  C C   . LEU B 1 174 ? -51.622 60.293  -9.072  1.00 21.54 ? 174 LEU B C   1 
ATOM 3228  O O   . LEU B 1 174 ? -50.769 60.178  -9.951  1.00 19.05 ? 174 LEU B O   1 
ATOM 3229  C CB  . LEU B 1 174 ? -50.420 60.617  -6.922  1.00 18.59 ? 174 LEU B CB  1 
ATOM 3230  C CG  . LEU B 1 174 ? -50.178 61.261  -5.562  1.00 14.87 ? 174 LEU B CG  1 
ATOM 3231  C CD1 . LEU B 1 174 ? -51.148 60.687  -4.540  1.00 16.60 ? 174 LEU B CD1 1 
ATOM 3232  C CD2 . LEU B 1 174 ? -48.752 60.981  -5.140  1.00 14.66 ? 174 LEU B CD2 1 
ATOM 3233  N N   . ASP B 1 175 ? -52.752 59.590  -9.066  1.00 23.13 ? 175 ASP B N   1 
ATOM 3234  C CA  . ASP B 1 175 ? -53.082 58.624  -10.115 1.00 22.07 ? 175 ASP B CA  1 
ATOM 3235  C C   . ASP B 1 175 ? -53.007 59.221  -11.518 1.00 26.21 ? 175 ASP B C   1 
ATOM 3236  O O   . ASP B 1 175 ? -52.510 58.588  -12.446 1.00 29.18 ? 175 ASP B O   1 
ATOM 3237  C CB  . ASP B 1 175 ? -54.481 58.044  -9.880  1.00 20.66 ? 175 ASP B CB  1 
ATOM 3238  C CG  . ASP B 1 175 ? -54.673 57.518  -8.466  1.00 22.46 ? 175 ASP B CG  1 
ATOM 3239  O OD1 . ASP B 1 175 ? -53.665 57.244  -7.774  1.00 21.21 ? 175 ASP B OD1 1 
ATOM 3240  O OD2 . ASP B 1 175 ? -55.843 57.381  -8.046  1.00 20.29 ? 175 ASP B OD2 1 
ATOM 3241  N N   . ALA B 1 176 ? -53.495 60.449  -11.666 1.00 24.51 ? 176 ALA B N   1 
ATOM 3242  C CA  . ALA B 1 176 ? -53.486 61.130  -12.960 1.00 22.35 ? 176 ALA B CA  1 
ATOM 3243  C C   . ALA B 1 176 ? -52.069 61.523  -13.376 1.00 22.91 ? 176 ALA B C   1 
ATOM 3244  O O   . ALA B 1 176 ? -51.850 62.035  -14.476 1.00 24.79 ? 176 ALA B O   1 
ATOM 3245  C CB  . ALA B 1 176 ? -54.378 62.361  -12.906 1.00 23.14 ? 176 ALA B CB  1 
ATOM 3246  N N   . PHE B 1 177 ? -51.110 61.283  -12.487 1.00 20.17 ? 177 PHE B N   1 
ATOM 3247  C CA  . PHE B 1 177 ? -49.719 61.620  -12.740 1.00 19.72 ? 177 PHE B CA  1 
ATOM 3248  C C   . PHE B 1 177 ? -48.850 60.478  -12.269 1.00 18.99 ? 177 PHE B C   1 
ATOM 3249  O O   . PHE B 1 177 ? -48.357 60.473  -11.134 1.00 18.28 ? 177 PHE B O   1 
ATOM 3250  C CB  . PHE B 1 177 ? -49.346 62.905  -11.996 1.00 18.76 ? 177 PHE B CB  1 
ATOM 3251  C CG  . PHE B 1 177 ? -50.464 63.893  -11.916 1.00 15.81 ? 177 PHE B CG  1 
ATOM 3252  C CD1 . PHE B 1 177 ? -50.686 64.792  -12.947 1.00 13.78 ? 177 PHE B CD1 1 
ATOM 3253  C CD2 . PHE B 1 177 ? -51.325 63.894  -10.830 1.00 15.00 ? 177 PHE B CD2 1 
ATOM 3254  C CE1 . PHE B 1 177 ? -51.754 65.678  -12.897 1.00 13.24 ? 177 PHE B CE1 1 
ATOM 3255  C CE2 . PHE B 1 177 ? -52.391 64.771  -10.771 1.00 16.37 ? 177 PHE B CE2 1 
ATOM 3256  C CZ  . PHE B 1 177 ? -52.610 65.665  -11.807 1.00 12.13 ? 177 PHE B CZ  1 
ATOM 3257  N N   . PRO B 1 178 ? -48.569 59.512  -13.158 1.00 18.51 ? 178 PRO B N   1 
ATOM 3258  C CA  . PRO B 1 178 ? -47.734 58.328  -12.899 1.00 16.80 ? 178 PRO B CA  1 
ATOM 3259  C C   . PRO B 1 178 ? -46.308 58.758  -12.550 1.00 13.15 ? 178 PRO B C   1 
ATOM 3260  O O   . PRO B 1 178 ? -45.534 58.010  -11.949 1.00 12.46 ? 178 PRO B O   1 
ATOM 3261  C CB  . PRO B 1 178 ? -47.787 57.585  -14.230 1.00 18.35 ? 178 PRO B CB  1 
ATOM 3262  C CG  . PRO B 1 178 ? -47.902 58.705  -15.230 1.00 18.60 ? 178 PRO B CG  1 
ATOM 3263  C CD  . PRO B 1 178 ? -48.937 59.594  -14.582 1.00 19.06 ? 178 PRO B CD  1 
ATOM 3264  N N   . ASN B 1 179 ? -45.988 59.982  -12.955 1.00 11.59 ? 179 ASN B N   1 
ATOM 3265  C CA  . ASN B 1 179 ? -44.702 60.626  -12.717 1.00 9.80  ? 179 ASN B CA  1 
ATOM 3266  C C   . ASN B 1 179 ? -44.521 60.825  -11.216 1.00 12.84 ? 179 ASN B C   1 
ATOM 3267  O O   . ASN B 1 179 ? -43.522 60.397  -10.645 1.00 12.90 ? 179 ASN B O   1 
ATOM 3268  C CB  . ASN B 1 179 ? -44.685 61.967  -13.468 1.00 4.84  ? 179 ASN B CB  1 
ATOM 3269  C CG  . ASN B 1 179 ? -43.476 62.810  -13.157 1.00 7.19  ? 179 ASN B CG  1 
ATOM 3270  O OD1 . ASN B 1 179 ? -43.567 64.031  -13.134 1.00 7.19  ? 179 ASN B OD1 1 
ATOM 3271  N ND2 . ASN B 1 179 ? -42.339 62.178  -12.940 1.00 8.53  ? 179 ASN B ND2 1 
ATOM 3272  N N   . LEU B 1 180 ? -45.528 61.412  -10.578 1.00 16.11 ? 180 LEU B N   1 
ATOM 3273  C CA  . LEU B 1 180 ? -45.488 61.649  -9.142  1.00 15.49 ? 180 LEU B CA  1 
ATOM 3274  C C   . LEU B 1 180 ? -45.644 60.354  -8.339  1.00 17.73 ? 180 LEU B C   1 
ATOM 3275  O O   . LEU B 1 180 ? -45.193 60.267  -7.193  1.00 20.09 ? 180 LEU B O   1 
ATOM 3276  C CB  . LEU B 1 180 ? -46.552 62.670  -8.727  1.00 15.28 ? 180 LEU B CB  1 
ATOM 3277  C CG  . LEU B 1 180 ? -46.373 64.112  -9.227  1.00 19.03 ? 180 LEU B CG  1 
ATOM 3278  C CD1 . LEU B 1 180 ? -47.434 65.024  -8.616  1.00 13.29 ? 180 LEU B CD1 1 
ATOM 3279  C CD2 . LEU B 1 180 ? -44.985 64.619  -8.882  1.00 19.62 ? 180 LEU B CD2 1 
ATOM 3280  N N   . LYS B 1 181 ? -46.268 59.344  -8.938  1.00 17.17 ? 181 LYS B N   1 
ATOM 3281  C CA  . LYS B 1 181 ? -46.452 58.060  -8.260  1.00 18.04 ? 181 LYS B CA  1 
ATOM 3282  C C   . LYS B 1 181 ? -45.135 57.292  -8.216  1.00 17.34 ? 181 LYS B C   1 
ATOM 3283  O O   . LYS B 1 181 ? -44.844 56.591  -7.245  1.00 18.87 ? 181 LYS B O   1 
ATOM 3284  C CB  . LYS B 1 181 ? -47.534 57.232  -8.952  1.00 17.84 ? 181 LYS B CB  1 
ATOM 3285  C CG  . LYS B 1 181 ? -48.866 57.956  -9.063  1.00 17.96 ? 181 LYS B CG  1 
ATOM 3286  C CD  . LYS B 1 181 ? -50.010 57.000  -9.338  1.00 19.31 ? 181 LYS B CD  1 
ATOM 3287  C CE  . LYS B 1 181 ? -50.285 56.095  -8.137  1.00 19.14 ? 181 LYS B CE  1 
ATOM 3288  N NZ  . LYS B 1 181 ? -51.433 55.160  -8.356  1.00 14.18 ? 181 LYS B NZ  1 
ATOM 3289  N N   . ASP B 1 182 ? -44.339 57.451  -9.270  1.00 17.35 ? 182 ASP B N   1 
ATOM 3290  C CA  . ASP B 1 182 ? -43.037 56.821  -9.374  1.00 16.83 ? 182 ASP B CA  1 
ATOM 3291  C C   . ASP B 1 182 ? -42.101 57.319  -8.295  1.00 16.38 ? 182 ASP B C   1 
ATOM 3292  O O   . ASP B 1 182 ? -41.352 56.551  -7.686  1.00 12.66 ? 182 ASP B O   1 
ATOM 3293  C CB  . ASP B 1 182 ? -42.417 57.072  -10.749 1.00 18.17 ? 182 ASP B CB  1 
ATOM 3294  C CG  . ASP B 1 182 ? -42.656 55.940  -11.738 1.00 14.10 ? 182 ASP B CG  1 
ATOM 3295  O OD1 . ASP B 1 182 ? -43.285 54.921  -11.372 1.00 14.28 ? 182 ASP B OD1 1 
ATOM 3296  O OD2 . ASP B 1 182 ? -42.194 56.070  -12.890 1.00 11.38 ? 182 ASP B OD2 1 
ATOM 3297  N N   . PHE B 1 183 ? -42.125 58.631  -8.085  1.00 15.42 ? 183 PHE B N   1 
ATOM 3298  C CA  . PHE B 1 183 ? -41.286 59.257  -7.071  1.00 18.11 ? 183 PHE B CA  1 
ATOM 3299  C C   . PHE B 1 183 ? -41.518 58.594  -5.721  1.00 19.90 ? 183 PHE B C   1 
ATOM 3300  O O   . PHE B 1 183 ? -40.571 58.078  -5.101  1.00 20.49 ? 183 PHE B O   1 
ATOM 3301  C CB  . PHE B 1 183 ? -41.585 60.752  -6.968  1.00 14.71 ? 183 PHE B CB  1 
ATOM 3302  C CG  . PHE B 1 183 ? -40.783 61.460  -5.912  1.00 17.56 ? 183 PHE B CG  1 
ATOM 3303  C CD1 . PHE B 1 183 ? -39.470 61.846  -6.161  1.00 12.24 ? 183 PHE B CD1 1 
ATOM 3304  C CD2 . PHE B 1 183 ? -41.345 61.751  -4.670  1.00 17.00 ? 183 PHE B CD2 1 
ATOM 3305  C CE1 . PHE B 1 183 ? -38.725 62.517  -5.179  1.00 11.83 ? 183 PHE B CE1 1 
ATOM 3306  C CE2 . PHE B 1 183 ? -40.612 62.418  -3.692  1.00 14.33 ? 183 PHE B CE2 1 
ATOM 3307  C CZ  . PHE B 1 183 ? -39.299 62.802  -3.948  1.00 11.57 ? 183 PHE B CZ  1 
ATOM 3308  N N   . ILE B 1 184 ? -42.781 58.478  -5.311  1.00 18.22 ? 184 ILE B N   1 
ATOM 3309  C CA  . ILE B 1 184 ? -43.124 57.836  -4.045  1.00 15.50 ? 184 ILE B CA  1 
ATOM 3310  C C   . ILE B 1 184 ? -42.805 56.334  -4.080  1.00 13.64 ? 184 ILE B C   1 
ATOM 3311  O O   . ILE B 1 184 ? -43.339 55.554  -3.325  1.00 11.32 ? 184 ILE B O   1 
ATOM 3312  C CB  . ILE B 1 184 ? -44.615 58.033  -3.670  1.00 14.99 ? 184 ILE B CB  1 
ATOM 3313  C CG1 . ILE B 1 184 ? -44.999 59.505  -3.733  1.00 14.82 ? 184 ILE B CG1 1 
ATOM 3314  C CG2 . ILE B 1 184 ? -44.860 57.608  -2.241  1.00 9.64  ? 184 ILE B CG2 1 
ATOM 3315  C CD1 . ILE B 1 184 ? -46.328 59.797  -3.063  1.00 12.94 ? 184 ILE B CD1 1 
ATOM 3316  N N   . SER B 1 185 ? -41.945 55.917  -4.997  1.00 13.53 ? 185 SER B N   1 
ATOM 3317  C CA  . SER B 1 185 ? -41.560 54.522  -5.072  1.00 17.22 ? 185 SER B CA  1 
ATOM 3318  C C   . SER B 1 185 ? -40.085 54.470  -4.689  1.00 15.32 ? 185 SER B C   1 
ATOM 3319  O O   . SER B 1 185 ? -39.696 53.727  -3.780  1.00 9.93  ? 185 SER B O   1 
ATOM 3320  C CB  . SER B 1 185 ? -41.801 53.964  -6.480  1.00 15.33 ? 185 SER B CB  1 
ATOM 3321  O OG  . SER B 1 185 ? -43.177 54.044  -6.831  1.00 15.54 ? 185 SER B OG  1 
ATOM 3322  N N   . ARG B 1 186 ? -39.267 55.286  -5.350  1.00 19.09 ? 186 ARG B N   1 
ATOM 3323  C CA  . ARG B 1 186 ? -37.843 55.334  -5.031  1.00 20.99 ? 186 ARG B CA  1 
ATOM 3324  C C   . ARG B 1 186 ? -37.726 55.771  -3.587  1.00 20.48 ? 186 ARG B C   1 
ATOM 3325  O O   . ARG B 1 186 ? -37.051 55.132  -2.784  1.00 19.87 ? 186 ARG B O   1 
ATOM 3326  C CB  . ARG B 1 186 ? -37.093 56.343  -5.912  1.00 19.38 ? 186 ARG B CB  1 
ATOM 3327  C CG  . ARG B 1 186 ? -36.552 55.782  -7.217  1.00 18.17 ? 186 ARG B CG  1 
ATOM 3328  C CD  . ARG B 1 186 ? -37.660 55.555  -8.222  1.00 18.62 ? 186 ARG B CD  1 
ATOM 3329  N NE  . ARG B 1 186 ? -38.247 56.814  -8.672  1.00 19.98 ? 186 ARG B NE  1 
ATOM 3330  C CZ  . ARG B 1 186 ? -37.789 57.530  -9.693  1.00 19.73 ? 186 ARG B CZ  1 
ATOM 3331  N NH1 . ARG B 1 186 ? -36.730 57.112  -10.378 1.00 18.67 ? 186 ARG B NH1 1 
ATOM 3332  N NH2 . ARG B 1 186 ? -38.400 58.659  -10.031 1.00 16.83 ? 186 ARG B NH2 1 
ATOM 3333  N N   . PHE B 1 187 ? -38.464 56.817  -3.240  1.00 19.74 ? 187 PHE B N   1 
ATOM 3334  C CA  . PHE B 1 187 ? -38.436 57.349  -1.891  1.00 18.18 ? 187 PHE B CA  1 
ATOM 3335  C C   . PHE B 1 187 ? -39.230 56.500  -0.909  1.00 20.34 ? 187 PHE B C   1 
ATOM 3336  O O   . PHE B 1 187 ? -39.939 57.013  -0.051  1.00 21.80 ? 187 PHE B O   1 
ATOM 3337  C CB  . PHE B 1 187 ? -38.923 58.798  -1.864  1.00 14.36 ? 187 PHE B CB  1 
ATOM 3338  C CG  . PHE B 1 187 ? -38.298 59.608  -0.771  1.00 11.95 ? 187 PHE B CG  1 
ATOM 3339  C CD1 . PHE B 1 187 ? -38.827 59.589  0.517   1.00 11.08 ? 187 PHE B CD1 1 
ATOM 3340  C CD2 . PHE B 1 187 ? -37.134 60.335  -1.009  1.00 10.53 ? 187 PHE B CD2 1 
ATOM 3341  C CE1 . PHE B 1 187 ? -38.204 60.274  1.570   1.00 8.98  ? 187 PHE B CE1 1 
ATOM 3342  C CE2 . PHE B 1 187 ? -36.491 61.020  0.017   1.00 7.03  ? 187 PHE B CE2 1 
ATOM 3343  C CZ  . PHE B 1 187 ? -37.044 60.986  1.301   1.00 7.23  ? 187 PHE B CZ  1 
ATOM 3344  N N   . GLU B 1 188 ? -39.124 55.191  -1.062  1.00 21.86 ? 188 GLU B N   1 
ATOM 3345  C CA  . GLU B 1 188 ? -39.784 54.237  -0.188  1.00 21.35 ? 188 GLU B CA  1 
ATOM 3346  C C   . GLU B 1 188 ? -38.943 52.985  -0.244  1.00 19.54 ? 188 GLU B C   1 
ATOM 3347  O O   . GLU B 1 188 ? -38.740 52.313  0.763   1.00 15.15 ? 188 GLU B O   1 
ATOM 3348  C CB  . GLU B 1 188 ? -41.207 53.931  -0.653  1.00 24.54 ? 188 GLU B CB  1 
ATOM 3349  C CG  . GLU B 1 188 ? -42.264 54.808  -0.003  1.00 26.64 ? 188 GLU B CG  1 
ATOM 3350  C CD  . GLU B 1 188 ? -43.659 54.200  -0.040  1.00 28.39 ? 188 GLU B CD  1 
ATOM 3351  O OE1 . GLU B 1 188 ? -43.787 52.976  -0.258  1.00 26.71 ? 188 GLU B OE1 1 
ATOM 3352  O OE2 . GLU B 1 188 ? -44.635 54.953  0.166   1.00 28.56 ? 188 GLU B OE2 1 
ATOM 3353  N N   . GLY B 1 189 ? -38.406 52.720  -1.429  1.00 21.23 ? 189 GLY B N   1 
ATOM 3354  C CA  . GLY B 1 189 ? -37.570 51.557  -1.631  1.00 20.31 ? 189 GLY B CA  1 
ATOM 3355  C C   . GLY B 1 189 ? -36.154 51.742  -1.130  1.00 20.53 ? 189 GLY B C   1 
ATOM 3356  O O   . GLY B 1 189 ? -35.341 50.828  -1.244  1.00 21.68 ? 189 GLY B O   1 
ATOM 3357  N N   . LEU B 1 190 ? -35.842 52.916  -0.591  1.00 17.92 ? 190 LEU B N   1 
ATOM 3358  C CA  . LEU B 1 190 ? -34.501 53.169  -0.079  1.00 15.95 ? 190 LEU B CA  1 
ATOM 3359  C C   . LEU B 1 190 ? -34.227 52.360  1.190   1.00 17.38 ? 190 LEU B C   1 
ATOM 3360  O O   . LEU B 1 190 ? -34.941 52.501  2.182   1.00 15.47 ? 190 LEU B O   1 
ATOM 3361  C CB  . LEU B 1 190 ? -34.293 54.666  0.175   1.00 13.12 ? 190 LEU B CB  1 
ATOM 3362  C CG  . LEU B 1 190 ? -34.224 55.557  -1.072  1.00 14.00 ? 190 LEU B CG  1 
ATOM 3363  C CD1 . LEU B 1 190 ? -34.212 57.031  -0.688  1.00 8.64  ? 190 LEU B CD1 1 
ATOM 3364  C CD2 . LEU B 1 190 ? -32.989 55.204  -1.885  1.00 15.04 ? 190 LEU B CD2 1 
ATOM 3365  N N   . GLU B 1 191 ? -33.201 51.509  1.129   1.00 17.40 ? 191 GLU B N   1 
ATOM 3366  C CA  . GLU B 1 191 ? -32.763 50.639  2.225   1.00 18.84 ? 191 GLU B CA  1 
ATOM 3367  C C   . GLU B 1 191 ? -33.045 51.195  3.610   1.00 18.78 ? 191 GLU B C   1 
ATOM 3368  O O   . GLU B 1 191 ? -33.791 50.607  4.389   1.00 18.43 ? 191 GLU B O   1 
ATOM 3369  C CB  . GLU B 1 191 ? -31.257 50.366  2.096   1.00 21.90 ? 191 GLU B CB  1 
ATOM 3370  C CG  . GLU B 1 191 ? -30.673 49.468  3.191   1.00 27.78 ? 191 GLU B CG  1 
ATOM 3371  C CD  . GLU B 1 191 ? -29.173 49.220  3.042   1.00 31.44 ? 191 GLU B CD  1 
ATOM 3372  O OE1 . GLU B 1 191 ? -28.768 48.465  2.131   1.00 33.11 ? 191 GLU B OE1 1 
ATOM 3373  O OE2 . GLU B 1 191 ? -28.397 49.766  3.854   1.00 31.96 ? 191 GLU B OE2 1 
ATOM 3374  N N   . LYS B 1 192 ? -32.446 52.338  3.910   1.00 19.00 ? 192 LYS B N   1 
ATOM 3375  C CA  . LYS B 1 192 ? -32.630 52.960  5.208   1.00 20.86 ? 192 LYS B CA  1 
ATOM 3376  C C   . LYS B 1 192 ? -34.057 53.460  5.478   1.00 21.21 ? 192 LYS B C   1 
ATOM 3377  O O   . LYS B 1 192 ? -34.532 53.385  6.617   1.00 23.11 ? 192 LYS B O   1 
ATOM 3378  C CB  . LYS B 1 192 ? -31.577 54.055  5.407   1.00 22.06 ? 192 LYS B CB  1 
ATOM 3379  C CG  . LYS B 1 192 ? -30.158 53.475  5.535   1.00 23.86 ? 192 LYS B CG  1 
ATOM 3380  C CD  . LYS B 1 192 ? -29.059 54.531  5.609   1.00 23.09 ? 192 LYS B CD  1 
ATOM 3381  C CE  . LYS B 1 192 ? -28.641 55.030  4.235   1.00 23.42 ? 192 LYS B CE  1 
ATOM 3382  N NZ  . LYS B 1 192 ? -29.756 55.707  3.520   1.00 24.74 ? 192 LYS B NZ  1 
ATOM 3383  N N   . ILE B 1 193 ? -34.761 53.903  4.433   1.00 20.77 ? 193 ILE B N   1 
ATOM 3384  C CA  . ILE B 1 193 ? -36.135 54.395  4.592   1.00 20.62 ? 193 ILE B CA  1 
ATOM 3385  C C   . ILE B 1 193 ? -37.118 53.252  4.843   1.00 18.92 ? 193 ILE B C   1 
ATOM 3386  O O   . ILE B 1 193 ? -38.008 53.369  5.684   1.00 17.33 ? 193 ILE B O   1 
ATOM 3387  C CB  . ILE B 1 193 ? -36.615 55.244  3.388   1.00 19.27 ? 193 ILE B CB  1 
ATOM 3388  C CG1 . ILE B 1 193 ? -35.902 56.589  3.366   1.00 17.69 ? 193 ILE B CG1 1 
ATOM 3389  C CG2 . ILE B 1 193 ? -38.104 55.558  3.507   1.00 17.82 ? 193 ILE B CG2 1 
ATOM 3390  C CD1 . ILE B 1 193 ? -34.422 56.504  3.182   1.00 18.39 ? 193 ILE B CD1 1 
ATOM 3391  N N   . SER B 1 194 ? -36.960 52.149  4.120   1.00 20.17 ? 194 SER B N   1 
ATOM 3392  C CA  . SER B 1 194 ? -37.831 50.993  4.306   1.00 21.50 ? 194 SER B CA  1 
ATOM 3393  C C   . SER B 1 194 ? -37.627 50.503  5.735   1.00 25.35 ? 194 SER B C   1 
ATOM 3394  O O   . SER B 1 194 ? -38.578 50.057  6.397   1.00 24.81 ? 194 SER B O   1 
ATOM 3395  C CB  . SER B 1 194 ? -37.489 49.882  3.301   1.00 22.56 ? 194 SER B CB  1 
ATOM 3396  O OG  . SER B 1 194 ? -36.103 49.576  3.306   1.00 21.50 ? 194 SER B OG  1 
ATOM 3397  N N   . ALA B 1 195 ? -36.384 50.616  6.203   1.00 26.43 ? 195 ALA B N   1 
ATOM 3398  C CA  . ALA B 1 195 ? -36.011 50.224  7.553   1.00 25.92 ? 195 ALA B CA  1 
ATOM 3399  C C   . ALA B 1 195 ? -36.835 51.045  8.537   1.00 27.23 ? 195 ALA B C   1 
ATOM 3400  O O   . ALA B 1 195 ? -37.570 50.498  9.353   1.00 28.78 ? 195 ALA B O   1 
ATOM 3401  C CB  . ALA B 1 195 ? -34.523 50.472  7.777   1.00 26.06 ? 195 ALA B CB  1 
ATOM 3402  N N   . TYR B 1 196 ? -36.732 52.364  8.424   1.00 27.37 ? 196 TYR B N   1 
ATOM 3403  C CA  . TYR B 1 196 ? -37.465 53.279  9.288   1.00 28.39 ? 196 TYR B CA  1 
ATOM 3404  C C   . TYR B 1 196 ? -38.971 53.047  9.182   1.00 28.54 ? 196 TYR B C   1 
ATOM 3405  O O   . TYR B 1 196 ? -39.693 53.109  10.176  1.00 30.78 ? 196 TYR B O   1 
ATOM 3406  C CB  . TYR B 1 196 ? -37.137 54.720  8.896   1.00 28.94 ? 196 TYR B CB  1 
ATOM 3407  C CG  . TYR B 1 196 ? -37.855 55.785  9.707   1.00 30.13 ? 196 TYR B CG  1 
ATOM 3408  C CD1 . TYR B 1 196 ? -38.035 55.646  11.086  1.00 31.16 ? 196 TYR B CD1 1 
ATOM 3409  C CD2 . TYR B 1 196 ? -38.333 56.944  9.097   1.00 30.04 ? 196 TYR B CD2 1 
ATOM 3410  C CE1 . TYR B 1 196 ? -38.671 56.633  11.830  1.00 30.24 ? 196 TYR B CE1 1 
ATOM 3411  C CE2 . TYR B 1 196 ? -38.970 57.937  9.832   1.00 29.73 ? 196 TYR B CE2 1 
ATOM 3412  C CZ  . TYR B 1 196 ? -39.137 57.776  11.196  1.00 29.26 ? 196 TYR B CZ  1 
ATOM 3413  O OH  . TYR B 1 196 ? -39.778 58.754  11.920  1.00 29.41 ? 196 TYR B OH  1 
ATOM 3414  N N   . MET B 1 197 ? -39.436 52.768  7.972   1.00 26.81 ? 197 MET B N   1 
ATOM 3415  C CA  . MET B 1 197 ? -40.853 52.538  7.722   1.00 24.82 ? 197 MET B CA  1 
ATOM 3416  C C   . MET B 1 197 ? -41.342 51.325  8.494   1.00 24.04 ? 197 MET B C   1 
ATOM 3417  O O   . MET B 1 197 ? -42.407 51.351  9.108   1.00 23.48 ? 197 MET B O   1 
ATOM 3418  C CB  . MET B 1 197 ? -41.087 52.304  6.230   1.00 21.85 ? 197 MET B CB  1 
ATOM 3419  C CG  . MET B 1 197 ? -42.380 52.884  5.716   1.00 16.16 ? 197 MET B CG  1 
ATOM 3420  S SD  . MET B 1 197 ? -42.225 54.638  5.417   1.00 8.43  ? 197 MET B SD  1 
ATOM 3421  C CE  . MET B 1 197 ? -42.125 54.671  3.656   1.00 9.48  ? 197 MET B CE  1 
ATOM 3422  N N   . LYS B 1 198 ? -40.544 50.268  8.468   1.00 25.01 ? 198 LYS B N   1 
ATOM 3423  C CA  . LYS B 1 198 ? -40.889 49.031  9.144   1.00 27.35 ? 198 LYS B CA  1 
ATOM 3424  C C   . LYS B 1 198 ? -40.243 48.935  10.522  1.00 28.29 ? 198 LYS B C   1 
ATOM 3425  O O   . LYS B 1 198 ? -39.856 47.851  10.961  1.00 26.52 ? 198 LYS B O   1 
ATOM 3426  C CB  . LYS B 1 198 ? -40.470 47.850  8.271   1.00 26.63 ? 198 LYS B CB  1 
ATOM 3427  C CG  . LYS B 1 198 ? -40.988 47.945  6.847   1.00 29.40 ? 198 LYS B CG  1 
ATOM 3428  C CD  . LYS B 1 198 ? -40.661 46.700  6.057   1.00 28.51 ? 198 LYS B CD  1 
ATOM 3429  C CE  . LYS B 1 198 ? -41.207 46.790  4.651   1.00 28.73 ? 198 LYS B CE  1 
ATOM 3430  N NZ  . LYS B 1 198 ? -40.616 47.944  3.927   1.00 31.09 ? 198 LYS B NZ  1 
ATOM 3431  N N   . SER B 1 199 ? -40.143 50.068  11.212  1.00 28.97 ? 199 SER B N   1 
ATOM 3432  C CA  . SER B 1 199 ? -39.537 50.090  12.540  1.00 25.97 ? 199 SER B CA  1 
ATOM 3433  C C   . SER B 1 199 ? -40.566 50.415  13.622  1.00 26.45 ? 199 SER B C   1 
ATOM 3434  O O   . SER B 1 199 ? -41.716 50.750  13.332  1.00 26.22 ? 199 SER B O   1 
ATOM 3435  C CB  . SER B 1 199 ? -38.378 51.091  12.587  1.00 24.18 ? 199 SER B CB  1 
ATOM 3436  O OG  . SER B 1 199 ? -38.833 52.434  12.551  1.00 19.96 ? 199 SER B OG  1 
ATOM 3437  N N   . SER B 1 200 ? -40.134 50.328  14.872  1.00 27.27 ? 200 SER B N   1 
ATOM 3438  C CA  . SER B 1 200 ? -40.993 50.600  16.012  1.00 25.75 ? 200 SER B CA  1 
ATOM 3439  C C   . SER B 1 200 ? -41.296 52.086  16.179  1.00 26.82 ? 200 SER B C   1 
ATOM 3440  O O   . SER B 1 200 ? -42.404 52.458  16.555  1.00 27.83 ? 200 SER B O   1 
ATOM 3441  C CB  . SER B 1 200 ? -40.329 50.074  17.277  1.00 28.27 ? 200 SER B CB  1 
ATOM 3442  O OG  . SER B 1 200 ? -38.976 50.503  17.336  1.00 33.11 ? 200 SER B OG  1 
ATOM 3443  N N   . ARG B 1 201 ? -40.308 52.938  15.921  1.00 27.21 ? 201 ARG B N   1 
ATOM 3444  C CA  . ARG B 1 201 ? -40.518 54.373  16.078  1.00 26.45 ? 201 ARG B CA  1 
ATOM 3445  C C   . ARG B 1 201 ? -40.941 55.111  14.801  1.00 24.45 ? 201 ARG B C   1 
ATOM 3446  O O   . ARG B 1 201 ? -40.595 56.282  14.606  1.00 21.96 ? 201 ARG B O   1 
ATOM 3447  C CB  . ARG B 1 201 ? -39.304 55.050  16.744  1.00 28.23 ? 201 ARG B CB  1 
ATOM 3448  C CG  . ARG B 1 201 ? -38.014 55.062  15.940  1.00 26.52 ? 201 ARG B CG  1 
ATOM 3449  C CD  . ARG B 1 201 ? -37.134 53.856  16.211  1.00 30.13 ? 201 ARG B CD  1 
ATOM 3450  N NE  . ARG B 1 201 ? -35.812 54.063  15.631  1.00 28.04 ? 201 ARG B NE  1 
ATOM 3451  C CZ  . ARG B 1 201 ? -35.433 53.612  14.442  1.00 27.05 ? 201 ARG B CZ  1 
ATOM 3452  N NH1 . ARG B 1 201 ? -36.264 52.907  13.695  1.00 28.62 ? 201 ARG B NH1 1 
ATOM 3453  N NH2 . ARG B 1 201 ? -34.240 53.928  13.968  1.00 22.32 ? 201 ARG B NH2 1 
ATOM 3454  N N   . PHE B 1 202 ? -41.707 54.432  13.947  1.00 22.06 ? 202 PHE B N   1 
ATOM 3455  C CA  . PHE B 1 202 ? -42.198 55.042  12.713  1.00 23.74 ? 202 PHE B CA  1 
ATOM 3456  C C   . PHE B 1 202 ? -43.520 55.744  13.010  1.00 24.76 ? 202 PHE B C   1 
ATOM 3457  O O   . PHE B 1 202 ? -44.519 55.094  13.333  1.00 26.13 ? 202 PHE B O   1 
ATOM 3458  C CB  . PHE B 1 202 ? -42.399 53.995  11.614  1.00 22.59 ? 202 PHE B CB  1 
ATOM 3459  C CG  . PHE B 1 202 ? -42.842 54.578  10.299  1.00 22.40 ? 202 PHE B CG  1 
ATOM 3460  C CD1 . PHE B 1 202 ? -42.002 55.417  9.576   1.00 22.08 ? 202 PHE B CD1 1 
ATOM 3461  C CD2 . PHE B 1 202 ? -44.108 54.300  9.792   1.00 21.94 ? 202 PHE B CD2 1 
ATOM 3462  C CE1 . PHE B 1 202 ? -42.414 55.971  8.368   1.00 23.50 ? 202 PHE B CE1 1 
ATOM 3463  C CE2 . PHE B 1 202 ? -44.527 54.851  8.585   1.00 21.76 ? 202 PHE B CE2 1 
ATOM 3464  C CZ  . PHE B 1 202 ? -43.678 55.688  7.875   1.00 23.21 ? 202 PHE B CZ  1 
ATOM 3465  N N   . LEU B 1 203 ? -43.521 57.069  12.892  1.00 24.27 ? 203 LEU B N   1 
ATOM 3466  C CA  . LEU B 1 203 ? -44.711 57.863  13.172  1.00 25.39 ? 203 LEU B CA  1 
ATOM 3467  C C   . LEU B 1 203 ? -45.362 58.444  11.914  1.00 26.43 ? 203 LEU B C   1 
ATOM 3468  O O   . LEU B 1 203 ? -44.790 59.314  11.246  1.00 28.46 ? 203 LEU B O   1 
ATOM 3469  C CB  . LEU B 1 203 ? -44.370 58.972  14.182  1.00 24.63 ? 203 LEU B CB  1 
ATOM 3470  C CG  . LEU B 1 203 ? -45.460 59.908  14.720  1.00 23.70 ? 203 LEU B CG  1 
ATOM 3471  C CD1 . LEU B 1 203 ? -45.132 60.306  16.148  1.00 23.17 ? 203 LEU B CD1 1 
ATOM 3472  C CD2 . LEU B 1 203 ? -45.592 61.136  13.839  1.00 21.19 ? 203 LEU B CD2 1 
ATOM 3473  N N   . PRO B 1 204 ? -46.528 57.895  11.525  1.00 25.95 ? 204 PRO B N   1 
ATOM 3474  C CA  . PRO B 1 204 ? -47.292 58.331  10.353  1.00 26.10 ? 204 PRO B CA  1 
ATOM 3475  C C   . PRO B 1 204 ? -48.297 59.399  10.792  1.00 27.46 ? 204 PRO B C   1 
ATOM 3476  O O   . PRO B 1 204 ? -48.158 60.579  10.462  1.00 27.97 ? 204 PRO B O   1 
ATOM 3477  C CB  . PRO B 1 204 ? -48.020 57.047  9.913   1.00 26.39 ? 204 PRO B CB  1 
ATOM 3478  C CG  . PRO B 1 204 ? -47.397 55.929  10.744  1.00 24.52 ? 204 PRO B CG  1 
ATOM 3479  C CD  . PRO B 1 204 ? -47.061 56.619  12.025  1.00 26.43 ? 204 PRO B CD  1 
ATOM 3480  N N   . LYS B 1 205 ? -49.309 58.961  11.540  1.00 26.21 ? 205 LYS B N   1 
ATOM 3481  C CA  . LYS B 1 205 ? -50.358 59.832  12.067  1.00 23.31 ? 205 LYS B CA  1 
ATOM 3482  C C   . LYS B 1 205 ? -50.120 59.985  13.578  1.00 22.03 ? 205 LYS B C   1 
ATOM 3483  O O   . LYS B 1 205 ? -49.290 59.271  14.152  1.00 22.48 ? 205 LYS B O   1 
ATOM 3484  C CB  . LYS B 1 205 ? -51.742 59.207  11.828  1.00 21.61 ? 205 LYS B CB  1 
ATOM 3485  C CG  . LYS B 1 205 ? -52.145 59.001  10.372  1.00 20.75 ? 205 LYS B CG  1 
ATOM 3486  C CD  . LYS B 1 205 ? -53.571 58.453  10.289  1.00 18.81 ? 205 LYS B CD  1 
ATOM 3487  C CE  . LYS B 1 205 ? -53.980 58.114  8.865   1.00 19.94 ? 205 LYS B CE  1 
ATOM 3488  N NZ  . LYS B 1 205 ? -55.408 57.682  8.778   1.00 16.78 ? 205 LYS B NZ  1 
ATOM 3489  N N   . PRO B 1 206 ? -50.834 60.911  14.241  1.00 20.90 ? 206 PRO B N   1 
ATOM 3490  C CA  . PRO B 1 206 ? -51.838 61.822  13.683  1.00 21.70 ? 206 PRO B CA  1 
ATOM 3491  C C   . PRO B 1 206 ? -51.198 62.881  12.797  1.00 23.24 ? 206 PRO B C   1 
ATOM 3492  O O   . PRO B 1 206 ? -50.074 63.320  13.053  1.00 22.86 ? 206 PRO B O   1 
ATOM 3493  C CB  . PRO B 1 206 ? -52.470 62.436  14.930  1.00 21.52 ? 206 PRO B CB  1 
ATOM 3494  C CG  . PRO B 1 206 ? -51.373 62.421  15.908  1.00 21.72 ? 206 PRO B CG  1 
ATOM 3495  C CD  . PRO B 1 206 ? -50.756 61.069  15.702  1.00 24.08 ? 206 PRO B CD  1 
ATOM 3496  N N   . LEU B 1 207 ? -51.910 63.265  11.741  1.00 22.80 ? 207 LEU B N   1 
ATOM 3497  C CA  . LEU B 1 207 ? -51.419 64.266  10.799  1.00 19.65 ? 207 LEU B CA  1 
ATOM 3498  C C   . LEU B 1 207 ? -51.335 65.633  11.445  1.00 18.83 ? 207 LEU B C   1 
ATOM 3499  O O   . LEU B 1 207 ? -50.326 66.328  11.346  1.00 19.00 ? 207 LEU B O   1 
ATOM 3500  C CB  . LEU B 1 207 ? -52.346 64.376  9.586   1.00 19.07 ? 207 LEU B CB  1 
ATOM 3501  C CG  . LEU B 1 207 ? -52.611 63.174  8.689   1.00 17.61 ? 207 LEU B CG  1 
ATOM 3502  C CD1 . LEU B 1 207 ? -53.191 63.693  7.385   1.00 13.17 ? 207 LEU B CD1 1 
ATOM 3503  C CD2 . LEU B 1 207 ? -51.326 62.418  8.421   1.00 17.27 ? 207 LEU B CD2 1 
ATOM 3504  N N   . TYR B 1 208 ? -52.429 66.013  12.086  1.00 19.64 ? 208 TYR B N   1 
ATOM 3505  C CA  . TYR B 1 208 ? -52.537 67.302  12.736  1.00 20.84 ? 208 TYR B CA  1 
ATOM 3506  C C   . TYR B 1 208 ? -52.726 67.104  14.237  1.00 19.61 ? 208 TYR B C   1 
ATOM 3507  O O   . TYR B 1 208 ? -52.952 65.985  14.701  1.00 19.06 ? 208 TYR B O   1 
ATOM 3508  C CB  . TYR B 1 208 ? -53.718 68.079  12.138  1.00 23.95 ? 208 TYR B CB  1 
ATOM 3509  C CG  . TYR B 1 208 ? -53.524 68.555  10.702  1.00 24.87 ? 208 TYR B CG  1 
ATOM 3510  C CD1 . TYR B 1 208 ? -53.398 67.649  9.647   1.00 23.79 ? 208 TYR B CD1 1 
ATOM 3511  C CD2 . TYR B 1 208 ? -53.467 69.917  10.402  1.00 24.78 ? 208 TYR B CD2 1 
ATOM 3512  C CE1 . TYR B 1 208 ? -53.216 68.092  8.332   1.00 23.24 ? 208 TYR B CE1 1 
ATOM 3513  C CE2 . TYR B 1 208 ? -53.289 70.366  9.100   1.00 24.82 ? 208 TYR B CE2 1 
ATOM 3514  C CZ  . TYR B 1 208 ? -53.165 69.454  8.070   1.00 22.81 ? 208 TYR B CZ  1 
ATOM 3515  O OH  . TYR B 1 208 ? -52.996 69.906  6.783   1.00 20.11 ? 208 TYR B OH  1 
ATOM 3516  N N   . THR B 1 209 ? -52.616 68.193  14.994  1.00 18.50 ? 209 THR B N   1 
ATOM 3517  C CA  . THR B 1 209 ? -52.769 68.149  16.450  1.00 19.93 ? 209 THR B CA  1 
ATOM 3518  C C   . THR B 1 209 ? -54.226 67.930  16.889  1.00 20.26 ? 209 THR B C   1 
ATOM 3519  O O   . THR B 1 209 ? -55.150 68.123  16.094  1.00 18.48 ? 209 THR B O   1 
ATOM 3520  C CB  . THR B 1 209 ? -52.191 69.428  17.113  1.00 16.81 ? 209 THR B CB  1 
ATOM 3521  O OG1 . THR B 1 209 ? -52.807 70.592  16.546  1.00 19.29 ? 209 THR B OG1 1 
ATOM 3522  C CG2 . THR B 1 209 ? -50.691 69.508  16.898  1.00 16.98 ? 209 THR B CG2 1 
ATOM 3523  N N   . ARG B 1 210 ? -54.426 67.608  18.163  1.00 21.24 ? 210 ARG B N   1 
ATOM 3524  C CA  . ARG B 1 210 ? -55.767 67.381  18.714  1.00 21.77 ? 210 ARG B CA  1 
ATOM 3525  C C   . ARG B 1 210 ? -56.723 68.518  18.355  1.00 22.41 ? 210 ARG B C   1 
ATOM 3526  O O   . ARG B 1 210 ? -57.936 68.327  18.310  1.00 22.16 ? 210 ARG B O   1 
ATOM 3527  C CB  . ARG B 1 210 ? -55.718 67.268  20.244  1.00 24.45 ? 210 ARG B CB  1 
ATOM 3528  C CG  . ARG B 1 210 ? -54.590 66.426  20.814  1.00 26.72 ? 210 ARG B CG  1 
ATOM 3529  C CD  . ARG B 1 210 ? -54.822 64.938  20.648  1.00 31.17 ? 210 ARG B CD  1 
ATOM 3530  N NE  . ARG B 1 210 ? -53.706 64.165  21.194  1.00 29.56 ? 210 ARG B NE  1 
ATOM 3531  C CZ  . ARG B 1 210 ? -53.824 63.239  22.142  1.00 28.16 ? 210 ARG B CZ  1 
ATOM 3532  N NH1 . ARG B 1 210 ? -55.010 62.960  22.664  1.00 29.41 ? 210 ARG B NH1 1 
ATOM 3533  N NH2 . ARG B 1 210 ? -52.754 62.573  22.551  1.00 27.28 ? 210 ARG B NH2 1 
ATOM 3534  N N   . VAL B 1 211 ? -56.167 69.698  18.099  1.00 20.56 ? 211 VAL B N   1 
ATOM 3535  C CA  . VAL B 1 211 ? -56.968 70.870  17.767  1.00 17.78 ? 211 VAL B CA  1 
ATOM 3536  C C   . VAL B 1 211 ? -57.339 70.964  16.274  1.00 15.51 ? 211 VAL B C   1 
ATOM 3537  O O   . VAL B 1 211 ? -57.767 72.022  15.789  1.00 11.25 ? 211 VAL B O   1 
ATOM 3538  C CB  . VAL B 1 211 ? -56.265 72.169  18.279  1.00 17.22 ? 211 VAL B CB  1 
ATOM 3539  C CG1 . VAL B 1 211 ? -55.118 72.579  17.360  1.00 19.37 ? 211 VAL B CG1 1 
ATOM 3540  C CG2 . VAL B 1 211 ? -57.275 73.284  18.472  1.00 16.37 ? 211 VAL B CG2 1 
ATOM 3541  N N   . ALA B 1 212 ? -57.217 69.844  15.565  1.00 15.54 ? 212 ALA B N   1 
ATOM 3542  C CA  . ALA B 1 212 ? -57.540 69.793  14.141  1.00 16.26 ? 212 ALA B CA  1 
ATOM 3543  C C   . ALA B 1 212 ? -58.882 69.115  13.901  1.00 12.90 ? 212 ALA B C   1 
ATOM 3544  O O   . ALA B 1 212 ? -59.155 68.062  14.476  1.00 9.50  ? 212 ALA B O   1 
ATOM 3545  C CB  . ALA B 1 212 ? -56.464 69.057  13.392  1.00 12.14 ? 212 ALA B CB  1 
ATOM 3546  N N   . VAL B 1 213 ? -59.700 69.700  13.027  1.00 14.79 ? 213 VAL B N   1 
ATOM 3547  C CA  . VAL B 1 213 ? -61.005 69.135  12.716  1.00 16.76 ? 213 VAL B CA  1 
ATOM 3548  C C   . VAL B 1 213 ? -60.813 67.797  11.997  1.00 19.45 ? 213 VAL B C   1 
ATOM 3549  O O   . VAL B 1 213 ? -61.528 66.828  12.262  1.00 22.12 ? 213 VAL B O   1 
ATOM 3550  C CB  . VAL B 1 213 ? -61.848 70.100  11.850  1.00 15.55 ? 213 VAL B CB  1 
ATOM 3551  C CG1 . VAL B 1 213 ? -61.212 70.295  10.485  1.00 19.52 ? 213 VAL B CG1 1 
ATOM 3552  C CG2 . VAL B 1 213 ? -63.270 69.589  11.714  1.00 13.43 ? 213 VAL B CG2 1 
ATOM 3553  N N   . TRP B 1 214 ? -59.820 67.743  11.116  1.00 19.90 ? 214 TRP B N   1 
ATOM 3554  C CA  . TRP B 1 214 ? -59.519 66.528  10.377  1.00 21.47 ? 214 TRP B CA  1 
ATOM 3555  C C   . TRP B 1 214 ? -58.048 66.201  10.570  1.00 23.10 ? 214 TRP B C   1 
ATOM 3556  O O   . TRP B 1 214 ? -57.237 67.090  10.842  1.00 25.77 ? 214 TRP B O   1 
ATOM 3557  C CB  . TRP B 1 214 ? -59.824 66.692  8.884   1.00 22.54 ? 214 TRP B CB  1 
ATOM 3558  C CG  . TRP B 1 214 ? -59.462 65.469  8.085   1.00 22.03 ? 214 TRP B CG  1 
ATOM 3559  C CD1 . TRP B 1 214 ? -60.171 64.303  8.011   1.00 22.76 ? 214 TRP B CD1 1 
ATOM 3560  C CD2 . TRP B 1 214 ? -58.259 65.257  7.326   1.00 20.54 ? 214 TRP B CD2 1 
ATOM 3561  N NE1 . TRP B 1 214 ? -59.480 63.376  7.268   1.00 23.92 ? 214 TRP B NE1 1 
ATOM 3562  C CE2 . TRP B 1 214 ? -58.305 63.931  6.837   1.00 21.75 ? 214 TRP B CE2 1 
ATOM 3563  C CE3 . TRP B 1 214 ? -57.147 66.052  7.020   1.00 21.50 ? 214 TRP B CE3 1 
ATOM 3564  C CZ2 . TRP B 1 214 ? -57.280 63.383  6.062   1.00 19.70 ? 214 TRP B CZ2 1 
ATOM 3565  C CZ3 . TRP B 1 214 ? -56.128 65.507  6.248   1.00 20.51 ? 214 TRP B CZ3 1 
ATOM 3566  C CH2 . TRP B 1 214 ? -56.202 64.182  5.780   1.00 20.48 ? 214 TRP B CH2 1 
ATOM 3567  N N   . GLY B 1 215 ? -57.717 64.919  10.459  1.00 25.18 ? 215 GLY B N   1 
ATOM 3568  C CA  . GLY B 1 215 ? -56.341 64.493  10.612  1.00 26.35 ? 215 GLY B CA  1 
ATOM 3569  C C   . GLY B 1 215 ? -55.876 64.439  12.051  1.00 27.73 ? 215 GLY B C   1 
ATOM 3570  O O   . GLY B 1 215 ? -54.741 64.037  12.293  1.00 26.95 ? 215 GLY B O   1 
ATOM 3571  N N   . ASN B 1 216 ? -56.729 64.866  12.980  1.00 29.12 ? 216 ASN B N   1 
ATOM 3572  C CA  . ASN B 1 216 ? -56.393 64.850  14.403  1.00 28.19 ? 216 ASN B CA  1 
ATOM 3573  C C   . ASN B 1 216 ? -56.561 63.437  14.961  1.00 30.49 ? 216 ASN B C   1 
ATOM 3574  O O   . ASN B 1 216 ? -57.387 62.670  14.447  1.00 32.49 ? 216 ASN B O   1 
ATOM 3575  C CB  . ASN B 1 216 ? -57.278 65.825  15.199  1.00 28.05 ? 216 ASN B CB  1 
ATOM 3576  C CG  . ASN B 1 216 ? -58.675 65.272  15.478  1.00 28.17 ? 216 ASN B CG  1 
ATOM 3577  O OD1 . ASN B 1 216 ? -58.889 64.551  16.453  1.00 28.57 ? 216 ASN B OD1 1 
ATOM 3578  N ND2 . ASN B 1 216 ? -59.634 65.638  14.641  1.00 29.93 ? 216 ASN B ND2 1 
ATOM 3579  N N   . LYS B 1 217 ? -55.766 63.096  15.950  1.00 30.05 ? 217 LYS B N   1 
ATOM 3580  C CA  . LYS B 1 217 ? -55.825 61.779  16.561  1.00 30.47 ? 217 LYS B CA  1 
ATOM 3581  C C   . LYS B 1 217 ? -55.043 61.814  17.867  1.00 31.09 ? 217 LYS B C   1 
ATOM 3582  O O   . LYS B 1 217 ? -55.191 60.870  18.672  1.00 31.42 ? 217 LYS B O   1 
ATOM 3583  C CB  . LYS B 1 217 ? -55.213 60.732  15.631  1.00 28.15 ? 217 LYS B CB  1 
ATOM 3584  C CG  . LYS B 1 217 ? -56.075 59.502  15.415  1.00 30.66 ? 217 LYS B CG  1 
ATOM 3585  C CD  . LYS B 1 217 ? -57.180 59.743  14.395  1.00 29.41 ? 217 LYS B CD  1 
ATOM 3586  C CE  . LYS B 1 217 ? -56.643 59.810  12.965  1.00 29.18 ? 217 LYS B CE  1 
ATOM 3587  N NZ  . LYS B 1 217 ? -55.813 61.014  12.680  1.00 27.19 ? 217 LYS B NZ  1 
ATOM 3588  O OXT . LYS B 1 217 ? -54.281 62.785  18.064  1.00 29.43 ? 217 LYS B OXT 1 
ATOM 3589  N N   . SER C 1 1   ? -42.855 148.798 2.878   1.00 18.83 ? 1   SER C N   1 
ATOM 3590  C CA  . SER C 1 1   ? -41.986 149.031 4.058   1.00 16.06 ? 1   SER C CA  1 
ATOM 3591  C C   . SER C 1 1   ? -42.035 147.840 4.992   1.00 19.11 ? 1   SER C C   1 
ATOM 3592  O O   . SER C 1 1   ? -43.105 147.276 5.231   1.00 23.07 ? 1   SER C O   1 
ATOM 3593  C CB  . SER C 1 1   ? -42.438 150.275 4.826   1.00 13.26 ? 1   SER C CB  1 
ATOM 3594  O OG  . SER C 1 1   ? -42.677 151.362 3.955   1.00 10.95 ? 1   SER C OG  1 
ATOM 3595  N N   . MET C 1 2   ? -40.874 147.440 5.492   1.00 20.03 ? 2   MET C N   1 
ATOM 3596  C CA  . MET C 1 2   ? -40.805 146.338 6.435   1.00 19.70 ? 2   MET C CA  1 
ATOM 3597  C C   . MET C 1 2   ? -40.475 146.952 7.800   1.00 20.17 ? 2   MET C C   1 
ATOM 3598  O O   . MET C 1 2   ? -39.899 148.042 7.885   1.00 19.57 ? 2   MET C O   1 
ATOM 3599  C CB  . MET C 1 2   ? -39.751 145.308 6.010   1.00 19.79 ? 2   MET C CB  1 
ATOM 3600  C CG  . MET C 1 2   ? -38.312 145.745 6.180   1.00 15.82 ? 2   MET C CG  1 
ATOM 3601  S SD  . MET C 1 2   ? -37.769 146.948 4.962   1.00 17.56 ? 2   MET C SD  1 
ATOM 3602  C CE  . MET C 1 2   ? -36.810 145.892 3.846   1.00 8.42  ? 2   MET C CE  1 
ATOM 3603  N N   . THR C 1 3   ? -40.887 146.290 8.870   1.00 21.28 ? 3   THR C N   1 
ATOM 3604  C CA  . THR C 1 3   ? -40.624 146.815 10.200  1.00 21.87 ? 3   THR C CA  1 
ATOM 3605  C C   . THR C 1 3   ? -39.466 146.126 10.916  1.00 19.00 ? 3   THR C C   1 
ATOM 3606  O O   . THR C 1 3   ? -39.381 144.895 10.963  1.00 16.74 ? 3   THR C O   1 
ATOM 3607  C CB  . THR C 1 3   ? -41.912 146.830 11.092  1.00 23.73 ? 3   THR C CB  1 
ATOM 3608  O OG1 . THR C 1 3   ? -41.557 146.754 12.482  1.00 23.25 ? 3   THR C OG1 1 
ATOM 3609  C CG2 . THR C 1 3   ? -42.851 145.691 10.732  1.00 26.40 ? 3   THR C CG2 1 
ATOM 3610  N N   . LEU C 1 4   ? -38.536 146.948 11.390  1.00 16.98 ? 4   LEU C N   1 
ATOM 3611  C CA  . LEU C 1 4   ? -37.375 146.490 12.134  1.00 11.05 ? 4   LEU C CA  1 
ATOM 3612  C C   . LEU C 1 4   ? -37.843 146.495 13.575  1.00 10.49 ? 4   LEU C C   1 
ATOM 3613  O O   . LEU C 1 4   ? -38.802 147.187 13.904  1.00 8.92  ? 4   LEU C O   1 
ATOM 3614  C CB  . LEU C 1 4   ? -36.221 147.484 11.952  1.00 10.55 ? 4   LEU C CB  1 
ATOM 3615  C CG  . LEU C 1 4   ? -34.910 147.285 12.722  1.00 7.07  ? 4   LEU C CG  1 
ATOM 3616  C CD1 . LEU C 1 4   ? -34.238 145.980 12.308  1.00 2.00  ? 4   LEU C CD1 1 
ATOM 3617  C CD2 . LEU C 1 4   ? -33.985 148.472 12.481  1.00 7.36  ? 4   LEU C CD2 1 
ATOM 3618  N N   . GLY C 1 5   ? -37.208 145.713 14.423  1.00 11.09 ? 5   GLY C N   1 
ATOM 3619  C CA  . GLY C 1 5   ? -37.578 145.672 15.819  1.00 11.40 ? 5   GLY C CA  1 
ATOM 3620  C C   . GLY C 1 5   ? -36.400 145.451 16.750  1.00 10.78 ? 5   GLY C C   1 
ATOM 3621  O O   . GLY C 1 5   ? -35.644 144.484 16.603  1.00 8.61  ? 5   GLY C O   1 
ATOM 3622  N N   . TYR C 1 6   ? -36.246 146.358 17.708  1.00 13.05 ? 6   TYR C N   1 
ATOM 3623  C CA  . TYR C 1 6   ? -35.172 146.300 18.689  1.00 12.17 ? 6   TYR C CA  1 
ATOM 3624  C C   . TYR C 1 6   ? -35.402 147.474 19.641  1.00 15.16 ? 6   TYR C C   1 
ATOM 3625  O O   . TYR C 1 6   ? -36.211 148.364 19.347  1.00 16.22 ? 6   TYR C O   1 
ATOM 3626  C CB  . TYR C 1 6   ? -33.809 146.413 17.992  1.00 9.29  ? 6   TYR C CB  1 
ATOM 3627  C CG  . TYR C 1 6   ? -32.641 145.924 18.819  1.00 7.47  ? 6   TYR C CG  1 
ATOM 3628  C CD1 . TYR C 1 6   ? -32.652 144.655 19.397  1.00 4.03  ? 6   TYR C CD1 1 
ATOM 3629  C CD2 . TYR C 1 6   ? -31.521 146.731 19.021  1.00 7.91  ? 6   TYR C CD2 1 
ATOM 3630  C CE1 . TYR C 1 6   ? -31.574 144.199 20.158  1.00 2.00  ? 6   TYR C CE1 1 
ATOM 3631  C CE2 . TYR C 1 6   ? -30.440 146.286 19.779  1.00 5.95  ? 6   TYR C CE2 1 
ATOM 3632  C CZ  . TYR C 1 6   ? -30.472 145.019 20.346  1.00 3.61  ? 6   TYR C CZ  1 
ATOM 3633  O OH  . TYR C 1 6   ? -29.412 144.576 21.111  1.00 4.63  ? 6   TYR C OH  1 
ATOM 3634  N N   . TRP C 1 7   ? -34.730 147.460 20.791  1.00 16.14 ? 7   TRP C N   1 
ATOM 3635  C CA  . TRP C 1 7   ? -34.895 148.529 21.774  1.00 18.24 ? 7   TRP C CA  1 
ATOM 3636  C C   . TRP C 1 7   ? -34.408 149.853 21.183  1.00 18.27 ? 7   TRP C C   1 
ATOM 3637  O O   . TRP C 1 7   ? -33.725 149.859 20.142  1.00 17.78 ? 7   TRP C O   1 
ATOM 3638  C CB  . TRP C 1 7   ? -34.118 148.227 23.063  1.00 16.28 ? 7   TRP C CB  1 
ATOM 3639  C CG  . TRP C 1 7   ? -33.913 146.767 23.398  1.00 17.27 ? 7   TRP C CG  1 
ATOM 3640  C CD1 . TRP C 1 7   ? -32.915 145.955 22.935  1.00 20.40 ? 7   TRP C CD1 1 
ATOM 3641  C CD2 . TRP C 1 7   ? -34.655 145.988 24.327  1.00 17.60 ? 7   TRP C CD2 1 
ATOM 3642  N NE1 . TRP C 1 7   ? -32.980 144.727 23.542  1.00 17.54 ? 7   TRP C NE1 1 
ATOM 3643  C CE2 . TRP C 1 7   ? -34.021 144.716 24.413  1.00 17.73 ? 7   TRP C CE2 1 
ATOM 3644  C CE3 . TRP C 1 7   ? -35.775 146.239 25.148  1.00 18.74 ? 7   TRP C CE3 1 
ATOM 3645  C CZ2 . TRP C 1 7   ? -34.505 143.700 25.256  1.00 15.47 ? 7   TRP C CZ2 1 
ATOM 3646  C CZ3 . TRP C 1 7   ? -36.241 145.227 25.990  1.00 14.74 ? 7   TRP C CZ3 1 
ATOM 3647  C CH2 . TRP C 1 7   ? -35.604 143.974 26.034  1.00 16.90 ? 7   TRP C CH2 1 
ATOM 3648  N N   . ASP C 1 8   ? -34.675 150.963 21.864  1.00 18.43 ? 8   ASP C N   1 
ATOM 3649  C CA  . ASP C 1 8   ? -34.234 152.285 21.411  1.00 17.25 ? 8   ASP C CA  1 
ATOM 3650  C C   . ASP C 1 8   ? -32.726 152.470 21.589  1.00 21.35 ? 8   ASP C C   1 
ATOM 3651  O O   . ASP C 1 8   ? -32.222 153.596 21.635  1.00 25.80 ? 8   ASP C O   1 
ATOM 3652  C CB  . ASP C 1 8   ? -35.000 153.393 22.144  1.00 22.04 ? 8   ASP C CB  1 
ATOM 3653  C CG  . ASP C 1 8   ? -34.898 153.280 23.653  1.00 19.58 ? 8   ASP C CG  1 
ATOM 3654  O OD1 . ASP C 1 8   ? -33.936 153.825 24.232  1.00 23.32 ? 8   ASP C OD1 1 
ATOM 3655  O OD2 . ASP C 1 8   ? -35.787 152.656 24.264  1.00 14.16 ? 8   ASP C OD2 1 
ATOM 3656  N N   . ILE C 1 9   ? -32.016 151.349 21.683  1.00 21.08 ? 9   ILE C N   1 
ATOM 3657  C CA  . ILE C 1 9   ? -30.573 151.322 21.856  1.00 17.64 ? 9   ILE C CA  1 
ATOM 3658  C C   . ILE C 1 9   ? -29.924 150.843 20.559  1.00 14.94 ? 9   ILE C C   1 
ATOM 3659  O O   . ILE C 1 9   ? -30.432 149.932 19.901  1.00 15.70 ? 9   ILE C O   1 
ATOM 3660  C CB  . ILE C 1 9   ? -30.164 150.360 23.012  1.00 15.87 ? 9   ILE C CB  1 
ATOM 3661  C CG1 . ILE C 1 9   ? -30.444 150.991 24.382  1.00 16.79 ? 9   ILE C CG1 1 
ATOM 3662  C CG2 . ILE C 1 9   ? -28.696 149.995 22.907  1.00 15.53 ? 9   ILE C CG2 1 
ATOM 3663  C CD1 . ILE C 1 9   ? -31.867 150.838 24.879  1.00 16.57 ? 9   ILE C CD1 1 
ATOM 3664  N N   . ARG C 1 10  ? -28.812 151.483 20.190  1.00 13.04 ? 10  ARG C N   1 
ATOM 3665  C CA  . ARG C 1 10  ? -28.021 151.163 19.021  1.00 9.66  ? 10  ARG C CA  1 
ATOM 3666  C C   . ARG C 1 10  ? -27.777 149.655 18.991  1.00 10.01 ? 10  ARG C C   1 
ATOM 3667  O O   . ARG C 1 10  ? -28.283 148.950 18.120  1.00 9.05  ? 10  ARG C O   1 
ATOM 3668  C CB  . ARG C 1 10  ? -26.704 151.937 19.109  1.00 8.81  ? 10  ARG C CB  1 
ATOM 3669  C CG  . ARG C 1 10  ? -25.541 151.413 18.289  1.00 11.24 ? 10  ARG C CG  1 
ATOM 3670  C CD  . ARG C 1 10  ? -24.256 152.043 18.807  1.00 13.19 ? 10  ARG C CD  1 
ATOM 3671  N NE  . ARG C 1 10  ? -23.064 151.633 18.075  1.00 11.11 ? 10  ARG C NE  1 
ATOM 3672  C CZ  . ARG C 1 10  ? -22.323 152.459 17.343  1.00 6.24  ? 10  ARG C CZ  1 
ATOM 3673  N NH1 . ARG C 1 10  ? -22.658 153.736 17.242  1.00 3.36  ? 10  ARG C NH1 1 
ATOM 3674  N NH2 . ARG C 1 10  ? -21.232 152.016 16.735  1.00 8.93  ? 10  ARG C NH2 1 
ATOM 3675  N N   . GLY C 1 11  ? -27.005 149.175 19.958  1.00 10.14 ? 11  GLY C N   1 
ATOM 3676  C CA  . GLY C 1 11  ? -26.703 147.757 20.082  1.00 9.01  ? 11  GLY C CA  1 
ATOM 3677  C C   . GLY C 1 11  ? -26.492 146.919 18.832  1.00 9.09  ? 11  GLY C C   1 
ATOM 3678  O O   . GLY C 1 11  ? -25.803 147.325 17.893  1.00 9.80  ? 11  GLY C O   1 
ATOM 3679  N N   . LEU C 1 12  ? -27.090 145.732 18.840  1.00 7.08  ? 12  LEU C N   1 
ATOM 3680  C CA  . LEU C 1 12  ? -26.989 144.778 17.738  1.00 8.14  ? 12  LEU C CA  1 
ATOM 3681  C C   . LEU C 1 12  ? -27.662 145.249 16.457  1.00 8.38  ? 12  LEU C C   1 
ATOM 3682  O O   . LEU C 1 12  ? -27.437 144.698 15.378  1.00 9.94  ? 12  LEU C O   1 
ATOM 3683  C CB  . LEU C 1 12  ? -27.590 143.441 18.162  1.00 8.31  ? 12  LEU C CB  1 
ATOM 3684  C CG  . LEU C 1 12  ? -26.813 142.694 19.249  1.00 8.79  ? 12  LEU C CG  1 
ATOM 3685  C CD1 . LEU C 1 12  ? -27.648 141.548 19.785  1.00 6.85  ? 12  LEU C CD1 1 
ATOM 3686  C CD2 . LEU C 1 12  ? -25.482 142.189 18.691  1.00 2.75  ? 12  LEU C CD2 1 
ATOM 3687  N N   . ALA C 1 13  ? -28.497 146.267 16.580  1.00 5.89  ? 13  ALA C N   1 
ATOM 3688  C CA  . ALA C 1 13  ? -29.197 146.784 15.428  1.00 4.48  ? 13  ALA C CA  1 
ATOM 3689  C C   . ALA C 1 13  ? -28.297 147.605 14.530  1.00 3.13  ? 13  ALA C C   1 
ATOM 3690  O O   . ALA C 1 13  ? -28.083 147.201 13.389  1.00 5.19  ? 13  ALA C O   1 
ATOM 3691  C CB  . ALA C 1 13  ? -30.410 147.590 15.864  1.00 4.74  ? 13  ALA C CB  1 
ATOM 3692  N N   . HIS C 1 14  ? -27.733 148.696 15.035  1.00 3.11  ? 14  HIS C N   1 
ATOM 3693  C CA  . HIS C 1 14  ? -26.874 149.629 14.283  1.00 5.47  ? 14  HIS C CA  1 
ATOM 3694  C C   . HIS C 1 14  ? -26.377 149.246 12.885  1.00 7.81  ? 14  HIS C C   1 
ATOM 3695  O O   . HIS C 1 14  ? -26.409 150.082 11.978  1.00 9.03  ? 14  HIS C O   1 
ATOM 3696  C CB  . HIS C 1 14  ? -25.681 150.102 15.115  1.00 5.19  ? 14  HIS C CB  1 
ATOM 3697  C CG  . HIS C 1 14  ? -24.988 151.293 14.529  1.00 5.91  ? 14  HIS C CG  1 
ATOM 3698  N ND1 . HIS C 1 14  ? -25.392 152.587 14.785  1.00 6.14  ? 14  HIS C ND1 1 
ATOM 3699  C CD2 . HIS C 1 14  ? -23.958 151.388 13.654  1.00 5.71  ? 14  HIS C CD2 1 
ATOM 3700  C CE1 . HIS C 1 14  ? -24.644 153.426 14.091  1.00 5.07  ? 14  HIS C CE1 1 
ATOM 3701  N NE2 . HIS C 1 14  ? -23.765 152.725 13.397  1.00 5.40  ? 14  HIS C NE2 1 
ATOM 3702  N N   . ALA C 1 15  ? -25.833 148.032 12.729  1.00 6.21  ? 15  ALA C N   1 
ATOM 3703  C CA  . ALA C 1 15  ? -25.363 147.574 11.430  1.00 6.50  ? 15  ALA C CA  1 
ATOM 3704  C C   . ALA C 1 15  ? -26.540 147.578 10.454  1.00 8.36  ? 15  ALA C C   1 
ATOM 3705  O O   . ALA C 1 15  ? -26.510 148.252 9.419   1.00 7.70  ? 15  ALA C O   1 
ATOM 3706  C CB  . ALA C 1 15  ? -24.775 146.167 11.554  1.00 6.14  ? 15  ALA C CB  1 
ATOM 3707  N N   . ILE C 1 16  ? -27.589 146.858 10.823  1.00 6.86  ? 16  ILE C N   1 
ATOM 3708  C CA  . ILE C 1 16  ? -28.822 146.730 10.071  1.00 6.95  ? 16  ILE C CA  1 
ATOM 3709  C C   . ILE C 1 16  ? -29.233 148.076 9.492   1.00 9.69  ? 16  ILE C C   1 
ATOM 3710  O O   . ILE C 1 16  ? -29.378 148.224 8.285   1.00 10.21 ? 16  ILE C O   1 
ATOM 3711  C CB  . ILE C 1 16  ? -29.992 146.247 10.975  1.00 4.10  ? 16  ILE C CB  1 
ATOM 3712  C CG1 . ILE C 1 16  ? -29.591 145.004 11.775  1.00 4.21  ? 16  ILE C CG1 1 
ATOM 3713  C CG2 . ILE C 1 16  ? -31.233 145.972 10.147  1.00 8.15  ? 16  ILE C CG2 1 
ATOM 3714  C CD1 . ILE C 1 16  ? -29.175 143.813 10.948  1.00 7.55  ? 16  ILE C CD1 1 
ATOM 3715  N N   . ARG C 1 17  ? -29.388 149.059 10.368  1.00 12.41 ? 17  ARG C N   1 
ATOM 3716  C CA  . ARG C 1 17  ? -29.807 150.403 9.982   1.00 16.22 ? 17  ARG C CA  1 
ATOM 3717  C C   . ARG C 1 17  ? -28.920 151.043 8.928   1.00 17.55 ? 17  ARG C C   1 
ATOM 3718  O O   . ARG C 1 17  ? -29.402 151.771 8.060   1.00 17.91 ? 17  ARG C O   1 
ATOM 3719  C CB  . ARG C 1 17  ? -29.883 151.296 11.217  1.00 15.75 ? 17  ARG C CB  1 
ATOM 3720  C CG  . ARG C 1 17  ? -30.804 150.740 12.280  1.00 18.55 ? 17  ARG C CG  1 
ATOM 3721  C CD  . ARG C 1 17  ? -30.792 151.598 13.514  1.00 19.17 ? 17  ARG C CD  1 
ATOM 3722  N NE  . ARG C 1 17  ? -31.523 150.961 14.602  1.00 15.33 ? 17  ARG C NE  1 
ATOM 3723  C CZ  . ARG C 1 17  ? -31.066 150.852 15.844  1.00 15.07 ? 17  ARG C CZ  1 
ATOM 3724  N NH1 . ARG C 1 17  ? -29.870 151.339 16.154  1.00 15.18 ? 17  ARG C NH1 1 
ATOM 3725  N NH2 . ARG C 1 17  ? -31.805 150.261 16.775  1.00 11.98 ? 17  ARG C NH2 1 
ATOM 3726  N N   . LEU C 1 18  ? -27.621 150.784 9.013   1.00 19.92 ? 18  LEU C N   1 
ATOM 3727  C CA  . LEU C 1 18  ? -26.675 151.327 8.045   1.00 18.52 ? 18  LEU C CA  1 
ATOM 3728  C C   . LEU C 1 18  ? -26.962 150.665 6.710   1.00 18.24 ? 18  LEU C C   1 
ATOM 3729  O O   . LEU C 1 18  ? -26.978 151.312 5.664   1.00 22.54 ? 18  LEU C O   1 
ATOM 3730  C CB  . LEU C 1 18  ? -25.234 151.009 8.458   1.00 16.53 ? 18  LEU C CB  1 
ATOM 3731  C CG  . LEU C 1 18  ? -24.693 151.578 9.769   1.00 10.66 ? 18  LEU C CG  1 
ATOM 3732  C CD1 . LEU C 1 18  ? -23.335 150.966 10.050  1.00 5.04  ? 18  LEU C CD1 1 
ATOM 3733  C CD2 . LEU C 1 18  ? -24.606 153.096 9.693   1.00 7.78  ? 18  LEU C CD2 1 
ATOM 3734  N N   . LEU C 1 19  ? -27.192 149.361 6.762   1.00 13.15 ? 19  LEU C N   1 
ATOM 3735  C CA  . LEU C 1 19  ? -27.481 148.597 5.562   1.00 15.60 ? 19  LEU C CA  1 
ATOM 3736  C C   . LEU C 1 19  ? -28.743 149.124 4.883   1.00 16.60 ? 19  LEU C C   1 
ATOM 3737  O O   . LEU C 1 19  ? -28.666 149.651 3.774   1.00 14.22 ? 19  LEU C O   1 
ATOM 3738  C CB  . LEU C 1 19  ? -27.646 147.121 5.909   1.00 11.03 ? 19  LEU C CB  1 
ATOM 3739  C CG  . LEU C 1 19  ? -27.488 146.152 4.747   1.00 8.80  ? 19  LEU C CG  1 
ATOM 3740  C CD1 . LEU C 1 19  ? -26.159 146.388 4.048   1.00 5.89  ? 19  LEU C CD1 1 
ATOM 3741  C CD2 . LEU C 1 19  ? -27.564 144.737 5.279   1.00 10.84 ? 19  LEU C CD2 1 
ATOM 3742  N N   . LEU C 1 20  ? -29.878 149.017 5.574   1.00 17.27 ? 20  LEU C N   1 
ATOM 3743  C CA  . LEU C 1 20  ? -31.171 149.472 5.064   1.00 14.06 ? 20  LEU C CA  1 
ATOM 3744  C C   . LEU C 1 20  ? -31.093 150.836 4.374   1.00 16.53 ? 20  LEU C C   1 
ATOM 3745  O O   . LEU C 1 20  ? -31.497 150.970 3.217   1.00 17.86 ? 20  LEU C O   1 
ATOM 3746  C CB  . LEU C 1 20  ? -32.205 149.535 6.191   1.00 11.71 ? 20  LEU C CB  1 
ATOM 3747  C CG  . LEU C 1 20  ? -32.587 148.226 6.882   1.00 13.17 ? 20  LEU C CG  1 
ATOM 3748  C CD1 . LEU C 1 20  ? -33.456 148.518 8.086   1.00 11.52 ? 20  LEU C CD1 1 
ATOM 3749  C CD2 . LEU C 1 20  ? -33.303 147.302 5.918   1.00 12.85 ? 20  LEU C CD2 1 
ATOM 3750  N N   . GLU C 1 21  ? -30.589 151.848 5.074   1.00 16.68 ? 21  GLU C N   1 
ATOM 3751  C CA  . GLU C 1 21  ? -30.470 153.181 4.485   1.00 19.27 ? 21  GLU C CA  1 
ATOM 3752  C C   . GLU C 1 21  ? -29.596 153.148 3.227   1.00 20.43 ? 21  GLU C C   1 
ATOM 3753  O O   . GLU C 1 21  ? -29.864 153.859 2.255   1.00 23.48 ? 21  GLU C O   1 
ATOM 3754  C CB  . GLU C 1 21  ? -29.923 154.184 5.507   1.00 19.91 ? 21  GLU C CB  1 
ATOM 3755  C CG  . GLU C 1 21  ? -30.955 154.630 6.535   1.00 21.57 ? 21  GLU C CG  1 
ATOM 3756  C CD  . GLU C 1 21  ? -32.097 155.447 5.927   1.00 19.22 ? 21  GLU C CD  1 
ATOM 3757  O OE1 . GLU C 1 21  ? -31.837 156.329 5.081   1.00 20.81 ? 21  GLU C OE1 1 
ATOM 3758  O OE2 . GLU C 1 21  ? -33.262 155.226 6.309   1.00 14.54 ? 21  GLU C OE2 1 
ATOM 3759  N N   . TYR C 1 22  ? -28.580 152.290 3.238   1.00 18.84 ? 22  TYR C N   1 
ATOM 3760  C CA  . TYR C 1 22  ? -27.688 152.147 2.100   1.00 17.78 ? 22  TYR C CA  1 
ATOM 3761  C C   . TYR C 1 22  ? -28.435 151.504 0.929   1.00 17.87 ? 22  TYR C C   1 
ATOM 3762  O O   . TYR C 1 22  ? -28.342 151.955 -0.215  1.00 16.83 ? 22  TYR C O   1 
ATOM 3763  C CB  . TYR C 1 22  ? -26.484 151.287 2.492   1.00 17.09 ? 22  TYR C CB  1 
ATOM 3764  C CG  . TYR C 1 22  ? -25.606 150.849 1.335   1.00 19.10 ? 22  TYR C CG  1 
ATOM 3765  C CD1 . TYR C 1 22  ? -24.701 151.732 0.745   1.00 16.01 ? 22  TYR C CD1 1 
ATOM 3766  C CD2 . TYR C 1 22  ? -25.668 149.545 0.844   1.00 17.36 ? 22  TYR C CD2 1 
ATOM 3767  C CE1 . TYR C 1 22  ? -23.879 151.324 -0.298  1.00 16.81 ? 22  TYR C CE1 1 
ATOM 3768  C CE2 . TYR C 1 22  ? -24.854 149.128 -0.195  1.00 13.27 ? 22  TYR C CE2 1 
ATOM 3769  C CZ  . TYR C 1 22  ? -23.963 150.020 -0.764  1.00 14.71 ? 22  TYR C CZ  1 
ATOM 3770  O OH  . TYR C 1 22  ? -23.155 149.601 -1.796  1.00 15.32 ? 22  TYR C OH  1 
ATOM 3771  N N   . THR C 1 23  ? -29.204 150.466 1.233   1.00 17.84 ? 23  THR C N   1 
ATOM 3772  C CA  . THR C 1 23  ? -29.950 149.743 0.214   1.00 17.79 ? 23  THR C CA  1 
ATOM 3773  C C   . THR C 1 23  ? -31.325 150.315 -0.080  1.00 18.18 ? 23  THR C C   1 
ATOM 3774  O O   . THR C 1 23  ? -32.142 149.659 -0.774  1.00 21.53 ? 23  THR C O   1 
ATOM 3775  C CB  . THR C 1 23  ? -30.041 148.236 0.577   1.00 16.41 ? 23  THR C CB  1 
ATOM 3776  O OG1 . THR C 1 23  ? -30.572 148.074 1.902   1.00 15.77 ? 23  THR C OG1 1 
ATOM 3777  C CG2 . THR C 1 23  ? -28.668 147.604 0.525   1.00 11.68 ? 23  THR C CG2 1 
ATOM 3778  N N   . ASP C 1 24  ? -31.617 151.511 0.447   1.00 19.75 ? 24  ASP C N   1 
ATOM 3779  C CA  . ASP C 1 24  ? -32.904 152.197 0.266   1.00 20.90 ? 24  ASP C CA  1 
ATOM 3780  C C   . ASP C 1 24  ? -34.121 151.317 0.558   1.00 21.15 ? 24  ASP C C   1 
ATOM 3781  O O   . ASP C 1 24  ? -35.219 151.555 0.037   1.00 19.12 ? 24  ASP C O   1 
ATOM 3782  C CB  . ASP C 1 24  ? -33.016 152.782 -1.144  1.00 19.34 ? 24  ASP C CB  1 
ATOM 3783  C CG  . ASP C 1 24  ? -32.283 154.090 -1.289  1.00 15.25 ? 24  ASP C CG  1 
ATOM 3784  O OD1 . ASP C 1 24  ? -31.041 154.104 -1.163  1.00 15.94 ? 24  ASP C OD1 1 
ATOM 3785  O OD2 . ASP C 1 24  ? -32.959 155.109 -1.535  1.00 16.32 ? 24  ASP C OD2 1 
ATOM 3786  N N   . SER C 1 25  ? -33.925 150.315 1.410   1.00 21.15 ? 25  SER C N   1 
ATOM 3787  C CA  . SER C 1 25  ? -34.982 149.386 1.781   1.00 19.89 ? 25  SER C CA  1 
ATOM 3788  C C   . SER C 1 25  ? -36.090 150.101 2.545   1.00 19.84 ? 25  SER C C   1 
ATOM 3789  O O   . SER C 1 25  ? -35.897 150.490 3.696   1.00 20.99 ? 25  SER C O   1 
ATOM 3790  C CB  . SER C 1 25  ? -34.394 148.269 2.633   1.00 19.86 ? 25  SER C CB  1 
ATOM 3791  O OG  . SER C 1 25  ? -33.354 147.614 1.933   1.00 17.85 ? 25  SER C OG  1 
ATOM 3792  N N   . SER C 1 26  ? -37.233 150.297 1.889   1.00 17.31 ? 26  SER C N   1 
ATOM 3793  C CA  . SER C 1 26  ? -38.371 150.971 2.507   1.00 18.67 ? 26  SER C CA  1 
ATOM 3794  C C   . SER C 1 26  ? -38.677 150.302 3.839   1.00 20.30 ? 26  SER C C   1 
ATOM 3795  O O   . SER C 1 26  ? -39.168 149.169 3.875   1.00 20.28 ? 26  SER C O   1 
ATOM 3796  C CB  . SER C 1 26  ? -39.599 150.911 1.588   1.00 18.44 ? 26  SER C CB  1 
ATOM 3797  O OG  . SER C 1 26  ? -40.055 149.581 1.403   1.00 19.68 ? 26  SER C OG  1 
ATOM 3798  N N   . TYR C 1 27  ? -38.399 151.007 4.929   1.00 20.84 ? 27  TYR C N   1 
ATOM 3799  C CA  . TYR C 1 27  ? -38.625 150.436 6.239   1.00 20.07 ? 27  TYR C CA  1 
ATOM 3800  C C   . TYR C 1 27  ? -39.252 151.369 7.261   1.00 19.28 ? 27  TYR C C   1 
ATOM 3801  O O   . TYR C 1 27  ? -39.448 152.557 7.012   1.00 18.62 ? 27  TYR C O   1 
ATOM 3802  C CB  . TYR C 1 27  ? -37.312 149.856 6.786   1.00 18.16 ? 27  TYR C CB  1 
ATOM 3803  C CG  . TYR C 1 27  ? -36.267 150.875 7.217   1.00 16.36 ? 27  TYR C CG  1 
ATOM 3804  C CD1 . TYR C 1 27  ? -35.541 151.613 6.280   1.00 15.90 ? 27  TYR C CD1 1 
ATOM 3805  C CD2 . TYR C 1 27  ? -35.979 151.069 8.571   1.00 16.96 ? 27  TYR C CD2 1 
ATOM 3806  C CE1 . TYR C 1 27  ? -34.555 152.511 6.679   1.00 15.29 ? 27  TYR C CE1 1 
ATOM 3807  C CE2 . TYR C 1 27  ? -34.997 151.963 8.979   1.00 14.53 ? 27  TYR C CE2 1 
ATOM 3808  C CZ  . TYR C 1 27  ? -34.289 152.678 8.031   1.00 16.42 ? 27  TYR C CZ  1 
ATOM 3809  O OH  . TYR C 1 27  ? -33.308 153.547 8.445   1.00 15.10 ? 27  TYR C OH  1 
ATOM 3810  N N   . GLU C 1 28  ? -39.590 150.781 8.400   1.00 19.76 ? 28  GLU C N   1 
ATOM 3811  C CA  . GLU C 1 28  ? -40.180 151.458 9.547   1.00 22.83 ? 28  GLU C CA  1 
ATOM 3812  C C   . GLU C 1 28  ? -39.543 150.727 10.721  1.00 24.74 ? 28  GLU C C   1 
ATOM 3813  O O   . GLU C 1 28  ? -39.065 149.581 10.556  1.00 23.54 ? 28  GLU C O   1 
ATOM 3814  C CB  . GLU C 1 28  ? -41.693 151.219 9.611   1.00 25.23 ? 28  GLU C CB  1 
ATOM 3815  C CG  . GLU C 1 28  ? -42.525 151.898 8.542   1.00 27.87 ? 28  GLU C CG  1 
ATOM 3816  C CD  . GLU C 1 28  ? -44.005 151.589 8.700   1.00 27.94 ? 28  GLU C CD  1 
ATOM 3817  O OE1 . GLU C 1 28  ? -44.587 151.953 9.748   1.00 28.15 ? 28  GLU C OE1 1 
ATOM 3818  O OE2 . GLU C 1 28  ? -44.582 150.968 7.782   1.00 27.25 ? 28  GLU C OE2 1 
ATOM 3819  N N   . GLU C 1 29  ? -39.545 151.338 11.901  1.00 24.01 ? 29  GLU C N   1 
ATOM 3820  C CA  . GLU C 1 29  ? -38.949 150.676 13.052  1.00 23.07 ? 29  GLU C CA  1 
ATOM 3821  C C   . GLU C 1 29  ? -39.787 150.667 14.308  1.00 23.08 ? 29  GLU C C   1 
ATOM 3822  O O   . GLU C 1 29  ? -40.323 151.689 14.736  1.00 23.17 ? 29  GLU C O   1 
ATOM 3823  C CB  . GLU C 1 29  ? -37.557 151.223 13.366  1.00 21.92 ? 29  GLU C CB  1 
ATOM 3824  C CG  . GLU C 1 29  ? -37.433 152.726 13.334  1.00 20.71 ? 29  GLU C CG  1 
ATOM 3825  C CD  . GLU C 1 29  ? -36.983 153.225 11.987  1.00 19.27 ? 29  GLU C CD  1 
ATOM 3826  O OE1 . GLU C 1 29  ? -35.754 153.307 11.769  1.00 19.51 ? 29  GLU C OE1 1 
ATOM 3827  O OE2 . GLU C 1 29  ? -37.855 153.534 11.149  1.00 18.16 ? 29  GLU C OE2 1 
ATOM 3828  N N   . LYS C 1 30  ? -39.894 149.475 14.879  1.00 23.13 ? 30  LYS C N   1 
ATOM 3829  C CA  . LYS C 1 30  ? -40.626 149.235 16.111  1.00 25.37 ? 30  LYS C CA  1 
ATOM 3830  C C   . LYS C 1 30  ? -39.575 149.425 17.196  1.00 25.20 ? 30  LYS C C   1 
ATOM 3831  O O   . LYS C 1 30  ? -38.634 148.631 17.306  1.00 27.88 ? 30  LYS C O   1 
ATOM 3832  C CB  . LYS C 1 30  ? -41.144 147.792 16.134  1.00 27.68 ? 30  LYS C CB  1 
ATOM 3833  C CG  . LYS C 1 30  ? -42.205 147.532 17.181  1.00 27.57 ? 30  LYS C CG  1 
ATOM 3834  C CD  . LYS C 1 30  ? -43.518 148.218 16.820  1.00 28.01 ? 30  LYS C CD  1 
ATOM 3835  C CE  . LYS C 1 30  ? -44.189 147.549 15.627  1.00 28.04 ? 30  LYS C CE  1 
ATOM 3836  N NZ  . LYS C 1 30  ? -44.614 146.157 15.943  1.00 28.11 ? 30  LYS C NZ  1 
ATOM 3837  N N   . LYS C 1 31  ? -39.716 150.492 17.970  1.00 24.17 ? 31  LYS C N   1 
ATOM 3838  C CA  . LYS C 1 31  ? -38.752 150.796 19.014  1.00 23.19 ? 31  LYS C CA  1 
ATOM 3839  C C   . LYS C 1 31  ? -39.312 150.482 20.393  1.00 23.09 ? 31  LYS C C   1 
ATOM 3840  O O   . LYS C 1 31  ? -40.352 151.008 20.794  1.00 27.58 ? 31  LYS C O   1 
ATOM 3841  C CB  . LYS C 1 31  ? -38.369 152.265 18.914  1.00 21.48 ? 31  LYS C CB  1 
ATOM 3842  C CG  . LYS C 1 31  ? -36.988 152.600 19.413  1.00 18.20 ? 31  LYS C CG  1 
ATOM 3843  C CD  . LYS C 1 31  ? -36.570 153.964 18.892  1.00 15.01 ? 31  LYS C CD  1 
ATOM 3844  C CE  . LYS C 1 31  ? -36.420 153.944 17.373  1.00 16.94 ? 31  LYS C CE  1 
ATOM 3845  N NZ  . LYS C 1 31  ? -36.363 155.314 16.799  1.00 14.91 ? 31  LYS C NZ  1 
ATOM 3846  N N   . TYR C 1 32  ? -38.635 149.611 21.110  1.00 22.02 ? 32  TYR C N   1 
ATOM 3847  C CA  . TYR C 1 32  ? -39.071 149.209 22.447  1.00 22.09 ? 32  TYR C CA  1 
ATOM 3848  C C   . TYR C 1 32  ? -38.252 149.947 23.503  1.00 22.20 ? 32  TYR C C   1 
ATOM 3849  O O   . TYR C 1 32  ? -37.022 150.026 23.421  1.00 21.18 ? 32  TYR C O   1 
ATOM 3850  C CB  . TYR C 1 32  ? -38.964 147.687 22.645  1.00 19.47 ? 32  TYR C CB  1 
ATOM 3851  C CG  . TYR C 1 32  ? -39.835 146.865 21.706  1.00 20.20 ? 32  TYR C CG  1 
ATOM 3852  C CD1 . TYR C 1 32  ? -41.227 146.912 21.786  1.00 21.90 ? 32  TYR C CD1 1 
ATOM 3853  C CD2 . TYR C 1 32  ? -39.262 146.035 20.741  1.00 22.37 ? 32  TYR C CD2 1 
ATOM 3854  C CE1 . TYR C 1 32  ? -42.025 146.156 20.932  1.00 20.96 ? 32  TYR C CE1 1 
ATOM 3855  C CE2 . TYR C 1 32  ? -40.049 145.276 19.886  1.00 23.48 ? 32  TYR C CE2 1 
ATOM 3856  C CZ  . TYR C 1 32  ? -41.428 145.341 19.987  1.00 21.57 ? 32  TYR C CZ  1 
ATOM 3857  O OH  . TYR C 1 32  ? -42.210 144.591 19.146  1.00 18.16 ? 32  TYR C OH  1 
ATOM 3858  N N   . THR C 1 33  ? -38.950 150.495 24.488  1.00 22.10 ? 33  THR C N   1 
ATOM 3859  C CA  . THR C 1 33  ? -38.320 151.252 25.555  1.00 20.26 ? 33  THR C CA  1 
ATOM 3860  C C   . THR C 1 33  ? -37.788 150.398 26.696  1.00 22.92 ? 33  THR C C   1 
ATOM 3861  O O   . THR C 1 33  ? -38.448 149.456 27.137  1.00 22.87 ? 33  THR C O   1 
ATOM 3862  C CB  . THR C 1 33  ? -39.304 152.266 26.142  1.00 18.61 ? 33  THR C CB  1 
ATOM 3863  O OG1 . THR C 1 33  ? -40.117 152.797 25.090  1.00 21.30 ? 33  THR C OG1 1 
ATOM 3864  C CG2 . THR C 1 33  ? -38.554 153.403 26.810  1.00 18.79 ? 33  THR C CG2 1 
ATOM 3865  N N   . MET C 1 34  ? -36.598 150.750 27.168  1.00 22.66 ? 34  MET C N   1 
ATOM 3866  C CA  . MET C 1 34  ? -35.962 150.064 28.279  1.00 22.72 ? 34  MET C CA  1 
ATOM 3867  C C   . MET C 1 34  ? -36.503 150.726 29.542  1.00 24.56 ? 34  MET C C   1 
ATOM 3868  O O   . MET C 1 34  ? -36.674 151.941 29.577  1.00 20.00 ? 34  MET C O   1 
ATOM 3869  C CB  . MET C 1 34  ? -34.442 150.255 28.203  1.00 25.54 ? 34  MET C CB  1 
ATOM 3870  C CG  . MET C 1 34  ? -33.624 148.984 27.990  1.00 24.63 ? 34  MET C CG  1 
ATOM 3871  S SD  . MET C 1 34  ? -33.295 148.045 29.495  1.00 28.24 ? 34  MET C SD  1 
ATOM 3872  C CE  . MET C 1 34  ? -34.398 146.661 29.302  1.00 23.86 ? 34  MET C CE  1 
ATOM 3873  N N   . GLY C 1 35  ? -36.810 149.930 30.560  1.00 27.42 ? 35  GLY C N   1 
ATOM 3874  C CA  . GLY C 1 35  ? -37.316 150.486 31.803  1.00 31.66 ? 35  GLY C CA  1 
ATOM 3875  C C   . GLY C 1 35  ? -36.189 150.720 32.795  1.00 32.68 ? 35  GLY C C   1 
ATOM 3876  O O   . GLY C 1 35  ? -35.015 150.542 32.462  1.00 33.83 ? 35  GLY C O   1 
ATOM 3877  N N   . ASP C 1 36  ? -36.539 151.107 34.018  1.00 32.12 ? 36  ASP C N   1 
ATOM 3878  C CA  . ASP C 1 36  ? -35.538 151.350 35.053  1.00 32.02 ? 36  ASP C CA  1 
ATOM 3879  C C   . ASP C 1 36  ? -35.791 150.505 36.303  1.00 33.77 ? 36  ASP C C   1 
ATOM 3880  O O   . ASP C 1 36  ? -36.395 149.433 36.186  1.00 32.89 ? 36  ASP C O   1 
ATOM 3881  C CB  . ASP C 1 36  ? -35.464 152.841 35.389  1.00 32.18 ? 36  ASP C CB  1 
ATOM 3882  C CG  . ASP C 1 36  ? -34.659 153.622 34.370  1.00 35.76 ? 36  ASP C CG  1 
ATOM 3883  O OD1 . ASP C 1 36  ? -35.183 153.866 33.261  1.00 37.42 ? 36  ASP C OD1 1 
ATOM 3884  O OD2 . ASP C 1 36  ? -33.497 153.976 34.676  1.00 37.54 ? 36  ASP C OD2 1 
ATOM 3885  N N   . ALA C 1 37  ? -35.297 150.967 37.456  1.00 32.88 ? 37  ALA C N   1 
ATOM 3886  C CA  . ALA C 1 37  ? -35.456 150.270 38.739  1.00 30.22 ? 37  ALA C CA  1 
ATOM 3887  C C   . ALA C 1 37  ? -34.413 149.146 38.868  1.00 30.30 ? 37  ALA C C   1 
ATOM 3888  O O   . ALA C 1 37  ? -33.545 149.036 38.002  1.00 31.25 ? 37  ALA C O   1 
ATOM 3889  C CB  . ALA C 1 37  ? -36.911 149.725 38.871  1.00 29.69 ? 37  ALA C CB  1 
ATOM 3890  N N   . PRO C 1 38  ? -34.434 148.372 39.981  1.00 31.14 ? 38  PRO C N   1 
ATOM 3891  C CA  . PRO C 1 38  ? -33.474 147.272 40.184  1.00 29.41 ? 38  PRO C CA  1 
ATOM 3892  C C   . PRO C 1 38  ? -33.666 146.161 39.161  1.00 30.09 ? 38  PRO C C   1 
ATOM 3893  O O   . PRO C 1 38  ? -32.791 145.324 38.946  1.00 30.88 ? 38  PRO C O   1 
ATOM 3894  C CB  . PRO C 1 38  ? -33.815 146.779 41.592  1.00 29.48 ? 38  PRO C CB  1 
ATOM 3895  C CG  . PRO C 1 38  ? -35.268 147.104 41.724  1.00 29.09 ? 38  PRO C CG  1 
ATOM 3896  C CD  . PRO C 1 38  ? -35.309 148.479 41.176  1.00 29.24 ? 38  PRO C CD  1 
ATOM 3897  N N   . ASP C 1 39  ? -34.848 146.150 38.570  1.00 31.49 ? 39  ASP C N   1 
ATOM 3898  C CA  . ASP C 1 39  ? -35.229 145.188 37.559  1.00 31.55 ? 39  ASP C CA  1 
ATOM 3899  C C   . ASP C 1 39  ? -35.808 146.012 36.419  1.00 31.85 ? 39  ASP C C   1 
ATOM 3900  O O   . ASP C 1 39  ? -37.003 146.313 36.395  1.00 34.39 ? 39  ASP C O   1 
ATOM 3901  C CB  . ASP C 1 39  ? -36.269 144.217 38.125  1.00 31.98 ? 39  ASP C CB  1 
ATOM 3902  C CG  . ASP C 1 39  ? -37.020 144.787 39.316  1.00 33.36 ? 39  ASP C CG  1 
ATOM 3903  O OD1 . ASP C 1 39  ? -37.986 145.550 39.105  1.00 36.59 ? 39  ASP C OD1 1 
ATOM 3904  O OD2 . ASP C 1 39  ? -36.630 144.484 40.463  1.00 35.85 ? 39  ASP C OD2 1 
ATOM 3905  N N   . TYR C 1 40  ? -34.928 146.435 35.518  1.00 30.88 ? 40  TYR C N   1 
ATOM 3906  C CA  . TYR C 1 40  ? -35.307 147.253 34.371  1.00 27.33 ? 40  TYR C CA  1 
ATOM 3907  C C   . TYR C 1 40  ? -36.444 146.616 33.583  1.00 27.00 ? 40  TYR C C   1 
ATOM 3908  O O   . TYR C 1 40  ? -36.369 145.437 33.229  1.00 27.42 ? 40  TYR C O   1 
ATOM 3909  C CB  . TYR C 1 40  ? -34.088 147.473 33.465  1.00 25.48 ? 40  TYR C CB  1 
ATOM 3910  C CG  . TYR C 1 40  ? -32.879 148.008 34.207  1.00 25.46 ? 40  TYR C CG  1 
ATOM 3911  C CD1 . TYR C 1 40  ? -32.817 149.340 34.605  1.00 24.84 ? 40  TYR C CD1 1 
ATOM 3912  C CD2 . TYR C 1 40  ? -31.817 147.170 34.548  1.00 25.94 ? 40  TYR C CD2 1 
ATOM 3913  C CE1 . TYR C 1 40  ? -31.737 149.827 35.327  1.00 22.68 ? 40  TYR C CE1 1 
ATOM 3914  C CE2 . TYR C 1 40  ? -30.730 147.648 35.272  1.00 25.83 ? 40  TYR C CE2 1 
ATOM 3915  C CZ  . TYR C 1 40  ? -30.698 148.976 35.657  1.00 22.96 ? 40  TYR C CZ  1 
ATOM 3916  O OH  . TYR C 1 40  ? -29.624 149.449 36.375  1.00 18.36 ? 40  TYR C OH  1 
ATOM 3917  N N   . ASP C 1 41  ? -37.502 147.386 33.333  1.00 24.69 ? 41  ASP C N   1 
ATOM 3918  C CA  . ASP C 1 41  ? -38.662 146.882 32.589  1.00 25.22 ? 41  ASP C CA  1 
ATOM 3919  C C   . ASP C 1 41  ? -38.321 146.459 31.159  1.00 24.89 ? 41  ASP C C   1 
ATOM 3920  O O   . ASP C 1 41  ? -37.603 147.168 30.446  1.00 24.40 ? 41  ASP C O   1 
ATOM 3921  C CB  . ASP C 1 41  ? -39.774 147.936 32.504  1.00 25.35 ? 41  ASP C CB  1 
ATOM 3922  C CG  . ASP C 1 41  ? -40.322 148.346 33.859  1.00 24.24 ? 41  ASP C CG  1 
ATOM 3923  O OD1 . ASP C 1 41  ? -40.719 147.473 34.683  1.00 26.05 ? 41  ASP C OD1 1 
ATOM 3924  O OD2 . ASP C 1 41  ? -40.392 149.570 34.090  1.00 16.20 ? 41  ASP C OD2 1 
ATOM 3925  N N   . ARG C 1 42  ? -38.859 145.313 30.748  1.00 24.28 ? 42  ARG C N   1 
ATOM 3926  C CA  . ARG C 1 42  ? -38.670 144.773 29.398  1.00 24.90 ? 42  ARG C CA  1 
ATOM 3927  C C   . ARG C 1 42  ? -40.040 144.542 28.758  1.00 23.39 ? 42  ARG C C   1 
ATOM 3928  O O   . ARG C 1 42  ? -40.140 144.181 27.585  1.00 23.99 ? 42  ARG C O   1 
ATOM 3929  C CB  . ARG C 1 42  ? -37.981 143.414 29.453  1.00 26.64 ? 42  ARG C CB  1 
ATOM 3930  C CG  . ARG C 1 42  ? -36.499 143.384 29.709  1.00 29.29 ? 42  ARG C CG  1 
ATOM 3931  C CD  . ARG C 1 42  ? -36.094 141.918 29.702  1.00 27.98 ? 42  ARG C CD  1 
ATOM 3932  N NE  . ARG C 1 42  ? -34.654 141.689 29.688  1.00 28.29 ? 42  ARG C NE  1 
ATOM 3933  C CZ  . ARG C 1 42  ? -34.090 140.504 29.913  1.00 29.75 ? 42  ARG C CZ  1 
ATOM 3934  N NH1 . ARG C 1 42  ? -34.848 139.444 30.172  1.00 32.40 ? 42  ARG C NH1 1 
ATOM 3935  N NH2 . ARG C 1 42  ? -32.769 140.378 29.880  1.00 22.02 ? 42  ARG C NH2 1 
ATOM 3936  N N   . SER C 1 43  ? -41.088 144.710 29.558  1.00 21.73 ? 43  SER C N   1 
ATOM 3937  C CA  . SER C 1 43  ? -42.473 144.498 29.149  1.00 20.28 ? 43  SER C CA  1 
ATOM 3938  C C   . SER C 1 43  ? -42.891 144.918 27.737  1.00 20.70 ? 43  SER C C   1 
ATOM 3939  O O   . SER C 1 43  ? -43.599 144.171 27.072  1.00 16.17 ? 43  SER C O   1 
ATOM 3940  C CB  . SER C 1 43  ? -43.413 145.123 30.181  1.00 21.19 ? 43  SER C CB  1 
ATOM 3941  O OG  . SER C 1 43  ? -43.093 144.670 31.485  1.00 20.73 ? 43  SER C OG  1 
ATOM 3942  N N   . GLN C 1 44  ? -42.477 146.101 27.282  1.00 21.85 ? 44  GLN C N   1 
ATOM 3943  C CA  . GLN C 1 44  ? -42.839 146.565 25.937  1.00 18.22 ? 44  GLN C CA  1 
ATOM 3944  C C   . GLN C 1 44  ? -42.451 145.513 24.894  1.00 15.16 ? 44  GLN C C   1 
ATOM 3945  O O   . GLN C 1 44  ? -43.135 145.339 23.885  1.00 10.04 ? 44  GLN C O   1 
ATOM 3946  C CB  . GLN C 1 44  ? -42.174 147.916 25.610  1.00 16.45 ? 44  GLN C CB  1 
ATOM 3947  C CG  . GLN C 1 44  ? -43.161 149.103 25.501  1.00 16.97 ? 44  GLN C CG  1 
ATOM 3948  C CD  . GLN C 1 44  ? -42.930 149.985 24.261  1.00 22.11 ? 44  GLN C CD  1 
ATOM 3949  O OE1 . GLN C 1 44  ? -43.311 149.641 23.149  1.00 24.18 ? 44  GLN C OE1 1 
ATOM 3950  N NE2 . GLN C 1 44  ? -42.327 151.148 24.461  1.00 22.92 ? 44  GLN C NE2 1 
ATOM 3951  N N   . TRP C 1 45  ? -41.352 144.814 25.164  1.00 16.36 ? 45  TRP C N   1 
ATOM 3952  C CA  . TRP C 1 45  ? -40.848 143.759 24.292  1.00 17.60 ? 45  TRP C CA  1 
ATOM 3953  C C   . TRP C 1 45  ? -41.448 142.411 24.679  1.00 15.08 ? 45  TRP C C   1 
ATOM 3954  O O   . TRP C 1 45  ? -41.897 141.657 23.821  1.00 14.53 ? 45  TRP C O   1 
ATOM 3955  C CB  . TRP C 1 45  ? -39.318 143.699 24.356  1.00 16.45 ? 45  TRP C CB  1 
ATOM 3956  C CG  . TRP C 1 45  ? -38.748 142.409 23.865  1.00 13.88 ? 45  TRP C CG  1 
ATOM 3957  C CD1 . TRP C 1 45  ? -37.928 141.568 24.553  1.00 10.25 ? 45  TRP C CD1 1 
ATOM 3958  C CD2 . TRP C 1 45  ? -38.997 141.782 22.600  1.00 13.24 ? 45  TRP C CD2 1 
ATOM 3959  N NE1 . TRP C 1 45  ? -37.654 140.455 23.802  1.00 11.59 ? 45  TRP C NE1 1 
ATOM 3960  C CE2 . TRP C 1 45  ? -38.296 140.560 22.599  1.00 14.77 ? 45  TRP C CE2 1 
ATOM 3961  C CE3 . TRP C 1 45  ? -39.747 142.137 21.472  1.00 15.25 ? 45  TRP C CE3 1 
ATOM 3962  C CZ2 . TRP C 1 45  ? -38.323 139.684 21.508  1.00 16.88 ? 45  TRP C CZ2 1 
ATOM 3963  C CZ3 . TRP C 1 45  ? -39.774 141.267 20.390  1.00 18.93 ? 45  TRP C CZ3 1 
ATOM 3964  C CH2 . TRP C 1 45  ? -39.064 140.053 20.417  1.00 16.34 ? 45  TRP C CH2 1 
ATOM 3965  N N   . LEU C 1 46  ? -41.451 142.120 25.973  1.00 16.02 ? 46  LEU C N   1 
ATOM 3966  C CA  . LEU C 1 46  ? -42.003 140.873 26.479  1.00 19.50 ? 46  LEU C CA  1 
ATOM 3967  C C   . LEU C 1 46  ? -43.432 140.685 25.989  1.00 22.53 ? 46  LEU C C   1 
ATOM 3968  O O   . LEU C 1 46  ? -43.814 139.606 25.541  1.00 21.55 ? 46  LEU C O   1 
ATOM 3969  C CB  . LEU C 1 46  ? -41.977 140.879 28.007  1.00 18.50 ? 46  LEU C CB  1 
ATOM 3970  C CG  . LEU C 1 46  ? -40.571 141.032 28.591  1.00 16.50 ? 46  LEU C CG  1 
ATOM 3971  C CD1 . LEU C 1 46  ? -40.628 141.115 30.101  1.00 12.88 ? 46  LEU C CD1 1 
ATOM 3972  C CD2 . LEU C 1 46  ? -39.706 139.865 28.149  1.00 18.67 ? 46  LEU C CD2 1 
ATOM 3973  N N   . ASN C 1 47  ? -44.185 141.774 26.033  1.00 24.84 ? 47  ASN C N   1 
ATOM 3974  C CA  . ASN C 1 47  ? -45.579 141.818 25.622  1.00 23.16 ? 47  ASN C CA  1 
ATOM 3975  C C   . ASN C 1 47  ? -45.794 141.273 24.206  1.00 21.98 ? 47  ASN C C   1 
ATOM 3976  O O   . ASN C 1 47  ? -46.474 140.266 24.014  1.00 24.61 ? 47  ASN C O   1 
ATOM 3977  C CB  . ASN C 1 47  ? -46.068 143.270 25.687  1.00 25.14 ? 47  ASN C CB  1 
ATOM 3978  C CG  . ASN C 1 47  ? -47.393 143.416 26.402  1.00 24.62 ? 47  ASN C CG  1 
ATOM 3979  O OD1 . ASN C 1 47  ? -47.737 142.625 27.274  1.00 21.96 ? 47  ASN C OD1 1 
ATOM 3980  N ND2 . ASN C 1 47  ? -48.130 144.459 26.061  1.00 27.69 ? 47  ASN C ND2 1 
ATOM 3981  N N   . GLU C 1 48  ? -45.205 141.938 23.217  1.00 20.49 ? 48  GLU C N   1 
ATOM 3982  C CA  . GLU C 1 48  ? -45.355 141.537 21.825  1.00 18.09 ? 48  GLU C CA  1 
ATOM 3983  C C   . GLU C 1 48  ? -44.580 140.276 21.446  1.00 17.27 ? 48  GLU C C   1 
ATOM 3984  O O   . GLU C 1 48  ? -45.093 139.428 20.722  1.00 15.16 ? 48  GLU C O   1 
ATOM 3985  C CB  . GLU C 1 48  ? -44.956 142.689 20.903  1.00 15.91 ? 48  GLU C CB  1 
ATOM 3986  C CG  . GLU C 1 48  ? -45.848 143.914 21.034  1.00 15.25 ? 48  GLU C CG  1 
ATOM 3987  C CD  . GLU C 1 48  ? -45.477 145.024 20.061  1.00 16.77 ? 48  GLU C CD  1 
ATOM 3988  O OE1 . GLU C 1 48  ? -45.455 144.759 18.839  1.00 14.79 ? 48  GLU C OE1 1 
ATOM 3989  O OE2 . GLU C 1 48  ? -45.206 146.160 20.512  1.00 14.14 ? 48  GLU C OE2 1 
ATOM 3990  N N   . LYS C 1 49  ? -43.357 140.160 21.951  1.00 15.37 ? 49  LYS C N   1 
ATOM 3991  C CA  . LYS C 1 49  ? -42.462 139.030 21.687  1.00 16.32 ? 49  LYS C CA  1 
ATOM 3992  C C   . LYS C 1 49  ? -43.074 137.757 21.105  1.00 14.98 ? 49  LYS C C   1 
ATOM 3993  O O   . LYS C 1 49  ? -42.897 137.441 19.931  1.00 12.47 ? 49  LYS C O   1 
ATOM 3994  C CB  . LYS C 1 49  ? -41.708 138.651 22.964  1.00 19.49 ? 49  LYS C CB  1 
ATOM 3995  C CG  . LYS C 1 49  ? -40.648 137.584 22.747  1.00 15.90 ? 49  LYS C CG  1 
ATOM 3996  C CD  . LYS C 1 49  ? -40.360 136.821 24.017  1.00 18.80 ? 49  LYS C CD  1 
ATOM 3997  C CE  . LYS C 1 49  ? -39.179 135.894 23.818  1.00 23.10 ? 49  LYS C CE  1 
ATOM 3998  N NZ  . LYS C 1 49  ? -39.380 134.584 24.487  1.00 21.96 ? 49  LYS C NZ  1 
ATOM 3999  N N   . PHE C 1 50  ? -43.783 137.030 21.957  1.00 14.47 ? 50  PHE C N   1 
ATOM 4000  C CA  . PHE C 1 50  ? -44.393 135.765 21.593  1.00 14.89 ? 50  PHE C CA  1 
ATOM 4001  C C   . PHE C 1 50  ? -45.457 135.836 20.508  1.00 17.43 ? 50  PHE C C   1 
ATOM 4002  O O   . PHE C 1 50  ? -45.474 135.016 19.591  1.00 21.48 ? 50  PHE C O   1 
ATOM 4003  C CB  . PHE C 1 50  ? -44.974 135.118 22.847  1.00 14.02 ? 50  PHE C CB  1 
ATOM 4004  C CG  . PHE C 1 50  ? -44.002 135.050 23.990  1.00 14.81 ? 50  PHE C CG  1 
ATOM 4005  C CD1 . PHE C 1 50  ? -43.073 134.017 24.066  1.00 14.63 ? 50  PHE C CD1 1 
ATOM 4006  C CD2 . PHE C 1 50  ? -44.012 136.033 24.987  1.00 11.67 ? 50  PHE C CD2 1 
ATOM 4007  C CE1 . PHE C 1 50  ? -42.169 133.949 25.117  1.00 8.80  ? 50  PHE C CE1 1 
ATOM 4008  C CE2 . PHE C 1 50  ? -43.108 135.959 26.045  1.00 11.75 ? 50  PHE C CE2 1 
ATOM 4009  C CZ  . PHE C 1 50  ? -42.185 134.919 26.108  1.00 13.56 ? 50  PHE C CZ  1 
ATOM 4010  N N   . LYS C 1 51  ? -46.314 136.846 20.582  1.00 14.62 ? 51  LYS C N   1 
ATOM 4011  C CA  . LYS C 1 51  ? -47.403 137.002 19.625  1.00 12.83 ? 51  LYS C CA  1 
ATOM 4012  C C   . LYS C 1 51  ? -47.032 137.358 18.184  1.00 10.98 ? 51  LYS C C   1 
ATOM 4013  O O   . LYS C 1 51  ? -47.921 137.620 17.374  1.00 15.58 ? 51  LYS C O   1 
ATOM 4014  C CB  . LYS C 1 51  ? -48.434 138.005 20.152  1.00 18.06 ? 51  LYS C CB  1 
ATOM 4015  C CG  . LYS C 1 51  ? -49.003 137.645 21.519  1.00 18.10 ? 51  LYS C CG  1 
ATOM 4016  C CD  . LYS C 1 51  ? -50.341 138.329 21.786  1.00 15.16 ? 51  LYS C CD  1 
ATOM 4017  C CE  . LYS C 1 51  ? -50.232 139.848 21.781  1.00 21.41 ? 51  LYS C CE  1 
ATOM 4018  N NZ  . LYS C 1 51  ? -51.474 140.485 22.305  1.00 27.48 ? 51  LYS C NZ  1 
ATOM 4019  N N   . LEU C 1 52  ? -45.746 137.381 17.849  1.00 9.31  ? 52  LEU C N   1 
ATOM 4020  C CA  . LEU C 1 52  ? -45.357 137.712 16.481  1.00 8.18  ? 52  LEU C CA  1 
ATOM 4021  C C   . LEU C 1 52  ? -45.025 136.526 15.587  1.00 7.09  ? 52  LEU C C   1 
ATOM 4022  O O   . LEU C 1 52  ? -44.486 136.716 14.497  1.00 5.84  ? 52  LEU C O   1 
ATOM 4023  C CB  . LEU C 1 52  ? -44.222 138.736 16.439  1.00 4.60  ? 52  LEU C CB  1 
ATOM 4024  C CG  . LEU C 1 52  ? -44.668 140.198 16.533  1.00 7.59  ? 52  LEU C CG  1 
ATOM 4025  C CD1 . LEU C 1 52  ? -44.688 140.648 17.980  1.00 7.71  ? 52  LEU C CD1 1 
ATOM 4026  C CD2 . LEU C 1 52  ? -43.733 141.078 15.716  1.00 10.22 ? 52  LEU C CD2 1 
ATOM 4027  N N   . GLY C 1 53  ? -45.347 135.317 16.041  1.00 5.44  ? 53  GLY C N   1 
ATOM 4028  C CA  . GLY C 1 53  ? -45.083 134.122 15.252  1.00 7.52  ? 53  GLY C CA  1 
ATOM 4029  C C   . GLY C 1 53  ? -43.661 133.982 14.733  1.00 7.43  ? 53  GLY C C   1 
ATOM 4030  O O   . GLY C 1 53  ? -43.441 133.505 13.616  1.00 7.90  ? 53  GLY C O   1 
ATOM 4031  N N   . LEU C 1 54  ? -42.695 134.400 15.548  1.00 7.47  ? 54  LEU C N   1 
ATOM 4032  C CA  . LEU C 1 54  ? -41.282 134.326 15.190  1.00 7.31  ? 54  LEU C CA  1 
ATOM 4033  C C   . LEU C 1 54  ? -40.773 132.960 15.612  1.00 8.69  ? 54  LEU C C   1 
ATOM 4034  O O   . LEU C 1 54  ? -40.921 132.603 16.772  1.00 8.10  ? 54  LEU C O   1 
ATOM 4035  C CB  . LEU C 1 54  ? -40.485 135.419 15.918  1.00 7.23  ? 54  LEU C CB  1 
ATOM 4036  C CG  . LEU C 1 54  ? -40.763 136.911 15.660  1.00 4.88  ? 54  LEU C CG  1 
ATOM 4037  C CD1 . LEU C 1 54  ? -40.112 137.766 16.745  1.00 2.00  ? 54  LEU C CD1 1 
ATOM 4038  C CD2 . LEU C 1 54  ? -40.259 137.321 14.284  1.00 5.79  ? 54  LEU C CD2 1 
ATOM 4039  N N   . ASP C 1 55  ? -40.166 132.234 14.673  1.00 7.54  ? 55  ASP C N   1 
ATOM 4040  C CA  . ASP C 1 55  ? -39.619 130.889 14.911  1.00 6.69  ? 55  ASP C CA  1 
ATOM 4041  C C   . ASP C 1 55  ? -38.851 130.836 16.224  1.00 6.89  ? 55  ASP C C   1 
ATOM 4042  O O   . ASP C 1 55  ? -39.024 129.929 17.044  1.00 7.46  ? 55  ASP C O   1 
ATOM 4043  C CB  . ASP C 1 55  ? -38.649 130.498 13.790  1.00 5.69  ? 55  ASP C CB  1 
ATOM 4044  C CG  . ASP C 1 55  ? -39.194 130.794 12.412  1.00 6.12  ? 55  ASP C CG  1 
ATOM 4045  O OD1 . ASP C 1 55  ? -39.992 129.979 11.906  1.00 8.17  ? 55  ASP C OD1 1 
ATOM 4046  O OD2 . ASP C 1 55  ? -38.813 131.835 11.835  1.00 2.00  ? 55  ASP C OD2 1 
ATOM 4047  N N   . PHE C 1 56  ? -37.955 131.798 16.383  1.00 9.97  ? 56  PHE C N   1 
ATOM 4048  C CA  . PHE C 1 56  ? -37.139 131.903 17.573  1.00 9.67  ? 56  PHE C CA  1 
ATOM 4049  C C   . PHE C 1 56  ? -37.270 133.348 18.039  1.00 8.71  ? 56  PHE C C   1 
ATOM 4050  O O   . PHE C 1 56  ? -36.518 134.217 17.577  1.00 7.94  ? 56  PHE C O   1 
ATOM 4051  C CB  . PHE C 1 56  ? -35.678 131.553 17.246  1.00 8.97  ? 56  PHE C CB  1 
ATOM 4052  C CG  . PHE C 1 56  ? -35.455 130.092 16.890  1.00 3.25  ? 56  PHE C CG  1 
ATOM 4053  C CD1 . PHE C 1 56  ? -35.332 129.128 17.885  1.00 5.73  ? 56  PHE C CD1 1 
ATOM 4054  C CD2 . PHE C 1 56  ? -35.339 129.694 15.563  1.00 2.00  ? 56  PHE C CD2 1 
ATOM 4055  C CE1 . PHE C 1 56  ? -35.093 127.787 17.566  1.00 3.66  ? 56  PHE C CE1 1 
ATOM 4056  C CE2 . PHE C 1 56  ? -35.100 128.359 15.233  1.00 3.38  ? 56  PHE C CE2 1 
ATOM 4057  C CZ  . PHE C 1 56  ? -34.976 127.386 16.237  1.00 2.00  ? 56  PHE C CZ  1 
ATOM 4058  N N   . PRO C 1 57  ? -38.283 133.629 18.883  1.00 7.64  ? 57  PRO C N   1 
ATOM 4059  C CA  . PRO C 1 57  ? -38.559 134.959 19.428  1.00 7.23  ? 57  PRO C CA  1 
ATOM 4060  C C   . PRO C 1 57  ? -37.248 135.569 19.871  1.00 9.39  ? 57  PRO C C   1 
ATOM 4061  O O   . PRO C 1 57  ? -36.630 135.108 20.832  1.00 14.32 ? 57  PRO C O   1 
ATOM 4062  C CB  . PRO C 1 57  ? -39.467 134.649 20.615  1.00 3.71  ? 57  PRO C CB  1 
ATOM 4063  C CG  . PRO C 1 57  ? -40.229 133.495 20.144  1.00 5.24  ? 57  PRO C CG  1 
ATOM 4064  C CD  . PRO C 1 57  ? -39.164 132.647 19.513  1.00 7.90  ? 57  PRO C CD  1 
ATOM 4065  N N   . ASN C 1 58  ? -36.818 136.601 19.159  1.00 9.54  ? 58  ASN C N   1 
ATOM 4066  C CA  . ASN C 1 58  ? -35.544 137.214 19.468  1.00 9.42  ? 58  ASN C CA  1 
ATOM 4067  C C   . ASN C 1 58  ? -35.496 138.650 18.967  1.00 10.39 ? 58  ASN C C   1 
ATOM 4068  O O   . ASN C 1 58  ? -36.330 139.071 18.161  1.00 9.59  ? 58  ASN C O   1 
ATOM 4069  C CB  . ASN C 1 58  ? -34.438 136.388 18.794  1.00 10.38 ? 58  ASN C CB  1 
ATOM 4070  C CG  . ASN C 1 58  ? -33.172 136.307 19.619  1.00 14.48 ? 58  ASN C CG  1 
ATOM 4071  O OD1 . ASN C 1 58  ? -33.219 136.083 20.827  1.00 12.71 ? 58  ASN C OD1 1 
ATOM 4072  N ND2 . ASN C 1 58  ? -32.027 136.456 18.962  1.00 15.68 ? 58  ASN C ND2 1 
ATOM 4073  N N   . LEU C 1 59  ? -34.550 139.401 19.488  1.00 11.16 ? 59  LEU C N   1 
ATOM 4074  C CA  . LEU C 1 59  ? -34.301 140.782 19.117  1.00 9.55  ? 59  LEU C CA  1 
ATOM 4075  C C   . LEU C 1 59  ? -32.840 140.846 18.661  1.00 9.43  ? 59  LEU C C   1 
ATOM 4076  O O   . LEU C 1 59  ? -31.999 140.119 19.195  1.00 9.15  ? 59  LEU C O   1 
ATOM 4077  C CB  . LEU C 1 59  ? -34.509 141.716 20.297  1.00 7.19  ? 59  LEU C CB  1 
ATOM 4078  C CG  . LEU C 1 59  ? -35.878 142.348 20.531  1.00 5.40  ? 59  LEU C CG  1 
ATOM 4079  C CD1 . LEU C 1 59  ? -35.798 143.280 21.730  1.00 2.78  ? 59  LEU C CD1 1 
ATOM 4080  C CD2 . LEU C 1 59  ? -36.316 143.121 19.301  1.00 7.90  ? 59  LEU C CD2 1 
ATOM 4081  N N   . PRO C 1 60  ? -32.542 141.627 17.610  1.00 10.04 ? 60  PRO C N   1 
ATOM 4082  C CA  . PRO C 1 60  ? -33.516 142.417 16.846  1.00 13.04 ? 60  PRO C CA  1 
ATOM 4083  C C   . PRO C 1 60  ? -34.285 141.497 15.914  1.00 10.58 ? 60  PRO C C   1 
ATOM 4084  O O   . PRO C 1 60  ? -33.959 140.264 15.847  1.00 13.92 ? 60  PRO C O   1 
ATOM 4085  C CB  . PRO C 1 60  ? -32.630 143.372 16.036  1.00 14.37 ? 60  PRO C CB  1 
ATOM 4086  C CG  . PRO C 1 60  ? -31.301 143.374 16.765  1.00 14.21 ? 60  PRO C CG  1 
ATOM 4087  C CD  . PRO C 1 60  ? -31.167 141.949 17.191  1.00 12.43 ? 60  PRO C CD  1 
ATOM 4088  N N   . TYR C 1 61  ? -35.274 142.019 15.202  1.00 10.93 ? 61  TYR C N   1 
ATOM 4089  C CA  . TYR C 1 61  ? -36.054 141.218 14.260  1.00 12.39 ? 61  TYR C CA  1 
ATOM 4090  C C   . TYR C 1 61  ? -36.451 142.061 13.053  1.00 10.32 ? 61  TYR C C   1 
ATOM 4091  O O   . TYR C 1 61  ? -36.466 143.294 13.126  1.00 11.25 ? 61  TYR C O   1 
ATOM 4092  C CB  . TYR C 1 61  ? -37.290 140.597 14.933  1.00 11.45 ? 61  TYR C CB  1 
ATOM 4093  C CG  . TYR C 1 61  ? -38.335 141.598 15.355  1.00 8.41  ? 61  TYR C CG  1 
ATOM 4094  C CD1 . TYR C 1 61  ? -39.333 142.000 14.474  1.00 12.50 ? 61  TYR C CD1 1 
ATOM 4095  C CD2 . TYR C 1 61  ? -38.322 142.153 16.631  1.00 9.94  ? 61  TYR C CD2 1 
ATOM 4096  C CE1 . TYR C 1 61  ? -40.294 142.935 14.854  1.00 12.23 ? 61  TYR C CE1 1 
ATOM 4097  C CE2 . TYR C 1 61  ? -39.280 143.087 17.020  1.00 12.07 ? 61  TYR C CE2 1 
ATOM 4098  C CZ  . TYR C 1 61  ? -40.260 143.477 16.125  1.00 9.58  ? 61  TYR C CZ  1 
ATOM 4099  O OH  . TYR C 1 61  ? -41.188 144.428 16.482  1.00 11.49 ? 61  TYR C OH  1 
ATOM 4100  N N   . LEU C 1 62  ? -36.766 141.391 11.949  1.00 11.63 ? 62  LEU C N   1 
ATOM 4101  C CA  . LEU C 1 62  ? -37.147 142.065 10.716  1.00 11.37 ? 62  LEU C CA  1 
ATOM 4102  C C   . LEU C 1 62  ? -38.395 141.451 10.109  1.00 13.17 ? 62  LEU C C   1 
ATOM 4103  O O   . LEU C 1 62  ? -38.404 140.270 9.749   1.00 14.55 ? 62  LEU C O   1 
ATOM 4104  C CB  . LEU C 1 62  ? -36.023 141.967 9.687   1.00 7.19  ? 62  LEU C CB  1 
ATOM 4105  C CG  . LEU C 1 62  ? -36.320 142.723 8.395   1.00 5.71  ? 62  LEU C CG  1 
ATOM 4106  C CD1 . LEU C 1 62  ? -36.064 144.196 8.648   1.00 2.00  ? 62  LEU C CD1 1 
ATOM 4107  C CD2 . LEU C 1 62  ? -35.464 142.213 7.247   1.00 8.09  ? 62  LEU C CD2 1 
ATOM 4108  N N   . ILE C 1 63  ? -39.435 142.260 9.968   1.00 16.49 ? 63  ILE C N   1 
ATOM 4109  C CA  . ILE C 1 63  ? -40.678 141.791 9.382   1.00 16.80 ? 63  ILE C CA  1 
ATOM 4110  C C   . ILE C 1 63  ? -40.707 142.216 7.923   1.00 17.66 ? 63  ILE C C   1 
ATOM 4111  O O   . ILE C 1 63  ? -41.016 143.366 7.614   1.00 17.14 ? 63  ILE C O   1 
ATOM 4112  C CB  . ILE C 1 63  ? -41.893 142.376 10.103  1.00 15.88 ? 63  ILE C CB  1 
ATOM 4113  C CG1 . ILE C 1 63  ? -41.806 142.053 11.599  1.00 15.00 ? 63  ILE C CG1 1 
ATOM 4114  C CG2 . ILE C 1 63  ? -43.175 141.840 9.467   1.00 12.29 ? 63  ILE C CG2 1 
ATOM 4115  C CD1 . ILE C 1 63  ? -42.884 142.684 12.441  1.00 9.92  ? 63  ILE C CD1 1 
ATOM 4116  N N   . ASP C 1 64  ? -40.365 141.286 7.037   1.00 17.34 ? 64  ASP C N   1 
ATOM 4117  C CA  . ASP C 1 64  ? -40.337 141.528 5.598   1.00 17.61 ? 64  ASP C CA  1 
ATOM 4118  C C   . ASP C 1 64  ? -41.621 141.000 4.963   1.00 16.71 ? 64  ASP C C   1 
ATOM 4119  O O   . ASP C 1 64  ? -41.587 140.138 4.081   1.00 15.92 ? 64  ASP C O   1 
ATOM 4120  C CB  . ASP C 1 64  ? -39.114 140.830 4.995   1.00 20.51 ? 64  ASP C CB  1 
ATOM 4121  C CG  . ASP C 1 64  ? -38.796 141.300 3.586   1.00 23.98 ? 64  ASP C CG  1 
ATOM 4122  O OD1 . ASP C 1 64  ? -39.333 140.709 2.626   1.00 24.50 ? 64  ASP C OD1 1 
ATOM 4123  O OD2 . ASP C 1 64  ? -37.988 142.241 3.435   1.00 25.48 ? 64  ASP C OD2 1 
ATOM 4124  N N   . GLY C 1 65  ? -42.756 141.496 5.446   1.00 15.84 ? 65  GLY C N   1 
ATOM 4125  C CA  . GLY C 1 65  ? -44.039 141.066 4.920   1.00 15.94 ? 65  GLY C CA  1 
ATOM 4126  C C   . GLY C 1 65  ? -44.392 139.643 5.316   1.00 16.28 ? 65  GLY C C   1 
ATOM 4127  O O   . GLY C 1 65  ? -45.246 139.423 6.173   1.00 15.38 ? 65  GLY C O   1 
ATOM 4128  N N   . ALA C 1 66  ? -43.737 138.678 4.680   1.00 14.98 ? 66  ALA C N   1 
ATOM 4129  C CA  . ALA C 1 66  ? -43.963 137.264 4.953   1.00 15.99 ? 66  ALA C CA  1 
ATOM 4130  C C   . ALA C 1 66  ? -42.729 136.629 5.576   1.00 18.30 ? 66  ALA C C   1 
ATOM 4131  O O   . ALA C 1 66  ? -42.805 135.570 6.199   1.00 19.48 ? 66  ALA C O   1 
ATOM 4132  C CB  . ALA C 1 66  ? -44.320 136.546 3.670   1.00 16.28 ? 66  ALA C CB  1 
ATOM 4133  N N   . HIS C 1 67  ? -41.583 137.260 5.366   1.00 20.08 ? 67  HIS C N   1 
ATOM 4134  C CA  . HIS C 1 67  ? -40.336 136.759 5.912   1.00 16.00 ? 67  HIS C CA  1 
ATOM 4135  C C   . HIS C 1 67  ? -40.040 137.404 7.250   1.00 16.61 ? 67  HIS C C   1 
ATOM 4136  O O   . HIS C 1 67  ? -39.760 138.597 7.319   1.00 17.79 ? 67  HIS C O   1 
ATOM 4137  C CB  . HIS C 1 67  ? -39.188 137.004 4.942   1.00 15.12 ? 67  HIS C CB  1 
ATOM 4138  C CG  . HIS C 1 67  ? -39.156 136.041 3.797   1.00 10.09 ? 67  HIS C CG  1 
ATOM 4139  N ND1 . HIS C 1 67  ? -38.652 136.371 2.557   1.00 9.67  ? 67  HIS C ND1 1 
ATOM 4140  C CD2 . HIS C 1 67  ? -39.540 134.745 3.714   1.00 2.55  ? 67  HIS C CD2 1 
ATOM 4141  C CE1 . HIS C 1 67  ? -38.726 135.320 1.760   1.00 4.02  ? 67  HIS C CE1 1 
ATOM 4142  N NE2 . HIS C 1 67  ? -39.258 134.320 2.435   1.00 2.91  ? 67  HIS C NE2 1 
ATOM 4143  N N   . LYS C 1 68  ? -40.146 136.614 8.310   1.00 17.02 ? 68  LYS C N   1 
ATOM 4144  C CA  . LYS C 1 68  ? -39.888 137.083 9.660   1.00 16.83 ? 68  LYS C CA  1 
ATOM 4145  C C   . LYS C 1 68  ? -38.544 136.506 10.080  1.00 15.46 ? 68  LYS C C   1 
ATOM 4146  O O   . LYS C 1 68  ? -38.405 135.292 10.220  1.00 15.10 ? 68  LYS C O   1 
ATOM 4147  C CB  . LYS C 1 68  ? -40.996 136.591 10.591  1.00 16.08 ? 68  LYS C CB  1 
ATOM 4148  C CG  . LYS C 1 68  ? -42.396 136.861 10.069  1.00 12.61 ? 68  LYS C CG  1 
ATOM 4149  C CD  . LYS C 1 68  ? -42.691 138.350 9.983   1.00 12.74 ? 68  LYS C CD  1 
ATOM 4150  C CE  . LYS C 1 68  ? -43.407 138.853 11.228  1.00 15.11 ? 68  LYS C CE  1 
ATOM 4151  N NZ  . LYS C 1 68  ? -42.557 138.797 12.446  1.00 12.28 ? 68  LYS C NZ  1 
ATOM 4152  N N   . ILE C 1 69  ? -37.557 137.374 10.267  1.00 15.18 ? 69  ILE C N   1 
ATOM 4153  C CA  . ILE C 1 69  ? -36.221 136.929 10.634  1.00 18.52 ? 69  ILE C CA  1 
ATOM 4154  C C   . ILE C 1 69  ? -35.705 137.487 11.963  1.00 16.77 ? 69  ILE C C   1 
ATOM 4155  O O   . ILE C 1 69  ? -35.903 138.656 12.279  1.00 13.07 ? 69  ILE C O   1 
ATOM 4156  C CB  . ILE C 1 69  ? -35.220 137.257 9.494   1.00 19.96 ? 69  ILE C CB  1 
ATOM 4157  C CG1 . ILE C 1 69  ? -35.744 136.684 8.170   1.00 19.85 ? 69  ILE C CG1 1 
ATOM 4158  C CG2 . ILE C 1 69  ? -33.846 136.683 9.796   1.00 19.75 ? 69  ILE C CG2 1 
ATOM 4159  C CD1 . ILE C 1 69  ? -34.895 136.988 6.971   1.00 21.09 ? 69  ILE C CD1 1 
ATOM 4160  N N   . THR C 1 70  ? -35.132 136.582 12.723  1.00 15.21 ? 70  THR C N   1 
ATOM 4161  C CA  . THR C 1 70  ? -34.620 136.950 14.039  1.00 14.56 ? 70  THR C CA  1 
ATOM 4162  C C   . THR C 1 70  ? -33.177 136.479 14.228  1.00 12.23 ? 70  THR C C   1 
ATOM 4163  O O   . THR C 1 70  ? -32.920 135.274 14.285  1.00 3.95  ? 70  THR C O   1 
ATOM 4164  C CB  . THR C 1 70  ? -35.487 136.351 15.175  1.00 15.72 ? 70  THR C CB  1 
ATOM 4165  O OG1 . THR C 1 70  ? -35.809 134.984 14.881  1.00 17.39 ? 70  THR C OG1 1 
ATOM 4166  C CG2 . THR C 1 70  ? -36.763 137.146 15.349  1.00 9.89  ? 70  THR C CG2 1 
ATOM 4167  N N   . GLN C 1 71  ? -32.261 137.446 14.317  1.00 13.99 ? 71  GLN C N   1 
ATOM 4168  C CA  . GLN C 1 71  ? -30.811 137.257 14.512  1.00 13.25 ? 71  GLN C CA  1 
ATOM 4169  C C   . GLN C 1 71  ? -30.038 138.264 13.674  1.00 12.79 ? 71  GLN C C   1 
ATOM 4170  O O   . GLN C 1 71  ? -30.162 138.286 12.450  1.00 13.83 ? 71  GLN C O   1 
ATOM 4171  C CB  . GLN C 1 71  ? -30.326 135.844 14.162  1.00 10.77 ? 71  GLN C CB  1 
ATOM 4172  C CG  . GLN C 1 71  ? -29.903 135.011 15.370  1.00 13.35 ? 71  GLN C CG  1 
ATOM 4173  C CD  . GLN C 1 71  ? -28.677 135.566 16.082  1.00 16.63 ? 71  GLN C CD  1 
ATOM 4174  O OE1 . GLN C 1 71  ? -28.005 136.472 15.580  1.00 18.56 ? 71  GLN C OE1 1 
ATOM 4175  N NE2 . GLN C 1 71  ? -28.376 135.018 17.252  1.00 12.31 ? 71  GLN C NE2 1 
ATOM 4176  N N   . SER C 1 72  ? -29.209 139.060 14.342  1.00 12.57 ? 72  SER C N   1 
ATOM 4177  C CA  . SER C 1 72  ? -28.397 140.091 13.706  1.00 14.17 ? 72  SER C CA  1 
ATOM 4178  C C   . SER C 1 72  ? -27.795 139.715 12.351  1.00 12.93 ? 72  SER C C   1 
ATOM 4179  O O   . SER C 1 72  ? -28.143 140.309 11.329  1.00 14.28 ? 72  SER C O   1 
ATOM 4180  C CB  . SER C 1 72  ? -27.296 140.550 14.669  1.00 15.75 ? 72  SER C CB  1 
ATOM 4181  O OG  . SER C 1 72  ? -27.049 139.578 15.674  1.00 20.39 ? 72  SER C OG  1 
ATOM 4182  N N   . ASN C 1 73  ? -26.936 138.639 12.300  1.00 12.78 ? 73  ASN C N   1 
ATOM 4183  C CA  . ASN C 1 73  ? -26.331 138.264 11.024  1.00 12.24 ? 73  ASN C CA  1 
ATOM 4184  C C   . ASN C 1 73  ? -27.375 137.829 9.999   1.00 13.43 ? 73  ASN C C   1 
ATOM 4185  O O   . ASN C 1 73  ? -27.368 138.315 8.866   1.00 15.67 ? 73  ASN C O   1 
ATOM 4186  C CB  . ASN C 1 73  ? -25.281 137.164 11.215  1.00 14.37 ? 73  ASN C CB  1 
ATOM 4187  C CG  . ASN C 1 73  ? -24.080 137.637 12.014  1.00 15.70 ? 73  ASN C CG  1 
ATOM 4188  O OD1 . ASN C 1 73  ? -23.565 138.742 11.795  1.00 5.93  ? 73  ASN C OD1 1 
ATOM 4189  N ND2 . ASN C 1 73  ? -23.618 136.799 12.941  1.00 13.40 ? 73  ASN C ND2 1 
ATOM 4190  N N   . ALA C 1 74  ? -28.287 136.945 10.409  1.00 13.30 ? 74  ALA C N   1 
ATOM 4191  C CA  . ALA C 1 74  ? -29.346 136.439 9.532   1.00 10.46 ? 74  ALA C CA  1 
ATOM 4192  C C   . ALA C 1 74  ? -30.099 137.564 8.788   1.00 12.23 ? 74  ALA C C   1 
ATOM 4193  O O   . ALA C 1 74  ? -30.359 137.456 7.590   1.00 9.75  ? 74  ALA C O   1 
ATOM 4194  C CB  . ALA C 1 74  ? -30.322 135.605 10.334  1.00 10.35 ? 74  ALA C CB  1 
ATOM 4195  N N   . ILE C 1 75  ? -30.380 138.645 9.506   1.00 12.51 ? 75  ILE C N   1 
ATOM 4196  C CA  . ILE C 1 75  ? -31.064 139.807 8.942   1.00 12.97 ? 75  ILE C CA  1 
ATOM 4197  C C   . ILE C 1 75  ? -30.143 140.534 7.967   1.00 11.72 ? 75  ILE C C   1 
ATOM 4198  O O   . ILE C 1 75  ? -30.601 141.143 7.002   1.00 12.85 ? 75  ILE C O   1 
ATOM 4199  C CB  . ILE C 1 75  ? -31.474 140.805 10.033  1.00 10.87 ? 75  ILE C CB  1 
ATOM 4200  C CG1 . ILE C 1 75  ? -32.342 140.121 11.083  1.00 10.19 ? 75  ILE C CG1 1 
ATOM 4201  C CG2 . ILE C 1 75  ? -32.225 141.965 9.417   1.00 13.76 ? 75  ILE C CG2 1 
ATOM 4202  C CD1 . ILE C 1 75  ? -32.491 140.939 12.341  1.00 10.42 ? 75  ILE C CD1 1 
ATOM 4203  N N   . LEU C 1 76  ? -28.845 140.498 8.231   1.00 13.08 ? 76  LEU C N   1 
ATOM 4204  C CA  . LEU C 1 76  ? -27.876 141.144 7.368   1.00 13.80 ? 76  LEU C CA  1 
ATOM 4205  C C   . LEU C 1 76  ? -27.740 140.331 6.085   1.00 12.86 ? 76  LEU C C   1 
ATOM 4206  O O   . LEU C 1 76  ? -27.824 140.881 4.985   1.00 13.49 ? 76  LEU C O   1 
ATOM 4207  C CB  . LEU C 1 76  ? -26.520 141.304 8.067   1.00 13.04 ? 76  LEU C CB  1 
ATOM 4208  C CG  . LEU C 1 76  ? -26.387 142.371 9.166   1.00 8.29  ? 76  LEU C CG  1 
ATOM 4209  C CD1 . LEU C 1 76  ? -25.050 142.220 9.856   1.00 2.00  ? 76  LEU C CD1 1 
ATOM 4210  C CD2 . LEU C 1 76  ? -26.527 143.771 8.588   1.00 10.57 ? 76  LEU C CD2 1 
ATOM 4211  N N   . CYS C 1 77  ? -27.590 139.018 6.222   1.00 10.79 ? 77  CYS C N   1 
ATOM 4212  C CA  . CYS C 1 77  ? -27.472 138.139 5.065   1.00 12.11 ? 77  CYS C CA  1 
ATOM 4213  C C   . CYS C 1 77  ? -28.648 138.336 4.110   1.00 12.92 ? 77  CYS C C   1 
ATOM 4214  O O   . CYS C 1 77  ? -28.446 138.636 2.935   1.00 11.35 ? 77  CYS C O   1 
ATOM 4215  C CB  . CYS C 1 77  ? -27.449 136.689 5.501   1.00 15.32 ? 77  CYS C CB  1 
ATOM 4216  S SG  . CYS C 1 77  ? -25.873 135.742 5.362   1.00 17.40 ? 77  CYS C SG  1 
ATOM 4217  N N   . TYR C 1 78  ? -29.868 138.220 4.628   1.00 12.49 ? 78  TYR C N   1 
ATOM 4218  C CA  . TYR C 1 78  ? -31.102 138.388 3.846   1.00 11.96 ? 78  TYR C CA  1 
ATOM 4219  C C   . TYR C 1 78  ? -31.129 139.640 2.974   1.00 12.11 ? 78  TYR C C   1 
ATOM 4220  O O   . TYR C 1 78  ? -31.421 139.574 1.778   1.00 13.34 ? 78  TYR C O   1 
ATOM 4221  C CB  . TYR C 1 78  ? -32.308 138.441 4.779   1.00 14.85 ? 78  TYR C CB  1 
ATOM 4222  C CG  . TYR C 1 78  ? -33.625 138.562 4.054   1.00 20.87 ? 78  TYR C CG  1 
ATOM 4223  C CD1 . TYR C 1 78  ? -34.309 137.422 3.620   1.00 21.16 ? 78  TYR C CD1 1 
ATOM 4224  C CD2 . TYR C 1 78  ? -34.223 139.825 3.823   1.00 18.18 ? 78  TYR C CD2 1 
ATOM 4225  C CE1 . TYR C 1 78  ? -35.541 137.514 2.983   1.00 20.47 ? 78  TYR C CE1 1 
ATOM 4226  C CE2 . TYR C 1 78  ? -35.461 139.927 3.179   1.00 18.34 ? 78  TYR C CE2 1 
ATOM 4227  C CZ  . TYR C 1 78  ? -36.112 138.755 2.765   1.00 19.73 ? 78  TYR C CZ  1 
ATOM 4228  O OH  . TYR C 1 78  ? -37.333 138.823 2.135   1.00 19.26 ? 78  TYR C OH  1 
ATOM 4229  N N   . ILE C 1 79  ? -30.895 140.783 3.610   1.00 7.09  ? 79  ILE C N   1 
ATOM 4230  C CA  . ILE C 1 79  ? -30.884 142.073 2.938   1.00 11.14 ? 79  ILE C CA  1 
ATOM 4231  C C   . ILE C 1 79  ? -29.674 142.155 2.015   1.00 11.18 ? 79  ILE C C   1 
ATOM 4232  O O   . ILE C 1 79  ? -29.667 142.929 1.050   1.00 6.75  ? 79  ILE C O   1 
ATOM 4233  C CB  . ILE C 1 79  ? -30.870 143.216 3.962   1.00 10.05 ? 79  ILE C CB  1 
ATOM 4234  C CG1 . ILE C 1 79  ? -31.988 142.992 4.982   1.00 10.81 ? 79  ILE C CG1 1 
ATOM 4235  C CG2 . ILE C 1 79  ? -31.081 144.545 3.260   1.00 11.68 ? 79  ILE C CG2 1 
ATOM 4236  C CD1 . ILE C 1 79  ? -31.995 143.961 6.115   1.00 11.18 ? 79  ILE C CD1 1 
ATOM 4237  N N   . ALA C 1 80  ? -28.672 141.327 2.297   1.00 12.21 ? 80  ALA C N   1 
ATOM 4238  C CA  . ALA C 1 80  ? -27.470 141.275 1.482   1.00 13.18 ? 80  ALA C CA  1 
ATOM 4239  C C   . ALA C 1 80  ? -27.801 140.585 0.180   1.00 10.99 ? 80  ALA C C   1 
ATOM 4240  O O   . ALA C 1 80  ? -27.606 141.189 -0.900  1.00 11.14 ? 80  ALA C O   1 
ATOM 4241  C CB  . ALA C 1 80  ? -26.356 140.534 2.209   1.00 10.24 ? 80  ALA C CB  1 
ATOM 4242  N N   . ARG C 1 81  ? -28.368 139.378 0.241   1.00 10.46 ? 81  ARG C N   1 
ATOM 4243  C CA  . ARG C 1 81  ? -28.733 138.600 -0.948  1.00 11.57 ? 81  ARG C CA  1 
ATOM 4244  C C   . ARG C 1 81  ? -29.549 139.427 -1.927  1.00 15.44 ? 81  ARG C C   1 
ATOM 4245  O O   . ARG C 1 81  ? -29.151 139.644 -3.078  1.00 18.00 ? 81  ARG C O   1 
ATOM 4246  C CB  . ARG C 1 81  ? -29.568 137.367 -0.573  1.00 8.75  ? 81  ARG C CB  1 
ATOM 4247  C CG  . ARG C 1 81  ? -29.000 136.481 0.532   1.00 9.46  ? 81  ARG C CG  1 
ATOM 4248  C CD  . ARG C 1 81  ? -29.705 135.121 0.568   1.00 9.29  ? 81  ARG C CD  1 
ATOM 4249  N NE  . ARG C 1 81  ? -29.520 134.395 1.827   1.00 13.49 ? 81  ARG C NE  1 
ATOM 4250  C CZ  . ARG C 1 81  ? -30.441 134.320 2.784   1.00 18.82 ? 81  ARG C CZ  1 
ATOM 4251  N NH1 . ARG C 1 81  ? -31.609 134.925 2.634   1.00 17.96 ? 81  ARG C NH1 1 
ATOM 4252  N NH2 . ARG C 1 81  ? -30.217 133.614 3.879   1.00 18.08 ? 81  ARG C NH2 1 
ATOM 4253  N N   . LYS C 1 82  ? -30.678 139.959 -1.447  1.00 14.70 ? 82  LYS C N   1 
ATOM 4254  C CA  . LYS C 1 82  ? -31.575 140.775 -2.255  1.00 15.89 ? 82  LYS C CA  1 
ATOM 4255  C C   . LYS C 1 82  ? -30.947 142.021 -2.883  1.00 15.55 ? 82  LYS C C   1 
ATOM 4256  O O   . LYS C 1 82  ? -31.528 142.626 -3.778  1.00 17.48 ? 82  LYS C O   1 
ATOM 4257  C CB  . LYS C 1 82  ? -32.810 141.156 -1.441  1.00 18.05 ? 82  LYS C CB  1 
ATOM 4258  C CG  . LYS C 1 82  ? -33.776 140.009 -1.195  1.00 18.45 ? 82  LYS C CG  1 
ATOM 4259  C CD  . LYS C 1 82  ? -35.073 140.551 -0.617  1.00 19.31 ? 82  LYS C CD  1 
ATOM 4260  C CE  . LYS C 1 82  ? -36.273 139.749 -1.085  1.00 19.30 ? 82  LYS C CE  1 
ATOM 4261  N NZ  . LYS C 1 82  ? -37.545 140.464 -0.784  1.00 17.97 ? 82  LYS C NZ  1 
ATOM 4262  N N   . HIS C 1 83  ? -29.789 142.436 -2.389  1.00 18.16 ? 83  HIS C N   1 
ATOM 4263  C CA  . HIS C 1 83  ? -29.109 143.595 -2.951  1.00 20.58 ? 83  HIS C CA  1 
ATOM 4264  C C   . HIS C 1 83  ? -27.696 143.238 -3.388  1.00 21.36 ? 83  HIS C C   1 
ATOM 4265  O O   . HIS C 1 83  ? -26.851 144.137 -3.560  1.00 21.35 ? 83  HIS C O   1 
ATOM 4266  C CB  . HIS C 1 83  ? -29.092 144.760 -1.957  1.00 23.87 ? 83  HIS C CB  1 
ATOM 4267  C CG  . HIS C 1 83  ? -30.238 145.714 -2.122  1.00 25.96 ? 83  HIS C CG  1 
ATOM 4268  N ND1 . HIS C 1 83  ? -30.295 146.644 -3.140  1.00 29.15 ? 83  HIS C ND1 1 
ATOM 4269  C CD2 . HIS C 1 83  ? -31.354 145.908 -1.377  1.00 24.68 ? 83  HIS C CD2 1 
ATOM 4270  C CE1 . HIS C 1 83  ? -31.392 147.369 -3.015  1.00 26.68 ? 83  HIS C CE1 1 
ATOM 4271  N NE2 . HIS C 1 83  ? -32.051 146.944 -1.952  1.00 25.81 ? 83  HIS C NE2 1 
ATOM 4272  N N   . ASN C 1 84  ? -27.461 141.936 -3.556  1.00 19.66 ? 84  ASN C N   1 
ATOM 4273  C CA  . ASN C 1 84  ? -26.180 141.370 -3.989  1.00 18.39 ? 84  ASN C CA  1 
ATOM 4274  C C   . ASN C 1 84  ? -24.895 141.876 -3.324  1.00 16.21 ? 84  ASN C C   1 
ATOM 4275  O O   . ASN C 1 84  ? -23.812 141.849 -3.930  1.00 18.80 ? 84  ASN C O   1 
ATOM 4276  C CB  . ASN C 1 84  ? -26.056 141.440 -5.510  1.00 17.05 ? 84  ASN C CB  1 
ATOM 4277  C CG  . ASN C 1 84  ? -26.298 140.107 -6.163  1.00 19.02 ? 84  ASN C CG  1 
ATOM 4278  O OD1 . ASN C 1 84  ? -27.216 139.952 -6.963  1.00 20.37 ? 84  ASN C OD1 1 
ATOM 4279  N ND2 . ASN C 1 84  ? -25.475 139.124 -5.815  1.00 21.88 ? 84  ASN C ND2 1 
ATOM 4280  N N   . LEU C 1 85  ? -25.003 142.262 -2.055  1.00 13.54 ? 85  LEU C N   1 
ATOM 4281  C CA  . LEU C 1 85  ? -23.869 142.764 -1.285  1.00 9.91  ? 85  LEU C CA  1 
ATOM 4282  C C   . LEU C 1 85  ? -23.149 141.632 -0.547  1.00 9.68  ? 85  LEU C C   1 
ATOM 4283  O O   . LEU C 1 85  ? -22.815 141.754 0.637   1.00 10.92 ? 85  LEU C O   1 
ATOM 4284  C CB  . LEU C 1 85  ? -24.356 143.804 -0.277  1.00 8.61  ? 85  LEU C CB  1 
ATOM 4285  C CG  . LEU C 1 85  ? -25.213 144.932 -0.836  1.00 6.30  ? 85  LEU C CG  1 
ATOM 4286  C CD1 . LEU C 1 85  ? -25.777 145.726 0.315   1.00 2.40  ? 85  LEU C CD1 1 
ATOM 4287  C CD2 . LEU C 1 85  ? -24.385 145.807 -1.766  1.00 2.00  ? 85  LEU C CD2 1 
ATOM 4288  N N   . CYS C 1 86  ? -22.883 140.542 -1.254  1.00 7.61  ? 86  CYS C N   1 
ATOM 4289  C CA  . CYS C 1 86  ? -22.215 139.401 -0.656  1.00 7.87  ? 86  CYS C CA  1 
ATOM 4290  C C   . CYS C 1 86  ? -21.091 138.961 -1.578  1.00 9.57  ? 86  CYS C C   1 
ATOM 4291  O O   . CYS C 1 86  ? -20.817 139.620 -2.588  1.00 12.11 ? 86  CYS C O   1 
ATOM 4292  C CB  . CYS C 1 86  ? -23.209 138.261 -0.465  1.00 9.20  ? 86  CYS C CB  1 
ATOM 4293  S SG  . CYS C 1 86  ? -24.781 138.809 0.133   1.00 4.58  ? 86  CYS C SG  1 
ATOM 4294  N N   . GLY C 1 87  ? -20.438 137.857 -1.224  1.00 6.64  ? 87  GLY C N   1 
ATOM 4295  C CA  . GLY C 1 87  ? -19.346 137.343 -2.032  1.00 9.01  ? 87  GLY C CA  1 
ATOM 4296  C C   . GLY C 1 87  ? -19.791 136.770 -3.369  1.00 11.50 ? 87  GLY C C   1 
ATOM 4297  O O   . GLY C 1 87  ? -20.766 136.025 -3.447  1.00 11.10 ? 87  GLY C O   1 
ATOM 4298  N N   . GLU C 1 88  ? -19.081 137.132 -4.428  1.00 13.20 ? 88  GLU C N   1 
ATOM 4299  C CA  . GLU C 1 88  ? -19.404 136.642 -5.757  1.00 12.96 ? 88  GLU C CA  1 
ATOM 4300  C C   . GLU C 1 88  ? -18.491 135.479 -6.142  1.00 12.83 ? 88  GLU C C   1 
ATOM 4301  O O   . GLU C 1 88  ? -18.948 134.473 -6.685  1.00 14.62 ? 88  GLU C O   1 
ATOM 4302  C CB  . GLU C 1 88  ? -19.305 137.780 -6.772  1.00 12.50 ? 88  GLU C CB  1 
ATOM 4303  C CG  . GLU C 1 88  ? -20.501 137.877 -7.727  1.00 14.39 ? 88  GLU C CG  1 
ATOM 4304  C CD  . GLU C 1 88  ? -21.824 138.175 -7.020  1.00 16.21 ? 88  GLU C CD  1 
ATOM 4305  O OE1 . GLU C 1 88  ? -21.869 139.050 -6.132  1.00 10.72 ? 88  GLU C OE1 1 
ATOM 4306  O OE2 . GLU C 1 88  ? -22.842 137.541 -7.365  1.00 12.73 ? 88  GLU C OE2 1 
ATOM 4307  N N   . THR C 1 89  ? -17.199 135.619 -5.863  1.00 14.70 ? 89  THR C N   1 
ATOM 4308  C CA  . THR C 1 89  ? -16.241 134.563 -6.178  1.00 15.31 ? 89  THR C CA  1 
ATOM 4309  C C   . THR C 1 89  ? -16.001 133.717 -4.920  1.00 15.31 ? 89  THR C C   1 
ATOM 4310  O O   . THR C 1 89  ? -16.373 134.152 -3.821  1.00 16.41 ? 89  THR C O   1 
ATOM 4311  C CB  . THR C 1 89  ? -14.894 135.149 -6.684  1.00 13.63 ? 89  THR C CB  1 
ATOM 4312  O OG1 . THR C 1 89  ? -14.223 135.836 -5.616  1.00 13.37 ? 89  THR C OG1 1 
ATOM 4313  C CG2 . THR C 1 89  ? -15.127 136.132 -7.820  1.00 12.04 ? 89  THR C CG2 1 
ATOM 4314  N N   . GLU C 1 90  ? -15.399 132.556 -5.073  1.00 14.36 ? 90  GLU C N   1 
ATOM 4315  C CA  . GLU C 1 90  ? -15.109 131.707 -3.921  1.00 16.46 ? 90  GLU C CA  1 
ATOM 4316  C C   . GLU C 1 90  ? -14.286 132.498 -2.910  1.00 17.63 ? 90  GLU C C   1 
ATOM 4317  O O   . GLU C 1 90  ? -14.568 132.491 -1.713  1.00 18.36 ? 90  GLU C O   1 
ATOM 4318  C CB  . GLU C 1 90  ? -14.335 130.455 -4.351  1.00 18.25 ? 90  GLU C CB  1 
ATOM 4319  C CG  . GLU C 1 90  ? -13.874 129.557 -3.195  1.00 16.15 ? 90  GLU C CG  1 
ATOM 4320  C CD  . GLU C 1 90  ? -15.009 129.159 -2.265  1.00 15.02 ? 90  GLU C CD  1 
ATOM 4321  O OE1 . GLU C 1 90  ? -15.739 128.178 -2.576  1.00 14.57 ? 90  GLU C OE1 1 
ATOM 4322  O OE2 . GLU C 1 90  ? -15.169 129.826 -1.219  1.00 12.68 ? 90  GLU C OE2 1 
ATOM 4323  N N   . GLU C 1 91  ? -13.285 133.204 -3.425  1.00 17.39 ? 91  GLU C N   1 
ATOM 4324  C CA  . GLU C 1 91  ? -12.390 134.028 -2.624  1.00 16.14 ? 91  GLU C CA  1 
ATOM 4325  C C   . GLU C 1 91  ? -13.190 134.992 -1.767  1.00 17.55 ? 91  GLU C C   1 
ATOM 4326  O O   . GLU C 1 91  ? -12.972 135.092 -0.562  1.00 20.48 ? 91  GLU C O   1 
ATOM 4327  C CB  . GLU C 1 91  ? -11.456 134.800 -3.551  1.00 15.81 ? 91  GLU C CB  1 
ATOM 4328  C CG  . GLU C 1 91  ? -10.535 135.782 -2.864  1.00 22.69 ? 91  GLU C CG  1 
ATOM 4329  C CD  . GLU C 1 91  ? -9.436  136.274 -3.783  1.00 22.23 ? 91  GLU C CD  1 
ATOM 4330  O OE1 . GLU C 1 91  ? -9.692  136.445 -4.998  1.00 23.92 ? 91  GLU C OE1 1 
ATOM 4331  O OE2 . GLU C 1 91  ? -8.308  136.477 -3.287  1.00 21.04 ? 91  GLU C OE2 1 
ATOM 4332  N N   . GLU C 1 92  ? -14.122 135.696 -2.397  1.00 16.64 ? 92  GLU C N   1 
ATOM 4333  C CA  . GLU C 1 92  ? -14.965 136.642 -1.684  1.00 17.17 ? 92  GLU C CA  1 
ATOM 4334  C C   . GLU C 1 92  ? -15.692 135.922 -0.554  1.00 15.99 ? 92  GLU C C   1 
ATOM 4335  O O   . GLU C 1 92  ? -15.692 136.381 0.590   1.00 16.77 ? 92  GLU C O   1 
ATOM 4336  C CB  . GLU C 1 92  ? -15.989 137.281 -2.628  1.00 18.81 ? 92  GLU C CB  1 
ATOM 4337  C CG  . GLU C 1 92  ? -15.599 138.633 -3.197  1.00 16.99 ? 92  GLU C CG  1 
ATOM 4338  C CD  . GLU C 1 92  ? -14.939 138.541 -4.549  1.00 15.88 ? 92  GLU C CD  1 
ATOM 4339  O OE1 . GLU C 1 92  ? -15.641 138.185 -5.519  1.00 18.86 ? 92  GLU C OE1 1 
ATOM 4340  O OE2 . GLU C 1 92  ? -13.730 138.845 -4.647  1.00 15.39 ? 92  GLU C OE2 1 
ATOM 4341  N N   . LYS C 1 93  ? -16.260 134.765 -0.871  1.00 13.22 ? 93  LYS C N   1 
ATOM 4342  C CA  . LYS C 1 93  ? -16.998 133.988 0.111   1.00 14.05 ? 93  LYS C CA  1 
ATOM 4343  C C   . LYS C 1 93  ? -16.184 133.529 1.323   1.00 14.62 ? 93  LYS C C   1 
ATOM 4344  O O   . LYS C 1 93  ? -16.751 133.171 2.352   1.00 11.90 ? 93  LYS C O   1 
ATOM 4345  C CB  . LYS C 1 93  ? -17.696 132.801 -0.558  1.00 14.08 ? 93  LYS C CB  1 
ATOM 4346  C CG  . LYS C 1 93  ? -18.825 133.204 -1.498  1.00 5.12  ? 93  LYS C CG  1 
ATOM 4347  C CD  . LYS C 1 93  ? -19.856 132.101 -1.644  1.00 6.56  ? 93  LYS C CD  1 
ATOM 4348  C CE  . LYS C 1 93  ? -21.041 132.554 -2.482  1.00 10.94 ? 93  LYS C CE  1 
ATOM 4349  N NZ  . LYS C 1 93  ? -20.663 132.892 -3.885  1.00 13.48 ? 93  LYS C NZ  1 
ATOM 4350  N N   . ILE C 1 94  ? -14.860 133.550 1.203   1.00 16.47 ? 94  ILE C N   1 
ATOM 4351  C CA  . ILE C 1 94  ? -13.967 133.155 2.296   1.00 14.18 ? 94  ILE C CA  1 
ATOM 4352  C C   . ILE C 1 94  ? -13.669 134.361 3.181   1.00 12.87 ? 94  ILE C C   1 
ATOM 4353  O O   . ILE C 1 94  ? -13.542 134.237 4.396   1.00 13.15 ? 94  ILE C O   1 
ATOM 4354  C CB  . ILE C 1 94  ? -12.631 132.620 1.749   1.00 12.65 ? 94  ILE C CB  1 
ATOM 4355  C CG1 . ILE C 1 94  ? -12.873 131.363 0.914   1.00 14.62 ? 94  ILE C CG1 1 
ATOM 4356  C CG2 . ILE C 1 94  ? -11.682 132.334 2.887   1.00 12.21 ? 94  ILE C CG2 1 
ATOM 4357  C CD1 . ILE C 1 94  ? -11.729 131.015 -0.007  1.00 17.29 ? 94  ILE C CD1 1 
ATOM 4358  N N   . ARG C 1 95  ? -13.588 135.529 2.560   1.00 11.99 ? 95  ARG C N   1 
ATOM 4359  C CA  . ARG C 1 95  ? -13.297 136.761 3.274   1.00 14.55 ? 95  ARG C CA  1 
ATOM 4360  C C   . ARG C 1 95  ? -14.540 137.391 3.908   1.00 15.68 ? 95  ARG C C   1 
ATOM 4361  O O   . ARG C 1 95  ? -14.468 137.987 4.987   1.00 17.20 ? 95  ARG C O   1 
ATOM 4362  C CB  . ARG C 1 95  ? -12.608 137.739 2.330   1.00 11.07 ? 95  ARG C CB  1 
ATOM 4363  C CG  . ARG C 1 95  ? -11.559 137.076 1.451   1.00 6.89  ? 95  ARG C CG  1 
ATOM 4364  C CD  . ARG C 1 95  ? -10.698 138.087 0.727   1.00 11.80 ? 95  ARG C CD  1 
ATOM 4365  N NE  . ARG C 1 95  ? -9.572  138.527 1.546   1.00 12.54 ? 95  ARG C NE  1 
ATOM 4366  C CZ  . ARG C 1 95  ? -9.590  139.575 2.366   1.00 11.24 ? 95  ARG C CZ  1 
ATOM 4367  N NH1 . ARG C 1 95  ? -10.681 140.318 2.491   1.00 11.43 ? 95  ARG C NH1 1 
ATOM 4368  N NH2 . ARG C 1 95  ? -8.512  139.872 3.080   1.00 12.76 ? 95  ARG C NH2 1 
ATOM 4369  N N   . VAL C 1 96  ? -15.673 137.262 3.225   1.00 15.60 ? 96  VAL C N   1 
ATOM 4370  C CA  . VAL C 1 96  ? -16.945 137.786 3.717   1.00 15.18 ? 96  VAL C CA  1 
ATOM 4371  C C   . VAL C 1 96  ? -17.299 137.040 4.997   1.00 13.33 ? 96  VAL C C   1 
ATOM 4372  O O   . VAL C 1 96  ? -17.702 137.643 5.992   1.00 14.25 ? 96  VAL C O   1 
ATOM 4373  C CB  . VAL C 1 96  ? -18.083 137.558 2.692   1.00 18.74 ? 96  VAL C CB  1 
ATOM 4374  C CG1 . VAL C 1 96  ? -19.439 137.827 3.327   1.00 16.34 ? 96  VAL C CG1 1 
ATOM 4375  C CG2 . VAL C 1 96  ? -17.891 138.455 1.490   1.00 16.20 ? 96  VAL C CG2 1 
ATOM 4376  N N   . ASP C 1 97  ? -17.160 135.717 4.941   1.00 13.57 ? 97  ASP C N   1 
ATOM 4377  C CA  . ASP C 1 97  ? -17.442 134.843 6.072   1.00 13.83 ? 97  ASP C CA  1 
ATOM 4378  C C   . ASP C 1 97  ? -16.655 135.254 7.306   1.00 14.00 ? 97  ASP C C   1 
ATOM 4379  O O   . ASP C 1 97  ? -17.257 135.706 8.293   1.00 14.09 ? 97  ASP C O   1 
ATOM 4380  C CB  . ASP C 1 97  ? -17.095 133.389 5.726   1.00 9.04  ? 97  ASP C CB  1 
ATOM 4381  C CG  . ASP C 1 97  ? -18.108 132.742 4.811   1.00 10.23 ? 97  ASP C CG  1 
ATOM 4382  O OD1 . ASP C 1 97  ? -18.945 133.458 4.216   1.00 7.41  ? 97  ASP C OD1 1 
ATOM 4383  O OD2 . ASP C 1 97  ? -18.054 131.504 4.679   1.00 12.24 ? 97  ASP C OD2 1 
ATOM 4384  N N   . ILE C 1 98  ? -15.330 135.105 7.235   1.00 13.96 ? 98  ILE C N   1 
ATOM 4385  C CA  . ILE C 1 98  ? -14.437 135.428 8.346   1.00 12.54 ? 98  ILE C CA  1 
ATOM 4386  C C   . ILE C 1 98  ? -14.876 136.681 9.073   1.00 12.07 ? 98  ILE C C   1 
ATOM 4387  O O   . ILE C 1 98  ? -15.241 136.617 10.223  1.00 10.65 ? 98  ILE C O   1 
ATOM 4388  C CB  . ILE C 1 98  ? -12.980 135.616 7.893   1.00 9.99  ? 98  ILE C CB  1 
ATOM 4389  C CG1 . ILE C 1 98  ? -12.461 134.345 7.229   1.00 8.54  ? 98  ILE C CG1 1 
ATOM 4390  C CG2 . ILE C 1 98  ? -12.107 135.935 9.093   1.00 9.65  ? 98  ILE C CG2 1 
ATOM 4391  C CD1 . ILE C 1 98  ? -11.095 134.514 6.603   1.00 4.97  ? 98  ILE C CD1 1 
ATOM 4392  N N   . LEU C 1 99  ? -14.890 137.807 8.371   1.00 13.06 ? 99  LEU C N   1 
ATOM 4393  C CA  . LEU C 1 99  ? -15.298 139.068 8.974   1.00 14.14 ? 99  LEU C CA  1 
ATOM 4394  C C   . LEU C 1 99  ? -16.656 138.938 9.631   1.00 17.12 ? 99  LEU C C   1 
ATOM 4395  O O   . LEU C 1 99  ? -16.807 139.341 10.773  1.00 15.50 ? 99  LEU C O   1 
ATOM 4396  C CB  . LEU C 1 99  ? -15.361 140.177 7.931   1.00 11.53 ? 99  LEU C CB  1 
ATOM 4397  C CG  . LEU C 1 99  ? -14.038 140.679 7.371   1.00 11.99 ? 99  LEU C CG  1 
ATOM 4398  C CD1 . LEU C 1 99  ? -14.328 141.575 6.198   1.00 14.29 ? 99  LEU C CD1 1 
ATOM 4399  C CD2 . LEU C 1 99  ? -13.255 141.420 8.440   1.00 16.13 ? 99  LEU C CD2 1 
ATOM 4400  N N   . GLU C 1 100 ? -17.614 138.353 8.931   1.00 20.46 ? 100 GLU C N   1 
ATOM 4401  C CA  . GLU C 1 100 ? -18.970 138.178 9.427   1.00 20.58 ? 100 GLU C CA  1 
ATOM 4402  C C   . GLU C 1 100 ? -18.870 137.652 10.849  1.00 17.96 ? 100 GLU C C   1 
ATOM 4403  O O   . GLU C 1 100 ? -19.230 138.360 11.805  1.00 15.69 ? 100 GLU C O   1 
ATOM 4404  C CB  . GLU C 1 100 ? -19.755 137.183 8.561   1.00 19.58 ? 100 GLU C CB  1 
ATOM 4405  C CG  . GLU C 1 100 ? -21.254 137.115 8.862   1.00 23.81 ? 100 GLU C CG  1 
ATOM 4406  C CD  . GLU C 1 100 ? -21.684 135.784 9.468   1.00 26.76 ? 100 GLU C CD  1 
ATOM 4407  O OE1 . GLU C 1 100 ? -21.523 134.735 8.803   1.00 24.10 ? 100 GLU C OE1 1 
ATOM 4408  O OE2 . GLU C 1 100 ? -22.195 135.783 10.607  1.00 28.24 ? 100 GLU C OE2 1 
ATOM 4409  N N   . ASN C 1 101 ? -18.254 136.508 10.995  1.00 16.83 ? 101 ASN C N   1 
ATOM 4410  C CA  . ASN C 1 101 ? -18.117 135.926 12.312  1.00 17.18 ? 101 ASN C CA  1 
ATOM 4411  C C   . ASN C 1 101 ? -17.130 136.705 13.175  1.00 18.46 ? 101 ASN C C   1 
ATOM 4412  O O   . ASN C 1 101 ? -17.515 137.250 14.207  1.00 17.85 ? 101 ASN C O   1 
ATOM 4413  C CB  . ASN C 1 101 ? -17.761 134.447 12.203  1.00 7.06  ? 101 ASN C CB  1 
ATOM 4414  C CG  . ASN C 1 101 ? -18.862 133.641 11.528  1.00 10.14 ? 101 ASN C CG  1 
ATOM 4415  O OD1 . ASN C 1 101 ? -19.874 133.306 12.142  1.00 16.06 ? 101 ASN C OD1 1 
ATOM 4416  N ND2 . ASN C 1 101 ? -18.691 133.375 10.243  1.00 9.37  ? 101 ASN C ND2 1 
ATOM 4417  N N   . GLN C 1 102 ? -15.888 136.828 12.721  1.00 19.50 ? 102 GLN C N   1 
ATOM 4418  C CA  . GLN C 1 102 ? -14.857 137.543 13.467  1.00 17.23 ? 102 GLN C CA  1 
ATOM 4419  C C   . GLN C 1 102 ? -15.349 138.814 14.137  1.00 19.45 ? 102 GLN C C   1 
ATOM 4420  O O   . GLN C 1 102 ? -15.151 139.000 15.336  1.00 23.05 ? 102 GLN C O   1 
ATOM 4421  C CB  . GLN C 1 102 ? -13.668 137.882 12.574  1.00 15.43 ? 102 GLN C CB  1 
ATOM 4422  C CG  . GLN C 1 102 ? -12.421 138.203 13.366  1.00 11.96 ? 102 GLN C CG  1 
ATOM 4423  C CD  . GLN C 1 102 ? -12.107 137.112 14.366  1.00 8.35  ? 102 GLN C CD  1 
ATOM 4424  O OE1 . GLN C 1 102 ? -11.851 135.971 13.987  1.00 4.06  ? 102 GLN C OE1 1 
ATOM 4425  N NE2 . GLN C 1 102 ? -12.172 137.442 15.651  1.00 3.00  ? 102 GLN C NE2 1 
ATOM 4426  N N   . ALA C 1 103 ? -15.986 139.681 13.375  1.00 19.20 ? 103 ALA C N   1 
ATOM 4427  C CA  . ALA C 1 103 ? -16.510 140.951 13.855  1.00 18.29 ? 103 ALA C CA  1 
ATOM 4428  C C   . ALA C 1 103 ? -17.538 140.746 14.944  1.00 18.34 ? 103 ALA C C   1 
ATOM 4429  O O   . ALA C 1 103 ? -17.502 141.434 15.983  1.00 15.88 ? 103 ALA C O   1 
ATOM 4430  C CB  . ALA C 1 103 ? -17.113 141.767 12.713  1.00 17.42 ? 103 ALA C CB  1 
ATOM 4431  N N   . MET C 1 104 ? -18.459 139.808 14.762  1.00 17.41 ? 104 MET C N   1 
ATOM 4432  C CA  . MET C 1 104 ? -19.464 139.555 15.787  1.00 19.36 ? 104 MET C CA  1 
ATOM 4433  C C   . MET C 1 104 ? -18.770 138.957 17.007  1.00 16.89 ? 104 MET C C   1 
ATOM 4434  O O   . MET C 1 104 ? -19.160 139.210 18.150  1.00 15.69 ? 104 MET C O   1 
ATOM 4435  C CB  . MET C 1 104 ? -20.559 138.611 15.283  1.00 20.31 ? 104 MET C CB  1 
ATOM 4436  C CG  . MET C 1 104 ? -21.825 138.650 16.135  1.00 24.74 ? 104 MET C CG  1 
ATOM 4437  S SD  . MET C 1 104 ? -22.404 140.373 16.392  1.00 26.53 ? 104 MET C SD  1 
ATOM 4438  C CE  . MET C 1 104 ? -23.192 140.704 14.828  1.00 30.03 ? 104 MET C CE  1 
ATOM 4439  N N   . ASP C 1 105 ? -17.696 138.217 16.754  1.00 13.82 ? 105 ASP C N   1 
ATOM 4440  C CA  . ASP C 1 105 ? -16.935 137.593 17.820  1.00 12.29 ? 105 ASP C CA  1 
ATOM 4441  C C   . ASP C 1 105 ? -16.298 138.646 18.716  1.00 14.71 ? 105 ASP C C   1 
ATOM 4442  O O   . ASP C 1 105 ? -16.484 138.625 19.933  1.00 14.12 ? 105 ASP C O   1 
ATOM 4443  C CB  . ASP C 1 105 ? -15.857 136.686 17.247  1.00 8.71  ? 105 ASP C CB  1 
ATOM 4444  C CG  . ASP C 1 105 ? -15.171 135.874 18.310  1.00 6.65  ? 105 ASP C CG  1 
ATOM 4445  O OD1 . ASP C 1 105 ? -15.889 135.242 19.113  1.00 6.92  ? 105 ASP C OD1 1 
ATOM 4446  O OD2 . ASP C 1 105 ? -13.923 135.878 18.354  1.00 8.73  ? 105 ASP C OD2 1 
ATOM 4447  N N   . VAL C 1 106 ? -15.558 139.572 18.115  1.00 15.03 ? 106 VAL C N   1 
ATOM 4448  C CA  . VAL C 1 106 ? -14.909 140.624 18.883  1.00 12.88 ? 106 VAL C CA  1 
ATOM 4449  C C   . VAL C 1 106 ? -15.935 141.559 19.520  1.00 16.42 ? 106 VAL C C   1 
ATOM 4450  O O   . VAL C 1 106 ? -15.758 141.992 20.660  1.00 20.39 ? 106 VAL C O   1 
ATOM 4451  C CB  . VAL C 1 106 ? -13.888 141.419 18.029  1.00 12.17 ? 106 VAL C CB  1 
ATOM 4452  C CG1 . VAL C 1 106 ? -14.573 142.106 16.880  1.00 10.33 ? 106 VAL C CG1 1 
ATOM 4453  C CG2 . VAL C 1 106 ? -13.140 142.422 18.893  1.00 11.65 ? 106 VAL C CG2 1 
ATOM 4454  N N   . SER C 1 107 ? -17.031 141.822 18.810  1.00 19.31 ? 107 SER C N   1 
ATOM 4455  C CA  . SER C 1 107 ? -18.088 142.698 19.315  1.00 18.79 ? 107 SER C CA  1 
ATOM 4456  C C   . SER C 1 107 ? -18.694 142.139 20.608  1.00 18.20 ? 107 SER C C   1 
ATOM 4457  O O   . SER C 1 107 ? -18.875 142.890 21.589  1.00 17.90 ? 107 SER C O   1 
ATOM 4458  C CB  . SER C 1 107 ? -19.180 142.870 18.262  1.00 18.35 ? 107 SER C CB  1 
ATOM 4459  O OG  . SER C 1 107 ? -20.125 143.834 18.682  1.00 18.06 ? 107 SER C OG  1 
ATOM 4460  N N   . ASN C 1 108 ? -18.986 140.836 20.598  1.00 16.97 ? 108 ASN C N   1 
ATOM 4461  C CA  . ASN C 1 108 ? -19.561 140.127 21.746  1.00 18.91 ? 108 ASN C CA  1 
ATOM 4462  C C   . ASN C 1 108 ? -18.535 139.956 22.847  1.00 20.59 ? 108 ASN C C   1 
ATOM 4463  O O   . ASN C 1 108 ? -18.874 139.695 24.002  1.00 20.45 ? 108 ASN C O   1 
ATOM 4464  C CB  . ASN C 1 108 ? -20.087 138.759 21.325  1.00 17.00 ? 108 ASN C CB  1 
ATOM 4465  C CG  . ASN C 1 108 ? -21.537 138.799 20.906  1.00 18.69 ? 108 ASN C CG  1 
ATOM 4466  O OD1 . ASN C 1 108 ? -21.859 138.662 19.727  1.00 16.75 ? 108 ASN C OD1 1 
ATOM 4467  N ND2 . ASN C 1 108 ? -22.428 138.970 21.877  1.00 21.44 ? 108 ASN C ND2 1 
ATOM 4468  N N   . GLN C 1 109 ? -17.275 140.060 22.455  1.00 21.57 ? 109 GLN C N   1 
ATOM 4469  C CA  . GLN C 1 109 ? -16.153 139.967 23.366  1.00 21.55 ? 109 GLN C CA  1 
ATOM 4470  C C   . GLN C 1 109 ? -16.109 141.287 24.126  1.00 22.54 ? 109 GLN C C   1 
ATOM 4471  O O   . GLN C 1 109 ? -15.842 141.315 25.331  1.00 24.45 ? 109 GLN C O   1 
ATOM 4472  C CB  . GLN C 1 109 ? -14.885 139.768 22.548  1.00 23.58 ? 109 GLN C CB  1 
ATOM 4473  C CG  . GLN C 1 109 ? -13.596 139.748 23.311  1.00 26.92 ? 109 GLN C CG  1 
ATOM 4474  C CD  . GLN C 1 109 ? -12.420 139.693 22.369  1.00 28.37 ? 109 GLN C CD  1 
ATOM 4475  O OE1 . GLN C 1 109 ? -11.665 140.656 22.246  1.00 29.66 ? 109 GLN C OE1 1 
ATOM 4476  N NE2 . GLN C 1 109 ? -12.287 138.581 21.654  1.00 26.62 ? 109 GLN C NE2 1 
ATOM 4477  N N   . LEU C 1 110 ? -16.418 142.370 23.417  1.00 19.31 ? 110 LEU C N   1 
ATOM 4478  C CA  . LEU C 1 110 ? -16.442 143.705 24.001  1.00 20.73 ? 110 LEU C CA  1 
ATOM 4479  C C   . LEU C 1 110 ? -17.609 143.844 24.974  1.00 22.03 ? 110 LEU C C   1 
ATOM 4480  O O   . LEU C 1 110 ? -17.414 144.121 26.152  1.00 21.99 ? 110 LEU C O   1 
ATOM 4481  C CB  . LEU C 1 110 ? -16.548 144.768 22.900  1.00 18.64 ? 110 LEU C CB  1 
ATOM 4482  C CG  . LEU C 1 110 ? -16.759 146.234 23.302  1.00 16.20 ? 110 LEU C CG  1 
ATOM 4483  C CD1 . LEU C 1 110 ? -15.637 146.729 24.203  1.00 17.99 ? 110 LEU C CD1 1 
ATOM 4484  C CD2 . LEU C 1 110 ? -16.860 147.089 22.053  1.00 16.34 ? 110 LEU C CD2 1 
ATOM 4485  N N   . ALA C 1 111 ? -18.822 143.625 24.484  1.00 22.30 ? 111 ALA C N   1 
ATOM 4486  C CA  . ALA C 1 111 ? -20.007 143.737 25.327  1.00 18.64 ? 111 ALA C CA  1 
ATOM 4487  C C   . ALA C 1 111 ? -19.915 142.845 26.566  1.00 18.85 ? 111 ALA C C   1 
ATOM 4488  O O   . ALA C 1 111 ? -20.478 143.168 27.610  1.00 20.33 ? 111 ALA C O   1 
ATOM 4489  C CB  . ALA C 1 111 ? -21.263 143.420 24.524  1.00 18.54 ? 111 ALA C CB  1 
ATOM 4490  N N   . ARG C 1 112 ? -19.183 141.741 26.450  1.00 19.15 ? 112 ARG C N   1 
ATOM 4491  C CA  . ARG C 1 112 ? -18.996 140.804 27.554  1.00 21.11 ? 112 ARG C CA  1 
ATOM 4492  C C   . ARG C 1 112 ? -18.457 141.566 28.743  1.00 21.61 ? 112 ARG C C   1 
ATOM 4493  O O   . ARG C 1 112 ? -18.933 141.415 29.868  1.00 18.21 ? 112 ARG C O   1 
ATOM 4494  C CB  . ARG C 1 112 ? -18.000 139.716 27.146  1.00 23.65 ? 112 ARG C CB  1 
ATOM 4495  C CG  . ARG C 1 112 ? -18.234 138.350 27.771  1.00 27.70 ? 112 ARG C CG  1 
ATOM 4496  C CD  . ARG C 1 112 ? -17.599 137.281 26.885  1.00 28.79 ? 112 ARG C CD  1 
ATOM 4497  N NE  . ARG C 1 112 ? -18.000 135.917 27.233  1.00 32.78 ? 112 ARG C NE  1 
ATOM 4498  C CZ  . ARG C 1 112 ? -18.208 134.946 26.345  1.00 35.81 ? 112 ARG C CZ  1 
ATOM 4499  N NH1 . ARG C 1 112 ? -18.066 135.177 25.046  1.00 34.92 ? 112 ARG C NH1 1 
ATOM 4500  N NH2 . ARG C 1 112 ? -18.528 133.731 26.761  1.00 36.64 ? 112 ARG C NH2 1 
ATOM 4501  N N   . VAL C 1 113 ? -17.496 142.467 28.474  1.00 22.55 ? 113 VAL C N   1 
ATOM 4502  C CA  . VAL C 1 113 ? -16.897 143.294 29.518  1.00 21.54 ? 113 VAL C CA  1 
ATOM 4503  C C   . VAL C 1 113 ? -17.795 144.469 29.932  1.00 21.07 ? 113 VAL C C   1 
ATOM 4504  O O   . VAL C 1 113 ? -17.951 144.733 31.119  1.00 21.84 ? 113 VAL C O   1 
ATOM 4505  C CB  . VAL C 1 113 ? -15.455 143.781 29.148  1.00 22.56 ? 113 VAL C CB  1 
ATOM 4506  C CG1 . VAL C 1 113 ? -14.558 142.589 28.841  1.00 22.74 ? 113 VAL C CG1 1 
ATOM 4507  C CG2 . VAL C 1 113 ? -15.451 144.750 27.985  1.00 22.10 ? 113 VAL C CG2 1 
ATOM 4508  N N   . CYS C 1 114 ? -18.441 145.125 28.969  1.00 19.86 ? 114 CYS C N   1 
ATOM 4509  C CA  . CYS C 1 114 ? -19.334 146.251 29.275  1.00 21.76 ? 114 CYS C CA  1 
ATOM 4510  C C   . CYS C 1 114 ? -20.529 145.847 30.146  1.00 22.29 ? 114 CYS C C   1 
ATOM 4511  O O   . CYS C 1 114 ? -21.201 146.703 30.730  1.00 23.72 ? 114 CYS C O   1 
ATOM 4512  C CB  . CYS C 1 114 ? -19.854 146.915 27.991  1.00 20.16 ? 114 CYS C CB  1 
ATOM 4513  S SG  . CYS C 1 114 ? -18.675 147.956 27.103  1.00 14.68 ? 114 CYS C SG  1 
ATOM 4514  N N   . TYR C 1 115 ? -20.829 144.552 30.172  1.00 23.10 ? 115 TYR C N   1 
ATOM 4515  C CA  . TYR C 1 115 ? -21.940 144.022 30.961  1.00 24.07 ? 115 TYR C CA  1 
ATOM 4516  C C   . TYR C 1 115 ? -21.458 143.357 32.250  1.00 25.41 ? 115 TYR C C   1 
ATOM 4517  O O   . TYR C 1 115 ? -22.269 142.873 33.046  1.00 23.95 ? 115 TYR C O   1 
ATOM 4518  C CB  . TYR C 1 115 ? -22.752 143.017 30.134  1.00 25.89 ? 115 TYR C CB  1 
ATOM 4519  C CG  . TYR C 1 115 ? -23.643 143.653 29.096  1.00 28.89 ? 115 TYR C CG  1 
ATOM 4520  C CD1 . TYR C 1 115 ? -23.108 144.377 28.032  1.00 28.01 ? 115 TYR C CD1 1 
ATOM 4521  C CD2 . TYR C 1 115 ? -25.026 143.545 29.185  1.00 28.89 ? 115 TYR C CD2 1 
ATOM 4522  C CE1 . TYR C 1 115 ? -23.928 144.977 27.085  1.00 28.98 ? 115 TYR C CE1 1 
ATOM 4523  C CE2 . TYR C 1 115 ? -25.857 144.144 28.242  1.00 29.78 ? 115 TYR C CE2 1 
ATOM 4524  C CZ  . TYR C 1 115 ? -25.301 144.858 27.196  1.00 31.93 ? 115 TYR C CZ  1 
ATOM 4525  O OH  . TYR C 1 115 ? -26.117 145.456 26.261  1.00 35.98 ? 115 TYR C OH  1 
ATOM 4526  N N   . SER C 1 116 ? -20.143 143.325 32.445  1.00 25.48 ? 116 SER C N   1 
ATOM 4527  C CA  . SER C 1 116 ? -19.563 142.720 33.634  1.00 23.54 ? 116 SER C CA  1 
ATOM 4528  C C   . SER C 1 116 ? -19.379 143.741 34.752  1.00 22.80 ? 116 SER C C   1 
ATOM 4529  O O   . SER C 1 116 ? -18.893 144.853 34.523  1.00 19.44 ? 116 SER C O   1 
ATOM 4530  C CB  . SER C 1 116 ? -18.225 142.057 33.300  1.00 22.55 ? 116 SER C CB  1 
ATOM 4531  O OG  . SER C 1 116 ? -18.417 140.894 32.514  1.00 28.37 ? 116 SER C OG  1 
ATOM 4532  N N   . PRO C 1 117 ? -19.789 143.380 35.983  1.00 23.39 ? 117 PRO C N   1 
ATOM 4533  C CA  . PRO C 1 117 ? -19.653 144.286 37.127  1.00 24.95 ? 117 PRO C CA  1 
ATOM 4534  C C   . PRO C 1 117 ? -18.188 144.642 37.378  1.00 27.15 ? 117 PRO C C   1 
ATOM 4535  O O   . PRO C 1 117 ? -17.872 145.754 37.796  1.00 25.30 ? 117 PRO C O   1 
ATOM 4536  C CB  . PRO C 1 117 ? -20.258 143.475 38.280  1.00 22.69 ? 117 PRO C CB  1 
ATOM 4537  C CG  . PRO C 1 117 ? -20.079 142.037 37.844  1.00 21.66 ? 117 PRO C CG  1 
ATOM 4538  C CD  . PRO C 1 117 ? -20.425 142.110 36.385  1.00 23.05 ? 117 PRO C CD  1 
ATOM 4539  N N   . ASP C 1 118 ? -17.294 143.708 37.061  1.00 28.47 ? 118 ASP C N   1 
ATOM 4540  C CA  . ASP C 1 118 ? -15.861 143.912 37.243  1.00 29.93 ? 118 ASP C CA  1 
ATOM 4541  C C   . ASP C 1 118 ? -15.252 144.684 36.067  1.00 25.92 ? 118 ASP C C   1 
ATOM 4542  O O   . ASP C 1 118 ? -14.060 144.546 35.782  1.00 25.04 ? 118 ASP C O   1 
ATOM 4543  C CB  . ASP C 1 118 ? -15.149 142.559 37.379  1.00 34.57 ? 118 ASP C CB  1 
ATOM 4544  C CG  . ASP C 1 118 ? -15.566 141.791 38.619  1.00 38.88 ? 118 ASP C CG  1 
ATOM 4545  O OD1 . ASP C 1 118 ? -16.760 141.448 38.748  1.00 38.93 ? 118 ASP C OD1 1 
ATOM 4546  O OD2 . ASP C 1 118 ? -14.686 141.518 39.458  1.00 38.35 ? 118 ASP C OD2 1 
ATOM 4547  N N   . PHE C 1 119 ? -16.056 145.525 35.420  1.00 24.83 ? 119 PHE C N   1 
ATOM 4548  C CA  . PHE C 1 119 ? -15.607 146.305 34.268  1.00 24.07 ? 119 PHE C CA  1 
ATOM 4549  C C   . PHE C 1 119 ? -14.273 147.020 34.445  1.00 24.46 ? 119 PHE C C   1 
ATOM 4550  O O   . PHE C 1 119 ? -13.273 146.625 33.853  1.00 22.66 ? 119 PHE C O   1 
ATOM 4551  C CB  . PHE C 1 119 ? -16.667 147.322 33.850  1.00 23.60 ? 119 PHE C CB  1 
ATOM 4552  C CG  . PHE C 1 119 ? -16.329 148.049 32.585  1.00 21.97 ? 119 PHE C CG  1 
ATOM 4553  C CD1 . PHE C 1 119 ? -16.080 147.344 31.410  1.00 25.30 ? 119 PHE C CD1 1 
ATOM 4554  C CD2 . PHE C 1 119 ? -16.238 149.430 32.586  1.00 23.29 ? 119 PHE C CD2 1 
ATOM 4555  C CE1 . PHE C 1 119 ? -15.745 148.000 30.241  1.00 24.77 ? 119 PHE C CE1 1 
ATOM 4556  C CE2 . PHE C 1 119 ? -15.902 150.102 31.397  1.00 23.27 ? 119 PHE C CE2 1 
ATOM 4557  C CZ  . PHE C 1 119 ? -15.655 149.380 30.229  1.00 21.52 ? 119 PHE C CZ  1 
ATOM 4558  N N   . GLU C 1 120 ? -14.269 148.067 35.264  1.00 23.90 ? 120 GLU C N   1 
ATOM 4559  C CA  . GLU C 1 120 ? -13.077 148.869 35.532  1.00 23.78 ? 120 GLU C CA  1 
ATOM 4560  C C   . GLU C 1 120 ? -11.814 148.045 35.778  1.00 25.61 ? 120 GLU C C   1 
ATOM 4561  O O   . GLU C 1 120 ? -10.709 148.469 35.439  1.00 27.72 ? 120 GLU C O   1 
ATOM 4562  C CB  . GLU C 1 120 ? -13.335 149.780 36.726  1.00 21.33 ? 120 GLU C CB  1 
ATOM 4563  C CG  . GLU C 1 120 ? -14.543 150.680 36.542  1.00 23.92 ? 120 GLU C CG  1 
ATOM 4564  C CD  . GLU C 1 120 ? -15.566 150.541 37.657  1.00 24.63 ? 120 GLU C CD  1 
ATOM 4565  O OE1 . GLU C 1 120 ? -15.170 150.474 38.839  1.00 19.40 ? 120 GLU C OE1 1 
ATOM 4566  O OE2 . GLU C 1 120 ? -16.775 150.504 37.349  1.00 24.98 ? 120 GLU C OE2 1 
ATOM 4567  N N   . LYS C 1 121 ? -11.988 146.866 36.358  1.00 25.36 ? 121 LYS C N   1 
ATOM 4568  C CA  . LYS C 1 121 ? -10.864 145.993 36.640  1.00 25.58 ? 121 LYS C CA  1 
ATOM 4569  C C   . LYS C 1 121 ? -10.439 145.249 35.379  1.00 26.34 ? 121 LYS C C   1 
ATOM 4570  O O   . LYS C 1 121 ? -9.256  145.247 35.023  1.00 27.86 ? 121 LYS C O   1 
ATOM 4571  C CB  . LYS C 1 121 ? -11.239 145.006 37.745  1.00 27.97 ? 121 LYS C CB  1 
ATOM 4572  C CG  . LYS C 1 121 ? -11.826 145.681 38.972  1.00 29.73 ? 121 LYS C CG  1 
ATOM 4573  C CD  . LYS C 1 121 ? -12.256 144.667 40.015  1.00 28.91 ? 121 LYS C CD  1 
ATOM 4574  C CE  . LYS C 1 121 ? -13.185 145.299 41.042  1.00 27.17 ? 121 LYS C CE  1 
ATOM 4575  N NZ  . LYS C 1 121 ? -12.571 146.451 41.757  1.00 24.81 ? 121 LYS C NZ  1 
ATOM 4576  N N   . LEU C 1 122 ? -11.406 144.653 34.684  1.00 28.58 ? 122 LEU C N   1 
ATOM 4577  C CA  . LEU C 1 122 ? -11.121 143.894 33.469  1.00 28.21 ? 122 LEU C CA  1 
ATOM 4578  C C   . LEU C 1 122 ? -10.904 144.766 32.231  1.00 25.93 ? 122 LEU C C   1 
ATOM 4579  O O   . LEU C 1 122 ? -10.330 144.317 31.237  1.00 25.34 ? 122 LEU C O   1 
ATOM 4580  C CB  . LEU C 1 122 ? -12.223 142.858 33.217  1.00 28.96 ? 122 LEU C CB  1 
ATOM 4581  C CG  . LEU C 1 122 ? -12.142 141.552 34.030  1.00 31.45 ? 122 LEU C CG  1 
ATOM 4582  C CD1 . LEU C 1 122 ? -12.204 141.819 35.527  1.00 30.30 ? 122 LEU C CD1 1 
ATOM 4583  C CD2 . LEU C 1 122 ? -13.264 140.608 33.615  1.00 32.34 ? 122 LEU C CD2 1 
ATOM 4584  N N   . LYS C 1 123 ? -11.276 146.036 32.330  1.00 24.98 ? 123 LYS C N   1 
ATOM 4585  C CA  . LYS C 1 123 ? -11.144 146.981 31.224  1.00 23.64 ? 123 LYS C CA  1 
ATOM 4586  C C   . LYS C 1 123 ? -9.716  147.108 30.698  1.00 25.87 ? 123 LYS C C   1 
ATOM 4587  O O   . LYS C 1 123 ? -9.489  147.004 29.489  1.00 23.53 ? 123 LYS C O   1 
ATOM 4588  C CB  . LYS C 1 123 ? -11.692 148.347 31.631  1.00 14.70 ? 123 LYS C CB  1 
ATOM 4589  C CG  . LYS C 1 123 ? -11.755 149.354 30.509  1.00 12.43 ? 123 LYS C CG  1 
ATOM 4590  C CD  . LYS C 1 123 ? -10.719 150.437 30.688  1.00 10.19 ? 123 LYS C CD  1 
ATOM 4591  C CE  . LYS C 1 123 ? -11.304 151.786 30.336  1.00 8.02  ? 123 LYS C CE  1 
ATOM 4592  N NZ  . LYS C 1 123 ? -12.481 152.064 31.206  1.00 7.06  ? 123 LYS C NZ  1 
ATOM 4593  N N   . PRO C 1 124 ? -8.734  147.342 31.590  1.00 27.61 ? 124 PRO C N   1 
ATOM 4594  C CA  . PRO C 1 124 ? -7.350  147.468 31.123  1.00 29.94 ? 124 PRO C CA  1 
ATOM 4595  C C   . PRO C 1 124 ? -6.821  146.181 30.483  1.00 29.36 ? 124 PRO C C   1 
ATOM 4596  O O   . PRO C 1 124 ? -5.989  146.236 29.571  1.00 28.81 ? 124 PRO C O   1 
ATOM 4597  C CB  . PRO C 1 124 ? -6.590  147.828 32.401  1.00 27.56 ? 124 PRO C CB  1 
ATOM 4598  C CG  . PRO C 1 124 ? -7.412  147.190 33.478  1.00 26.92 ? 124 PRO C CG  1 
ATOM 4599  C CD  . PRO C 1 124 ? -8.792  147.534 33.049  1.00 28.67 ? 124 PRO C CD  1 
ATOM 4600  N N   . GLU C 1 125 ? -7.318  145.030 30.931  1.00 30.38 ? 125 GLU C N   1 
ATOM 4601  C CA  . GLU C 1 125 ? -6.879  143.760 30.369  1.00 29.23 ? 125 GLU C CA  1 
ATOM 4602  C C   . GLU C 1 125 ? -7.187  143.745 28.875  1.00 31.32 ? 125 GLU C C   1 
ATOM 4603  O O   . GLU C 1 125 ? -6.310  143.476 28.053  1.00 32.87 ? 125 GLU C O   1 
ATOM 4604  C CB  . GLU C 1 125 ? -7.587  142.589 31.056  1.00 31.62 ? 125 GLU C CB  1 
ATOM 4605  C CG  . GLU C 1 125 ? -7.084  141.221 30.599  1.00 33.13 ? 125 GLU C CG  1 
ATOM 4606  C CD  . GLU C 1 125 ? -7.875  140.054 31.177  1.00 32.28 ? 125 GLU C CD  1 
ATOM 4607  O OE1 . GLU C 1 125 ? -8.639  140.240 32.149  1.00 31.02 ? 125 GLU C OE1 1 
ATOM 4608  O OE2 . GLU C 1 125 ? -7.720  138.933 30.645  1.00 31.64 ? 125 GLU C OE2 1 
ATOM 4609  N N   . TYR C 1 126 ? -8.427  144.078 28.526  1.00 32.07 ? 126 TYR C N   1 
ATOM 4610  C CA  . TYR C 1 126 ? -8.851  144.111 27.127  1.00 27.21 ? 126 TYR C CA  1 
ATOM 4611  C C   . TYR C 1 126 ? -8.100  145.208 26.350  1.00 25.33 ? 126 TYR C C   1 
ATOM 4612  O O   . TYR C 1 126 ? -7.850  145.040 25.154  1.00 23.80 ? 126 TYR C O   1 
ATOM 4613  C CB  . TYR C 1 126 ? -10.368 144.339 27.030  1.00 27.70 ? 126 TYR C CB  1 
ATOM 4614  C CG  . TYR C 1 126 ? -10.894 144.510 25.612  1.00 26.91 ? 126 TYR C CG  1 
ATOM 4615  C CD1 . TYR C 1 126 ? -10.723 143.509 24.654  1.00 23.97 ? 126 TYR C CD1 1 
ATOM 4616  C CD2 . TYR C 1 126 ? -11.548 145.683 25.228  1.00 25.96 ? 126 TYR C CD2 1 
ATOM 4617  C CE1 . TYR C 1 126 ? -11.186 143.673 23.356  1.00 20.94 ? 126 TYR C CE1 1 
ATOM 4618  C CE2 . TYR C 1 126 ? -12.014 145.856 23.933  1.00 23.77 ? 126 TYR C CE2 1 
ATOM 4619  C CZ  . TYR C 1 126 ? -11.829 144.849 23.002  1.00 21.98 ? 126 TYR C CZ  1 
ATOM 4620  O OH  . TYR C 1 126 ? -12.282 145.033 21.711  1.00 22.75 ? 126 TYR C OH  1 
ATOM 4621  N N   . LEU C 1 127 ? -7.746  146.277 27.031  1.00 24.68 ? 127 LEU C N   1 
ATOM 4622  C CA  . LEU C 1 127 ? -7.020  147.368 26.401  1.00 25.02 ? 127 LEU C CA  1 
ATOM 4623  C C   . LEU C 1 127 ? -5.630  146.960 25.938  1.00 24.97 ? 127 LEU C C   1 
ATOM 4624  O O   . LEU C 1 127 ? -5.187  147.376 24.866  1.00 26.93 ? 127 LEU C O   1 
ATOM 4625  C CB  . LEU C 1 127 ? -6.915  148.561 27.342  1.00 23.21 ? 127 LEU C CB  1 
ATOM 4626  C CG  . LEU C 1 127 ? -8.233  149.270 27.624  1.00 23.83 ? 127 LEU C CG  1 
ATOM 4627  C CD1 . LEU C 1 127 ? -7.978  150.475 28.510  1.00 20.59 ? 127 LEU C CD1 1 
ATOM 4628  C CD2 . LEU C 1 127 ? -8.872  149.693 26.313  1.00 26.52 ? 127 LEU C CD2 1 
ATOM 4629  N N   . GLU C 1 128 ? -4.930  146.171 26.746  1.00 23.48 ? 128 GLU C N   1 
ATOM 4630  C CA  . GLU C 1 128 ? -3.594  145.732 26.364  1.00 25.40 ? 128 GLU C CA  1 
ATOM 4631  C C   . GLU C 1 128 ? -3.664  144.700 25.235  1.00 25.08 ? 128 GLU C C   1 
ATOM 4632  O O   . GLU C 1 128 ? -2.750  144.592 24.414  1.00 26.11 ? 128 GLU C O   1 
ATOM 4633  C CB  . GLU C 1 128 ? -2.813  145.196 27.575  1.00 26.02 ? 128 GLU C CB  1 
ATOM 4634  C CG  . GLU C 1 128 ? -3.333  143.912 28.204  1.00 21.64 ? 128 GLU C CG  1 
ATOM 4635  C CD  . GLU C 1 128 ? -2.513  143.488 29.415  1.00 18.90 ? 128 GLU C CD  1 
ATOM 4636  O OE1 . GLU C 1 128 ? -1.323  143.143 29.246  1.00 22.06 ? 128 GLU C OE1 1 
ATOM 4637  O OE2 . GLU C 1 128 ? -3.058  143.507 30.539  1.00 16.57 ? 128 GLU C OE2 1 
ATOM 4638  N N   . GLU C 1 129 ? -4.771  143.963 25.191  1.00 23.69 ? 129 GLU C N   1 
ATOM 4639  C CA  . GLU C 1 129 ? -4.999  142.958 24.162  1.00 21.78 ? 129 GLU C CA  1 
ATOM 4640  C C   . GLU C 1 129 ? -5.378  143.632 22.846  1.00 20.08 ? 129 GLU C C   1 
ATOM 4641  O O   . GLU C 1 129 ? -4.857  143.282 21.787  1.00 21.19 ? 129 GLU C O   1 
ATOM 4642  C CB  . GLU C 1 129 ? -6.135  142.023 24.586  1.00 26.02 ? 129 GLU C CB  1 
ATOM 4643  C CG  . GLU C 1 129 ? -5.832  141.140 25.788  1.00 28.35 ? 129 GLU C CG  1 
ATOM 4644  C CD  . GLU C 1 129 ? -5.120  139.852 25.417  1.00 28.81 ? 129 GLU C CD  1 
ATOM 4645  O OE1 . GLU C 1 129 ? -5.818  138.880 25.069  1.00 23.12 ? 129 GLU C OE1 1 
ATOM 4646  O OE2 . GLU C 1 129 ? -3.873  139.807 25.487  1.00 22.22 ? 129 GLU C OE2 1 
ATOM 4647  N N   . LEU C 1 130 ? -6.270  144.614 22.931  1.00 17.78 ? 130 LEU C N   1 
ATOM 4648  C CA  . LEU C 1 130 ? -6.768  145.355 21.770  1.00 18.00 ? 130 LEU C CA  1 
ATOM 4649  C C   . LEU C 1 130 ? -5.777  145.534 20.606  1.00 22.36 ? 130 LEU C C   1 
ATOM 4650  O O   . LEU C 1 130 ? -6.067  145.098 19.485  1.00 25.69 ? 130 LEU C O   1 
ATOM 4651  C CB  . LEU C 1 130 ? -7.344  146.719 22.204  1.00 15.89 ? 130 LEU C CB  1 
ATOM 4652  C CG  . LEU C 1 130 ? -8.090  147.562 21.156  1.00 14.04 ? 130 LEU C CG  1 
ATOM 4653  C CD1 . LEU C 1 130 ? -9.244  146.773 20.550  1.00 10.11 ? 130 LEU C CD1 1 
ATOM 4654  C CD2 . LEU C 1 130 ? -8.606  148.841 21.783  1.00 7.29  ? 130 LEU C CD2 1 
ATOM 4655  N N   . PRO C 1 131 ? -4.596  146.116 20.852  1.00 22.64 ? 131 PRO C N   1 
ATOM 4656  C CA  . PRO C 1 131 ? -3.604  146.308 19.787  1.00 23.26 ? 131 PRO C CA  1 
ATOM 4657  C C   . PRO C 1 131 ? -3.213  145.094 18.935  1.00 24.41 ? 131 PRO C C   1 
ATOM 4658  O O   . PRO C 1 131 ? -2.912  145.258 17.758  1.00 24.78 ? 131 PRO C O   1 
ATOM 4659  C CB  . PRO C 1 131 ? -2.414  146.880 20.544  1.00 23.23 ? 131 PRO C CB  1 
ATOM 4660  C CG  . PRO C 1 131 ? -3.081  147.731 21.564  1.00 22.51 ? 131 PRO C CG  1 
ATOM 4661  C CD  . PRO C 1 131 ? -4.142  146.806 22.080  1.00 23.92 ? 131 PRO C CD  1 
ATOM 4662  N N   . THR C 1 132 ? -3.194  143.890 19.496  1.00 22.24 ? 132 THR C N   1 
ATOM 4663  C CA  . THR C 1 132 ? -2.833  142.730 18.677  1.00 26.62 ? 132 THR C CA  1 
ATOM 4664  C C   . THR C 1 132 ? -4.013  142.315 17.781  1.00 27.76 ? 132 THR C C   1 
ATOM 4665  O O   . THR C 1 132 ? -3.835  141.999 16.580  1.00 28.32 ? 132 THR C O   1 
ATOM 4666  C CB  . THR C 1 132 ? -2.309  141.526 19.533  1.00 28.67 ? 132 THR C CB  1 
ATOM 4667  O OG1 . THR C 1 132 ? -1.696  140.556 18.676  1.00 26.32 ? 132 THR C OG1 1 
ATOM 4668  C CG2 . THR C 1 132 ? -3.442  140.832 20.315  1.00 27.50 ? 132 THR C CG2 1 
ATOM 4669  N N   . MET C 1 133 ? -5.221  142.349 18.341  1.00 29.01 ? 133 MET C N   1 
ATOM 4670  C CA  . MET C 1 133 ? -6.423  141.998 17.589  1.00 29.66 ? 133 MET C CA  1 
ATOM 4671  C C   . MET C 1 133 ? -6.633  143.016 16.461  1.00 27.61 ? 133 MET C C   1 
ATOM 4672  O O   . MET C 1 133 ? -6.822  142.632 15.299  1.00 28.75 ? 133 MET C O   1 
ATOM 4673  C CB  . MET C 1 133 ? -7.655  141.972 18.512  1.00 31.01 ? 133 MET C CB  1 
ATOM 4674  C CG  . MET C 1 133 ? -8.992  141.621 17.824  1.00 28.52 ? 133 MET C CG  1 
ATOM 4675  S SD  . MET C 1 133 ? -9.565  139.886 18.059  1.00 28.58 ? 133 MET C SD  1 
ATOM 4676  C CE  . MET C 1 133 ? -8.978  139.125 16.581  1.00 24.44 ? 133 MET C CE  1 
ATOM 4677  N N   . MET C 1 134 ? -6.552  144.306 16.797  1.00 24.82 ? 134 MET C N   1 
ATOM 4678  C CA  . MET C 1 134 ? -6.743  145.364 15.810  1.00 24.16 ? 134 MET C CA  1 
ATOM 4679  C C   . MET C 1 134 ? -5.646  145.376 14.769  1.00 22.78 ? 134 MET C C   1 
ATOM 4680  O O   . MET C 1 134 ? -5.788  146.004 13.699  1.00 22.61 ? 134 MET C O   1 
ATOM 4681  C CB  . MET C 1 134 ? -6.882  146.731 16.475  1.00 23.42 ? 134 MET C CB  1 
ATOM 4682  C CG  . MET C 1 134 ? -7.566  147.755 15.585  1.00 22.49 ? 134 MET C CG  1 
ATOM 4683  S SD  . MET C 1 134 ? -8.957  148.571 16.384  1.00 20.03 ? 134 MET C SD  1 
ATOM 4684  C CE  . MET C 1 134 ? -10.151 147.313 16.421  1.00 22.91 ? 134 MET C CE  1 
ATOM 4685  N N   . GLN C 1 135 ? -4.566  144.653 15.026  1.00 23.96 ? 135 GLN C N   1 
ATOM 4686  C CA  . GLN C 1 135 ? -3.466  144.531 14.079  1.00 25.13 ? 135 GLN C CA  1 
ATOM 4687  C C   . GLN C 1 135 ? -3.953  143.657 12.937  1.00 24.12 ? 135 GLN C C   1 
ATOM 4688  O O   . GLN C 1 135 ? -3.652  143.913 11.773  1.00 23.45 ? 135 GLN C O   1 
ATOM 4689  C CB  . GLN C 1 135 ? -2.259  143.871 14.743  1.00 26.32 ? 135 GLN C CB  1 
ATOM 4690  C CG  . GLN C 1 135 ? -1.114  143.544 13.795  1.00 24.72 ? 135 GLN C CG  1 
ATOM 4691  C CD  . GLN C 1 135 ? -0.074  142.643 14.434  1.00 23.86 ? 135 GLN C CD  1 
ATOM 4692  O OE1 . GLN C 1 135 ? 0.019   142.552 15.659  1.00 20.06 ? 135 GLN C OE1 1 
ATOM 4693  N NE2 . GLN C 1 135 ? 0.703   141.954 13.608  1.00 23.18 ? 135 GLN C NE2 1 
ATOM 4694  N N   . HIS C 1 136 ? -4.736  142.639 13.285  1.00 23.02 ? 136 HIS C N   1 
ATOM 4695  C CA  . HIS C 1 136 ? -5.290  141.715 12.301  1.00 24.15 ? 136 HIS C CA  1 
ATOM 4696  C C   . HIS C 1 136 ? -6.346  142.382 11.424  1.00 21.21 ? 136 HIS C C   1 
ATOM 4697  O O   . HIS C 1 136 ? -6.500  142.026 10.254  1.00 22.58 ? 136 HIS C O   1 
ATOM 4698  C CB  . HIS C 1 136 ? -5.879  140.476 12.983  1.00 24.38 ? 136 HIS C CB  1 
ATOM 4699  C CG  . HIS C 1 136 ? -4.868  139.627 13.688  1.00 24.37 ? 136 HIS C CG  1 
ATOM 4700  N ND1 . HIS C 1 136 ? -5.017  139.225 14.998  1.00 23.41 ? 136 HIS C ND1 1 
ATOM 4701  C CD2 . HIS C 1 136 ? -3.694  139.098 13.267  1.00 24.90 ? 136 HIS C CD2 1 
ATOM 4702  C CE1 . HIS C 1 136 ? -3.979  138.491 15.355  1.00 24.11 ? 136 HIS C CE1 1 
ATOM 4703  N NE2 . HIS C 1 136 ? -3.163  138.399 14.324  1.00 27.15 ? 136 HIS C NE2 1 
ATOM 4704  N N   . PHE C 1 137 ? -7.082  143.336 11.989  1.00 17.57 ? 137 PHE C N   1 
ATOM 4705  C CA  . PHE C 1 137 ? -8.101  144.050 11.224  1.00 19.67 ? 137 PHE C CA  1 
ATOM 4706  C C   . PHE C 1 137 ? -7.447  144.816 10.078  1.00 18.23 ? 137 PHE C C   1 
ATOM 4707  O O   . PHE C 1 137 ? -7.817  144.646 8.916   1.00 18.14 ? 137 PHE C O   1 
ATOM 4708  C CB  . PHE C 1 137 ? -8.935  144.979 12.120  1.00 18.11 ? 137 PHE C CB  1 
ATOM 4709  C CG  . PHE C 1 137 ? -10.060 144.272 12.837  1.00 19.93 ? 137 PHE C CG  1 
ATOM 4710  C CD1 . PHE C 1 137 ? -10.930 143.443 12.136  1.00 20.09 ? 137 PHE C CD1 1 
ATOM 4711  C CD2 . PHE C 1 137 ? -10.226 144.399 14.209  1.00 19.23 ? 137 PHE C CD2 1 
ATOM 4712  C CE1 . PHE C 1 137 ? -11.943 142.750 12.788  1.00 15.55 ? 137 PHE C CE1 1 
ATOM 4713  C CE2 . PHE C 1 137 ? -11.242 143.707 14.873  1.00 17.91 ? 137 PHE C CE2 1 
ATOM 4714  C CZ  . PHE C 1 137 ? -12.098 142.881 14.158  1.00 17.49 ? 137 PHE C CZ  1 
ATOM 4715  N N   . SER C 1 138 ? -6.446  145.628 10.397  1.00 16.72 ? 138 SER C N   1 
ATOM 4716  C CA  . SER C 1 138 ? -5.738  146.372 9.366   1.00 16.31 ? 138 SER C CA  1 
ATOM 4717  C C   . SER C 1 138 ? -4.951  145.395 8.486   1.00 18.59 ? 138 SER C C   1 
ATOM 4718  O O   . SER C 1 138 ? -4.667  145.692 7.328   1.00 16.40 ? 138 SER C O   1 
ATOM 4719  C CB  . SER C 1 138 ? -4.792  147.391 9.992   1.00 17.37 ? 138 SER C CB  1 
ATOM 4720  O OG  . SER C 1 138 ? -4.097  148.111 8.992   1.00 10.55 ? 138 SER C OG  1 
ATOM 4721  N N   . GLN C 1 139 ? -4.593  144.241 9.046   1.00 19.54 ? 139 GLN C N   1 
ATOM 4722  C CA  . GLN C 1 139 ? -3.854  143.213 8.315   1.00 21.24 ? 139 GLN C CA  1 
ATOM 4723  C C   . GLN C 1 139 ? -4.750  142.654 7.213   1.00 21.03 ? 139 GLN C C   1 
ATOM 4724  O O   . GLN C 1 139 ? -4.300  142.437 6.088   1.00 20.93 ? 139 GLN C O   1 
ATOM 4725  C CB  . GLN C 1 139 ? -3.436  142.079 9.270   1.00 22.63 ? 139 GLN C CB  1 
ATOM 4726  C CG  . GLN C 1 139 ? -2.553  140.978 8.673   1.00 22.66 ? 139 GLN C CG  1 
ATOM 4727  C CD  . GLN C 1 139 ? -1.063  141.192 8.924   1.00 21.97 ? 139 GLN C CD  1 
ATOM 4728  O OE1 . GLN C 1 139 ? -0.625  141.320 10.069  1.00 25.97 ? 139 GLN C OE1 1 
ATOM 4729  N NE2 . GLN C 1 139 ? -0.280  141.210 7.854   1.00 21.25 ? 139 GLN C NE2 1 
ATOM 4730  N N   . PHE C 1 140 ? -6.026  142.464 7.542   1.00 19.12 ? 140 PHE C N   1 
ATOM 4731  C CA  . PHE C 1 140 ? -7.013  141.917 6.613   1.00 16.00 ? 140 PHE C CA  1 
ATOM 4732  C C   . PHE C 1 140 ? -7.416  142.868 5.482   1.00 13.78 ? 140 PHE C C   1 
ATOM 4733  O O   . PHE C 1 140 ? -7.637  142.428 4.354   1.00 12.86 ? 140 PHE C O   1 
ATOM 4734  C CB  . PHE C 1 140 ? -8.256  141.467 7.383   1.00 14.36 ? 140 PHE C CB  1 
ATOM 4735  C CG  . PHE C 1 140 ? -9.118  140.495 6.633   1.00 13.81 ? 140 PHE C CG  1 
ATOM 4736  C CD1 . PHE C 1 140 ? -8.811  139.139 6.629   1.00 11.96 ? 140 PHE C CD1 1 
ATOM 4737  C CD2 . PHE C 1 140 ? -10.253 140.925 5.957   1.00 13.21 ? 140 PHE C CD2 1 
ATOM 4738  C CE1 . PHE C 1 140 ? -9.623  138.209 5.967   1.00 9.08  ? 140 PHE C CE1 1 
ATOM 4739  C CE2 . PHE C 1 140 ? -11.073 140.018 5.294   1.00 12.13 ? 140 PHE C CE2 1 
ATOM 4740  C CZ  . PHE C 1 140 ? -10.757 138.661 5.299   1.00 7.81  ? 140 PHE C CZ  1 
ATOM 4741  N N   . LEU C 1 141 ? -7.570  144.153 5.804   1.00 9.09  ? 141 LEU C N   1 
ATOM 4742  C CA  . LEU C 1 141 ? -7.943  145.167 4.817   1.00 9.73  ? 141 LEU C CA  1 
ATOM 4743  C C   . LEU C 1 141 ? -6.766  145.449 3.882   1.00 12.70 ? 141 LEU C C   1 
ATOM 4744  O O   . LEU C 1 141 ? -6.884  145.334 2.660   1.00 13.94 ? 141 LEU C O   1 
ATOM 4745  C CB  . LEU C 1 141 ? -8.387  146.455 5.520   1.00 4.21  ? 141 LEU C CB  1 
ATOM 4746  C CG  . LEU C 1 141 ? -8.629  147.698 4.658   1.00 4.20  ? 141 LEU C CG  1 
ATOM 4747  C CD1 . LEU C 1 141 ? -9.636  147.390 3.561   1.00 2.00  ? 141 LEU C CD1 1 
ATOM 4748  C CD2 . LEU C 1 141 ? -9.107  148.853 5.529   1.00 4.35  ? 141 LEU C CD2 1 
ATOM 4749  N N   . GLY C 1 142 ? -5.635  145.825 4.468   1.00 15.03 ? 142 GLY C N   1 
ATOM 4750  C CA  . GLY C 1 142 ? -4.443  146.103 3.692   1.00 16.36 ? 142 GLY C CA  1 
ATOM 4751  C C   . GLY C 1 142 ? -4.634  147.069 2.543   1.00 16.58 ? 142 GLY C C   1 
ATOM 4752  O O   . GLY C 1 142 ? -5.492  147.941 2.579   1.00 13.90 ? 142 GLY C O   1 
ATOM 4753  N N   . LYS C 1 143 ? -3.838  146.869 1.500   1.00 17.20 ? 143 LYS C N   1 
ATOM 4754  C CA  . LYS C 1 143 ? -3.855  147.709 0.311   1.00 18.91 ? 143 LYS C CA  1 
ATOM 4755  C C   . LYS C 1 143 ? -5.089  147.602 -0.554  1.00 20.98 ? 143 LYS C C   1 
ATOM 4756  O O   . LYS C 1 143 ? -4.980  147.400 -1.775  1.00 25.41 ? 143 LYS C O   1 
ATOM 4757  C CB  . LYS C 1 143 ? -2.610  147.440 -0.534  1.00 21.05 ? 143 LYS C CB  1 
ATOM 4758  C CG  . LYS C 1 143 ? -1.351  148.058 0.025   1.00 24.61 ? 143 LYS C CG  1 
ATOM 4759  C CD  . LYS C 1 143 ? -0.121  147.665 -0.773  1.00 25.08 ? 143 LYS C CD  1 
ATOM 4760  C CE  . LYS C 1 143 ? 0.317   146.245 -0.463  1.00 28.81 ? 143 LYS C CE  1 
ATOM 4761  N NZ  . LYS C 1 143 ? 1.608   145.932 -1.128  1.00 29.19 ? 143 LYS C NZ  1 
ATOM 4762  N N   . ARG C 1 144 ? -6.265  147.770 -0.009  1.00 16.67 ? 144 ARG C N   1 
ATOM 4763  C CA  . ARG C 1 144 ? -7.477  147.698 -0.785  1.00 14.80 ? 144 ARG C CA  1 
ATOM 4764  C C   . ARG C 1 144 ? -8.545  148.539 -0.116  1.00 17.65 ? 144 ARG C C   1 
ATOM 4765  O O   . ARG C 1 144 ? -8.503  148.754 1.095   1.00 23.69 ? 144 ARG C O   1 
ATOM 4766  C CB  . ARG C 1 144 ? -7.938  146.254 -0.952  1.00 15.77 ? 144 ARG C CB  1 
ATOM 4767  C CG  . ARG C 1 144 ? -8.585  145.654 0.265   1.00 15.63 ? 144 ARG C CG  1 
ATOM 4768  C CD  . ARG C 1 144 ? -8.914  144.209 0.001   1.00 14.13 ? 144 ARG C CD  1 
ATOM 4769  N NE  . ARG C 1 144 ? -7.710  143.395 -0.048  1.00 13.45 ? 144 ARG C NE  1 
ATOM 4770  C CZ  . ARG C 1 144 ? -7.417  142.471 0.857   1.00 11.55 ? 144 ARG C CZ  1 
ATOM 4771  N NH1 . ARG C 1 144 ? -8.252  142.258 1.863   1.00 11.99 ? 144 ARG C NH1 1 
ATOM 4772  N NH2 . ARG C 1 144 ? -6.282  141.788 0.776   1.00 7.01  ? 144 ARG C NH2 1 
ATOM 4773  N N   . PRO C 1 145 ? -9.507  149.047 -0.898  1.00 16.89 ? 145 PRO C N   1 
ATOM 4774  C CA  . PRO C 1 145 ? -10.562 149.874 -0.309  1.00 15.93 ? 145 PRO C CA  1 
ATOM 4775  C C   . PRO C 1 145 ? -11.438 149.131 0.714   1.00 15.58 ? 145 PRO C C   1 
ATOM 4776  O O   . PRO C 1 145 ? -11.396 149.451 1.905   1.00 15.43 ? 145 PRO C O   1 
ATOM 4777  C CB  . PRO C 1 145 ? -11.351 150.347 -1.540  1.00 16.24 ? 145 PRO C CB  1 
ATOM 4778  C CG  . PRO C 1 145 ? -11.167 149.229 -2.516  1.00 17.21 ? 145 PRO C CG  1 
ATOM 4779  C CD  . PRO C 1 145 ? -9.716  148.864 -2.347  1.00 18.05 ? 145 PRO C CD  1 
ATOM 4780  N N   . TRP C 1 146 ? -12.222 148.183 0.270   1.00 13.18 ? 146 TRP C N   1 
ATOM 4781  C CA  . TRP C 1 146 ? -13.113 147.458 1.143   1.00 12.30 ? 146 TRP C CA  1 
ATOM 4782  C C   . TRP C 1 146 ? -12.442 146.178 1.592   1.00 13.09 ? 146 TRP C C   1 
ATOM 4783  O O   . TRP C 1 146 ? -11.601 145.634 0.890   1.00 15.62 ? 146 TRP C O   1 
ATOM 4784  C CB  . TRP C 1 146 ? -14.446 147.175 0.437   1.00 13.29 ? 146 TRP C CB  1 
ATOM 4785  C CG  . TRP C 1 146 ? -15.036 148.412 -0.202  1.00 13.55 ? 146 TRP C CG  1 
ATOM 4786  C CD1 . TRP C 1 146 ? -15.050 148.718 -1.532  1.00 9.73  ? 146 TRP C CD1 1 
ATOM 4787  C CD2 . TRP C 1 146 ? -15.623 149.534 0.470   1.00 12.42 ? 146 TRP C CD2 1 
ATOM 4788  N NE1 . TRP C 1 146 ? -15.597 149.958 -1.728  1.00 12.91 ? 146 TRP C NE1 1 
ATOM 4789  C CE2 . TRP C 1 146 ? -15.959 150.482 -0.515  1.00 11.54 ? 146 TRP C CE2 1 
ATOM 4790  C CE3 . TRP C 1 146 ? -15.896 149.829 1.812   1.00 9.02  ? 146 TRP C CE3 1 
ATOM 4791  C CZ2 . TRP C 1 146 ? -16.552 151.702 -0.205  1.00 11.21 ? 146 TRP C CZ2 1 
ATOM 4792  C CZ3 . TRP C 1 146 ? -16.486 151.042 2.121   1.00 5.46  ? 146 TRP C CZ3 1 
ATOM 4793  C CH2 . TRP C 1 146 ? -16.808 151.963 1.115   1.00 11.76 ? 146 TRP C CH2 1 
ATOM 4794  N N   . PHE C 1 147 ? -12.804 145.712 2.779   1.00 11.41 ? 147 PHE C N   1 
ATOM 4795  C CA  . PHE C 1 147 ? -12.230 144.498 3.334   1.00 11.51 ? 147 PHE C CA  1 
ATOM 4796  C C   . PHE C 1 147 ? -12.161 143.330 2.358   1.00 13.80 ? 147 PHE C C   1 
ATOM 4797  O O   . PHE C 1 147 ? -11.095 142.770 2.135   1.00 14.85 ? 147 PHE C O   1 
ATOM 4798  C CB  . PHE C 1 147 ? -12.995 144.108 4.590   1.00 12.87 ? 147 PHE C CB  1 
ATOM 4799  C CG  . PHE C 1 147 ? -12.515 144.773 5.838   1.00 9.81  ? 147 PHE C CG  1 
ATOM 4800  C CD1 . PHE C 1 147 ? -11.398 144.294 6.515   1.00 7.30  ? 147 PHE C CD1 1 
ATOM 4801  C CD2 . PHE C 1 147 ? -13.190 145.890 6.337   1.00 8.50  ? 147 PHE C CD2 1 
ATOM 4802  C CE1 . PHE C 1 147 ? -10.942 144.910 7.668   1.00 5.82  ? 147 PHE C CE1 1 
ATOM 4803  C CE2 . PHE C 1 147 ? -12.722 146.522 7.500   1.00 6.85  ? 147 PHE C CE2 1 
ATOM 4804  C CZ  . PHE C 1 147 ? -11.601 146.028 8.166   1.00 6.31  ? 147 PHE C CZ  1 
ATOM 4805  N N   . VAL C 1 148 ? -13.295 142.987 1.756   1.00 12.24 ? 148 VAL C N   1 
ATOM 4806  C CA  . VAL C 1 148 ? -13.362 141.873 0.810   1.00 11.60 ? 148 VAL C CA  1 
ATOM 4807  C C   . VAL C 1 148 ? -12.581 142.121 -0.480  1.00 12.77 ? 148 VAL C C   1 
ATOM 4808  O O   . VAL C 1 148 ? -12.190 141.180 -1.171  1.00 9.82  ? 148 VAL C O   1 
ATOM 4809  C CB  . VAL C 1 148 ? -14.829 141.544 0.447   1.00 8.32  ? 148 VAL C CB  1 
ATOM 4810  C CG1 . VAL C 1 148 ? -14.899 140.342 -0.444  1.00 6.28  ? 148 VAL C CG1 1 
ATOM 4811  C CG2 . VAL C 1 148 ? -15.628 141.286 1.697   1.00 6.49  ? 148 VAL C CG2 1 
ATOM 4812  N N   . GLY C 1 149 ? -12.368 143.389 -0.810  1.00 12.78 ? 149 GLY C N   1 
ATOM 4813  C CA  . GLY C 1 149 ? -11.652 143.729 -2.025  1.00 13.47 ? 149 GLY C CA  1 
ATOM 4814  C C   . GLY C 1 149 ? -12.033 145.116 -2.502  1.00 15.76 ? 149 GLY C C   1 
ATOM 4815  O O   . GLY C 1 149 ? -12.063 146.066 -1.721  1.00 15.30 ? 149 GLY C O   1 
ATOM 4816  N N   . ASP C 1 150 ? -12.316 145.245 -3.791  1.00 16.79 ? 150 ASP C N   1 
ATOM 4817  C CA  . ASP C 1 150 ? -12.704 146.533 -4.350  1.00 15.81 ? 150 ASP C CA  1 
ATOM 4818  C C   . ASP C 1 150 ? -14.222 146.663 -4.314  1.00 15.79 ? 150 ASP C C   1 
ATOM 4819  O O   . ASP C 1 150 ? -14.775 147.702 -4.670  1.00 14.48 ? 150 ASP C O   1 
ATOM 4820  C CB  . ASP C 1 150 ? -12.196 146.664 -5.794  1.00 19.25 ? 150 ASP C CB  1 
ATOM 4821  C CG  . ASP C 1 150 ? -10.673 146.700 -5.887  1.00 22.65 ? 150 ASP C CG  1 
ATOM 4822  O OD1 . ASP C 1 150 ? -10.007 145.791 -5.354  1.00 22.44 ? 150 ASP C OD1 1 
ATOM 4823  O OD2 . ASP C 1 150 ? -10.135 147.640 -6.507  1.00 24.55 ? 150 ASP C OD2 1 
ATOM 4824  N N   . LYS C 1 151 ? -14.884 145.594 -3.877  1.00 14.88 ? 151 LYS C N   1 
ATOM 4825  C CA  . LYS C 1 151 ? -16.345 145.532 -3.797  1.00 16.78 ? 151 LYS C CA  1 
ATOM 4826  C C   . LYS C 1 151 ? -16.868 145.872 -2.404  1.00 14.81 ? 151 LYS C C   1 
ATOM 4827  O O   . LYS C 1 151 ? -16.335 145.376 -1.406  1.00 17.25 ? 151 LYS C O   1 
ATOM 4828  C CB  . LYS C 1 151 ? -16.824 144.106 -4.123  1.00 17.86 ? 151 LYS C CB  1 
ATOM 4829  C CG  . LYS C 1 151 ? -16.620 143.639 -5.554  1.00 19.00 ? 151 LYS C CG  1 
ATOM 4830  C CD  . LYS C 1 151 ? -16.563 142.112 -5.637  1.00 21.00 ? 151 LYS C CD  1 
ATOM 4831  C CE  . LYS C 1 151 ? -17.713 141.421 -4.899  1.00 21.46 ? 151 LYS C CE  1 
ATOM 4832  N NZ  . LYS C 1 151 ? -19.063 141.689 -5.469  1.00 24.48 ? 151 LYS C NZ  1 
ATOM 4833  N N   . ILE C 1 152 ? -17.902 146.707 -2.321  1.00 11.33 ? 152 ILE C N   1 
ATOM 4834  C CA  . ILE C 1 152 ? -18.487 147.009 -1.017  1.00 10.61 ? 152 ILE C CA  1 
ATOM 4835  C C   . ILE C 1 152 ? -19.562 145.925 -0.783  1.00 9.57  ? 152 ILE C C   1 
ATOM 4836  O O   . ILE C 1 152 ? -20.425 145.702 -1.644  1.00 2.00  ? 152 ILE C O   1 
ATOM 4837  C CB  . ILE C 1 152 ? -19.111 148.398 -0.909  1.00 10.51 ? 152 ILE C CB  1 
ATOM 4838  C CG1 . ILE C 1 152 ? -19.781 148.549 0.464   1.00 5.71  ? 152 ILE C CG1 1 
ATOM 4839  C CG2 . ILE C 1 152 ? -20.101 148.632 -2.039  1.00 12.10 ? 152 ILE C CG2 1 
ATOM 4840  C CD1 . ILE C 1 152 ? -20.354 149.902 0.729   1.00 9.47  ? 152 ILE C CD1 1 
ATOM 4841  N N   . THR C 1 153 ? -19.453 145.233 0.349   1.00 10.86 ? 153 THR C N   1 
ATOM 4842  C CA  . THR C 1 153 ? -20.378 144.173 0.731   1.00 9.86  ? 153 THR C CA  1 
ATOM 4843  C C   . THR C 1 153 ? -20.937 144.522 2.108   1.00 10.36 ? 153 THR C C   1 
ATOM 4844  O O   . THR C 1 153 ? -20.562 145.547 2.683   1.00 11.01 ? 153 THR C O   1 
ATOM 4845  C CB  . THR C 1 153 ? -19.648 142.817 0.787   1.00 10.89 ? 153 THR C CB  1 
ATOM 4846  O OG1 . THR C 1 153 ? -18.362 142.994 1.391   1.00 15.25 ? 153 THR C OG1 1 
ATOM 4847  C CG2 . THR C 1 153 ? -19.453 142.247 -0.606  1.00 8.23  ? 153 THR C CG2 1 
ATOM 4848  N N   . PHE C 1 154 ? -21.803 143.676 2.657   1.00 10.63 ? 154 PHE C N   1 
ATOM 4849  C CA  . PHE C 1 154 ? -22.379 143.960 3.968   1.00 11.50 ? 154 PHE C CA  1 
ATOM 4850  C C   . PHE C 1 154 ? -21.383 143.932 5.132   1.00 13.64 ? 154 PHE C C   1 
ATOM 4851  O O   . PHE C 1 154 ? -21.522 144.683 6.101   1.00 13.60 ? 154 PHE C O   1 
ATOM 4852  C CB  . PHE C 1 154 ? -23.599 143.067 4.251   1.00 9.47  ? 154 PHE C CB  1 
ATOM 4853  C CG  . PHE C 1 154 ? -23.271 141.628 4.551   1.00 7.21  ? 154 PHE C CG  1 
ATOM 4854  C CD1 . PHE C 1 154 ? -22.767 140.790 3.563   1.00 6.44  ? 154 PHE C CD1 1 
ATOM 4855  C CD2 . PHE C 1 154 ? -23.525 141.099 5.811   1.00 3.69  ? 154 PHE C CD2 1 
ATOM 4856  C CE1 . PHE C 1 154 ? -22.524 139.453 3.820   1.00 2.00  ? 154 PHE C CE1 1 
ATOM 4857  C CE2 . PHE C 1 154 ? -23.285 139.760 6.081   1.00 2.98  ? 154 PHE C CE2 1 
ATOM 4858  C CZ  . PHE C 1 154 ? -22.784 138.934 5.080   1.00 3.24  ? 154 PHE C CZ  1 
ATOM 4859  N N   . VAL C 1 155 ? -20.347 143.113 5.007   1.00 12.21 ? 155 VAL C N   1 
ATOM 4860  C CA  . VAL C 1 155 ? -19.337 142.995 6.056   1.00 13.19 ? 155 VAL C CA  1 
ATOM 4861  C C   . VAL C 1 155 ? -18.664 144.316 6.416   1.00 11.51 ? 155 VAL C C   1 
ATOM 4862  O O   . VAL C 1 155 ? -18.192 144.483 7.537   1.00 5.31  ? 155 VAL C O   1 
ATOM 4863  C CB  . VAL C 1 155 ? -18.247 141.965 5.693   1.00 14.57 ? 155 VAL C CB  1 
ATOM 4864  C CG1 . VAL C 1 155 ? -18.859 140.577 5.537   1.00 12.86 ? 155 VAL C CG1 1 
ATOM 4865  C CG2 . VAL C 1 155 ? -17.525 142.386 4.425   1.00 7.90  ? 155 VAL C CG2 1 
ATOM 4866  N N   . ASP C 1 156 ? -18.621 145.250 5.470   1.00 11.89 ? 156 ASP C N   1 
ATOM 4867  C CA  . ASP C 1 156 ? -18.008 146.560 5.708   1.00 14.79 ? 156 ASP C CA  1 
ATOM 4868  C C   . ASP C 1 156 ? -18.850 147.380 6.685   1.00 14.02 ? 156 ASP C C   1 
ATOM 4869  O O   . ASP C 1 156 ? -18.345 148.280 7.361   1.00 12.17 ? 156 ASP C O   1 
ATOM 4870  C CB  . ASP C 1 156 ? -17.814 147.317 4.389   1.00 14.54 ? 156 ASP C CB  1 
ATOM 4871  C CG  . ASP C 1 156 ? -16.787 146.652 3.483   1.00 17.95 ? 156 ASP C CG  1 
ATOM 4872  O OD1 . ASP C 1 156 ? -15.574 146.806 3.744   1.00 13.53 ? 156 ASP C OD1 1 
ATOM 4873  O OD2 . ASP C 1 156 ? -17.188 145.970 2.517   1.00 18.80 ? 156 ASP C OD2 1 
ATOM 4874  N N   . PHE C 1 157 ? -20.134 147.048 6.761   1.00 16.66 ? 157 PHE C N   1 
ATOM 4875  C CA  . PHE C 1 157 ? -21.042 147.723 7.667   1.00 15.80 ? 157 PHE C CA  1 
ATOM 4876  C C   . PHE C 1 157 ? -20.752 147.213 9.072   1.00 13.84 ? 157 PHE C C   1 
ATOM 4877  O O   . PHE C 1 157 ? -20.649 147.995 10.019  1.00 11.73 ? 157 PHE C O   1 
ATOM 4878  C CB  . PHE C 1 157 ? -22.490 147.455 7.248   1.00 15.34 ? 157 PHE C CB  1 
ATOM 4879  C CG  . PHE C 1 157 ? -22.837 148.047 5.915   1.00 12.96 ? 157 PHE C CG  1 
ATOM 4880  C CD1 . PHE C 1 157 ? -22.574 147.350 4.743   1.00 13.31 ? 157 PHE C CD1 1 
ATOM 4881  C CD2 . PHE C 1 157 ? -23.364 149.331 5.827   1.00 13.90 ? 157 PHE C CD2 1 
ATOM 4882  C CE1 . PHE C 1 157 ? -22.822 147.924 3.505   1.00 18.09 ? 157 PHE C CE1 1 
ATOM 4883  C CE2 . PHE C 1 157 ? -23.616 149.932 4.593   1.00 13.49 ? 157 PHE C CE2 1 
ATOM 4884  C CZ  . PHE C 1 157 ? -23.343 149.210 3.429   1.00 17.87 ? 157 PHE C CZ  1 
ATOM 4885  N N   . LEU C 1 158 ? -20.555 145.902 9.190   1.00 13.21 ? 158 LEU C N   1 
ATOM 4886  C CA  . LEU C 1 158 ? -20.245 145.293 10.480  1.00 13.28 ? 158 LEU C CA  1 
ATOM 4887  C C   . LEU C 1 158 ? -18.910 145.809 10.999  1.00 12.24 ? 158 LEU C C   1 
ATOM 4888  O O   . LEU C 1 158 ? -18.821 146.306 12.124  1.00 13.55 ? 158 LEU C O   1 
ATOM 4889  C CB  . LEU C 1 158 ? -20.201 143.769 10.365  1.00 5.90  ? 158 LEU C CB  1 
ATOM 4890  C CG  . LEU C 1 158 ? -21.532 143.038 10.506  1.00 2.55  ? 158 LEU C CG  1 
ATOM 4891  C CD1 . LEU C 1 158 ? -21.324 141.539 10.349  1.00 2.00  ? 158 LEU C CD1 1 
ATOM 4892  C CD2 . LEU C 1 158 ? -22.118 143.348 11.870  1.00 2.02  ? 158 LEU C CD2 1 
ATOM 4893  N N   . ALA C 1 159 ? -17.891 145.724 10.150  1.00 12.33 ? 159 ALA C N   1 
ATOM 4894  C CA  . ALA C 1 159 ? -16.545 146.168 10.490  1.00 13.60 ? 159 ALA C CA  1 
ATOM 4895  C C   . ALA C 1 159 ? -16.508 147.616 10.957  1.00 12.80 ? 159 ALA C C   1 
ATOM 4896  O O   . ALA C 1 159 ? -15.869 147.896 11.961  1.00 10.69 ? 159 ALA C O   1 
ATOM 4897  C CB  . ALA C 1 159 ? -15.613 145.963 9.317   1.00 11.92 ? 159 ALA C CB  1 
ATOM 4898  N N   . TYR C 1 160 ? -17.198 148.507 10.245  1.00 13.21 ? 160 TYR C N   1 
ATOM 4899  C CA  . TYR C 1 160 ? -17.252 149.921 10.621  1.00 11.23 ? 160 TYR C CA  1 
ATOM 4900  C C   . TYR C 1 160 ? -17.842 150.076 12.025  1.00 12.22 ? 160 TYR C C   1 
ATOM 4901  O O   . TYR C 1 160 ? -17.390 150.916 12.801  1.00 10.37 ? 160 TYR C O   1 
ATOM 4902  C CB  . TYR C 1 160 ? -18.070 150.720 9.606   1.00 7.22  ? 160 TYR C CB  1 
ATOM 4903  C CG  . TYR C 1 160 ? -18.541 152.099 10.084  1.00 4.57  ? 160 TYR C CG  1 
ATOM 4904  C CD1 . TYR C 1 160 ? -19.652 152.249 10.949  1.00 5.32  ? 160 TYR C CD1 1 
ATOM 4905  C CD2 . TYR C 1 160 ? -17.878 153.258 9.678   1.00 2.80  ? 160 TYR C CD2 1 
ATOM 4906  C CE1 . TYR C 1 160 ? -20.051 153.487 11.397  1.00 4.95  ? 160 TYR C CE1 1 
ATOM 4907  C CE2 . TYR C 1 160 ? -18.290 154.513 10.121  1.00 3.82  ? 160 TYR C CE2 1 
ATOM 4908  C CZ  . TYR C 1 160 ? -19.374 154.616 10.983  1.00 7.71  ? 160 TYR C CZ  1 
ATOM 4909  O OH  . TYR C 1 160 ? -19.776 155.841 11.457  1.00 10.91 ? 160 TYR C OH  1 
ATOM 4910  N N   . ASP C 1 161 ? -18.863 149.280 12.336  1.00 13.99 ? 161 ASP C N   1 
ATOM 4911  C CA  . ASP C 1 161 ? -19.515 149.331 13.641  1.00 14.59 ? 161 ASP C CA  1 
ATOM 4912  C C   . ASP C 1 161 ? -18.591 148.797 14.732  1.00 16.43 ? 161 ASP C C   1 
ATOM 4913  O O   . ASP C 1 161 ? -18.483 149.390 15.808  1.00 16.00 ? 161 ASP C O   1 
ATOM 4914  C CB  . ASP C 1 161 ? -20.813 148.526 13.618  1.00 15.24 ? 161 ASP C CB  1 
ATOM 4915  C CG  . ASP C 1 161 ? -21.591 148.635 14.915  1.00 15.14 ? 161 ASP C CG  1 
ATOM 4916  O OD1 . ASP C 1 161 ? -21.985 149.757 15.288  1.00 19.20 ? 161 ASP C OD1 1 
ATOM 4917  O OD2 . ASP C 1 161 ? -21.818 147.587 15.557  1.00 15.87 ? 161 ASP C OD2 1 
ATOM 4918  N N   . VAL C 1 162 ? -17.935 147.674 14.447  1.00 17.96 ? 162 VAL C N   1 
ATOM 4919  C CA  . VAL C 1 162 ? -17.001 147.039 15.377  1.00 17.59 ? 162 VAL C CA  1 
ATOM 4920  C C   . VAL C 1 162 ? -15.877 147.999 15.745  1.00 19.31 ? 162 VAL C C   1 
ATOM 4921  O O   . VAL C 1 162 ? -15.554 148.188 16.923  1.00 19.90 ? 162 VAL C O   1 
ATOM 4922  C CB  . VAL C 1 162 ? -16.386 145.790 14.744  1.00 17.48 ? 162 VAL C CB  1 
ATOM 4923  C CG1 . VAL C 1 162 ? -15.259 145.264 15.585  1.00 19.42 ? 162 VAL C CG1 1 
ATOM 4924  C CG2 . VAL C 1 162 ? -17.453 144.739 14.556  1.00 21.29 ? 162 VAL C CG2 1 
ATOM 4925  N N   . LEU C 1 163 ? -15.278 148.594 14.723  1.00 18.55 ? 163 LEU C N   1 
ATOM 4926  C CA  . LEU C 1 163 ? -14.195 149.542 14.913  1.00 16.94 ? 163 LEU C CA  1 
ATOM 4927  C C   . LEU C 1 163 ? -14.705 150.876 15.489  1.00 17.73 ? 163 LEU C C   1 
ATOM 4928  O O   . LEU C 1 163 ? -14.047 151.467 16.347  1.00 20.11 ? 163 LEU C O   1 
ATOM 4929  C CB  . LEU C 1 163 ? -13.450 149.775 13.588  1.00 14.16 ? 163 LEU C CB  1 
ATOM 4930  C CG  . LEU C 1 163 ? -12.939 148.568 12.778  1.00 13.53 ? 163 LEU C CG  1 
ATOM 4931  C CD1 . LEU C 1 163 ? -12.342 149.052 11.465  1.00 11.84 ? 163 LEU C CD1 1 
ATOM 4932  C CD2 . LEU C 1 163 ? -11.920 147.752 13.541  1.00 12.49 ? 163 LEU C CD2 1 
ATOM 4933  N N   . ASP C 1 164 ? -15.883 151.334 15.065  1.00 17.81 ? 164 ASP C N   1 
ATOM 4934  C CA  . ASP C 1 164 ? -16.405 152.603 15.573  1.00 14.64 ? 164 ASP C CA  1 
ATOM 4935  C C   . ASP C 1 164 ? -16.624 152.628 17.084  1.00 13.91 ? 164 ASP C C   1 
ATOM 4936  O O   . ASP C 1 164 ? -16.216 153.576 17.752  1.00 13.32 ? 164 ASP C O   1 
ATOM 4937  C CB  . ASP C 1 164 ? -17.687 153.041 14.848  1.00 10.50 ? 164 ASP C CB  1 
ATOM 4938  C CG  . ASP C 1 164 ? -18.205 154.392 15.347  1.00 6.89  ? 164 ASP C CG  1 
ATOM 4939  O OD1 . ASP C 1 164 ? -17.426 155.341 15.428  1.00 3.71  ? 164 ASP C OD1 1 
ATOM 4940  O OD2 . ASP C 1 164 ? -19.400 154.509 15.687  1.00 8.99  ? 164 ASP C OD2 1 
ATOM 4941  N N   . LEU C 1 165 ? -17.262 151.605 17.626  1.00 13.71 ? 165 LEU C N   1 
ATOM 4942  C CA  . LEU C 1 165 ? -17.519 151.558 19.067  1.00 11.91 ? 165 LEU C CA  1 
ATOM 4943  C C   . LEU C 1 165 ? -16.179 151.665 19.778  1.00 13.69 ? 165 LEU C C   1 
ATOM 4944  O O   . LEU C 1 165 ? -16.050 152.354 20.794  1.00 10.91 ? 165 LEU C O   1 
ATOM 4945  C CB  . LEU C 1 165 ? -18.185 150.238 19.480  1.00 10.29 ? 165 LEU C CB  1 
ATOM 4946  C CG  . LEU C 1 165 ? -19.681 149.955 19.302  1.00 4.57  ? 165 LEU C CG  1 
ATOM 4947  C CD1 . LEU C 1 165 ? -19.947 148.506 19.704  1.00 3.34  ? 165 LEU C CD1 1 
ATOM 4948  C CD2 . LEU C 1 165 ? -20.529 150.902 20.142  1.00 6.10  ? 165 LEU C CD2 1 
ATOM 4949  N N   . HIS C 1 166 ? -15.175 150.990 19.221  1.00 16.28 ? 166 HIS C N   1 
ATOM 4950  C CA  . HIS C 1 166 ? -13.837 150.991 19.799  1.00 18.06 ? 166 HIS C CA  1 
ATOM 4951  C C   . HIS C 1 166 ? -13.229 152.389 19.896  1.00 20.45 ? 166 HIS C C   1 
ATOM 4952  O O   . HIS C 1 166 ? -12.555 152.680 20.876  1.00 21.55 ? 166 HIS C O   1 
ATOM 4953  C CB  . HIS C 1 166 ? -12.915 150.026 19.049  1.00 16.30 ? 166 HIS C CB  1 
ATOM 4954  C CG  . HIS C 1 166 ? -13.164 148.583 19.369  1.00 14.36 ? 166 HIS C CG  1 
ATOM 4955  N ND1 . HIS C 1 166 ? -14.354 148.127 19.894  1.00 16.62 ? 166 HIS C ND1 1 
ATOM 4956  C CD2 . HIS C 1 166 ? -12.366 147.494 19.259  1.00 14.24 ? 166 HIS C CD2 1 
ATOM 4957  C CE1 . HIS C 1 166 ? -14.278 146.826 20.097  1.00 16.40 ? 166 HIS C CE1 1 
ATOM 4958  N NE2 . HIS C 1 166 ? -13.081 146.418 19.721  1.00 15.77 ? 166 HIS C NE2 1 
ATOM 4959  N N   . ARG C 1 167 ? -13.503 153.271 18.934  1.00 22.17 ? 167 ARG C N   1 
ATOM 4960  C CA  . ARG C 1 167 ? -12.953 154.631 18.992  1.00 21.25 ? 167 ARG C CA  1 
ATOM 4961  C C   . ARG C 1 167 ? -13.678 155.508 20.014  1.00 22.43 ? 167 ARG C C   1 
ATOM 4962  O O   . ARG C 1 167 ? -13.291 156.648 20.242  1.00 23.68 ? 167 ARG C O   1 
ATOM 4963  C CB  . ARG C 1 167 ? -12.944 155.297 17.618  1.00 19.23 ? 167 ARG C CB  1 
ATOM 4964  C CG  . ARG C 1 167 ? -14.302 155.565 17.057  1.00 12.97 ? 167 ARG C CG  1 
ATOM 4965  C CD  . ARG C 1 167 ? -14.319 155.192 15.604  1.00 16.12 ? 167 ARG C CD  1 
ATOM 4966  N NE  . ARG C 1 167 ? -13.797 156.232 14.740  1.00 14.17 ? 167 ARG C NE  1 
ATOM 4967  C CZ  . ARG C 1 167 ? -14.534 156.936 13.888  1.00 10.81 ? 167 ARG C CZ  1 
ATOM 4968  N NH1 . ARG C 1 167 ? -15.834 156.713 13.790  1.00 8.81  ? 167 ARG C NH1 1 
ATOM 4969  N NH2 . ARG C 1 167 ? -13.966 157.826 13.096  1.00 4.38  ? 167 ARG C NH2 1 
ATOM 4970  N N   . ILE C 1 168 ? -14.754 154.986 20.594  1.00 19.95 ? 168 ILE C N   1 
ATOM 4971  C CA  . ILE C 1 168 ? -15.502 155.702 21.621  1.00 19.72 ? 168 ILE C CA  1 
ATOM 4972  C C   . ILE C 1 168 ? -14.977 155.179 22.958  1.00 21.24 ? 168 ILE C C   1 
ATOM 4973  O O   . ILE C 1 168 ? -14.901 155.900 23.951  1.00 19.82 ? 168 ILE C O   1 
ATOM 4974  C CB  . ILE C 1 168 ? -17.018 155.406 21.524  1.00 20.32 ? 168 ILE C CB  1 
ATOM 4975  C CG1 . ILE C 1 168 ? -17.546 155.812 20.148  1.00 19.38 ? 168 ILE C CG1 1 
ATOM 4976  C CG2 . ILE C 1 168 ? -17.779 156.155 22.606  1.00 21.51 ? 168 ILE C CG2 1 
ATOM 4977  C CD1 . ILE C 1 168 ? -19.049 155.672 19.999  1.00 19.74 ? 168 ILE C CD1 1 
ATOM 4978  N N   . PHE C 1 169 ? -14.628 153.899 22.952  1.00 22.74 ? 169 PHE C N   1 
ATOM 4979  C CA  . PHE C 1 169 ? -14.100 153.187 24.109  1.00 23.53 ? 169 PHE C CA  1 
ATOM 4980  C C   . PHE C 1 169 ? -12.658 153.651 24.346  1.00 24.34 ? 169 PHE C C   1 
ATOM 4981  O O   . PHE C 1 169 ? -12.322 154.200 25.396  1.00 21.31 ? 169 PHE C O   1 
ATOM 4982  C CB  . PHE C 1 169 ? -14.125 151.685 23.788  1.00 22.41 ? 169 PHE C CB  1 
ATOM 4983  C CG  . PHE C 1 169 ? -13.948 150.786 24.975  1.00 23.14 ? 169 PHE C CG  1 
ATOM 4984  C CD1 . PHE C 1 169 ? -12.678 150.429 25.417  1.00 21.97 ? 169 PHE C CD1 1 
ATOM 4985  C CD2 . PHE C 1 169 ? -15.056 150.242 25.615  1.00 22.25 ? 169 PHE C CD2 1 
ATOM 4986  C CE1 . PHE C 1 169 ? -12.515 149.537 26.475  1.00 21.65 ? 169 PHE C CE1 1 
ATOM 4987  C CE2 . PHE C 1 169 ? -14.903 149.351 26.672  1.00 21.99 ? 169 PHE C CE2 1 
ATOM 4988  C CZ  . PHE C 1 169 ? -13.631 148.998 27.102  1.00 21.83 ? 169 PHE C CZ  1 
ATOM 4989  N N   . GLU C 1 170 ? -11.830 153.438 23.329  1.00 27.80 ? 170 GLU C N   1 
ATOM 4990  C CA  . GLU C 1 170 ? -10.413 153.778 23.331  1.00 28.44 ? 170 GLU C CA  1 
ATOM 4991  C C   . GLU C 1 170 ? -10.070 154.434 21.991  1.00 27.29 ? 170 GLU C C   1 
ATOM 4992  O O   . GLU C 1 170 ? -9.418  153.829 21.144  1.00 28.04 ? 170 GLU C O   1 
ATOM 4993  C CB  . GLU C 1 170 ? -9.600  152.490 23.486  1.00 28.19 ? 170 GLU C CB  1 
ATOM 4994  C CG  . GLU C 1 170 ? -8.108  152.694 23.532  1.00 33.44 ? 170 GLU C CG  1 
ATOM 4995  C CD  . GLU C 1 170 ? -7.683  153.467 24.750  1.00 34.18 ? 170 GLU C CD  1 
ATOM 4996  O OE1 . GLU C 1 170 ? -8.006  153.025 25.873  1.00 29.33 ? 170 GLU C OE1 1 
ATOM 4997  O OE2 . GLU C 1 170 ? -7.035  154.522 24.584  1.00 36.16 ? 170 GLU C OE2 1 
ATOM 4998  N N   . PRO C 1 171 ? -10.446 155.708 21.814  1.00 25.11 ? 171 PRO C N   1 
ATOM 4999  C CA  . PRO C 1 171 ? -10.204 156.477 20.587  1.00 28.78 ? 171 PRO C CA  1 
ATOM 5000  C C   . PRO C 1 171 ? -8.915  156.211 19.806  1.00 30.51 ? 171 PRO C C   1 
ATOM 5001  O O   . PRO C 1 171 ? -8.950  155.658 18.707  1.00 31.44 ? 171 PRO C O   1 
ATOM 5002  C CB  . PRO C 1 171 ? -10.289 157.934 21.065  1.00 27.90 ? 171 PRO C CB  1 
ATOM 5003  C CG  . PRO C 1 171 ? -10.084 157.849 22.551  1.00 27.74 ? 171 PRO C CG  1 
ATOM 5004  C CD  . PRO C 1 171 ? -10.848 156.608 22.903  1.00 24.21 ? 171 PRO C CD  1 
ATOM 5005  N N   . ASN C 1 172 ? -7.777  156.569 20.383  1.00 27.43 ? 172 ASN C N   1 
ATOM 5006  C CA  . ASN C 1 172 ? -6.498  156.402 19.697  1.00 26.66 ? 172 ASN C CA  1 
ATOM 5007  C C   . ASN C 1 172 ? -5.894  155.008 19.517  1.00 26.48 ? 172 ASN C C   1 
ATOM 5008  O O   . ASN C 1 172 ? -4.672  154.865 19.499  1.00 28.57 ? 172 ASN C O   1 
ATOM 5009  C CB  . ASN C 1 172 ? -5.453  157.381 20.256  1.00 28.16 ? 172 ASN C CB  1 
ATOM 5010  C CG  . ASN C 1 172 ? -5.407  157.397 21.769  1.00 28.43 ? 172 ASN C CG  1 
ATOM 5011  O OD1 . ASN C 1 172 ? -6.440  157.493 22.439  1.00 26.57 ? 172 ASN C OD1 1 
ATOM 5012  N ND2 . ASN C 1 172 ? -4.204  157.336 22.320  1.00 29.08 ? 172 ASN C ND2 1 
ATOM 5013  N N   . CYS C 1 173 ? -6.735  153.994 19.329  1.00 24.23 ? 173 CYS C N   1 
ATOM 5014  C CA  . CYS C 1 173 ? -6.235  152.633 19.116  1.00 26.36 ? 173 CYS C CA  1 
ATOM 5015  C C   . CYS C 1 173 ? -6.063  152.387 17.616  1.00 25.29 ? 173 CYS C C   1 
ATOM 5016  O O   . CYS C 1 173 ? -5.065  151.812 17.186  1.00 24.12 ? 173 CYS C O   1 
ATOM 5017  C CB  . CYS C 1 173 ? -7.169  151.584 19.727  1.00 27.18 ? 173 CYS C CB  1 
ATOM 5018  S SG  . CYS C 1 173 ? -8.598  151.153 18.724  1.00 27.27 ? 173 CYS C SG  1 
ATOM 5019  N N   . LEU C 1 174 ? -7.034  152.839 16.824  1.00 22.21 ? 174 LEU C N   1 
ATOM 5020  C CA  . LEU C 1 174 ? -6.982  152.700 15.366  1.00 20.45 ? 174 LEU C CA  1 
ATOM 5021  C C   . LEU C 1 174 ? -5.822  153.534 14.815  1.00 19.60 ? 174 LEU C C   1 
ATOM 5022  O O   . LEU C 1 174 ? -5.307  153.268 13.728  1.00 15.23 ? 174 LEU C O   1 
ATOM 5023  C CB  . LEU C 1 174 ? -8.292  153.190 14.739  1.00 20.39 ? 174 LEU C CB  1 
ATOM 5024  C CG  . LEU C 1 174 ? -9.358  152.204 14.253  1.00 18.04 ? 174 LEU C CG  1 
ATOM 5025  C CD1 . LEU C 1 174 ? -9.819  151.307 15.377  1.00 15.22 ? 174 LEU C CD1 1 
ATOM 5026  C CD2 . LEU C 1 174 ? -10.533 152.977 13.676  1.00 17.60 ? 174 LEU C CD2 1 
ATOM 5027  N N   . ASP C 1 175 ? -5.418  154.539 15.589  1.00 22.79 ? 175 ASP C N   1 
ATOM 5028  C CA  . ASP C 1 175 ? -4.335  155.450 15.229  1.00 25.57 ? 175 ASP C CA  1 
ATOM 5029  C C   . ASP C 1 175 ? -3.042  154.786 14.772  1.00 23.33 ? 175 ASP C C   1 
ATOM 5030  O O   . ASP C 1 175 ? -2.336  155.323 13.920  1.00 23.01 ? 175 ASP C O   1 
ATOM 5031  C CB  . ASP C 1 175 ? -4.047  156.399 16.395  1.00 23.00 ? 175 ASP C CB  1 
ATOM 5032  C CG  . ASP C 1 175 ? -5.110  157.465 16.555  1.00 21.72 ? 175 ASP C CG  1 
ATOM 5033  O OD1 . ASP C 1 175 ? -6.314  157.136 16.468  1.00 17.91 ? 175 ASP C OD1 1 
ATOM 5034  O OD2 . ASP C 1 175 ? -4.733  158.639 16.765  1.00 25.40 ? 175 ASP C OD2 1 
ATOM 5035  N N   . ALA C 1 176 ? -2.740  153.617 15.326  1.00 22.57 ? 176 ALA C N   1 
ATOM 5036  C CA  . ALA C 1 176 ? -1.524  152.893 14.973  1.00 22.37 ? 176 ALA C CA  1 
ATOM 5037  C C   . ALA C 1 176 ? -1.531  152.327 13.550  1.00 24.16 ? 176 ALA C C   1 
ATOM 5038  O O   . ALA C 1 176 ? -0.489  151.913 13.039  1.00 24.74 ? 176 ALA C O   1 
ATOM 5039  C CB  . ALA C 1 176 ? -1.264  151.791 15.980  1.00 22.81 ? 176 ALA C CB  1 
ATOM 5040  N N   . PHE C 1 177 ? -2.706  152.267 12.927  1.00 23.89 ? 177 PHE C N   1 
ATOM 5041  C CA  . PHE C 1 177 ? -2.833  151.749 11.559  1.00 20.34 ? 177 PHE C CA  1 
ATOM 5042  C C   . PHE C 1 177 ? -3.901  152.552 10.822  1.00 18.63 ? 177 PHE C C   1 
ATOM 5043  O O   . PHE C 1 177 ? -5.085  152.200 10.836  1.00 17.35 ? 177 PHE C O   1 
ATOM 5044  C CB  . PHE C 1 177 ? -3.185  150.276 11.526  1.00 18.63 ? 177 PHE C CB  1 
ATOM 5045  C CG  . PHE C 1 177 ? -3.225  149.631 12.852  1.00 13.48 ? 177 PHE C CG  1 
ATOM 5046  C CD1 . PHE C 1 177 ? -4.297  149.844 13.725  1.00 14.18 ? 177 PHE C CD1 1 
ATOM 5047  C CD2 . PHE C 1 177 ? -2.189  148.812 13.265  1.00 13.60 ? 177 PHE C CD2 1 
ATOM 5048  C CE1 . PHE C 1 177 ? -4.338  149.250 14.979  1.00 16.02 ? 177 PHE C CE1 1 
ATOM 5049  C CE2 . PHE C 1 177 ? -2.216  148.209 14.536  1.00 16.27 ? 177 PHE C CE2 1 
ATOM 5050  C CZ  . PHE C 1 177 ? -3.295  148.429 15.388  1.00 18.52 ? 177 PHE C CZ  1 
ATOM 5051  N N   . PRO C 1 178 ? -3.486  153.603 10.075  1.00 18.47 ? 178 PRO C N   1 
ATOM 5052  C CA  . PRO C 1 178 ? -4.355  154.483 9.285   1.00 17.30 ? 178 PRO C CA  1 
ATOM 5053  C C   . PRO C 1 178 ? -5.223  153.740 8.270   1.00 15.96 ? 178 PRO C C   1 
ATOM 5054  O O   . PRO C 1 178 ? -6.138  154.325 7.697   1.00 15.57 ? 178 PRO C O   1 
ATOM 5055  C CB  . PRO C 1 178 ? -3.359  155.407 8.594   1.00 18.45 ? 178 PRO C CB  1 
ATOM 5056  C CG  . PRO C 1 178 ? -2.247  155.487 9.581   1.00 17.91 ? 178 PRO C CG  1 
ATOM 5057  C CD  . PRO C 1 178 ? -2.085  154.043 9.973   1.00 19.54 ? 178 PRO C CD  1 
ATOM 5058  N N   . ASN C 1 179 ? -4.895  152.473 8.014   1.00 14.56 ? 179 ASN C N   1 
ATOM 5059  C CA  . ASN C 1 179 ? -5.667  151.632 7.098   1.00 12.91 ? 179 ASN C CA  1 
ATOM 5060  C C   . ASN C 1 179 ? -7.103  151.819 7.534   1.00 14.52 ? 179 ASN C C   1 
ATOM 5061  O O   . ASN C 1 179 ? -7.930  152.394 6.815   1.00 16.88 ? 179 ASN C O   1 
ATOM 5062  C CB  . ASN C 1 179 ? -5.328  150.155 7.332   1.00 7.18  ? 179 ASN C CB  1 
ATOM 5063  C CG  . ASN C 1 179 ? -4.509  149.544 6.222   1.00 2.00  ? 179 ASN C CG  1 
ATOM 5064  O OD1 . ASN C 1 179 ? -5.027  148.791 5.402   1.00 2.00  ? 179 ASN C OD1 1 
ATOM 5065  N ND2 . ASN C 1 179 ? -3.208  149.796 6.236   1.00 4.66  ? 179 ASN C ND2 1 
ATOM 5066  N N   . LEU C 1 180 ? -7.333  151.482 8.791   1.00 13.87 ? 180 LEU C N   1 
ATOM 5067  C CA  . LEU C 1 180 ? -8.630  151.577 9.428   1.00 16.01 ? 180 LEU C CA  1 
ATOM 5068  C C   . LEU C 1 180 ? -9.136  153.016 9.435   1.00 16.54 ? 180 LEU C C   1 
ATOM 5069  O O   . LEU C 1 180 ? -10.282 153.273 9.074   1.00 17.82 ? 180 LEU C O   1 
ATOM 5070  C CB  . LEU C 1 180 ? -8.529  151.039 10.859  1.00 11.98 ? 180 LEU C CB  1 
ATOM 5071  C CG  . LEU C 1 180 ? -7.830  149.678 10.968  1.00 13.67 ? 180 LEU C CG  1 
ATOM 5072  C CD1 . LEU C 1 180 ? -7.593  149.323 12.415  1.00 11.15 ? 180 LEU C CD1 1 
ATOM 5073  C CD2 . LEU C 1 180 ? -8.638  148.595 10.261  1.00 18.73 ? 180 LEU C CD2 1 
ATOM 5074  N N   . LYS C 1 181 ? -8.278  153.957 9.819   1.00 16.58 ? 181 LYS C N   1 
ATOM 5075  C CA  . LYS C 1 181 ? -8.659  155.367 9.874   1.00 18.09 ? 181 LYS C CA  1 
ATOM 5076  C C   . LYS C 1 181 ? -9.308  155.845 8.576   1.00 17.67 ? 181 LYS C C   1 
ATOM 5077  O O   . LYS C 1 181 ? -10.461 156.272 8.578   1.00 20.13 ? 181 LYS C O   1 
ATOM 5078  C CB  . LYS C 1 181 ? -7.448  156.242 10.209  1.00 18.99 ? 181 LYS C CB  1 
ATOM 5079  C CG  . LYS C 1 181 ? -6.911  156.052 11.624  1.00 19.07 ? 181 LYS C CG  1 
ATOM 5080  C CD  . LYS C 1 181 ? -7.927  156.490 12.671  1.00 19.82 ? 181 LYS C CD  1 
ATOM 5081  C CE  . LYS C 1 181 ? -8.180  157.999 12.645  1.00 16.30 ? 181 LYS C CE  1 
ATOM 5082  N NZ  . LYS C 1 181 ? -7.008  158.794 13.111  1.00 17.92 ? 181 LYS C NZ  1 
ATOM 5083  N N   . ASP C 1 182 ? -8.585  155.738 7.463   1.00 16.95 ? 182 ASP C N   1 
ATOM 5084  C CA  . ASP C 1 182 ? -9.110  156.167 6.165   1.00 18.93 ? 182 ASP C CA  1 
ATOM 5085  C C   . ASP C 1 182 ? -10.333 155.345 5.768   1.00 18.91 ? 182 ASP C C   1 
ATOM 5086  O O   . ASP C 1 182 ? -11.244 155.856 5.124   1.00 17.29 ? 182 ASP C O   1 
ATOM 5087  C CB  . ASP C 1 182 ? -8.022  156.108 5.076   1.00 19.53 ? 182 ASP C CB  1 
ATOM 5088  C CG  . ASP C 1 182 ? -7.044  157.298 5.136   1.00 17.46 ? 182 ASP C CG  1 
ATOM 5089  O OD1 . ASP C 1 182 ? -7.220  158.216 5.985   1.00 17.48 ? 182 ASP C OD1 1 
ATOM 5090  O OD2 . ASP C 1 182 ? -6.099  157.333 4.316   1.00 16.12 ? 182 ASP C OD2 1 
ATOM 5091  N N   . PHE C 1 183 ? -10.367 154.085 6.186   1.00 18.12 ? 183 PHE C N   1 
ATOM 5092  C CA  . PHE C 1 183 ? -11.498 153.214 5.890   1.00 17.49 ? 183 PHE C CA  1 
ATOM 5093  C C   . PHE C 1 183 ? -12.754 153.813 6.517   1.00 19.14 ? 183 PHE C C   1 
ATOM 5094  O O   . PHE C 1 183 ? -13.788 153.964 5.855   1.00 20.38 ? 183 PHE C O   1 
ATOM 5095  C CB  . PHE C 1 183 ? -11.243 151.806 6.453   1.00 17.84 ? 183 PHE C CB  1 
ATOM 5096  C CG  . PHE C 1 183 ? -12.470 150.932 6.508   1.00 17.09 ? 183 PHE C CG  1 
ATOM 5097  C CD1 . PHE C 1 183 ? -13.029 150.416 5.345   1.00 17.82 ? 183 PHE C CD1 1 
ATOM 5098  C CD2 . PHE C 1 183 ? -13.062 150.613 7.726   1.00 15.86 ? 183 PHE C CD2 1 
ATOM 5099  C CE1 . PHE C 1 183 ? -14.156 149.597 5.394   1.00 16.95 ? 183 PHE C CE1 1 
ATOM 5100  C CE2 . PHE C 1 183 ? -14.189 149.794 7.783   1.00 16.50 ? 183 PHE C CE2 1 
ATOM 5101  C CZ  . PHE C 1 183 ? -14.735 149.285 6.615   1.00 15.92 ? 183 PHE C CZ  1 
ATOM 5102  N N   . ILE C 1 184 ? -12.630 154.206 7.779   1.00 19.52 ? 184 ILE C N   1 
ATOM 5103  C CA  . ILE C 1 184 ? -13.737 154.777 8.523   1.00 15.88 ? 184 ILE C CA  1 
ATOM 5104  C C   . ILE C 1 184 ? -14.165 156.148 7.993   1.00 15.93 ? 184 ILE C C   1 
ATOM 5105  O O   . ILE C 1 184 ? -15.294 156.577 8.223   1.00 16.62 ? 184 ILE C O   1 
ATOM 5106  C CB  . ILE C 1 184 ? -13.417 154.801 10.041  1.00 16.19 ? 184 ILE C CB  1 
ATOM 5107  C CG1 . ILE C 1 184 ? -14.661 154.422 10.847  1.00 16.39 ? 184 ILE C CG1 1 
ATOM 5108  C CG2 . ILE C 1 184 ? -12.889 156.156 10.474  1.00 16.28 ? 184 ILE C CG2 1 
ATOM 5109  C CD1 . ILE C 1 184 ? -14.360 153.636 12.110  1.00 20.83 ? 184 ILE C CD1 1 
ATOM 5110  N N   . SER C 1 185 ? -13.285 156.809 7.245   1.00 14.34 ? 185 SER C N   1 
ATOM 5111  C CA  . SER C 1 185 ? -13.596 158.115 6.666   1.00 16.17 ? 185 SER C CA  1 
ATOM 5112  C C   . SER C 1 185 ? -14.314 157.944 5.323   1.00 15.74 ? 185 SER C C   1 
ATOM 5113  O O   . SER C 1 185 ? -15.262 158.667 5.008   1.00 16.25 ? 185 SER C O   1 
ATOM 5114  C CB  . SER C 1 185 ? -12.314 158.934 6.481   1.00 15.63 ? 185 SER C CB  1 
ATOM 5115  O OG  . SER C 1 185 ? -12.596 160.254 6.043   1.00 14.46 ? 185 SER C OG  1 
ATOM 5116  N N   . ARG C 1 186 ? -13.856 156.973 4.544   1.00 18.93 ? 186 ARG C N   1 
ATOM 5117  C CA  . ARG C 1 186 ? -14.434 156.674 3.239   1.00 19.23 ? 186 ARG C CA  1 
ATOM 5118  C C   . ARG C 1 186 ? -15.853 156.118 3.362   1.00 19.44 ? 186 ARG C C   1 
ATOM 5119  O O   . ARG C 1 186 ? -16.746 156.494 2.601   1.00 18.90 ? 186 ARG C O   1 
ATOM 5120  C CB  . ARG C 1 186 ? -13.545 155.681 2.489   1.00 19.07 ? 186 ARG C CB  1 
ATOM 5121  C CG  . ARG C 1 186 ? -12.209 156.247 2.019   1.00 18.25 ? 186 ARG C CG  1 
ATOM 5122  C CD  . ARG C 1 186 ? -11.219 155.127 1.678   1.00 18.44 ? 186 ARG C CD  1 
ATOM 5123  N NE  . ARG C 1 186 ? -11.872 154.019 0.983   1.00 20.88 ? 186 ARG C NE  1 
ATOM 5124  C CZ  . ARG C 1 186 ? -12.012 152.801 1.489   1.00 20.00 ? 186 ARG C CZ  1 
ATOM 5125  N NH1 . ARG C 1 186 ? -11.531 152.513 2.688   1.00 18.66 ? 186 ARG C NH1 1 
ATOM 5126  N NH2 . ARG C 1 186 ? -12.713 151.896 0.836   1.00 21.43 ? 186 ARG C NH2 1 
ATOM 5127  N N   . PHE C 1 187 ? -16.052 155.209 4.310   1.00 18.34 ? 187 PHE C N   1 
ATOM 5128  C CA  . PHE C 1 187 ? -17.363 154.616 4.537   1.00 19.79 ? 187 PHE C CA  1 
ATOM 5129  C C   . PHE C 1 187 ? -18.388 155.703 4.890   1.00 22.28 ? 187 PHE C C   1 
ATOM 5130  O O   . PHE C 1 187 ? -19.507 155.702 4.382   1.00 23.45 ? 187 PHE C O   1 
ATOM 5131  C CB  . PHE C 1 187 ? -17.277 153.588 5.660   1.00 15.26 ? 187 PHE C CB  1 
ATOM 5132  C CG  . PHE C 1 187 ? -18.566 152.871 5.922   1.00 11.73 ? 187 PHE C CG  1 
ATOM 5133  C CD1 . PHE C 1 187 ? -18.865 151.688 5.232   1.00 8.42  ? 187 PHE C CD1 1 
ATOM 5134  C CD2 . PHE C 1 187 ? -19.468 153.370 6.870   1.00 7.65  ? 187 PHE C CD2 1 
ATOM 5135  C CE1 . PHE C 1 187 ? -20.040 150.995 5.523   1.00 7.73  ? 187 PHE C CE1 1 
ATOM 5136  C CE2 . PHE C 1 187 ? -20.649 152.667 7.152   1.00 2.00  ? 187 PHE C CE2 1 
ATOM 5137  C CZ  . PHE C 1 187 ? -20.935 151.486 6.480   1.00 4.72  ? 187 PHE C CZ  1 
ATOM 5138  N N   . GLU C 1 188 ? -18.008 156.615 5.778   1.00 21.85 ? 188 GLU C N   1 
ATOM 5139  C CA  . GLU C 1 188 ? -18.888 157.706 6.176   1.00 20.83 ? 188 GLU C CA  1 
ATOM 5140  C C   . GLU C 1 188 ? -19.064 158.649 4.998   1.00 20.67 ? 188 GLU C C   1 
ATOM 5141  O O   . GLU C 1 188 ? -20.071 159.345 4.890   1.00 20.55 ? 188 GLU C O   1 
ATOM 5142  C CB  . GLU C 1 188 ? -18.301 158.467 7.369   1.00 26.01 ? 188 GLU C CB  1 
ATOM 5143  C CG  . GLU C 1 188 ? -18.300 157.679 8.672   1.00 25.22 ? 188 GLU C CG  1 
ATOM 5144  C CD  . GLU C 1 188 ? -17.875 158.507 9.879   1.00 30.37 ? 188 GLU C CD  1 
ATOM 5145  O OE1 . GLU C 1 188 ? -17.901 159.756 9.810   1.00 36.26 ? 188 GLU C OE1 1 
ATOM 5146  O OE2 . GLU C 1 188 ? -17.525 157.899 10.913  1.00 29.66 ? 188 GLU C OE2 1 
ATOM 5147  N N   . GLY C 1 189 ? -18.072 158.658 4.114   1.00 21.49 ? 189 GLY C N   1 
ATOM 5148  C CA  . GLY C 1 189 ? -18.122 159.510 2.944   1.00 21.99 ? 189 GLY C CA  1 
ATOM 5149  C C   . GLY C 1 189 ? -19.175 159.108 1.927   1.00 20.77 ? 189 GLY C C   1 
ATOM 5150  O O   . GLY C 1 189 ? -19.444 159.862 0.990   1.00 20.97 ? 189 GLY C O   1 
ATOM 5151  N N   . LEU C 1 190 ? -19.745 157.914 2.054   1.00 18.35 ? 190 LEU C N   1 
ATOM 5152  C CA  . LEU C 1 190 ? -20.775 157.456 1.146   1.00 16.88 ? 190 LEU C CA  1 
ATOM 5153  C C   . LEU C 1 190 ? -21.976 158.378 1.256   1.00 16.45 ? 190 LEU C C   1 
ATOM 5154  O O   . LEU C 1 190 ? -22.471 158.650 2.347   1.00 11.57 ? 190 LEU C O   1 
ATOM 5155  C CB  . LEU C 1 190 ? -21.203 156.021 1.455   1.00 14.10 ? 190 LEU C CB  1 
ATOM 5156  C CG  . LEU C 1 190 ? -20.175 154.897 1.302   1.00 11.17 ? 190 LEU C CG  1 
ATOM 5157  C CD1 . LEU C 1 190 ? -20.721 153.621 1.930   1.00 11.97 ? 190 LEU C CD1 1 
ATOM 5158  C CD2 . LEU C 1 190 ? -19.813 154.678 -0.160  1.00 8.91  ? 190 LEU C CD2 1 
ATOM 5159  N N   . GLU C 1 191 ? -22.435 158.846 0.106   1.00 18.32 ? 191 GLU C N   1 
ATOM 5160  C CA  . GLU C 1 191 ? -23.573 159.749 -0.009  1.00 19.26 ? 191 GLU C CA  1 
ATOM 5161  C C   . GLU C 1 191 ? -24.771 159.365 0.869   1.00 17.94 ? 191 GLU C C   1 
ATOM 5162  O O   . GLU C 1 191 ? -25.215 160.157 1.695   1.00 15.63 ? 191 GLU C O   1 
ATOM 5163  C CB  . GLU C 1 191 ? -23.973 159.802 -1.477  1.00 23.77 ? 191 GLU C CB  1 
ATOM 5164  C CG  . GLU C 1 191 ? -25.274 160.478 -1.789  1.00 28.60 ? 191 GLU C CG  1 
ATOM 5165  C CD  . GLU C 1 191 ? -25.789 160.060 -3.146  1.00 29.81 ? 191 GLU C CD  1 
ATOM 5166  O OE1 . GLU C 1 191 ? -25.354 160.651 -4.160  1.00 35.38 ? 191 GLU C OE1 1 
ATOM 5167  O OE2 . GLU C 1 191 ? -26.604 159.114 -3.198  1.00 30.25 ? 191 GLU C OE2 1 
ATOM 5168  N N   . LYS C 1 192 ? -25.288 158.152 0.689   1.00 18.83 ? 192 LYS C N   1 
ATOM 5169  C CA  . LYS C 1 192 ? -26.432 157.670 1.472   1.00 21.51 ? 192 LYS C CA  1 
ATOM 5170  C C   . LYS C 1 192 ? -26.135 157.576 2.971   1.00 22.31 ? 192 LYS C C   1 
ATOM 5171  O O   . LYS C 1 192 ? -26.968 157.941 3.812   1.00 22.94 ? 192 LYS C O   1 
ATOM 5172  C CB  . LYS C 1 192 ? -26.897 156.304 0.949   1.00 20.84 ? 192 LYS C CB  1 
ATOM 5173  C CG  . LYS C 1 192 ? -27.949 156.386 -0.143  1.00 20.45 ? 192 LYS C CG  1 
ATOM 5174  C CD  . LYS C 1 192 ? -27.981 155.129 -1.005  1.00 23.29 ? 192 LYS C CD  1 
ATOM 5175  C CE  . LYS C 1 192 ? -26.885 155.130 -2.074  1.00 23.86 ? 192 LYS C CE  1 
ATOM 5176  N NZ  . LYS C 1 192 ? -25.499 155.097 -1.514  1.00 21.05 ? 192 LYS C NZ  1 
ATOM 5177  N N   . ILE C 1 193 ? -24.939 157.089 3.293   1.00 21.71 ? 193 ILE C N   1 
ATOM 5178  C CA  . ILE C 1 193 ? -24.515 156.928 4.675   1.00 19.68 ? 193 ILE C CA  1 
ATOM 5179  C C   . ILE C 1 193 ? -24.476 158.278 5.383   1.00 19.01 ? 193 ILE C C   1 
ATOM 5180  O O   . ILE C 1 193 ? -25.132 158.457 6.410   1.00 21.50 ? 193 ILE C O   1 
ATOM 5181  C CB  . ILE C 1 193 ? -23.146 156.215 4.762   1.00 18.66 ? 193 ILE C CB  1 
ATOM 5182  C CG1 . ILE C 1 193 ? -23.319 154.709 4.555   1.00 16.70 ? 193 ILE C CG1 1 
ATOM 5183  C CG2 . ILE C 1 193 ? -22.506 156.446 6.121   1.00 20.99 ? 193 ILE C CG2 1 
ATOM 5184  C CD1 . ILE C 1 193 ? -23.959 154.314 3.252   1.00 22.88 ? 193 ILE C CD1 1 
ATOM 5185  N N   . SER C 1 194 ? -23.739 159.233 4.825   1.00 19.45 ? 194 SER C N   1 
ATOM 5186  C CA  . SER C 1 194 ? -23.659 160.564 5.415   1.00 20.30 ? 194 SER C CA  1 
ATOM 5187  C C   . SER C 1 194 ? -25.056 161.174 5.529   1.00 21.03 ? 194 SER C C   1 
ATOM 5188  O O   . SER C 1 194 ? -25.366 161.846 6.510   1.00 20.29 ? 194 SER C O   1 
ATOM 5189  C CB  . SER C 1 194 ? -22.742 161.467 4.589   1.00 20.19 ? 194 SER C CB  1 
ATOM 5190  O OG  . SER C 1 194 ? -23.027 161.375 3.206   1.00 15.68 ? 194 SER C OG  1 
ATOM 5191  N N   . ALA C 1 195 ? -25.903 160.913 4.536   1.00 24.53 ? 195 ALA C N   1 
ATOM 5192  C CA  . ALA C 1 195 ? -27.273 161.419 4.533   1.00 27.72 ? 195 ALA C CA  1 
ATOM 5193  C C   . ALA C 1 195 ? -28.022 160.927 5.766   1.00 29.46 ? 195 ALA C C   1 
ATOM 5194  O O   . ALA C 1 195 ? -28.604 161.725 6.502   1.00 30.80 ? 195 ALA C O   1 
ATOM 5195  C CB  . ALA C 1 195 ? -27.997 160.983 3.267   1.00 27.68 ? 195 ALA C CB  1 
ATOM 5196  N N   . TYR C 1 196 ? -28.002 159.615 5.993   1.00 28.24 ? 196 TYR C N   1 
ATOM 5197  C CA  . TYR C 1 196 ? -28.663 159.028 7.158   1.00 27.19 ? 196 TYR C CA  1 
ATOM 5198  C C   . TYR C 1 196 ? -28.050 159.622 8.425   1.00 25.85 ? 196 TYR C C   1 
ATOM 5199  O O   . TYR C 1 196 ? -28.742 159.878 9.409   1.00 26.35 ? 196 TYR C O   1 
ATOM 5200  C CB  . TYR C 1 196 ? -28.475 157.509 7.174   1.00 29.66 ? 196 TYR C CB  1 
ATOM 5201  C CG  . TYR C 1 196 ? -29.022 156.835 8.418   1.00 28.86 ? 196 TYR C CG  1 
ATOM 5202  C CD1 . TYR C 1 196 ? -30.324 157.085 8.856   1.00 28.89 ? 196 TYR C CD1 1 
ATOM 5203  C CD2 . TYR C 1 196 ? -28.242 155.948 9.152   1.00 29.76 ? 196 TYR C CD2 1 
ATOM 5204  C CE1 . TYR C 1 196 ? -30.835 156.466 9.995   1.00 30.59 ? 196 TYR C CE1 1 
ATOM 5205  C CE2 . TYR C 1 196 ? -28.744 155.324 10.294  1.00 29.67 ? 196 TYR C CE2 1 
ATOM 5206  C CZ  . TYR C 1 196 ? -30.041 155.588 10.710  1.00 29.06 ? 196 TYR C CZ  1 
ATOM 5207  O OH  . TYR C 1 196 ? -30.537 154.983 11.846  1.00 27.75 ? 196 TYR C OH  1 
ATOM 5208  N N   . MET C 1 197 ? -26.738 159.822 8.386   1.00 23.93 ? 197 MET C N   1 
ATOM 5209  C CA  . MET C 1 197 ? -25.984 160.388 9.495   1.00 23.31 ? 197 MET C CA  1 
ATOM 5210  C C   . MET C 1 197 ? -26.574 161.758 9.818   1.00 26.11 ? 197 MET C C   1 
ATOM 5211  O O   . MET C 1 197 ? -26.603 162.186 10.974  1.00 28.83 ? 197 MET C O   1 
ATOM 5212  C CB  . MET C 1 197 ? -24.529 160.539 9.064   1.00 20.51 ? 197 MET C CB  1 
ATOM 5213  C CG  . MET C 1 197 ? -23.511 160.262 10.130  1.00 20.03 ? 197 MET C CG  1 
ATOM 5214  S SD  . MET C 1 197 ? -22.036 159.569 9.359   1.00 19.84 ? 197 MET C SD  1 
ATOM 5215  C CE  . MET C 1 197 ? -22.229 157.830 9.745   1.00 15.03 ? 197 MET C CE  1 
ATOM 5216  N N   . LYS C 1 198 ? -27.072 162.420 8.780   1.00 26.69 ? 198 LYS C N   1 
ATOM 5217  C CA  . LYS C 1 198 ? -27.671 163.740 8.896   1.00 26.16 ? 198 LYS C CA  1 
ATOM 5218  C C   . LYS C 1 198 ? -29.193 163.663 9.044   1.00 25.56 ? 198 LYS C C   1 
ATOM 5219  O O   . LYS C 1 198 ? -29.913 164.546 8.571   1.00 25.34 ? 198 LYS C O   1 
ATOM 5220  C CB  . LYS C 1 198 ? -27.313 164.573 7.662   1.00 28.19 ? 198 LYS C CB  1 
ATOM 5221  C CG  . LYS C 1 198 ? -25.842 164.945 7.541   1.00 29.06 ? 198 LYS C CG  1 
ATOM 5222  C CD  . LYS C 1 198 ? -25.486 166.087 8.476   1.00 28.79 ? 198 LYS C CD  1 
ATOM 5223  C CE  . LYS C 1 198 ? -24.109 166.643 8.163   1.00 32.68 ? 198 LYS C CE  1 
ATOM 5224  N NZ  . LYS C 1 198 ? -23.835 167.894 8.931   1.00 31.21 ? 198 LYS C NZ  1 
ATOM 5225  N N   . SER C 1 199 ? -29.688 162.623 9.710   1.00 25.11 ? 199 SER C N   1 
ATOM 5226  C CA  . SER C 1 199 ? -31.130 162.472 9.896   1.00 24.48 ? 199 SER C CA  1 
ATOM 5227  C C   . SER C 1 199 ? -31.500 162.235 11.356  1.00 25.14 ? 199 SER C C   1 
ATOM 5228  O O   . SER C 1 199 ? -30.673 161.789 12.152  1.00 24.34 ? 199 SER C O   1 
ATOM 5229  C CB  . SER C 1 199 ? -31.676 161.339 9.016   1.00 23.57 ? 199 SER C CB  1 
ATOM 5230  O OG  . SER C 1 199 ? -31.440 160.056 9.576   1.00 19.61 ? 199 SER C OG  1 
ATOM 5231  N N   . SER C 1 200 ? -32.764 162.475 11.690  1.00 24.72 ? 200 SER C N   1 
ATOM 5232  C CA  . SER C 1 200 ? -33.267 162.286 13.052  1.00 23.71 ? 200 SER C CA  1 
ATOM 5233  C C   . SER C 1 200 ? -33.636 160.830 13.353  1.00 25.37 ? 200 SER C C   1 
ATOM 5234  O O   . SER C 1 200 ? -34.333 160.546 14.331  1.00 24.69 ? 200 SER C O   1 
ATOM 5235  C CB  . SER C 1 200 ? -34.482 163.193 13.299  1.00 25.93 ? 200 SER C CB  1 
ATOM 5236  O OG  . SER C 1 200 ? -34.154 164.580 13.125  1.00 22.97 ? 200 SER C OG  1 
ATOM 5237  N N   . ARG C 1 201 ? -33.185 159.918 12.496  1.00 26.98 ? 201 ARG C N   1 
ATOM 5238  C CA  . ARG C 1 201 ? -33.455 158.495 12.664  1.00 25.89 ? 201 ARG C CA  1 
ATOM 5239  C C   . ARG C 1 201 ? -32.154 157.789 13.038  1.00 24.32 ? 201 ARG C C   1 
ATOM 5240  O O   . ARG C 1 201 ? -32.155 156.622 13.436  1.00 25.47 ? 201 ARG C O   1 
ATOM 5241  C CB  . ARG C 1 201 ? -33.988 157.903 11.357  1.00 27.27 ? 201 ARG C CB  1 
ATOM 5242  C CG  . ARG C 1 201 ? -35.097 158.704 10.682  1.00 28.21 ? 201 ARG C CG  1 
ATOM 5243  C CD  . ARG C 1 201 ? -35.217 158.306 9.223   1.00 27.69 ? 201 ARG C CD  1 
ATOM 5244  N NE  . ARG C 1 201 ? -33.914 158.323 8.561   1.00 25.93 ? 201 ARG C NE  1 
ATOM 5245  C CZ  . ARG C 1 201 ? -33.695 158.804 7.342   1.00 28.36 ? 201 ARG C CZ  1 
ATOM 5246  N NH1 . ARG C 1 201 ? -34.694 159.316 6.634   1.00 29.79 ? 201 ARG C NH1 1 
ATOM 5247  N NH2 . ARG C 1 201 ? -32.469 158.786 6.834   1.00 29.72 ? 201 ARG C NH2 1 
ATOM 5248  N N   . PHE C 1 202 ? -31.043 158.497 12.861  1.00 23.68 ? 202 PHE C N   1 
ATOM 5249  C CA  . PHE C 1 202 ? -29.717 157.970 13.156  1.00 26.36 ? 202 PHE C CA  1 
ATOM 5250  C C   . PHE C 1 202 ? -29.602 157.682 14.645  1.00 27.26 ? 202 PHE C C   1 
ATOM 5251  O O   . PHE C 1 202 ? -29.871 158.554 15.473  1.00 28.40 ? 202 PHE C O   1 
ATOM 5252  C CB  . PHE C 1 202 ? -28.655 158.991 12.732  1.00 25.49 ? 202 PHE C CB  1 
ATOM 5253  C CG  . PHE C 1 202 ? -27.240 158.522 12.916  1.00 23.95 ? 202 PHE C CG  1 
ATOM 5254  C CD1 . PHE C 1 202 ? -26.840 157.264 12.471  1.00 23.78 ? 202 PHE C CD1 1 
ATOM 5255  C CD2 . PHE C 1 202 ? -26.298 159.368 13.520  1.00 24.06 ? 202 PHE C CD2 1 
ATOM 5256  C CE1 . PHE C 1 202 ? -25.519 156.831 12.625  1.00 27.34 ? 202 PHE C CE1 1 
ATOM 5257  C CE2 . PHE C 1 202 ? -24.978 158.936 13.678  1.00 25.31 ? 202 PHE C CE2 1 
ATOM 5258  C CZ  . PHE C 1 202 ? -24.587 157.673 13.228  1.00 27.33 ? 202 PHE C CZ  1 
ATOM 5259  N N   . LEU C 1 203 ? -29.227 156.452 14.984  1.00 27.06 ? 203 LEU C N   1 
ATOM 5260  C CA  . LEU C 1 203 ? -29.078 156.066 16.384  1.00 27.03 ? 203 LEU C CA  1 
ATOM 5261  C C   . LEU C 1 203 ? -27.636 155.674 16.699  1.00 26.64 ? 203 LEU C C   1 
ATOM 5262  O O   . LEU C 1 203 ? -27.242 154.513 16.530  1.00 25.77 ? 203 LEU C O   1 
ATOM 5263  C CB  . LEU C 1 203 ? -30.033 154.920 16.732  1.00 24.39 ? 203 LEU C CB  1 
ATOM 5264  C CG  . LEU C 1 203 ? -30.184 154.600 18.221  1.00 24.94 ? 203 LEU C CG  1 
ATOM 5265  C CD1 . LEU C 1 203 ? -30.540 155.867 18.983  1.00 19.34 ? 203 LEU C CD1 1 
ATOM 5266  C CD2 . LEU C 1 203 ? -31.252 153.535 18.416  1.00 23.85 ? 203 LEU C CD2 1 
ATOM 5267  N N   . PRO C 1 204 ? -26.813 156.653 17.111  1.00 27.61 ? 204 PRO C N   1 
ATOM 5268  C CA  . PRO C 1 204 ? -25.407 156.408 17.446  1.00 26.52 ? 204 PRO C CA  1 
ATOM 5269  C C   . PRO C 1 204 ? -25.244 155.878 18.874  1.00 25.13 ? 204 PRO C C   1 
ATOM 5270  O O   . PRO C 1 204 ? -24.353 155.071 19.152  1.00 24.60 ? 204 PRO C O   1 
ATOM 5271  C CB  . PRO C 1 204 ? -24.791 157.797 17.300  1.00 25.77 ? 204 PRO C CB  1 
ATOM 5272  C CG  . PRO C 1 204 ? -25.875 158.682 17.822  1.00 24.81 ? 204 PRO C CG  1 
ATOM 5273  C CD  . PRO C 1 204 ? -27.125 158.095 17.187  1.00 26.78 ? 204 PRO C CD  1 
ATOM 5274  N N   . LYS C 1 205 ? -26.119 156.331 19.768  1.00 25.06 ? 205 LYS C N   1 
ATOM 5275  C CA  . LYS C 1 205 ? -26.083 155.943 21.172  1.00 23.00 ? 205 LYS C CA  1 
ATOM 5276  C C   . LYS C 1 205 ? -27.471 156.138 21.757  1.00 22.02 ? 205 LYS C C   1 
ATOM 5277  O O   . LYS C 1 205 ? -28.232 156.936 21.228  1.00 20.60 ? 205 LYS C O   1 
ATOM 5278  C CB  . LYS C 1 205 ? -25.089 156.818 21.926  1.00 24.98 ? 205 LYS C CB  1 
ATOM 5279  C CG  . LYS C 1 205 ? -25.324 158.318 21.783  1.00 23.75 ? 205 LYS C CG  1 
ATOM 5280  C CD  . LYS C 1 205 ? -24.566 159.127 22.833  1.00 24.24 ? 205 LYS C CD  1 
ATOM 5281  C CE  . LYS C 1 205 ? -23.205 158.526 23.180  1.00 24.65 ? 205 LYS C CE  1 
ATOM 5282  N NZ  . LYS C 1 205 ? -23.315 157.426 24.189  1.00 22.81 ? 205 LYS C NZ  1 
ATOM 5283  N N   . PRO C 1 206 ? -27.765 155.515 22.916  1.00 20.95 ? 206 PRO C N   1 
ATOM 5284  C CA  . PRO C 1 206 ? -26.963 154.637 23.784  1.00 21.59 ? 206 PRO C CA  1 
ATOM 5285  C C   . PRO C 1 206 ? -26.263 153.471 23.082  1.00 22.80 ? 206 PRO C C   1 
ATOM 5286  O O   . PRO C 1 206 ? -26.844 152.828 22.205  1.00 23.00 ? 206 PRO C O   1 
ATOM 5287  C CB  . PRO C 1 206 ? -27.995 154.109 24.775  1.00 23.08 ? 206 PRO C CB  1 
ATOM 5288  C CG  . PRO C 1 206 ? -28.992 155.206 24.844  1.00 20.87 ? 206 PRO C CG  1 
ATOM 5289  C CD  . PRO C 1 206 ? -29.152 155.577 23.408  1.00 21.23 ? 206 PRO C CD  1 
ATOM 5290  N N   . LEU C 1 207 ? -25.010 153.252 23.435  1.00 23.56 ? 207 LEU C N   1 
ATOM 5291  C CA  . LEU C 1 207 ? -24.211 152.197 22.830  1.00 21.80 ? 207 LEU C CA  1 
ATOM 5292  C C   . LEU C 1 207 ? -24.709 150.853 23.329  1.00 22.63 ? 207 LEU C C   1 
ATOM 5293  O O   . LEU C 1 207 ? -24.755 149.876 22.581  1.00 25.19 ? 207 LEU C O   1 
ATOM 5294  C CB  . LEU C 1 207 ? -22.739 152.378 23.199  1.00 17.42 ? 207 LEU C CB  1 
ATOM 5295  C CG  . LEU C 1 207 ? -22.206 153.814 23.132  1.00 19.44 ? 207 LEU C CG  1 
ATOM 5296  C CD1 . LEU C 1 207 ? -20.791 153.867 23.676  1.00 20.23 ? 207 LEU C CD1 1 
ATOM 5297  C CD2 . LEU C 1 207 ? -22.263 154.351 21.710  1.00 17.92 ? 207 LEU C CD2 1 
ATOM 5298  N N   . TYR C 1 208 ? -25.084 150.804 24.599  1.00 21.24 ? 208 TYR C N   1 
ATOM 5299  C CA  . TYR C 1 208 ? -25.585 149.577 25.186  1.00 20.99 ? 208 TYR C CA  1 
ATOM 5300  C C   . TYR C 1 208 ? -26.872 149.878 25.925  1.00 22.71 ? 208 TYR C C   1 
ATOM 5301  O O   . TYR C 1 208 ? -27.237 151.043 26.108  1.00 23.87 ? 208 TYR C O   1 
ATOM 5302  C CB  . TYR C 1 208 ? -24.551 148.965 26.128  1.00 22.78 ? 208 TYR C CB  1 
ATOM 5303  C CG  . TYR C 1 208 ? -23.315 148.447 25.420  1.00 23.90 ? 208 TYR C CG  1 
ATOM 5304  C CD1 . TYR C 1 208 ? -23.336 147.237 24.736  1.00 23.88 ? 208 TYR C CD1 1 
ATOM 5305  C CD2 . TYR C 1 208 ? -22.126 149.173 25.427  1.00 22.26 ? 208 TYR C CD2 1 
ATOM 5306  C CE1 . TYR C 1 208 ? -22.205 146.762 24.078  1.00 23.17 ? 208 TYR C CE1 1 
ATOM 5307  C CE2 . TYR C 1 208 ? -20.989 148.707 24.771  1.00 20.63 ? 208 TYR C CE2 1 
ATOM 5308  C CZ  . TYR C 1 208 ? -21.036 147.502 24.099  1.00 20.92 ? 208 TYR C CZ  1 
ATOM 5309  O OH  . TYR C 1 208 ? -19.916 147.030 23.451  1.00 20.19 ? 208 TYR C OH  1 
ATOM 5310  N N   . THR C 1 209 ? -27.587 148.827 26.306  1.00 20.57 ? 209 THR C N   1 
ATOM 5311  C CA  . THR C 1 209 ? -28.846 148.976 27.020  1.00 19.61 ? 209 THR C CA  1 
ATOM 5312  C C   . THR C 1 209 ? -28.577 149.680 28.348  1.00 22.98 ? 209 THR C C   1 
ATOM 5313  O O   . THR C 1 209 ? -27.419 149.793 28.768  1.00 23.13 ? 209 THR C O   1 
ATOM 5314  C CB  . THR C 1 209 ? -29.503 147.603 27.263  1.00 20.88 ? 209 THR C CB  1 
ATOM 5315  O OG1 . THR C 1 209 ? -28.610 146.773 28.015  1.00 23.54 ? 209 THR C OG1 1 
ATOM 5316  C CG2 . THR C 1 209 ? -29.823 146.922 25.934  1.00 17.93 ? 209 THR C CG2 1 
ATOM 5317  N N   . ARG C 1 210 ? -29.633 150.125 29.025  1.00 22.18 ? 210 ARG C N   1 
ATOM 5318  C CA  . ARG C 1 210 ? -29.475 150.828 30.299  1.00 21.57 ? 210 ARG C CA  1 
ATOM 5319  C C   . ARG C 1 210 ? -29.055 149.941 31.485  1.00 22.41 ? 210 ARG C C   1 
ATOM 5320  O O   . ARG C 1 210 ? -29.090 150.388 32.639  1.00 24.15 ? 210 ARG C O   1 
ATOM 5321  C CB  . ARG C 1 210 ? -30.758 151.586 30.639  1.00 25.31 ? 210 ARG C CB  1 
ATOM 5322  C CG  . ARG C 1 210 ? -30.552 152.708 31.646  1.00 28.00 ? 210 ARG C CG  1 
ATOM 5323  C CD  . ARG C 1 210 ? -31.831 153.475 31.913  1.00 29.32 ? 210 ARG C CD  1 
ATOM 5324  N NE  . ARG C 1 210 ? -32.452 153.980 30.689  1.00 31.38 ? 210 ARG C NE  1 
ATOM 5325  C CZ  . ARG C 1 210 ? -33.576 153.497 30.172  1.00 31.85 ? 210 ARG C CZ  1 
ATOM 5326  N NH1 . ARG C 1 210 ? -34.202 152.496 30.775  1.00 30.55 ? 210 ARG C NH1 1 
ATOM 5327  N NH2 . ARG C 1 210 ? -34.068 154.004 29.049  1.00 33.56 ? 210 ARG C NH2 1 
ATOM 5328  N N   . VAL C 1 211 ? -28.641 148.704 31.203  1.00 20.50 ? 211 VAL C N   1 
ATOM 5329  C CA  . VAL C 1 211 ? -28.223 147.776 32.254  1.00 17.15 ? 211 VAL C CA  1 
ATOM 5330  C C   . VAL C 1 211 ? -26.711 147.499 32.251  1.00 15.71 ? 211 VAL C C   1 
ATOM 5331  O O   . VAL C 1 211 ? -26.147 147.075 33.265  1.00 16.38 ? 211 VAL C O   1 
ATOM 5332  C CB  . VAL C 1 211 ? -29.005 146.447 32.156  1.00 16.50 ? 211 VAL C CB  1 
ATOM 5333  C CG1 . VAL C 1 211 ? -28.650 145.723 30.869  1.00 17.22 ? 211 VAL C CG1 1 
ATOM 5334  C CG2 . VAL C 1 211 ? -28.733 145.567 33.369  1.00 14.04 ? 211 VAL C CG2 1 
ATOM 5335  N N   . ALA C 1 212 ? -26.060 147.733 31.113  1.00 15.05 ? 212 ALA C N   1 
ATOM 5336  C CA  . ALA C 1 212 ? -24.622 147.509 30.998  1.00 13.54 ? 212 ALA C CA  1 
ATOM 5337  C C   . ALA C 1 212 ? -23.901 148.515 31.877  1.00 13.15 ? 212 ALA C C   1 
ATOM 5338  O O   . ALA C 1 212 ? -24.283 149.685 31.920  1.00 12.78 ? 212 ALA C O   1 
ATOM 5339  C CB  . ALA C 1 212 ? -24.181 147.662 29.560  1.00 14.73 ? 212 ALA C CB  1 
ATOM 5340  N N   . VAL C 1 213 ? -22.843 148.073 32.549  1.00 14.92 ? 213 VAL C N   1 
ATOM 5341  C CA  . VAL C 1 213 ? -22.083 148.944 33.445  1.00 18.17 ? 213 VAL C CA  1 
ATOM 5342  C C   . VAL C 1 213 ? -21.447 150.164 32.756  1.00 22.86 ? 213 VAL C C   1 
ATOM 5343  O O   . VAL C 1 213 ? -21.081 151.141 33.421  1.00 22.24 ? 213 VAL C O   1 
ATOM 5344  C CB  . VAL C 1 213 ? -21.008 148.148 34.214  1.00 16.86 ? 213 VAL C CB  1 
ATOM 5345  C CG1 . VAL C 1 213 ? -21.655 147.004 34.977  1.00 20.31 ? 213 VAL C CG1 1 
ATOM 5346  C CG2 . VAL C 1 213 ? -19.956 147.619 33.267  1.00 16.80 ? 213 VAL C CG2 1 
ATOM 5347  N N   . TRP C 1 214 ? -21.321 150.101 31.432  1.00 24.65 ? 214 TRP C N   1 
ATOM 5348  C CA  . TRP C 1 214 ? -20.751 151.189 30.634  1.00 24.83 ? 214 TRP C CA  1 
ATOM 5349  C C   . TRP C 1 214 ? -21.566 151.273 29.340  1.00 27.50 ? 214 TRP C C   1 
ATOM 5350  O O   . TRP C 1 214 ? -22.332 150.355 29.022  1.00 27.35 ? 214 TRP C O   1 
ATOM 5351  C CB  . TRP C 1 214 ? -19.276 150.893 30.305  1.00 22.75 ? 214 TRP C CB  1 
ATOM 5352  C CG  . TRP C 1 214 ? -18.512 152.054 29.696  1.00 24.02 ? 214 TRP C CG  1 
ATOM 5353  C CD1 . TRP C 1 214 ? -17.918 153.082 30.367  1.00 24.55 ? 214 TRP C CD1 1 
ATOM 5354  C CD2 . TRP C 1 214 ? -18.244 152.278 28.302  1.00 24.33 ? 214 TRP C CD2 1 
ATOM 5355  N NE1 . TRP C 1 214 ? -17.298 153.930 29.482  1.00 23.30 ? 214 TRP C NE1 1 
ATOM 5356  C CE2 . TRP C 1 214 ? -17.481 153.461 28.208  1.00 23.93 ? 214 TRP C CE2 1 
ATOM 5357  C CE3 . TRP C 1 214 ? -18.573 151.595 27.124  1.00 24.65 ? 214 TRP C CE3 1 
ATOM 5358  C CZ2 . TRP C 1 214 ? -17.041 153.976 26.984  1.00 22.72 ? 214 TRP C CZ2 1 
ATOM 5359  C CZ3 . TRP C 1 214 ? -18.135 152.108 25.907  1.00 24.01 ? 214 TRP C CZ3 1 
ATOM 5360  C CH2 . TRP C 1 214 ? -17.377 153.287 25.849  1.00 21.85 ? 214 TRP C CH2 1 
ATOM 5361  N N   . GLY C 1 215 ? -21.438 152.385 28.621  1.00 28.80 ? 215 GLY C N   1 
ATOM 5362  C CA  . GLY C 1 215 ? -22.156 152.540 27.368  1.00 27.48 ? 215 GLY C CA  1 
ATOM 5363  C C   . GLY C 1 215 ? -23.627 152.891 27.493  1.00 28.05 ? 215 GLY C C   1 
ATOM 5364  O O   . GLY C 1 215 ? -24.220 153.390 26.533  1.00 26.97 ? 215 GLY C O   1 
ATOM 5365  N N   . ASN C 1 216 ? -24.233 152.589 28.625  1.00 28.74 ? 216 ASN C N   1 
ATOM 5366  C CA  . ASN C 1 216 ? -25.644 152.903 28.860  1.00 29.98 ? 216 ASN C CA  1 
ATOM 5367  C C   . ASN C 1 216 ? -25.861 154.421 28.822  1.00 29.73 ? 216 ASN C C   1 
ATOM 5368  O O   . ASN C 1 216 ? -24.887 155.197 28.924  1.00 30.73 ? 216 ASN C O   1 
ATOM 5369  C CB  . ASN C 1 216 ? -26.150 152.321 30.196  1.00 28.36 ? 216 ASN C CB  1 
ATOM 5370  C CG  . ASN C 1 216 ? -25.580 153.042 31.420  1.00 26.01 ? 216 ASN C CG  1 
ATOM 5371  O OD1 . ASN C 1 216 ? -26.032 154.125 31.789  1.00 25.77 ? 216 ASN C OD1 1 
ATOM 5372  N ND2 . ASN C 1 216 ? -24.604 152.426 32.069  1.00 25.13 ? 216 ASN C ND2 1 
ATOM 5373  N N   . LYS C 1 217 ? -27.078 154.835 28.678  1.00 29.47 ? 217 LYS C N   1 
ATOM 5374  C CA  . LYS C 1 217 ? -27.432 156.244 28.607  1.00 28.67 ? 217 LYS C CA  1 
ATOM 5375  C C   . LYS C 1 217 ? -28.895 156.388 29.018  1.00 28.15 ? 217 LYS C C   1 
ATOM 5376  O O   . LYS C 1 217 ? -29.226 157.406 29.658  1.00 27.43 ? 217 LYS C O   1 
ATOM 5377  C CB  . LYS C 1 217 ? -27.237 156.734 27.171  1.00 30.18 ? 217 LYS C CB  1 
ATOM 5378  C CG  . LYS C 1 217 ? -27.208 158.231 26.980  1.00 28.36 ? 217 LYS C CG  1 
ATOM 5379  C CD  . LYS C 1 217 ? -25.979 158.820 27.629  1.00 29.25 ? 217 LYS C CD  1 
ATOM 5380  C CE  . LYS C 1 217 ? -25.639 160.159 27.021  1.00 30.18 ? 217 LYS C CE  1 
ATOM 5381  N NZ  . LYS C 1 217 ? -25.195 160.008 25.613  1.00 30.68 ? 217 LYS C NZ  1 
ATOM 5382  O OXT . LYS C 1 217 ? -29.691 155.468 28.708  1.00 30.09 ? 217 LYS C OXT 1 
ATOM 5383  N N   . SER D 1 1   ? -3.888  116.767 1.106   1.00 13.77 ? 1   SER D N   1 
ATOM 5384  C CA  . SER D 1 1   ? -5.146  116.744 1.892   1.00 16.26 ? 1   SER D CA  1 
ATOM 5385  C C   . SER D 1 1   ? -5.321  118.077 2.618   1.00 16.19 ? 1   SER D C   1 
ATOM 5386  O O   . SER D 1 1   ? -4.463  118.972 2.487   1.00 18.02 ? 1   SER D O   1 
ATOM 5387  C CB  . SER D 1 1   ? -5.078  115.597 2.904   1.00 16.28 ? 1   SER D CB  1 
ATOM 5388  O OG  . SER D 1 1   ? -3.761  115.465 3.390   1.00 17.51 ? 1   SER D OG  1 
ATOM 5389  N N   . MET D 1 2   ? -6.415  118.233 3.322   1.00 16.36 ? 2   MET D N   1 
ATOM 5390  C CA  . MET D 1 2   ? -6.653  119.444 4.081   1.00 17.45 ? 2   MET D CA  1 
ATOM 5391  C C   . MET D 1 2   ? -6.363  119.077 5.523   1.00 19.32 ? 2   MET D C   1 
ATOM 5392  O O   . MET D 1 2   ? -6.555  117.903 5.916   1.00 22.01 ? 2   MET D O   1 
ATOM 5393  C CB  . MET D 1 2   ? -8.099  119.910 3.923   1.00 17.31 ? 2   MET D CB  1 
ATOM 5394  C CG  . MET D 1 2   ? -9.146  118.847 4.212   1.00 14.79 ? 2   MET D CG  1 
ATOM 5395  S SD  . MET D 1 2   ? -10.828 119.497 4.276   1.00 10.48 ? 2   MET D SD  1 
ATOM 5396  C CE  . MET D 1 2   ? -10.656 121.070 3.499   1.00 4.90  ? 2   MET D CE  1 
ATOM 5397  N N   . THR D 1 3   ? -5.879  120.037 6.305   1.00 19.08 ? 3   THR D N   1 
ATOM 5398  C CA  . THR D 1 3   ? -5.562  119.754 7.698   1.00 19.49 ? 3   THR D CA  1 
ATOM 5399  C C   . THR D 1 3   ? -6.358  120.600 8.680   1.00 17.31 ? 3   THR D C   1 
ATOM 5400  O O   . THR D 1 3   ? -6.347  121.856 8.624   1.00 18.19 ? 3   THR D O   1 
ATOM 5401  C CB  . THR D 1 3   ? -4.033  119.852 7.985   1.00 22.80 ? 3   THR D CB  1 
ATOM 5402  O OG1 . THR D 1 3   ? -3.778  119.497 9.350   1.00 23.77 ? 3   THR D OG1 1 
ATOM 5403  C CG2 . THR D 1 3   ? -3.498  121.252 7.707   1.00 24.65 ? 3   THR D CG2 1 
ATOM 5404  N N   . LEU D 1 4   ? -7.112  119.902 9.519   1.00 15.24 ? 4   LEU D N   1 
ATOM 5405  C CA  . LEU D 1 4   ? -7.931  120.531 10.527  1.00 9.28  ? 4   LEU D CA  1 
ATOM 5406  C C   . LEU D 1 4   ? -7.052  120.725 11.741  1.00 8.84  ? 4   LEU D C   1 
ATOM 5407  O O   . LEU D 1 4   ? -6.190  119.866 12.011  1.00 9.21  ? 4   LEU D O   1 
ATOM 5408  C CB  . LEU D 1 4   ? -9.117  119.634 10.885  1.00 7.14  ? 4   LEU D CB  1 
ATOM 5409  C CG  . LEU D 1 4   ? -9.979  120.095 12.068  1.00 3.63  ? 4   LEU D CG  1 
ATOM 5410  C CD1 . LEU D 1 4   ? -10.485 121.518 11.843  1.00 3.34  ? 4   LEU D CD1 1 
ATOM 5411  C CD2 . LEU D 1 4   ? -11.133 119.130 12.291  1.00 5.15  ? 4   LEU D CD2 1 
ATOM 5412  N N   . GLY D 1 5   ? -7.271  121.832 12.445  1.00 11.60 ? 5   GLY D N   1 
ATOM 5413  C CA  . GLY D 1 5   ? -6.502  122.118 13.637  1.00 11.01 ? 5   GLY D CA  1 
ATOM 5414  C C   . GLY D 1 5   ? -7.397  122.462 14.804  1.00 8.56  ? 5   GLY D C   1 
ATOM 5415  O O   . GLY D 1 5   ? -8.285  123.303 14.681  1.00 6.97  ? 5   GLY D O   1 
ATOM 5416  N N   . TYR D 1 6   ? -7.192  121.772 15.920  1.00 11.17 ? 6   TYR D N   1 
ATOM 5417  C CA  . TYR D 1 6   ? -7.959  121.996 17.141  1.00 12.38 ? 6   TYR D CA  1 
ATOM 5418  C C   . TYR D 1 6   ? -7.271  121.271 18.289  1.00 15.52 ? 6   TYR D C   1 
ATOM 5419  O O   . TYR D 1 6   ? -6.380  120.450 18.070  1.00 15.85 ? 6   TYR D O   1 
ATOM 5420  C CB  . TYR D 1 6   ? -9.393  121.471 17.008  1.00 9.15  ? 6   TYR D CB  1 
ATOM 5421  C CG  . TYR D 1 6   ? -10.332 122.012 18.064  1.00 4.30  ? 6   TYR D CG  1 
ATOM 5422  C CD1 . TYR D 1 6   ? -10.450 123.379 18.268  1.00 4.43  ? 6   TYR D CD1 1 
ATOM 5423  C CD2 . TYR D 1 6   ? -11.111 121.163 18.849  1.00 5.64  ? 6   TYR D CD2 1 
ATOM 5424  C CE1 . TYR D 1 6   ? -11.317 123.893 19.221  1.00 6.44  ? 6   TYR D CE1 1 
ATOM 5425  C CE2 . TYR D 1 6   ? -11.982 121.668 19.802  1.00 2.00  ? 6   TYR D CE2 1 
ATOM 5426  C CZ  . TYR D 1 6   ? -12.079 123.035 19.982  1.00 2.00  ? 6   TYR D CZ  1 
ATOM 5427  O OH  . TYR D 1 6   ? -12.945 123.574 20.903  1.00 2.00  ? 6   TYR D OH  1 
ATOM 5428  N N   . TRP D 1 7   ? -7.657  121.602 19.516  1.00 16.21 ? 7   TRP D N   1 
ATOM 5429  C CA  . TRP D 1 7   ? -7.080  120.946 20.679  1.00 17.01 ? 7   TRP D CA  1 
ATOM 5430  C C   . TRP D 1 7   ? -7.542  119.493 20.635  1.00 15.73 ? 7   TRP D C   1 
ATOM 5431  O O   . TRP D 1 7   ? -8.274  119.088 19.733  1.00 17.46 ? 7   TRP D O   1 
ATOM 5432  C CB  . TRP D 1 7   ? -7.587  121.581 21.975  1.00 18.40 ? 7   TRP D CB  1 
ATOM 5433  C CG  . TRP D 1 7   ? -7.443  123.076 22.065  1.00 19.20 ? 7   TRP D CG  1 
ATOM 5434  C CD1 . TRP D 1 7   ? -8.356  124.010 21.658  1.00 17.44 ? 7   TRP D CD1 1 
ATOM 5435  C CD2 . TRP D 1 7   ? -6.371  123.806 22.681  1.00 18.44 ? 7   TRP D CD2 1 
ATOM 5436  N NE1 . TRP D 1 7   ? -7.927  125.271 21.994  1.00 14.88 ? 7   TRP D NE1 1 
ATOM 5437  C CE2 . TRP D 1 7   ? -6.715  125.178 22.624  1.00 17.95 ? 7   TRP D CE2 1 
ATOM 5438  C CE3 . TRP D 1 7   ? -5.162  123.431 23.283  1.00 18.23 ? 7   TRP D CE3 1 
ATOM 5439  C CZ2 . TRP D 1 7   ? -5.890  126.181 23.146  1.00 15.77 ? 7   TRP D CZ2 1 
ATOM 5440  C CZ3 . TRP D 1 7   ? -4.341  124.435 23.804  1.00 21.18 ? 7   TRP D CZ3 1 
ATOM 5441  C CH2 . TRP D 1 7   ? -4.713  125.792 23.730  1.00 15.85 ? 7   TRP D CH2 1 
ATOM 5442  N N   . ASP D 1 8   ? -7.118  118.717 21.621  1.00 16.64 ? 8   ASP D N   1 
ATOM 5443  C CA  . ASP D 1 8   ? -7.501  117.314 21.722  1.00 18.64 ? 8   ASP D CA  1 
ATOM 5444  C C   . ASP D 1 8   ? -8.983  117.217 22.086  1.00 19.66 ? 8   ASP D C   1 
ATOM 5445  O O   . ASP D 1 8   ? -9.597  116.159 21.978  1.00 20.87 ? 8   ASP D O   1 
ATOM 5446  C CB  . ASP D 1 8   ? -6.670  116.638 22.814  1.00 18.33 ? 8   ASP D CB  1 
ATOM 5447  C CG  . ASP D 1 8   ? -6.788  117.346 24.159  1.00 17.78 ? 8   ASP D CG  1 
ATOM 5448  O OD1 . ASP D 1 8   ? -6.121  118.385 24.337  1.00 14.04 ? 8   ASP D OD1 1 
ATOM 5449  O OD2 . ASP D 1 8   ? -7.549  116.870 25.033  1.00 17.58 ? 8   ASP D OD2 1 
ATOM 5450  N N   . ILE D 1 9   ? -9.530  118.337 22.542  1.00 18.59 ? 9   ILE D N   1 
ATOM 5451  C CA  . ILE D 1 9   ? -10.914 118.447 22.979  1.00 18.57 ? 9   ILE D CA  1 
ATOM 5452  C C   . ILE D 1 9   ? -11.934 118.334 21.831  1.00 17.81 ? 9   ILE D C   1 
ATOM 5453  O O   . ILE D 1 9   ? -11.586 118.561 20.666  1.00 17.31 ? 9   ILE D O   1 
ATOM 5454  C CB  . ILE D 1 9   ? -11.072 119.781 23.778  1.00 20.01 ? 9   ILE D CB  1 
ATOM 5455  C CG1 . ILE D 1 9   ? -11.238 119.488 25.265  1.00 20.96 ? 9   ILE D CG1 1 
ATOM 5456  C CG2 . ILE D 1 9   ? -12.191 120.667 23.259  1.00 18.53 ? 9   ILE D CG2 1 
ATOM 5457  C CD1 . ILE D 1 9   ? -9.950  119.089 25.973  1.00 22.91 ? 9   ILE D CD1 1 
ATOM 5458  N N   . ARG D 1 10  ? -13.173 117.962 22.159  1.00 15.10 ? 10  ARG D N   1 
ATOM 5459  C CA  . ARG D 1 10  ? -14.255 117.897 21.166  1.00 13.53 ? 10  ARG D CA  1 
ATOM 5460  C C   . ARG D 1 10  ? -14.620 119.325 20.760  1.00 11.55 ? 10  ARG D C   1 
ATOM 5461  O O   . ARG D 1 10  ? -14.419 119.734 19.593  1.00 10.48 ? 10  ARG D O   1 
ATOM 5462  C CB  . ARG D 1 10  ? -15.493 117.207 21.763  1.00 14.49 ? 10  ARG D CB  1 
ATOM 5463  C CG  . ARG D 1 10  ? -16.819 117.617 21.121  1.00 15.99 ? 10  ARG D CG  1 
ATOM 5464  C CD  . ARG D 1 10  ? -18.022 117.111 21.894  1.00 13.19 ? 10  ARG D CD  1 
ATOM 5465  N NE  . ARG D 1 10  ? -19.281 117.670 21.394  1.00 14.44 ? 10  ARG D NE  1 
ATOM 5466  C CZ  . ARG D 1 10  ? -20.403 116.970 21.215  1.00 15.10 ? 10  ARG D CZ  1 
ATOM 5467  N NH1 . ARG D 1 10  ? -20.436 115.672 21.488  1.00 9.23  ? 10  ARG D NH1 1 
ATOM 5468  N NH2 . ARG D 1 10  ? -21.501 117.568 20.765  1.00 10.58 ? 10  ARG D NH2 1 
ATOM 5469  N N   . GLY D 1 11  ? -15.170 120.059 21.726  1.00 11.28 ? 11  GLY D N   1 
ATOM 5470  C CA  . GLY D 1 11  ? -15.561 121.442 21.527  1.00 9.04  ? 11  GLY D CA  1 
ATOM 5471  C C   . GLY D 1 11  ? -16.185 121.782 20.189  1.00 10.42 ? 11  GLY D C   1 
ATOM 5472  O O   . GLY D 1 11  ? -17.002 121.025 19.652  1.00 14.04 ? 11  GLY D O   1 
ATOM 5473  N N   . LEU D 1 12  ? -15.775 122.922 19.645  1.00 11.20 ? 12  LEU D N   1 
ATOM 5474  C CA  . LEU D 1 12  ? -16.278 123.433 18.370  1.00 8.16  ? 12  LEU D CA  1 
ATOM 5475  C C   . LEU D 1 12  ? -15.915 122.574 17.149  1.00 6.23  ? 12  LEU D C   1 
ATOM 5476  O O   . LEU D 1 12  ? -16.697 122.490 16.203  1.00 9.89  ? 12  LEU D O   1 
ATOM 5477  C CB  . LEU D 1 12  ? -15.808 124.852 18.150  1.00 2.31  ? 12  LEU D CB  1 
ATOM 5478  C CG  . LEU D 1 12  ? -16.323 125.862 19.166  1.00 7.78  ? 12  LEU D CG  1 
ATOM 5479  C CD1 . LEU D 1 12  ? -15.542 127.151 19.036  1.00 10.56 ? 12  LEU D CD1 1 
ATOM 5480  C CD2 . LEU D 1 12  ? -17.817 126.093 18.971  1.00 6.32  ? 12  LEU D CD2 1 
ATOM 5481  N N   . ALA D 1 13  ? -14.750 121.922 17.158  1.00 2.93  ? 13  ALA D N   1 
ATOM 5482  C CA  . ALA D 1 13  ? -14.311 121.146 16.042  1.00 3.86  ? 13  ALA D CA  1 
ATOM 5483  C C   . ALA D 1 13  ? -15.110 119.897 15.789  1.00 6.91  ? 13  ALA D C   1 
ATOM 5484  O O   . ALA D 1 13  ? -15.052 119.340 14.704  1.00 7.17  ? 13  ALA D O   1 
ATOM 5485  C CB  . ALA D 1 13  ? -12.879 120.803 16.166  1.00 2.00  ? 13  ALA D CB  1 
ATOM 5486  N N   . HIS D 1 14  ? -15.923 119.478 16.768  1.00 9.34  ? 14  HIS D N   1 
ATOM 5487  C CA  . HIS D 1 14  ? -16.756 118.279 16.615  1.00 10.04 ? 14  HIS D CA  1 
ATOM 5488  C C   . HIS D 1 14  ? -17.678 118.406 15.404  1.00 8.77  ? 14  HIS D C   1 
ATOM 5489  O O   . HIS D 1 14  ? -17.834 117.459 14.639  1.00 10.59 ? 14  HIS D O   1 
ATOM 5490  C CB  . HIS D 1 14  ? -17.597 118.027 17.872  1.00 7.64  ? 14  HIS D CB  1 
ATOM 5491  C CG  . HIS D 1 14  ? -18.190 116.651 17.942  1.00 7.05  ? 14  HIS D CG  1 
ATOM 5492  N ND1 . HIS D 1 14  ? -17.444 115.507 17.754  1.00 12.01 ? 14  HIS D ND1 1 
ATOM 5493  C CD2 . HIS D 1 14  ? -19.447 116.233 18.221  1.00 7.91  ? 14  HIS D CD2 1 
ATOM 5494  C CE1 . HIS D 1 14  ? -18.214 114.445 17.916  1.00 3.03  ? 14  HIS D CE1 1 
ATOM 5495  N NE2 . HIS D 1 14  ? -19.435 114.858 18.202  1.00 6.09  ? 14  HIS D NE2 1 
ATOM 5496  N N   . ALA D 1 15  ? -18.282 119.580 15.239  1.00 9.20  ? 15  ALA D N   1 
ATOM 5497  C CA  . ALA D 1 15  ? -19.185 119.833 14.122  1.00 8.22  ? 15  ALA D CA  1 
ATOM 5498  C C   . ALA D 1 15  ? -18.427 119.732 12.810  1.00 8.29  ? 15  ALA D C   1 
ATOM 5499  O O   . ALA D 1 15  ? -18.868 119.044 11.891  1.00 7.13  ? 15  ALA D O   1 
ATOM 5500  C CB  . ALA D 1 15  ? -19.829 121.200 14.254  1.00 8.77  ? 15  ALA D CB  1 
ATOM 5501  N N   . ILE D 1 16  ? -17.270 120.385 12.739  1.00 9.77  ? 16  ILE D N   1 
ATOM 5502  C CA  . ILE D 1 16  ? -16.443 120.353 11.533  1.00 9.02  ? 16  ILE D CA  1 
ATOM 5503  C C   . ILE D 1 16  ? -16.049 118.903 11.228  1.00 9.77  ? 16  ILE D C   1 
ATOM 5504  O O   . ILE D 1 16  ? -16.200 118.430 10.100  1.00 4.73  ? 16  ILE D O   1 
ATOM 5505  C CB  . ILE D 1 16  ? -15.156 121.223 11.682  1.00 2.00  ? 16  ILE D CB  1 
ATOM 5506  C CG1 . ILE D 1 16  ? -15.512 122.707 11.773  1.00 2.00  ? 16  ILE D CG1 1 
ATOM 5507  C CG2 . ILE D 1 16  ? -14.236 121.029 10.494  1.00 2.00  ? 16  ILE D CG2 1 
ATOM 5508  C CD1 . ILE D 1 16  ? -15.958 123.177 13.131  1.00 2.29  ? 16  ILE D CD1 1 
ATOM 5509  N N   . ARG D 1 17  ? -15.602 118.189 12.257  1.00 13.33 ? 17  ARG D N   1 
ATOM 5510  C CA  . ARG D 1 17  ? -15.184 116.792 12.131  1.00 16.43 ? 17  ARG D CA  1 
ATOM 5511  C C   . ARG D 1 17  ? -16.295 115.888 11.597  1.00 14.23 ? 17  ARG D C   1 
ATOM 5512  O O   . ARG D 1 17  ? -16.029 114.905 10.898  1.00 14.63 ? 17  ARG D O   1 
ATOM 5513  C CB  . ARG D 1 17  ? -14.707 116.259 13.485  1.00 17.42 ? 17  ARG D CB  1 
ATOM 5514  C CG  . ARG D 1 17  ? -13.480 116.963 14.037  1.00 19.86 ? 17  ARG D CG  1 
ATOM 5515  C CD  . ARG D 1 17  ? -13.002 116.331 15.342  1.00 20.50 ? 17  ARG D CD  1 
ATOM 5516  N NE  . ARG D 1 17  ? -11.775 116.974 15.806  1.00 21.96 ? 17  ARG D NE  1 
ATOM 5517  C CZ  . ARG D 1 17  ? -11.676 117.707 16.910  1.00 20.14 ? 17  ARG D CZ  1 
ATOM 5518  N NH1 . ARG D 1 17  ? -12.739 117.891 17.689  1.00 17.23 ? 17  ARG D NH1 1 
ATOM 5519  N NH2 . ARG D 1 17  ? -10.520 118.297 17.204  1.00 17.78 ? 17  ARG D NH2 1 
ATOM 5520  N N   . LEU D 1 18  ? -17.532 116.208 11.959  1.00 16.19 ? 18  LEU D N   1 
ATOM 5521  C CA  . LEU D 1 18  ? -18.680 115.439 11.515  1.00 15.42 ? 18  LEU D CA  1 
ATOM 5522  C C   . LEU D 1 18  ? -18.869 115.653 10.029  1.00 17.12 ? 18  LEU D C   1 
ATOM 5523  O O   . LEU D 1 18  ? -18.864 114.704 9.244   1.00 18.16 ? 18  LEU D O   1 
ATOM 5524  C CB  . LEU D 1 18  ? -19.936 115.884 12.261  1.00 12.91 ? 18  LEU D CB  1 
ATOM 5525  C CG  . LEU D 1 18  ? -19.955 115.570 13.753  1.00 9.36  ? 18  LEU D CG  1 
ATOM 5526  C CD1 . LEU D 1 18  ? -21.209 116.151 14.372  1.00 4.77  ? 18  LEU D CD1 1 
ATOM 5527  C CD2 . LEU D 1 18  ? -19.881 114.068 13.965  1.00 2.00  ? 18  LEU D CD2 1 
ATOM 5528  N N   . LEU D 1 19  ? -18.989 116.920 9.651   1.00 15.23 ? 19  LEU D N   1 
ATOM 5529  C CA  . LEU D 1 19  ? -19.186 117.309 8.265   1.00 15.11 ? 19  LEU D CA  1 
ATOM 5530  C C   . LEU D 1 19  ? -18.077 116.772 7.359   1.00 15.31 ? 19  LEU D C   1 
ATOM 5531  O O   . LEU D 1 19  ? -18.356 116.173 6.323   1.00 13.65 ? 19  LEU D O   1 
ATOM 5532  C CB  . LEU D 1 19  ? -19.263 118.832 8.175   1.00 14.18 ? 19  LEU D CB  1 
ATOM 5533  C CG  . LEU D 1 19  ? -19.518 119.518 6.832   1.00 17.08 ? 19  LEU D CG  1 
ATOM 5534  C CD1 . LEU D 1 19  ? -20.812 119.015 6.196   1.00 10.44 ? 19  LEU D CD1 1 
ATOM 5535  C CD2 . LEU D 1 19  ? -19.576 121.022 7.071   1.00 8.89  ? 19  LEU D CD2 1 
ATOM 5536  N N   . LEU D 1 20  ? -16.827 116.953 7.770   1.00 16.77 ? 20  LEU D N   1 
ATOM 5537  C CA  . LEU D 1 20  ? -15.675 116.488 6.997   1.00 16.62 ? 20  LEU D CA  1 
ATOM 5538  C C   . LEU D 1 20  ? -15.712 114.980 6.726   1.00 16.06 ? 20  LEU D C   1 
ATOM 5539  O O   . LEU D 1 20  ? -15.429 114.524 5.592   1.00 14.78 ? 20  LEU D O   1 
ATOM 5540  C CB  . LEU D 1 20  ? -14.368 116.862 7.714   1.00 13.82 ? 20  LEU D CB  1 
ATOM 5541  C CG  . LEU D 1 20  ? -13.952 118.340 7.753   1.00 17.90 ? 20  LEU D CG  1 
ATOM 5542  C CD1 . LEU D 1 20  ? -12.806 118.527 8.730   1.00 12.74 ? 20  LEU D CD1 1 
ATOM 5543  C CD2 . LEU D 1 20  ? -13.558 118.828 6.365   1.00 13.06 ? 20  LEU D CD2 1 
ATOM 5544  N N   . GLU D 1 21  ? -16.066 114.217 7.753   1.00 17.46 ? 21  GLU D N   1 
ATOM 5545  C CA  . GLU D 1 21  ? -16.142 112.768 7.646   1.00 20.02 ? 21  GLU D CA  1 
ATOM 5546  C C   . GLU D 1 21  ? -17.304 112.329 6.760   1.00 21.84 ? 21  GLU D C   1 
ATOM 5547  O O   . GLU D 1 21  ? -17.177 111.368 5.968   1.00 22.53 ? 21  GLU D O   1 
ATOM 5548  C CB  . GLU D 1 21  ? -16.282 112.143 9.035   1.00 19.63 ? 21  GLU D CB  1 
ATOM 5549  C CG  . GLU D 1 21  ? -15.089 111.312 9.454   1.00 23.01 ? 21  GLU D CG  1 
ATOM 5550  C CD  . GLU D 1 21  ? -14.913 110.072 8.601   1.00 27.99 ? 21  GLU D CD  1 
ATOM 5551  O OE1 . GLU D 1 21  ? -14.213 110.148 7.568   1.00 30.19 ? 21  GLU D OE1 1 
ATOM 5552  O OE2 . GLU D 1 21  ? -15.475 109.019 8.965   1.00 29.84 ? 21  GLU D OE2 1 
ATOM 5553  N N   . TYR D 1 22  ? -18.426 113.033 6.897   1.00 20.58 ? 22  TYR D N   1 
ATOM 5554  C CA  . TYR D 1 22  ? -19.635 112.751 6.132   1.00 19.14 ? 22  TYR D CA  1 
ATOM 5555  C C   . TYR D 1 22  ? -19.311 112.710 4.648   1.00 15.99 ? 22  TYR D C   1 
ATOM 5556  O O   . TYR D 1 22  ? -19.367 111.651 4.019   1.00 16.33 ? 22  TYR D O   1 
ATOM 5557  C CB  . TYR D 1 22  ? -20.687 113.835 6.402   1.00 16.24 ? 22  TYR D CB  1 
ATOM 5558  C CG  . TYR D 1 22  ? -21.998 113.665 5.667   1.00 16.56 ? 22  TYR D CG  1 
ATOM 5559  C CD1 . TYR D 1 22  ? -23.038 112.922 6.226   1.00 16.60 ? 22  TYR D CD1 1 
ATOM 5560  C CD2 . TYR D 1 22  ? -22.220 114.289 4.439   1.00 15.17 ? 22  TYR D CD2 1 
ATOM 5561  C CE1 . TYR D 1 22  ? -24.275 112.808 5.583   1.00 14.55 ? 22  TYR D CE1 1 
ATOM 5562  C CE2 . TYR D 1 22  ? -23.451 114.181 3.768   1.00 14.76 ? 22  TYR D CE2 1 
ATOM 5563  C CZ  . TYR D 1 22  ? -24.476 113.441 4.364   1.00 15.22 ? 22  TYR D CZ  1 
ATOM 5564  O OH  . TYR D 1 22  ? -25.699 113.347 3.741   1.00 14.32 ? 22  TYR D OH  1 
ATOM 5565  N N   . THR D 1 23  ? -18.908 113.856 4.111   1.00 14.69 ? 23  THR D N   1 
ATOM 5566  C CA  . THR D 1 23  ? -18.596 113.968 2.698   1.00 18.03 ? 23  THR D CA  1 
ATOM 5567  C C   . THR D 1 23  ? -17.255 113.416 2.222   1.00 20.10 ? 23  THR D C   1 
ATOM 5568  O O   . THR D 1 23  ? -16.579 114.039 1.403   1.00 21.96 ? 23  THR D O   1 
ATOM 5569  C CB  . THR D 1 23  ? -18.765 115.409 2.227   1.00 16.54 ? 23  THR D CB  1 
ATOM 5570  O OG1 . THR D 1 23  ? -18.350 116.303 3.269   1.00 18.76 ? 23  THR D OG1 1 
ATOM 5571  C CG2 . THR D 1 23  ? -20.216 115.679 1.871   1.00 15.15 ? 23  THR D CG2 1 
ATOM 5572  N N   . ASP D 1 24  ? -16.899 112.232 2.707   1.00 21.08 ? 24  ASP D N   1 
ATOM 5573  C CA  . ASP D 1 24  ? -15.658 111.562 2.336   1.00 19.18 ? 24  ASP D CA  1 
ATOM 5574  C C   . ASP D 1 24  ? -14.487 112.490 2.047   1.00 21.27 ? 24  ASP D C   1 
ATOM 5575  O O   . ASP D 1 24  ? -13.792 112.332 1.041   1.00 21.35 ? 24  ASP D O   1 
ATOM 5576  C CB  . ASP D 1 24  ? -15.887 110.628 1.141   1.00 18.48 ? 24  ASP D CB  1 
ATOM 5577  C CG  . ASP D 1 24  ? -16.373 109.236 1.557   1.00 19.78 ? 24  ASP D CG  1 
ATOM 5578  O OD1 . ASP D 1 24  ? -17.496 109.131 2.101   1.00 18.49 ? 24  ASP D OD1 1 
ATOM 5579  O OD2 . ASP D 1 24  ? -15.637 108.245 1.329   1.00 19.75 ? 24  ASP D OD2 1 
ATOM 5580  N N   . SER D 1 25  ? -14.278 113.475 2.911   1.00 21.70 ? 25  SER D N   1 
ATOM 5581  C CA  . SER D 1 25  ? -13.167 114.386 2.713   1.00 19.13 ? 25  SER D CA  1 
ATOM 5582  C C   . SER D 1 25  ? -11.906 113.787 3.340   1.00 18.19 ? 25  SER D C   1 
ATOM 5583  O O   . SER D 1 25  ? -11.930 113.271 4.462   1.00 15.98 ? 25  SER D O   1 
ATOM 5584  C CB  . SER D 1 25  ? -13.478 115.775 3.289   1.00 19.34 ? 25  SER D CB  1 
ATOM 5585  O OG  . SER D 1 25  ? -14.428 116.475 2.487   1.00 21.44 ? 25  SER D OG  1 
ATOM 5586  N N   . SER D 1 26  ? -10.825 113.802 2.573   1.00 18.53 ? 26  SER D N   1 
ATOM 5587  C CA  . SER D 1 26  ? -9.542  113.283 3.017   1.00 18.12 ? 26  SER D CA  1 
ATOM 5588  C C   . SER D 1 26  ? -8.816  114.335 3.846   1.00 19.61 ? 26  SER D C   1 
ATOM 5589  O O   . SER D 1 26  ? -8.039  115.124 3.309   1.00 20.62 ? 26  SER D O   1 
ATOM 5590  C CB  . SER D 1 26  ? -8.710  112.901 1.796   1.00 16.57 ? 26  SER D CB  1 
ATOM 5591  O OG  . SER D 1 26  ? -8.994  113.759 0.699   1.00 14.49 ? 26  SER D OG  1 
ATOM 5592  N N   . TYR D 1 27  ? -9.076  114.359 5.149   1.00 20.40 ? 27  TYR D N   1 
ATOM 5593  C CA  . TYR D 1 27  ? -8.444  115.346 6.015   1.00 16.22 ? 27  TYR D CA  1 
ATOM 5594  C C   . TYR D 1 27  ? -7.392  114.759 6.935   1.00 18.23 ? 27  TYR D C   1 
ATOM 5595  O O   . TYR D 1 27  ? -7.311  113.538 7.110   1.00 14.63 ? 27  TYR D O   1 
ATOM 5596  C CB  . TYR D 1 27  ? -9.490  116.099 6.845   1.00 16.94 ? 27  TYR D CB  1 
ATOM 5597  C CG  . TYR D 1 27  ? -10.227 115.249 7.856   1.00 12.95 ? 27  TYR D CG  1 
ATOM 5598  C CD1 . TYR D 1 27  ? -11.207 114.343 7.453   1.00 12.78 ? 27  TYR D CD1 1 
ATOM 5599  C CD2 . TYR D 1 27  ? -9.964  115.368 9.217   1.00 9.68  ? 27  TYR D CD2 1 
ATOM 5600  C CE1 . TYR D 1 27  ? -11.907 113.578 8.381   1.00 12.54 ? 27  TYR D CE1 1 
ATOM 5601  C CE2 . TYR D 1 27  ? -10.659 114.609 10.150  1.00 7.74  ? 27  TYR D CE2 1 
ATOM 5602  C CZ  . TYR D 1 27  ? -11.628 113.719 9.729   1.00 7.29  ? 27  TYR D CZ  1 
ATOM 5603  O OH  . TYR D 1 27  ? -12.325 112.981 10.656  1.00 4.34  ? 27  TYR D OH  1 
ATOM 5604  N N   . GLU D 1 28  ? -6.584  115.648 7.507   1.00 21.18 ? 28  GLU D N   1 
ATOM 5605  C CA  . GLU D 1 28  ? -5.528  115.275 8.435   1.00 20.63 ? 28  GLU D CA  1 
ATOM 5606  C C   . GLU D 1 28  ? -5.855  116.014 9.724   1.00 20.56 ? 28  GLU D C   1 
ATOM 5607  O O   . GLU D 1 28  ? -6.289  117.168 9.693   1.00 20.84 ? 28  GLU D O   1 
ATOM 5608  C CB  . GLU D 1 28  ? -4.168  115.707 7.897   1.00 20.57 ? 28  GLU D CB  1 
ATOM 5609  C CG  . GLU D 1 28  ? -3.034  114.779 8.291   1.00 22.72 ? 28  GLU D CG  1 
ATOM 5610  C CD  . GLU D 1 28  ? -1.711  115.180 7.671   1.00 25.41 ? 28  GLU D CD  1 
ATOM 5611  O OE1 . GLU D 1 28  ? -1.542  114.966 6.453   1.00 25.64 ? 28  GLU D OE1 1 
ATOM 5612  O OE2 . GLU D 1 28  ? -0.844  115.711 8.399   1.00 26.36 ? 28  GLU D OE2 1 
ATOM 5613  N N   . GLU D 1 29  ? -5.665  115.345 10.852  1.00 21.28 ? 29  GLU D N   1 
ATOM 5614  C CA  . GLU D 1 29  ? -5.987  115.929 12.145  1.00 23.23 ? 29  GLU D CA  1 
ATOM 5615  C C   . GLU D 1 29  ? -4.773  116.462 12.909  1.00 23.83 ? 29  GLU D C   1 
ATOM 5616  O O   . GLU D 1 29  ? -3.836  115.711 13.197  1.00 23.63 ? 29  GLU D O   1 
ATOM 5617  C CB  . GLU D 1 29  ? -6.708  114.878 12.994  1.00 22.50 ? 29  GLU D CB  1 
ATOM 5618  C CG  . GLU D 1 29  ? -7.371  115.407 14.253  1.00 18.95 ? 29  GLU D CG  1 
ATOM 5619  C CD  . GLU D 1 29  ? -8.781  115.908 14.018  1.00 15.24 ? 29  GLU D CD  1 
ATOM 5620  O OE1 . GLU D 1 29  ? -9.687  115.061 13.850  1.00 12.76 ? 29  GLU D OE1 1 
ATOM 5621  O OE2 . GLU D 1 29  ? -8.989  117.141 14.017  1.00 14.73 ? 29  GLU D OE2 1 
ATOM 5622  N N   . LYS D 1 30  ? -4.803  117.752 13.244  1.00 24.46 ? 30  LYS D N   1 
ATOM 5623  C CA  . LYS D 1 30  ? -3.731  118.383 14.012  1.00 23.21 ? 30  LYS D CA  1 
ATOM 5624  C C   . LYS D 1 30  ? -4.283  118.858 15.353  1.00 22.87 ? 30  LYS D C   1 
ATOM 5625  O O   . LYS D 1 30  ? -5.130  119.749 15.414  1.00 22.09 ? 30  LYS D O   1 
ATOM 5626  C CB  . LYS D 1 30  ? -3.112  119.549 13.242  1.00 23.09 ? 30  LYS D CB  1 
ATOM 5627  C CG  . LYS D 1 30  ? -1.971  120.224 13.983  1.00 22.60 ? 30  LYS D CG  1 
ATOM 5628  C CD  . LYS D 1 30  ? -1.116  121.073 13.056  1.00 23.70 ? 30  LYS D CD  1 
ATOM 5629  C CE  . LYS D 1 30  ? -0.411  120.228 11.995  1.00 19.24 ? 30  LYS D CE  1 
ATOM 5630  N NZ  . LYS D 1 30  ? 0.552   121.023 11.179  1.00 16.01 ? 30  LYS D NZ  1 
ATOM 5631  N N   . LYS D 1 31  ? -3.805  118.235 16.423  1.00 22.46 ? 31  LYS D N   1 
ATOM 5632  C CA  . LYS D 1 31  ? -4.259  118.551 17.773  1.00 20.62 ? 31  LYS D CA  1 
ATOM 5633  C C   . LYS D 1 31  ? -3.212  119.274 18.621  1.00 19.18 ? 31  LYS D C   1 
ATOM 5634  O O   . LYS D 1 31  ? -2.017  119.263 18.313  1.00 19.59 ? 31  LYS D O   1 
ATOM 5635  C CB  . LYS D 1 31  ? -4.688  117.258 18.498  1.00 18.59 ? 31  LYS D CB  1 
ATOM 5636  C CG  . LYS D 1 31  ? -5.897  116.557 17.887  1.00 17.39 ? 31  LYS D CG  1 
ATOM 5637  C CD  . LYS D 1 31  ? -5.988  115.087 18.280  1.00 13.28 ? 31  LYS D CD  1 
ATOM 5638  C CE  . LYS D 1 31  ? -7.156  114.416 17.553  1.00 16.43 ? 31  LYS D CE  1 
ATOM 5639  N NZ  . LYS D 1 31  ? -7.043  112.929 17.412  1.00 15.82 ? 31  LYS D NZ  1 
ATOM 5640  N N   . TYR D 1 32  ? -3.685  119.910 19.686  1.00 19.54 ? 32  TYR D N   1 
ATOM 5641  C CA  . TYR D 1 32  ? -2.840  120.614 20.647  1.00 19.43 ? 32  TYR D CA  1 
ATOM 5642  C C   . TYR D 1 32  ? -3.363  120.139 22.008  1.00 20.95 ? 32  TYR D C   1 
ATOM 5643  O O   . TYR D 1 32  ? -4.537  119.710 22.110  1.00 22.93 ? 32  TYR D O   1 
ATOM 5644  C CB  . TYR D 1 32  ? -2.978  122.141 20.515  1.00 19.76 ? 32  TYR D CB  1 
ATOM 5645  C CG  . TYR D 1 32  ? -2.445  122.715 19.216  1.00 19.18 ? 32  TYR D CG  1 
ATOM 5646  C CD1 . TYR D 1 32  ? -1.115  122.533 18.838  1.00 18.94 ? 32  TYR D CD1 1 
ATOM 5647  C CD2 . TYR D 1 32  ? -3.277  123.430 18.345  1.00 21.98 ? 32  TYR D CD2 1 
ATOM 5648  C CE1 . TYR D 1 32  ? -0.622  123.043 17.635  1.00 19.67 ? 32  TYR D CE1 1 
ATOM 5649  C CE2 . TYR D 1 32  ? -2.795  123.944 17.138  1.00 22.98 ? 32  TYR D CE2 1 
ATOM 5650  C CZ  . TYR D 1 32  ? -1.467  123.743 16.789  1.00 21.67 ? 32  TYR D CZ  1 
ATOM 5651  O OH  . TYR D 1 32  ? -0.987  124.208 15.585  1.00 24.39 ? 32  TYR D OH  1 
ATOM 5652  N N   . THR D 1 33  ? -2.522  120.183 23.038  1.00 21.69 ? 33  THR D N   1 
ATOM 5653  C CA  . THR D 1 33  ? -2.918  119.736 24.374  1.00 21.63 ? 33  THR D CA  1 
ATOM 5654  C C   . THR D 1 33  ? -2.683  120.839 25.406  1.00 18.87 ? 33  THR D C   1 
ATOM 5655  O O   . THR D 1 33  ? -1.682  121.560 25.335  1.00 18.20 ? 33  THR D O   1 
ATOM 5656  C CB  . THR D 1 33  ? -2.128  118.477 24.786  1.00 20.36 ? 33  THR D CB  1 
ATOM 5657  O OG1 . THR D 1 33  ? -2.132  117.528 23.709  1.00 24.70 ? 33  THR D OG1 1 
ATOM 5658  C CG2 . THR D 1 33  ? -2.750  117.840 26.014  1.00 23.40 ? 33  THR D CG2 1 
ATOM 5659  N N   . MET D 1 34  ? -3.605  120.964 26.359  1.00 18.59 ? 34  MET D N   1 
ATOM 5660  C CA  . MET D 1 34  ? -3.503  121.990 27.396  1.00 20.33 ? 34  MET D CA  1 
ATOM 5661  C C   . MET D 1 34  ? -3.048  121.393 28.728  1.00 21.46 ? 34  MET D C   1 
ATOM 5662  O O   . MET D 1 34  ? -3.596  120.385 29.189  1.00 19.05 ? 34  MET D O   1 
ATOM 5663  C CB  . MET D 1 34  ? -4.844  122.700 27.572  1.00 21.29 ? 34  MET D CB  1 
ATOM 5664  C CG  . MET D 1 34  ? -4.754  124.030 28.295  1.00 19.15 ? 34  MET D CG  1 
ATOM 5665  S SD  . MET D 1 34  ? -6.363  124.818 28.492  1.00 18.22 ? 34  MET D SD  1 
ATOM 5666  C CE  . MET D 1 34  ? -6.423  125.834 27.039  1.00 22.00 ? 34  MET D CE  1 
ATOM 5667  N N   . GLY D 1 35  ? -2.052  122.031 29.337  1.00 23.79 ? 35  GLY D N   1 
ATOM 5668  C CA  . GLY D 1 35  ? -1.503  121.557 30.597  1.00 27.98 ? 35  GLY D CA  1 
ATOM 5669  C C   . GLY D 1 35  ? -2.441  121.556 31.794  1.00 30.55 ? 35  GLY D C   1 
ATOM 5670  O O   . GLY D 1 35  ? -3.480  122.219 31.783  1.00 29.16 ? 35  GLY D O   1 
ATOM 5671  N N   . ASP D 1 36  ? -2.065  120.796 32.823  1.00 30.52 ? 36  ASP D N   1 
ATOM 5672  C CA  . ASP D 1 36  ? -2.846  120.687 34.058  1.00 32.53 ? 36  ASP D CA  1 
ATOM 5673  C C   . ASP D 1 36  ? -2.473  121.808 35.033  1.00 32.85 ? 36  ASP D C   1 
ATOM 5674  O O   . ASP D 1 36  ? -1.881  122.818 34.636  1.00 34.94 ? 36  ASP D O   1 
ATOM 5675  C CB  . ASP D 1 36  ? -2.611  119.319 34.725  1.00 32.50 ? 36  ASP D CB  1 
ATOM 5676  C CG  . ASP D 1 36  ? -3.525  118.230 34.179  1.00 34.68 ? 36  ASP D CG  1 
ATOM 5677  O OD1 . ASP D 1 36  ? -4.637  118.060 34.722  1.00 33.63 ? 36  ASP D OD1 1 
ATOM 5678  O OD2 . ASP D 1 36  ? -3.133  117.542 33.212  1.00 41.45 ? 36  ASP D OD2 1 
ATOM 5679  N N   . ALA D 1 37  ? -2.822  121.622 36.307  1.00 31.81 ? 37  ALA D N   1 
ATOM 5680  C CA  . ALA D 1 37  ? -2.515  122.597 37.346  1.00 29.94 ? 37  ALA D CA  1 
ATOM 5681  C C   . ALA D 1 37  ? -3.259  123.900 37.055  1.00 31.87 ? 37  ALA D C   1 
ATOM 5682  O O   . ALA D 1 37  ? -3.986  123.990 36.068  1.00 29.94 ? 37  ALA D O   1 
ATOM 5683  C CB  . ALA D 1 37  ? -0.994  122.834 37.402  1.00 29.40 ? 37  ALA D CB  1 
ATOM 5684  N N   . PRO D 1 38  ? -3.132  124.909 37.940  1.00 34.56 ? 38  PRO D N   1 
ATOM 5685  C CA  . PRO D 1 38  ? -3.828  126.178 37.691  1.00 30.35 ? 38  PRO D CA  1 
ATOM 5686  C C   . PRO D 1 38  ? -3.343  126.822 36.398  1.00 31.26 ? 38  PRO D C   1 
ATOM 5687  O O   . PRO D 1 38  ? -4.113  127.476 35.695  1.00 33.73 ? 38  PRO D O   1 
ATOM 5688  C CB  . PRO D 1 38  ? -3.449  127.022 38.910  1.00 28.68 ? 38  PRO D CB  1 
ATOM 5689  C CG  . PRO D 1 38  ? -2.100  126.457 39.326  1.00 31.91 ? 38  PRO D CG  1 
ATOM 5690  C CD  . PRO D 1 38  ? -2.365  124.978 39.215  1.00 34.69 ? 38  PRO D CD  1 
ATOM 5691  N N   . ASP D 1 39  ? -2.059  126.643 36.100  1.00 29.90 ? 39  ASP D N   1 
ATOM 5692  C CA  . ASP D 1 39  ? -1.465  127.199 34.895  1.00 31.41 ? 39  ASP D CA  1 
ATOM 5693  C C   . ASP D 1 39  ? -1.546  126.200 33.753  1.00 27.50 ? 39  ASP D C   1 
ATOM 5694  O O   . ASP D 1 39  ? -0.562  125.534 33.413  1.00 27.60 ? 39  ASP D O   1 
ATOM 5695  C CB  . ASP D 1 39  ? -0.016  127.615 35.152  1.00 33.35 ? 39  ASP D CB  1 
ATOM 5696  C CG  . ASP D 1 39  ? 0.088   128.982 35.794  1.00 34.24 ? 39  ASP D CG  1 
ATOM 5697  O OD1 . ASP D 1 39  ? -0.262  129.121 36.987  1.00 36.75 ? 39  ASP D OD1 1 
ATOM 5698  O OD2 . ASP D 1 39  ? 0.509   129.924 35.093  1.00 34.63 ? 39  ASP D OD2 1 
ATOM 5699  N N   . TYR D 1 40  ? -2.733  126.108 33.167  1.00 25.37 ? 40  TYR D N   1 
ATOM 5700  C CA  . TYR D 1 40  ? -2.998  125.203 32.061  1.00 25.25 ? 40  TYR D CA  1 
ATOM 5701  C C   . TYR D 1 40  ? -2.141  125.591 30.867  1.00 23.54 ? 40  TYR D C   1 
ATOM 5702  O O   . TYR D 1 40  ? -2.583  126.307 29.970  1.00 20.76 ? 40  TYR D O   1 
ATOM 5703  C CB  . TYR D 1 40  ? -4.477  125.267 31.698  1.00 25.36 ? 40  TYR D CB  1 
ATOM 5704  C CG  . TYR D 1 40  ? -5.387  125.200 32.898  1.00 23.21 ? 40  TYR D CG  1 
ATOM 5705  C CD1 . TYR D 1 40  ? -5.761  126.361 33.573  1.00 23.47 ? 40  TYR D CD1 1 
ATOM 5706  C CD2 . TYR D 1 40  ? -5.873  123.981 33.364  1.00 24.27 ? 40  TYR D CD2 1 
ATOM 5707  C CE1 . TYR D 1 40  ? -6.595  126.314 34.680  1.00 24.24 ? 40  TYR D CE1 1 
ATOM 5708  C CE2 . TYR D 1 40  ? -6.711  123.921 34.477  1.00 24.82 ? 40  TYR D CE2 1 
ATOM 5709  C CZ  . TYR D 1 40  ? -7.068  125.097 35.128  1.00 23.94 ? 40  TYR D CZ  1 
ATOM 5710  O OH  . TYR D 1 40  ? -7.906  125.087 36.220  1.00 20.09 ? 40  TYR D OH  1 
ATOM 5711  N N   . ASP D 1 41  ? -0.903  125.114 30.859  1.00 23.61 ? 41  ASP D N   1 
ATOM 5712  C CA  . ASP D 1 41  ? 0.053   125.418 29.808  1.00 24.39 ? 41  ASP D CA  1 
ATOM 5713  C C   . ASP D 1 41  ? -0.429  125.094 28.397  1.00 23.58 ? 41  ASP D C   1 
ATOM 5714  O O   . ASP D 1 41  ? -0.512  123.927 28.000  1.00 24.25 ? 41  ASP D O   1 
ATOM 5715  C CB  . ASP D 1 41  ? 1.389   124.715 30.084  1.00 24.36 ? 41  ASP D CB  1 
ATOM 5716  C CG  . ASP D 1 41  ? 2.501   125.142 29.126  1.00 24.06 ? 41  ASP D CG  1 
ATOM 5717  O OD1 . ASP D 1 41  ? 2.406   126.232 28.524  1.00 24.55 ? 41  ASP D OD1 1 
ATOM 5718  O OD2 . ASP D 1 41  ? 3.486   124.389 28.983  1.00 20.14 ? 41  ASP D OD2 1 
ATOM 5719  N N   . ARG D 1 42  ? -0.694  126.151 27.633  1.00 21.88 ? 42  ARG D N   1 
ATOM 5720  C CA  . ARG D 1 42  ? -1.142  126.045 26.246  1.00 22.30 ? 42  ARG D CA  1 
ATOM 5721  C C   . ARG D 1 42  ? 0.080   126.165 25.332  1.00 21.81 ? 42  ARG D C   1 
ATOM 5722  O O   . ARG D 1 42  ? 0.066   126.904 24.343  1.00 19.09 ? 42  ARG D O   1 
ATOM 5723  C CB  . ARG D 1 42  ? -2.123  127.173 25.936  1.00 26.69 ? 42  ARG D CB  1 
ATOM 5724  C CG  . ARG D 1 42  ? -3.302  127.248 26.884  1.00 28.77 ? 42  ARG D CG  1 
ATOM 5725  C CD  . ARG D 1 42  ? -3.450  128.639 27.466  1.00 25.91 ? 42  ARG D CD  1 
ATOM 5726  N NE  . ARG D 1 42  ? -3.419  129.660 26.424  1.00 24.37 ? 42  ARG D NE  1 
ATOM 5727  C CZ  . ARG D 1 42  ? -4.187  130.745 26.403  1.00 25.50 ? 42  ARG D CZ  1 
ATOM 5728  N NH1 . ARG D 1 42  ? -5.066  130.978 27.370  1.00 24.59 ? 42  ARG D NH1 1 
ATOM 5729  N NH2 . ARG D 1 42  ? -4.068  131.600 25.401  1.00 25.95 ? 42  ARG D NH2 1 
ATOM 5730  N N   . SER D 1 43  ? 1.127   125.420 25.676  1.00 23.01 ? 43  SER D N   1 
ATOM 5731  C CA  . SER D 1 43  ? 2.401   125.413 24.955  1.00 20.80 ? 43  SER D CA  1 
ATOM 5732  C C   . SER D 1 43  ? 2.294   125.105 23.462  1.00 20.37 ? 43  SER D C   1 
ATOM 5733  O O   . SER D 1 43  ? 2.542   125.969 22.625  1.00 20.88 ? 43  SER D O   1 
ATOM 5734  C CB  . SER D 1 43  ? 3.363   124.422 25.626  1.00 21.05 ? 43  SER D CB  1 
ATOM 5735  O OG  . SER D 1 43  ? 4.472   124.088 24.801  1.00 23.24 ? 43  SER D OG  1 
ATOM 5736  N N   . GLN D 1 44  ? 1.925   123.868 23.140  1.00 19.49 ? 44  GLN D N   1 
ATOM 5737  C CA  . GLN D 1 44  ? 1.801   123.427 21.755  1.00 18.90 ? 44  GLN D CA  1 
ATOM 5738  C C   . GLN D 1 44  ? 1.124   124.477 20.873  1.00 18.54 ? 44  GLN D C   1 
ATOM 5739  O O   . GLN D 1 44  ? 1.703   124.941 19.884  1.00 20.18 ? 44  GLN D O   1 
ATOM 5740  C CB  . GLN D 1 44  ? 1.034   122.095 21.681  1.00 18.93 ? 44  GLN D CB  1 
ATOM 5741  C CG  . GLN D 1 44  ? 1.765   120.883 22.264  1.00 19.80 ? 44  GLN D CG  1 
ATOM 5742  C CD  . GLN D 1 44  ? 1.023   119.566 22.034  1.00 21.47 ? 44  GLN D CD  1 
ATOM 5743  O OE1 . GLN D 1 44  ? -0.194  119.494 22.171  1.00 18.43 ? 44  GLN D OE1 1 
ATOM 5744  N NE2 . GLN D 1 44  ? 1.763   118.518 21.693  1.00 21.05 ? 44  GLN D NE2 1 
ATOM 5745  N N   . TRP D 1 45  ? -0.077  124.884 21.272  1.00 17.55 ? 45  TRP D N   1 
ATOM 5746  C CA  . TRP D 1 45  ? -0.837  125.867 20.518  1.00 15.07 ? 45  TRP D CA  1 
ATOM 5747  C C   . TRP D 1 45  ? -0.038  127.147 20.251  1.00 13.74 ? 45  TRP D C   1 
ATOM 5748  O O   . TRP D 1 45  ? 0.456   127.341 19.141  1.00 13.14 ? 45  TRP D O   1 
ATOM 5749  C CB  . TRP D 1 45  ? -2.160  126.169 21.234  1.00 13.14 ? 45  TRP D CB  1 
ATOM 5750  C CG  . TRP D 1 45  ? -2.896  127.374 20.735  1.00 9.38  ? 45  TRP D CG  1 
ATOM 5751  C CD1 . TRP D 1 45  ? -3.524  128.294 21.498  1.00 6.38  ? 45  TRP D CD1 1 
ATOM 5752  C CD2 . TRP D 1 45  ? -3.032  127.812 19.370  1.00 13.98 ? 45  TRP D CD2 1 
ATOM 5753  N NE1 . TRP D 1 45  ? -4.034  129.308 20.703  1.00 14.54 ? 45  TRP D NE1 1 
ATOM 5754  C CE2 . TRP D 1 45  ? -3.750  129.029 19.395  1.00 16.35 ? 45  TRP D CE2 1 
ATOM 5755  C CE3 . TRP D 1 45  ? -2.616  127.296 18.136  1.00 13.31 ? 45  TRP D CE3 1 
ATOM 5756  C CZ2 . TRP D 1 45  ? -4.058  129.743 18.231  1.00 16.33 ? 45  TRP D CZ2 1 
ATOM 5757  C CZ3 . TRP D 1 45  ? -2.922  128.007 16.977  1.00 15.69 ? 45  TRP D CZ3 1 
ATOM 5758  C CH2 . TRP D 1 45  ? -3.638  129.228 17.038  1.00 15.30 ? 45  TRP D CH2 1 
ATOM 5759  N N   . LEU D 1 46  ? 0.131   127.979 21.276  1.00 17.35 ? 46  LEU D N   1 
ATOM 5760  C CA  . LEU D 1 46  ? 0.849   129.256 21.168  1.00 16.55 ? 46  LEU D CA  1 
ATOM 5761  C C   . LEU D 1 46  ? 2.174   129.222 20.407  1.00 20.72 ? 46  LEU D C   1 
ATOM 5762  O O   . LEU D 1 46  ? 2.638   130.257 19.916  1.00 21.83 ? 46  LEU D O   1 
ATOM 5763  C CB  . LEU D 1 46  ? 1.064   129.854 22.558  1.00 15.30 ? 46  LEU D CB  1 
ATOM 5764  C CG  . LEU D 1 46  ? -0.220  130.338 23.232  1.00 17.78 ? 46  LEU D CG  1 
ATOM 5765  C CD1 . LEU D 1 46  ? 0.012   130.602 24.709  1.00 18.58 ? 46  LEU D CD1 1 
ATOM 5766  C CD2 . LEU D 1 46  ? -0.730  131.581 22.513  1.00 19.89 ? 46  LEU D CD2 1 
ATOM 5767  N N   . ASN D 1 47  ? 2.766   128.037 20.298  1.00 22.65 ? 47  ASN D N   1 
ATOM 5768  C CA  . ASN D 1 47  ? 4.026   127.866 19.587  1.00 22.18 ? 47  ASN D CA  1 
ATOM 5769  C C   . ASN D 1 47  ? 3.869   128.172 18.101  1.00 21.90 ? 47  ASN D C   1 
ATOM 5770  O O   . ASN D 1 47  ? 4.726   128.803 17.490  1.00 23.69 ? 47  ASN D O   1 
ATOM 5771  C CB  . ASN D 1 47  ? 4.552   126.438 19.779  1.00 23.98 ? 47  ASN D CB  1 
ATOM 5772  C CG  . ASN D 1 47  ? 5.088   126.191 21.186  1.00 25.22 ? 47  ASN D CG  1 
ATOM 5773  O OD1 . ASN D 1 47  ? 5.603   127.100 21.839  1.00 26.46 ? 47  ASN D OD1 1 
ATOM 5774  N ND2 . ASN D 1 47  ? 4.973   124.957 21.654  1.00 22.94 ? 47  ASN D ND2 1 
ATOM 5775  N N   . GLU D 1 48  ? 2.757   127.730 17.524  1.00 21.14 ? 48  GLU D N   1 
ATOM 5776  C CA  . GLU D 1 48  ? 2.490   127.950 16.106  1.00 18.88 ? 48  GLU D CA  1 
ATOM 5777  C C   . GLU D 1 48  ? 1.536   129.096 15.802  1.00 17.16 ? 48  GLU D C   1 
ATOM 5778  O O   . GLU D 1 48  ? 1.481   129.546 14.642  1.00 16.89 ? 48  GLU D O   1 
ATOM 5779  C CB  . GLU D 1 48  ? 1.915   126.688 15.477  1.00 15.95 ? 48  GLU D CB  1 
ATOM 5780  C CG  . GLU D 1 48  ? 2.869   125.544 15.317  1.00 16.76 ? 48  GLU D CG  1 
ATOM 5781  C CD  . GLU D 1 48  ? 2.204   124.386 14.629  1.00 15.07 ? 48  GLU D CD  1 
ATOM 5782  O OE1 . GLU D 1 48  ? 2.128   124.402 13.383  1.00 14.35 ? 48  GLU D OE1 1 
ATOM 5783  O OE2 . GLU D 1 48  ? 1.726   123.477 15.335  1.00 14.40 ? 48  GLU D OE2 1 
ATOM 5784  N N   . LYS D 1 49  ? 0.774   129.541 16.780  1.00 14.27 ? 49  LYS D N   1 
ATOM 5785  C CA  . LYS D 1 49  ? -0.222  130.603 16.626  1.00 16.98 ? 49  LYS D CA  1 
ATOM 5786  C C   . LYS D 1 49  ? 0.049   131.765 15.639  1.00 16.78 ? 49  LYS D C   1 
ATOM 5787  O O   . LYS D 1 49  ? -0.853  132.183 14.924  1.00 15.96 ? 49  LYS D O   1 
ATOM 5788  C CB  . LYS D 1 49  ? -0.603  131.162 17.997  1.00 15.78 ? 49  LYS D CB  1 
ATOM 5789  C CG  . LYS D 1 49  ? -1.648  132.249 17.927  1.00 19.05 ? 49  LYS D CG  1 
ATOM 5790  C CD  . LYS D 1 49  ? -2.277  132.526 19.275  1.00 18.99 ? 49  LYS D CD  1 
ATOM 5791  C CE  . LYS D 1 49  ? -3.247  133.692 19.167  1.00 20.25 ? 49  LYS D CE  1 
ATOM 5792  N NZ  . LYS D 1 49  ? -4.189  133.777 20.308  1.00 21.75 ? 49  LYS D NZ  1 
ATOM 5793  N N   . PHE D 1 50  ? 1.278   132.239 15.578  1.00 13.64 ? 50  PHE D N   1 
ATOM 5794  C CA  . PHE D 1 50  ? 1.594   133.332 14.676  1.00 11.22 ? 50  PHE D CA  1 
ATOM 5795  C C   . PHE D 1 50  ? 2.589   132.888 13.622  1.00 13.45 ? 50  PHE D C   1 
ATOM 5796  O O   . PHE D 1 50  ? 3.269   133.701 13.010  1.00 15.52 ? 50  PHE D O   1 
ATOM 5797  C CB  . PHE D 1 50  ? 2.145   134.494 15.481  1.00 12.87 ? 50  PHE D CB  1 
ATOM 5798  C CG  . PHE D 1 50  ? 1.364   134.769 16.707  1.00 13.54 ? 50  PHE D CG  1 
ATOM 5799  C CD1 . PHE D 1 50  ? 0.188   135.501 16.669  1.00 12.79 ? 50  PHE D CD1 1 
ATOM 5800  C CD2 . PHE D 1 50  ? 1.777   134.254 17.944  1.00 15.22 ? 50  PHE D CD2 1 
ATOM 5801  C CE1 . PHE D 1 50  ? -0.570  135.719 17.814  1.00 10.08 ? 50  PHE D CE1 1 
ATOM 5802  C CE2 . PHE D 1 50  ? 1.028   134.464 19.094  1.00 12.57 ? 50  PHE D CE2 1 
ATOM 5803  C CZ  . PHE D 1 50  ? -0.152  135.201 19.026  1.00 9.72  ? 50  PHE D CZ  1 
ATOM 5804  N N   . LYS D 1 51  ? 2.648   131.581 13.413  1.00 13.08 ? 51  LYS D N   1 
ATOM 5805  C CA  . LYS D 1 51  ? 3.547   130.970 12.445  1.00 13.47 ? 51  LYS D CA  1 
ATOM 5806  C C   . LYS D 1 51  ? 2.752   130.489 11.224  1.00 15.11 ? 51  LYS D C   1 
ATOM 5807  O O   . LYS D 1 51  ? 3.207   130.624 10.083  1.00 15.93 ? 51  LYS D O   1 
ATOM 5808  C CB  . LYS D 1 51  ? 4.285   129.789 13.093  1.00 19.07 ? 51  LYS D CB  1 
ATOM 5809  C CG  . LYS D 1 51  ? 5.629   129.434 12.449  1.00 23.59 ? 51  LYS D CG  1 
ATOM 5810  C CD  . LYS D 1 51  ? 6.203   128.105 12.958  1.00 23.85 ? 51  LYS D CD  1 
ATOM 5811  C CE  . LYS D 1 51  ? 6.460   128.095 14.463  1.00 23.29 ? 51  LYS D CE  1 
ATOM 5812  N NZ  . LYS D 1 51  ? 7.519   129.056 14.863  1.00 22.00 ? 51  LYS D NZ  1 
ATOM 5813  N N   . LEU D 1 52  ? 1.550   129.963 11.474  1.00 10.91 ? 52  LEU D N   1 
ATOM 5814  C CA  . LEU D 1 52  ? 0.669   129.440 10.423  1.00 7.23  ? 52  LEU D CA  1 
ATOM 5815  C C   . LEU D 1 52  ? 0.280   130.436 9.332   1.00 7.40  ? 52  LEU D C   1 
ATOM 5816  O O   . LEU D 1 52  ? -0.070  130.033 8.226   1.00 5.44  ? 52  LEU D O   1 
ATOM 5817  C CB  . LEU D 1 52  ? -0.602  128.859 11.037  1.00 6.12  ? 52  LEU D CB  1 
ATOM 5818  C CG  . LEU D 1 52  ? -0.497  127.593 11.882  1.00 6.19  ? 52  LEU D CG  1 
ATOM 5819  C CD1 . LEU D 1 52  ? -1.758  127.438 12.714  1.00 7.01  ? 52  LEU D CD1 1 
ATOM 5820  C CD2 . LEU D 1 52  ? -0.275  126.385 10.989  1.00 7.31  ? 52  LEU D CD2 1 
ATOM 5821  N N   . GLY D 1 53  ? 0.299   131.725 9.659   1.00 7.91  ? 53  GLY D N   1 
ATOM 5822  C CA  . GLY D 1 53  ? -0.049  132.742 8.682   1.00 11.20 ? 53  GLY D CA  1 
ATOM 5823  C C   . GLY D 1 53  ? -1.534  133.000 8.512   1.00 10.01 ? 53  GLY D C   1 
ATOM 5824  O O   . GLY D 1 53  ? -1.981  133.430 7.452   1.00 9.65  ? 53  GLY D O   1 
ATOM 5825  N N   . LEU D 1 54  ? -2.306  132.748 9.559   1.00 7.10  ? 54  LEU D N   1 
ATOM 5826  C CA  . LEU D 1 54  ? -3.742  132.978 9.506   1.00 5.60  ? 54  LEU D CA  1 
ATOM 5827  C C   . LEU D 1 54  ? -4.000  134.480 9.598   1.00 6.05  ? 54  LEU D C   1 
ATOM 5828  O O   . LEU D 1 54  ? -3.308  135.175 10.334  1.00 7.75  ? 54  LEU D O   1 
ATOM 5829  C CB  . LEU D 1 54  ? -4.435  132.261 10.674  1.00 3.10  ? 54  LEU D CB  1 
ATOM 5830  C CG  . LEU D 1 54  ? -4.193  130.755 10.826  1.00 2.11  ? 54  LEU D CG  1 
ATOM 5831  C CD1 . LEU D 1 54  ? -4.943  130.236 12.032  1.00 4.41  ? 54  LEU D CD1 1 
ATOM 5832  C CD2 . LEU D 1 54  ? -4.621  130.009 9.577   1.00 5.12  ? 54  LEU D CD2 1 
ATOM 5833  N N   . ASP D 1 55  ? -4.975  134.984 8.845   1.00 7.35  ? 55  ASP D N   1 
ATOM 5834  C CA  . ASP D 1 55  ? -5.318  136.411 8.889   1.00 8.92  ? 55  ASP D CA  1 
ATOM 5835  C C   . ASP D 1 55  ? -5.649  136.778 10.333  1.00 9.86  ? 55  ASP D C   1 
ATOM 5836  O O   . ASP D 1 55  ? -5.310  137.866 10.819  1.00 11.58 ? 55  ASP D O   1 
ATOM 5837  C CB  . ASP D 1 55  ? -6.551  136.713 8.023   1.00 10.29 ? 55  ASP D CB  1 
ATOM 5838  C CG  . ASP D 1 55  ? -6.241  136.771 6.539   1.00 3.73  ? 55  ASP D CG  1 
ATOM 5839  O OD1 . ASP D 1 55  ? -5.518  137.696 6.101   1.00 3.56  ? 55  ASP D OD1 1 
ATOM 5840  O OD2 . ASP D 1 55  ? -6.761  135.908 5.807   1.00 6.40  ? 55  ASP D OD2 1 
ATOM 5841  N N   . PHE D 1 56  ? -6.354  135.862 10.992  1.00 10.23 ? 56  PHE D N   1 
ATOM 5842  C CA  . PHE D 1 56  ? -6.765  136.015 12.379  1.00 7.59  ? 56  PHE D CA  1 
ATOM 5843  C C   . PHE D 1 56  ? -6.469  134.701 13.100  1.00 4.65  ? 56  PHE D C   1 
ATOM 5844  O O   . PHE D 1 56  ? -7.354  133.862 13.250  1.00 2.21  ? 56  PHE D O   1 
ATOM 5845  C CB  . PHE D 1 56  ? -8.270  136.320 12.466  1.00 10.17 ? 56  PHE D CB  1 
ATOM 5846  C CG  . PHE D 1 56  ? -8.652  137.702 11.993  1.00 9.33  ? 56  PHE D CG  1 
ATOM 5847  C CD1 . PHE D 1 56  ? -8.842  137.968 10.639  1.00 8.75  ? 56  PHE D CD1 1 
ATOM 5848  C CD2 . PHE D 1 56  ? -8.839  138.734 12.905  1.00 8.76  ? 56  PHE D CD2 1 
ATOM 5849  C CE1 . PHE D 1 56  ? -9.208  139.239 10.200  1.00 10.12 ? 56  PHE D CE1 1 
ATOM 5850  C CE2 . PHE D 1 56  ? -9.206  140.010 12.474  1.00 10.98 ? 56  PHE D CE2 1 
ATOM 5851  C CZ  . PHE D 1 56  ? -9.391  140.261 11.120  1.00 9.39  ? 56  PHE D CZ  1 
ATOM 5852  N N   . PRO D 1 57  ? -5.207  134.488 13.525  1.00 6.97  ? 57  PRO D N   1 
ATOM 5853  C CA  . PRO D 1 57  ? -4.836  133.259 14.226  1.00 8.93  ? 57  PRO D CA  1 
ATOM 5854  C C   . PRO D 1 57  ? -5.824  132.985 15.339  1.00 8.23  ? 57  PRO D C   1 
ATOM 5855  O O   . PRO D 1 57  ? -6.088  133.868 16.176  1.00 7.06  ? 57  PRO D O   1 
ATOM 5856  C CB  . PRO D 1 57  ? -3.457  133.593 14.781  1.00 7.97  ? 57  PRO D CB  1 
ATOM 5857  C CG  . PRO D 1 57  ? -2.900  134.452 13.737  1.00 9.89  ? 57  PRO D CG  1 
ATOM 5858  C CD  . PRO D 1 57  ? -4.048  135.374 13.445  1.00 6.77  ? 57  PRO D CD  1 
ATOM 5859  N N   . ASN D 1 58  ? -6.416  131.798 15.294  1.00 9.01  ? 58  ASN D N   1 
ATOM 5860  C CA  . ASN D 1 58  ? -7.399  131.376 16.274  1.00 8.13  ? 58  ASN D CA  1 
ATOM 5861  C C   . ASN D 1 58  ? -7.765  129.941 15.980  1.00 5.75  ? 58  ASN D C   1 
ATOM 5862  O O   . ASN D 1 58  ? -7.579  129.460 14.859  1.00 2.72  ? 58  ASN D O   1 
ATOM 5863  C CB  . ASN D 1 58  ? -8.656  132.253 16.181  1.00 9.33  ? 58  ASN D CB  1 
ATOM 5864  C CG  . ASN D 1 58  ? -9.790  131.754 17.063  1.00 9.19  ? 58  ASN D CG  1 
ATOM 5865  O OD1 . ASN D 1 58  ? -9.582  131.414 18.222  1.00 9.51  ? 58  ASN D OD1 1 
ATOM 5866  N ND2 . ASN D 1 58  ? -10.990 131.695 16.511  1.00 12.41 ? 58  ASN D ND2 1 
ATOM 5867  N N   . LEU D 1 59  ? -8.183  129.241 17.021  1.00 9.40  ? 59  LEU D N   1 
ATOM 5868  C CA  . LEU D 1 59  ? -8.640  127.857 16.921  1.00 10.36 ? 59  LEU D CA  1 
ATOM 5869  C C   . LEU D 1 59  ? -10.171 127.918 16.948  1.00 10.41 ? 59  LEU D C   1 
ATOM 5870  O O   . LEU D 1 59  ? -10.749 128.685 17.720  1.00 7.71  ? 59  LEU D O   1 
ATOM 5871  C CB  . LEU D 1 59  ? -8.111  126.989 18.064  1.00 7.81  ? 59  LEU D CB  1 
ATOM 5872  C CG  . LEU D 1 59  ? -6.731  126.316 17.972  1.00 6.41  ? 59  LEU D CG  1 
ATOM 5873  C CD1 . LEU D 1 59  ? -6.399  125.611 19.275  1.00 5.03  ? 59  LEU D CD1 1 
ATOM 5874  C CD2 . LEU D 1 59  ? -6.697  125.319 16.838  1.00 10.83 ? 59  LEU D CD2 1 
ATOM 5875  N N   . PRO D 1 60  ? -10.843 127.133 16.097  1.00 12.75 ? 60  PRO D N   1 
ATOM 5876  C CA  . PRO D 1 60  ? -10.186 126.239 15.145  1.00 10.37 ? 60  PRO D CA  1 
ATOM 5877  C C   . PRO D 1 60  ? -9.700  126.986 13.907  1.00 9.00  ? 60  PRO D C   1 
ATOM 5878  O O   . PRO D 1 60  ? -10.026 128.177 13.688  1.00 7.57  ? 60  PRO D O   1 
ATOM 5879  C CB  . PRO D 1 60  ? -11.297 125.248 14.781  1.00 11.11 ? 60  PRO D CB  1 
ATOM 5880  C CG  . PRO D 1 60  ? -12.334 125.420 15.874  1.00 13.24 ? 60  PRO D CG  1 
ATOM 5881  C CD  . PRO D 1 60  ? -12.291 126.891 16.116  1.00 13.49 ? 60  PRO D CD  1 
ATOM 5882  N N   . TYR D 1 61  ? -8.897  126.294 13.115  1.00 6.18  ? 61  TYR D N   1 
ATOM 5883  C CA  . TYR D 1 61  ? -8.375  126.833 11.876  1.00 5.00  ? 61  TYR D CA  1 
ATOM 5884  C C   . TYR D 1 61  ? -8.287  125.635 10.943  1.00 9.00  ? 61  TYR D C   1 
ATOM 5885  O O   . TYR D 1 61  ? -8.018  124.488 11.384  1.00 11.99 ? 61  TYR D O   1 
ATOM 5886  C CB  . TYR D 1 61  ? -6.994  127.476 12.076  1.00 7.31  ? 61  TYR D CB  1 
ATOM 5887  C CG  . TYR D 1 61  ? -5.892  126.495 12.346  1.00 9.04  ? 61  TYR D CG  1 
ATOM 5888  C CD1 . TYR D 1 61  ? -5.226  125.833 11.295  1.00 7.04  ? 61  TYR D CD1 1 
ATOM 5889  C CD2 . TYR D 1 61  ? -5.561  126.116 13.648  1.00 12.71 ? 61  TYR D CD2 1 
ATOM 5890  C CE1 . TYR D 1 61  ? -4.289  124.846 11.537  1.00 9.57  ? 61  TYR D CE1 1 
ATOM 5891  C CE2 . TYR D 1 61  ? -4.614  125.128 13.900  1.00 11.52 ? 61  TYR D CE2 1 
ATOM 5892  C CZ  . TYR D 1 61  ? -3.987  124.481 12.839  1.00 11.83 ? 61  TYR D CZ  1 
ATOM 5893  O OH  . TYR D 1 61  ? -3.076  123.501 13.090  1.00 10.96 ? 61  TYR D OH  1 
ATOM 5894  N N   . LEU D 1 62  ? -8.500  125.875 9.662   1.00 11.36 ? 62  LEU D N   1 
ATOM 5895  C CA  . LEU D 1 62  ? -8.418  124.814 8.672   1.00 10.87 ? 62  LEU D CA  1 
ATOM 5896  C C   . LEU D 1 62  ? -7.557  125.319 7.530   1.00 12.80 ? 62  LEU D C   1 
ATOM 5897  O O   . LEU D 1 62  ? -7.588  126.531 7.192   1.00 11.57 ? 62  LEU D O   1 
ATOM 5898  C CB  . LEU D 1 62  ? -9.813  124.444 8.149   1.00 7.64  ? 62  LEU D CB  1 
ATOM 5899  C CG  . LEU D 1 62  ? -9.898  123.427 7.003   1.00 2.00  ? 62  LEU D CG  1 
ATOM 5900  C CD1 . LEU D 1 62  ? -9.443  122.060 7.476   1.00 3.25  ? 62  LEU D CD1 1 
ATOM 5901  C CD2 . LEU D 1 62  ? -11.327 123.363 6.476   1.00 5.53  ? 62  LEU D CD2 1 
ATOM 5902  N N   . ILE D 1 63  ? -6.759  124.423 6.966   1.00 15.82 ? 63  ILE D N   1 
ATOM 5903  C CA  . ILE D 1 63  ? -5.910  124.786 5.854   1.00 16.94 ? 63  ILE D CA  1 
ATOM 5904  C C   . ILE D 1 63  ? -6.268  123.871 4.700   1.00 16.78 ? 63  ILE D C   1 
ATOM 5905  O O   . ILE D 1 63  ? -6.255  122.649 4.837   1.00 13.82 ? 63  ILE D O   1 
ATOM 5906  C CB  . ILE D 1 63  ? -4.405  124.671 6.217   1.00 14.07 ? 63  ILE D CB  1 
ATOM 5907  C CG1 . ILE D 1 63  ? -4.082  125.614 7.386   1.00 11.69 ? 63  ILE D CG1 1 
ATOM 5908  C CG2 . ILE D 1 63  ? -3.538  125.028 5.008   1.00 13.56 ? 63  ILE D CG2 1 
ATOM 5909  C CD1 . ILE D 1 63  ? -2.663  125.543 7.899   1.00 6.78  ? 63  ILE D CD1 1 
ATOM 5910  N N   . ASP D 1 64  ? -6.720  124.489 3.619   1.00 16.44 ? 64  ASP D N   1 
ATOM 5911  C CA  . ASP D 1 64  ? -7.104  123.802 2.399   1.00 18.86 ? 64  ASP D CA  1 
ATOM 5912  C C   . ASP D 1 64  ? -6.171  124.293 1.296   1.00 19.57 ? 64  ASP D C   1 
ATOM 5913  O O   . ASP D 1 64  ? -6.517  125.195 0.529   1.00 18.84 ? 64  ASP D O   1 
ATOM 5914  C CB  . ASP D 1 64  ? -8.560  124.143 2.057   1.00 21.70 ? 64  ASP D CB  1 
ATOM 5915  C CG  . ASP D 1 64  ? -9.163  123.205 1.017   1.00 23.87 ? 64  ASP D CG  1 
ATOM 5916  O OD1 . ASP D 1 64  ? -8.411  122.613 0.202   1.00 24.86 ? 64  ASP D OD1 1 
ATOM 5917  O OD2 . ASP D 1 64  ? -10.404 123.054 1.017   1.00 24.43 ? 64  ASP D OD2 1 
ATOM 5918  N N   . GLY D 1 65  ? -4.986  123.697 1.232   1.00 18.59 ? 65  GLY D N   1 
ATOM 5919  C CA  . GLY D 1 65  ? -4.004  124.080 0.234   1.00 18.15 ? 65  GLY D CA  1 
ATOM 5920  C C   . GLY D 1 65  ? -3.502  125.492 0.464   1.00 18.81 ? 65  GLY D C   1 
ATOM 5921  O O   . GLY D 1 65  ? -2.624  125.723 1.299   1.00 20.34 ? 65  GLY D O   1 
ATOM 5922  N N   . ALA D 1 66  ? -4.070  126.433 -0.284  1.00 17.36 ? 66  ALA D N   1 
ATOM 5923  C CA  . ALA D 1 66  ? -3.712  127.843 -0.180  1.00 18.23 ? 66  ALA D CA  1 
ATOM 5924  C C   . ALA D 1 66  ? -4.751  128.553 0.671   1.00 17.64 ? 66  ALA D C   1 
ATOM 5925  O O   . ALA D 1 66  ? -4.631  129.739 0.948   1.00 17.70 ? 66  ALA D O   1 
ATOM 5926  C CB  . ALA D 1 66  ? -3.655  128.475 -1.574  1.00 19.26 ? 66  ALA D CB  1 
ATOM 5927  N N   . HIS D 1 67  ? -5.781  127.819 1.070   1.00 19.30 ? 67  HIS D N   1 
ATOM 5928  C CA  . HIS D 1 67  ? -6.853  128.381 1.873   1.00 16.92 ? 67  HIS D CA  1 
ATOM 5929  C C   . HIS D 1 67  ? -6.622  128.107 3.346   1.00 17.93 ? 67  HIS D C   1 
ATOM 5930  O O   . HIS D 1 67  ? -6.224  127.010 3.723   1.00 19.35 ? 67  HIS D O   1 
ATOM 5931  C CB  . HIS D 1 67  ? -8.202  127.782 1.462   1.00 15.12 ? 67  HIS D CB  1 
ATOM 5932  C CG  . HIS D 1 67  ? -8.492  127.890 -0.005  1.00 8.75  ? 67  HIS D CG  1 
ATOM 5933  N ND1 . HIS D 1 67  ? -8.362  126.825 -0.868  1.00 10.38 ? 67  HIS D ND1 1 
ATOM 5934  C CD2 . HIS D 1 67  ? -8.902  128.937 -0.759  1.00 5.40  ? 67  HIS D CD2 1 
ATOM 5935  C CE1 . HIS D 1 67  ? -8.676  127.210 -2.092  1.00 9.53  ? 67  HIS D CE1 1 
ATOM 5936  N NE2 . HIS D 1 67  ? -9.008  128.489 -2.052  1.00 2.00  ? 67  HIS D NE2 1 
ATOM 5937  N N   . LYS D 1 68  ? -6.863  129.115 4.173   1.00 16.69 ? 68  LYS D N   1 
ATOM 5938  C CA  . LYS D 1 68  ? -6.709  128.989 5.616   1.00 15.37 ? 68  LYS D CA  1 
ATOM 5939  C C   . LYS D 1 68  ? -7.885  129.718 6.256   1.00 15.35 ? 68  LYS D C   1 
ATOM 5940  O O   . LYS D 1 68  ? -7.958  130.972 6.248   1.00 12.90 ? 68  LYS D O   1 
ATOM 5941  C CB  . LYS D 1 68  ? -5.360  129.557 6.076   1.00 9.93  ? 68  LYS D CB  1 
ATOM 5942  C CG  . LYS D 1 68  ? -4.959  130.875 5.429   1.00 11.81 ? 68  LYS D CG  1 
ATOM 5943  C CD  . LYS D 1 68  ? -3.535  131.266 5.804   1.00 12.08 ? 68  LYS D CD  1 
ATOM 5944  C CE  . LYS D 1 68  ? -2.516  130.276 5.255   1.00 12.72 ? 68  LYS D CE  1 
ATOM 5945  N NZ  . LYS D 1 68  ? -1.134  130.684 5.611   1.00 9.91  ? 68  LYS D NZ  1 
ATOM 5946  N N   . ILE D 1 69  ? -8.849  128.938 6.737   1.00 14.93 ? 69  ILE D N   1 
ATOM 5947  C CA  . ILE D 1 69  ? -10.043 129.513 7.336   1.00 18.90 ? 69  ILE D CA  1 
ATOM 5948  C C   . ILE D 1 69  ? -10.011 129.524 8.859   1.00 18.04 ? 69  ILE D C   1 
ATOM 5949  O O   . ILE D 1 69  ? -9.559  128.572 9.507   1.00 17.20 ? 69  ILE D O   1 
ATOM 5950  C CB  . ILE D 1 69  ? -11.341 128.795 6.865   1.00 19.64 ? 69  ILE D CB  1 
ATOM 5951  C CG1 . ILE D 1 69  ? -11.227 128.363 5.394   1.00 19.16 ? 69  ILE D CG1 1 
ATOM 5952  C CG2 . ILE D 1 69  ? -12.548 129.738 7.027   1.00 17.46 ? 69  ILE D CG2 1 
ATOM 5953  C CD1 . ILE D 1 69  ? -11.209 129.508 4.397   1.00 15.85 ? 69  ILE D CD1 1 
ATOM 5954  N N   . THR D 1 70  ? -10.528 130.613 9.408   1.00 18.12 ? 70  THR D N   1 
ATOM 5955  C CA  . THR D 1 70  ? -10.608 130.835 10.838  1.00 15.66 ? 70  THR D CA  1 
ATOM 5956  C C   . THR D 1 70  ? -12.105 131.001 11.121  1.00 16.76 ? 70  THR D C   1 
ATOM 5957  O O   . THR D 1 70  ? -12.872 131.305 10.182  1.00 17.38 ? 70  THR D O   1 
ATOM 5958  C CB  . THR D 1 70  ? -9.836  132.121 11.203  1.00 14.90 ? 70  THR D CB  1 
ATOM 5959  O OG1 . THR D 1 70  ? -8.469  131.987 10.787  1.00 12.79 ? 70  THR D OG1 1 
ATOM 5960  C CG2 . THR D 1 70  ? -9.898  132.398 12.696  1.00 13.57 ? 70  THR D CG2 1 
ATOM 5961  N N   . GLN D 1 71  ? -12.511 130.856 12.381  1.00 15.93 ? 71  GLN D N   1 
ATOM 5962  C CA  . GLN D 1 71  ? -13.912 130.984 12.800  1.00 11.70 ? 71  GLN D CA  1 
ATOM 5963  C C   . GLN D 1 71  ? -14.725 129.774 12.363  1.00 10.97 ? 71  GLN D C   1 
ATOM 5964  O O   . GLN D 1 71  ? -14.892 129.516 11.176  1.00 12.69 ? 71  GLN D O   1 
ATOM 5965  C CB  . GLN D 1 71  ? -14.559 132.278 12.281  1.00 12.90 ? 71  GLN D CB  1 
ATOM 5966  C CG  . GLN D 1 71  ? -14.112 133.573 12.974  1.00 10.52 ? 71  GLN D CG  1 
ATOM 5967  C CD  . GLN D 1 71  ? -14.729 133.783 14.356  1.00 5.03  ? 71  GLN D CD  1 
ATOM 5968  O OE1 . GLN D 1 71  ? -15.944 133.924 14.495  1.00 2.00  ? 71  GLN D OE1 1 
ATOM 5969  N NE2 . GLN D 1 71  ? -13.887 133.840 15.377  1.00 9.53  ? 71  GLN D NE2 1 
ATOM 5970  N N   . SER D 1 72  ? -15.253 129.057 13.346  1.00 12.69 ? 72  SER D N   1 
ATOM 5971  C CA  . SER D 1 72  ? -16.043 127.849 13.132  1.00 12.78 ? 72  SER D CA  1 
ATOM 5972  C C   . SER D 1 72  ? -17.010 127.881 11.944  1.00 12.39 ? 72  SER D C   1 
ATOM 5973  O O   . SER D 1 72  ? -16.847 127.125 10.981  1.00 11.83 ? 72  SER D O   1 
ATOM 5974  C CB  . SER D 1 72  ? -16.801 127.515 14.418  1.00 12.55 ? 72  SER D CB  1 
ATOM 5975  O OG  . SER D 1 72  ? -16.148 128.108 15.539  1.00 15.76 ? 72  SER D OG  1 
ATOM 5976  N N   . ASN D 1 73  ? -17.996 128.773 12.004  1.00 12.33 ? 73  ASN D N   1 
ATOM 5977  C CA  . ASN D 1 73  ? -18.995 128.884 10.946  1.00 10.71 ? 73  ASN D CA  1 
ATOM 5978  C C   . ASN D 1 73  ? -18.459 129.201 9.562   1.00 11.85 ? 73  ASN D C   1 
ATOM 5979  O O   . ASN D 1 73  ? -19.020 128.763 8.564   1.00 12.54 ? 73  ASN D O   1 
ATOM 5980  C CB  . ASN D 1 73  ? -20.091 129.869 11.335  1.00 9.82  ? 73  ASN D CB  1 
ATOM 5981  C CG  . ASN D 1 73  ? -21.005 129.314 12.399  1.00 10.43 ? 73  ASN D CG  1 
ATOM 5982  O OD1 . ASN D 1 73  ? -20.719 128.276 12.990  1.00 2.00  ? 73  ASN D OD1 1 
ATOM 5983  N ND2 . ASN D 1 73  ? -22.112 130.003 12.655  1.00 7.59  ? 73  ASN D ND2 1 
ATOM 5984  N N   . ALA D 1 74  ? -17.379 129.963 9.489   1.00 12.84 ? 74  ALA D N   1 
ATOM 5985  C CA  . ALA D 1 74  ? -16.794 130.279 8.194   1.00 11.51 ? 74  ALA D CA  1 
ATOM 5986  C C   . ALA D 1 74  ? -16.249 128.962 7.634   1.00 13.61 ? 74  ALA D C   1 
ATOM 5987  O O   . ALA D 1 74  ? -16.425 128.640 6.450   1.00 14.35 ? 74  ALA D O   1 
ATOM 5988  C CB  . ALA D 1 74  ? -15.674 131.308 8.353   1.00 9.85  ? 74  ALA D CB  1 
ATOM 5989  N N   . ILE D 1 75  ? -15.634 128.181 8.514   1.00 11.06 ? 75  ILE D N   1 
ATOM 5990  C CA  . ILE D 1 75  ? -15.071 126.900 8.136   1.00 12.05 ? 75  ILE D CA  1 
ATOM 5991  C C   . ILE D 1 75  ? -16.176 125.979 7.617   1.00 15.76 ? 75  ILE D C   1 
ATOM 5992  O O   . ILE D 1 75  ? -16.037 125.368 6.551   1.00 16.57 ? 75  ILE D O   1 
ATOM 5993  C CB  . ILE D 1 75  ? -14.351 126.245 9.327   1.00 10.47 ? 75  ILE D CB  1 
ATOM 5994  C CG1 . ILE D 1 75  ? -13.275 127.190 9.858   1.00 13.99 ? 75  ILE D CG1 1 
ATOM 5995  C CG2 . ILE D 1 75  ? -13.728 124.914 8.912   1.00 8.64  ? 75  ILE D CG2 1 
ATOM 5996  C CD1 . ILE D 1 75  ? -12.585 126.699 11.113  1.00 12.99 ? 75  ILE D CD1 1 
ATOM 5997  N N   . LEU D 1 76  ? -17.283 125.902 8.353   1.00 15.50 ? 76  LEU D N   1 
ATOM 5998  C CA  . LEU D 1 76  ? -18.409 125.058 7.955   1.00 11.57 ? 76  LEU D CA  1 
ATOM 5999  C C   . LEU D 1 76  ? -18.905 125.461 6.571   1.00 11.86 ? 76  LEU D C   1 
ATOM 6000  O O   . LEU D 1 76  ? -19.020 124.627 5.675   1.00 12.27 ? 76  LEU D O   1 
ATOM 6001  C CB  . LEU D 1 76  ? -19.540 125.169 8.976   1.00 9.26  ? 76  LEU D CB  1 
ATOM 6002  C CG  . LEU D 1 76  ? -19.164 124.735 10.393  1.00 4.63  ? 76  LEU D CG  1 
ATOM 6003  C CD1 . LEU D 1 76  ? -20.142 125.315 11.396  1.00 8.30  ? 76  LEU D CD1 1 
ATOM 6004  C CD2 . LEU D 1 76  ? -19.118 123.215 10.476  1.00 5.32  ? 76  LEU D CD2 1 
ATOM 6005  N N   . CYS D 1 77  ? -19.128 126.757 6.387   1.00 12.28 ? 77  CYS D N   1 
ATOM 6006  C CA  . CYS D 1 77  ? -19.591 127.295 5.112   1.00 13.27 ? 77  CYS D CA  1 
ATOM 6007  C C   . CYS D 1 77  ? -18.609 127.008 3.975   1.00 13.94 ? 77  CYS D C   1 
ATOM 6008  O O   . CYS D 1 77  ? -18.996 126.988 2.810   1.00 12.57 ? 77  CYS D O   1 
ATOM 6009  C CB  . CYS D 1 77  ? -19.829 128.804 5.232   1.00 11.47 ? 77  CYS D CB  1 
ATOM 6010  S SG  . CYS D 1 77  ? -20.985 129.266 6.535   1.00 19.08 ? 77  CYS D SG  1 
ATOM 6011  N N   . TYR D 1 78  ? -17.342 126.793 4.313   1.00 13.96 ? 78  TYR D N   1 
ATOM 6012  C CA  . TYR D 1 78  ? -16.340 126.493 3.304   1.00 13.34 ? 78  TYR D CA  1 
ATOM 6013  C C   . TYR D 1 78  ? -16.394 125.030 2.858   1.00 12.54 ? 78  TYR D C   1 
ATOM 6014  O O   . TYR D 1 78  ? -16.076 124.711 1.714   1.00 12.76 ? 78  TYR D O   1 
ATOM 6015  C CB  . TYR D 1 78  ? -14.942 126.856 3.802   1.00 16.92 ? 78  TYR D CB  1 
ATOM 6016  C CG  . TYR D 1 78  ? -13.872 126.728 2.732   1.00 17.35 ? 78  TYR D CG  1 
ATOM 6017  C CD1 . TYR D 1 78  ? -13.572 127.813 1.886   1.00 10.69 ? 78  TYR D CD1 1 
ATOM 6018  C CD2 . TYR D 1 78  ? -13.170 125.513 2.557   1.00 17.16 ? 78  TYR D CD2 1 
ATOM 6019  C CE1 . TYR D 1 78  ? -12.607 127.694 0.896   1.00 13.25 ? 78  TYR D CE1 1 
ATOM 6020  C CE2 . TYR D 1 78  ? -12.204 125.383 1.572   1.00 16.89 ? 78  TYR D CE2 1 
ATOM 6021  C CZ  . TYR D 1 78  ? -11.926 126.475 0.742   1.00 18.86 ? 78  TYR D CZ  1 
ATOM 6022  O OH  . TYR D 1 78  ? -10.970 126.354 -0.248  1.00 21.43 ? 78  TYR D OH  1 
ATOM 6023  N N   . ILE D 1 79  ? -16.780 124.137 3.761   1.00 10.79 ? 79  ILE D N   1 
ATOM 6024  C CA  . ILE D 1 79  ? -16.889 122.723 3.420   1.00 9.50  ? 79  ILE D CA  1 
ATOM 6025  C C   . ILE D 1 79  ? -18.205 122.476 2.687   1.00 8.84  ? 79  ILE D C   1 
ATOM 6026  O O   . ILE D 1 79  ? -18.226 121.901 1.598   1.00 6.56  ? 79  ILE D O   1 
ATOM 6027  C CB  . ILE D 1 79  ? -16.848 121.831 4.682   1.00 9.55  ? 79  ILE D CB  1 
ATOM 6028  C CG1 . ILE D 1 79  ? -15.523 122.035 5.427   1.00 15.11 ? 79  ILE D CG1 1 
ATOM 6029  C CG2 . ILE D 1 79  ? -17.035 120.366 4.295   1.00 11.37 ? 79  ILE D CG2 1 
ATOM 6030  C CD1 . ILE D 1 79  ? -15.553 121.576 6.874   1.00 15.06 ? 79  ILE D CD1 1 
ATOM 6031  N N   . ALA D 1 80  ? -19.294 122.957 3.277   1.00 11.32 ? 80  ALA D N   1 
ATOM 6032  C CA  . ALA D 1 80  ? -20.635 122.798 2.721   1.00 10.83 ? 80  ALA D CA  1 
ATOM 6033  C C   . ALA D 1 80  ? -20.819 123.415 1.342   1.00 11.54 ? 80  ALA D C   1 
ATOM 6034  O O   . ALA D 1 80  ? -21.616 122.931 0.548   1.00 12.82 ? 80  ALA D O   1 
ATOM 6035  C CB  . ALA D 1 80  ? -21.662 123.361 3.675   1.00 9.21  ? 80  ALA D CB  1 
ATOM 6036  N N   . ARG D 1 81  ? -20.090 124.486 1.059   1.00 9.45  ? 81  ARG D N   1 
ATOM 6037  C CA  . ARG D 1 81  ? -20.181 125.176 -0.224  1.00 9.14  ? 81  ARG D CA  1 
ATOM 6038  C C   . ARG D 1 81  ? -19.559 124.342 -1.342  1.00 9.62  ? 81  ARG D C   1 
ATOM 6039  O O   . ARG D 1 81  ? -20.001 124.376 -2.489  1.00 9.26  ? 81  ARG D O   1 
ATOM 6040  C CB  . ARG D 1 81  ? -19.452 126.510 -0.120  1.00 10.75 ? 81  ARG D CB  1 
ATOM 6041  C CG  . ARG D 1 81  ? -19.915 127.586 -1.083  1.00 12.96 ? 81  ARG D CG  1 
ATOM 6042  C CD  . ARG D 1 81  ? -18.897 128.720 -1.161  1.00 13.24 ? 81  ARG D CD  1 
ATOM 6043  N NE  . ARG D 1 81  ? -18.568 129.286 0.146   1.00 18.34 ? 81  ARG D NE  1 
ATOM 6044  C CZ  . ARG D 1 81  ? -17.536 128.901 0.890   1.00 20.51 ? 81  ARG D CZ  1 
ATOM 6045  N NH1 . ARG D 1 81  ? -16.728 127.942 0.464   1.00 20.55 ? 81  ARG D NH1 1 
ATOM 6046  N NH2 . ARG D 1 81  ? -17.297 129.485 2.053   1.00 22.63 ? 81  ARG D NH2 1 
ATOM 6047  N N   . LYS D 1 82  ? -18.551 123.561 -0.981  1.00 12.74 ? 82  LYS D N   1 
ATOM 6048  C CA  . LYS D 1 82  ? -17.839 122.719 -1.927  1.00 13.50 ? 82  LYS D CA  1 
ATOM 6049  C C   . LYS D 1 82  ? -18.538 121.379 -2.121  1.00 14.92 ? 82  LYS D C   1 
ATOM 6050  O O   . LYS D 1 82  ? -18.024 120.490 -2.787  1.00 13.39 ? 82  LYS D O   1 
ATOM 6051  C CB  . LYS D 1 82  ? -16.394 122.538 -1.450  1.00 17.57 ? 82  LYS D CB  1 
ATOM 6052  C CG  . LYS D 1 82  ? -15.406 122.181 -2.547  1.00 18.94 ? 82  LYS D CG  1 
ATOM 6053  C CD  . LYS D 1 82  ? -14.042 122.824 -2.313  1.00 18.05 ? 82  LYS D CD  1 
ATOM 6054  C CE  . LYS D 1 82  ? -14.061 124.318 -2.628  1.00 15.15 ? 82  LYS D CE  1 
ATOM 6055  N NZ  . LYS D 1 82  ? -12.691 124.906 -2.583  1.00 11.05 ? 82  LYS D NZ  1 
ATOM 6056  N N   . HIS D 1 83  ? -19.704 121.234 -1.505  1.00 18.68 ? 83  HIS D N   1 
ATOM 6057  C CA  . HIS D 1 83  ? -20.509 120.021 -1.609  1.00 21.13 ? 83  HIS D CA  1 
ATOM 6058  C C   . HIS D 1 83  ? -21.981 120.416 -1.714  1.00 18.87 ? 83  HIS D C   1 
ATOM 6059  O O   . HIS D 1 83  ? -22.873 119.588 -1.528  1.00 20.24 ? 83  HIS D O   1 
ATOM 6060  C CB  . HIS D 1 83  ? -20.307 119.116 -0.385  1.00 20.50 ? 83  HIS D CB  1 
ATOM 6061  C CG  . HIS D 1 83  ? -19.034 118.327 -0.411  1.00 25.02 ? 83  HIS D CG  1 
ATOM 6062  N ND1 . HIS D 1 83  ? -18.858 117.216 -1.211  1.00 28.97 ? 83  HIS D ND1 1 
ATOM 6063  C CD2 . HIS D 1 83  ? -17.882 118.467 0.289   1.00 27.21 ? 83  HIS D CD2 1 
ATOM 6064  C CE1 . HIS D 1 83  ? -17.658 116.707 -1.001  1.00 28.90 ? 83  HIS D CE1 1 
ATOM 6065  N NE2 . HIS D 1 83  ? -17.045 117.447 -0.096  1.00 28.94 ? 83  HIS D NE2 1 
ATOM 6066  N N   . ASN D 1 84  ? -22.214 121.692 -2.010  1.00 18.00 ? 84  ASN D N   1 
ATOM 6067  C CA  . ASN D 1 84  ? -23.554 122.267 -2.135  1.00 18.87 ? 84  ASN D CA  1 
ATOM 6068  C C   . ASN D 1 84  ? -24.518 121.892 -1.014  1.00 17.70 ? 84  ASN D C   1 
ATOM 6069  O O   . ASN D 1 84  ? -25.724 121.766 -1.229  1.00 20.71 ? 84  ASN D O   1 
ATOM 6070  C CB  . ASN D 1 84  ? -24.167 121.990 -3.516  1.00 17.25 ? 84  ASN D CB  1 
ATOM 6071  C CG  . ASN D 1 84  ? -23.855 123.096 -4.531  1.00 18.80 ? 84  ASN D CG  1 
ATOM 6072  O OD1 . ASN D 1 84  ? -24.625 124.064 -4.696  1.00 22.12 ? 84  ASN D OD1 1 
ATOM 6073  N ND2 . ASN D 1 84  ? -22.726 122.964 -5.218  1.00 19.88 ? 84  ASN D ND2 1 
ATOM 6074  N N   . LEU D 1 85  ? -23.978 121.773 0.193   1.00 13.29 ? 85  LEU D N   1 
ATOM 6075  C CA  . LEU D 1 85  ? -24.763 121.447 1.370   1.00 8.46  ? 85  LEU D CA  1 
ATOM 6076  C C   . LEU D 1 85  ? -25.220 122.731 2.062   1.00 9.22  ? 85  LEU D C   1 
ATOM 6077  O O   . LEU D 1 85  ? -25.558 122.714 3.249   1.00 9.26  ? 85  LEU D O   1 
ATOM 6078  C CB  . LEU D 1 85  ? -23.931 120.601 2.335   1.00 4.72  ? 85  LEU D CB  1 
ATOM 6079  C CG  . LEU D 1 85  ? -23.476 119.228 1.840   1.00 2.90  ? 85  LEU D CG  1 
ATOM 6080  C CD1 . LEU D 1 85  ? -22.372 118.703 2.722   1.00 6.12  ? 85  LEU D CD1 1 
ATOM 6081  C CD2 . LEU D 1 85  ? -24.653 118.271 1.813   1.00 3.80  ? 85  LEU D CD2 1 
ATOM 6082  N N   . CYS D 1 86  ? -25.200 123.846 1.327   1.00 6.64  ? 86  CYS D N   1 
ATOM 6083  C CA  . CYS D 1 86  ? -25.613 125.136 1.878   1.00 9.42  ? 86  CYS D CA  1 
ATOM 6084  C C   . CYS D 1 86  ? -27.133 125.347 1.802   1.00 13.15 ? 86  CYS D C   1 
ATOM 6085  O O   . CYS D 1 86  ? -27.859 124.896 2.679   1.00 10.95 ? 86  CYS D O   1 
ATOM 6086  C CB  . CYS D 1 86  ? -24.863 126.297 1.201   1.00 15.79 ? 86  CYS D CB  1 
ATOM 6087  S SG  . CYS D 1 86  ? -23.192 126.676 1.887   1.00 10.63 ? 86  CYS D SG  1 
ATOM 6088  N N   . GLY D 1 87  ? -27.609 126.037 0.766   1.00 14.07 ? 87  GLY D N   1 
ATOM 6089  C CA  . GLY D 1 87  ? -29.033 126.289 0.611   1.00 13.93 ? 87  GLY D CA  1 
ATOM 6090  C C   . GLY D 1 87  ? -29.276 126.668 -0.833  1.00 15.21 ? 87  GLY D C   1 
ATOM 6091  O O   . GLY D 1 87  ? -28.441 127.340 -1.435  1.00 17.19 ? 87  GLY D O   1 
ATOM 6092  N N   . GLU D 1 88  ? -30.401 126.244 -1.397  1.00 13.53 ? 88  GLU D N   1 
ATOM 6093  C CA  . GLU D 1 88  ? -30.698 126.541 -2.795  1.00 12.30 ? 88  GLU D CA  1 
ATOM 6094  C C   . GLU D 1 88  ? -31.692 127.668 -3.019  1.00 13.70 ? 88  GLU D C   1 
ATOM 6095  O O   . GLU D 1 88  ? -31.395 128.655 -3.688  1.00 10.77 ? 88  GLU D O   1 
ATOM 6096  C CB  . GLU D 1 88  ? -31.222 125.295 -3.497  1.00 11.77 ? 88  GLU D CB  1 
ATOM 6097  C CG  . GLU D 1 88  ? -30.307 124.106 -3.441  1.00 11.22 ? 88  GLU D CG  1 
ATOM 6098  C CD  . GLU D 1 88  ? -30.785 123.009 -4.347  1.00 12.07 ? 88  GLU D CD  1 
ATOM 6099  O OE1 . GLU D 1 88  ? -31.787 122.343 -4.007  1.00 10.27 ? 88  GLU D OE1 1 
ATOM 6100  O OE2 . GLU D 1 88  ? -30.171 122.840 -5.418  1.00 9.14  ? 88  GLU D OE2 1 
ATOM 6101  N N   . THR D 1 89  ? -32.913 127.452 -2.552  1.00 15.10 ? 89  THR D N   1 
ATOM 6102  C CA  . THR D 1 89  ? -33.970 128.432 -2.695  1.00 15.20 ? 89  THR D CA  1 
ATOM 6103  C C   . THR D 1 89  ? -33.815 129.484 -1.601  1.00 14.91 ? 89  THR D C   1 
ATOM 6104  O O   . THR D 1 89  ? -32.882 129.432 -0.828  1.00 13.32 ? 89  THR D O   1 
ATOM 6105  C CB  . THR D 1 89  ? -35.355 127.767 -2.574  1.00 11.86 ? 89  THR D CB  1 
ATOM 6106  O OG1 . THR D 1 89  ? -35.568 127.314 -1.227  1.00 10.91 ? 89  THR D OG1 1 
ATOM 6107  C CG2 . THR D 1 89  ? -35.449 126.582 -3.523  1.00 10.31 ? 89  THR D CG2 1 
ATOM 6108  N N   . GLU D 1 90  ? -34.758 130.370 -1.505  1.00 15.70 ? 90  GLU D N   1 
ATOM 6109  C CA  . GLU D 1 90  ? -34.713 131.378 -0.490  1.00 18.75 ? 90  GLU D CA  1 
ATOM 6110  C C   . GLU D 1 90  ? -35.040 130.836 0.891   1.00 19.27 ? 90  GLU D C   1 
ATOM 6111  O O   . GLU D 1 90  ? -34.300 131.083 1.842   1.00 20.23 ? 90  GLU D O   1 
ATOM 6112  C CB  . GLU D 1 90  ? -35.647 132.557 -0.838  1.00 14.60 ? 90  GLU D CB  1 
ATOM 6113  C CG  . GLU D 1 90  ? -35.528 133.750 0.103   1.00 16.06 ? 90  GLU D CG  1 
ATOM 6114  C CD  . GLU D 1 90  ? -34.123 134.331 0.175   1.00 17.43 ? 90  GLU D CD  1 
ATOM 6115  O OE1 . GLU D 1 90  ? -33.283 134.044 -0.704  1.00 17.78 ? 90  GLU D OE1 1 
ATOM 6116  O OE2 . GLU D 1 90  ? -33.862 135.095 1.125   1.00 13.96 ? 90  GLU D OE2 1 
ATOM 6117  N N   . GLU D 1 91  ? -36.116 130.055 0.999   1.00 18.12 ? 91  GLU D N   1 
ATOM 6118  C CA  . GLU D 1 91  ? -36.509 129.498 2.298   1.00 17.84 ? 91  GLU D CA  1 
ATOM 6119  C C   . GLU D 1 91  ? -35.360 128.740 2.938   1.00 18.34 ? 91  GLU D C   1 
ATOM 6120  O O   . GLU D 1 91  ? -35.084 128.892 4.122   1.00 20.92 ? 91  GLU D O   1 
ATOM 6121  C CB  . GLU D 1 91  ? -37.710 128.557 2.183   1.00 20.19 ? 91  GLU D CB  1 
ATOM 6122  C CG  . GLU D 1 91  ? -38.120 127.948 3.539   1.00 22.57 ? 91  GLU D CG  1 
ATOM 6123  C CD  . GLU D 1 91  ? -39.087 126.771 3.438   1.00 25.73 ? 91  GLU D CD  1 
ATOM 6124  O OE1 . GLU D 1 91  ? -39.445 126.358 2.310   1.00 25.22 ? 91  GLU D OE1 1 
ATOM 6125  O OE2 . GLU D 1 91  ? -39.483 126.251 4.521   1.00 22.42 ? 91  GLU D OE2 1 
ATOM 6126  N N   . GLU D 1 92  ? -34.699 127.916 2.137   1.00 18.68 ? 92  GLU D N   1 
ATOM 6127  C CA  . GLU D 1 92  ? -33.581 127.120 2.610   1.00 18.03 ? 92  GLU D CA  1 
ATOM 6128  C C   . GLU D 1 92  ? -32.480 128.044 3.099   1.00 17.39 ? 92  GLU D C   1 
ATOM 6129  O O   . GLU D 1 92  ? -32.026 127.923 4.237   1.00 17.76 ? 92  GLU D O   1 
ATOM 6130  C CB  . GLU D 1 92  ? -33.085 126.209 1.486   1.00 16.65 ? 92  GLU D CB  1 
ATOM 6131  C CG  . GLU D 1 92  ? -34.193 125.341 0.912   1.00 14.77 ? 92  GLU D CG  1 
ATOM 6132  C CD  . GLU D 1 92  ? -33.767 124.497 -0.267  1.00 18.00 ? 92  GLU D CD  1 
ATOM 6133  O OE1 . GLU D 1 92  ? -32.758 124.826 -0.921  1.00 18.83 ? 92  GLU D OE1 1 
ATOM 6134  O OE2 . GLU D 1 92  ? -34.459 123.498 -0.545  1.00 19.14 ? 92  GLU D OE2 1 
ATOM 6135  N N   . LYS D 1 93  ? -32.114 129.009 2.261   1.00 15.85 ? 93  LYS D N   1 
ATOM 6136  C CA  . LYS D 1 93  ? -31.080 129.977 2.597   1.00 14.07 ? 93  LYS D CA  1 
ATOM 6137  C C   . LYS D 1 93  ? -31.339 130.636 3.953   1.00 13.85 ? 93  LYS D C   1 
ATOM 6138  O O   . LYS D 1 93  ? -30.462 130.654 4.814   1.00 16.68 ? 93  LYS D O   1 
ATOM 6139  C CB  . LYS D 1 93  ? -31.001 131.061 1.524   1.00 11.57 ? 93  LYS D CB  1 
ATOM 6140  C CG  . LYS D 1 93  ? -30.368 130.647 0.205   1.00 6.07  ? 93  LYS D CG  1 
ATOM 6141  C CD  . LYS D 1 93  ? -30.569 131.762 -0.826  1.00 7.92  ? 93  LYS D CD  1 
ATOM 6142  C CE  . LYS D 1 93  ? -29.842 131.512 -2.142  1.00 10.01 ? 93  LYS D CE  1 
ATOM 6143  N NZ  . LYS D 1 93  ? -28.370 131.732 -2.069  1.00 7.18  ? 93  LYS D NZ  1 
ATOM 6144  N N   . ILE D 1 94  ? -32.544 131.168 4.140   1.00 14.68 ? 94  ILE D N   1 
ATOM 6145  C CA  . ILE D 1 94  ? -32.916 131.840 5.382   1.00 15.25 ? 94  ILE D CA  1 
ATOM 6146  C C   . ILE D 1 94  ? -32.899 130.898 6.584   1.00 14.50 ? 94  ILE D C   1 
ATOM 6147  O O   . ILE D 1 94  ? -32.418 131.268 7.654   1.00 18.20 ? 94  ILE D O   1 
ATOM 6148  C CB  . ILE D 1 94  ? -34.310 132.456 5.283   1.00 12.64 ? 94  ILE D CB  1 
ATOM 6149  C CG1 . ILE D 1 94  ? -34.420 133.275 4.003   1.00 12.92 ? 94  ILE D CG1 1 
ATOM 6150  C CG2 . ILE D 1 94  ? -34.570 133.347 6.484   1.00 13.27 ? 94  ILE D CG2 1 
ATOM 6151  C CD1 . ILE D 1 94  ? -35.835 133.585 3.607   1.00 15.10 ? 94  ILE D CD1 1 
ATOM 6152  N N   . ARG D 1 95  ? -33.430 129.689 6.408   1.00 14.29 ? 95  ARG D N   1 
ATOM 6153  C CA  . ARG D 1 95  ? -33.478 128.692 7.479   1.00 15.28 ? 95  ARG D CA  1 
ATOM 6154  C C   . ARG D 1 95  ? -32.104 128.259 7.934   1.00 15.38 ? 95  ARG D C   1 
ATOM 6155  O O   . ARG D 1 95  ? -31.886 127.998 9.113   1.00 12.77 ? 95  ARG D O   1 
ATOM 6156  C CB  . ARG D 1 95  ? -34.283 127.471 7.049   1.00 15.13 ? 95  ARG D CB  1 
ATOM 6157  C CG  . ARG D 1 95  ? -35.748 127.751 7.003   1.00 6.91  ? 95  ARG D CG  1 
ATOM 6158  C CD  . ARG D 1 95  ? -36.562 126.500 6.901   1.00 7.70  ? 95  ARG D CD  1 
ATOM 6159  N NE  . ARG D 1 95  ? -37.858 126.737 7.508   1.00 9.49  ? 95  ARG D NE  1 
ATOM 6160  C CZ  . ARG D 1 95  ? -38.181 126.338 8.731   1.00 9.98  ? 95  ARG D CZ  1 
ATOM 6161  N NH1 . ARG D 1 95  ? -37.309 125.669 9.468   1.00 8.35  ? 95  ARG D NH1 1 
ATOM 6162  N NH2 . ARG D 1 95  ? -39.359 126.660 9.242   1.00 11.25 ? 95  ARG D NH2 1 
ATOM 6163  N N   . VAL D 1 96  ? -31.191 128.132 6.984   1.00 15.36 ? 96  VAL D N   1 
ATOM 6164  C CA  . VAL D 1 96  ? -29.834 127.762 7.314   1.00 15.68 ? 96  VAL D CA  1 
ATOM 6165  C C   . VAL D 1 96  ? -29.237 128.984 8.016   1.00 14.16 ? 96  VAL D C   1 
ATOM 6166  O O   . VAL D 1 96  ? -28.635 128.863 9.090   1.00 16.47 ? 96  VAL D O   1 
ATOM 6167  C CB  . VAL D 1 96  ? -29.033 127.395 6.041   1.00 14.40 ? 96  VAL D CB  1 
ATOM 6168  C CG1 . VAL D 1 96  ? -27.564 127.211 6.364   1.00 11.00 ? 96  VAL D CG1 1 
ATOM 6169  C CG2 . VAL D 1 96  ? -29.577 126.115 5.436   1.00 10.08 ? 96  VAL D CG2 1 
ATOM 6170  N N   . ASP D 1 97  ? -29.486 130.165 7.441   1.00 11.39 ? 97  ASP D N   1 
ATOM 6171  C CA  . ASP D 1 97  ? -29.003 131.422 7.981   1.00 9.33  ? 97  ASP D CA  1 
ATOM 6172  C C   . ASP D 1 97  ? -29.334 131.566 9.470   1.00 8.13  ? 97  ASP D C   1 
ATOM 6173  O O   . ASP D 1 97  ? -28.437 131.587 10.317  1.00 10.04 ? 97  ASP D O   1 
ATOM 6174  C CB  . ASP D 1 97  ? -29.621 132.581 7.197   1.00 7.74  ? 97  ASP D CB  1 
ATOM 6175  C CG  . ASP D 1 97  ? -28.582 133.476 6.567   1.00 10.23 ? 97  ASP D CG  1 
ATOM 6176  O OD1 . ASP D 1 97  ? -28.140 133.192 5.435   1.00 10.16 ? 97  ASP D OD1 1 
ATOM 6177  O OD2 . ASP D 1 97  ? -28.196 134.461 7.219   1.00 6.19  ? 97  ASP D OD2 1 
ATOM 6178  N N   . ILE D 1 98  ? -30.627 131.646 9.775   1.00 7.81  ? 98  ILE D N   1 
ATOM 6179  C CA  . ILE D 1 98  ? -31.132 131.792 11.141  1.00 5.78  ? 98  ILE D CA  1 
ATOM 6180  C C   . ILE D 1 98  ? -30.717 130.691 12.125  1.00 10.92 ? 98  ILE D C   1 
ATOM 6181  O O   . ILE D 1 98  ? -30.346 130.987 13.263  1.00 7.87  ? 98  ILE D O   1 
ATOM 6182  C CB  . ILE D 1 98  ? -32.678 131.915 11.132  1.00 2.00  ? 98  ILE D CB  1 
ATOM 6183  C CG1 . ILE D 1 98  ? -33.087 133.382 11.115  1.00 7.01  ? 98  ILE D CG1 1 
ATOM 6184  C CG2 . ILE D 1 98  ? -33.326 131.200 12.320  1.00 2.00  ? 98  ILE D CG2 1 
ATOM 6185  C CD1 . ILE D 1 98  ? -34.584 133.594 11.179  1.00 9.79  ? 98  ILE D CD1 1 
ATOM 6186  N N   . LEU D 1 99  ? -30.804 129.433 11.698  1.00 12.66 ? 99  LEU D N   1 
ATOM 6187  C CA  . LEU D 1 99  ? -30.458 128.306 12.557  1.00 11.27 ? 99  LEU D CA  1 
ATOM 6188  C C   . LEU D 1 99  ? -29.003 128.350 12.991  1.00 15.23 ? 99  LEU D C   1 
ATOM 6189  O O   . LEU D 1 99  ? -28.729 128.206 14.176  1.00 18.58 ? 99  LEU D O   1 
ATOM 6190  C CB  . LEU D 1 99  ? -30.783 126.968 11.871  1.00 11.69 ? 99  LEU D CB  1 
ATOM 6191  C CG  . LEU D 1 99  ? -30.940 125.654 12.665  1.00 12.68 ? 99  LEU D CG  1 
ATOM 6192  C CD1 . LEU D 1 99  ? -29.599 125.040 13.010  1.00 10.18 ? 99  LEU D CD1 1 
ATOM 6193  C CD2 . LEU D 1 99  ? -31.798 125.869 13.904  1.00 11.91 ? 99  LEU D CD2 1 
ATOM 6194  N N   . GLU D 1 100 ? -28.077 128.581 12.062  1.00 16.46 ? 100 GLU D N   1 
ATOM 6195  C CA  . GLU D 1 100 ? -26.669 128.625 12.441  1.00 20.07 ? 100 GLU D CA  1 
ATOM 6196  C C   . GLU D 1 100 ? -26.391 129.783 13.407  1.00 19.53 ? 100 GLU D C   1 
ATOM 6197  O O   . GLU D 1 100 ? -25.652 129.616 14.379  1.00 23.71 ? 100 GLU D O   1 
ATOM 6198  C CB  . GLU D 1 100 ? -25.742 128.660 11.217  1.00 20.39 ? 100 GLU D CB  1 
ATOM 6199  C CG  . GLU D 1 100 ? -25.652 129.990 10.489  1.00 24.23 ? 100 GLU D CG  1 
ATOM 6200  C CD  . GLU D 1 100 ? -24.564 130.010 9.423   1.00 25.69 ? 100 GLU D CD  1 
ATOM 6201  O OE1 . GLU D 1 100 ? -23.529 129.332 9.603   1.00 27.84 ? 100 GLU D OE1 1 
ATOM 6202  O OE2 . GLU D 1 100 ? -24.744 130.717 8.407   1.00 26.23 ? 100 GLU D OE2 1 
ATOM 6203  N N   . ASN D 1 101 ? -27.044 130.923 13.184  1.00 18.94 ? 101 ASN D N   1 
ATOM 6204  C CA  . ASN D 1 101 ? -26.885 132.096 14.051  1.00 17.77 ? 101 ASN D CA  1 
ATOM 6205  C C   . ASN D 1 101 ? -27.376 131.805 15.468  1.00 18.41 ? 101 ASN D C   1 
ATOM 6206  O O   . ASN D 1 101 ? -26.859 132.356 16.435  1.00 16.59 ? 101 ASN D O   1 
ATOM 6207  C CB  . ASN D 1 101 ? -27.658 133.300 13.499  1.00 14.42 ? 101 ASN D CB  1 
ATOM 6208  C CG  . ASN D 1 101 ? -26.780 134.262 12.705  1.00 15.29 ? 101 ASN D CG  1 
ATOM 6209  O OD1 . ASN D 1 101 ? -25.988 135.045 13.268  1.00 10.57 ? 101 ASN D OD1 1 
ATOM 6210  N ND2 . ASN D 1 101 ? -26.950 134.268 11.386  1.00 11.52 ? 101 ASN D ND2 1 
ATOM 6211  N N   . GLN D 1 102 ? -28.393 130.957 15.581  1.00 16.94 ? 102 GLN D N   1 
ATOM 6212  C CA  . GLN D 1 102 ? -28.952 130.592 16.879  1.00 14.47 ? 102 GLN D CA  1 
ATOM 6213  C C   . GLN D 1 102 ? -28.277 129.366 17.473  1.00 17.00 ? 102 GLN D C   1 
ATOM 6214  O O   . GLN D 1 102 ? -28.029 129.328 18.696  1.00 18.30 ? 102 GLN D O   1 
ATOM 6215  C CB  . GLN D 1 102 ? -30.469 130.366 16.781  1.00 11.55 ? 102 GLN D CB  1 
ATOM 6216  C CG  . GLN D 1 102 ? -31.301 131.623 16.482  1.00 6.81  ? 102 GLN D CG  1 
ATOM 6217  C CD  . GLN D 1 102 ? -31.374 132.606 17.653  1.00 2.00  ? 102 GLN D CD  1 
ATOM 6218  O OE1 . GLN D 1 102 ? -30.355 133.058 18.174  1.00 2.00  ? 102 GLN D OE1 1 
ATOM 6219  N NE2 . GLN D 1 102 ? -32.588 132.968 18.042  1.00 2.52  ? 102 GLN D NE2 1 
ATOM 6220  N N   . ALA D 1 103 ? -27.940 128.388 16.652  1.00 18.36 ? 103 ALA D N   1 
ATOM 6221  C CA  . ALA D 1 103 ? -27.293 127.160 17.111  1.00 18.04 ? 103 ALA D CA  1 
ATOM 6222  C C   . ALA D 1 103 ? -26.057 127.530 17.919  1.00 16.47 ? 103 ALA D C   1 
ATOM 6223  O O   . ALA D 1 103 ? -25.841 127.015 19.018  1.00 13.14 ? 103 ALA D O   1 
ATOM 6224  C CB  . ALA D 1 103 ? -26.914 126.272 15.924  1.00 17.07 ? 103 ALA D CB  1 
ATOM 6225  N N   . MET D 1 104 ? -25.270 128.462 17.389  1.00 16.86 ? 104 MET D N   1 
ATOM 6226  C CA  . MET D 1 104 ? -24.078 128.916 18.086  1.00 19.41 ? 104 MET D CA  1 
ATOM 6227  C C   . MET D 1 104 ? -24.474 129.657 19.366  1.00 16.31 ? 104 MET D C   1 
ATOM 6228  O O   . MET D 1 104 ? -23.863 129.449 20.415  1.00 17.16 ? 104 MET D O   1 
ATOM 6229  C CB  . MET D 1 104 ? -23.224 129.818 17.189  1.00 20.15 ? 104 MET D CB  1 
ATOM 6230  C CG  . MET D 1 104 ? -22.498 129.090 16.060  1.00 25.62 ? 104 MET D CG  1 
ATOM 6231  S SD  . MET D 1 104 ? -21.295 127.839 16.609  1.00 36.35 ? 104 MET D SD  1 
ATOM 6232  C CE  . MET D 1 104 ? -19.758 128.702 16.338  1.00 32.60 ? 104 MET D CE  1 
ATOM 6233  N N   . ASP D 1 105 ? -25.527 130.472 19.292  1.00 13.32 ? 105 ASP D N   1 
ATOM 6234  C CA  . ASP D 1 105 ? -26.004 131.237 20.446  1.00 11.87 ? 105 ASP D CA  1 
ATOM 6235  C C   . ASP D 1 105 ? -26.337 130.359 21.642  1.00 15.74 ? 105 ASP D C   1 
ATOM 6236  O O   . ASP D 1 105 ? -26.100 130.747 22.789  1.00 19.35 ? 105 ASP D O   1 
ATOM 6237  C CB  . ASP D 1 105 ? -27.230 132.071 20.081  1.00 8.24  ? 105 ASP D CB  1 
ATOM 6238  C CG  . ASP D 1 105 ? -26.909 133.544 19.908  1.00 12.28 ? 105 ASP D CG  1 
ATOM 6239  O OD1 . ASP D 1 105 ? -25.777 133.870 19.491  1.00 14.53 ? 105 ASP D OD1 1 
ATOM 6240  O OD2 . ASP D 1 105 ? -27.799 134.381 20.184  1.00 12.33 ? 105 ASP D OD2 1 
ATOM 6241  N N   . VAL D 1 106 ? -26.911 129.189 21.376  1.00 14.10 ? 106 VAL D N   1 
ATOM 6242  C CA  . VAL D 1 106 ? -27.261 128.250 22.435  1.00 12.01 ? 106 VAL D CA  1 
ATOM 6243  C C   . VAL D 1 106 ? -25.955 127.686 22.983  1.00 14.69 ? 106 VAL D C   1 
ATOM 6244  O O   . VAL D 1 106 ? -25.795 127.525 24.191  1.00 16.90 ? 106 VAL D O   1 
ATOM 6245  C CB  . VAL D 1 106 ? -28.110 127.072 21.912  1.00 11.23 ? 106 VAL D CB  1 
ATOM 6246  C CG1 . VAL D 1 106 ? -28.718 126.325 23.077  1.00 13.80 ? 106 VAL D CG1 1 
ATOM 6247  C CG2 . VAL D 1 106 ? -29.189 127.563 20.958  1.00 10.02 ? 106 VAL D CG2 1 
ATOM 6248  N N   . SER D 1 107 ? -25.013 127.417 22.085  1.00 16.71 ? 107 SER D N   1 
ATOM 6249  C CA  . SER D 1 107 ? -23.711 126.878 22.464  1.00 18.33 ? 107 SER D CA  1 
ATOM 6250  C C   . SER D 1 107 ? -22.985 127.826 23.417  1.00 18.09 ? 107 SER D C   1 
ATOM 6251  O O   . SER D 1 107 ? -22.464 127.402 24.445  1.00 18.24 ? 107 SER D O   1 
ATOM 6252  C CB  . SER D 1 107 ? -22.853 126.649 21.222  1.00 19.46 ? 107 SER D CB  1 
ATOM 6253  O OG  . SER D 1 107 ? -23.505 125.798 20.299  1.00 14.91 ? 107 SER D OG  1 
ATOM 6254  N N   . ASN D 1 108 ? -22.942 129.106 23.072  1.00 16.47 ? 108 ASN D N   1 
ATOM 6255  C CA  . ASN D 1 108 ? -22.287 130.087 23.921  1.00 20.68 ? 108 ASN D CA  1 
ATOM 6256  C C   . ASN D 1 108 ? -23.018 130.199 25.242  1.00 21.74 ? 108 ASN D C   1 
ATOM 6257  O O   . ASN D 1 108 ? -22.404 130.392 26.284  1.00 21.43 ? 108 ASN D O   1 
ATOM 6258  C CB  . ASN D 1 108 ? -22.237 131.451 23.244  1.00 16.51 ? 108 ASN D CB  1 
ATOM 6259  C CG  . ASN D 1 108 ? -21.257 131.492 22.102  1.00 16.59 ? 108 ASN D CG  1 
ATOM 6260  O OD1 . ASN D 1 108 ? -21.395 132.305 21.196  1.00 15.78 ? 108 ASN D OD1 1 
ATOM 6261  N ND2 . ASN D 1 108 ? -20.257 130.616 22.133  1.00 10.67 ? 108 ASN D ND2 1 
ATOM 6262  N N   . GLN D 1 109 ? -24.336 130.068 25.200  1.00 22.81 ? 109 GLN D N   1 
ATOM 6263  C CA  . GLN D 1 109 ? -25.127 130.142 26.415  1.00 22.22 ? 109 GLN D CA  1 
ATOM 6264  C C   . GLN D 1 109 ? -24.841 128.970 27.352  1.00 24.23 ? 109 GLN D C   1 
ATOM 6265  O O   . GLN D 1 109 ? -25.122 129.047 28.546  1.00 22.74 ? 109 GLN D O   1 
ATOM 6266  C CB  . GLN D 1 109 ? -26.617 130.231 26.081  1.00 23.34 ? 109 GLN D CB  1 
ATOM 6267  C CG  . GLN D 1 109 ? -27.023 131.592 25.540  1.00 24.77 ? 109 GLN D CG  1 
ATOM 6268  C CD  . GLN D 1 109 ? -28.472 131.652 25.112  1.00 28.05 ? 109 GLN D CD  1 
ATOM 6269  O OE1 . GLN D 1 109 ? -29.370 131.215 25.837  1.00 29.51 ? 109 GLN D OE1 1 
ATOM 6270  N NE2 . GLN D 1 109 ? -28.709 132.189 23.924  1.00 24.13 ? 109 GLN D NE2 1 
ATOM 6271  N N   . LEU D 1 110 ? -24.293 127.885 26.817  1.00 20.56 ? 110 LEU D N   1 
ATOM 6272  C CA  . LEU D 1 110 ? -23.956 126.735 27.649  1.00 20.84 ? 110 LEU D CA  1 
ATOM 6273  C C   . LEU D 1 110 ? -22.494 126.842 28.088  1.00 21.40 ? 110 LEU D C   1 
ATOM 6274  O O   . LEU D 1 110 ? -22.165 126.634 29.255  1.00 20.87 ? 110 LEU D O   1 
ATOM 6275  C CB  . LEU D 1 110 ? -24.187 125.424 26.898  1.00 20.65 ? 110 LEU D CB  1 
ATOM 6276  C CG  . LEU D 1 110 ? -23.977 124.154 27.733  1.00 18.88 ? 110 LEU D CG  1 
ATOM 6277  C CD1 . LEU D 1 110 ? -24.938 124.141 28.912  1.00 16.68 ? 110 LEU D CD1 1 
ATOM 6278  C CD2 . LEU D 1 110 ? -24.169 122.910 26.878  1.00 17.67 ? 110 LEU D CD2 1 
ATOM 6279  N N   . ALA D 1 111 ? -21.626 127.185 27.143  1.00 21.66 ? 111 ALA D N   1 
ATOM 6280  C CA  . ALA D 1 111 ? -20.200 127.343 27.405  1.00 19.11 ? 111 ALA D CA  1 
ATOM 6281  C C   . ALA D 1 111 ? -19.932 128.431 28.439  1.00 20.86 ? 111 ALA D C   1 
ATOM 6282  O O   . ALA D 1 111 ? -19.138 128.243 29.364  1.00 20.25 ? 111 ALA D O   1 
ATOM 6283  C CB  . ALA D 1 111 ? -19.468 127.666 26.111  1.00 18.89 ? 111 ALA D CB  1 
ATOM 6284  N N   . ARG D 1 112 ? -20.595 129.570 28.275  1.00 21.69 ? 112 ARG D N   1 
ATOM 6285  C CA  . ARG D 1 112 ? -20.432 130.693 29.185  1.00 20.81 ? 112 ARG D CA  1 
ATOM 6286  C C   . ARG D 1 112 ? -20.758 130.252 30.608  1.00 22.10 ? 112 ARG D C   1 
ATOM 6287  O O   . ARG D 1 112 ? -19.982 130.489 31.538  1.00 21.81 ? 112 ARG D O   1 
ATOM 6288  C CB  . ARG D 1 112 ? -21.334 131.859 28.761  1.00 20.61 ? 112 ARG D CB  1 
ATOM 6289  C CG  . ARG D 1 112 ? -21.042 133.172 29.471  1.00 26.81 ? 112 ARG D CG  1 
ATOM 6290  C CD  . ARG D 1 112 ? -21.816 134.335 28.871  1.00 25.33 ? 112 ARG D CD  1 
ATOM 6291  N NE  . ARG D 1 112 ? -21.289 134.752 27.573  1.00 31.11 ? 112 ARG D NE  1 
ATOM 6292  C CZ  . ARG D 1 112 ? -21.974 134.714 26.434  1.00 34.38 ? 112 ARG D CZ  1 
ATOM 6293  N NH1 . ARG D 1 112 ? -23.224 134.268 26.418  1.00 35.00 ? 112 ARG D NH1 1 
ATOM 6294  N NH2 . ARG D 1 112 ? -21.414 135.142 25.311  1.00 36.41 ? 112 ARG D NH2 1 
ATOM 6295  N N   . VAL D 1 113 ? -21.878 129.556 30.761  1.00 22.59 ? 113 VAL D N   1 
ATOM 6296  C CA  . VAL D 1 113 ? -22.297 129.072 32.068  1.00 21.61 ? 113 VAL D CA  1 
ATOM 6297  C C   . VAL D 1 113 ? -21.243 128.128 32.665  1.00 21.12 ? 113 VAL D C   1 
ATOM 6298  O O   . VAL D 1 113 ? -20.834 128.283 33.816  1.00 21.47 ? 113 VAL D O   1 
ATOM 6299  C CB  . VAL D 1 113 ? -23.701 128.384 31.977  1.00 19.14 ? 113 VAL D CB  1 
ATOM 6300  C CG1 . VAL D 1 113 ? -23.651 126.860 32.266  1.00 23.99 ? 113 VAL D CG1 1 
ATOM 6301  C CG2 . VAL D 1 113 ? -24.679 129.071 32.910  1.00 19.09 ? 113 VAL D CG2 1 
ATOM 6302  N N   . CYS D 1 114 ? -20.757 127.196 31.852  1.00 20.68 ? 114 CYS D N   1 
ATOM 6303  C CA  . CYS D 1 114 ? -19.768 126.222 32.296  1.00 21.55 ? 114 CYS D CA  1 
ATOM 6304  C C   . CYS D 1 114 ? -18.376 126.818 32.545  1.00 23.06 ? 114 CYS D C   1 
ATOM 6305  O O   . CYS D 1 114 ? -17.517 126.177 33.153  1.00 20.33 ? 114 CYS D O   1 
ATOM 6306  C CB  . CYS D 1 114 ? -19.702 125.060 31.299  1.00 23.46 ? 114 CYS D CB  1 
ATOM 6307  S SG  . CYS D 1 114 ? -21.305 124.236 31.041  1.00 21.06 ? 114 CYS D SG  1 
ATOM 6308  N N   . TYR D 1 115 ? -18.143 128.016 32.065  1.00 23.81 ? 115 TYR D N   1 
ATOM 6309  C CA  . TYR D 1 115 ? -16.857 128.688 32.279  1.00 27.29 ? 115 TYR D CA  1 
ATOM 6310  C C   . TYR D 1 115 ? -16.932 129.670 33.443  1.00 27.93 ? 115 TYR D C   1 
ATOM 6311  O O   . TYR D 1 115 ? -16.030 130.488 33.646  1.00 25.58 ? 115 TYR D O   1 
ATOM 6312  C CB  . TYR D 1 115 ? -16.377 129.382 31.001  1.00 26.25 ? 115 TYR D CB  1 
ATOM 6313  C CG  . TYR D 1 115 ? -15.850 128.416 29.969  1.00 29.12 ? 115 TYR D CG  1 
ATOM 6314  C CD1 . TYR D 1 115 ? -15.527 127.106 30.321  1.00 27.38 ? 115 TYR D CD1 1 
ATOM 6315  C CD2 . TYR D 1 115 ? -15.669 128.820 28.646  1.00 29.53 ? 115 TYR D CD2 1 
ATOM 6316  C CE1 . TYR D 1 115 ? -15.037 126.202 29.384  1.00 28.76 ? 115 TYR D CE1 1 
ATOM 6317  C CE2 . TYR D 1 115 ? -15.174 127.903 27.693  1.00 28.72 ? 115 TYR D CE2 1 
ATOM 6318  C CZ  . TYR D 1 115 ? -14.860 126.598 28.075  1.00 28.87 ? 115 TYR D CZ  1 
ATOM 6319  O OH  . TYR D 1 115 ? -14.377 125.666 27.161  1.00 28.50 ? 115 TYR D OH  1 
ATOM 6320  N N   . SER D 1 116 ? -18.011 129.576 34.213  1.00 26.19 ? 116 SER D N   1 
ATOM 6321  C CA  . SER D 1 116 ? -18.206 130.441 35.365  1.00 24.95 ? 116 SER D CA  1 
ATOM 6322  C C   . SER D 1 116 ? -18.033 129.662 36.668  1.00 26.36 ? 116 SER D C   1 
ATOM 6323  O O   . SER D 1 116 ? -18.578 128.564 36.834  1.00 21.41 ? 116 SER D O   1 
ATOM 6324  C CB  . SER D 1 116 ? -19.592 131.092 35.320  1.00 25.61 ? 116 SER D CB  1 
ATOM 6325  O OG  . SER D 1 116 ? -19.740 131.907 34.172  1.00 24.40 ? 116 SER D OG  1 
ATOM 6326  N N   . PRO D 1 117 ? -17.263 130.226 37.615  1.00 25.66 ? 117 PRO D N   1 
ATOM 6327  C CA  . PRO D 1 117 ? -17.000 129.612 38.922  1.00 25.40 ? 117 PRO D CA  1 
ATOM 6328  C C   . PRO D 1 117 ? -18.276 129.431 39.754  1.00 25.51 ? 117 PRO D C   1 
ATOM 6329  O O   . PRO D 1 117 ? -18.313 128.632 40.690  1.00 24.92 ? 117 PRO D O   1 
ATOM 6330  C CB  . PRO D 1 117 ? -16.023 130.601 39.575  1.00 25.67 ? 117 PRO D CB  1 
ATOM 6331  C CG  . PRO D 1 117 ? -16.368 131.919 38.928  1.00 27.79 ? 117 PRO D CG  1 
ATOM 6332  C CD  . PRO D 1 117 ? -16.542 131.507 37.487  1.00 27.62 ? 117 PRO D CD  1 
ATOM 6333  N N   . ASP D 1 118 ? -19.325 130.165 39.394  1.00 27.39 ? 118 ASP D N   1 
ATOM 6334  C CA  . ASP D 1 118 ? -20.602 130.090 40.098  1.00 31.80 ? 118 ASP D CA  1 
ATOM 6335  C C   . ASP D 1 118 ? -21.519 129.059 39.443  1.00 30.51 ? 118 ASP D C   1 
ATOM 6336  O O   . ASP D 1 118 ? -22.745 129.170 39.514  1.00 28.69 ? 118 ASP D O   1 
ATOM 6337  C CB  . ASP D 1 118 ? -21.274 131.464 40.101  1.00 34.82 ? 118 ASP D CB  1 
ATOM 6338  C CG  . ASP D 1 118 ? -20.350 132.557 40.601  1.00 40.30 ? 118 ASP D CG  1 
ATOM 6339  O OD1 . ASP D 1 118 ? -19.536 133.061 39.794  1.00 43.71 ? 118 ASP D OD1 1 
ATOM 6340  O OD2 . ASP D 1 118 ? -20.428 132.903 41.801  1.00 39.10 ? 118 ASP D OD2 1 
ATOM 6341  N N   . PHE D 1 119 ? -20.905 128.064 38.806  1.00 28.52 ? 119 PHE D N   1 
ATOM 6342  C CA  . PHE D 1 119 ? -21.593 126.979 38.113  1.00 27.68 ? 119 PHE D CA  1 
ATOM 6343  C C   . PHE D 1 119 ? -22.895 126.537 38.785  1.00 27.74 ? 119 PHE D C   1 
ATOM 6344  O O   . PHE D 1 119 ? -23.976 126.722 38.227  1.00 28.81 ? 119 PHE D O   1 
ATOM 6345  C CB  . PHE D 1 119 ? -20.634 125.789 37.982  1.00 27.95 ? 119 PHE D CB  1 
ATOM 6346  C CG  . PHE D 1 119 ? -21.239 124.575 37.334  1.00 26.98 ? 119 PHE D CG  1 
ATOM 6347  C CD1 . PHE D 1 119 ? -21.598 124.587 35.992  1.00 27.12 ? 119 PHE D CD1 1 
ATOM 6348  C CD2 . PHE D 1 119 ? -21.439 123.412 38.069  1.00 27.58 ? 119 PHE D CD2 1 
ATOM 6349  C CE1 . PHE D 1 119 ? -22.150 123.454 35.393  1.00 28.35 ? 119 PHE D CE1 1 
ATOM 6350  C CE2 . PHE D 1 119 ? -21.989 122.276 37.479  1.00 27.84 ? 119 PHE D CE2 1 
ATOM 6351  C CZ  . PHE D 1 119 ? -22.344 122.296 36.142  1.00 26.59 ? 119 PHE D CZ  1 
ATOM 6352  N N   . GLU D 1 120 ? -22.790 125.994 39.997  1.00 25.31 ? 120 GLU D N   1 
ATOM 6353  C CA  . GLU D 1 120 ? -23.955 125.516 40.744  1.00 26.07 ? 120 GLU D CA  1 
ATOM 6354  C C   . GLU D 1 120 ? -25.091 126.518 40.924  1.00 25.22 ? 120 GLU D C   1 
ATOM 6355  O O   . GLU D 1 120 ? -26.220 126.126 41.208  1.00 25.24 ? 120 GLU D O   1 
ATOM 6356  C CB  . GLU D 1 120 ? -23.540 124.979 42.114  1.00 24.50 ? 120 GLU D CB  1 
ATOM 6357  C CG  . GLU D 1 120 ? -23.523 123.460 42.224  1.00 23.34 ? 120 GLU D CG  1 
ATOM 6358  C CD  . GLU D 1 120 ? -22.270 122.833 41.654  1.00 25.25 ? 120 GLU D CD  1 
ATOM 6359  O OE1 . GLU D 1 120 ? -21.165 123.205 42.102  1.00 27.23 ? 120 GLU D OE1 1 
ATOM 6360  O OE2 . GLU D 1 120 ? -22.388 121.954 40.776  1.00 20.76 ? 120 GLU D OE2 1 
ATOM 6361  N N   . LYS D 1 121 ? -24.789 127.805 40.788  1.00 25.39 ? 121 LYS D N   1 
ATOM 6362  C CA  . LYS D 1 121 ? -25.792 128.858 40.929  1.00 26.91 ? 121 LYS D CA  1 
ATOM 6363  C C   . LYS D 1 121 ? -26.482 129.145 39.595  1.00 26.93 ? 121 LYS D C   1 
ATOM 6364  O O   . LYS D 1 121 ? -27.730 129.238 39.511  1.00 27.70 ? 121 LYS D O   1 
ATOM 6365  C CB  . LYS D 1 121 ? -25.130 130.145 41.419  1.00 26.39 ? 121 LYS D CB  1 
ATOM 6366  C CG  . LYS D 1 121 ? -24.500 130.078 42.789  1.00 27.15 ? 121 LYS D CG  1 
ATOM 6367  C CD  . LYS D 1 121 ? -23.595 131.271 42.974  1.00 29.61 ? 121 LYS D CD  1 
ATOM 6368  C CE  . LYS D 1 121 ? -23.218 131.488 44.416  1.00 24.94 ? 121 LYS D CE  1 
ATOM 6369  N NZ  . LYS D 1 121 ? -22.398 132.721 44.525  1.00 23.19 ? 121 LYS D NZ  1 
ATOM 6370  N N   . LEU D 1 122 ? -25.664 129.288 38.556  1.00 26.77 ? 122 LEU D N   1 
ATOM 6371  C CA  . LEU D 1 122 ? -26.139 129.590 37.212  1.00 27.30 ? 122 LEU D CA  1 
ATOM 6372  C C   . LEU D 1 122 ? -26.719 128.408 36.442  1.00 25.60 ? 122 LEU D C   1 
ATOM 6373  O O   . LEU D 1 122 ? -27.428 128.605 35.451  1.00 23.82 ? 122 LEU D O   1 
ATOM 6374  C CB  . LEU D 1 122 ? -25.032 130.254 36.389  1.00 28.74 ? 122 LEU D CB  1 
ATOM 6375  C CG  . LEU D 1 122 ? -24.618 131.700 36.684  1.00 27.79 ? 122 LEU D CG  1 
ATOM 6376  C CD1 . LEU D 1 122 ? -24.229 131.883 38.142  1.00 26.40 ? 122 LEU D CD1 1 
ATOM 6377  C CD2 . LEU D 1 122 ? -23.455 132.075 35.774  1.00 29.89 ? 122 LEU D CD2 1 
ATOM 6378  N N   . LYS D 1 123 ? -26.411 127.184 36.863  1.00 24.63 ? 123 LYS D N   1 
ATOM 6379  C CA  . LYS D 1 123 ? -26.957 126.025 36.167  1.00 23.30 ? 123 LYS D CA  1 
ATOM 6380  C C   . LYS D 1 123 ? -28.477 126.014 36.275  1.00 25.70 ? 123 LYS D C   1 
ATOM 6381  O O   . LYS D 1 123 ? -29.160 126.145 35.262  1.00 24.73 ? 123 LYS D O   1 
ATOM 6382  C CB  . LYS D 1 123 ? -26.370 124.697 36.663  1.00 19.54 ? 123 LYS D CB  1 
ATOM 6383  C CG  . LYS D 1 123 ? -27.046 123.479 36.031  1.00 8.36  ? 123 LYS D CG  1 
ATOM 6384  C CD  . LYS D 1 123 ? -26.389 122.185 36.456  1.00 4.99  ? 123 LYS D CD  1 
ATOM 6385  C CE  . LYS D 1 123 ? -27.112 120.984 35.872  1.00 5.75  ? 123 LYS D CE  1 
ATOM 6386  N NZ  . LYS D 1 123 ? -26.367 119.719 36.125  1.00 5.12  ? 123 LYS D NZ  1 
ATOM 6387  N N   . PRO D 1 124 ? -29.030 125.916 37.500  1.00 27.33 ? 124 PRO D N   1 
ATOM 6388  C CA  . PRO D 1 124 ? -30.492 125.904 37.620  1.00 28.58 ? 124 PRO D CA  1 
ATOM 6389  C C   . PRO D 1 124 ? -31.103 127.134 36.963  1.00 27.62 ? 124 PRO D C   1 
ATOM 6390  O O   . PRO D 1 124 ? -32.194 127.070 36.399  1.00 30.04 ? 124 PRO D O   1 
ATOM 6391  C CB  . PRO D 1 124 ? -30.707 125.919 39.131  1.00 29.75 ? 124 PRO D CB  1 
ATOM 6392  C CG  . PRO D 1 124 ? -29.505 125.188 39.639  1.00 27.46 ? 124 PRO D CG  1 
ATOM 6393  C CD  . PRO D 1 124 ? -28.411 125.812 38.828  1.00 27.64 ? 124 PRO D CD  1 
ATOM 6394  N N   . GLU D 1 125 ? -30.366 128.239 37.007  1.00 26.78 ? 125 GLU D N   1 
ATOM 6395  C CA  . GLU D 1 125 ? -30.814 129.486 36.406  1.00 28.93 ? 125 GLU D CA  1 
ATOM 6396  C C   . GLU D 1 125 ? -31.033 129.287 34.911  1.00 28.14 ? 125 GLU D C   1 
ATOM 6397  O O   . GLU D 1 125 ? -32.086 129.645 34.382  1.00 32.06 ? 125 GLU D O   1 
ATOM 6398  C CB  . GLU D 1 125 ? -29.781 130.583 36.652  1.00 28.56 ? 125 GLU D CB  1 
ATOM 6399  C CG  . GLU D 1 125 ? -30.211 131.963 36.199  1.00 31.04 ? 125 GLU D CG  1 
ATOM 6400  C CD  . GLU D 1 125 ? -29.121 133.002 36.387  1.00 31.23 ? 125 GLU D CD  1 
ATOM 6401  O OE1 . GLU D 1 125 ? -28.216 133.072 35.529  1.00 30.70 ? 125 GLU D OE1 1 
ATOM 6402  O OE2 . GLU D 1 125 ? -29.166 133.745 37.391  1.00 27.88 ? 125 GLU D OE2 1 
ATOM 6403  N N   . TYR D 1 126 ? -30.047 128.694 34.243  1.00 27.16 ? 126 TYR D N   1 
ATOM 6404  C CA  . TYR D 1 126 ? -30.135 128.428 32.808  1.00 25.97 ? 126 TYR D CA  1 
ATOM 6405  C C   . TYR D 1 126 ? -31.169 127.336 32.542  1.00 26.95 ? 126 TYR D C   1 
ATOM 6406  O O   . TYR D 1 126 ? -31.945 127.423 31.591  1.00 25.89 ? 126 TYR D O   1 
ATOM 6407  C CB  . TYR D 1 126 ? -28.768 128.000 32.261  1.00 25.41 ? 126 TYR D CB  1 
ATOM 6408  C CG  . TYR D 1 126 ? -28.768 127.588 30.797  1.00 23.14 ? 126 TYR D CG  1 
ATOM 6409  C CD1 . TYR D 1 126 ? -29.058 128.508 29.790  1.00 24.14 ? 126 TYR D CD1 1 
ATOM 6410  C CD2 . TYR D 1 126 ? -28.466 126.278 30.422  1.00 22.85 ? 126 TYR D CD2 1 
ATOM 6411  C CE1 . TYR D 1 126 ? -29.045 128.136 28.447  1.00 24.79 ? 126 TYR D CE1 1 
ATOM 6412  C CE2 . TYR D 1 126 ? -28.452 125.896 29.082  1.00 24.26 ? 126 TYR D CE2 1 
ATOM 6413  C CZ  . TYR D 1 126 ? -28.743 126.830 28.100  1.00 24.52 ? 126 TYR D CZ  1 
ATOM 6414  O OH  . TYR D 1 126 ? -28.734 126.457 26.771  1.00 25.98 ? 126 TYR D OH  1 
ATOM 6415  N N   . LEU D 1 127 ? -31.185 126.325 33.402  1.00 25.64 ? 127 LEU D N   1 
ATOM 6416  C CA  . LEU D 1 127 ? -32.112 125.209 33.288  1.00 23.68 ? 127 LEU D CA  1 
ATOM 6417  C C   . LEU D 1 127 ? -33.564 125.702 33.227  1.00 25.52 ? 127 LEU D C   1 
ATOM 6418  O O   . LEU D 1 127 ? -34.421 125.055 32.620  1.00 27.82 ? 127 LEU D O   1 
ATOM 6419  C CB  . LEU D 1 127 ? -31.924 124.256 34.474  1.00 21.04 ? 127 LEU D CB  1 
ATOM 6420  C CG  . LEU D 1 127 ? -31.775 122.756 34.201  1.00 21.69 ? 127 LEU D CG  1 
ATOM 6421  C CD1 . LEU D 1 127 ? -31.443 122.040 35.501  1.00 21.22 ? 127 LEU D CD1 1 
ATOM 6422  C CD2 . LEU D 1 127 ? -33.043 122.180 33.580  1.00 21.33 ? 127 LEU D CD2 1 
ATOM 6423  N N   . GLU D 1 128 ? -33.826 126.861 33.827  1.00 24.90 ? 128 GLU D N   1 
ATOM 6424  C CA  . GLU D 1 128 ? -35.168 127.442 33.841  1.00 26.84 ? 128 GLU D CA  1 
ATOM 6425  C C   . GLU D 1 128 ? -35.710 127.744 32.446  1.00 27.02 ? 128 GLU D C   1 
ATOM 6426  O O   . GLU D 1 128 ? -36.883 127.497 32.164  1.00 25.55 ? 128 GLU D O   1 
ATOM 6427  C CB  . GLU D 1 128 ? -35.189 128.725 34.675  1.00 27.33 ? 128 GLU D CB  1 
ATOM 6428  C CG  . GLU D 1 128 ? -34.928 128.515 36.154  1.00 25.94 ? 128 GLU D CG  1 
ATOM 6429  C CD  . GLU D 1 128 ? -34.807 129.813 36.936  1.00 24.63 ? 128 GLU D CD  1 
ATOM 6430  O OE1 . GLU D 1 128 ? -33.997 130.685 36.543  1.00 24.60 ? 128 GLU D OE1 1 
ATOM 6431  O OE2 . GLU D 1 128 ? -35.514 129.948 37.956  1.00 19.01 ? 128 GLU D OE2 1 
ATOM 6432  N N   . GLU D 1 129 ? -34.863 128.290 31.582  1.00 26.55 ? 129 GLU D N   1 
ATOM 6433  C CA  . GLU D 1 129 ? -35.284 128.631 30.232  1.00 25.10 ? 129 GLU D CA  1 
ATOM 6434  C C   . GLU D 1 129 ? -34.991 127.531 29.217  1.00 23.04 ? 129 GLU D C   1 
ATOM 6435  O O   . GLU D 1 129 ? -35.366 127.644 28.049  1.00 20.18 ? 129 GLU D O   1 
ATOM 6436  C CB  . GLU D 1 129 ? -34.645 129.948 29.781  1.00 25.52 ? 129 GLU D CB  1 
ATOM 6437  C CG  . GLU D 1 129 ? -34.992 131.171 30.635  1.00 26.78 ? 129 GLU D CG  1 
ATOM 6438  C CD  . GLU D 1 129 ? -33.905 131.513 31.639  1.00 26.55 ? 129 GLU D CD  1 
ATOM 6439  O OE1 . GLU D 1 129 ? -32.791 131.875 31.202  1.00 27.81 ? 129 GLU D OE1 1 
ATOM 6440  O OE2 . GLU D 1 129 ? -34.163 131.428 32.861  1.00 28.32 ? 129 GLU D OE2 1 
ATOM 6441  N N   . LEU D 1 130 ? -34.343 126.475 29.662  1.00 20.64 ? 130 LEU D N   1 
ATOM 6442  C CA  . LEU D 1 130 ? -34.020 125.346 28.771  1.00 20.83 ? 130 LEU D CA  1 
ATOM 6443  C C   . LEU D 1 130 ? -35.255 124.699 28.142  1.00 22.55 ? 130 LEU D C   1 
ATOM 6444  O O   . LEU D 1 130 ? -35.223 124.311 26.970  1.00 26.61 ? 130 LEU D O   1 
ATOM 6445  C CB  . LEU D 1 130 ? -33.159 124.287 29.472  1.00 15.00 ? 130 LEU D CB  1 
ATOM 6446  C CG  . LEU D 1 130 ? -32.658 123.144 28.576  1.00 14.86 ? 130 LEU D CG  1 
ATOM 6447  C CD1 . LEU D 1 130 ? -31.897 123.709 27.388  1.00 9.73  ? 130 LEU D CD1 1 
ATOM 6448  C CD2 . LEU D 1 130 ? -31.778 122.182 29.369  1.00 9.36  ? 130 LEU D CD2 1 
ATOM 6449  N N   . PRO D 1 131 ? -36.345 124.536 28.914  1.00 23.04 ? 131 PRO D N   1 
ATOM 6450  C CA  . PRO D 1 131 ? -37.547 123.931 28.339  1.00 23.88 ? 131 PRO D CA  1 
ATOM 6451  C C   . PRO D 1 131 ? -38.072 124.710 27.123  1.00 23.18 ? 131 PRO D C   1 
ATOM 6452  O O   . PRO D 1 131 ? -38.341 124.136 26.066  1.00 24.33 ? 131 PRO D O   1 
ATOM 6453  C CB  . PRO D 1 131 ? -38.533 123.994 29.503  1.00 22.54 ? 131 PRO D CB  1 
ATOM 6454  C CG  . PRO D 1 131 ? -37.657 123.768 30.673  1.00 25.46 ? 131 PRO D CG  1 
ATOM 6455  C CD  . PRO D 1 131 ? -36.509 124.663 30.375  1.00 24.79 ? 131 PRO D CD  1 
ATOM 6456  N N   . THR D 1 132 ? -38.170 126.025 27.275  1.00 22.84 ? 132 THR D N   1 
ATOM 6457  C CA  . THR D 1 132 ? -38.668 126.910 26.228  1.00 23.75 ? 132 THR D CA  1 
ATOM 6458  C C   . THR D 1 132 ? -37.822 126.956 24.950  1.00 27.18 ? 132 THR D C   1 
ATOM 6459  O O   . THR D 1 132 ? -38.365 126.921 23.841  1.00 27.85 ? 132 THR D O   1 
ATOM 6460  C CB  . THR D 1 132 ? -38.918 128.323 26.806  1.00 21.93 ? 132 THR D CB  1 
ATOM 6461  O OG1 . THR D 1 132 ? -40.309 128.453 27.130  1.00 21.43 ? 132 THR D OG1 1 
ATOM 6462  C CG2 . THR D 1 132 ? -38.521 129.421 25.842  1.00 21.05 ? 132 THR D CG2 1 
ATOM 6463  N N   . MET D 1 133 ? -36.505 127.104 25.097  1.00 28.51 ? 133 MET D N   1 
ATOM 6464  C CA  . MET D 1 133 ? -35.611 127.171 23.940  1.00 27.92 ? 133 MET D CA  1 
ATOM 6465  C C   . MET D 1 133 ? -35.654 125.857 23.172  1.00 28.21 ? 133 MET D C   1 
ATOM 6466  O O   . MET D 1 133 ? -35.594 125.846 21.940  1.00 27.33 ? 133 MET D O   1 
ATOM 6467  C CB  . MET D 1 133 ? -34.172 127.492 24.366  1.00 27.97 ? 133 MET D CB  1 
ATOM 6468  C CG  . MET D 1 133 ? -33.587 126.517 25.373  1.00 25.89 ? 133 MET D CG  1 
ATOM 6469  S SD  . MET D 1 133 ? -31.950 126.953 25.999  1.00 32.01 ? 133 MET D SD  1 
ATOM 6470  C CE  . MET D 1 133 ? -32.352 128.285 27.135  1.00 25.91 ? 133 MET D CE  1 
ATOM 6471  N N   . MET D 1 134 ? -35.808 124.762 23.911  1.00 24.64 ? 134 MET D N   1 
ATOM 6472  C CA  . MET D 1 134 ? -35.877 123.431 23.330  1.00 22.89 ? 134 MET D CA  1 
ATOM 6473  C C   . MET D 1 134 ? -37.159 123.295 22.532  1.00 22.48 ? 134 MET D C   1 
ATOM 6474  O O   . MET D 1 134 ? -37.148 122.769 21.401  1.00 21.70 ? 134 MET D O   1 
ATOM 6475  C CB  . MET D 1 134 ? -35.831 122.383 24.437  1.00 20.23 ? 134 MET D CB  1 
ATOM 6476  C CG  . MET D 1 134 ? -34.687 121.393 24.310  1.00 25.68 ? 134 MET D CG  1 
ATOM 6477  S SD  . MET D 1 134 ? -33.074 122.175 24.116  1.00 24.58 ? 134 MET D SD  1 
ATOM 6478  C CE  . MET D 1 134 ? -32.354 121.160 22.845  1.00 24.28 ? 134 MET D CE  1 
ATOM 6479  N N   . GLN D 1 135 ? -38.261 123.790 23.070  1.00 20.77 ? 135 GLN D N   1 
ATOM 6480  C CA  . GLN D 1 135 ? -39.553 123.752 22.391  1.00 21.61 ? 135 GLN D CA  1 
ATOM 6481  C C   . GLN D 1 135 ? -39.465 124.492 21.057  1.00 22.85 ? 135 GLN D C   1 
ATOM 6482  O O   . GLN D 1 135 ? -39.961 124.014 20.040  1.00 21.06 ? 135 GLN D O   1 
ATOM 6483  C CB  . GLN D 1 135 ? -40.630 124.402 23.259  1.00 24.45 ? 135 GLN D CB  1 
ATOM 6484  C CG  . GLN D 1 135 ? -42.018 124.403 22.636  1.00 24.81 ? 135 GLN D CG  1 
ATOM 6485  C CD  . GLN D 1 135 ? -43.008 125.237 23.424  1.00 24.62 ? 135 GLN D CD  1 
ATOM 6486  O OE1 . GLN D 1 135 ? -43.953 124.709 24.008  1.00 27.37 ? 135 GLN D OE1 1 
ATOM 6487  N NE2 . GLN D 1 135 ? -42.793 126.544 23.452  1.00 20.76 ? 135 GLN D NE2 1 
ATOM 6488  N N   . HIS D 1 136 ? -38.812 125.651 21.067  1.00 23.16 ? 136 HIS D N   1 
ATOM 6489  C CA  . HIS D 1 136 ? -38.648 126.454 19.860  1.00 22.62 ? 136 HIS D CA  1 
ATOM 6490  C C   . HIS D 1 136 ? -37.904 125.702 18.769  1.00 21.43 ? 136 HIS D C   1 
ATOM 6491  O O   . HIS D 1 136 ? -38.157 125.911 17.584  1.00 20.35 ? 136 HIS D O   1 
ATOM 6492  C CB  . HIS D 1 136 ? -37.950 127.769 20.182  1.00 25.96 ? 136 HIS D CB  1 
ATOM 6493  C CG  . HIS D 1 136 ? -38.810 128.735 20.935  1.00 27.92 ? 136 HIS D CG  1 
ATOM 6494  N ND1 . HIS D 1 136 ? -38.329 129.531 21.952  1.00 27.34 ? 136 HIS D ND1 1 
ATOM 6495  C CD2 . HIS D 1 136 ? -40.126 129.036 20.815  1.00 26.09 ? 136 HIS D CD2 1 
ATOM 6496  C CE1 . HIS D 1 136 ? -39.308 130.281 22.425  1.00 25.85 ? 136 HIS D CE1 1 
ATOM 6497  N NE2 . HIS D 1 136 ? -40.409 130.001 21.752  1.00 27.81 ? 136 HIS D NE2 1 
ATOM 6498  N N   . PHE D 1 137 ? -36.994 124.819 19.167  1.00 20.31 ? 137 PHE D N   1 
ATOM 6499  C CA  . PHE D 1 137 ? -36.251 124.018 18.202  1.00 19.95 ? 137 PHE D CA  1 
ATOM 6500  C C   . PHE D 1 137 ? -37.219 123.064 17.515  1.00 16.43 ? 137 PHE D C   1 
ATOM 6501  O O   . PHE D 1 137 ? -37.147 122.858 16.303  1.00 14.66 ? 137 PHE D O   1 
ATOM 6502  C CB  . PHE D 1 137 ? -35.123 123.235 18.880  1.00 19.03 ? 137 PHE D CB  1 
ATOM 6503  C CG  . PHE D 1 137 ? -33.766 123.864 18.719  1.00 15.04 ? 137 PHE D CG  1 
ATOM 6504  C CD1 . PHE D 1 137 ? -33.360 124.376 17.491  1.00 16.92 ? 137 PHE D CD1 1 
ATOM 6505  C CD2 . PHE D 1 137 ? -32.887 123.928 19.789  1.00 16.81 ? 137 PHE D CD2 1 
ATOM 6506  C CE1 . PHE D 1 137 ? -32.103 124.937 17.331  1.00 15.98 ? 137 PHE D CE1 1 
ATOM 6507  C CE2 . PHE D 1 137 ? -31.621 124.489 19.641  1.00 12.48 ? 137 PHE D CE2 1 
ATOM 6508  C CZ  . PHE D 1 137 ? -31.229 124.994 18.410  1.00 14.15 ? 137 PHE D CZ  1 
ATOM 6509  N N   . SER D 1 138 ? -38.141 122.500 18.291  1.00 17.98 ? 138 SER D N   1 
ATOM 6510  C CA  . SER D 1 138 ? -39.148 121.591 17.744  1.00 18.43 ? 138 SER D CA  1 
ATOM 6511  C C   . SER D 1 138 ? -40.013 122.366 16.769  1.00 19.26 ? 138 SER D C   1 
ATOM 6512  O O   . SER D 1 138 ? -40.333 121.883 15.684  1.00 19.22 ? 138 SER D O   1 
ATOM 6513  C CB  . SER D 1 138 ? -40.041 121.011 18.849  1.00 13.75 ? 138 SER D CB  1 
ATOM 6514  O OG  . SER D 1 138 ? -39.516 119.806 19.372  1.00 13.59 ? 138 SER D OG  1 
ATOM 6515  N N   . GLN D 1 139 ? -40.363 123.585 17.162  1.00 19.47 ? 139 GLN D N   1 
ATOM 6516  C CA  . GLN D 1 139 ? -41.192 124.458 16.344  1.00 20.74 ? 139 GLN D CA  1 
ATOM 6517  C C   . GLN D 1 139 ? -40.472 124.943 15.095  1.00 20.64 ? 139 GLN D C   1 
ATOM 6518  O O   . GLN D 1 139 ? -40.990 125.780 14.353  1.00 17.18 ? 139 GLN D O   1 
ATOM 6519  C CB  . GLN D 1 139 ? -41.711 125.628 17.173  1.00 22.76 ? 139 GLN D CB  1 
ATOM 6520  C CG  . GLN D 1 139 ? -42.736 125.195 18.201  1.00 24.33 ? 139 GLN D CG  1 
ATOM 6521  C CD  . GLN D 1 139 ? -42.988 126.247 19.248  1.00 23.75 ? 139 GLN D CD  1 
ATOM 6522  O OE1 . GLN D 1 139 ? -42.691 126.049 20.421  1.00 23.17 ? 139 GLN D OE1 1 
ATOM 6523  N NE2 . GLN D 1 139 ? -43.524 127.384 18.830  1.00 20.61 ? 139 GLN D NE2 1 
ATOM 6524  N N   . PHE D 1 140 ? -39.256 124.453 14.889  1.00 18.70 ? 140 PHE D N   1 
ATOM 6525  C CA  . PHE D 1 140 ? -38.513 124.801 13.695  1.00 16.03 ? 140 PHE D CA  1 
ATOM 6526  C C   . PHE D 1 140 ? -38.455 123.533 12.856  1.00 13.77 ? 140 PHE D C   1 
ATOM 6527  O O   . PHE D 1 140 ? -38.700 123.562 11.654  1.00 15.28 ? 140 PHE D O   1 
ATOM 6528  C CB  . PHE D 1 140 ? -37.110 125.283 14.032  1.00 15.98 ? 140 PHE D CB  1 
ATOM 6529  C CG  . PHE D 1 140 ? -36.468 126.050 12.923  1.00 10.67 ? 140 PHE D CG  1 
ATOM 6530  C CD1 . PHE D 1 140 ? -37.093 127.178 12.404  1.00 8.24  ? 140 PHE D CD1 1 
ATOM 6531  C CD2 . PHE D 1 140 ? -35.255 125.645 12.387  1.00 11.18 ? 140 PHE D CD2 1 
ATOM 6532  C CE1 . PHE D 1 140 ? -36.517 127.895 11.364  1.00 10.97 ? 140 PHE D CE1 1 
ATOM 6533  C CE2 . PHE D 1 140 ? -34.665 126.350 11.345  1.00 9.04  ? 140 PHE D CE2 1 
ATOM 6534  C CZ  . PHE D 1 140 ? -35.298 127.481 10.830  1.00 12.87 ? 140 PHE D CZ  1 
ATOM 6535  N N   . LEU D 1 141 ? -38.134 122.416 13.504  1.00 11.59 ? 141 LEU D N   1 
ATOM 6536  C CA  . LEU D 1 141 ? -38.067 121.136 12.815  1.00 11.81 ? 141 LEU D CA  1 
ATOM 6537  C C   . LEU D 1 141 ? -39.504 120.705 12.535  1.00 15.52 ? 141 LEU D C   1 
ATOM 6538  O O   . LEU D 1 141 ? -40.053 120.991 11.467  1.00 13.67 ? 141 LEU D O   1 
ATOM 6539  C CB  . LEU D 1 141 ? -37.356 120.086 13.679  1.00 5.16  ? 141 LEU D CB  1 
ATOM 6540  C CG  . LEU D 1 141 ? -37.086 118.726 13.024  1.00 6.63  ? 141 LEU D CG  1 
ATOM 6541  C CD1 . LEU D 1 141 ? -36.136 118.899 11.845  1.00 2.76  ? 141 LEU D CD1 1 
ATOM 6542  C CD2 . LEU D 1 141 ? -36.503 117.764 14.048  1.00 6.66  ? 141 LEU D CD2 1 
ATOM 6543  N N   . GLY D 1 142 ? -40.130 120.058 13.513  1.00 17.67 ? 142 GLY D N   1 
ATOM 6544  C CA  . GLY D 1 142 ? -41.495 119.608 13.337  1.00 17.95 ? 142 GLY D CA  1 
ATOM 6545  C C   . GLY D 1 142 ? -41.612 118.524 12.287  1.00 18.04 ? 142 GLY D C   1 
ATOM 6546  O O   . GLY D 1 142 ? -41.085 117.429 12.453  1.00 15.12 ? 142 GLY D O   1 
ATOM 6547  N N   . LYS D 1 143 ? -42.273 118.854 11.184  1.00 21.23 ? 143 LYS D N   1 
ATOM 6548  C CA  . LYS D 1 143 ? -42.497 117.906 10.101  1.00 21.76 ? 143 LYS D CA  1 
ATOM 6549  C C   . LYS D 1 143 ? -41.264 117.557 9.271   1.00 21.10 ? 143 LYS D C   1 
ATOM 6550  O O   . LYS D 1 143 ? -41.060 116.394 8.910   1.00 20.23 ? 143 LYS D O   1 
ATOM 6551  C CB  . LYS D 1 143 ? -43.610 118.417 9.180   1.00 21.78 ? 143 LYS D CB  1 
ATOM 6552  C CG  . LYS D 1 143 ? -45.010 118.342 9.775   1.00 24.29 ? 143 LYS D CG  1 
ATOM 6553  C CD  . LYS D 1 143 ? -45.263 119.420 10.809  1.00 24.88 ? 143 LYS D CD  1 
ATOM 6554  C CE  . LYS D 1 143 ? -46.711 119.405 11.257  1.00 25.33 ? 143 LYS D CE  1 
ATOM 6555  N NZ  . LYS D 1 143 ? -47.096 120.623 12.023  1.00 29.83 ? 143 LYS D NZ  1 
ATOM 6556  N N   . ARG D 1 144 ? -40.460 118.566 8.950   1.00 17.63 ? 144 ARG D N   1 
ATOM 6557  C CA  . ARG D 1 144 ? -39.270 118.365 8.135   1.00 17.47 ? 144 ARG D CA  1 
ATOM 6558  C C   . ARG D 1 144 ? -38.273 117.428 8.792   1.00 16.39 ? 144 ARG D C   1 
ATOM 6559  O O   . ARG D 1 144 ? -38.149 117.439 10.010  1.00 15.70 ? 144 ARG D O   1 
ATOM 6560  C CB  . ARG D 1 144 ? -38.605 119.703 7.831   1.00 15.68 ? 144 ARG D CB  1 
ATOM 6561  C CG  . ARG D 1 144 ? -39.470 120.624 7.016   1.00 9.71  ? 144 ARG D CG  1 
ATOM 6562  C CD  . ARG D 1 144 ? -38.868 122.005 6.920   1.00 12.13 ? 144 ARG D CD  1 
ATOM 6563  N NE  . ARG D 1 144 ? -39.866 123.032 7.202   1.00 11.40 ? 144 ARG D NE  1 
ATOM 6564  C CZ  . ARG D 1 144 ? -40.325 123.304 8.422   1.00 9.94  ? 144 ARG D CZ  1 
ATOM 6565  N NH1 . ARG D 1 144 ? -39.867 122.630 9.465   1.00 11.62 ? 144 ARG D NH1 1 
ATOM 6566  N NH2 . ARG D 1 144 ? -41.268 124.222 8.599   1.00 8.30  ? 144 ARG D NH2 1 
ATOM 6567  N N   . PRO D 1 145 ? -37.618 116.575 7.982   1.00 16.01 ? 145 PRO D N   1 
ATOM 6568  C CA  . PRO D 1 145 ? -36.611 115.579 8.378   1.00 16.32 ? 145 PRO D CA  1 
ATOM 6569  C C   . PRO D 1 145 ? -35.300 116.223 8.831   1.00 16.36 ? 145 PRO D C   1 
ATOM 6570  O O   . PRO D 1 145 ? -34.593 115.726 9.722   1.00 14.08 ? 145 PRO D O   1 
ATOM 6571  C CB  . PRO D 1 145 ? -36.407 114.773 7.092   1.00 16.75 ? 145 PRO D CB  1 
ATOM 6572  C CG  . PRO D 1 145 ? -37.715 114.909 6.388   1.00 19.16 ? 145 PRO D CG  1 
ATOM 6573  C CD  . PRO D 1 145 ? -38.011 116.367 6.578   1.00 15.74 ? 145 PRO D CD  1 
ATOM 6574  N N   . TRP D 1 146 ? -34.930 117.297 8.156   1.00 15.96 ? 146 TRP D N   1 
ATOM 6575  C CA  . TRP D 1 146 ? -33.724 118.032 8.481   1.00 14.16 ? 146 TRP D CA  1 
ATOM 6576  C C   . TRP D 1 146 ? -34.210 119.461 8.634   1.00 12.53 ? 146 TRP D C   1 
ATOM 6577  O O   . TRP D 1 146 ? -35.123 119.883 7.931   1.00 9.05  ? 146 TRP D O   1 
ATOM 6578  C CB  . TRP D 1 146 ? -32.711 117.927 7.344   1.00 14.54 ? 146 TRP D CB  1 
ATOM 6579  C CG  . TRP D 1 146 ? -32.381 116.518 6.944   1.00 9.06  ? 146 TRP D CG  1 
ATOM 6580  C CD1 . TRP D 1 146 ? -32.735 115.905 5.785   1.00 8.71  ? 146 TRP D CD1 1 
ATOM 6581  C CD2 . TRP D 1 146 ? -31.628 115.564 7.686   1.00 14.06 ? 146 TRP D CD2 1 
ATOM 6582  N NE1 . TRP D 1 146 ? -32.232 114.634 5.747   1.00 13.40 ? 146 TRP D NE1 1 
ATOM 6583  C CE2 . TRP D 1 146 ? -31.537 114.395 6.898   1.00 13.24 ? 146 TRP D CE2 1 
ATOM 6584  C CE3 . TRP D 1 146 ? -30.975 115.582 8.934   1.00 17.05 ? 146 TRP D CE3 1 
ATOM 6585  C CZ2 . TRP D 1 146 ? -30.847 113.253 7.320   1.00 8.81  ? 146 TRP D CZ2 1 
ATOM 6586  C CZ3 . TRP D 1 146 ? -30.285 114.440 9.354   1.00 9.04  ? 146 TRP D CZ3 1 
ATOM 6587  C CH2 . TRP D 1 146 ? -30.230 113.294 8.545   1.00 8.18  ? 146 TRP D CH2 1 
ATOM 6588  N N   . PHE D 1 147 ? -33.600 120.210 9.541   1.00 11.81 ? 147 PHE D N   1 
ATOM 6589  C CA  . PHE D 1 147 ? -34.019 121.587 9.792   1.00 13.44 ? 147 PHE D CA  1 
ATOM 6590  C C   . PHE D 1 147 ? -34.269 122.492 8.588   1.00 13.79 ? 147 PHE D C   1 
ATOM 6591  O O   . PHE D 1 147 ? -34.981 123.488 8.699   1.00 17.83 ? 147 PHE D O   1 
ATOM 6592  C CB  . PHE D 1 147 ? -33.084 122.263 10.799  1.00 9.16  ? 147 PHE D CB  1 
ATOM 6593  C CG  . PHE D 1 147 ? -33.352 121.865 12.221  1.00 3.91  ? 147 PHE D CG  1 
ATOM 6594  C CD1 . PHE D 1 147 ? -32.990 120.604 12.683  1.00 2.00  ? 147 PHE D CD1 1 
ATOM 6595  C CD2 . PHE D 1 147 ? -34.003 122.734 13.088  1.00 4.86  ? 147 PHE D CD2 1 
ATOM 6596  C CE1 . PHE D 1 147 ? -33.276 120.212 13.989  1.00 2.00  ? 147 PHE D CE1 1 
ATOM 6597  C CE2 . PHE D 1 147 ? -34.294 122.354 14.388  1.00 2.00  ? 147 PHE D CE2 1 
ATOM 6598  C CZ  . PHE D 1 147 ? -33.930 121.090 14.841  1.00 2.00  ? 147 PHE D CZ  1 
ATOM 6599  N N   . VAL D 1 148 ? -33.704 122.149 7.438   1.00 12.23 ? 148 VAL D N   1 
ATOM 6600  C CA  . VAL D 1 148 ? -33.914 122.966 6.252   1.00 12.18 ? 148 VAL D CA  1 
ATOM 6601  C C   . VAL D 1 148 ? -35.027 122.400 5.355   1.00 12.35 ? 148 VAL D C   1 
ATOM 6602  O O   . VAL D 1 148 ? -35.604 123.125 4.547   1.00 8.82  ? 148 VAL D O   1 
ATOM 6603  C CB  . VAL D 1 148 ? -32.601 123.138 5.456   1.00 13.95 ? 148 VAL D CB  1 
ATOM 6604  C CG1 . VAL D 1 148 ? -32.306 121.909 4.632   1.00 13.21 ? 148 VAL D CG1 1 
ATOM 6605  C CG2 . VAL D 1 148 ? -32.668 124.374 4.594   1.00 11.51 ? 148 VAL D CG2 1 
ATOM 6606  N N   . GLY D 1 149 ? -35.319 121.107 5.498   1.00 14.84 ? 149 GLY D N   1 
ATOM 6607  C CA  . GLY D 1 149 ? -36.357 120.470 4.701   1.00 15.43 ? 149 GLY D CA  1 
ATOM 6608  C C   . GLY D 1 149 ? -36.110 118.979 4.569   1.00 16.03 ? 149 GLY D C   1 
ATOM 6609  O O   . GLY D 1 149 ? -35.741 118.322 5.536   1.00 13.83 ? 149 GLY D O   1 
ATOM 6610  N N   . ASP D 1 150 ? -36.361 118.435 3.381   1.00 16.62 ? 150 ASP D N   1 
ATOM 6611  C CA  . ASP D 1 150 ? -36.125 117.012 3.109   1.00 17.75 ? 150 ASP D CA  1 
ATOM 6612  C C   . ASP D 1 150 ? -34.658 116.872 2.710   1.00 17.00 ? 150 ASP D C   1 
ATOM 6613  O O   . ASP D 1 150 ? -34.171 115.769 2.453   1.00 15.06 ? 150 ASP D O   1 
ATOM 6614  C CB  . ASP D 1 150 ? -36.997 116.510 1.944   1.00 18.39 ? 150 ASP D CB  1 
ATOM 6615  C CG  . ASP D 1 150 ? -38.471 116.366 2.315   1.00 18.65 ? 150 ASP D CG  1 
ATOM 6616  O OD1 . ASP D 1 150 ? -38.801 115.507 3.159   1.00 20.44 ? 150 ASP D OD1 1 
ATOM 6617  O OD2 . ASP D 1 150 ? -39.311 117.087 1.733   1.00 21.23 ? 150 ASP D OD2 1 
ATOM 6618  N N   . LYS D 1 151 ? -33.977 118.014 2.640   1.00 14.75 ? 151 LYS D N   1 
ATOM 6619  C CA  . LYS D 1 151 ? -32.577 118.091 2.246   1.00 14.22 ? 151 LYS D CA  1 
ATOM 6620  C C   . LYS D 1 151 ? -31.683 118.352 3.452   1.00 14.68 ? 151 LYS D C   1 
ATOM 6621  O O   . LYS D 1 151 ? -32.068 119.063 4.382   1.00 13.73 ? 151 LYS D O   1 
ATOM 6622  C CB  . LYS D 1 151 ? -32.418 119.222 1.227   1.00 16.05 ? 151 LYS D CB  1 
ATOM 6623  C CG  . LYS D 1 151 ? -31.112 119.240 0.480   1.00 18.55 ? 151 LYS D CG  1 
ATOM 6624  C CD  . LYS D 1 151 ? -31.095 120.360 -0.534  1.00 18.22 ? 151 LYS D CD  1 
ATOM 6625  C CE  . LYS D 1 151 ? -29.857 120.293 -1.406  1.00 22.06 ? 151 LYS D CE  1 
ATOM 6626  N NZ  . LYS D 1 151 ? -29.815 119.044 -2.229  1.00 18.90 ? 151 LYS D NZ  1 
ATOM 6627  N N   . ILE D 1 152 ? -30.493 117.763 3.437   1.00 14.28 ? 152 ILE D N   1 
ATOM 6628  C CA  . ILE D 1 152 ? -29.541 117.949 4.522   1.00 11.77 ? 152 ILE D CA  1 
ATOM 6629  C C   . ILE D 1 152 ? -28.600 119.118 4.214   1.00 11.61 ? 152 ILE D C   1 
ATOM 6630  O O   . ILE D 1 152 ? -28.031 119.212 3.120   1.00 10.39 ? 152 ILE D O   1 
ATOM 6631  C CB  . ILE D 1 152 ? -28.734 116.660 4.811   1.00 8.70  ? 152 ILE D CB  1 
ATOM 6632  C CG1 . ILE D 1 152 ? -27.760 116.897 5.965   1.00 6.79  ? 152 ILE D CG1 1 
ATOM 6633  C CG2 . ILE D 1 152 ? -28.007 116.184 3.563   1.00 11.18 ? 152 ILE D CG2 1 
ATOM 6634  C CD1 . ILE D 1 152 ? -26.969 115.677 6.336   1.00 12.65 ? 152 ILE D CD1 1 
ATOM 6635  N N   . THR D 1 153 ? -28.476 120.019 5.180   1.00 11.57 ? 153 THR D N   1 
ATOM 6636  C CA  . THR D 1 153 ? -27.632 121.203 5.073   1.00 10.93 ? 153 THR D CA  1 
ATOM 6637  C C   . THR D 1 153 ? -26.619 121.163 6.194   1.00 10.24 ? 153 THR D C   1 
ATOM 6638  O O   . THR D 1 153 ? -26.851 120.486 7.209   1.00 9.73  ? 153 THR D O   1 
ATOM 6639  C CB  . THR D 1 153 ? -28.482 122.466 5.211   1.00 11.72 ? 153 THR D CB  1 
ATOM 6640  O OG1 . THR D 1 153 ? -29.464 122.268 6.238   1.00 8.54  ? 153 THR D OG1 1 
ATOM 6641  C CG2 . THR D 1 153 ? -29.182 122.754 3.913   1.00 10.20 ? 153 THR D CG2 1 
ATOM 6642  N N   . PHE D 1 154 ? -25.523 121.905 6.098   1.00 8.19  ? 154 PHE D N   1 
ATOM 6643  C CA  . PHE D 1 154 ? -24.520 121.895 7.156   1.00 10.41 ? 154 PHE D CA  1 
ATOM 6644  C C   . PHE D 1 154 ? -25.075 122.225 8.538   1.00 11.03 ? 154 PHE D C   1 
ATOM 6645  O O   . PHE D 1 154 ? -24.517 121.799 9.545   1.00 14.53 ? 154 PHE D O   1 
ATOM 6646  C CB  . PHE D 1 154 ? -23.350 122.813 6.820   1.00 5.13  ? 154 PHE D CB  1 
ATOM 6647  C CG  . PHE D 1 154 ? -23.703 124.250 6.783   1.00 2.70  ? 154 PHE D CG  1 
ATOM 6648  C CD1 . PHE D 1 154 ? -23.591 125.052 7.922   1.00 2.00  ? 154 PHE D CD1 1 
ATOM 6649  C CD2 . PHE D 1 154 ? -24.107 124.860 5.597   1.00 7.51  ? 154 PHE D CD2 1 
ATOM 6650  C CE1 . PHE D 1 154 ? -23.872 126.417 7.878   1.00 2.85  ? 154 PHE D CE1 1 
ATOM 6651  C CE2 . PHE D 1 154 ? -24.390 126.220 5.538   1.00 5.56  ? 154 PHE D CE2 1 
ATOM 6652  C CZ  . PHE D 1 154 ? -24.272 127.002 6.681   1.00 6.61  ? 154 PHE D CZ  1 
ATOM 6653  N N   . VAL D 1 155 ? -26.170 122.955 8.592   1.00 8.36  ? 155 VAL D N   1 
ATOM 6654  C CA  . VAL D 1 155 ? -26.796 123.300 9.873   1.00 10.09 ? 155 VAL D CA  1 
ATOM 6655  C C   . VAL D 1 155 ? -27.340 122.081 10.617  1.00 11.00 ? 155 VAL D C   1 
ATOM 6656  O O   . VAL D 1 155 ? -27.594 122.149 11.814  1.00 13.50 ? 155 VAL D O   1 
ATOM 6657  C CB  . VAL D 1 155 ? -27.910 124.356 9.740   1.00 14.55 ? 155 VAL D CB  1 
ATOM 6658  C CG1 . VAL D 1 155 ? -27.330 125.661 9.248   1.00 13.51 ? 155 VAL D CG1 1 
ATOM 6659  C CG2 . VAL D 1 155 ? -29.017 123.859 8.826   1.00 13.83 ? 155 VAL D CG2 1 
ATOM 6660  N N   . ASP D 1 156 ? -27.524 120.967 9.915   1.00 9.51  ? 156 ASP D N   1 
ATOM 6661  C CA  . ASP D 1 156 ? -28.003 119.745 10.557  1.00 13.61 ? 156 ASP D CA  1 
ATOM 6662  C C   . ASP D 1 156 ? -26.902 119.191 11.465  1.00 14.39 ? 156 ASP D C   1 
ATOM 6663  O O   . ASP D 1 156 ? -27.180 118.527 12.473  1.00 14.88 ? 156 ASP D O   1 
ATOM 6664  C CB  . ASP D 1 156 ? -28.421 118.694 9.514   1.00 15.64 ? 156 ASP D CB  1 
ATOM 6665  C CG  . ASP D 1 156 ? -29.787 118.987 8.899   1.00 14.73 ? 156 ASP D CG  1 
ATOM 6666  O OD1 . ASP D 1 156 ? -30.789 119.005 9.648   1.00 17.57 ? 156 ASP D OD1 1 
ATOM 6667  O OD2 . ASP D 1 156 ? -29.862 119.193 7.668   1.00 17.63 ? 156 ASP D OD2 1 
ATOM 6668  N N   . PHE D 1 157 ? -25.653 119.489 11.112  1.00 14.18 ? 157 PHE D N   1 
ATOM 6669  C CA  . PHE D 1 157 ? -24.500 119.046 11.892  1.00 12.86 ? 157 PHE D CA  1 
ATOM 6670  C C   . PHE D 1 157 ? -24.365 119.876 13.178  1.00 10.50 ? 157 PHE D C   1 
ATOM 6671  O O   . PHE D 1 157 ? -24.077 119.335 14.243  1.00 8.65  ? 157 PHE D O   1 
ATOM 6672  C CB  . PHE D 1 157 ? -23.227 119.112 11.039  1.00 13.19 ? 157 PHE D CB  1 
ATOM 6673  C CG  . PHE D 1 157 ? -23.191 118.100 9.917   1.00 14.28 ? 157 PHE D CG  1 
ATOM 6674  C CD1 . PHE D 1 157 ? -24.008 118.242 8.801   1.00 17.39 ? 157 PHE D CD1 1 
ATOM 6675  C CD2 . PHE D 1 157 ? -22.356 116.989 9.989   1.00 14.92 ? 157 PHE D CD2 1 
ATOM 6676  C CE1 . PHE D 1 157 ? -23.993 117.288 7.775   1.00 17.99 ? 157 PHE D CE1 1 
ATOM 6677  C CE2 . PHE D 1 157 ? -22.336 116.034 8.969   1.00 14.15 ? 157 PHE D CE2 1 
ATOM 6678  C CZ  . PHE D 1 157 ? -23.156 116.186 7.865   1.00 13.65 ? 157 PHE D CZ  1 
ATOM 6679  N N   . LEU D 1 158 ? -24.608 121.182 13.088  1.00 7.09  ? 158 LEU D N   1 
ATOM 6680  C CA  . LEU D 1 158 ? -24.556 122.096 14.213  1.00 9.29  ? 158 LEU D CA  1 
ATOM 6681  C C   . LEU D 1 158 ? -25.682 121.791 15.192  1.00 11.37 ? 158 LEU D C   1 
ATOM 6682  O O   . LEU D 1 158 ? -25.508 121.892 16.403  1.00 10.55 ? 158 LEU D O   1 
ATOM 6683  C CB  . LEU D 1 158 ? -24.702 123.552 13.757  1.00 7.73  ? 158 LEU D CB  1 
ATOM 6684  C CG  . LEU D 1 158 ? -23.505 124.310 13.188  1.00 7.43  ? 158 LEU D CG  1 
ATOM 6685  C CD1 . LEU D 1 158 ? -23.964 125.638 12.583  1.00 6.71  ? 158 LEU D CD1 1 
ATOM 6686  C CD2 . LEU D 1 158 ? -22.487 124.541 14.294  1.00 2.00  ? 158 LEU D CD2 1 
ATOM 6687  N N   . ALA D 1 159 ? -26.848 121.451 14.656  1.00 11.71 ? 159 ALA D N   1 
ATOM 6688  C CA  . ALA D 1 159 ? -28.013 121.134 15.472  1.00 10.66 ? 159 ALA D CA  1 
ATOM 6689  C C   . ALA D 1 159 ? -27.808 119.841 16.249  1.00 10.81 ? 159 ALA D C   1 
ATOM 6690  O O   . ALA D 1 159 ? -28.192 119.749 17.409  1.00 8.76  ? 159 ALA D O   1 
ATOM 6691  C CB  . ALA D 1 159 ? -29.249 121.037 14.605  1.00 10.05 ? 159 ALA D CB  1 
ATOM 6692  N N   . TYR D 1 160 ? -27.216 118.842 15.601  1.00 11.41 ? 160 TYR D N   1 
ATOM 6693  C CA  . TYR D 1 160 ? -26.931 117.561 16.242  1.00 11.44 ? 160 TYR D CA  1 
ATOM 6694  C C   . TYR D 1 160 ? -26.016 117.795 17.437  1.00 11.95 ? 160 TYR D C   1 
ATOM 6695  O O   . TYR D 1 160 ? -26.236 117.257 18.520  1.00 12.09 ? 160 TYR D O   1 
ATOM 6696  C CB  . TYR D 1 160 ? -26.225 116.629 15.264  1.00 8.11  ? 160 TYR D CB  1 
ATOM 6697  C CG  . TYR D 1 160 ? -25.691 115.384 15.913  1.00 11.81 ? 160 TYR D CG  1 
ATOM 6698  C CD1 . TYR D 1 160 ? -26.559 114.435 16.471  1.00 12.21 ? 160 TYR D CD1 1 
ATOM 6699  C CD2 . TYR D 1 160 ? -24.321 115.101 15.943  1.00 11.31 ? 160 TYR D CD2 1 
ATOM 6700  C CE1 . TYR D 1 160 ? -26.080 113.254 17.039  1.00 12.88 ? 160 TYR D CE1 1 
ATOM 6701  C CE2 . TYR D 1 160 ? -23.815 113.920 16.510  1.00 11.30 ? 160 TYR D CE2 1 
ATOM 6702  C CZ  . TYR D 1 160 ? -24.719 113.003 17.053  1.00 11.50 ? 160 TYR D CZ  1 
ATOM 6703  O OH  . TYR D 1 160 ? -24.259 111.831 17.601  1.00 13.64 ? 160 TYR D OH  1 
ATOM 6704  N N   . ASP D 1 161 ? -24.963 118.567 17.202  1.00 11.81 ? 161 ASP D N   1 
ATOM 6705  C CA  . ASP D 1 161 ? -23.973 118.937 18.190  1.00 14.22 ? 161 ASP D CA  1 
ATOM 6706  C C   . ASP D 1 161 ? -24.715 119.567 19.371  1.00 14.76 ? 161 ASP D C   1 
ATOM 6707  O O   . ASP D 1 161 ? -24.712 119.025 20.471  1.00 12.36 ? 161 ASP D O   1 
ATOM 6708  C CB  . ASP D 1 161 ? -23.004 119.952 17.561  1.00 15.36 ? 161 ASP D CB  1 
ATOM 6709  C CG  . ASP D 1 161 ? -21.689 120.079 18.315  1.00 18.11 ? 161 ASP D CG  1 
ATOM 6710  O OD1 . ASP D 1 161 ? -20.949 119.077 18.406  1.00 18.33 ? 161 ASP D OD1 1 
ATOM 6711  O OD2 . ASP D 1 161 ? -21.375 121.198 18.779  1.00 15.93 ? 161 ASP D OD2 1 
ATOM 6712  N N   . VAL D 1 162 ? -25.408 120.673 19.108  1.00 15.26 ? 162 VAL D N   1 
ATOM 6713  C CA  . VAL D 1 162 ? -26.161 121.411 20.121  1.00 16.10 ? 162 VAL D CA  1 
ATOM 6714  C C   . VAL D 1 162 ? -27.140 120.538 20.906  1.00 19.17 ? 162 VAL D C   1 
ATOM 6715  O O   . VAL D 1 162 ? -27.214 120.616 22.139  1.00 20.15 ? 162 VAL D O   1 
ATOM 6716  C CB  . VAL D 1 162 ? -26.945 122.574 19.481  1.00 17.56 ? 162 VAL D CB  1 
ATOM 6717  C CG1 . VAL D 1 162 ? -27.662 123.369 20.546  1.00 18.90 ? 162 VAL D CG1 1 
ATOM 6718  C CG2 . VAL D 1 162 ? -26.008 123.468 18.703  1.00 21.83 ? 162 VAL D CG2 1 
ATOM 6719  N N   . LEU D 1 163 ? -27.892 119.713 20.190  1.00 20.37 ? 163 LEU D N   1 
ATOM 6720  C CA  . LEU D 1 163 ? -28.870 118.829 20.813  1.00 19.02 ? 163 LEU D CA  1 
ATOM 6721  C C   . LEU D 1 163 ? -28.172 117.797 21.697  1.00 18.49 ? 163 LEU D C   1 
ATOM 6722  O O   . LEU D 1 163 ? -28.593 117.548 22.826  1.00 20.15 ? 163 LEU D O   1 
ATOM 6723  C CB  . LEU D 1 163 ? -29.725 118.137 19.741  1.00 18.23 ? 163 LEU D CB  1 
ATOM 6724  C CG  . LEU D 1 163 ? -30.600 119.040 18.857  1.00 19.57 ? 163 LEU D CG  1 
ATOM 6725  C CD1 . LEU D 1 163 ? -31.166 118.248 17.702  1.00 13.72 ? 163 LEU D CD1 1 
ATOM 6726  C CD2 . LEU D 1 163 ? -31.719 119.677 19.657  1.00 18.25 ? 163 LEU D CD2 1 
ATOM 6727  N N   . ASP D 1 164 ? -27.072 117.246 21.197  1.00 17.67 ? 164 ASP D N   1 
ATOM 6728  C CA  . ASP D 1 164 ? -26.302 116.251 21.932  1.00 14.67 ? 164 ASP D CA  1 
ATOM 6729  C C   . ASP D 1 164 ? -25.737 116.828 23.224  1.00 11.76 ? 164 ASP D C   1 
ATOM 6730  O O   . ASP D 1 164 ? -25.793 116.179 24.271  1.00 8.52  ? 164 ASP D O   1 
ATOM 6731  C CB  . ASP D 1 164 ? -25.173 115.713 21.058  1.00 11.51 ? 164 ASP D CB  1 
ATOM 6732  C CG  . ASP D 1 164 ? -24.380 114.628 21.739  1.00 11.90 ? 164 ASP D CG  1 
ATOM 6733  O OD1 . ASP D 1 164 ? -24.933 113.525 21.944  1.00 12.69 ? 164 ASP D OD1 1 
ATOM 6734  O OD2 . ASP D 1 164 ? -23.199 114.877 22.058  1.00 12.94 ? 164 ASP D OD2 1 
ATOM 6735  N N   . LEU D 1 165 ? -25.213 118.052 23.153  1.00 12.95 ? 165 LEU D N   1 
ATOM 6736  C CA  . LEU D 1 165 ? -24.644 118.720 24.320  1.00 14.22 ? 165 LEU D CA  1 
ATOM 6737  C C   . LEU D 1 165 ? -25.667 118.891 25.433  1.00 14.58 ? 165 LEU D C   1 
ATOM 6738  O O   . LEU D 1 165 ? -25.371 118.654 26.605  1.00 16.79 ? 165 LEU D O   1 
ATOM 6739  C CB  . LEU D 1 165 ? -24.085 120.083 23.940  1.00 6.73  ? 165 LEU D CB  1 
ATOM 6740  C CG  . LEU D 1 165 ? -22.836 120.053 23.066  1.00 2.00  ? 165 LEU D CG  1 
ATOM 6741  C CD1 . LEU D 1 165 ? -22.389 121.476 22.765  1.00 6.20  ? 165 LEU D CD1 1 
ATOM 6742  C CD2 . LEU D 1 165 ? -21.742 119.294 23.779  1.00 2.00  ? 165 LEU D CD2 1 
ATOM 6743  N N   . HIS D 1 166 ? -26.879 119.276 25.066  1.00 15.37 ? 166 HIS D N   1 
ATOM 6744  C CA  . HIS D 1 166 ? -27.927 119.403 26.059  1.00 17.09 ? 166 HIS D CA  1 
ATOM 6745  C C   . HIS D 1 166 ? -28.490 118.047 26.475  1.00 19.40 ? 166 HIS D C   1 
ATOM 6746  O O   . HIS D 1 166 ? -29.049 117.922 27.560  1.00 19.30 ? 166 HIS D O   1 
ATOM 6747  C CB  . HIS D 1 166 ? -29.028 120.333 25.560  1.00 14.79 ? 166 HIS D CB  1 
ATOM 6748  C CG  . HIS D 1 166 ? -28.647 121.781 25.602  1.00 9.52  ? 166 HIS D CG  1 
ATOM 6749  N ND1 . HIS D 1 166 ? -27.957 122.399 24.583  1.00 12.78 ? 166 HIS D ND1 1 
ATOM 6750  C CD2 . HIS D 1 166 ? -28.847 122.728 26.548  1.00 10.14 ? 166 HIS D CD2 1 
ATOM 6751  C CE1 . HIS D 1 166 ? -27.747 123.665 24.899  1.00 11.33 ? 166 HIS D CE1 1 
ATOM 6752  N NE2 . HIS D 1 166 ? -28.278 123.888 26.086  1.00 7.83  ? 166 HIS D NE2 1 
ATOM 6753  N N   . ARG D 1 167 ? -28.307 117.033 25.630  1.00 21.81 ? 167 ARG D N   1 
ATOM 6754  C CA  . ARG D 1 167 ? -28.779 115.679 25.923  1.00 19.79 ? 167 ARG D CA  1 
ATOM 6755  C C   . ARG D 1 167 ? -27.894 115.015 26.985  1.00 18.33 ? 167 ARG D C   1 
ATOM 6756  O O   . ARG D 1 167 ? -28.348 114.140 27.723  1.00 18.98 ? 167 ARG D O   1 
ATOM 6757  C CB  . ARG D 1 167 ? -28.834 114.838 24.635  1.00 19.44 ? 167 ARG D CB  1 
ATOM 6758  C CG  . ARG D 1 167 ? -27.894 113.633 24.567  1.00 12.22 ? 167 ARG D CG  1 
ATOM 6759  C CD  . ARG D 1 167 ? -27.709 113.096 23.166  1.00 12.35 ? 167 ARG D CD  1 
ATOM 6760  N NE  . ARG D 1 167 ? -28.800 112.234 22.716  1.00 11.21 ? 167 ARG D NE  1 
ATOM 6761  C CZ  . ARG D 1 167 ? -28.630 111.050 22.125  1.00 11.11 ? 167 ARG D CZ  1 
ATOM 6762  N NH1 . ARG D 1 167 ? -27.409 110.560 21.908  1.00 6.49  ? 167 ARG D NH1 1 
ATOM 6763  N NH2 . ARG D 1 167 ? -29.682 110.337 21.741  1.00 7.34  ? 167 ARG D NH2 1 
ATOM 6764  N N   . ILE D 1 168 ? -26.625 115.408 27.026  1.00 17.79 ? 168 ILE D N   1 
ATOM 6765  C CA  . ILE D 1 168 ? -25.681 114.882 28.006  1.00 19.30 ? 168 ILE D CA  1 
ATOM 6766  C C   . ILE D 1 168 ? -25.859 115.629 29.331  1.00 21.63 ? 168 ILE D C   1 
ATOM 6767  O O   . ILE D 1 168 ? -25.905 115.018 30.402  1.00 21.32 ? 168 ILE D O   1 
ATOM 6768  C CB  . ILE D 1 168 ? -24.215 115.012 27.500  1.00 17.42 ? 168 ILE D CB  1 
ATOM 6769  C CG1 . ILE D 1 168 ? -23.806 113.756 26.734  1.00 13.85 ? 168 ILE D CG1 1 
ATOM 6770  C CG2 . ILE D 1 168 ? -23.246 115.225 28.652  1.00 21.06 ? 168 ILE D CG2 1 
ATOM 6771  C CD1 . ILE D 1 168 ? -24.558 113.532 25.458  1.00 20.21 ? 168 ILE D CD1 1 
ATOM 6772  N N   . PHE D 1 169 ? -25.969 116.952 29.236  1.00 22.34 ? 169 PHE D N   1 
ATOM 6773  C CA  . PHE D 1 169 ? -26.135 117.817 30.402  1.00 23.51 ? 169 PHE D CA  1 
ATOM 6774  C C   . PHE D 1 169 ? -27.492 117.621 31.064  1.00 24.63 ? 169 PHE D C   1 
ATOM 6775  O O   . PHE D 1 169 ? -27.594 117.570 32.289  1.00 24.03 ? 169 PHE D O   1 
ATOM 6776  C CB  . PHE D 1 169 ? -25.965 119.281 29.995  1.00 21.12 ? 169 PHE D CB  1 
ATOM 6777  C CG  . PHE D 1 169 ? -25.689 120.207 31.146  1.00 23.10 ? 169 PHE D CG  1 
ATOM 6778  C CD1 . PHE D 1 169 ? -24.955 119.778 32.248  1.00 22.24 ? 169 PHE D CD1 1 
ATOM 6779  C CD2 . PHE D 1 169 ? -26.133 121.521 31.111  1.00 23.46 ? 169 PHE D CD2 1 
ATOM 6780  C CE1 . PHE D 1 169 ? -24.662 120.642 33.293  1.00 23.81 ? 169 PHE D CE1 1 
ATOM 6781  C CE2 . PHE D 1 169 ? -25.847 122.398 32.153  1.00 24.40 ? 169 PHE D CE2 1 
ATOM 6782  C CZ  . PHE D 1 169 ? -25.107 121.957 33.246  1.00 25.18 ? 169 PHE D CZ  1 
ATOM 6783  N N   . GLU D 1 170 ? -28.532 117.543 30.245  1.00 26.70 ? 170 GLU D N   1 
ATOM 6784  C CA  . GLU D 1 170 ? -29.889 117.342 30.728  1.00 27.17 ? 170 GLU D CA  1 
ATOM 6785  C C   . GLU D 1 170 ? -30.517 116.281 29.835  1.00 28.77 ? 170 GLU D C   1 
ATOM 6786  O O   . GLU D 1 170 ? -31.199 116.601 28.825  1.00 31.27 ? 170 GLU D O   1 
ATOM 6787  C CB  . GLU D 1 170 ? -30.680 118.650 30.654  1.00 26.98 ? 170 GLU D CB  1 
ATOM 6788  C CG  . GLU D 1 170 ? -32.026 118.623 31.372  1.00 29.97 ? 170 GLU D CG  1 
ATOM 6789  C CD  . GLU D 1 170 ? -31.881 118.597 32.880  1.00 32.49 ? 170 GLU D CD  1 
ATOM 6790  O OE1 . GLU D 1 170 ? -31.186 119.482 33.431  1.00 32.77 ? 170 GLU D OE1 1 
ATOM 6791  O OE2 . GLU D 1 170 ? -32.469 117.697 33.515  1.00 31.30 ? 170 GLU D OE2 1 
ATOM 6792  N N   . PRO D 1 171 ? -30.353 114.997 30.188  1.00 27.12 ? 171 PRO D N   1 
ATOM 6793  C CA  . PRO D 1 171 ? -30.885 113.841 29.456  1.00 27.42 ? 171 PRO D CA  1 
ATOM 6794  C C   . PRO D 1 171 ? -32.408 113.710 29.391  1.00 27.23 ? 171 PRO D C   1 
ATOM 6795  O O   . PRO D 1 171 ? -32.938 112.602 29.392  1.00 26.07 ? 171 PRO D O   1 
ATOM 6796  C CB  . PRO D 1 171 ? -30.250 112.665 30.190  1.00 28.72 ? 171 PRO D CB  1 
ATOM 6797  C CG  . PRO D 1 171 ? -30.144 113.175 31.590  1.00 28.25 ? 171 PRO D CG  1 
ATOM 6798  C CD  . PRO D 1 171 ? -29.597 114.552 31.371  1.00 25.61 ? 171 PRO D CD  1 
ATOM 6799  N N   . ASN D 1 172 ? -33.111 114.836 29.338  1.00 25.62 ? 172 ASN D N   1 
ATOM 6800  C CA  . ASN D 1 172 ? -34.563 114.815 29.248  1.00 25.58 ? 172 ASN D CA  1 
ATOM 6801  C C   . ASN D 1 172 ? -35.137 115.993 28.468  1.00 22.56 ? 172 ASN D C   1 
ATOM 6802  O O   . ASN D 1 172 ? -36.347 116.056 28.267  1.00 25.55 ? 172 ASN D O   1 
ATOM 6803  C CB  . ASN D 1 172 ? -35.227 114.674 30.633  1.00 26.69 ? 172 ASN D CB  1 
ATOM 6804  C CG  . ASN D 1 172 ? -35.183 115.954 31.454  1.00 24.59 ? 172 ASN D CG  1 
ATOM 6805  O OD1 . ASN D 1 172 ? -35.576 117.017 30.993  1.00 20.91 ? 172 ASN D OD1 1 
ATOM 6806  N ND2 . ASN D 1 172 ? -34.728 115.847 32.693  1.00 21.19 ? 172 ASN D ND2 1 
ATOM 6807  N N   . CYS D 1 173 ? -34.276 116.897 27.995  1.00 19.71 ? 173 CYS D N   1 
ATOM 6808  C CA  . CYS D 1 173 ? -34.740 118.048 27.203  1.00 21.25 ? 173 CYS D CA  1 
ATOM 6809  C C   . CYS D 1 173 ? -35.432 117.491 25.959  1.00 21.45 ? 173 CYS D C   1 
ATOM 6810  O O   . CYS D 1 173 ? -36.563 117.856 25.631  1.00 21.73 ? 173 CYS D O   1 
ATOM 6811  C CB  . CYS D 1 173 ? -33.574 118.927 26.708  1.00 18.84 ? 173 CYS D CB  1 
ATOM 6812  S SG  . CYS D 1 173 ? -32.238 119.325 27.828  1.00 18.95 ? 173 CYS D SG  1 
ATOM 6813  N N   . LEU D 1 174 ? -34.708 116.596 25.271  1.00 21.44 ? 174 LEU D N   1 
ATOM 6814  C CA  . LEU D 1 174 ? -35.173 115.960 24.053  1.00 18.99 ? 174 LEU D CA  1 
ATOM 6815  C C   . LEU D 1 174 ? -36.336 115.019 24.328  1.00 19.07 ? 174 LEU D C   1 
ATOM 6816  O O   . LEU D 1 174 ? -37.238 114.867 23.508  1.00 20.06 ? 174 LEU D O   1 
ATOM 6817  C CB  . LEU D 1 174 ? -34.025 115.178 23.415  1.00 18.35 ? 174 LEU D CB  1 
ATOM 6818  C CG  . LEU D 1 174 ? -33.060 115.947 22.509  1.00 16.50 ? 174 LEU D CG  1 
ATOM 6819  C CD1 . LEU D 1 174 ? -32.650 117.267 23.132  1.00 18.51 ? 174 LEU D CD1 1 
ATOM 6820  C CD2 . LEU D 1 174 ? -31.843 115.091 22.211  1.00 18.13 ? 174 LEU D CD2 1 
ATOM 6821  N N   . ASP D 1 175 ? -36.307 114.402 25.501  1.00 20.42 ? 175 ASP D N   1 
ATOM 6822  C CA  . ASP D 1 175 ? -37.341 113.469 25.923  1.00 22.72 ? 175 ASP D CA  1 
ATOM 6823  C C   . ASP D 1 175 ? -38.742 114.078 25.805  1.00 23.99 ? 175 ASP D C   1 
ATOM 6824  O O   . ASP D 1 175 ? -39.662 113.442 25.290  1.00 25.74 ? 175 ASP D O   1 
ATOM 6825  C CB  . ASP D 1 175 ? -37.067 113.033 27.368  1.00 21.90 ? 175 ASP D CB  1 
ATOM 6826  C CG  . ASP D 1 175 ? -37.685 111.692 27.707  1.00 21.78 ? 175 ASP D CG  1 
ATOM 6827  O OD1 . ASP D 1 175 ? -37.216 110.662 27.174  1.00 25.90 ? 175 ASP D OD1 1 
ATOM 6828  O OD2 . ASP D 1 175 ? -38.636 111.665 28.517  1.00 23.41 ? 175 ASP D OD2 1 
ATOM 6829  N N   . ALA D 1 176 ? -38.889 115.320 26.254  1.00 25.94 ? 176 ALA D N   1 
ATOM 6830  C CA  . ALA D 1 176 ? -40.175 116.009 26.210  1.00 26.07 ? 176 ALA D CA  1 
ATOM 6831  C C   . ALA D 1 176 ? -40.629 116.423 24.807  1.00 24.55 ? 176 ALA D C   1 
ATOM 6832  O O   . ALA D 1 176 ? -41.787 116.803 24.611  1.00 27.16 ? 176 ALA D O   1 
ATOM 6833  C CB  . ALA D 1 176 ? -40.148 117.215 27.133  1.00 26.57 ? 176 ALA D CB  1 
ATOM 6834  N N   . PHE D 1 177 ? -39.726 116.350 23.835  1.00 22.50 ? 177 PHE D N   1 
ATOM 6835  C CA  . PHE D 1 177 ? -40.051 116.722 22.462  1.00 19.41 ? 177 PHE D CA  1 
ATOM 6836  C C   . PHE D 1 177 ? -39.583 115.617 21.543  1.00 18.65 ? 177 PHE D C   1 
ATOM 6837  O O   . PHE D 1 177 ? -38.588 115.778 20.816  1.00 16.14 ? 177 PHE D O   1 
ATOM 6838  C CB  . PHE D 1 177 ? -39.349 118.026 22.087  1.00 17.88 ? 177 PHE D CB  1 
ATOM 6839  C CG  . PHE D 1 177 ? -39.512 119.118 23.101  1.00 14.87 ? 177 PHE D CG  1 
ATOM 6840  C CD1 . PHE D 1 177 ? -40.678 119.874 23.151  1.00 12.14 ? 177 PHE D CD1 1 
ATOM 6841  C CD2 . PHE D 1 177 ? -38.495 119.395 24.006  1.00 17.18 ? 177 PHE D CD2 1 
ATOM 6842  C CE1 . PHE D 1 177 ? -40.827 120.896 24.093  1.00 18.06 ? 177 PHE D CE1 1 
ATOM 6843  C CE2 . PHE D 1 177 ? -38.632 120.412 24.950  1.00 18.86 ? 177 PHE D CE2 1 
ATOM 6844  C CZ  . PHE D 1 177 ? -39.801 121.165 24.995  1.00 18.31 ? 177 PHE D CZ  1 
ATOM 6845  N N   . PRO D 1 178 ? -40.352 114.516 21.447  1.00 19.90 ? 178 PRO D N   1 
ATOM 6846  C CA  . PRO D 1 178 ? -40.077 113.334 20.615  1.00 18.50 ? 178 PRO D CA  1 
ATOM 6847  C C   . PRO D 1 178 ? -39.592 113.680 19.214  1.00 15.76 ? 178 PRO D C   1 
ATOM 6848  O O   . PRO D 1 178 ? -38.719 113.021 18.656  1.00 17.61 ? 178 PRO D O   1 
ATOM 6849  C CB  . PRO D 1 178 ? -41.430 112.630 20.577  1.00 17.70 ? 178 PRO D CB  1 
ATOM 6850  C CG  . PRO D 1 178 ? -42.007 112.949 21.913  1.00 18.46 ? 178 PRO D CG  1 
ATOM 6851  C CD  . PRO D 1 178 ? -41.694 114.419 22.053  1.00 19.09 ? 178 PRO D CD  1 
ATOM 6852  N N   . ASN D 1 179 ? -40.174 114.734 18.664  1.00 13.69 ? 179 ASN D N   1 
ATOM 6853  C CA  . ASN D 1 179 ? -39.853 115.233 17.336  1.00 10.09 ? 179 ASN D CA  1 
ATOM 6854  C C   . ASN D 1 179 ? -38.334 115.440 17.141  1.00 10.21 ? 179 ASN D C   1 
ATOM 6855  O O   . ASN D 1 179 ? -37.780 115.096 16.093  1.00 12.63 ? 179 ASN D O   1 
ATOM 6856  C CB  . ASN D 1 179 ? -40.676 116.511 17.103  1.00 8.64  ? 179 ASN D CB  1 
ATOM 6857  C CG  . ASN D 1 179 ? -39.987 117.512 16.219  1.00 2.00  ? 179 ASN D CG  1 
ATOM 6858  O OD1 . ASN D 1 179 ? -39.854 117.313 15.016  1.00 2.00  ? 179 ASN D OD1 1 
ATOM 6859  N ND2 . ASN D 1 179 ? -39.570 118.618 16.811  1.00 4.79  ? 179 ASN D ND2 1 
ATOM 6860  N N   . LEU D 1 180 ? -37.659 115.936 18.178  1.00 13.03 ? 180 LEU D N   1 
ATOM 6861  C CA  . LEU D 1 180 ? -36.215 116.164 18.128  1.00 14.35 ? 180 LEU D CA  1 
ATOM 6862  C C   . LEU D 1 180 ? -35.437 114.862 18.331  1.00 14.07 ? 180 LEU D C   1 
ATOM 6863  O O   . LEU D 1 180 ? -34.395 114.647 17.710  1.00 14.33 ? 180 LEU D O   1 
ATOM 6864  C CB  . LEU D 1 180 ? -35.801 117.164 19.205  1.00 13.64 ? 180 LEU D CB  1 
ATOM 6865  C CG  . LEU D 1 180 ? -36.381 118.571 19.128  1.00 13.99 ? 180 LEU D CG  1 
ATOM 6866  C CD1 . LEU D 1 180 ? -35.896 119.371 20.327  1.00 9.45  ? 180 LEU D CD1 1 
ATOM 6867  C CD2 . LEU D 1 180 ? -35.968 119.241 17.827  1.00 19.55 ? 180 LEU D CD2 1 
ATOM 6868  N N   . LYS D 1 181 ? -35.955 114.005 19.208  1.00 17.30 ? 181 LYS D N   1 
ATOM 6869  C CA  . LYS D 1 181 ? -35.339 112.721 19.529  1.00 16.09 ? 181 LYS D CA  1 
ATOM 6870  C C   . LYS D 1 181 ? -34.970 111.934 18.286  1.00 18.21 ? 181 LYS D C   1 
ATOM 6871  O O   . LYS D 1 181 ? -33.871 111.397 18.186  1.00 19.89 ? 181 LYS D O   1 
ATOM 6872  C CB  . LYS D 1 181 ? -36.286 111.883 20.387  1.00 15.45 ? 181 LYS D CB  1 
ATOM 6873  C CG  . LYS D 1 181 ? -36.429 112.359 21.819  1.00 19.21 ? 181 LYS D CG  1 
ATOM 6874  C CD  . LYS D 1 181 ? -35.463 111.633 22.744  1.00 17.93 ? 181 LYS D CD  1 
ATOM 6875  C CE  . LYS D 1 181 ? -35.905 110.197 23.032  1.00 16.75 ? 181 LYS D CE  1 
ATOM 6876  N NZ  . LYS D 1 181 ? -37.103 110.141 23.916  1.00 8.64  ? 181 LYS D NZ  1 
ATOM 6877  N N   . ASP D 1 182 ? -35.887 111.886 17.330  1.00 17.53 ? 182 ASP D N   1 
ATOM 6878  C CA  . ASP D 1 182 ? -35.654 111.156 16.096  1.00 18.26 ? 182 ASP D CA  1 
ATOM 6879  C C   . ASP D 1 182 ? -34.663 111.847 15.162  1.00 17.53 ? 182 ASP D C   1 
ATOM 6880  O O   . ASP D 1 182 ? -34.035 111.191 14.331  1.00 15.19 ? 182 ASP D O   1 
ATOM 6881  C CB  . ASP D 1 182 ? -36.980 110.879 15.406  1.00 16.04 ? 182 ASP D CB  1 
ATOM 6882  C CG  . ASP D 1 182 ? -37.955 110.170 16.319  1.00 14.85 ? 182 ASP D CG  1 
ATOM 6883  O OD1 . ASP D 1 182 ? -37.679 109.016 16.721  1.00 15.46 ? 182 ASP D OD1 1 
ATOM 6884  O OD2 . ASP D 1 182 ? -38.983 110.784 16.659  1.00 15.59 ? 182 ASP D OD2 1 
ATOM 6885  N N   . PHE D 1 183 ? -34.489 113.157 15.331  1.00 17.83 ? 183 PHE D N   1 
ATOM 6886  C CA  . PHE D 1 183 ? -33.552 113.927 14.513  1.00 17.21 ? 183 PHE D CA  1 
ATOM 6887  C C   . PHE D 1 183 ? -32.139 113.415 14.748  1.00 19.53 ? 183 PHE D C   1 
ATOM 6888  O O   . PHE D 1 183 ? -31.344 113.304 13.814  1.00 23.20 ? 183 PHE D O   1 
ATOM 6889  C CB  . PHE D 1 183 ? -33.625 115.413 14.860  1.00 20.96 ? 183 PHE D CB  1 
ATOM 6890  C CG  . PHE D 1 183 ? -32.626 116.258 14.121  1.00 19.05 ? 183 PHE D CG  1 
ATOM 6891  C CD1 . PHE D 1 183 ? -32.881 116.693 12.823  1.00 18.67 ? 183 PHE D CD1 1 
ATOM 6892  C CD2 . PHE D 1 183 ? -31.431 116.625 14.724  1.00 14.57 ? 183 PHE D CD2 1 
ATOM 6893  C CE1 . PHE D 1 183 ? -31.962 117.480 12.139  1.00 14.58 ? 183 PHE D CE1 1 
ATOM 6894  C CE2 . PHE D 1 183 ? -30.506 117.409 14.051  1.00 13.05 ? 183 PHE D CE2 1 
ATOM 6895  C CZ  . PHE D 1 183 ? -30.770 117.838 12.756  1.00 12.81 ? 183 PHE D CZ  1 
ATOM 6896  N N   . ILE D 1 184 ? -31.824 113.131 16.008  1.00 21.76 ? 184 ILE D N   1 
ATOM 6897  C CA  . ILE D 1 184 ? -30.511 112.598 16.372  1.00 17.06 ? 184 ILE D CA  1 
ATOM 6898  C C   . ILE D 1 184 ? -30.454 111.129 15.940  1.00 14.21 ? 184 ILE D C   1 
ATOM 6899  O O   . ILE D 1 184 ? -29.406 110.634 15.521  1.00 14.96 ? 184 ILE D O   1 
ATOM 6900  C CB  . ILE D 1 184 ? -30.234 112.689 17.908  1.00 15.44 ? 184 ILE D CB  1 
ATOM 6901  C CG1 . ILE D 1 184 ? -30.272 114.140 18.393  1.00 9.71  ? 184 ILE D CG1 1 
ATOM 6902  C CG2 . ILE D 1 184 ? -28.873 112.090 18.240  1.00 14.79 ? 184 ILE D CG2 1 
ATOM 6903  C CD1 . ILE D 1 184 ? -31.624 114.587 18.856  1.00 9.85  ? 184 ILE D CD1 1 
ATOM 6904  N N   . SER D 1 185 ? -31.593 110.447 16.038  1.00 15.00 ? 185 SER D N   1 
ATOM 6905  C CA  . SER D 1 185 ? -31.693 109.048 15.658  1.00 13.13 ? 185 SER D CA  1 
ATOM 6906  C C   . SER D 1 185 ? -31.361 108.866 14.180  1.00 14.58 ? 185 SER D C   1 
ATOM 6907  O O   . SER D 1 185 ? -30.665 107.915 13.814  1.00 11.36 ? 185 SER D O   1 
ATOM 6908  C CB  . SER D 1 185 ? -33.097 108.522 15.943  1.00 10.17 ? 185 SER D CB  1 
ATOM 6909  O OG  . SER D 1 185 ? -33.542 108.925 17.225  1.00 4.57  ? 185 SER D OG  1 
ATOM 6910  N N   . ARG D 1 186 ? -31.862 109.772 13.340  1.00 17.87 ? 186 ARG D N   1 
ATOM 6911  C CA  . ARG D 1 186 ? -31.609 109.722 11.904  1.00 17.54 ? 186 ARG D CA  1 
ATOM 6912  C C   . ARG D 1 186 ? -30.137 109.983 11.646  1.00 15.10 ? 186 ARG D C   1 
ATOM 6913  O O   . ARG D 1 186 ? -29.488 109.264 10.889  1.00 15.11 ? 186 ARG D O   1 
ATOM 6914  C CB  . ARG D 1 186 ? -32.455 110.760 11.152  1.00 15.68 ? 186 ARG D CB  1 
ATOM 6915  C CG  . ARG D 1 186 ? -33.801 110.234 10.652  1.00 16.99 ? 186 ARG D CG  1 
ATOM 6916  C CD  . ARG D 1 186 ? -34.483 111.203 9.681   1.00 13.75 ? 186 ARG D CD  1 
ATOM 6917  N NE  . ARG D 1 186 ? -34.858 112.478 10.294  1.00 14.92 ? 186 ARG D NE  1 
ATOM 6918  C CZ  . ARG D 1 186 ? -35.854 112.635 11.164  1.00 10.34 ? 186 ARG D CZ  1 
ATOM 6919  N NH1 . ARG D 1 186 ? -36.593 111.604 11.545  1.00 10.12 ? 186 ARG D NH1 1 
ATOM 6920  N NH2 . ARG D 1 186 ? -36.123 113.834 11.650  1.00 5.03  ? 186 ARG D NH2 1 
ATOM 6921  N N   . PHE D 1 187 ? -29.600 110.996 12.310  1.00 13.38 ? 187 PHE D N   1 
ATOM 6922  C CA  . PHE D 1 187 ? -28.199 111.341 12.143  1.00 15.44 ? 187 PHE D CA  1 
ATOM 6923  C C   . PHE D 1 187 ? -27.303 110.128 12.434  1.00 16.90 ? 187 PHE D C   1 
ATOM 6924  O O   . PHE D 1 187 ? -26.482 109.738 11.604  1.00 17.63 ? 187 PHE D O   1 
ATOM 6925  C CB  . PHE D 1 187 ? -27.834 112.525 13.043  1.00 14.49 ? 187 PHE D CB  1 
ATOM 6926  C CG  . PHE D 1 187 ? -26.808 113.441 12.443  1.00 12.27 ? 187 PHE D CG  1 
ATOM 6927  C CD1 . PHE D 1 187 ? -27.198 114.490 11.619  1.00 10.97 ? 187 PHE D CD1 1 
ATOM 6928  C CD2 . PHE D 1 187 ? -25.451 113.243 12.679  1.00 10.35 ? 187 PHE D CD2 1 
ATOM 6929  C CE1 . PHE D 1 187 ? -26.258 115.326 11.035  1.00 9.21  ? 187 PHE D CE1 1 
ATOM 6930  C CE2 . PHE D 1 187 ? -24.505 114.072 12.101  1.00 8.34  ? 187 PHE D CE2 1 
ATOM 6931  C CZ  . PHE D 1 187 ? -24.909 115.117 11.276  1.00 8.18  ? 187 PHE D CZ  1 
ATOM 6932  N N   . GLU D 1 188 ? -27.531 109.488 13.577  1.00 19.53 ? 188 GLU D N   1 
ATOM 6933  C CA  . GLU D 1 188 ? -26.762 108.317 14.001  1.00 19.62 ? 188 GLU D CA  1 
ATOM 6934  C C   . GLU D 1 188 ? -26.932 107.065 13.133  1.00 20.98 ? 188 GLU D C   1 
ATOM 6935  O O   . GLU D 1 188 ? -26.319 106.008 13.411  1.00 18.55 ? 188 GLU D O   1 
ATOM 6936  C CB  . GLU D 1 188 ? -27.103 107.959 15.447  1.00 22.71 ? 188 GLU D CB  1 
ATOM 6937  C CG  . GLU D 1 188 ? -26.616 108.952 16.474  1.00 25.74 ? 188 GLU D CG  1 
ATOM 6938  C CD  . GLU D 1 188 ? -26.602 108.373 17.871  1.00 27.24 ? 188 GLU D CD  1 
ATOM 6939  O OE1 . GLU D 1 188 ? -26.063 107.257 18.044  1.00 24.67 ? 188 GLU D OE1 1 
ATOM 6940  O OE2 . GLU D 1 188 ? -27.130 109.028 18.793  1.00 32.58 ? 188 GLU D OE2 1 
ATOM 6941  N N   . GLY D 1 189 ? -27.797 107.149 12.128  1.00 20.46 ? 189 GLY D N   1 
ATOM 6942  C CA  . GLY D 1 189 ? -28.018 106.022 11.243  1.00 17.78 ? 189 GLY D CA  1 
ATOM 6943  C C   . GLY D 1 189 ? -27.327 106.217 9.907   1.00 16.01 ? 189 GLY D C   1 
ATOM 6944  O O   . GLY D 1 189 ? -27.110 105.249 9.170   1.00 15.96 ? 189 GLY D O   1 
ATOM 6945  N N   . LEU D 1 190 ? -26.956 107.464 9.608   1.00 15.21 ? 190 LEU D N   1 
ATOM 6946  C CA  . LEU D 1 190 ? -26.296 107.798 8.351   1.00 14.93 ? 190 LEU D CA  1 
ATOM 6947  C C   . LEU D 1 190 ? -24.989 107.045 8.171   1.00 14.60 ? 190 LEU D C   1 
ATOM 6948  O O   . LEU D 1 190 ? -24.045 107.276 8.895   1.00 11.61 ? 190 LEU D O   1 
ATOM 6949  C CB  . LEU D 1 190 ? -26.059 109.301 8.250   1.00 15.24 ? 190 LEU D CB  1 
ATOM 6950  C CG  . LEU D 1 190 ? -27.339 110.135 8.315   1.00 12.45 ? 190 LEU D CG  1 
ATOM 6951  C CD1 . LEU D 1 190 ? -27.033 111.599 8.032   1.00 12.41 ? 190 LEU D CD1 1 
ATOM 6952  C CD2 . LEU D 1 190 ? -28.351 109.597 7.315   1.00 13.89 ? 190 LEU D CD2 1 
ATOM 6953  N N   . GLU D 1 191 ? -24.959 106.182 7.162   1.00 16.91 ? 191 GLU D N   1 
ATOM 6954  C CA  . GLU D 1 191 ? -23.808 105.340 6.839   1.00 19.34 ? 191 GLU D CA  1 
ATOM 6955  C C   . GLU D 1 191 ? -22.427 105.960 7.072   1.00 18.23 ? 191 GLU D C   1 
ATOM 6956  O O   . GLU D 1 191 ? -21.685 105.514 7.947   1.00 17.09 ? 191 GLU D O   1 
ATOM 6957  C CB  . GLU D 1 191 ? -23.922 104.834 5.398   1.00 18.99 ? 191 GLU D CB  1 
ATOM 6958  C CG  . GLU D 1 191 ? -22.908 103.753 5.037   1.00 22.55 ? 191 GLU D CG  1 
ATOM 6959  C CD  . GLU D 1 191 ? -23.129 103.151 3.657   1.00 29.78 ? 191 GLU D CD  1 
ATOM 6960  O OE1 . GLU D 1 191 ? -23.776 103.802 2.806   1.00 28.89 ? 191 GLU D OE1 1 
ATOM 6961  O OE2 . GLU D 1 191 ? -22.650 102.020 3.421   1.00 33.61 ? 191 GLU D OE2 1 
ATOM 6962  N N   . LYS D 1 192 ? -22.088 106.974 6.304   1.00 17.37 ? 192 LYS D N   1 
ATOM 6963  C CA  . LYS D 1 192 ? -20.786 107.647 6.441   1.00 20.08 ? 192 LYS D CA  1 
ATOM 6964  C C   . LYS D 1 192 ? -20.546 108.348 7.792   1.00 20.51 ? 192 LYS D C   1 
ATOM 6965  O O   . LYS D 1 192 ? -19.483 108.926 8.026   1.00 22.83 ? 192 LYS D O   1 
ATOM 6966  C CB  . LYS D 1 192 ? -20.527 108.614 5.266   1.00 22.66 ? 192 LYS D CB  1 
ATOM 6967  C CG  . LYS D 1 192 ? -21.640 109.618 4.986   1.00 23.50 ? 192 LYS D CG  1 
ATOM 6968  C CD  . LYS D 1 192 ? -22.392 109.297 3.693   1.00 22.69 ? 192 LYS D CD  1 
ATOM 6969  C CE  . LYS D 1 192 ? -21.857 110.083 2.500   1.00 21.44 ? 192 LYS D CE  1 
ATOM 6970  N NZ  . LYS D 1 192 ? -20.483 109.691 2.095   1.00 17.66 ? 192 LYS D NZ  1 
ATOM 6971  N N   . ILE D 1 193 ? -21.533 108.303 8.677   1.00 21.44 ? 193 ILE D N   1 
ATOM 6972  C CA  . ILE D 1 193 ? -21.419 108.887 9.995   1.00 19.84 ? 193 ILE D CA  1 
ATOM 6973  C C   . ILE D 1 193 ? -21.333 107.810 11.065  1.00 20.72 ? 193 ILE D C   1 
ATOM 6974  O O   . ILE D 1 193 ? -20.502 107.905 11.966  1.00 23.86 ? 193 ILE D O   1 
ATOM 6975  C CB  . ILE D 1 193 ? -22.580 109.847 10.269  1.00 17.98 ? 193 ILE D CB  1 
ATOM 6976  C CG1 . ILE D 1 193 ? -22.353 111.138 9.482   1.00 15.13 ? 193 ILE D CG1 1 
ATOM 6977  C CG2 . ILE D 1 193 ? -22.715 110.118 11.758  1.00 16.56 ? 193 ILE D CG2 1 
ATOM 6978  C CD1 . ILE D 1 193 ? -23.421 112.174 9.661   1.00 15.43 ? 193 ILE D CD1 1 
ATOM 6979  N N   . SER D 1 194 ? -22.151 106.765 10.936  1.00 22.06 ? 194 SER D N   1 
ATOM 6980  C CA  . SER D 1 194 ? -22.156 105.648 11.886  1.00 23.22 ? 194 SER D CA  1 
ATOM 6981  C C   . SER D 1 194 ? -20.768 105.012 11.979  1.00 25.56 ? 194 SER D C   1 
ATOM 6982  O O   . SER D 1 194 ? -20.312 104.651 13.065  1.00 25.72 ? 194 SER D O   1 
ATOM 6983  C CB  . SER D 1 194 ? -23.164 104.573 11.458  1.00 21.24 ? 194 SER D CB  1 
ATOM 6984  O OG  . SER D 1 194 ? -24.461 105.107 11.263  1.00 18.20 ? 194 SER D OG  1 
ATOM 6985  N N   . ALA D 1 195 ? -20.108 104.879 10.831  1.00 26.24 ? 195 ALA D N   1 
ATOM 6986  C CA  . ALA D 1 195 ? -18.774 104.293 10.764  1.00 28.83 ? 195 ALA D CA  1 
ATOM 6987  C C   . ALA D 1 195 ? -17.762 105.146 11.522  1.00 29.51 ? 195 ALA D C   1 
ATOM 6988  O O   . ALA D 1 195 ? -16.914 104.618 12.247  1.00 30.70 ? 195 ALA D O   1 
ATOM 6989  C CB  . ALA D 1 195 ? -18.344 104.129 9.313   1.00 29.32 ? 195 ALA D CB  1 
ATOM 6990  N N   . TYR D 1 196 ? -17.859 106.466 11.358  1.00 28.98 ? 196 TYR D N   1 
ATOM 6991  C CA  . TYR D 1 196 ? -16.957 107.395 12.036  1.00 28.97 ? 196 TYR D CA  1 
ATOM 6992  C C   . TYR D 1 196 ? -17.172 107.317 13.544  1.00 28.58 ? 196 TYR D C   1 
ATOM 6993  O O   . TYR D 1 196 ? -16.217 107.323 14.317  1.00 28.80 ? 196 TYR D O   1 
ATOM 6994  C CB  . TYR D 1 196 ? -17.186 108.831 11.557  1.00 28.93 ? 196 TYR D CB  1 
ATOM 6995  C CG  . TYR D 1 196 ? -16.427 109.859 12.360  1.00 27.12 ? 196 TYR D CG  1 
ATOM 6996  C CD1 . TYR D 1 196 ? -15.040 109.794 12.480  1.00 27.22 ? 196 TYR D CD1 1 
ATOM 6997  C CD2 . TYR D 1 196 ? -17.097 110.880 13.030  1.00 28.34 ? 196 TYR D CD2 1 
ATOM 6998  C CE1 . TYR D 1 196 ? -14.335 110.723 13.254  1.00 26.75 ? 196 TYR D CE1 1 
ATOM 6999  C CE2 . TYR D 1 196 ? -16.401 111.814 13.810  1.00 26.77 ? 196 TYR D CE2 1 
ATOM 7000  C CZ  . TYR D 1 196 ? -15.023 111.727 13.919  1.00 24.69 ? 196 TYR D CZ  1 
ATOM 7001  O OH  . TYR D 1 196 ? -14.344 112.616 14.720  1.00 26.71 ? 196 TYR D OH  1 
ATOM 7002  N N   . MET D 1 197 ? -18.430 107.232 13.957  1.00 25.79 ? 197 MET D N   1 
ATOM 7003  C CA  . MET D 1 197 ? -18.753 107.146 15.370  1.00 25.61 ? 197 MET D CA  1 
ATOM 7004  C C   . MET D 1 197 ? -18.260 105.850 16.008  1.00 25.75 ? 197 MET D C   1 
ATOM 7005  O O   . MET D 1 197 ? -18.111 105.772 17.226  1.00 26.42 ? 197 MET D O   1 
ATOM 7006  C CB  . MET D 1 197 ? -20.250 107.357 15.584  1.00 24.25 ? 197 MET D CB  1 
ATOM 7007  C CG  . MET D 1 197 ? -20.685 108.757 15.192  1.00 20.37 ? 197 MET D CG  1 
ATOM 7008  S SD  . MET D 1 197 ? -22.400 109.087 15.479  1.00 16.56 ? 197 MET D SD  1 
ATOM 7009  C CE  . MET D 1 197 ? -22.370 109.666 17.160  1.00 10.72 ? 197 MET D CE  1 
ATOM 7010  N N   . LYS D 1 198 ? -17.988 104.841 15.187  1.00 24.81 ? 198 LYS D N   1 
ATOM 7011  C CA  . LYS D 1 198 ? -17.474 103.576 15.690  1.00 25.63 ? 198 LYS D CA  1 
ATOM 7012  C C   . LYS D 1 198 ? -16.059 103.365 15.191  1.00 26.46 ? 198 LYS D C   1 
ATOM 7013  O O   . LYS D 1 198 ? -15.679 102.257 14.818  1.00 27.08 ? 198 LYS D O   1 
ATOM 7014  C CB  . LYS D 1 198 ? -18.359 102.406 15.263  1.00 27.75 ? 198 LYS D CB  1 
ATOM 7015  C CG  . LYS D 1 198 ? -19.748 102.438 15.858  1.00 31.60 ? 198 LYS D CG  1 
ATOM 7016  C CD  . LYS D 1 198 ? -19.697 102.673 17.360  1.00 32.23 ? 198 LYS D CD  1 
ATOM 7017  C CE  . LYS D 1 198 ? -21.079 103.004 17.893  1.00 30.04 ? 198 LYS D CE  1 
ATOM 7018  N NZ  . LYS D 1 198 ? -21.035 103.498 19.297  1.00 28.26 ? 198 LYS D NZ  1 
ATOM 7019  N N   . SER D 1 199 ? -15.285 104.440 15.140  1.00 24.73 ? 199 SER D N   1 
ATOM 7020  C CA  . SER D 1 199 ? -13.912 104.333 14.689  1.00 23.21 ? 199 SER D CA  1 
ATOM 7021  C C   . SER D 1 199 ? -12.982 104.865 15.770  1.00 24.94 ? 199 SER D C   1 
ATOM 7022  O O   . SER D 1 199 ? -13.434 105.383 16.795  1.00 24.21 ? 199 SER D O   1 
ATOM 7023  C CB  . SER D 1 199 ? -13.701 105.075 13.361  1.00 22.41 ? 199 SER D CB  1 
ATOM 7024  O OG  . SER D 1 199 ? -13.567 106.475 13.542  1.00 19.21 ? 199 SER D OG  1 
ATOM 7025  N N   . SER D 1 200 ? -11.683 104.729 15.531  1.00 26.08 ? 200 SER D N   1 
ATOM 7026  C CA  . SER D 1 200 ? -10.661 105.171 16.465  1.00 24.44 ? 200 SER D CA  1 
ATOM 7027  C C   . SER D 1 200 ? -10.387 106.662 16.368  1.00 21.66 ? 200 SER D C   1 
ATOM 7028  O O   . SER D 1 200 ? -9.673  107.220 17.195  1.00 21.45 ? 200 SER D O   1 
ATOM 7029  C CB  . SER D 1 200 ? -9.371  104.394 16.208  1.00 26.27 ? 200 SER D CB  1 
ATOM 7030  O OG  . SER D 1 200 ? -9.072  104.355 14.822  1.00 27.48 ? 200 SER D OG  1 
ATOM 7031  N N   . ARG D 1 201 ? -10.960 107.307 15.360  1.00 22.71 ? 201 ARG D N   1 
ATOM 7032  C CA  . ARG D 1 201 ? -10.746 108.734 15.153  1.00 25.03 ? 201 ARG D CA  1 
ATOM 7033  C C   . ARG D 1 201 ? -11.843 109.592 15.771  1.00 22.09 ? 201 ARG D C   1 
ATOM 7034  O O   . ARG D 1 201 ? -11.760 110.822 15.771  1.00 19.76 ? 201 ARG D O   1 
ATOM 7035  C CB  . ARG D 1 201 ? -10.634 109.020 13.652  1.00 25.24 ? 201 ARG D CB  1 
ATOM 7036  C CG  . ARG D 1 201 ? -9.749  108.016 12.913  1.00 25.45 ? 201 ARG D CG  1 
ATOM 7037  C CD  . ARG D 1 201 ? -10.556 107.106 11.986  1.00 27.88 ? 201 ARG D CD  1 
ATOM 7038  N NE  . ARG D 1 201 ? -10.840 107.755 10.708  1.00 28.53 ? 201 ARG D NE  1 
ATOM 7039  C CZ  . ARG D 1 201 ? -12.053 108.076 10.268  1.00 24.86 ? 201 ARG D CZ  1 
ATOM 7040  N NH1 . ARG D 1 201 ? -13.131 107.810 10.993  1.00 25.49 ? 201 ARG D NH1 1 
ATOM 7041  N NH2 . ARG D 1 201 ? -12.183 108.703 9.110   1.00 22.90 ? 201 ARG D NH2 1 
ATOM 7042  N N   . PHE D 1 202 ? -12.855 108.938 16.327  1.00 22.94 ? 202 PHE D N   1 
ATOM 7043  C CA  . PHE D 1 202 ? -13.978 109.643 16.917  1.00 23.70 ? 202 PHE D CA  1 
ATOM 7044  C C   . PHE D 1 202 ? -13.674 110.305 18.251  1.00 25.92 ? 202 PHE D C   1 
ATOM 7045  O O   . PHE D 1 202 ? -13.303 109.639 19.216  1.00 27.41 ? 202 PHE D O   1 
ATOM 7046  C CB  . PHE D 1 202 ? -15.173 108.705 17.077  1.00 22.29 ? 202 PHE D CB  1 
ATOM 7047  C CG  . PHE D 1 202 ? -16.421 109.393 17.563  1.00 24.38 ? 202 PHE D CG  1 
ATOM 7048  C CD1 . PHE D 1 202 ? -16.782 110.661 17.061  1.00 22.31 ? 202 PHE D CD1 1 
ATOM 7049  C CD2 . PHE D 1 202 ? -17.231 108.796 18.522  1.00 24.77 ? 202 PHE D CD2 1 
ATOM 7050  C CE1 . PHE D 1 202 ? -17.929 111.299 17.505  1.00 23.30 ? 202 PHE D CE1 1 
ATOM 7051  C CE2 . PHE D 1 202 ? -18.387 109.435 18.976  1.00 24.60 ? 202 PHE D CE2 1 
ATOM 7052  C CZ  . PHE D 1 202 ? -18.737 110.703 18.464  1.00 23.74 ? 202 PHE D CZ  1 
ATOM 7053  N N   . LEU D 1 203 ? -13.864 111.618 18.306  1.00 25.83 ? 203 LEU D N   1 
ATOM 7054  C CA  . LEU D 1 203 ? -13.640 112.363 19.535  1.00 24.65 ? 203 LEU D CA  1 
ATOM 7055  C C   . LEU D 1 203 ? -14.995 112.706 20.131  1.00 26.36 ? 203 LEU D C   1 
ATOM 7056  O O   . LEU D 1 203 ? -15.745 113.499 19.563  1.00 28.49 ? 203 LEU D O   1 
ATOM 7057  C CB  . LEU D 1 203 ? -12.837 113.636 19.264  1.00 24.91 ? 203 LEU D CB  1 
ATOM 7058  C CG  . LEU D 1 203 ? -11.360 113.425 18.920  1.00 22.94 ? 203 LEU D CG  1 
ATOM 7059  C CD1 . LEU D 1 203 ? -10.709 114.750 18.603  1.00 22.37 ? 203 LEU D CD1 1 
ATOM 7060  C CD2 . LEU D 1 203 ? -10.637 112.737 20.070  1.00 22.38 ? 203 LEU D CD2 1 
ATOM 7061  N N   . PRO D 1 204 ? -15.373 112.019 21.215  1.00 26.97 ? 204 PRO D N   1 
ATOM 7062  C CA  . PRO D 1 204 ? -16.647 112.228 21.912  1.00 24.90 ? 204 PRO D CA  1 
ATOM 7063  C C   . PRO D 1 204 ? -16.479 113.176 23.094  1.00 23.62 ? 204 PRO D C   1 
ATOM 7064  O O   . PRO D 1 204 ? -17.076 114.250 23.131  1.00 23.16 ? 204 PRO D O   1 
ATOM 7065  C CB  . PRO D 1 204 ? -17.009 110.821 22.401  1.00 25.72 ? 204 PRO D CB  1 
ATOM 7066  C CG  . PRO D 1 204 ? -15.976 109.891 21.731  1.00 27.55 ? 204 PRO D CG  1 
ATOM 7067  C CD  . PRO D 1 204 ? -14.770 110.748 21.631  1.00 26.81 ? 204 PRO D CD  1 
ATOM 7068  N N   . LYS D 1 205 ? -15.643 112.768 24.048  1.00 23.05 ? 205 LYS D N   1 
ATOM 7069  C CA  . LYS D 1 205 ? -15.367 113.543 25.256  1.00 23.41 ? 205 LYS D CA  1 
ATOM 7070  C C   . LYS D 1 205 ? -13.903 113.978 25.298  1.00 23.05 ? 205 LYS D C   1 
ATOM 7071  O O   . LYS D 1 205 ? -13.035 113.291 24.756  1.00 21.77 ? 205 LYS D O   1 
ATOM 7072  C CB  . LYS D 1 205 ? -15.660 112.697 26.498  1.00 23.08 ? 205 LYS D CB  1 
ATOM 7073  C CG  . LYS D 1 205 ? -17.096 112.229 26.624  1.00 25.04 ? 205 LYS D CG  1 
ATOM 7074  C CD  . LYS D 1 205 ? -17.322 111.586 27.978  1.00 22.55 ? 205 LYS D CD  1 
ATOM 7075  C CE  . LYS D 1 205 ? -18.800 111.497 28.302  1.00 22.28 ? 205 LYS D CE  1 
ATOM 7076  N NZ  . LYS D 1 205 ? -19.021 111.162 29.737  1.00 18.89 ? 205 LYS D NZ  1 
ATOM 7077  N N   . PRO D 1 206 ? -13.602 115.094 25.983  1.00 23.30 ? 206 PRO D N   1 
ATOM 7078  C CA  . PRO D 1 206 ? -14.516 115.975 26.723  1.00 22.32 ? 206 PRO D CA  1 
ATOM 7079  C C   . PRO D 1 206 ? -15.130 117.076 25.858  1.00 22.79 ? 206 PRO D C   1 
ATOM 7080  O O   . PRO D 1 206 ? -14.604 117.417 24.795  1.00 23.24 ? 206 PRO D O   1 
ATOM 7081  C CB  . PRO D 1 206 ? -13.609 116.571 27.787  1.00 22.93 ? 206 PRO D CB  1 
ATOM 7082  C CG  . PRO D 1 206 ? -12.334 116.745 27.053  1.00 21.47 ? 206 PRO D CG  1 
ATOM 7083  C CD  . PRO D 1 206 ? -12.200 115.451 26.276  1.00 24.98 ? 206 PRO D CD  1 
ATOM 7084  N N   . LEU D 1 207 ? -16.219 117.660 26.352  1.00 21.17 ? 207 LEU D N   1 
ATOM 7085  C CA  . LEU D 1 207 ? -16.920 118.719 25.634  1.00 20.37 ? 207 LEU D CA  1 
ATOM 7086  C C   . LEU D 1 207 ? -16.099 119.990 25.640  1.00 21.28 ? 207 LEU D C   1 
ATOM 7087  O O   . LEU D 1 207 ? -15.764 120.527 24.586  1.00 22.35 ? 207 LEU D O   1 
ATOM 7088  C CB  . LEU D 1 207 ? -18.265 119.031 26.289  1.00 20.04 ? 207 LEU D CB  1 
ATOM 7089  C CG  . LEU D 1 207 ? -19.139 117.891 26.801  1.00 18.44 ? 207 LEU D CG  1 
ATOM 7090  C CD1 . LEU D 1 207 ? -20.456 118.487 27.249  1.00 14.25 ? 207 LEU D CD1 1 
ATOM 7091  C CD2 . LEU D 1 207 ? -19.355 116.834 25.729  1.00 16.25 ? 207 LEU D CD2 1 
ATOM 7092  N N   . TYR D 1 208 ? -15.789 120.463 26.840  1.00 21.78 ? 208 TYR D N   1 
ATOM 7093  C CA  . TYR D 1 208 ? -15.034 121.691 27.004  1.00 19.49 ? 208 TYR D CA  1 
ATOM 7094  C C   . TYR D 1 208 ? -13.587 121.472 27.427  1.00 19.54 ? 208 TYR D C   1 
ATOM 7095  O O   . TYR D 1 208 ? -13.197 120.371 27.821  1.00 18.15 ? 208 TYR D O   1 
ATOM 7096  C CB  . TYR D 1 208 ? -15.758 122.614 27.990  1.00 19.26 ? 208 TYR D CB  1 
ATOM 7097  C CG  . TYR D 1 208 ? -17.120 123.057 27.501  1.00 24.10 ? 208 TYR D CG  1 
ATOM 7098  C CD1 . TYR D 1 208 ? -17.241 124.031 26.510  1.00 24.79 ? 208 TYR D CD1 1 
ATOM 7099  C CD2 . TYR D 1 208 ? -18.287 122.489 28.010  1.00 23.98 ? 208 TYR D CD2 1 
ATOM 7100  C CE1 . TYR D 1 208 ? -18.492 124.430 26.035  1.00 25.72 ? 208 TYR D CE1 1 
ATOM 7101  C CE2 . TYR D 1 208 ? -19.544 122.881 27.543  1.00 21.49 ? 208 TYR D CE2 1 
ATOM 7102  C CZ  . TYR D 1 208 ? -19.638 123.853 26.553  1.00 23.75 ? 208 TYR D CZ  1 
ATOM 7103  O OH  . TYR D 1 208 ? -20.869 124.252 26.074  1.00 27.12 ? 208 TYR D OH  1 
ATOM 7104  N N   . THR D 1 209 ? -12.795 122.534 27.316  1.00 20.57 ? 209 THR D N   1 
ATOM 7105  C CA  . THR D 1 209 ? -11.385 122.508 27.671  1.00 20.57 ? 209 THR D CA  1 
ATOM 7106  C C   . THR D 1 209 ? -11.157 122.166 29.140  1.00 19.84 ? 209 THR D C   1 
ATOM 7107  O O   . THR D 1 209 ? -12.038 122.374 29.974  1.00 19.57 ? 209 THR D O   1 
ATOM 7108  C CB  . THR D 1 209 ? -10.723 123.856 27.348  1.00 20.77 ? 209 THR D CB  1 
ATOM 7109  O OG1 . THR D 1 209 ? -11.563 124.929 27.804  1.00 16.44 ? 209 THR D OG1 1 
ATOM 7110  C CG2 . THR D 1 209 ? -10.496 123.986 25.846  1.00 21.09 ? 209 THR D CG2 1 
ATOM 7111  N N   . ARG D 1 210 ? -9.936  121.775 29.461  1.00 20.62 ? 210 ARG D N   1 
ATOM 7112  C CA  . ARG D 1 210 ? -9.562  121.400 30.824  1.00 21.78 ? 210 ARG D CA  1 
ATOM 7113  C C   . ARG D 1 210 ? -9.736  122.479 31.907  1.00 19.98 ? 210 ARG D C   1 
ATOM 7114  O O   . ARG D 1 210 ? -9.631  122.183 33.093  1.00 18.23 ? 210 ARG D O   1 
ATOM 7115  C CB  . ARG D 1 210 ? -8.121  120.882 30.824  1.00 22.75 ? 210 ARG D CB  1 
ATOM 7116  C CG  . ARG D 1 210 ? -7.849  119.786 31.834  1.00 24.73 ? 210 ARG D CG  1 
ATOM 7117  C CD  . ARG D 1 210 ? -6.579  119.027 31.494  1.00 24.81 ? 210 ARG D CD  1 
ATOM 7118  N NE  . ARG D 1 210 ? -6.660  118.383 30.183  1.00 26.17 ? 210 ARG D NE  1 
ATOM 7119  C CZ  . ARG D 1 210 ? -6.059  117.236 29.867  1.00 28.65 ? 210 ARG D CZ  1 
ATOM 7120  N NH1 . ARG D 1 210 ? -5.324  116.591 30.769  1.00 32.99 ? 210 ARG D NH1 1 
ATOM 7121  N NH2 . ARG D 1 210 ? -6.195  116.732 28.644  1.00 26.31 ? 210 ARG D NH2 1 
ATOM 7122  N N   . VAL D 1 211 ? -10.022 123.715 31.509  1.00 18.47 ? 211 VAL D N   1 
ATOM 7123  C CA  . VAL D 1 211 ? -10.192 124.807 32.472  1.00 15.45 ? 211 VAL D CA  1 
ATOM 7124  C C   . VAL D 1 211 ? -11.655 125.056 32.855  1.00 13.71 ? 211 VAL D C   1 
ATOM 7125  O O   . VAL D 1 211 ? -11.980 126.067 33.471  1.00 11.38 ? 211 VAL D O   1 
ATOM 7126  C CB  . VAL D 1 211 ? -9.583  126.126 31.937  1.00 16.84 ? 211 VAL D CB  1 
ATOM 7127  C CG1 . VAL D 1 211 ? -8.265  125.853 31.243  1.00 16.12 ? 211 VAL D CG1 1 
ATOM 7128  C CG2 . VAL D 1 211 ? -10.541 126.823 30.992  1.00 13.39 ? 211 VAL D CG2 1 
ATOM 7129  N N   . ALA D 1 212 ? -12.532 124.129 32.493  1.00 15.60 ? 212 ALA D N   1 
ATOM 7130  C CA  . ALA D 1 212 ? -13.957 124.267 32.778  1.00 15.86 ? 212 ALA D CA  1 
ATOM 7131  C C   . ALA D 1 212 ? -14.412 123.479 34.001  1.00 13.21 ? 212 ALA D C   1 
ATOM 7132  O O   . ALA D 1 212 ? -13.989 122.344 34.216  1.00 6.98  ? 212 ALA D O   1 
ATOM 7133  C CB  . ALA D 1 212 ? -14.765 123.850 31.566  1.00 14.79 ? 212 ALA D CB  1 
ATOM 7134  N N   . VAL D 1 213 ? -15.296 124.082 34.789  1.00 13.81 ? 213 VAL D N   1 
ATOM 7135  C CA  . VAL D 1 213 ? -15.822 123.438 35.986  1.00 14.84 ? 213 VAL D CA  1 
ATOM 7136  C C   . VAL D 1 213 ? -16.657 122.204 35.617  1.00 20.34 ? 213 VAL D C   1 
ATOM 7137  O O   . VAL D 1 213 ? -16.712 121.227 36.366  1.00 21.63 ? 213 VAL D O   1 
ATOM 7138  C CB  . VAL D 1 213 ? -16.670 124.442 36.832  1.00 11.09 ? 213 VAL D CB  1 
ATOM 7139  C CG1 . VAL D 1 213 ? -17.786 125.044 35.996  1.00 17.77 ? 213 VAL D CG1 1 
ATOM 7140  C CG2 . VAL D 1 213 ? -17.231 123.770 38.085  1.00 8.31  ? 213 VAL D CG2 1 
ATOM 7141  N N   . TRP D 1 214 ? -17.290 122.246 34.451  1.00 22.70 ? 214 TRP D N   1 
ATOM 7142  C CA  . TRP D 1 214 ? -18.114 121.136 33.995  1.00 23.67 ? 214 TRP D CA  1 
ATOM 7143  C C   . TRP D 1 214 ? -17.716 120.668 32.597  1.00 25.41 ? 214 TRP D C   1 
ATOM 7144  O O   . TRP D 1 214 ? -17.419 121.488 31.726  1.00 25.85 ? 214 TRP D O   1 
ATOM 7145  C CB  . TRP D 1 214 ? -19.595 121.521 34.010  1.00 23.83 ? 214 TRP D CB  1 
ATOM 7146  C CG  . TRP D 1 214 ? -20.476 120.448 33.432  1.00 25.39 ? 214 TRP D CG  1 
ATOM 7147  C CD1 . TRP D 1 214 ? -20.888 119.298 34.050  1.00 25.79 ? 214 TRP D CD1 1 
ATOM 7148  C CD2 . TRP D 1 214 ? -20.995 120.393 32.097  1.00 24.63 ? 214 TRP D CD2 1 
ATOM 7149  N NE1 . TRP D 1 214 ? -21.621 118.530 33.179  1.00 27.21 ? 214 TRP D NE1 1 
ATOM 7150  C CE2 . TRP D 1 214 ? -21.704 119.178 31.975  1.00 25.25 ? 214 TRP D CE2 1 
ATOM 7151  C CE3 . TRP D 1 214 ? -20.929 121.250 30.991  1.00 22.81 ? 214 TRP D CE3 1 
ATOM 7152  C CZ2 . TRP D 1 214 ? -22.337 118.800 30.790  1.00 24.17 ? 214 TRP D CZ2 1 
ATOM 7153  C CZ3 . TRP D 1 214 ? -21.558 120.874 29.818  1.00 22.08 ? 214 TRP D CZ3 1 
ATOM 7154  C CH2 . TRP D 1 214 ? -22.256 119.661 29.727  1.00 23.88 ? 214 TRP D CH2 1 
ATOM 7155  N N   . GLY D 1 215 ? -17.717 119.349 32.398  1.00 26.50 ? 215 GLY D N   1 
ATOM 7156  C CA  . GLY D 1 215 ? -17.364 118.777 31.110  1.00 26.43 ? 215 GLY D CA  1 
ATOM 7157  C C   . GLY D 1 215 ? -15.955 119.082 30.644  1.00 26.56 ? 215 GLY D C   1 
ATOM 7158  O O   . GLY D 1 215 ? -15.738 119.353 29.464  1.00 27.83 ? 215 GLY D O   1 
ATOM 7159  N N   . ASN D 1 216 ? -14.999 119.016 31.566  1.00 27.44 ? 216 ASN D N   1 
ATOM 7160  C CA  . ASN D 1 216 ? -13.596 119.286 31.257  1.00 28.69 ? 216 ASN D CA  1 
ATOM 7161  C C   . ASN D 1 216 ? -12.754 118.032 31.505  1.00 29.89 ? 216 ASN D C   1 
ATOM 7162  O O   . ASN D 1 216 ? -13.039 117.307 32.473  1.00 32.00 ? 216 ASN D O   1 
ATOM 7163  C CB  . ASN D 1 216 ? -13.058 120.419 32.132  1.00 32.03 ? 216 ASN D CB  1 
ATOM 7164  C CG  . ASN D 1 216 ? -12.687 119.956 33.533  1.00 30.91 ? 216 ASN D CG  1 
ATOM 7165  O OD1 . ASN D 1 216 ? -11.511 119.783 33.846  1.00 33.28 ? 216 ASN D OD1 1 
ATOM 7166  N ND2 . ASN D 1 216 ? -13.687 119.761 34.381  1.00 27.86 ? 216 ASN D ND2 1 
ATOM 7167  N N   . LYS D 1 217 ? -11.809 117.780 30.619  1.00 30.83 ? 217 LYS D N   1 
ATOM 7168  C CA  . LYS D 1 217 ? -10.910 116.626 30.690  1.00 30.32 ? 217 LYS D CA  1 
ATOM 7169  C C   . LYS D 1 217 ? -9.744  116.844 29.721  1.00 29.81 ? 217 LYS D C   1 
ATOM 7170  O O   . LYS D 1 217 ? -8.921  115.918 29.566  1.00 30.23 ? 217 LYS D O   1 
ATOM 7171  C CB  . LYS D 1 217 ? -11.639 115.328 30.309  1.00 26.01 ? 217 LYS D CB  1 
ATOM 7172  C CG  . LYS D 1 217 ? -12.581 114.766 31.352  1.00 24.74 ? 217 LYS D CG  1 
ATOM 7173  C CD  . LYS D 1 217 ? -13.593 113.874 30.718  1.00 25.36 ? 217 LYS D CD  1 
ATOM 7174  C CE  . LYS D 1 217 ? -14.713 113.558 31.683  1.00 29.77 ? 217 LYS D CE  1 
ATOM 7175  N NZ  . LYS D 1 217 ? -15.786 112.765 31.023  1.00 29.21 ? 217 LYS D NZ  1 
ATOM 7176  O OXT . LYS D 1 217 ? -9.669  117.937 29.110  1.00 29.68 ? 217 LYS D OXT 1 
ATOM 7177  N N   . SER E 1 1   ? 48.491  66.395  65.425  1.00 7.46  ? 1   SER E N   1 
ATOM 7178  C CA  . SER E 1 1   ? 47.099  65.898  65.571  1.00 13.46 ? 1   SER E CA  1 
ATOM 7179  C C   . SER E 1 1   ? 46.092  67.031  65.769  1.00 15.87 ? 1   SER E C   1 
ATOM 7180  O O   . SER E 1 1   ? 45.739  67.350  66.910  1.00 16.33 ? 1   SER E O   1 
ATOM 7181  C CB  . SER E 1 1   ? 47.024  64.936  66.757  1.00 12.41 ? 1   SER E CB  1 
ATOM 7182  O OG  . SER E 1 1   ? 48.270  64.302  66.939  1.00 16.30 ? 1   SER E OG  1 
ATOM 7183  N N   . MET E 1 2   ? 45.659  67.671  64.683  1.00 17.01 ? 2   MET E N   1 
ATOM 7184  C CA  . MET E 1 2   ? 44.668  68.739  64.817  1.00 16.88 ? 2   MET E CA  1 
ATOM 7185  C C   . MET E 1 2   ? 43.328  68.065  65.089  1.00 17.56 ? 2   MET E C   1 
ATOM 7186  O O   . MET E 1 2   ? 43.139  66.912  64.660  1.00 21.48 ? 2   MET E O   1 
ATOM 7187  C CB  . MET E 1 2   ? 44.564  69.595  63.554  1.00 17.01 ? 2   MET E CB  1 
ATOM 7188  C CG  . MET E 1 2   ? 44.395  68.814  62.275  1.00 12.38 ? 2   MET E CG  1 
ATOM 7189  S SD  . MET E 1 2   ? 45.990  68.376  61.597  1.00 18.05 ? 2   MET E SD  1 
ATOM 7190  C CE  . MET E 1 2   ? 45.997  69.386  60.129  1.00 10.89 ? 2   MET E CE  1 
ATOM 7191  N N   . THR E 1 3   ? 42.447  68.712  65.801  1.00 18.04 ? 3   THR E N   1 
ATOM 7192  C CA  . THR E 1 3   ? 41.190  68.071  66.102  1.00 19.13 ? 3   THR E CA  1 
ATOM 7193  C C   . THR E 1 3   ? 40.042  68.526  65.230  1.00 17.50 ? 3   THR E C   1 
ATOM 7194  O O   . THR E 1 3   ? 39.928  69.697  64.865  1.00 18.94 ? 3   THR E O   1 
ATOM 7195  C CB  . THR E 1 3   ? 40.836  68.164  67.610  1.00 21.40 ? 3   THR E CB  1 
ATOM 7196  O OG1 . THR E 1 3   ? 39.646  67.415  67.881  1.00 22.06 ? 3   THR E OG1 1 
ATOM 7197  C CG2 . THR E 1 3   ? 40.633  69.573  68.032  1.00 23.36 ? 3   THR E CG2 1 
ATOM 7198  N N   . LEU E 1 4   ? 39.256  67.541  64.828  1.00 14.12 ? 4   LEU E N   1 
ATOM 7199  C CA  . LEU E 1 4   ? 38.076  67.731  64.011  1.00 11.87 ? 4   LEU E CA  1 
ATOM 7200  C C   . LEU E 1 4   ? 36.987  67.892  65.071  1.00 11.12 ? 4   LEU E C   1 
ATOM 7201  O O   . LEU E 1 4   ? 37.076  67.249  66.127  1.00 9.68  ? 4   LEU E O   1 
ATOM 7202  C CB  . LEU E 1 4   ? 37.853  66.460  63.174  1.00 13.59 ? 4   LEU E CB  1 
ATOM 7203  C CG  . LEU E 1 4   ? 37.041  66.438  61.872  1.00 11.47 ? 4   LEU E CG  1 
ATOM 7204  C CD1 . LEU E 1 4   ? 35.562  66.692  62.134  1.00 6.95  ? 4   LEU E CD1 1 
ATOM 7205  C CD2 . LEU E 1 4   ? 37.618  67.456  60.897  1.00 11.69 ? 4   LEU E CD2 1 
ATOM 7206  N N   . GLY E 1 5   ? 36.001  68.729  64.833  1.00 10.86 ? 5   GLY E N   1 
ATOM 7207  C CA  . GLY E 1 5   ? 34.941  68.889  65.809  1.00 11.54 ? 5   GLY E CA  1 
ATOM 7208  C C   . GLY E 1 5   ? 33.600  69.015  65.122  1.00 14.64 ? 5   GLY E C   1 
ATOM 7209  O O   . GLY E 1 5   ? 33.352  70.046  64.515  1.00 15.25 ? 5   GLY E O   1 
ATOM 7210  N N   . TYR E 1 6   ? 32.767  67.977  65.205  1.00 15.16 ? 6   TYR E N   1 
ATOM 7211  C CA  . TYR E 1 6   ? 31.443  67.970  64.580  1.00 14.95 ? 6   TYR E CA  1 
ATOM 7212  C C   . TYR E 1 6   ? 30.523  66.988  65.316  1.00 18.41 ? 6   TYR E C   1 
ATOM 7213  O O   . TYR E 1 6   ? 30.924  66.393  66.321  1.00 15.21 ? 6   TYR E O   1 
ATOM 7214  C CB  . TYR E 1 6   ? 31.555  67.588  63.097  1.00 10.70 ? 6   TYR E CB  1 
ATOM 7215  C CG  . TYR E 1 6   ? 30.396  68.045  62.262  1.00 6.33  ? 6   TYR E CG  1 
ATOM 7216  C CD1 . TYR E 1 6   ? 29.898  69.349  62.369  1.00 7.30  ? 6   TYR E CD1 1 
ATOM 7217  C CD2 . TYR E 1 6   ? 29.737  67.159  61.381  1.00 6.71  ? 6   TYR E CD2 1 
ATOM 7218  C CE1 . TYR E 1 6   ? 28.799  69.785  61.622  1.00 8.31  ? 6   TYR E CE1 1 
ATOM 7219  C CE2 . TYR E 1 6   ? 28.633  67.601  60.628  1.00 3.01  ? 6   TYR E CE2 1 
ATOM 7220  C CZ  . TYR E 1 6   ? 28.170  68.912  60.757  1.00 5.06  ? 6   TYR E CZ  1 
ATOM 7221  O OH  . TYR E 1 6   ? 27.072  69.355  60.050  1.00 4.29  ? 6   TYR E OH  1 
ATOM 7222  N N   . TRP E 1 7   ? 29.282  66.850  64.850  1.00 19.82 ? 7   TRP E N   1 
ATOM 7223  C CA  . TRP E 1 7   ? 28.331  65.933  65.477  1.00 18.40 ? 7   TRP E CA  1 
ATOM 7224  C C   . TRP E 1 7   ? 28.665  64.501  65.039  1.00 19.24 ? 7   TRP E C   1 
ATOM 7225  O O   . TRP E 1 7   ? 29.580  64.282  64.246  1.00 17.74 ? 7   TRP E O   1 
ATOM 7226  C CB  . TRP E 1 7   ? 26.891  66.261  65.046  1.00 20.08 ? 7   TRP E CB  1 
ATOM 7227  C CG  . TRP E 1 7   ? 26.510  67.722  65.075  1.00 20.18 ? 7   TRP E CG  1 
ATOM 7228  C CD1 . TRP E 1 7   ? 26.624  68.619  64.046  1.00 18.27 ? 7   TRP E CD1 1 
ATOM 7229  C CD2 . TRP E 1 7   ? 25.902  68.425  66.164  1.00 21.17 ? 7   TRP E CD2 1 
ATOM 7230  N NE1 . TRP E 1 7   ? 26.121  69.844  64.423  1.00 19.40 ? 7   TRP E NE1 1 
ATOM 7231  C CE2 . TRP E 1 7   ? 25.672  69.766  65.716  1.00 19.78 ? 7   TRP E CE2 1 
ATOM 7232  C CE3 . TRP E 1 7   ? 25.530  68.099  67.474  1.00 19.13 ? 7   TRP E CE3 1 
ATOM 7233  C CZ2 . TRP E 1 7   ? 25.086  70.747  66.530  1.00 17.90 ? 7   TRP E CZ2 1 
ATOM 7234  C CZ3 . TRP E 1 7   ? 24.950  69.076  68.285  1.00 20.90 ? 7   TRP E CZ3 1 
ATOM 7235  C CH2 . TRP E 1 7   ? 24.735  70.383  67.806  1.00 21.37 ? 7   TRP E CH2 1 
ATOM 7236  N N   . ASP E 1 8   ? 27.926  63.522  65.553  1.00 20.45 ? 8   ASP E N   1 
ATOM 7237  C CA  . ASP E 1 8   ? 28.145  62.138  65.145  1.00 19.45 ? 8   ASP E CA  1 
ATOM 7238  C C   . ASP E 1 8   ? 27.393  61.903  63.830  1.00 20.94 ? 8   ASP E C   1 
ATOM 7239  O O   . ASP E 1 8   ? 27.251  60.773  63.365  1.00 22.87 ? 8   ASP E O   1 
ATOM 7240  C CB  . ASP E 1 8   ? 27.687  61.154  66.236  1.00 21.34 ? 8   ASP E CB  1 
ATOM 7241  C CG  . ASP E 1 8   ? 26.179  61.123  66.421  1.00 22.94 ? 8   ASP E CG  1 
ATOM 7242  O OD1 . ASP E 1 8   ? 25.631  62.052  67.047  1.00 20.15 ? 8   ASP E OD1 1 
ATOM 7243  O OD2 . ASP E 1 8   ? 25.543  60.154  65.957  1.00 23.11 ? 8   ASP E OD2 1 
ATOM 7244  N N   . ILE E 1 9   ? 26.908  62.999  63.253  1.00 20.63 ? 9   ILE E N   1 
ATOM 7245  C CA  . ILE E 1 9   ? 26.172  63.000  61.997  1.00 19.47 ? 9   ILE E CA  1 
ATOM 7246  C C   . ILE E 1 9   ? 27.100  63.481  60.882  1.00 17.29 ? 9   ILE E C   1 
ATOM 7247  O O   . ILE E 1 9   ? 27.791  64.483  61.068  1.00 15.99 ? 9   ILE E O   1 
ATOM 7248  C CB  . ILE E 1 9   ? 24.954  63.960  62.078  1.00 21.53 ? 9   ILE E CB  1 
ATOM 7249  C CG1 . ILE E 1 9   ? 23.835  63.354  62.933  1.00 19.97 ? 9   ILE E CG1 1 
ATOM 7250  C CG2 . ILE E 1 9   ? 24.445  64.293  60.686  1.00 21.32 ? 9   ILE E CG2 1 
ATOM 7251  C CD1 . ILE E 1 9   ? 24.096  63.357  64.420  1.00 18.14 ? 9   ILE E CD1 1 
ATOM 7252  N N   . ARG E 1 10  ? 27.085  62.778  59.748  1.00 15.05 ? 10  ARG E N   1 
ATOM 7253  C CA  . ARG E 1 10  ? 27.902  63.096  58.564  1.00 14.84 ? 10  ARG E CA  1 
ATOM 7254  C C   . ARG E 1 10  ? 27.943  64.596  58.238  1.00 12.99 ? 10  ARG E C   1 
ATOM 7255  O O   . ARG E 1 10  ? 29.023  65.235  58.281  1.00 13.03 ? 10  ARG E O   1 
ATOM 7256  C CB  . ARG E 1 10  ? 27.359  62.315  57.360  1.00 12.77 ? 10  ARG E CB  1 
ATOM 7257  C CG  . ARG E 1 10  ? 27.855  62.749  55.986  1.00 15.16 ? 10  ARG E CG  1 
ATOM 7258  C CD  . ARG E 1 10  ? 26.861  62.312  54.908  1.00 15.83 ? 10  ARG E CD  1 
ATOM 7259  N NE  . ARG E 1 10  ? 27.365  62.478  53.544  1.00 14.85 ? 10  ARG E NE  1 
ATOM 7260  C CZ  . ARG E 1 10  ? 27.661  61.473  52.723  1.00 12.82 ? 10  ARG E CZ  1 
ATOM 7261  N NH1 . ARG E 1 10  ? 27.510  60.212  53.115  1.00 9.37  ? 10  ARG E NH1 1 
ATOM 7262  N NH2 . ARG E 1 10  ? 28.094  61.727  51.497  1.00 15.50 ? 10  ARG E NH2 1 
ATOM 7263  N N   . GLY E 1 11  ? 26.788  65.157  57.873  1.00 11.52 ? 11  GLY E N   1 
ATOM 7264  C CA  . GLY E 1 11  ? 26.696  66.549  57.555  1.00 9.79  ? 11  GLY E CA  1 
ATOM 7265  C C   . GLY E 1 11  ? 27.757  67.141  56.639  1.00 8.99  ? 11  GLY E C   1 
ATOM 7266  O O   . GLY E 1 11  ? 28.514  66.430  55.942  1.00 8.95  ? 11  GLY E O   1 
ATOM 7267  N N   . LEU E 1 12  ? 27.844  68.467  56.697  1.00 6.92  ? 12  LEU E N   1 
ATOM 7268  C CA  . LEU E 1 12  ? 28.766  69.253  55.893  1.00 6.25  ? 12  LEU E CA  1 
ATOM 7269  C C   . LEU E 1 12  ? 30.254  69.032  56.130  1.00 4.31  ? 12  LEU E C   1 
ATOM 7270  O O   . LEU E 1 12  ? 31.079  69.468  55.325  1.00 11.33 ? 12  LEU E O   1 
ATOM 7271  C CB  . LEU E 1 12  ? 28.416  70.734  56.015  1.00 6.76  ? 12  LEU E CB  1 
ATOM 7272  C CG  . LEU E 1 12  ? 27.871  71.206  57.360  1.00 8.28  ? 12  LEU E CG  1 
ATOM 7273  C CD1 . LEU E 1 12  ? 28.989  71.315  58.353  1.00 4.14  ? 12  LEU E CD1 1 
ATOM 7274  C CD2 . LEU E 1 12  ? 27.173  72.539  57.204  1.00 9.47  ? 12  LEU E CD2 1 
ATOM 7275  N N   . ALA E 1 13  ? 30.604  68.352  57.206  1.00 4.04  ? 13  ALA E N   1 
ATOM 7276  C CA  . ALA E 1 13  ? 32.011  68.067  57.505  1.00 5.73  ? 13  ALA E CA  1 
ATOM 7277  C C   . ALA E 1 13  ? 32.559  66.852  56.739  1.00 6.69  ? 13  ALA E C   1 
ATOM 7278  O O   . ALA E 1 13  ? 33.775  66.640  56.691  1.00 6.25  ? 13  ALA E O   1 
ATOM 7279  C CB  . ALA E 1 13  ? 32.207  67.880  59.008  1.00 4.78  ? 13  ALA E CB  1 
ATOM 7280  N N   . HIS E 1 14  ? 31.666  66.064  56.118  1.00 9.45  ? 14  HIS E N   1 
ATOM 7281  C CA  . HIS E 1 14  ? 32.059  64.891  55.364  1.00 9.99  ? 14  HIS E CA  1 
ATOM 7282  C C   . HIS E 1 14  ? 33.160  65.125  54.321  1.00 8.64  ? 14  HIS E C   1 
ATOM 7283  O O   . HIS E 1 14  ? 33.974  64.236  54.077  1.00 8.94  ? 14  HIS E O   1 
ATOM 7284  C CB  . HIS E 1 14  ? 30.843  64.234  54.702  1.00 10.80 ? 14  HIS E CB  1 
ATOM 7285  C CG  . HIS E 1 14  ? 31.127  62.873  54.142  1.00 6.83  ? 14  HIS E CG  1 
ATOM 7286  N ND1 . HIS E 1 14  ? 30.888  61.713  54.844  1.00 7.62  ? 14  HIS E ND1 1 
ATOM 7287  C CD2 . HIS E 1 14  ? 31.676  62.493  52.963  1.00 8.66  ? 14  HIS E CD2 1 
ATOM 7288  C CE1 . HIS E 1 14  ? 31.283  60.675  54.127  1.00 4.77  ? 14  HIS E CE1 1 
ATOM 7289  N NE2 . HIS E 1 14  ? 31.765  61.122  52.981  1.00 9.67  ? 14  HIS E NE2 1 
ATOM 7290  N N   . ALA E 1 15  ? 33.177  66.299  53.693  1.00 6.37  ? 15  ALA E N   1 
ATOM 7291  C CA  . ALA E 1 15  ? 34.202  66.611  52.694  1.00 8.27  ? 15  ALA E CA  1 
ATOM 7292  C C   . ALA E 1 15  ? 35.535  66.860  53.387  1.00 9.55  ? 15  ALA E C   1 
ATOM 7293  O O   . ALA E 1 15  ? 36.601  66.672  52.803  1.00 8.57  ? 15  ALA E O   1 
ATOM 7294  C CB  . ALA E 1 15  ? 33.799  67.829  51.893  1.00 7.63  ? 15  ALA E CB  1 
ATOM 7295  N N   . ILE E 1 16  ? 35.456  67.279  54.646  1.00 10.38 ? 16  ILE E N   1 
ATOM 7296  C CA  . ILE E 1 16  ? 36.633  67.561  55.450  1.00 7.82  ? 16  ILE E CA  1 
ATOM 7297  C C   . ILE E 1 16  ? 37.332  66.265  55.820  1.00 9.86  ? 16  ILE E C   1 
ATOM 7298  O O   . ILE E 1 16  ? 38.482  66.042  55.447  1.00 11.22 ? 16  ILE E O   1 
ATOM 7299  C CB  . ILE E 1 16  ? 36.255  68.319  56.746  1.00 4.95  ? 16  ILE E CB  1 
ATOM 7300  C CG1 . ILE E 1 16  ? 35.438  69.565  56.402  1.00 7.95  ? 16  ILE E CG1 1 
ATOM 7301  C CG2 . ILE E 1 16  ? 37.508  68.706  57.525  1.00 2.50  ? 16  ILE E CG2 1 
ATOM 7302  C CD1 . ILE E 1 16  ? 35.031  70.368  57.600  1.00 9.80  ? 16  ILE E CD1 1 
ATOM 7303  N N   . ARG E 1 17  ? 36.609  65.386  56.507  1.00 9.65  ? 17  ARG E N   1 
ATOM 7304  C CA  . ARG E 1 17  ? 37.173  64.112  56.943  1.00 14.52 ? 17  ARG E CA  1 
ATOM 7305  C C   . ARG E 1 17  ? 37.781  63.279  55.816  1.00 15.06 ? 17  ARG E C   1 
ATOM 7306  O O   . ARG E 1 17  ? 38.650  62.439  56.062  1.00 12.56 ? 17  ARG E O   1 
ATOM 7307  C CB  . ARG E 1 17  ? 36.154  63.310  57.763  1.00 17.00 ? 17  ARG E CB  1 
ATOM 7308  C CG  . ARG E 1 17  ? 34.796  63.125  57.119  1.00 19.16 ? 17  ARG E CG  1 
ATOM 7309  C CD  . ARG E 1 17  ? 33.831  62.470  58.092  1.00 21.35 ? 17  ARG E CD  1 
ATOM 7310  N NE  . ARG E 1 17  ? 33.354  63.401  59.112  1.00 17.31 ? 17  ARG E NE  1 
ATOM 7311  C CZ  . ARG E 1 17  ? 32.139  63.946  59.115  1.00 18.20 ? 17  ARG E CZ  1 
ATOM 7312  N NH1 . ARG E 1 17  ? 31.279  63.651  58.151  1.00 15.86 ? 17  ARG E NH1 1 
ATOM 7313  N NH2 . ARG E 1 17  ? 31.783  64.789  60.077  1.00 16.68 ? 17  ARG E NH2 1 
ATOM 7314  N N   . LEU E 1 18  ? 37.349  63.542  54.582  1.00 18.34 ? 18  LEU E N   1 
ATOM 7315  C CA  . LEU E 1 18  ? 37.869  62.850  53.398  1.00 17.41 ? 18  LEU E CA  1 
ATOM 7316  C C   . LEU E 1 18  ? 39.211  63.453  53.002  1.00 17.81 ? 18  LEU E C   1 
ATOM 7317  O O   . LEU E 1 18  ? 40.127  62.736  52.600  1.00 19.75 ? 18  LEU E O   1 
ATOM 7318  C CB  . LEU E 1 18  ? 36.888  62.959  52.224  1.00 12.50 ? 18  LEU E CB  1 
ATOM 7319  C CG  . LEU E 1 18  ? 35.756  61.929  52.147  1.00 11.99 ? 18  LEU E CG  1 
ATOM 7320  C CD1 . LEU E 1 18  ? 34.740  62.320  51.071  1.00 6.28  ? 18  LEU E CD1 1 
ATOM 7321  C CD2 . LEU E 1 18  ? 36.350  60.557  51.861  1.00 7.70  ? 18  LEU E CD2 1 
ATOM 7322  N N   . LEU E 1 19  ? 39.330  64.770  53.156  1.00 16.41 ? 19  LEU E N   1 
ATOM 7323  C CA  . LEU E 1 19  ? 40.555  65.489  52.823  1.00 16.34 ? 19  LEU E CA  1 
ATOM 7324  C C   . LEU E 1 19  ? 41.691  65.195  53.800  1.00 16.04 ? 19  LEU E C   1 
ATOM 7325  O O   . LEU E 1 19  ? 42.844  65.054  53.385  1.00 17.13 ? 19  LEU E O   1 
ATOM 7326  C CB  . LEU E 1 19  ? 40.277  66.994  52.744  1.00 15.20 ? 19  LEU E CB  1 
ATOM 7327  C CG  . LEU E 1 19  ? 41.418  67.911  52.294  1.00 15.75 ? 19  LEU E CG  1 
ATOM 7328  C CD1 . LEU E 1 19  ? 42.043  67.392  51.007  1.00 10.04 ? 19  LEU E CD1 1 
ATOM 7329  C CD2 . LEU E 1 19  ? 40.899  69.336  52.113  1.00 11.54 ? 19  LEU E CD2 1 
ATOM 7330  N N   . LEU E 1 20  ? 41.359  65.079  55.085  1.00 13.81 ? 20  LEU E N   1 
ATOM 7331  C CA  . LEU E 1 20  ? 42.340  64.781  56.131  1.00 12.43 ? 20  LEU E CA  1 
ATOM 7332  C C   . LEU E 1 20  ? 43.003  63.444  55.852  1.00 14.76 ? 20  LEU E C   1 
ATOM 7333  O O   . LEU E 1 20  ? 44.227  63.316  55.885  1.00 18.20 ? 20  LEU E O   1 
ATOM 7334  C CB  . LEU E 1 20  ? 41.657  64.632  57.490  1.00 11.53 ? 20  LEU E CB  1 
ATOM 7335  C CG  . LEU E 1 20  ? 40.681  65.648  58.069  1.00 12.13 ? 20  LEU E CG  1 
ATOM 7336  C CD1 . LEU E 1 20  ? 39.847  64.960  59.132  1.00 6.73  ? 20  LEU E CD1 1 
ATOM 7337  C CD2 . LEU E 1 20  ? 41.424  66.828  58.654  1.00 5.31  ? 20  LEU E CD2 1 
ATOM 7338  N N   . GLU E 1 21  ? 42.156  62.438  55.657  1.00 16.68 ? 21  GLU E N   1 
ATOM 7339  C CA  . GLU E 1 21  ? 42.584  61.075  55.400  1.00 16.19 ? 21  GLU E CA  1 
ATOM 7340  C C   . GLU E 1 21  ? 43.514  60.953  54.213  1.00 18.18 ? 21  GLU E C   1 
ATOM 7341  O O   . GLU E 1 21  ? 44.617  60.424  54.331  1.00 18.79 ? 21  GLU E O   1 
ATOM 7342  C CB  . GLU E 1 21  ? 41.368  60.175  55.184  1.00 18.17 ? 21  GLU E CB  1 
ATOM 7343  C CG  . GLU E 1 21  ? 40.698  59.693  56.459  1.00 20.43 ? 21  GLU E CG  1 
ATOM 7344  C CD  . GLU E 1 21  ? 41.524  58.665  57.211  1.00 21.45 ? 21  GLU E CD  1 
ATOM 7345  O OE1 . GLU E 1 21  ? 42.273  57.899  56.567  1.00 21.96 ? 21  GLU E OE1 1 
ATOM 7346  O OE2 . GLU E 1 21  ? 41.418  58.614  58.452  1.00 21.41 ? 21  GLU E OE2 1 
ATOM 7347  N N   . TYR E 1 22  ? 43.069  61.450  53.067  1.00 17.06 ? 22  TYR E N   1 
ATOM 7348  C CA  . TYR E 1 22  ? 43.860  61.370  51.853  1.00 18.01 ? 22  TYR E CA  1 
ATOM 7349  C C   . TYR E 1 22  ? 45.253  61.999  51.986  1.00 18.16 ? 22  TYR E C   1 
ATOM 7350  O O   . TYR E 1 22  ? 46.249  61.411  51.562  1.00 16.11 ? 22  TYR E O   1 
ATOM 7351  C CB  . TYR E 1 22  ? 43.096  61.985  50.669  1.00 16.35 ? 22  TYR E CB  1 
ATOM 7352  C CG  . TYR E 1 22  ? 43.723  61.683  49.333  1.00 16.22 ? 22  TYR E CG  1 
ATOM 7353  C CD1 . TYR E 1 22  ? 43.948  60.364  48.930  1.00 15.41 ? 22  TYR E CD1 1 
ATOM 7354  C CD2 . TYR E 1 22  ? 44.213  62.707  48.510  1.00 16.82 ? 22  TYR E CD2 1 
ATOM 7355  C CE1 . TYR E 1 22  ? 44.621  60.055  47.752  1.00 14.35 ? 22  TYR E CE1 1 
ATOM 7356  C CE2 . TYR E 1 22  ? 44.886  62.424  47.328  1.00 16.19 ? 22  TYR E CE2 1 
ATOM 7357  C CZ  . TYR E 1 22  ? 45.090  61.098  46.956  1.00 17.54 ? 22  TYR E CZ  1 
ATOM 7358  O OH  . TYR E 1 22  ? 45.775  60.783  45.800  1.00 18.37 ? 22  TYR E OH  1 
ATOM 7359  N N   . THR E 1 23  ? 45.328  63.176  52.598  1.00 18.05 ? 23  THR E N   1 
ATOM 7360  C CA  . THR E 1 23  ? 46.606  63.862  52.758  1.00 18.14 ? 23  THR E CA  1 
ATOM 7361  C C   . THR E 1 23  ? 47.400  63.428  53.996  1.00 20.13 ? 23  THR E C   1 
ATOM 7362  O O   . THR E 1 23  ? 48.327  64.147  54.419  1.00 18.94 ? 23  THR E O   1 
ATOM 7363  C CB  . THR E 1 23  ? 46.409  65.392  52.774  1.00 15.02 ? 23  THR E CB  1 
ATOM 7364  O OG1 . THR E 1 23  ? 45.566  65.758  53.871  1.00 13.72 ? 23  THR E OG1 1 
ATOM 7365  C CG2 . THR E 1 23  ? 45.757  65.851  51.488  1.00 14.05 ? 23  THR E CG2 1 
ATOM 7366  N N   . ASP E 1 24  ? 47.041  62.273  54.562  1.00 19.63 ? 24  ASP E N   1 
ATOM 7367  C CA  . ASP E 1 24  ? 47.690  61.724  55.759  1.00 20.02 ? 24  ASP E CA  1 
ATOM 7368  C C   . ASP E 1 24  ? 47.845  62.746  56.888  1.00 21.28 ? 24  ASP E C   1 
ATOM 7369  O O   . ASP E 1 24  ? 48.791  62.667  57.676  1.00 18.34 ? 24  ASP E O   1 
ATOM 7370  C CB  . ASP E 1 24  ? 49.061  61.112  55.421  1.00 20.97 ? 24  ASP E CB  1 
ATOM 7371  C CG  . ASP E 1 24  ? 48.961  59.848  54.578  1.00 18.61 ? 24  ASP E CG  1 
ATOM 7372  O OD1 . ASP E 1 24  ? 47.968  59.102  54.701  1.00 17.06 ? 24  ASP E OD1 1 
ATOM 7373  O OD2 . ASP E 1 24  ? 49.901  59.590  53.796  1.00 14.77 ? 24  ASP E OD2 1 
ATOM 7374  N N   . SER E 1 25  ? 46.918  63.696  56.972  1.00 20.98 ? 25  SER E N   1 
ATOM 7375  C CA  . SER E 1 25  ? 46.971  64.718  58.010  1.00 19.52 ? 25  SER E CA  1 
ATOM 7376  C C   . SER E 1 25  ? 46.524  64.123  59.342  1.00 20.50 ? 25  SER E C   1 
ATOM 7377  O O   . SER E 1 25  ? 45.419  63.582  59.451  1.00 19.85 ? 25  SER E O   1 
ATOM 7378  C CB  . SER E 1 25  ? 46.091  65.915  57.640  1.00 21.09 ? 25  SER E CB  1 
ATOM 7379  O OG  . SER E 1 25  ? 46.562  66.577  56.467  1.00 23.42 ? 25  SER E OG  1 
ATOM 7380  N N   . SER E 1 26  ? 47.400  64.204  60.342  1.00 20.00 ? 26  SER E N   1 
ATOM 7381  C CA  . SER E 1 26  ? 47.118  63.676  61.674  1.00 18.83 ? 26  SER E CA  1 
ATOM 7382  C C   . SER E 1 26  ? 45.998  64.465  62.372  1.00 19.85 ? 26  SER E C   1 
ATOM 7383  O O   . SER E 1 26  ? 46.241  65.575  62.851  1.00 19.22 ? 26  SER E O   1 
ATOM 7384  C CB  . SER E 1 26  ? 48.396  63.672  62.517  1.00 20.78 ? 26  SER E CB  1 
ATOM 7385  O OG  . SER E 1 26  ? 49.088  64.910  62.415  1.00 12.92 ? 26  SER E OG  1 
ATOM 7386  N N   . TYR E 1 27  ? 44.824  63.880  62.433  1.00 18.00 ? 27  TYR E N   1 
ATOM 7387  C CA  . TYR E 1 27  ? 43.684  64.532  63.055  1.00 17.20 ? 27  TYR E CA  1 
ATOM 7388  C C   . TYR E 1 27  ? 43.165  63.794  64.283  1.00 19.08 ? 27  TYR E C   1 
ATOM 7389  O O   . TYR E 1 27  ? 43.657  62.731  64.643  1.00 21.45 ? 27  TYR E O   1 
ATOM 7390  C CB  . TYR E 1 27  ? 42.550  64.704  62.034  1.00 18.48 ? 27  TYR E CB  1 
ATOM 7391  C CG  . TYR E 1 27  ? 41.874  63.415  61.597  1.00 20.38 ? 27  TYR E CG  1 
ATOM 7392  C CD1 . TYR E 1 27  ? 42.556  62.462  60.837  1.00 17.61 ? 27  TYR E CD1 1 
ATOM 7393  C CD2 . TYR E 1 27  ? 40.542  63.160  61.928  1.00 18.83 ? 27  TYR E CD2 1 
ATOM 7394  C CE1 . TYR E 1 27  ? 41.926  61.286  60.418  1.00 15.54 ? 27  TYR E CE1 1 
ATOM 7395  C CE2 . TYR E 1 27  ? 39.906  61.992  61.513  1.00 16.79 ? 27  TYR E CE2 1 
ATOM 7396  C CZ  . TYR E 1 27  ? 40.601  61.060  60.760  1.00 15.87 ? 27  TYR E CZ  1 
ATOM 7397  O OH  . TYR E 1 27  ? 39.964  59.907  60.355  1.00 17.74 ? 27  TYR E OH  1 
ATOM 7398  N N   . GLU E 1 28  ? 42.181  64.365  64.924  1.00 20.20 ? 28  GLU E N   1 
ATOM 7399  C CA  . GLU E 1 28  ? 41.533  63.810  66.105  1.00 22.39 ? 28  GLU E CA  1 
ATOM 7400  C C   . GLU E 1 28  ? 40.040  63.955  65.822  1.00 22.95 ? 28  GLU E C   1 
ATOM 7401  O O   . GLU E 1 28  ? 39.656  64.729  64.942  1.00 24.51 ? 28  GLU E O   1 
ATOM 7402  C CB  . GLU E 1 28  ? 41.916  64.633  67.337  1.00 24.94 ? 28  GLU E CB  1 
ATOM 7403  C CG  . GLU E 1 28  ? 41.665  63.952  68.680  1.00 27.24 ? 28  GLU E CG  1 
ATOM 7404  C CD  . GLU E 1 28  ? 42.864  63.156  69.179  1.00 29.38 ? 28  GLU E CD  1 
ATOM 7405  O OE1 . GLU E 1 28  ? 44.020  63.414  68.721  1.00 33.08 ? 28  GLU E OE1 1 
ATOM 7406  O OE2 . GLU E 1 28  ? 42.661  62.280  70.049  1.00 26.66 ? 28  GLU E OE2 1 
ATOM 7407  N N   . GLU E 1 29  ? 39.190  63.251  66.560  1.00 20.57 ? 29  GLU E N   1 
ATOM 7408  C CA  . GLU E 1 29  ? 37.757  63.347  66.305  1.00 22.91 ? 29  GLU E CA  1 
ATOM 7409  C C   . GLU E 1 29  ? 36.862  63.608  67.503  1.00 22.73 ? 29  GLU E C   1 
ATOM 7410  O O   . GLU E 1 29  ? 36.598  62.711  68.304  1.00 23.97 ? 29  GLU E O   1 
ATOM 7411  C CB  . GLU E 1 29  ? 37.275  62.112  65.545  1.00 22.56 ? 29  GLU E CB  1 
ATOM 7412  C CG  . GLU E 1 29  ? 37.677  62.123  64.084  1.00 19.55 ? 29  GLU E CG  1 
ATOM 7413  C CD  . GLU E 1 29  ? 37.365  60.828  63.379  1.00 18.47 ? 29  GLU E CD  1 
ATOM 7414  O OE1 . GLU E 1 29  ? 38.153  59.872  63.532  1.00 19.34 ? 29  GLU E OE1 1 
ATOM 7415  O OE2 . GLU E 1 29  ? 36.343  60.772  62.665  1.00 17.68 ? 29  GLU E OE2 1 
ATOM 7416  N N   . LYS E 1 30  ? 36.362  64.835  67.593  1.00 22.43 ? 30  LYS E N   1 
ATOM 7417  C CA  . LYS E 1 30  ? 35.477  65.235  68.681  1.00 24.61 ? 30  LYS E CA  1 
ATOM 7418  C C   . LYS E 1 30  ? 34.043  65.094  68.191  1.00 24.86 ? 30  LYS E C   1 
ATOM 7419  O O   . LYS E 1 30  ? 33.533  65.988  67.510  1.00 27.62 ? 30  LYS E O   1 
ATOM 7420  C CB  . LYS E 1 30  ? 35.716  66.701  69.044  1.00 25.82 ? 30  LYS E CB  1 
ATOM 7421  C CG  . LYS E 1 30  ? 35.649  67.002  70.520  1.00 26.74 ? 30  LYS E CG  1 
ATOM 7422  C CD  . LYS E 1 30  ? 37.019  66.839  71.125  1.00 25.87 ? 30  LYS E CD  1 
ATOM 7423  C CE  . LYS E 1 30  ? 38.000  67.768  70.437  1.00 22.25 ? 30  LYS E CE  1 
ATOM 7424  N NZ  . LYS E 1 30  ? 39.413  67.472  70.785  1.00 22.34 ? 30  LYS E NZ  1 
ATOM 7425  N N   . LYS E 1 31  ? 33.397  63.980  68.508  1.00 21.52 ? 31  LYS E N   1 
ATOM 7426  C CA  . LYS E 1 31  ? 32.023  63.787  68.073  1.00 19.65 ? 31  LYS E CA  1 
ATOM 7427  C C   . LYS E 1 31  ? 31.005  64.162  69.147  1.00 22.11 ? 31  LYS E C   1 
ATOM 7428  O O   . LYS E 1 31  ? 31.074  63.683  70.282  1.00 23.36 ? 31  LYS E O   1 
ATOM 7429  C CB  . LYS E 1 31  ? 31.801  62.350  67.592  1.00 16.52 ? 31  LYS E CB  1 
ATOM 7430  C CG  . LYS E 1 31  ? 32.383  62.050  66.213  1.00 14.19 ? 31  LYS E CG  1 
ATOM 7431  C CD  . LYS E 1 31  ? 32.058  60.623  65.785  1.00 13.47 ? 31  LYS E CD  1 
ATOM 7432  C CE  . LYS E 1 31  ? 32.503  60.320  64.358  1.00 14.06 ? 31  LYS E CE  1 
ATOM 7433  N NZ  . LYS E 1 31  ? 33.973  60.451  64.168  1.00 12.76 ? 31  LYS E NZ  1 
ATOM 7434  N N   . TYR E 1 32  ? 30.085  65.051  68.785  1.00 21.45 ? 32  TYR E N   1 
ATOM 7435  C CA  . TYR E 1 32  ? 29.033  65.506  69.694  1.00 20.93 ? 32  TYR E CA  1 
ATOM 7436  C C   . TYR E 1 32  ? 27.736  64.822  69.310  1.00 19.20 ? 32  TYR E C   1 
ATOM 7437  O O   . TYR E 1 32  ? 27.300  64.898  68.161  1.00 19.53 ? 32  TYR E O   1 
ATOM 7438  C CB  . TYR E 1 32  ? 28.844  67.019  69.603  1.00 22.83 ? 32  TYR E CB  1 
ATOM 7439  C CG  . TYR E 1 32  ? 30.079  67.819  69.925  1.00 21.01 ? 32  TYR E CG  1 
ATOM 7440  C CD1 . TYR E 1 32  ? 31.145  67.882  69.030  1.00 21.52 ? 32  TYR E CD1 1 
ATOM 7441  C CD2 . TYR E 1 32  ? 30.172  68.540  71.112  1.00 23.79 ? 32  TYR E CD2 1 
ATOM 7442  C CE1 . TYR E 1 32  ? 32.271  68.646  69.309  1.00 23.05 ? 32  TYR E CE1 1 
ATOM 7443  C CE2 . TYR E 1 32  ? 31.296  69.312  71.401  1.00 21.78 ? 32  TYR E CE2 1 
ATOM 7444  C CZ  . TYR E 1 32  ? 32.337  69.358  70.496  1.00 21.19 ? 32  TYR E CZ  1 
ATOM 7445  O OH  . TYR E 1 32  ? 33.430  70.104  70.782  1.00 17.47 ? 32  TYR E OH  1 
ATOM 7446  N N   . THR E 1 33  ? 27.112  64.177  70.272  1.00 17.13 ? 33  THR E N   1 
ATOM 7447  C CA  . THR E 1 33  ? 25.868  63.456  70.004  1.00 20.73 ? 33  THR E CA  1 
ATOM 7448  C C   . THR E 1 33  ? 24.666  64.340  70.278  1.00 19.19 ? 33  THR E C   1 
ATOM 7449  O O   . THR E 1 33  ? 24.694  65.141  71.212  1.00 22.87 ? 33  THR E O   1 
ATOM 7450  C CB  . THR E 1 33  ? 25.752  62.156  70.848  1.00 22.41 ? 33  THR E CB  1 
ATOM 7451  O OG1 . THR E 1 33  ? 26.921  61.347  70.655  1.00 23.74 ? 33  THR E OG1 1 
ATOM 7452  C CG2 . THR E 1 33  ? 24.523  61.353  70.433  1.00 21.06 ? 33  THR E CG2 1 
ATOM 7453  N N   . MET E 1 34  ? 23.653  64.209  69.428  1.00 19.46 ? 34  MET E N   1 
ATOM 7454  C CA  . MET E 1 34  ? 22.419  64.964  69.571  1.00 22.44 ? 34  MET E CA  1 
ATOM 7455  C C   . MET E 1 34  ? 21.435  64.150  70.410  1.00 23.36 ? 34  MET E C   1 
ATOM 7456  O O   . MET E 1 34  ? 21.832  63.234  71.131  1.00 23.24 ? 34  MET E O   1 
ATOM 7457  C CB  . MET E 1 34  ? 21.810  65.272  68.195  1.00 22.95 ? 34  MET E CB  1 
ATOM 7458  C CG  . MET E 1 34  ? 21.952  66.724  67.764  1.00 24.47 ? 34  MET E CG  1 
ATOM 7459  S SD  . MET E 1 34  ? 20.724  67.214  66.538  1.00 30.26 ? 34  MET E SD  1 
ATOM 7460  C CE  . MET E 1 34  ? 19.480  67.890  67.597  1.00 29.02 ? 34  MET E CE  1 
ATOM 7461  N N   . GLY E 1 35  ? 20.153  64.482  70.301  1.00 26.49 ? 35  GLY E N   1 
ATOM 7462  C CA  . GLY E 1 35  ? 19.129  63.772  71.041  1.00 27.48 ? 35  GLY E CA  1 
ATOM 7463  C C   . GLY E 1 35  ? 17.915  63.525  70.168  1.00 29.10 ? 35  GLY E C   1 
ATOM 7464  O O   . GLY E 1 35  ? 18.002  63.587  68.940  1.00 27.20 ? 35  GLY E O   1 
ATOM 7465  N N   . ASP E 1 36  ? 16.780  63.262  70.803  1.00 31.52 ? 36  ASP E N   1 
ATOM 7466  C CA  . ASP E 1 36  ? 15.537  63.004  70.091  1.00 30.28 ? 36  ASP E CA  1 
ATOM 7467  C C   . ASP E 1 36  ? 14.459  63.831  70.764  1.00 31.08 ? 36  ASP E C   1 
ATOM 7468  O O   . ASP E 1 36  ? 14.792  64.785  71.475  1.00 28.38 ? 36  ASP E O   1 
ATOM 7469  C CB  . ASP E 1 36  ? 15.178  61.516  70.173  1.00 31.60 ? 36  ASP E CB  1 
ATOM 7470  C CG  . ASP E 1 36  ? 16.208  60.628  69.506  1.00 32.95 ? 36  ASP E CG  1 
ATOM 7471  O OD1 . ASP E 1 36  ? 16.101  60.408  68.281  1.00 31.17 ? 36  ASP E OD1 1 
ATOM 7472  O OD2 . ASP E 1 36  ? 17.122  60.152  70.209  1.00 35.35 ? 36  ASP E OD2 1 
ATOM 7473  N N   . ALA E 1 37  ? 13.199  63.448  70.554  1.00 32.17 ? 37  ALA E N   1 
ATOM 7474  C CA  . ALA E 1 37  ? 12.043  64.130  71.144  1.00 30.20 ? 37  ALA E CA  1 
ATOM 7475  C C   . ALA E 1 37  ? 11.839  65.494  70.481  1.00 29.99 ? 37  ALA E C   1 
ATOM 7476  O O   . ALA E 1 37  ? 12.584  65.857  69.576  1.00 29.57 ? 37  ALA E O   1 
ATOM 7477  C CB  . ALA E 1 37  ? 12.232  64.274  72.681  1.00 29.98 ? 37  ALA E CB  1 
ATOM 7478  N N   . PRO E 1 38  ? 10.799  66.247  70.885  1.00 29.67 ? 38  PRO E N   1 
ATOM 7479  C CA  . PRO E 1 38  ? 10.614  67.551  70.244  1.00 29.31 ? 38  PRO E CA  1 
ATOM 7480  C C   . PRO E 1 38  ? 11.717  68.519  70.644  1.00 31.05 ? 38  PRO E C   1 
ATOM 7481  O O   . PRO E 1 38  ? 12.275  69.225  69.808  1.00 33.07 ? 38  PRO E O   1 
ATOM 7482  C CB  . PRO E 1 38  ? 9.258   68.005  70.784  1.00 29.38 ? 38  PRO E CB  1 
ATOM 7483  C CG  . PRO E 1 38  ? 9.210   67.369  72.147  1.00 30.22 ? 38  PRO E CG  1 
ATOM 7484  C CD  . PRO E 1 38  ? 9.719   65.982  71.854  1.00 28.48 ? 38  PRO E CD  1 
ATOM 7485  N N   . ASP E 1 39  ? 12.065  68.494  71.926  1.00 31.16 ? 39  ASP E N   1 
ATOM 7486  C CA  . ASP E 1 39  ? 13.083  69.370  72.495  1.00 32.86 ? 39  ASP E CA  1 
ATOM 7487  C C   . ASP E 1 39  ? 14.481  68.872  72.167  1.00 30.92 ? 39  ASP E C   1 
ATOM 7488  O O   . ASP E 1 39  ? 15.269  68.582  73.064  1.00 31.88 ? 39  ASP E O   1 
ATOM 7489  C CB  . ASP E 1 39  ? 12.903  69.436  74.016  1.00 33.02 ? 39  ASP E CB  1 
ATOM 7490  C CG  . ASP E 1 39  ? 13.584  70.641  74.635  1.00 34.53 ? 39  ASP E CG  1 
ATOM 7491  O OD1 . ASP E 1 39  ? 14.833  70.674  74.665  1.00 35.91 ? 39  ASP E OD1 1 
ATOM 7492  O OD2 . ASP E 1 39  ? 12.866  71.556  75.102  1.00 34.74 ? 39  ASP E OD2 1 
ATOM 7493  N N   . TYR E 1 40  ? 14.788  68.790  70.881  1.00 28.26 ? 40  TYR E N   1 
ATOM 7494  C CA  . TYR E 1 40  ? 16.089  68.314  70.438  1.00 28.02 ? 40  TYR E CA  1 
ATOM 7495  C C   . TYR E 1 40  ? 17.262  68.980  71.170  1.00 26.70 ? 40  TYR E C   1 
ATOM 7496  O O   . TYR E 1 40  ? 17.571  70.157  70.945  1.00 26.37 ? 40  TYR E O   1 
ATOM 7497  C CB  . TYR E 1 40  ? 16.205  68.479  68.921  1.00 28.24 ? 40  TYR E CB  1 
ATOM 7498  C CG  . TYR E 1 40  ? 15.402  67.453  68.158  1.00 26.32 ? 40  TYR E CG  1 
ATOM 7499  C CD1 . TYR E 1 40  ? 15.926  66.183  67.901  1.00 25.39 ? 40  TYR E CD1 1 
ATOM 7500  C CD2 . TYR E 1 40  ? 14.122  67.761  67.698  1.00 26.22 ? 40  TYR E CD2 1 
ATOM 7501  C CE1 . TYR E 1 40  ? 15.200  65.234  67.206  1.00 24.13 ? 40  TYR E CE1 1 
ATOM 7502  C CE2 . TYR E 1 40  ? 13.381  66.796  66.994  1.00 27.13 ? 40  TYR E CE2 1 
ATOM 7503  C CZ  . TYR E 1 40  ? 13.931  65.543  66.752  1.00 24.72 ? 40  TYR E CZ  1 
ATOM 7504  O OH  . TYR E 1 40  ? 13.229  64.602  66.038  1.00 25.65 ? 40  TYR E OH  1 
ATOM 7505  N N   . ASP E 1 41  ? 17.905  68.213  72.051  1.00 24.13 ? 41  ASP E N   1 
ATOM 7506  C CA  . ASP E 1 41  ? 19.026  68.721  72.833  1.00 25.89 ? 41  ASP E CA  1 
ATOM 7507  C C   . ASP E 1 41  ? 20.393  68.472  72.226  1.00 26.90 ? 41  ASP E C   1 
ATOM 7508  O O   . ASP E 1 41  ? 20.656  67.421  71.644  1.00 25.95 ? 41  ASP E O   1 
ATOM 7509  C CB  . ASP E 1 41  ? 18.982  68.187  74.265  1.00 24.59 ? 41  ASP E CB  1 
ATOM 7510  C CG  . ASP E 1 41  ? 18.915  69.303  75.295  1.00 26.51 ? 41  ASP E CG  1 
ATOM 7511  O OD1 . ASP E 1 41  ? 17.894  70.023  75.329  1.00 26.08 ? 41  ASP E OD1 1 
ATOM 7512  O OD2 . ASP E 1 41  ? 19.883  69.463  76.070  1.00 26.21 ? 41  ASP E OD2 1 
ATOM 7513  N N   . ARG E 1 42  ? 21.257  69.464  72.393  1.00 25.07 ? 42  ARG E N   1 
ATOM 7514  C CA  . ARG E 1 42  ? 22.616  69.442  71.878  1.00 23.31 ? 42  ARG E CA  1 
ATOM 7515  C C   . ARG E 1 42  ? 23.511  70.154  72.893  1.00 23.98 ? 42  ARG E C   1 
ATOM 7516  O O   . ARG E 1 42  ? 24.580  70.669  72.546  1.00 22.53 ? 42  ARG E O   1 
ATOM 7517  C CB  . ARG E 1 42  ? 22.666  70.189  70.544  1.00 25.15 ? 42  ARG E CB  1 
ATOM 7518  C CG  . ARG E 1 42  ? 22.302  71.676  70.652  1.00 28.33 ? 42  ARG E CG  1 
ATOM 7519  C CD  . ARG E 1 42  ? 21.028  72.027  69.903  1.00 29.51 ? 42  ARG E CD  1 
ATOM 7520  N NE  . ARG E 1 42  ? 21.166  71.787  68.471  1.00 28.85 ? 42  ARG E NE  1 
ATOM 7521  C CZ  . ARG E 1 42  ? 20.176  71.388  67.683  1.00 29.69 ? 42  ARG E CZ  1 
ATOM 7522  N NH1 . ARG E 1 42  ? 18.963  71.186  68.184  1.00 26.40 ? 42  ARG E NH1 1 
ATOM 7523  N NH2 . ARG E 1 42  ? 20.409  71.162  66.397  1.00 29.90 ? 42  ARG E NH2 1 
ATOM 7524  N N   . SER E 1 43  ? 23.061  70.176  74.146  1.00 23.97 ? 43  SER E N   1 
ATOM 7525  C CA  . SER E 1 43  ? 23.778  70.826  75.238  1.00 21.19 ? 43  SER E CA  1 
ATOM 7526  C C   . SER E 1 43  ? 25.273  70.546  75.211  1.00 19.81 ? 43  SER E C   1 
ATOM 7527  O O   . SER E 1 43  ? 26.082  71.446  75.436  1.00 18.20 ? 43  SER E O   1 
ATOM 7528  C CB  . SER E 1 43  ? 23.203  70.365  76.573  1.00 21.19 ? 43  SER E CB  1 
ATOM 7529  O OG  . SER E 1 43  ? 23.039  68.961  76.560  1.00 16.89 ? 43  SER E OG  1 
ATOM 7530  N N   . GLN E 1 44  ? 25.624  69.295  74.904  1.00 19.70 ? 44  GLN E N   1 
ATOM 7531  C CA  . GLN E 1 44  ? 27.015  68.865  74.809  1.00 19.57 ? 44  GLN E CA  1 
ATOM 7532  C C   . GLN E 1 44  ? 27.827  69.974  74.127  1.00 20.11 ? 44  GLN E C   1 
ATOM 7533  O O   . GLN E 1 44  ? 28.700  70.568  74.738  1.00 17.01 ? 44  GLN E O   1 
ATOM 7534  C CB  . GLN E 1 44  ? 27.115  67.560  74.002  1.00 18.83 ? 44  GLN E CB  1 
ATOM 7535  C CG  . GLN E 1 44  ? 28.524  66.976  73.913  1.00 19.87 ? 44  GLN E CG  1 
ATOM 7536  C CD  . GLN E 1 44  ? 28.580  65.596  73.256  1.00 24.81 ? 44  GLN E CD  1 
ATOM 7537  O OE1 . GLN E 1 44  ? 29.651  65.136  72.861  1.00 23.92 ? 44  GLN E OE1 1 
ATOM 7538  N NE2 . GLN E 1 44  ? 27.432  64.935  73.133  1.00 24.41 ? 44  GLN E NE2 1 
ATOM 7539  N N   . TRP E 1 45  ? 27.399  70.328  72.916  1.00 20.35 ? 45  TRP E N   1 
ATOM 7540  C CA  . TRP E 1 45  ? 28.070  71.376  72.166  1.00 16.89 ? 45  TRP E CA  1 
ATOM 7541  C C   . TRP E 1 45  ? 27.945  72.715  72.879  1.00 16.72 ? 45  TRP E C   1 
ATOM 7542  O O   . TRP E 1 45  ? 28.942  73.411  73.071  1.00 17.48 ? 45  TRP E O   1 
ATOM 7543  C CB  . TRP E 1 45  ? 27.496  71.485  70.747  1.00 15.97 ? 45  TRP E CB  1 
ATOM 7544  C CG  . TRP E 1 45  ? 27.854  72.777  70.057  1.00 14.94 ? 45  TRP E CG  1 
ATOM 7545  C CD1 . TRP E 1 45  ? 26.990  73.753  69.643  1.00 15.32 ? 45  TRP E CD1 1 
ATOM 7546  C CD2 . TRP E 1 45  ? 29.173  73.257  69.759  1.00 16.75 ? 45  TRP E CD2 1 
ATOM 7547  N NE1 . TRP E 1 45  ? 27.687  74.813  69.115  1.00 13.89 ? 45  TRP E NE1 1 
ATOM 7548  C CE2 . TRP E 1 45  ? 29.026  74.536  69.170  1.00 16.48 ? 45  TRP E CE2 1 
ATOM 7549  C CE3 . TRP E 1 45  ? 30.460  72.734  69.931  1.00 16.95 ? 45  TRP E CE3 1 
ATOM 7550  C CZ2 . TRP E 1 45  ? 30.121  75.298  68.756  1.00 16.08 ? 45  TRP E CZ2 1 
ATOM 7551  C CZ3 . TRP E 1 45  ? 31.549  73.494  69.518  1.00 15.84 ? 45  TRP E CZ3 1 
ATOM 7552  C CH2 . TRP E 1 45  ? 31.371  74.762  68.937  1.00 13.44 ? 45  TRP E CH2 1 
ATOM 7553  N N   . LEU E 1 46  ? 26.725  73.057  73.291  1.00 18.53 ? 46  LEU E N   1 
ATOM 7554  C CA  . LEU E 1 46  ? 26.456  74.330  73.960  1.00 19.86 ? 46  LEU E CA  1 
ATOM 7555  C C   . LEU E 1 46  ? 27.392  74.636  75.121  1.00 21.63 ? 46  LEU E C   1 
ATOM 7556  O O   . LEU E 1 46  ? 27.681  75.801  75.401  1.00 20.52 ? 46  LEU E O   1 
ATOM 7557  C CB  . LEU E 1 46  ? 25.000  74.404  74.416  1.00 18.65 ? 46  LEU E CB  1 
ATOM 7558  C CG  . LEU E 1 46  ? 23.963  74.416  73.290  1.00 17.37 ? 46  LEU E CG  1 
ATOM 7559  C CD1 . LEU E 1 46  ? 22.571  74.533  73.884  1.00 21.08 ? 46  LEU E CD1 1 
ATOM 7560  C CD2 . LEU E 1 46  ? 24.237  75.563  72.323  1.00 16.92 ? 46  LEU E CD2 1 
ATOM 7561  N N   . ASN E 1 47  ? 27.861  73.596  75.799  1.00 22.31 ? 47  ASN E N   1 
ATOM 7562  C CA  . ASN E 1 47  ? 28.788  73.786  76.904  1.00 20.89 ? 47  ASN E CA  1 
ATOM 7563  C C   . ASN E 1 47  ? 30.101  74.285  76.323  1.00 18.56 ? 47  ASN E C   1 
ATOM 7564  O O   . ASN E 1 47  ? 30.485  75.435  76.501  1.00 20.94 ? 47  ASN E O   1 
ATOM 7565  C CB  . ASN E 1 47  ? 29.042  72.464  77.637  1.00 23.05 ? 47  ASN E CB  1 
ATOM 7566  C CG  . ASN E 1 47  ? 27.891  72.058  78.533  1.00 24.94 ? 47  ASN E CG  1 
ATOM 7567  O OD1 . ASN E 1 47  ? 27.703  72.619  79.608  1.00 24.47 ? 47  ASN E OD1 1 
ATOM 7568  N ND2 . ASN E 1 47  ? 27.131  71.061  78.108  1.00 26.25 ? 47  ASN E ND2 1 
ATOM 7569  N N   . GLU E 1 48  ? 30.736  73.440  75.540  1.00 19.01 ? 48  GLU E N   1 
ATOM 7570  C CA  . GLU E 1 48  ? 32.024  73.727  74.937  1.00 15.55 ? 48  GLU E CA  1 
ATOM 7571  C C   . GLU E 1 48  ? 32.058  74.881  73.942  1.00 15.57 ? 48  GLU E C   1 
ATOM 7572  O O   . GLU E 1 48  ? 33.121  75.469  73.751  1.00 17.09 ? 48  GLU E O   1 
ATOM 7573  C CB  . GLU E 1 48  ? 32.607  72.465  74.298  1.00 16.01 ? 48  GLU E CB  1 
ATOM 7574  C CG  . GLU E 1 48  ? 32.721  71.304  75.271  1.00 15.52 ? 48  GLU E CG  1 
ATOM 7575  C CD  . GLU E 1 48  ? 33.715  70.237  74.842  1.00 18.83 ? 48  GLU E CD  1 
ATOM 7576  O OE1 . GLU E 1 48  ? 34.533  70.482  73.927  1.00 17.43 ? 48  GLU E OE1 1 
ATOM 7577  O OE2 . GLU E 1 48  ? 33.690  69.146  75.445  1.00 17.14 ? 48  GLU E OE2 1 
ATOM 7578  N N   . LYS E 1 49  ? 30.908  75.240  73.375  1.00 13.19 ? 49  LYS E N   1 
ATOM 7579  C CA  . LYS E 1 49  ? 30.815  76.320  72.384  1.00 13.40 ? 49  LYS E CA  1 
ATOM 7580  C C   . LYS E 1 49  ? 31.705  77.554  72.626  1.00 11.41 ? 49  LYS E C   1 
ATOM 7581  O O   . LYS E 1 49  ? 32.659  77.793  71.891  1.00 9.84  ? 49  LYS E O   1 
ATOM 7582  C CB  . LYS E 1 49  ? 29.360  76.785  72.233  1.00 17.58 ? 49  LYS E CB  1 
ATOM 7583  C CG  . LYS E 1 49  ? 29.180  77.969  71.286  1.00 18.74 ? 49  LYS E CG  1 
ATOM 7584  C CD  . LYS E 1 49  ? 27.716  78.272  71.012  1.00 18.80 ? 49  LYS E CD  1 
ATOM 7585  C CE  . LYS E 1 49  ? 27.560  79.480  70.094  1.00 18.96 ? 49  LYS E CE  1 
ATOM 7586  N NZ  . LYS E 1 49  ? 26.134  79.845  69.870  1.00 18.56 ? 49  LYS E NZ  1 
ATOM 7587  N N   . PHE E 1 50  ? 31.389  78.273  73.672  1.00 9.19  ? 50  PHE E N   1 
ATOM 7588  C CA  . PHE E 1 50  ? 32.116  79.482  74.032  1.00 12.24 ? 50  PHE E CA  1 
ATOM 7589  C C   . PHE E 1 50  ? 33.441  79.185  74.739  1.00 14.16 ? 50  PHE E C   1 
ATOM 7590  O O   . PHE E 1 50  ? 34.294  80.067  74.868  1.00 16.17 ? 50  PHE E O   1 
ATOM 7591  C CB  . PHE E 1 50  ? 31.223  80.367  74.902  1.00 10.71 ? 50  PHE E CB  1 
ATOM 7592  C CG  . PHE E 1 50  ? 29.763  80.308  74.528  1.00 12.46 ? 50  PHE E CG  1 
ATOM 7593  C CD1 . PHE E 1 50  ? 28.961  79.250  74.963  1.00 11.01 ? 50  PHE E CD1 1 
ATOM 7594  C CD2 . PHE E 1 50  ? 29.190  81.298  73.744  1.00 5.81  ? 50  PHE E CD2 1 
ATOM 7595  C CE1 . PHE E 1 50  ? 27.616  79.182  74.624  1.00 10.91 ? 50  PHE E CE1 1 
ATOM 7596  C CE2 . PHE E 1 50  ? 27.846  81.240  73.401  1.00 8.69  ? 50  PHE E CE2 1 
ATOM 7597  C CZ  . PHE E 1 50  ? 27.057  80.177  73.843  1.00 12.31 ? 50  PHE E CZ  1 
ATOM 7598  N N   . LYS E 1 51  ? 33.618  77.934  75.162  1.00 11.63 ? 51  LYS E N   1 
ATOM 7599  C CA  . LYS E 1 51  ? 34.830  77.510  75.853  1.00 12.71 ? 51  LYS E CA  1 
ATOM 7600  C C   . LYS E 1 51  ? 36.067  77.410  74.979  1.00 10.62 ? 51  LYS E C   1 
ATOM 7601  O O   . LYS E 1 51  ? 37.088  77.951  75.326  1.00 13.69 ? 51  LYS E O   1 
ATOM 7602  C CB  . LYS E 1 51  ? 34.617  76.169  76.557  1.00 15.20 ? 51  LYS E CB  1 
ATOM 7603  C CG  . LYS E 1 51  ? 33.802  76.257  77.823  1.00 19.09 ? 51  LYS E CG  1 
ATOM 7604  C CD  . LYS E 1 51  ? 33.504  74.879  78.391  1.00 20.27 ? 51  LYS E CD  1 
ATOM 7605  C CE  . LYS E 1 51  ? 32.525  74.966  79.558  1.00 21.15 ? 51  LYS E CE  1 
ATOM 7606  N NZ  . LYS E 1 51  ? 31.963  73.638  79.942  1.00 17.35 ? 51  LYS E NZ  1 
ATOM 7607  N N   . LEU E 1 52  ? 35.963  76.751  73.831  1.00 9.28  ? 52  LEU E N   1 
ATOM 7608  C CA  . LEU E 1 52  ? 37.130  76.566  72.966  1.00 6.20  ? 52  LEU E CA  1 
ATOM 7609  C C   . LEU E 1 52  ? 37.662  77.837  72.251  1.00 6.76  ? 52  LEU E C   1 
ATOM 7610  O O   . LEU E 1 52  ? 38.359  77.722  71.238  1.00 5.37  ? 52  LEU E O   1 
ATOM 7611  C CB  . LEU E 1 52  ? 36.890  75.463  71.955  1.00 7.83  ? 52  LEU E CB  1 
ATOM 7612  C CG  . LEU E 1 52  ? 35.821  74.424  72.294  1.00 10.94 ? 52  LEU E CG  1 
ATOM 7613  C CD1 . LEU E 1 52  ? 34.586  74.740  71.479  1.00 11.68 ? 52  LEU E CD1 1 
ATOM 7614  C CD2 . LEU E 1 52  ? 36.297  73.012  71.975  1.00 11.09 ? 52  LEU E CD2 1 
ATOM 7615  N N   . GLY E 1 53  ? 37.340  79.022  72.780  1.00 7.31  ? 53  GLY E N   1 
ATOM 7616  C CA  . GLY E 1 53  ? 37.803  80.285  72.212  1.00 6.83  ? 53  GLY E CA  1 
ATOM 7617  C C   . GLY E 1 53  ? 37.756  80.458  70.700  1.00 7.66  ? 53  GLY E C   1 
ATOM 7618  O O   . GLY E 1 53  ? 38.699  81.039  70.115  1.00 6.00  ? 53  GLY E O   1 
ATOM 7619  N N   . LEU E 1 54  ? 36.675  79.986  70.075  1.00 8.88  ? 54  LEU E N   1 
ATOM 7620  C CA  . LEU E 1 54  ? 36.503  80.078  68.619  1.00 6.83  ? 54  LEU E CA  1 
ATOM 7621  C C   . LEU E 1 54  ? 35.985  81.467  68.226  1.00 5.08  ? 54  LEU E C   1 
ATOM 7622  O O   . LEU E 1 54  ? 35.013  81.933  68.812  1.00 5.96  ? 54  LEU E O   1 
ATOM 7623  C CB  . LEU E 1 54  ? 35.524  79.002  68.147  1.00 6.21  ? 54  LEU E CB  1 
ATOM 7624  C CG  . LEU E 1 54  ? 35.897  77.564  68.505  1.00 2.56  ? 54  LEU E CG  1 
ATOM 7625  C CD1 . LEU E 1 54  ? 34.690  76.666  68.398  1.00 3.12  ? 54  LEU E CD1 1 
ATOM 7626  C CD2 . LEU E 1 54  ? 37.008  77.090  67.597  1.00 6.15  ? 54  LEU E CD2 1 
ATOM 7627  N N   . ASP E 1 55  ? 36.630  82.093  67.224  1.00 4.02  ? 55  ASP E N   1 
ATOM 7628  C CA  . ASP E 1 55  ? 36.256  83.428  66.769  1.00 5.29  ? 55  ASP E CA  1 
ATOM 7629  C C   . ASP E 1 55  ? 34.753  83.542  66.661  1.00 9.11  ? 55  ASP E C   1 
ATOM 7630  O O   . ASP E 1 55  ? 34.115  84.336  67.354  1.00 10.52 ? 55  ASP E O   1 
ATOM 7631  C CB  . ASP E 1 55  ? 36.843  83.677  65.388  1.00 7.35  ? 55  ASP E CB  1 
ATOM 7632  C CG  . ASP E 1 55  ? 38.309  83.471  65.350  1.00 10.63 ? 55  ASP E CG  1 
ATOM 7633  O OD1 . ASP E 1 55  ? 39.044  84.322  65.917  1.00 9.01  ? 55  ASP E OD1 1 
ATOM 7634  O OD2 . ASP E 1 55  ? 38.757  82.460  64.754  1.00 9.05  ? 55  ASP E OD2 1 
ATOM 7635  N N   . PHE E 1 56  ? 34.208  82.754  65.744  1.00 11.91 ? 56  PHE E N   1 
ATOM 7636  C CA  . PHE E 1 56  ? 32.780  82.704  65.504  1.00 8.47  ? 56  PHE E CA  1 
ATOM 7637  C C   . PHE E 1 56  ? 32.403  81.298  65.897  1.00 5.38  ? 56  PHE E C   1 
ATOM 7638  O O   . PHE E 1 56  ? 32.732  80.350  65.178  1.00 5.80  ? 56  PHE E O   1 
ATOM 7639  C CB  . PHE E 1 56  ? 32.481  82.886  64.020  1.00 7.93  ? 56  PHE E CB  1 
ATOM 7640  C CG  . PHE E 1 56  ? 32.936  84.195  63.463  1.00 2.00  ? 56  PHE E CG  1 
ATOM 7641  C CD1 . PHE E 1 56  ? 32.101  85.304  63.513  1.00 6.59  ? 56  PHE E CD1 1 
ATOM 7642  C CD2 . PHE E 1 56  ? 34.177  84.313  62.841  1.00 2.00  ? 56  PHE E CD2 1 
ATOM 7643  C CE1 . PHE E 1 56  ? 32.490  86.518  62.944  1.00 6.52  ? 56  PHE E CE1 1 
ATOM 7644  C CE2 . PHE E 1 56  ? 34.574  85.523  62.269  1.00 3.99  ? 56  PHE E CE2 1 
ATOM 7645  C CZ  . PHE E 1 56  ? 33.727  86.627  62.321  1.00 2.00  ? 56  PHE E CZ  1 
ATOM 7646  N N   . PRO E 1 57  ? 31.848  81.124  67.098  1.00 5.87  ? 57  PRO E N   1 
ATOM 7647  C CA  . PRO E 1 57  ? 31.471  79.768  67.499  1.00 6.93  ? 57  PRO E CA  1 
ATOM 7648  C C   . PRO E 1 57  ? 30.586  79.092  66.430  1.00 6.10  ? 57  PRO E C   1 
ATOM 7649  O O   . PRO E 1 57  ? 29.539  79.644  66.051  1.00 2.83  ? 57  PRO E O   1 
ATOM 7650  C CB  . PRO E 1 57  ? 30.750  79.992  68.838  1.00 7.19  ? 57  PRO E CB  1 
ATOM 7651  C CG  . PRO E 1 57  ? 30.419  81.451  68.854  1.00 9.98  ? 57  PRO E CG  1 
ATOM 7652  C CD  . PRO E 1 57  ? 31.586  82.083  68.177  1.00 6.79  ? 57  PRO E CD  1 
ATOM 7653  N N   . ASN E 1 58  ? 31.043  77.972  65.909  1.00 3.59  ? 58  ASN E N   1 
ATOM 7654  C CA  . ASN E 1 58  ? 30.315  77.259  64.859  1.00 6.06  ? 58  ASN E CA  1 
ATOM 7655  C C   . ASN E 1 58  ? 30.853  75.829  64.756  1.00 8.00  ? 58  ASN E C   1 
ATOM 7656  O O   . ASN E 1 58  ? 32.040  75.594  64.991  1.00 2.84  ? 58  ASN E O   1 
ATOM 7657  C CB  . ASN E 1 58  ? 30.491  78.024  63.525  1.00 8.26  ? 58  ASN E CB  1 
ATOM 7658  C CG  . ASN E 1 58  ? 29.906  77.292  62.313  1.00 7.67  ? 58  ASN E CG  1 
ATOM 7659  O OD1 . ASN E 1 58  ? 28.720  77.416  62.007  1.00 9.78  ? 58  ASN E OD1 1 
ATOM 7660  N ND2 . ASN E 1 58  ? 30.754  76.565  61.579  1.00 5.60  ? 58  ASN E ND2 1 
ATOM 7661  N N   . LEU E 1 59  ? 29.968  74.884  64.442  1.00 8.35  ? 59  LEU E N   1 
ATOM 7662  C CA  . LEU E 1 59  ? 30.312  73.467  64.296  1.00 9.55  ? 59  LEU E CA  1 
ATOM 7663  C C   . LEU E 1 59  ? 30.191  73.115  62.818  1.00 10.49 ? 59  LEU E C   1 
ATOM 7664  O O   . LEU E 1 59  ? 29.135  73.330  62.252  1.00 14.96 ? 59  LEU E O   1 
ATOM 7665  C CB  . LEU E 1 59  ? 29.300  72.621  65.072  1.00 8.90  ? 59  LEU E CB  1 
ATOM 7666  C CG  . LEU E 1 59  ? 29.720  71.823  66.307  1.00 6.92  ? 59  LEU E CG  1 
ATOM 7667  C CD1 . LEU E 1 59  ? 28.524  71.112  66.905  1.00 3.34  ? 59  LEU E CD1 1 
ATOM 7668  C CD2 . LEU E 1 59  ? 30.761  70.823  65.935  1.00 5.59  ? 59  LEU E CD2 1 
ATOM 7669  N N   . PRO E 1 60  ? 31.211  72.472  62.218  1.00 11.05 ? 60  PRO E N   1 
ATOM 7670  C CA  . PRO E 1 60  ? 32.493  72.019  62.740  1.00 13.19 ? 60  PRO E CA  1 
ATOM 7671  C C   . PRO E 1 60  ? 33.555  73.086  62.833  1.00 13.57 ? 60  PRO E C   1 
ATOM 7672  O O   . PRO E 1 60  ? 33.359  74.225  62.342  1.00 17.04 ? 60  PRO E O   1 
ATOM 7673  C CB  . PRO E 1 60  ? 32.900  70.934  61.762  1.00 14.01 ? 60  PRO E CB  1 
ATOM 7674  C CG  . PRO E 1 60  ? 32.451  71.498  60.485  1.00 13.75 ? 60  PRO E CG  1 
ATOM 7675  C CD  . PRO E 1 60  ? 31.098  72.061  60.808  1.00 12.45 ? 60  PRO E CD  1 
ATOM 7676  N N   . TYR E 1 61  ? 34.690  72.741  63.424  1.00 10.38 ? 61  TYR E N   1 
ATOM 7677  C CA  . TYR E 1 61  ? 35.825  73.648  63.579  1.00 11.46 ? 61  TYR E CA  1 
ATOM 7678  C C   . TYR E 1 61  ? 37.106  72.824  63.494  1.00 10.89 ? 61  TYR E C   1 
ATOM 7679  O O   . TYR E 1 61  ? 37.070  71.581  63.657  1.00 11.62 ? 61  TYR E O   1 
ATOM 7680  C CB  . TYR E 1 61  ? 35.747  74.390  64.917  1.00 9.82  ? 61  TYR E CB  1 
ATOM 7681  C CG  . TYR E 1 61  ? 35.613  73.476  66.110  1.00 7.89  ? 61  TYR E CG  1 
ATOM 7682  C CD1 . TYR E 1 61  ? 36.713  72.768  66.596  1.00 9.70  ? 61  TYR E CD1 1 
ATOM 7683  C CD2 . TYR E 1 61  ? 34.389  73.309  66.748  1.00 9.08  ? 61  TYR E CD2 1 
ATOM 7684  C CE1 . TYR E 1 61  ? 36.597  71.920  67.681  1.00 10.22 ? 61  TYR E CE1 1 
ATOM 7685  C CE2 . TYR E 1 61  ? 34.262  72.459  67.840  1.00 12.73 ? 61  TYR E CE2 1 
ATOM 7686  C CZ  . TYR E 1 61  ? 35.372  71.769  68.300  1.00 14.64 ? 61  TYR E CZ  1 
ATOM 7687  O OH  . TYR E 1 61  ? 35.264  70.941  69.386  1.00 19.73 ? 61  TYR E OH  1 
ATOM 7688  N N   . LEU E 1 62  ? 38.234  73.488  63.264  1.00 10.62 ? 62  LEU E N   1 
ATOM 7689  C CA  . LEU E 1 62  ? 39.508  72.790  63.151  1.00 10.90 ? 62  LEU E CA  1 
ATOM 7690  C C   . LEU E 1 62  ? 40.550  73.428  64.053  1.00 12.98 ? 62  LEU E C   1 
ATOM 7691  O O   . LEU E 1 62  ? 41.105  74.483  63.736  1.00 11.68 ? 62  LEU E O   1 
ATOM 7692  C CB  . LEU E 1 62  ? 40.009  72.805  61.703  1.00 10.08 ? 62  LEU E CB  1 
ATOM 7693  C CG  . LEU E 1 62  ? 41.205  71.899  61.381  1.00 5.19  ? 62  LEU E CG  1 
ATOM 7694  C CD1 . LEU E 1 62  ? 40.804  70.428  61.514  1.00 2.00  ? 62  LEU E CD1 1 
ATOM 7695  C CD2 . LEU E 1 62  ? 41.708  72.193  59.977  1.00 4.14  ? 62  LEU E CD2 1 
ATOM 7696  N N   . ILE E 1 63  ? 40.820  72.784  65.178  1.00 15.23 ? 63  ILE E N   1 
ATOM 7697  C CA  . ILE E 1 63  ? 41.795  73.311  66.110  1.00 14.66 ? 63  ILE E CA  1 
ATOM 7698  C C   . ILE E 1 63  ? 43.185  72.869  65.680  1.00 15.17 ? 63  ILE E C   1 
ATOM 7699  O O   . ILE E 1 63  ? 43.609  71.759  65.999  1.00 15.08 ? 63  ILE E O   1 
ATOM 7700  C CB  . ILE E 1 63  ? 41.520  72.829  67.549  1.00 15.28 ? 63  ILE E CB  1 
ATOM 7701  C CG1 . ILE E 1 63  ? 40.030  72.968  67.879  1.00 13.17 ? 63  ILE E CG1 1 
ATOM 7702  C CG2 . ILE E 1 63  ? 42.362  73.632  68.535  1.00 17.26 ? 63  ILE E CG2 1 
ATOM 7703  C CD1 . ILE E 1 63  ? 39.661  72.580  69.295  1.00 14.24 ? 63  ILE E CD1 1 
ATOM 7704  N N   . ASP E 1 64  ? 43.854  73.672  64.874  1.00 17.73 ? 64  ASP E N   1 
ATOM 7705  C CA  . ASP E 1 64  ? 45.203  73.356  64.446  1.00 20.05 ? 64  ASP E CA  1 
ATOM 7706  C C   . ASP E 1 64  ? 46.229  74.002  65.357  1.00 17.51 ? 64  ASP E C   1 
ATOM 7707  O O   . ASP E 1 64  ? 46.801  75.049  65.014  1.00 13.75 ? 64  ASP E O   1 
ATOM 7708  C CB  . ASP E 1 64  ? 45.470  73.765  62.996  1.00 23.48 ? 64  ASP E CB  1 
ATOM 7709  C CG  . ASP E 1 64  ? 46.764  73.162  62.462  1.00 22.94 ? 64  ASP E CG  1 
ATOM 7710  O OD1 . ASP E 1 64  ? 46.753  71.969  62.090  1.00 17.98 ? 64  ASP E OD1 1 
ATOM 7711  O OD2 . ASP E 1 64  ? 47.799  73.864  62.451  1.00 21.61 ? 64  ASP E OD2 1 
ATOM 7712  N N   . GLY E 1 65  ? 46.448  73.361  66.502  1.00 18.68 ? 65  GLY E N   1 
ATOM 7713  C CA  . GLY E 1 65  ? 47.407  73.839  67.479  1.00 19.36 ? 65  GLY E CA  1 
ATOM 7714  C C   . GLY E 1 65  ? 47.138  75.261  67.906  1.00 20.22 ? 65  GLY E C   1 
ATOM 7715  O O   . GLY E 1 65  ? 46.362  75.500  68.830  1.00 19.74 ? 65  GLY E O   1 
ATOM 7716  N N   . ALA E 1 66  ? 47.759  76.196  67.192  1.00 19.51 ? 66  ALA E N   1 
ATOM 7717  C CA  . ALA E 1 66  ? 47.628  77.622  67.472  1.00 18.20 ? 66  ALA E CA  1 
ATOM 7718  C C   . ALA E 1 66  ? 46.463  78.276  66.755  1.00 20.29 ? 66  ALA E C   1 
ATOM 7719  O O   . ALA E 1 66  ? 46.208  79.467  66.927  1.00 22.32 ? 66  ALA E O   1 
ATOM 7720  C CB  . ALA E 1 66  ? 48.925  78.342  67.121  1.00 18.58 ? 66  ALA E CB  1 
ATOM 7721  N N   . HIS E 1 67  ? 45.779  77.522  65.879  1.00 20.05 ? 67  HIS E N   1 
ATOM 7722  C CA  . HIS E 1 67  ? 44.659  78.078  65.129  1.00 16.86 ? 67  HIS E CA  1 
ATOM 7723  C C   . HIS E 1 67  ? 43.389  77.269  65.322  1.00 13.66 ? 67  HIS E C   1 
ATOM 7724  O O   . HIS E 1 67  ? 43.429  76.062  65.492  1.00 10.66 ? 67  HIS E O   1 
ATOM 7725  C CB  . HIS E 1 67  ? 44.943  78.126  63.621  1.00 15.67 ? 67  HIS E CB  1 
ATOM 7726  C CG  . HIS E 1 67  ? 46.389  78.258  63.265  1.00 10.73 ? 67  HIS E CG  1 
ATOM 7727  N ND1 . HIS E 1 67  ? 47.166  77.171  62.920  1.00 9.19  ? 67  HIS E ND1 1 
ATOM 7728  C CD2 . HIS E 1 67  ? 47.182  79.346  63.136  1.00 3.97  ? 67  HIS E CD2 1 
ATOM 7729  C CE1 . HIS E 1 67  ? 48.375  77.586  62.590  1.00 9.31  ? 67  HIS E CE1 1 
ATOM 7730  N NE2 . HIS E 1 67  ? 48.411  78.902  62.712  1.00 4.33  ? 67  HIS E NE2 1 
ATOM 7731  N N   . LYS E 1 68  ? 42.266  77.953  65.281  1.00 15.74 ? 68  LYS E N   1 
ATOM 7732  C CA  . LYS E 1 68  ? 40.951  77.372  65.395  1.00 15.12 ? 68  LYS E CA  1 
ATOM 7733  C C   . LYS E 1 68  ? 40.243  77.845  64.137  1.00 14.22 ? 68  LYS E C   1 
ATOM 7734  O O   . LYS E 1 68  ? 39.825  79.018  64.052  1.00 16.08 ? 68  LYS E O   1 
ATOM 7735  C CB  . LYS E 1 68  ? 40.200  77.917  66.609  1.00 16.48 ? 68  LYS E CB  1 
ATOM 7736  C CG  . LYS E 1 68  ? 40.581  77.313  67.946  1.00 16.91 ? 68  LYS E CG  1 
ATOM 7737  C CD  . LYS E 1 68  ? 41.777  77.998  68.590  1.00 15.57 ? 68  LYS E CD  1 
ATOM 7738  C CE  . LYS E 1 68  ? 41.816  77.695  70.085  1.00 15.54 ? 68  LYS E CE  1 
ATOM 7739  N NZ  . LYS E 1 68  ? 41.726  76.225  70.384  1.00 17.69 ? 68  LYS E NZ  1 
ATOM 7740  N N   . ILE E 1 69  ? 40.195  76.986  63.128  1.00 16.40 ? 69  ILE E N   1 
ATOM 7741  C CA  . ILE E 1 69  ? 39.541  77.332  61.873  1.00 16.87 ? 69  ILE E CA  1 
ATOM 7742  C C   . ILE E 1 69  ? 38.067  76.954  61.979  1.00 16.61 ? 69  ILE E C   1 
ATOM 7743  O O   . ILE E 1 69  ? 37.730  75.773  62.087  1.00 13.63 ? 69  ILE E O   1 
ATOM 7744  C CB  . ILE E 1 69  ? 40.158  76.577  60.673  1.00 18.09 ? 69  ILE E CB  1 
ATOM 7745  C CG1 . ILE E 1 69  ? 41.668  76.388  60.860  1.00 18.81 ? 69  ILE E CG1 1 
ATOM 7746  C CG2 . ILE E 1 69  ? 39.896  77.352  59.395  1.00 20.59 ? 69  ILE E CG2 1 
ATOM 7747  C CD1 . ILE E 1 69  ? 42.452  77.665  60.900  1.00 17.53 ? 69  ILE E CD1 1 
ATOM 7748  N N   . THR E 1 70  ? 37.281  77.964  62.019  1.00 16.23 ? 70  THR E N   1 
ATOM 7749  C CA  . THR E 1 70  ? 35.849  77.727  62.130  1.00 14.64 ? 70  THR E CA  1 
ATOM 7750  C C   . THR E 1 70  ? 35.119  78.159  60.860  1.00 14.38 ? 70  THR E C   1 
ATOM 7751  O O   . THR E 1 70  ? 35.178  79.331  60.487  1.00 11.86 ? 70  THR E O   1 
ATOM 7752  C CB  . THR E 1 70  ? 35.253  78.487  63.330  1.00 15.07 ? 70  THR E CB  1 
ATOM 7753  O OG1 . THR E 1 70  ? 36.131  78.373  64.459  1.00 10.72 ? 70  THR E OG1 1 
ATOM 7754  C CG2 . THR E 1 70  ? 33.899  77.908  63.695  1.00 13.51 ? 70  THR E CG2 1 
ATOM 7755  N N   . GLN E 1 71  ? 34.477  77.187  60.204  1.00 17.05 ? 71  GLN E N   1 
ATOM 7756  C CA  . GLN E 1 71  ? 33.686  77.335  58.968  1.00 13.64 ? 71  GLN E CA  1 
ATOM 7757  C C   . GLN E 1 71  ? 34.076  76.258  57.955  1.00 14.25 ? 71  GLN E C   1 
ATOM 7758  O O   . GLN E 1 71  ? 35.257  75.960  57.782  1.00 11.07 ? 71  GLN E O   1 
ATOM 7759  C CB  . GLN E 1 71  ? 33.824  78.722  58.327  1.00 12.38 ? 71  GLN E CB  1 
ATOM 7760  C CG  . GLN E 1 71  ? 32.829  78.998  57.219  1.00 10.25 ? 71  GLN E CG  1 
ATOM 7761  C CD  . GLN E 1 71  ? 31.388  78.824  57.660  1.00 12.23 ? 71  GLN E CD  1 
ATOM 7762  O OE1 . GLN E 1 71  ? 30.683  77.947  57.165  1.00 15.59 ? 71  GLN E OE1 1 
ATOM 7763  N NE2 . GLN E 1 71  ? 30.949  79.647  58.603  1.00 5.51  ? 71  GLN E NE2 1 
ATOM 7764  N N   . SER E 1 72  ? 33.076  75.713  57.265  1.00 15.49 ? 72  SER E N   1 
ATOM 7765  C CA  . SER E 1 72  ? 33.261  74.655  56.271  1.00 15.49 ? 72  SER E CA  1 
ATOM 7766  C C   . SER E 1 72  ? 34.404  74.876  55.276  1.00 13.18 ? 72  SER E C   1 
ATOM 7767  O O   . SER E 1 72  ? 35.453  74.228  55.369  1.00 14.57 ? 72  SER E O   1 
ATOM 7768  C CB  . SER E 1 72  ? 31.953  74.433  55.507  1.00 12.06 ? 72  SER E CB  1 
ATOM 7769  O OG  . SER E 1 72  ? 30.859  74.329  56.400  1.00 16.03 ? 72  SER E OG  1 
ATOM 7770  N N   . ASN E 1 73  ? 34.242  75.852  54.325  1.00 12.56 ? 73  ASN E N   1 
ATOM 7771  C CA  . ASN E 1 73  ? 35.242  76.149  53.300  1.00 12.77 ? 73  ASN E CA  1 
ATOM 7772  C C   . ASN E 1 73  ? 36.574  76.562  53.931  1.00 14.44 ? 73  ASN E C   1 
ATOM 7773  O O   . ASN E 1 73  ? 37.638  76.206  53.422  1.00 15.49 ? 73  ASN E O   1 
ATOM 7774  C CB  . ASN E 1 73  ? 34.742  77.238  52.327  1.00 11.51 ? 73  ASN E CB  1 
ATOM 7775  C CG  . ASN E 1 73  ? 33.573  76.771  51.448  1.00 10.89 ? 73  ASN E CG  1 
ATOM 7776  O OD1 . ASN E 1 73  ? 33.182  75.607  51.474  1.00 2.00  ? 73  ASN E OD1 1 
ATOM 7777  N ND2 . ASN E 1 73  ? 33.015  77.689  50.667  1.00 8.59  ? 73  ASN E ND2 1 
ATOM 7778  N N   . ALA E 1 74  ? 36.505  77.272  55.059  1.00 14.63 ? 74  ALA E N   1 
ATOM 7779  C CA  . ALA E 1 74  ? 37.692  77.745  55.782  1.00 13.27 ? 74  ALA E CA  1 
ATOM 7780  C C   . ALA E 1 74  ? 38.601  76.607  56.256  1.00 13.72 ? 74  ALA E C   1 
ATOM 7781  O O   . ALA E 1 74  ? 39.825  76.709  56.198  1.00 13.70 ? 74  ALA E O   1 
ATOM 7782  C CB  . ALA E 1 74  ? 37.279  78.606  56.969  1.00 11.18 ? 74  ALA E CB  1 
ATOM 7783  N N   . ILE E 1 75  ? 37.996  75.537  56.733  1.00 14.08 ? 75  ILE E N   1 
ATOM 7784  C CA  . ILE E 1 75  ? 38.749  74.382  57.190  1.00 13.81 ? 75  ILE E CA  1 
ATOM 7785  C C   . ILE E 1 75  ? 39.352  73.672  55.983  1.00 14.19 ? 75  ILE E C   1 
ATOM 7786  O O   . ILE E 1 75  ? 40.512  73.253  56.003  1.00 14.44 ? 75  ILE E O   1 
ATOM 7787  C CB  . ILE E 1 75  ? 37.822  73.436  57.968  1.00 14.56 ? 75  ILE E CB  1 
ATOM 7788  C CG1 . ILE E 1 75  ? 37.323  74.145  59.228  1.00 12.76 ? 75  ILE E CG1 1 
ATOM 7789  C CG2 . ILE E 1 75  ? 38.533  72.136  58.307  1.00 14.79 ? 75  ILE E CG2 1 
ATOM 7790  C CD1 . ILE E 1 75  ? 36.116  73.510  59.852  1.00 12.77 ? 75  ILE E CD1 1 
ATOM 7791  N N   . LEU E 1 76  ? 38.564  73.587  54.917  1.00 16.42 ? 76  LEU E N   1 
ATOM 7792  C CA  . LEU E 1 76  ? 38.980  72.942  53.676  1.00 17.22 ? 76  LEU E CA  1 
ATOM 7793  C C   . LEU E 1 76  ? 40.158  73.628  52.987  1.00 16.62 ? 76  LEU E C   1 
ATOM 7794  O O   . LEU E 1 76  ? 41.156  72.975  52.671  1.00 14.13 ? 76  LEU E O   1 
ATOM 7795  C CB  . LEU E 1 76  ? 37.796  72.841  52.717  1.00 13.01 ? 76  LEU E CB  1 
ATOM 7796  C CG  . LEU E 1 76  ? 36.686  71.873  53.119  1.00 9.86  ? 76  LEU E CG  1 
ATOM 7797  C CD1 . LEU E 1 76  ? 35.467  72.111  52.260  1.00 6.13  ? 76  LEU E CD1 1 
ATOM 7798  C CD2 . LEU E 1 76  ? 37.178  70.443  52.981  1.00 12.94 ? 76  LEU E CD2 1 
ATOM 7799  N N   . CYS E 1 77  ? 40.040  74.935  52.753  1.00 14.93 ? 77  CYS E N   1 
ATOM 7800  C CA  . CYS E 1 77  ? 41.099  75.706  52.105  1.00 14.85 ? 77  CYS E CA  1 
ATOM 7801  C C   . CYS E 1 77  ? 42.374  75.697  52.945  1.00 14.99 ? 77  CYS E C   1 
ATOM 7802  O O   . CYS E 1 77  ? 43.473  75.891  52.419  1.00 12.61 ? 77  CYS E O   1 
ATOM 7803  C CB  . CYS E 1 77  ? 40.660  77.153  51.863  1.00 16.76 ? 77  CYS E CB  1 
ATOM 7804  S SG  . CYS E 1 77  ? 39.182  77.379  50.845  1.00 19.35 ? 77  CYS E SG  1 
ATOM 7805  N N   . TYR E 1 78  ? 42.218  75.480  54.250  1.00 14.66 ? 78  TYR E N   1 
ATOM 7806  C CA  . TYR E 1 78  ? 43.348  75.430  55.171  1.00 14.45 ? 78  TYR E CA  1 
ATOM 7807  C C   . TYR E 1 78  ? 44.234  74.222  54.885  1.00 13.15 ? 78  TYR E C   1 
ATOM 7808  O O   . TYR E 1 78  ? 45.440  74.366  54.679  1.00 15.69 ? 78  TYR E O   1 
ATOM 7809  C CB  . TYR E 1 78  ? 42.865  75.399  56.622  1.00 18.29 ? 78  TYR E CB  1 
ATOM 7810  C CG  . TYR E 1 78  ? 43.980  75.425  57.649  1.00 19.53 ? 78  TYR E CG  1 
ATOM 7811  C CD1 . TYR E 1 78  ? 44.504  76.631  58.109  1.00 19.19 ? 78  TYR E CD1 1 
ATOM 7812  C CD2 . TYR E 1 78  ? 44.511  74.241  58.160  1.00 20.24 ? 78  TYR E CD2 1 
ATOM 7813  C CE1 . TYR E 1 78  ? 45.528  76.661  59.047  1.00 22.75 ? 78  TYR E CE1 1 
ATOM 7814  C CE2 . TYR E 1 78  ? 45.536  74.261  59.101  1.00 23.16 ? 78  TYR E CE2 1 
ATOM 7815  C CZ  . TYR E 1 78  ? 46.040  75.474  59.539  1.00 23.86 ? 78  TYR E CZ  1 
ATOM 7816  O OH  . TYR E 1 78  ? 47.056  75.505  60.468  1.00 23.66 ? 78  TYR E OH  1 
ATOM 7817  N N   . ILE E 1 79  ? 43.646  73.031  54.894  1.00 10.34 ? 79  ILE E N   1 
ATOM 7818  C CA  . ILE E 1 79  ? 44.412  71.824  54.604  1.00 11.00 ? 79  ILE E CA  1 
ATOM 7819  C C   . ILE E 1 79  ? 44.927  71.941  53.170  1.00 9.13  ? 79  ILE E C   1 
ATOM 7820  O O   . ILE E 1 79  ? 46.070  71.578  52.868  1.00 7.98  ? 79  ILE E O   1 
ATOM 7821  C CB  . ILE E 1 79  ? 43.548  70.531  54.738  1.00 10.62 ? 79  ILE E CB  1 
ATOM 7822  C CG1 . ILE E 1 79  ? 43.013  70.381  56.164  1.00 9.80  ? 79  ILE E CG1 1 
ATOM 7823  C CG2 . ILE E 1 79  ? 44.369  69.296  54.401  1.00 11.34 ? 79  ILE E CG2 1 
ATOM 7824  C CD1 . ILE E 1 79  ? 42.437  69.018  56.449  1.00 5.91  ? 79  ILE E CD1 1 
ATOM 7825  N N   . ALA E 1 80  ? 44.085  72.505  52.310  1.00 10.63 ? 80  ALA E N   1 
ATOM 7826  C CA  . ALA E 1 80  ? 44.399  72.696  50.899  1.00 10.45 ? 80  ALA E CA  1 
ATOM 7827  C C   . ALA E 1 80  ? 45.749  73.358  50.641  1.00 10.92 ? 80  ALA E C   1 
ATOM 7828  O O   . ALA E 1 80  ? 46.630  72.760  50.019  1.00 9.67  ? 80  ALA E O   1 
ATOM 7829  C CB  . ALA E 1 80  ? 43.293  73.485  50.234  1.00 7.78  ? 80  ALA E CB  1 
ATOM 7830  N N   . ARG E 1 81  ? 45.912  74.587  51.114  1.00 11.39 ? 81  ARG E N   1 
ATOM 7831  C CA  . ARG E 1 81  ? 47.171  75.298  50.922  1.00 12.65 ? 81  ARG E CA  1 
ATOM 7832  C C   . ARG E 1 81  ? 48.295  74.632  51.695  1.00 14.52 ? 81  ARG E C   1 
ATOM 7833  O O   . ARG E 1 81  ? 49.452  74.659  51.270  1.00 14.50 ? 81  ARG E O   1 
ATOM 7834  C CB  . ARG E 1 81  ? 47.041  76.761  51.327  1.00 11.21 ? 81  ARG E CB  1 
ATOM 7835  C CG  . ARG E 1 81  ? 46.314  76.982  52.619  1.00 12.10 ? 81  ARG E CG  1 
ATOM 7836  C CD  . ARG E 1 81  ? 46.117  78.461  52.839  1.00 14.39 ? 81  ARG E CD  1 
ATOM 7837  N NE  . ARG E 1 81  ? 44.870  78.754  53.536  1.00 18.07 ? 81  ARG E NE  1 
ATOM 7838  C CZ  . ARG E 1 81  ? 44.595  78.359  54.773  1.00 23.31 ? 81  ARG E CZ  1 
ATOM 7839  N NH1 . ARG E 1 81  ? 45.485  77.651  55.454  1.00 21.08 ? 81  ARG E NH1 1 
ATOM 7840  N NH2 . ARG E 1 81  ? 43.429  78.667  55.330  1.00 25.24 ? 81  ARG E NH2 1 
ATOM 7841  N N   . LYS E 1 82  ? 47.939  73.991  52.804  1.00 14.93 ? 82  LYS E N   1 
ATOM 7842  C CA  . LYS E 1 82  ? 48.913  73.296  53.635  1.00 16.10 ? 82  LYS E CA  1 
ATOM 7843  C C   . LYS E 1 82  ? 49.348  71.993  52.959  1.00 17.64 ? 82  LYS E C   1 
ATOM 7844  O O   . LYS E 1 82  ? 50.261  71.305  53.430  1.00 15.84 ? 82  LYS E O   1 
ATOM 7845  C CB  . LYS E 1 82  ? 48.320  73.025  55.017  1.00 16.27 ? 82  LYS E CB  1 
ATOM 7846  C CG  . LYS E 1 82  ? 49.349  72.908  56.104  1.00 18.48 ? 82  LYS E CG  1 
ATOM 7847  C CD  . LYS E 1 82  ? 48.720  73.115  57.456  1.00 19.80 ? 82  LYS E CD  1 
ATOM 7848  C CE  . LYS E 1 82  ? 49.790  73.245  58.533  1.00 21.29 ? 82  LYS E CE  1 
ATOM 7849  N NZ  . LYS E 1 82  ? 49.220  73.548  59.882  1.00 18.97 ? 82  LYS E NZ  1 
ATOM 7850  N N   . HIS E 1 83  ? 48.662  71.639  51.876  1.00 19.12 ? 83  HIS E N   1 
ATOM 7851  C CA  . HIS E 1 83  ? 48.984  70.445  51.107  1.00 20.56 ? 83  HIS E CA  1 
ATOM 7852  C C   . HIS E 1 83  ? 49.038  70.778  49.618  1.00 20.16 ? 83  HIS E C   1 
ATOM 7853  O O   . HIS E 1 83  ? 49.074  69.881  48.771  1.00 19.39 ? 83  HIS E O   1 
ATOM 7854  C CB  . HIS E 1 83  ? 47.964  69.333  51.374  1.00 20.76 ? 83  HIS E CB  1 
ATOM 7855  C CG  . HIS E 1 83  ? 48.197  68.595  52.655  1.00 25.69 ? 83  HIS E CG  1 
ATOM 7856  N ND1 . HIS E 1 83  ? 49.254  67.724  52.833  1.00 28.44 ? 83  HIS E ND1 1 
ATOM 7857  C CD2 . HIS E 1 83  ? 47.510  68.590  53.821  1.00 27.70 ? 83  HIS E CD2 1 
ATOM 7858  C CE1 . HIS E 1 83  ? 49.204  67.216  54.052  1.00 27.02 ? 83  HIS E CE1 1 
ATOM 7859  N NE2 . HIS E 1 83  ? 48.156  67.726  54.671  1.00 30.09 ? 83  HIS E NE2 1 
ATOM 7860  N N   . ASN E 1 84  ? 49.035  72.075  49.315  1.00 19.44 ? 84  ASN E N   1 
ATOM 7861  C CA  . ASN E 1 84  ? 49.089  72.580  47.943  1.00 18.80 ? 84  ASN E CA  1 
ATOM 7862  C C   . ASN E 1 84  ? 47.892  72.117  47.095  1.00 17.41 ? 84  ASN E C   1 
ATOM 7863  O O   . ASN E 1 84  ? 47.877  72.310  45.877  1.00 15.60 ? 84  ASN E O   1 
ATOM 7864  C CB  . ASN E 1 84  ? 50.410  72.155  47.272  1.00 18.90 ? 84  ASN E CB  1 
ATOM 7865  C CG  . ASN E 1 84  ? 50.961  73.210  46.310  1.00 20.90 ? 84  ASN E CG  1 
ATOM 7866  O OD1 . ASN E 1 84  ? 52.143  73.556  46.372  1.00 20.79 ? 84  ASN E OD1 1 
ATOM 7867  N ND2 . ASN E 1 84  ? 50.122  73.701  45.405  1.00 19.36 ? 84  ASN E ND2 1 
ATOM 7868  N N   . LEU E 1 85  ? 46.888  71.524  47.737  1.00 15.45 ? 85  LEU E N   1 
ATOM 7869  C CA  . LEU E 1 85  ? 45.707  71.041  47.032  1.00 12.32 ? 85  LEU E CA  1 
ATOM 7870  C C   . LEU E 1 85  ? 44.794  72.180  46.597  1.00 10.13 ? 85  LEU E C   1 
ATOM 7871  O O   . LEU E 1 85  ? 43.612  72.229  46.982  1.00 10.91 ? 85  LEU E O   1 
ATOM 7872  C CB  . LEU E 1 85  ? 44.949  70.024  47.894  1.00 11.00 ? 85  LEU E CB  1 
ATOM 7873  C CG  . LEU E 1 85  ? 45.542  68.607  47.881  1.00 10.47 ? 85  LEU E CG  1 
ATOM 7874  C CD1 . LEU E 1 85  ? 44.726  67.654  48.751  1.00 2.00  ? 85  LEU E CD1 1 
ATOM 7875  C CD2 . LEU E 1 85  ? 45.602  68.082  46.444  1.00 7.92  ? 85  LEU E CD2 1 
ATOM 7876  N N   . CYS E 1 86  ? 45.315  73.068  45.763  1.00 8.10  ? 86  CYS E N   1 
ATOM 7877  C CA  . CYS E 1 86  ? 44.581  74.220  45.256  1.00 10.62 ? 86  CYS E CA  1 
ATOM 7878  C C   . CYS E 1 86  ? 45.195  74.606  43.922  1.00 11.37 ? 86  CYS E C   1 
ATOM 7879  O O   . CYS E 1 86  ? 46.273  74.131  43.560  1.00 11.98 ? 86  CYS E O   1 
ATOM 7880  C CB  . CYS E 1 86  ? 44.694  75.403  46.216  1.00 11.40 ? 86  CYS E CB  1 
ATOM 7881  S SG  . CYS E 1 86  ? 44.303  75.030  47.933  1.00 11.07 ? 86  CYS E SG  1 
ATOM 7882  N N   . GLY E 1 87  ? 44.514  75.490  43.205  1.00 12.71 ? 87  GLY E N   1 
ATOM 7883  C CA  . GLY E 1 87  ? 44.993  75.923  41.907  1.00 11.27 ? 87  GLY E CA  1 
ATOM 7884  C C   . GLY E 1 87  ? 46.386  76.517  41.905  1.00 9.26  ? 87  GLY E C   1 
ATOM 7885  O O   . GLY E 1 87  ? 46.746  77.269  42.805  1.00 11.01 ? 87  GLY E O   1 
ATOM 7886  N N   . GLU E 1 88  ? 47.162  76.194  40.875  1.00 11.50 ? 88  GLU E N   1 
ATOM 7887  C CA  . GLU E 1 88  ? 48.526  76.704  40.737  1.00 12.78 ? 88  GLU E CA  1 
ATOM 7888  C C   . GLU E 1 88  ? 48.677  77.643  39.526  1.00 13.24 ? 88  GLU E C   1 
ATOM 7889  O O   . GLU E 1 88  ? 49.779  78.068  39.187  1.00 13.11 ? 88  GLU E O   1 
ATOM 7890  C CB  . GLU E 1 88  ? 49.521  75.538  40.653  1.00 11.72 ? 88  GLU E CB  1 
ATOM 7891  C CG  . GLU E 1 88  ? 49.573  74.668  41.917  1.00 13.58 ? 88  GLU E CG  1 
ATOM 7892  C CD  . GLU E 1 88  ? 50.511  73.472  41.790  1.00 15.56 ? 88  GLU E CD  1 
ATOM 7893  O OE1 . GLU E 1 88  ? 50.099  72.469  41.174  1.00 13.89 ? 88  GLU E OE1 1 
ATOM 7894  O OE2 . GLU E 1 88  ? 51.650  73.526  42.311  1.00 15.96 ? 88  GLU E OE2 1 
ATOM 7895  N N   . THR E 1 89  ? 47.559  77.951  38.877  1.00 15.04 ? 89  THR E N   1 
ATOM 7896  C CA  . THR E 1 89  ? 47.535  78.843  37.720  1.00 14.37 ? 89  THR E CA  1 
ATOM 7897  C C   . THR E 1 89  ? 46.180  79.530  37.762  1.00 16.44 ? 89  THR E C   1 
ATOM 7898  O O   . THR E 1 89  ? 45.200  78.906  38.201  1.00 14.71 ? 89  THR E O   1 
ATOM 7899  C CB  . THR E 1 89  ? 47.710  78.072  36.379  1.00 15.80 ? 89  THR E CB  1 
ATOM 7900  O OG1 . THR E 1 89  ? 47.422  78.940  35.280  1.00 15.44 ? 89  THR E OG1 1 
ATOM 7901  C CG2 . THR E 1 89  ? 46.786  76.889  36.304  1.00 12.91 ? 89  THR E CG2 1 
ATOM 7902  N N   . GLU E 1 90  ? 46.130  80.795  37.352  1.00 15.96 ? 90  GLU E N   1 
ATOM 7903  C CA  . GLU E 1 90  ? 44.889  81.564  37.360  1.00 15.64 ? 90  GLU E CA  1 
ATOM 7904  C C   . GLU E 1 90  ? 43.712  80.739  36.842  1.00 17.00 ? 90  GLU E C   1 
ATOM 7905  O O   . GLU E 1 90  ? 42.676  80.645  37.505  1.00 16.17 ? 90  GLU E O   1 
ATOM 7906  C CB  . GLU E 1 90  ? 45.048  82.845  36.532  1.00 15.95 ? 90  GLU E CB  1 
ATOM 7907  C CG  . GLU E 1 90  ? 43.783  83.712  36.402  1.00 15.97 ? 90  GLU E CG  1 
ATOM 7908  C CD  . GLU E 1 90  ? 43.485  84.526  37.644  1.00 15.78 ? 90  GLU E CD  1 
ATOM 7909  O OE1 . GLU E 1 90  ? 42.874  83.984  38.586  1.00 15.59 ? 90  GLU E OE1 1 
ATOM 7910  O OE2 . GLU E 1 90  ? 43.856  85.716  37.671  1.00 15.54 ? 90  GLU E OE2 1 
ATOM 7911  N N   . GLU E 1 91  ? 43.900  80.112  35.681  1.00 17.26 ? 91  GLU E N   1 
ATOM 7912  C CA  . GLU E 1 91  ? 42.877  79.278  35.053  1.00 17.17 ? 91  GLU E CA  1 
ATOM 7913  C C   . GLU E 1 91  ? 42.233  78.352  36.084  1.00 18.33 ? 91  GLU E C   1 
ATOM 7914  O O   . GLU E 1 91  ? 41.021  78.395  36.319  1.00 19.14 ? 91  GLU E O   1 
ATOM 7915  C CB  . GLU E 1 91  ? 43.513  78.455  33.929  1.00 19.58 ? 91  GLU E CB  1 
ATOM 7916  C CG  . GLU E 1 91  ? 42.629  77.345  33.364  1.00 24.91 ? 91  GLU E CG  1 
ATOM 7917  C CD  . GLU E 1 91  ? 43.270  76.597  32.203  1.00 26.35 ? 91  GLU E CD  1 
ATOM 7918  O OE1 . GLU E 1 91  ? 44.503  76.695  32.022  1.00 25.48 ? 91  GLU E OE1 1 
ATOM 7919  O OE2 . GLU E 1 91  ? 42.532  75.908  31.467  1.00 25.49 ? 91  GLU E OE2 1 
ATOM 7920  N N   . GLU E 1 92  ? 43.073  77.556  36.733  1.00 19.51 ? 92  GLU E N   1 
ATOM 7921  C CA  . GLU E 1 92  ? 42.616  76.623  37.750  1.00 16.19 ? 92  GLU E CA  1 
ATOM 7922  C C   . GLU E 1 92  ? 42.059  77.369  38.954  1.00 16.58 ? 92  GLU E C   1 
ATOM 7923  O O   . GLU E 1 92  ? 41.086  76.927  39.563  1.00 14.59 ? 92  GLU E O   1 
ATOM 7924  C CB  . GLU E 1 92  ? 43.760  75.690  38.163  1.00 20.20 ? 92  GLU E CB  1 
ATOM 7925  C CG  . GLU E 1 92  ? 44.117  74.654  37.090  1.00 18.10 ? 92  GLU E CG  1 
ATOM 7926  C CD  . GLU E 1 92  ? 45.438  73.932  37.338  1.00 17.59 ? 92  GLU E CD  1 
ATOM 7927  O OE1 . GLU E 1 92  ? 46.069  74.119  38.405  1.00 14.82 ? 92  GLU E OE1 1 
ATOM 7928  O OE2 . GLU E 1 92  ? 45.853  73.176  36.436  1.00 18.23 ? 92  GLU E OE2 1 
ATOM 7929  N N   . LYS E 1 93  ? 42.636  78.534  39.242  1.00 16.84 ? 93  LYS E N   1 
ATOM 7930  C CA  . LYS E 1 93  ? 42.214  79.365  40.371  1.00 13.75 ? 93  LYS E CA  1 
ATOM 7931  C C   . LYS E 1 93  ? 40.752  79.769  40.287  1.00 14.76 ? 93  LYS E C   1 
ATOM 7932  O O   . LYS E 1 93  ? 40.041  79.748  41.289  1.00 16.18 ? 93  LYS E O   1 
ATOM 7933  C CB  . LYS E 1 93  ? 43.067  80.634  40.464  1.00 13.52 ? 93  LYS E CB  1 
ATOM 7934  C CG  . LYS E 1 93  ? 43.801  80.805  41.781  1.00 10.21 ? 93  LYS E CG  1 
ATOM 7935  C CD  . LYS E 1 93  ? 45.198  80.200  41.733  1.00 10.46 ? 93  LYS E CD  1 
ATOM 7936  C CE  . LYS E 1 93  ? 46.125  81.010  40.832  1.00 8.34  ? 93  LYS E CE  1 
ATOM 7937  N NZ  . LYS E 1 93  ? 47.517  80.480  40.808  1.00 9.00  ? 93  LYS E NZ  1 
ATOM 7938  N N   . ILE E 1 94  ? 40.299  80.131  39.096  1.00 13.73 ? 94  ILE E N   1 
ATOM 7939  C CA  . ILE E 1 94  ? 38.918  80.548  38.936  1.00 14.14 ? 94  ILE E CA  1 
ATOM 7940  C C   . ILE E 1 94  ? 37.906  79.408  39.138  1.00 13.39 ? 94  ILE E C   1 
ATOM 7941  O O   . ILE E 1 94  ? 37.003  79.529  39.967  1.00 10.68 ? 94  ILE E O   1 
ATOM 7942  C CB  . ILE E 1 94  ? 38.691  81.245  37.579  1.00 11.12 ? 94  ILE E CB  1 
ATOM 7943  C CG1 . ILE E 1 94  ? 39.655  82.419  37.419  1.00 8.22  ? 94  ILE E CG1 1 
ATOM 7944  C CG2 . ILE E 1 94  ? 37.282  81.779  37.502  1.00 14.28 ? 94  ILE E CG2 1 
ATOM 7945  C CD1 . ILE E 1 94  ? 39.510  83.155  36.101  1.00 16.25 ? 94  ILE E CD1 1 
ATOM 7946  N N   . ARG E 1 95  ? 38.059  78.298  38.417  1.00 13.93 ? 95  ARG E N   1 
ATOM 7947  C CA  . ARG E 1 95  ? 37.119  77.184  38.564  1.00 14.58 ? 95  ARG E CA  1 
ATOM 7948  C C   . ARG E 1 95  ? 37.138  76.461  39.918  1.00 15.14 ? 95  ARG E C   1 
ATOM 7949  O O   . ARG E 1 95  ? 36.132  75.866  40.321  1.00 14.34 ? 95  ARG E O   1 
ATOM 7950  C CB  . ARG E 1 95  ? 37.210  76.193  37.398  1.00 14.50 ? 95  ARG E CB  1 
ATOM 7951  C CG  . ARG E 1 95  ? 38.575  75.977  36.785  1.00 9.32  ? 95  ARG E CG  1 
ATOM 7952  C CD  . ARG E 1 95  ? 38.489  74.894  35.711  1.00 11.36 ? 95  ARG E CD  1 
ATOM 7953  N NE  . ARG E 1 95  ? 37.412  75.147  34.755  1.00 7.76  ? 95  ARG E NE  1 
ATOM 7954  C CZ  . ARG E 1 95  ? 36.597  74.213  34.273  1.00 10.61 ? 95  ARG E CZ  1 
ATOM 7955  N NH1 . ARG E 1 95  ? 36.728  72.950  34.651  1.00 13.60 ? 95  ARG E NH1 1 
ATOM 7956  N NH2 . ARG E 1 95  ? 35.642  74.545  33.418  1.00 14.98 ? 95  ARG E NH2 1 
ATOM 7957  N N   . VAL E 1 96  ? 38.275  76.513  40.610  1.00 13.06 ? 96  VAL E N   1 
ATOM 7958  C CA  . VAL E 1 96  ? 38.401  75.917  41.940  1.00 11.79 ? 96  VAL E CA  1 
ATOM 7959  C C   . VAL E 1 96  ? 37.395  76.654  42.827  1.00 11.77 ? 96  VAL E C   1 
ATOM 7960  O O   . VAL E 1 96  ? 36.628  76.046  43.571  1.00 10.76 ? 96  VAL E O   1 
ATOM 7961  C CB  . VAL E 1 96  ? 39.819  76.143  42.520  1.00 11.81 ? 96  VAL E CB  1 
ATOM 7962  C CG1 . VAL E 1 96  ? 39.828  75.945  44.029  1.00 13.32 ? 96  VAL E CG1 1 
ATOM 7963  C CG2 . VAL E 1 96  ? 40.802  75.207  41.873  1.00 11.29 ? 96  VAL E CG2 1 
ATOM 7964  N N   . ASP E 1 97  ? 37.410  77.978  42.720  1.00 11.91 ? 97  ASP E N   1 
ATOM 7965  C CA  . ASP E 1 97  ? 36.515  78.837  43.481  1.00 11.51 ? 97  ASP E CA  1 
ATOM 7966  C C   . ASP E 1 97  ? 35.072  78.544  43.096  1.00 11.73 ? 97  ASP E C   1 
ATOM 7967  O O   . ASP E 1 97  ? 34.229  78.304  43.979  1.00 18.51 ? 97  ASP E O   1 
ATOM 7968  C CB  . ASP E 1 97  ? 36.826  80.310  43.197  1.00 4.50  ? 97  ASP E CB  1 
ATOM 7969  C CG  . ASP E 1 97  ? 38.215  80.726  43.659  1.00 3.53  ? 97  ASP E CG  1 
ATOM 7970  O OD1 . ASP E 1 97  ? 39.094  79.856  43.848  1.00 3.44  ? 97  ASP E OD1 1 
ATOM 7971  O OD2 . ASP E 1 97  ? 38.430  81.942  43.832  1.00 7.93  ? 97  ASP E OD2 1 
ATOM 7972  N N   . ILE E 1 98  ? 34.804  78.578  41.791  1.00 10.69 ? 98  ILE E N   1 
ATOM 7973  C CA  . ILE E 1 98  ? 33.474  78.321  41.247  1.00 6.50  ? 98  ILE E CA  1 
ATOM 7974  C C   . ILE E 1 98  ? 32.835  77.158  41.985  1.00 6.43  ? 98  ILE E C   1 
ATOM 7975  O O   . ILE E 1 98  ? 31.883  77.341  42.740  1.00 2.00  ? 98  ILE E O   1 
ATOM 7976  C CB  . ILE E 1 98  ? 33.542  77.971  39.740  1.00 6.06  ? 98  ILE E CB  1 
ATOM 7977  C CG1 . ILE E 1 98  ? 33.898  79.212  38.913  1.00 7.23  ? 98  ILE E CG1 1 
ATOM 7978  C CG2 . ILE E 1 98  ? 32.218  77.362  39.270  1.00 7.12  ? 98  ILE E CG2 1 
ATOM 7979  C CD1 . ILE E 1 98  ? 32.739  80.152  38.671  1.00 3.19  ? 98  ILE E CD1 1 
ATOM 7980  N N   . LEU E 1 99  ? 33.413  75.975  41.813  1.00 12.11 ? 99  LEU E N   1 
ATOM 7981  C CA  . LEU E 1 99  ? 32.906  74.763  42.451  1.00 15.31 ? 99  LEU E CA  1 
ATOM 7982  C C   . LEU E 1 99  ? 32.721  74.915  43.944  1.00 17.30 ? 99  LEU E C   1 
ATOM 7983  O O   . LEU E 1 99  ? 31.667  74.580  44.452  1.00 17.40 ? 99  LEU E O   1 
ATOM 7984  C CB  . LEU E 1 99  ? 33.835  73.588  42.175  1.00 10.34 ? 99  LEU E CB  1 
ATOM 7985  C CG  . LEU E 1 99  ? 33.751  73.049  40.757  1.00 9.74  ? 99  LEU E CG  1 
ATOM 7986  C CD1 . LEU E 1 99  ? 34.803  72.013  40.584  1.00 10.55 ? 99  LEU E CD1 1 
ATOM 7987  C CD2 . LEU E 1 99  ? 32.365  72.480  40.505  1.00 7.98  ? 99  LEU E CD2 1 
ATOM 7988  N N   . GLU E 1 100 ? 33.735  75.455  44.614  1.00 19.63 ? 100 GLU E N   1 
ATOM 7989  C CA  . GLU E 1 100 ? 33.696  75.646  46.060  1.00 18.40 ? 100 GLU E CA  1 
ATOM 7990  C C   . GLU E 1 100 ? 32.434  76.375  46.494  1.00 17.82 ? 100 GLU E C   1 
ATOM 7991  O O   . GLU E 1 100 ? 31.837  76.045  47.514  1.00 18.49 ? 100 GLU E O   1 
ATOM 7992  C CB  . GLU E 1 100 ? 34.914  76.440  46.516  1.00 20.92 ? 100 GLU E CB  1 
ATOM 7993  C CG  . GLU E 1 100 ? 35.030  76.572  48.018  1.00 23.30 ? 100 GLU E CG  1 
ATOM 7994  C CD  . GLU E 1 100 ? 35.947  77.702  48.431  1.00 24.01 ? 100 GLU E CD  1 
ATOM 7995  O OE1 . GLU E 1 100 ? 37.005  77.899  47.791  1.00 24.42 ? 100 GLU E OE1 1 
ATOM 7996  O OE2 . GLU E 1 100 ? 35.597  78.401  49.401  1.00 24.27 ? 100 GLU E OE2 1 
ATOM 7997  N N   . ASN E 1 101 ? 32.025  77.364  45.713  1.00 17.42 ? 101 ASN E N   1 
ATOM 7998  C CA  . ASN E 1 101 ? 30.832  78.130  46.041  1.00 18.16 ? 101 ASN E CA  1 
ATOM 7999  C C   . ASN E 1 101 ? 29.567  77.501  45.477  1.00 18.92 ? 101 ASN E C   1 
ATOM 8000  O O   . ASN E 1 101 ? 28.520  77.504  46.123  1.00 17.91 ? 101 ASN E O   1 
ATOM 8001  C CB  . ASN E 1 101 ? 30.974  79.560  45.532  1.00 11.97 ? 101 ASN E CB  1 
ATOM 8002  C CG  . ASN E 1 101 ? 32.026  80.331  46.276  1.00 8.58  ? 101 ASN E CG  1 
ATOM 8003  O OD1 . ASN E 1 101 ? 31.712  81.170  47.103  1.00 7.92  ? 101 ASN E OD1 1 
ATOM 8004  N ND2 . ASN E 1 101 ? 33.284  80.035  46.003  1.00 4.59  ? 101 ASN E ND2 1 
ATOM 8005  N N   . GLN E 1 102 ? 29.665  76.959  44.271  1.00 19.63 ? 102 GLN E N   1 
ATOM 8006  C CA  . GLN E 1 102 ? 28.518  76.349  43.624  1.00 16.55 ? 102 GLN E CA  1 
ATOM 8007  C C   . GLN E 1 102 ? 28.115  75.071  44.341  1.00 16.43 ? 102 GLN E C   1 
ATOM 8008  O O   . GLN E 1 102 ? 26.955  74.905  44.708  1.00 21.04 ? 102 GLN E O   1 
ATOM 8009  C CB  . GLN E 1 102 ? 28.826  76.056  42.154  1.00 14.64 ? 102 GLN E CB  1 
ATOM 8010  C CG  . GLN E 1 102 ? 27.591  75.867  41.294  1.00 7.79  ? 102 GLN E CG  1 
ATOM 8011  C CD  . GLN E 1 102 ? 26.733  77.106  41.245  1.00 7.53  ? 102 GLN E CD  1 
ATOM 8012  O OE1 . GLN E 1 102 ? 27.077  78.083  40.587  1.00 5.13  ? 102 GLN E OE1 1 
ATOM 8013  N NE2 . GLN E 1 102 ? 25.610  77.075  41.944  1.00 2.00  ? 102 GLN E NE2 1 
ATOM 8014  N N   . ALA E 1 103 ? 29.073  74.171  44.532  1.00 16.73 ? 103 ALA E N   1 
ATOM 8015  C CA  . ALA E 1 103 ? 28.829  72.896  45.211  1.00 17.20 ? 103 ALA E CA  1 
ATOM 8016  C C   . ALA E 1 103 ? 28.200  73.123  46.585  1.00 14.56 ? 103 ALA E C   1 
ATOM 8017  O O   . ALA E 1 103 ? 27.292  72.404  46.994  1.00 14.20 ? 103 ALA E O   1 
ATOM 8018  C CB  . ALA E 1 103 ? 30.125  72.107  45.342  1.00 14.84 ? 103 ALA E CB  1 
ATOM 8019  N N   . MET E 1 104 ? 28.694  74.127  47.298  1.00 16.04 ? 104 MET E N   1 
ATOM 8020  C CA  . MET E 1 104 ? 28.165  74.469  48.614  1.00 16.71 ? 104 MET E CA  1 
ATOM 8021  C C   . MET E 1 104 ? 26.737  74.986  48.396  1.00 16.42 ? 104 MET E C   1 
ATOM 8022  O O   . MET E 1 104 ? 25.785  74.484  48.993  1.00 14.94 ? 104 MET E O   1 
ATOM 8023  C CB  . MET E 1 104 ? 29.040  75.554  49.258  1.00 22.10 ? 104 MET E CB  1 
ATOM 8024  C CG  . MET E 1 104 ? 28.710  75.900  50.706  1.00 24.68 ? 104 MET E CG  1 
ATOM 8025  S SD  . MET E 1 104 ? 29.246  74.661  51.892  1.00 24.16 ? 104 MET E SD  1 
ATOM 8026  C CE  . MET E 1 104 ? 27.758  74.456  52.853  1.00 27.84 ? 104 MET E CE  1 
ATOM 8027  N N   . ASP E 1 105 ? 26.586  75.929  47.468  1.00 14.49 ? 105 ASP E N   1 
ATOM 8028  C CA  . ASP E 1 105 ? 25.323  76.537  47.121  1.00 11.17 ? 105 ASP E CA  1 
ATOM 8029  C C   . ASP E 1 105 ? 24.215  75.494  46.986  1.00 12.42 ? 105 ASP E C   1 
ATOM 8030  O O   . ASP E 1 105 ? 23.193  75.570  47.674  1.00 13.16 ? 105 ASP E O   1 
ATOM 8031  C CB  . ASP E 1 105 ? 25.473  77.304  45.807  1.00 3.92  ? 105 ASP E CB  1 
ATOM 8032  C CG  . ASP E 1 105 ? 24.227  78.077  45.426  1.00 7.71  ? 105 ASP E CG  1 
ATOM 8033  O OD1 . ASP E 1 105 ? 23.993  79.150  46.021  1.00 4.08  ? 105 ASP E OD1 1 
ATOM 8034  O OD2 . ASP E 1 105 ? 23.498  77.625  44.516  1.00 8.98  ? 105 ASP E OD2 1 
ATOM 8035  N N   . VAL E 1 106 ? 24.437  74.505  46.121  1.00 11.98 ? 106 VAL E N   1 
ATOM 8036  C CA  . VAL E 1 106 ? 23.459  73.444  45.878  1.00 13.64 ? 106 VAL E CA  1 
ATOM 8037  C C   . VAL E 1 106 ? 23.278  72.514  47.069  1.00 16.77 ? 106 VAL E C   1 
ATOM 8038  O O   . VAL E 1 106 ? 22.226  71.895  47.219  1.00 16.88 ? 106 VAL E O   1 
ATOM 8039  C CB  . VAL E 1 106 ? 23.804  72.622  44.628  1.00 11.63 ? 106 VAL E CB  1 
ATOM 8040  C CG1 . VAL E 1 106 ? 23.899  73.533  43.422  1.00 10.10 ? 106 VAL E CG1 1 
ATOM 8041  C CG2 . VAL E 1 106 ? 25.088  71.857  44.833  1.00 9.32  ? 106 VAL E CG2 1 
ATOM 8042  N N   . SER E 1 107 ? 24.291  72.437  47.926  1.00 17.32 ? 107 SER E N   1 
ATOM 8043  C CA  . SER E 1 107 ? 24.215  71.595  49.112  1.00 16.19 ? 107 SER E CA  1 
ATOM 8044  C C   . SER E 1 107 ? 23.270  72.261  50.118  1.00 17.67 ? 107 SER E C   1 
ATOM 8045  O O   . SER E 1 107 ? 22.498  71.584  50.805  1.00 15.41 ? 107 SER E O   1 
ATOM 8046  C CB  . SER E 1 107 ? 25.609  71.394  49.713  1.00 16.27 ? 107 SER E CB  1 
ATOM 8047  O OG  . SER E 1 107 ? 25.606  70.390  50.712  1.00 22.42 ? 107 SER E OG  1 
ATOM 8048  N N   . ASN E 1 108 ? 23.312  73.593  50.178  1.00 18.21 ? 108 ASN E N   1 
ATOM 8049  C CA  . ASN E 1 108 ? 22.442  74.365  51.073  1.00 20.12 ? 108 ASN E CA  1 
ATOM 8050  C C   . ASN E 1 108 ? 21.050  74.353  50.487  1.00 21.96 ? 108 ASN E C   1 
ATOM 8051  O O   . ASN E 1 108 ? 20.054  74.440  51.203  1.00 22.93 ? 108 ASN E O   1 
ATOM 8052  C CB  . ASN E 1 108 ? 22.897  75.817  51.164  1.00 18.39 ? 108 ASN E CB  1 
ATOM 8053  C CG  . ASN E 1 108 ? 24.245  75.963  51.797  1.00 19.48 ? 108 ASN E CG  1 
ATOM 8054  O OD1 . ASN E 1 108 ? 25.231  76.219  51.118  1.00 18.90 ? 108 ASN E OD1 1 
ATOM 8055  N ND2 . ASN E 1 108 ? 24.302  75.808  53.109  1.00 18.02 ? 108 ASN E ND2 1 
ATOM 8056  N N   . GLN E 1 109 ? 21.016  74.300  49.162  1.00 23.02 ? 109 GLN E N   1 
ATOM 8057  C CA  . GLN E 1 109 ? 19.794  74.277  48.377  1.00 22.92 ? 109 GLN E CA  1 
ATOM 8058  C C   . GLN E 1 109 ? 19.007  73.012  48.682  1.00 22.69 ? 109 GLN E C   1 
ATOM 8059  O O   . GLN E 1 109 ? 17.778  73.031  48.726  1.00 20.61 ? 109 GLN E O   1 
ATOM 8060  C CB  . GLN E 1 109 ? 20.176  74.325  46.905  1.00 23.65 ? 109 GLN E CB  1 
ATOM 8061  C CG  . GLN E 1 109 ? 19.071  74.620  45.941  1.00 25.44 ? 109 GLN E CG  1 
ATOM 8062  C CD  . GLN E 1 109 ? 19.624  74.916  44.567  1.00 24.50 ? 109 GLN E CD  1 
ATOM 8063  O OE1 . GLN E 1 109 ? 19.753  74.024  43.729  1.00 24.24 ? 109 GLN E OE1 1 
ATOM 8064  N NE2 . GLN E 1 109 ? 19.989  76.172  44.337  1.00 27.85 ? 109 GLN E NE2 1 
ATOM 8065  N N   . LEU E 1 110 ? 19.723  71.913  48.885  1.00 22.45 ? 110 LEU E N   1 
ATOM 8066  C CA  . LEU E 1 110 ? 19.092  70.643  49.207  1.00 21.46 ? 110 LEU E CA  1 
ATOM 8067  C C   . LEU E 1 110 ? 18.737  70.613  50.693  1.00 19.72 ? 110 LEU E C   1 
ATOM 8068  O O   . LEU E 1 110 ? 17.601  70.310  51.059  1.00 21.40 ? 110 LEU E O   1 
ATOM 8069  C CB  . LEU E 1 110 ? 20.022  69.472  48.849  1.00 18.83 ? 110 LEU E CB  1 
ATOM 8070  C CG  . LEU E 1 110 ? 19.578  68.035  49.175  1.00 19.82 ? 110 LEU E CG  1 
ATOM 8071  C CD1 . LEU E 1 110 ? 18.212  67.742  48.576  1.00 19.24 ? 110 LEU E CD1 1 
ATOM 8072  C CD2 . LEU E 1 110 ? 20.613  67.030  48.670  1.00 22.14 ? 110 LEU E CD2 1 
ATOM 8073  N N   . ALA E 1 111 ? 19.698  70.964  51.544  1.00 17.06 ? 111 ALA E N   1 
ATOM 8074  C CA  . ALA E 1 111 ? 19.486  70.965  52.990  1.00 18.77 ? 111 ALA E CA  1 
ATOM 8075  C C   . ALA E 1 111 ? 18.282  71.811  53.392  1.00 20.13 ? 111 ALA E C   1 
ATOM 8076  O O   . ALA E 1 111 ? 17.433  71.366  54.166  1.00 17.33 ? 111 ALA E O   1 
ATOM 8077  C CB  . ALA E 1 111 ? 20.740  71.447  53.712  1.00 17.48 ? 111 ALA E CB  1 
ATOM 8078  N N   . ARG E 1 112 ? 18.194  73.008  52.816  1.00 20.63 ? 112 ARG E N   1 
ATOM 8079  C CA  . ARG E 1 112 ? 17.109  73.952  53.083  1.00 21.65 ? 112 ARG E CA  1 
ATOM 8080  C C   . ARG E 1 112 ? 15.769  73.249  52.903  1.00 22.24 ? 112 ARG E C   1 
ATOM 8081  O O   . ARG E 1 112 ? 14.837  73.453  53.687  1.00 19.62 ? 112 ARG E O   1 
ATOM 8082  C CB  . ARG E 1 112 ? 17.208  75.137  52.119  1.00 23.80 ? 112 ARG E CB  1 
ATOM 8083  C CG  . ARG E 1 112 ? 16.571  76.429  52.619  1.00 29.40 ? 112 ARG E CG  1 
ATOM 8084  C CD  . ARG E 1 112 ? 16.615  77.541  51.557  1.00 28.50 ? 112 ARG E CD  1 
ATOM 8085  N NE  . ARG E 1 112 ? 17.974  77.870  51.118  1.00 31.94 ? 112 ARG E NE  1 
ATOM 8086  C CZ  . ARG E 1 112 ? 18.376  77.868  49.847  1.00 35.90 ? 112 ARG E CZ  1 
ATOM 8087  N NH1 . ARG E 1 112 ? 17.527  77.556  48.877  1.00 37.16 ? 112 ARG E NH1 1 
ATOM 8088  N NH2 . ARG E 1 112 ? 19.632  78.166  49.543  1.00 35.67 ? 112 ARG E NH2 1 
ATOM 8089  N N   . VAL E 1 113 ? 15.700  72.405  51.875  1.00 23.38 ? 113 VAL E N   1 
ATOM 8090  C CA  . VAL E 1 113 ? 14.509  71.625  51.549  1.00 21.28 ? 113 VAL E CA  1 
ATOM 8091  C C   . VAL E 1 113 ? 14.259  70.589  52.646  1.00 22.07 ? 113 VAL E C   1 
ATOM 8092  O O   . VAL E 1 113 ? 13.179  70.557  53.242  1.00 21.35 ? 113 VAL E O   1 
ATOM 8093  C CB  . VAL E 1 113 ? 14.681  70.888  50.185  1.00 19.88 ? 113 VAL E CB  1 
ATOM 8094  C CG1 . VAL E 1 113 ? 13.453  70.037  49.866  1.00 25.25 ? 113 VAL E CG1 1 
ATOM 8095  C CG2 . VAL E 1 113 ? 14.952  71.888  49.066  1.00 21.68 ? 113 VAL E CG2 1 
ATOM 8096  N N   . CYS E 1 114 ? 15.278  69.782  52.941  1.00 23.21 ? 114 CYS E N   1 
ATOM 8097  C CA  . CYS E 1 114 ? 15.175  68.732  53.953  1.00 22.87 ? 114 CYS E CA  1 
ATOM 8098  C C   . CYS E 1 114 ? 14.916  69.232  55.380  1.00 23.74 ? 114 CYS E C   1 
ATOM 8099  O O   . CYS E 1 114 ? 14.641  68.436  56.282  1.00 22.48 ? 114 CYS E O   1 
ATOM 8100  C CB  . CYS E 1 114 ? 16.407  67.824  53.909  1.00 21.88 ? 114 CYS E CB  1 
ATOM 8101  S SG  . CYS E 1 114 ? 16.605  66.907  52.353  1.00 24.72 ? 114 CYS E SG  1 
ATOM 8102  N N   . TYR E 1 115 ? 15.037  70.540  55.591  1.00 23.02 ? 115 TYR E N   1 
ATOM 8103  C CA  . TYR E 1 115 ? 14.767  71.137  56.900  1.00 24.36 ? 115 TYR E CA  1 
ATOM 8104  C C   . TYR E 1 115 ? 13.348  71.704  56.889  1.00 26.23 ? 115 TYR E C   1 
ATOM 8105  O O   . TYR E 1 115 ? 12.781  71.995  57.938  1.00 23.52 ? 115 TYR E O   1 
ATOM 8106  C CB  . TYR E 1 115 ? 15.751  72.269  57.216  1.00 25.99 ? 115 TYR E CB  1 
ATOM 8107  C CG  . TYR E 1 115 ? 17.185  71.842  57.437  1.00 27.77 ? 115 TYR E CG  1 
ATOM 8108  C CD1 . TYR E 1 115 ? 17.499  70.550  57.855  1.00 29.16 ? 115 TYR E CD1 1 
ATOM 8109  C CD2 . TYR E 1 115 ? 18.230  72.741  57.236  1.00 29.24 ? 115 TYR E CD2 1 
ATOM 8110  C CE1 . TYR E 1 115 ? 18.822  70.163  58.066  1.00 31.75 ? 115 TYR E CE1 1 
ATOM 8111  C CE2 . TYR E 1 115 ? 19.549  72.368  57.443  1.00 32.43 ? 115 TYR E CE2 1 
ATOM 8112  C CZ  . TYR E 1 115 ? 19.841  71.081  57.857  1.00 33.75 ? 115 TYR E CZ  1 
ATOM 8113  O OH  . TYR E 1 115 ? 21.156  70.718  58.049  1.00 33.68 ? 115 TYR E OH  1 
ATOM 8114  N N   . SER E 1 116 ? 12.788  71.868  55.694  1.00 26.94 ? 116 SER E N   1 
ATOM 8115  C CA  . SER E 1 116 ? 11.443  72.406  55.534  1.00 26.87 ? 116 SER E CA  1 
ATOM 8116  C C   . SER E 1 116 ? 10.355  71.402  55.898  1.00 25.59 ? 116 SER E C   1 
ATOM 8117  O O   . SER E 1 116 ? 10.370  70.265  55.431  1.00 24.34 ? 116 SER E O   1 
ATOM 8118  C CB  . SER E 1 116 ? 11.229  72.896  54.101  1.00 27.43 ? 116 SER E CB  1 
ATOM 8119  O OG  . SER E 1 116 ? 12.041  74.020  53.811  1.00 23.14 ? 116 SER E OG  1 
ATOM 8120  N N   . PRO E 1 117 ? 9.383   71.828  56.725  1.00 24.74 ? 117 PRO E N   1 
ATOM 8121  C CA  . PRO E 1 117 ? 8.253   71.011  57.187  1.00 24.52 ? 117 PRO E CA  1 
ATOM 8122  C C   . PRO E 1 117 ? 7.449   70.388  56.047  1.00 27.51 ? 117 PRO E C   1 
ATOM 8123  O O   . PRO E 1 117 ? 7.055   69.219  56.124  1.00 28.47 ? 117 PRO E O   1 
ATOM 8124  C CB  . PRO E 1 117 ? 7.418   72.011  57.981  1.00 23.31 ? 117 PRO E CB  1 
ATOM 8125  C CG  . PRO E 1 117 ? 8.467   72.920  58.561  1.00 23.46 ? 117 PRO E CG  1 
ATOM 8126  C CD  . PRO E 1 117 ? 9.359   73.157  57.367  1.00 23.29 ? 117 PRO E CD  1 
ATOM 8127  N N   . ASP E 1 118 ? 7.198   71.167  54.997  1.00 27.52 ? 118 ASP E N   1 
ATOM 8128  C CA  . ASP E 1 118 ? 6.450   70.676  53.839  1.00 29.81 ? 118 ASP E CA  1 
ATOM 8129  C C   . ASP E 1 118 ? 7.360   69.964  52.836  1.00 29.45 ? 118 ASP E C   1 
ATOM 8130  O O   . ASP E 1 118 ? 7.370   70.276  51.642  1.00 31.24 ? 118 ASP E O   1 
ATOM 8131  C CB  . ASP E 1 118 ? 5.633   71.798  53.172  1.00 34.70 ? 118 ASP E CB  1 
ATOM 8132  C CG  . ASP E 1 118 ? 6.220   73.184  53.396  1.00 38.63 ? 118 ASP E CG  1 
ATOM 8133  O OD1 . ASP E 1 118 ? 7.282   73.497  52.818  1.00 39.82 ? 118 ASP E OD1 1 
ATOM 8134  O OD2 . ASP E 1 118 ? 5.605   73.969  54.147  1.00 39.15 ? 118 ASP E OD2 1 
ATOM 8135  N N   . PHE E 1 119 ? 8.095   68.981  53.331  1.00 26.25 ? 119 PHE E N   1 
ATOM 8136  C CA  . PHE E 1 119 ? 9.028   68.169  52.576  1.00 24.66 ? 119 PHE E CA  1 
ATOM 8137  C C   . PHE E 1 119 ? 8.400   67.678  51.271  1.00 24.83 ? 119 PHE E C   1 
ATOM 8138  O O   . PHE E 1 119 ? 8.896   67.974  50.179  1.00 24.57 ? 119 PHE E O   1 
ATOM 8139  C CB  . PHE E 1 119 ? 9.485   66.977  53.436  1.00 24.27 ? 119 PHE E CB  1 
ATOM 8140  C CG  . PHE E 1 119 ? 10.332  65.977  52.716  1.00 24.02 ? 119 PHE E CG  1 
ATOM 8141  C CD1 . PHE E 1 119 ? 11.689  66.203  52.503  1.00 26.24 ? 119 PHE E CD1 1 
ATOM 8142  C CD2 . PHE E 1 119 ? 9.770   64.810  52.195  1.00 24.76 ? 119 PHE E CD2 1 
ATOM 8143  C CE1 . PHE E 1 119 ? 12.472  65.276  51.806  1.00 27.05 ? 119 PHE E CE1 1 
ATOM 8144  C CE2 . PHE E 1 119 ? 10.536  63.887  51.503  1.00 24.65 ? 119 PHE E CE2 1 
ATOM 8145  C CZ  . PHE E 1 119 ? 11.890  64.118  51.308  1.00 25.82 ? 119 PHE E CZ  1 
ATOM 8146  N N   . GLU E 1 120 ? 7.279   66.968  51.395  1.00 25.84 ? 120 GLU E N   1 
ATOM 8147  C CA  . GLU E 1 120 ? 6.556   66.409  50.251  1.00 25.77 ? 120 GLU E CA  1 
ATOM 8148  C C   . GLU E 1 120 ? 6.335   67.384  49.104  1.00 26.43 ? 120 GLU E C   1 
ATOM 8149  O O   . GLU E 1 120 ? 6.412   67.002  47.940  1.00 25.95 ? 120 GLU E O   1 
ATOM 8150  C CB  . GLU E 1 120 ? 5.212   65.841  50.705  1.00 22.30 ? 120 GLU E CB  1 
ATOM 8151  C CG  . GLU E 1 120 ? 5.274   64.406  51.191  1.00 21.55 ? 120 GLU E CG  1 
ATOM 8152  C CD  . GLU E 1 120 ? 6.357   64.167  52.226  1.00 18.46 ? 120 GLU E CD  1 
ATOM 8153  O OE1 . GLU E 1 120 ? 6.402   64.896  53.243  1.00 14.28 ? 120 GLU E OE1 1 
ATOM 8154  O OE2 . GLU E 1 120 ? 7.164   63.238  52.014  1.00 21.17 ? 120 GLU E OE2 1 
ATOM 8155  N N   . LYS E 1 121 ? 6.066   68.640  49.444  1.00 28.02 ? 121 LYS E N   1 
ATOM 8156  C CA  . LYS E 1 121 ? 5.823   69.678  48.447  1.00 28.78 ? 121 LYS E CA  1 
ATOM 8157  C C   . LYS E 1 121 ? 7.111   70.128  47.778  1.00 27.72 ? 121 LYS E C   1 
ATOM 8158  O O   . LYS E 1 121 ? 7.169   70.295  46.559  1.00 30.04 ? 121 LYS E O   1 
ATOM 8159  C CB  . LYS E 1 121 ? 5.149   70.887  49.093  1.00 28.95 ? 121 LYS E CB  1 
ATOM 8160  C CG  . LYS E 1 121 ? 3.775   70.604  49.641  1.00 26.97 ? 121 LYS E CG  1 
ATOM 8161  C CD  . LYS E 1 121 ? 3.226   71.811  50.372  1.00 28.14 ? 121 LYS E CD  1 
ATOM 8162  C CE  . LYS E 1 121 ? 1.843   71.537  50.938  1.00 28.64 ? 121 LYS E CE  1 
ATOM 8163  N NZ  . LYS E 1 121 ? 1.834   70.387  51.886  1.00 23.37 ? 121 LYS E NZ  1 
ATOM 8164  N N   . LEU E 1 122 ? 8.152   70.305  48.578  1.00 27.70 ? 122 LEU E N   1 
ATOM 8165  C CA  . LEU E 1 122 ? 9.428   70.759  48.056  1.00 28.68 ? 122 LEU E CA  1 
ATOM 8166  C C   . LEU E 1 122 ? 10.310  69.701  47.397  1.00 27.92 ? 122 LEU E C   1 
ATOM 8167  O O   . LEU E 1 122 ? 11.172  70.048  46.585  1.00 28.81 ? 122 LEU E O   1 
ATOM 8168  C CB  . LEU E 1 122 ? 10.209  71.519  49.138  1.00 29.46 ? 122 LEU E CB  1 
ATOM 8169  C CG  . LEU E 1 122 ? 9.821   72.989  49.375  1.00 29.54 ? 122 LEU E CG  1 
ATOM 8170  C CD1 . LEU E 1 122 ? 8.363   73.114  49.795  1.00 30.92 ? 122 LEU E CD1 1 
ATOM 8171  C CD2 . LEU E 1 122 ? 10.729  73.604  50.421  1.00 28.89 ? 122 LEU E CD2 1 
ATOM 8172  N N   . LYS E 1 123 ? 10.086  68.423  47.699  1.00 24.35 ? 123 LYS E N   1 
ATOM 8173  C CA  . LYS E 1 123 ? 10.909  67.369  47.099  1.00 22.55 ? 123 LYS E CA  1 
ATOM 8174  C C   . LYS E 1 123 ? 10.766  67.271  45.578  1.00 24.64 ? 123 LYS E C   1 
ATOM 8175  O O   . LYS E 1 123 ? 11.762  67.363  44.853  1.00 21.97 ? 123 LYS E O   1 
ATOM 8176  C CB  . LYS E 1 123 ? 10.663  66.005  47.754  1.00 18.21 ? 123 LYS E CB  1 
ATOM 8177  C CG  . LYS E 1 123 ? 11.669  64.941  47.317  1.00 10.98 ? 123 LYS E CG  1 
ATOM 8178  C CD  . LYS E 1 123 ? 11.533  63.656  48.103  1.00 8.20  ? 123 LYS E CD  1 
ATOM 8179  C CE  . LYS E 1 123 ? 10.708  62.626  47.373  1.00 6.71  ? 123 LYS E CE  1 
ATOM 8180  N NZ  . LYS E 1 123 ? 11.427  62.084  46.197  1.00 8.50  ? 123 LYS E NZ  1 
ATOM 8181  N N   . PRO E 1 124 ? 9.535   67.063  45.070  1.00 27.39 ? 124 PRO E N   1 
ATOM 8182  C CA  . PRO E 1 124 ? 9.380   66.972  43.615  1.00 27.22 ? 124 PRO E CA  1 
ATOM 8183  C C   . PRO E 1 124 ? 9.832   68.258  42.910  1.00 29.41 ? 124 PRO E C   1 
ATOM 8184  O O   . PRO E 1 124 ? 10.419  68.201  41.829  1.00 29.58 ? 124 PRO E O   1 
ATOM 8185  C CB  . PRO E 1 124 ? 7.879   66.711  43.444  1.00 26.35 ? 124 PRO E CB  1 
ATOM 8186  C CG  . PRO E 1 124 ? 7.268   67.321  44.675  1.00 25.70 ? 124 PRO E CG  1 
ATOM 8187  C CD  . PRO E 1 124 ? 8.235   66.882  45.736  1.00 28.01 ? 124 PRO E CD  1 
ATOM 8188  N N   . GLU E 1 125 ? 9.579   69.404  43.543  1.00 29.34 ? 125 GLU E N   1 
ATOM 8189  C CA  . GLU E 1 125 ? 9.966   70.712  43.008  1.00 28.69 ? 125 GLU E CA  1 
ATOM 8190  C C   . GLU E 1 125 ? 11.432  70.677  42.604  1.00 27.45 ? 125 GLU E C   1 
ATOM 8191  O O   . GLU E 1 125 ? 11.790  70.961  41.459  1.00 29.09 ? 125 GLU E O   1 
ATOM 8192  C CB  . GLU E 1 125 ? 9.797   71.786  44.085  1.00 28.84 ? 125 GLU E CB  1 
ATOM 8193  C CG  . GLU E 1 125 ? 8.365   72.161  44.402  1.00 32.09 ? 125 GLU E CG  1 
ATOM 8194  C CD  . GLU E 1 125 ? 7.877   73.337  43.581  1.00 33.67 ? 125 GLU E CD  1 
ATOM 8195  O OE1 . GLU E 1 125 ? 8.461   74.434  43.717  1.00 32.80 ? 125 GLU E OE1 1 
ATOM 8196  O OE2 . GLU E 1 125 ? 6.908   73.170  42.808  1.00 31.26 ? 125 GLU E OE2 1 
ATOM 8197  N N   . TYR E 1 126 ? 12.271  70.313  43.567  1.00 24.71 ? 126 TYR E N   1 
ATOM 8198  C CA  . TYR E 1 126 ? 13.706  70.231  43.358  1.00 23.05 ? 126 TYR E CA  1 
ATOM 8199  C C   . TYR E 1 126 ? 14.047  69.137  42.350  1.00 23.65 ? 126 TYR E C   1 
ATOM 8200  O O   . TYR E 1 126 ? 14.860  69.357  41.452  1.00 22.90 ? 126 TYR E O   1 
ATOM 8201  C CB  . TYR E 1 126 ? 14.425  69.986  44.694  1.00 23.36 ? 126 TYR E CB  1 
ATOM 8202  C CG  . TYR E 1 126 ? 15.935  69.976  44.588  1.00 20.92 ? 126 TYR E CG  1 
ATOM 8203  C CD1 . TYR E 1 126 ? 16.622  71.052  43.986  1.00 20.44 ? 126 TYR E CD1 1 
ATOM 8204  C CD2 . TYR E 1 126 ? 16.675  68.885  45.046  1.00 20.38 ? 126 TYR E CD2 1 
ATOM 8205  C CE1 . TYR E 1 126 ? 18.001  71.006  43.838  1.00 19.41 ? 126 TYR E CE1 1 
ATOM 8206  C CE2 . TYR E 1 126 ? 18.059  68.847  44.901  1.00 21.71 ? 126 TYR E CE2 1 
ATOM 8207  C CZ  . TYR E 1 126 ? 18.714  69.908  44.295  1.00 19.54 ? 126 TYR E CZ  1 
ATOM 8208  O OH  . TYR E 1 126 ? 20.080  69.838  44.134  1.00 14.93 ? 126 TYR E OH  1 
ATOM 8209  N N   . LEU E 1 127 ? 13.405  67.979  42.478  1.00 24.91 ? 127 LEU E N   1 
ATOM 8210  C CA  . LEU E 1 127 ? 13.655  66.860  41.572  1.00 23.39 ? 127 LEU E CA  1 
ATOM 8211  C C   . LEU E 1 127 ? 13.399  67.217  40.115  1.00 24.11 ? 127 LEU E C   1 
ATOM 8212  O O   . LEU E 1 127 ? 13.974  66.610  39.212  1.00 23.32 ? 127 LEU E O   1 
ATOM 8213  C CB  . LEU E 1 127 ? 12.804  65.652  41.956  1.00 22.49 ? 127 LEU E CB  1 
ATOM 8214  C CG  . LEU E 1 127 ? 13.106  64.982  43.298  1.00 20.41 ? 127 LEU E CG  1 
ATOM 8215  C CD1 . LEU E 1 127 ? 12.361  63.651  43.391  1.00 13.14 ? 127 LEU E CD1 1 
ATOM 8216  C CD2 . LEU E 1 127 ? 14.602  64.756  43.435  1.00 21.95 ? 127 LEU E CD2 1 
ATOM 8217  N N   . GLU E 1 128 ? 12.546  68.215  39.902  1.00 26.27 ? 128 GLU E N   1 
ATOM 8218  C CA  . GLU E 1 128 ? 12.181  68.691  38.569  1.00 26.52 ? 128 GLU E CA  1 
ATOM 8219  C C   . GLU E 1 128 ? 13.217  69.674  38.016  1.00 27.73 ? 128 GLU E C   1 
ATOM 8220  O O   . GLU E 1 128 ? 13.311  69.884  36.804  1.00 29.12 ? 128 GLU E O   1 
ATOM 8221  C CB  . GLU E 1 128 ? 10.799  69.350  38.647  1.00 26.09 ? 128 GLU E CB  1 
ATOM 8222  C CG  . GLU E 1 128 ? 10.160  69.727  37.325  1.00 21.61 ? 128 GLU E CG  1 
ATOM 8223  C CD  . GLU E 1 128 ? 8.663   69.974  37.450  1.00 21.42 ? 128 GLU E CD  1 
ATOM 8224  O OE1 . GLU E 1 128 ? 8.248   70.795  38.295  1.00 25.60 ? 128 GLU E OE1 1 
ATOM 8225  O OE2 . GLU E 1 128 ? 7.896   69.335  36.704  1.00 24.41 ? 128 GLU E OE2 1 
ATOM 8226  N N   . GLU E 1 129 ? 13.993  70.264  38.919  1.00 26.61 ? 129 GLU E N   1 
ATOM 8227  C CA  . GLU E 1 129 ? 15.028  71.232  38.565  1.00 27.12 ? 129 GLU E CA  1 
ATOM 8228  C C   . GLU E 1 129 ? 16.415  70.573  38.570  1.00 26.10 ? 129 GLU E C   1 
ATOM 8229  O O   . GLU E 1 129 ? 17.337  71.007  37.866  1.00 25.42 ? 129 GLU E O   1 
ATOM 8230  C CB  . GLU E 1 129 ? 15.001  72.380  39.578  1.00 26.68 ? 129 GLU E CB  1 
ATOM 8231  C CG  . GLU E 1 129 ? 15.272  73.745  38.990  1.00 28.08 ? 129 GLU E CG  1 
ATOM 8232  C CD  . GLU E 1 129 ? 14.222  74.163  37.981  1.00 30.41 ? 129 GLU E CD  1 
ATOM 8233  O OE1 . GLU E 1 129 ? 13.030  74.261  38.348  1.00 34.43 ? 129 GLU E OE1 1 
ATOM 8234  O OE2 . GLU E 1 129 ? 14.597  74.403  36.816  1.00 28.60 ? 129 GLU E OE2 1 
ATOM 8235  N N   . LEU E 1 130 ? 16.520  69.491  39.337  1.00 21.96 ? 130 LEU E N   1 
ATOM 8236  C CA  . LEU E 1 130 ? 17.747  68.719  39.513  1.00 18.82 ? 130 LEU E CA  1 
ATOM 8237  C C   . LEU E 1 130 ? 18.521  68.288  38.262  1.00 22.16 ? 130 LEU E C   1 
ATOM 8238  O O   . LEU E 1 130 ? 19.753  68.338  38.252  1.00 21.18 ? 130 LEU E O   1 
ATOM 8239  C CB  . LEU E 1 130 ? 17.452  67.501  40.392  1.00 9.96  ? 130 LEU E CB  1 
ATOM 8240  C CG  . LEU E 1 130 ? 18.560  66.482  40.643  1.00 6.68  ? 130 LEU E CG  1 
ATOM 8241  C CD1 . LEU E 1 130 ? 19.768  67.154  41.226  1.00 8.18  ? 130 LEU E CD1 1 
ATOM 8242  C CD2 . LEU E 1 130 ? 18.059  65.417  41.594  1.00 4.98  ? 130 LEU E CD2 1 
ATOM 8243  N N   . PRO E 1 131 ? 17.823  67.855  37.194  1.00 23.80 ? 131 PRO E N   1 
ATOM 8244  C CA  . PRO E 1 131 ? 18.541  67.431  35.985  1.00 25.78 ? 131 PRO E CA  1 
ATOM 8245  C C   . PRO E 1 131 ? 19.377  68.488  35.251  1.00 25.59 ? 131 PRO E C   1 
ATOM 8246  O O   . PRO E 1 131 ? 20.584  68.301  35.074  1.00 26.70 ? 131 PRO E O   1 
ATOM 8247  C CB  . PRO E 1 131 ? 17.424  66.858  35.103  1.00 26.47 ? 131 PRO E CB  1 
ATOM 8248  C CG  . PRO E 1 131 ? 16.207  67.607  35.553  1.00 26.84 ? 131 PRO E CG  1 
ATOM 8249  C CD  . PRO E 1 131 ? 16.377  67.606  37.049  1.00 24.69 ? 131 PRO E CD  1 
ATOM 8250  N N   . THR E 1 132 ? 18.760  69.602  34.861  1.00 23.53 ? 132 THR E N   1 
ATOM 8251  C CA  . THR E 1 132 ? 19.477  70.646  34.123  1.00 26.28 ? 132 THR E CA  1 
ATOM 8252  C C   . THR E 1 132 ? 20.581  71.275  34.972  1.00 28.01 ? 132 THR E C   1 
ATOM 8253  O O   . THR E 1 132 ? 21.546  71.844  34.456  1.00 27.54 ? 132 THR E O   1 
ATOM 8254  C CB  . THR E 1 132 ? 18.505  71.720  33.575  1.00 25.30 ? 132 THR E CB  1 
ATOM 8255  O OG1 . THR E 1 132 ? 19.111  72.397  32.462  1.00 22.74 ? 132 THR E OG1 1 
ATOM 8256  C CG2 . THR E 1 132 ? 18.137  72.739  34.663  1.00 26.11 ? 132 THR E CG2 1 
ATOM 8257  N N   . MET E 1 133 ? 20.425  71.135  36.281  1.00 29.28 ? 133 MET E N   1 
ATOM 8258  C CA  . MET E 1 133 ? 21.370  71.618  37.276  1.00 28.28 ? 133 MET E CA  1 
ATOM 8259  C C   . MET E 1 133 ? 22.624  70.724  37.204  1.00 28.04 ? 133 MET E C   1 
ATOM 8260  O O   . MET E 1 133 ? 23.759  71.221  37.200  1.00 29.03 ? 133 MET E O   1 
ATOM 8261  C CB  . MET E 1 133 ? 20.692  71.515  38.642  1.00 28.62 ? 133 MET E CB  1 
ATOM 8262  C CG  . MET E 1 133 ? 21.504  71.923  39.837  1.00 29.27 ? 133 MET E CG  1 
ATOM 8263  S SD  . MET E 1 133 ? 20.712  71.181  41.284  1.00 33.23 ? 133 MET E SD  1 
ATOM 8264  C CE  . MET E 1 133 ? 21.666  69.746  41.461  1.00 25.04 ? 133 MET E CE  1 
ATOM 8265  N N   . MET E 1 134 ? 22.407  69.415  37.088  1.00 25.48 ? 134 MET E N   1 
ATOM 8266  C CA  . MET E 1 134 ? 23.442  68.407  36.981  1.00 21.77 ? 134 MET E CA  1 
ATOM 8267  C C   . MET E 1 134 ? 24.071  68.401  35.603  1.00 21.41 ? 134 MET E C   1 
ATOM 8268  O O   . MET E 1 134 ? 25.106  67.795  35.377  1.00 20.53 ? 134 MET E O   1 
ATOM 8269  C CB  . MET E 1 134 ? 22.877  67.023  37.263  1.00 23.56 ? 134 MET E CB  1 
ATOM 8270  C CG  . MET E 1 134 ? 22.589  66.771  38.725  1.00 27.27 ? 134 MET E CG  1 
ATOM 8271  S SD  . MET E 1 134 ? 24.095  66.533  39.695  1.00 25.45 ? 134 MET E SD  1 
ATOM 8272  C CE  . MET E 1 134 ? 23.921  64.837  40.178  1.00 23.23 ? 134 MET E CE  1 
ATOM 8273  N N   . GLN E 1 135 ? 23.419  69.101  34.672  1.00 23.96 ? 135 GLN E N   1 
ATOM 8274  C CA  . GLN E 1 135 ? 23.917  69.228  33.308  1.00 23.83 ? 135 GLN E CA  1 
ATOM 8275  C C   . GLN E 1 135 ? 25.191  70.058  33.290  1.00 21.76 ? 135 GLN E C   1 
ATOM 8276  O O   . GLN E 1 135 ? 26.220  69.620  32.772  1.00 22.52 ? 135 GLN E O   1 
ATOM 8277  C CB  . GLN E 1 135 ? 22.868  69.888  32.411  1.00 24.48 ? 135 GLN E CB  1 
ATOM 8278  C CG  . GLN E 1 135 ? 23.427  70.409  31.099  1.00 25.63 ? 135 GLN E CG  1 
ATOM 8279  C CD  . GLN E 1 135 ? 22.350  70.867  30.151  1.00 22.06 ? 135 GLN E CD  1 
ATOM 8280  O OE1 . GLN E 1 135 ? 21.534  70.066  29.706  1.00 17.77 ? 135 GLN E OE1 1 
ATOM 8281  N NE2 . GLN E 1 135 ? 22.339  72.156  29.829  1.00 18.10 ? 135 GLN E NE2 1 
ATOM 8282  N N   . HIS E 1 136 ? 25.123  71.249  33.876  1.00 20.89 ? 136 HIS E N   1 
ATOM 8283  C CA  . HIS E 1 136 ? 26.279  72.142  33.919  1.00 23.21 ? 136 HIS E CA  1 
ATOM 8284  C C   . HIS E 1 136 ? 27.447  71.430  34.588  1.00 23.10 ? 136 HIS E C   1 
ATOM 8285  O O   . HIS E 1 136 ? 28.599  71.626  34.212  1.00 23.74 ? 136 HIS E O   1 
ATOM 8286  C CB  . HIS E 1 136 ? 25.979  73.420  34.710  1.00 26.22 ? 136 HIS E CB  1 
ATOM 8287  C CG  . HIS E 1 136 ? 24.559  73.837  34.748  1.00 28.06 ? 136 HIS E CG  1 
ATOM 8288  N ND1 . HIS E 1 136 ? 23.881  74.028  35.931  1.00 28.37 ? 136 HIS E ND1 1 
ATOM 8289  C CD2 . HIS E 1 136 ? 23.679  74.122  33.758  1.00 29.11 ? 136 HIS E CD2 1 
ATOM 8290  C CE1 . HIS E 1 136 ? 22.644  74.414  35.672  1.00 30.92 ? 136 HIS E CE1 1 
ATOM 8291  N NE2 . HIS E 1 136 ? 22.495  74.477  34.360  1.00 30.85 ? 136 HIS E NE2 1 
ATOM 8292  N N   . PHE E 1 137 ? 27.137  70.630  35.607  1.00 20.68 ? 137 PHE E N   1 
ATOM 8293  C CA  . PHE E 1 137 ? 28.147  69.871  36.336  1.00 17.99 ? 137 PHE E CA  1 
ATOM 8294  C C   . PHE E 1 137 ? 28.922  69.034  35.335  1.00 18.57 ? 137 PHE E C   1 
ATOM 8295  O O   . PHE E 1 137 ? 30.146  69.126  35.251  1.00 16.90 ? 137 PHE E O   1 
ATOM 8296  C CB  . PHE E 1 137 ? 27.485  68.951  37.369  1.00 17.56 ? 137 PHE E CB  1 
ATOM 8297  C CG  . PHE E 1 137 ? 27.718  69.362  38.797  1.00 17.28 ? 137 PHE E CG  1 
ATOM 8298  C CD1 . PHE E 1 137 ? 27.752  70.706  39.166  1.00 16.91 ? 137 PHE E CD1 1 
ATOM 8299  C CD2 . PHE E 1 137 ? 27.904  68.397  39.770  1.00 16.50 ? 137 PHE E CD2 1 
ATOM 8300  C CE1 . PHE E 1 137 ? 27.968  71.105  40.491  1.00 18.78 ? 137 PHE E CE1 1 
ATOM 8301  C CE2 . PHE E 1 137 ? 28.121  68.768  41.106  1.00 19.38 ? 137 PHE E CE2 1 
ATOM 8302  C CZ  . PHE E 1 137 ? 28.154  70.117  41.465  1.00 18.60 ? 137 PHE E CZ  1 
ATOM 8303  N N   . SER E 1 138 ? 28.188  68.265  34.538  1.00 18.48 ? 138 SER E N   1 
ATOM 8304  C CA  . SER E 1 138 ? 28.773  67.402  33.522  1.00 17.07 ? 138 SER E CA  1 
ATOM 8305  C C   . SER E 1 138 ? 29.528  68.198  32.457  1.00 16.77 ? 138 SER E C   1 
ATOM 8306  O O   . SER E 1 138 ? 30.493  67.708  31.868  1.00 16.67 ? 138 SER E O   1 
ATOM 8307  C CB  . SER E 1 138 ? 27.677  66.570  32.863  1.00 15.79 ? 138 SER E CB  1 
ATOM 8308  O OG  . SER E 1 138 ? 28.227  65.541  32.061  1.00 15.44 ? 138 SER E OG  1 
ATOM 8309  N N   . GLN E 1 139 ? 29.071  69.417  32.192  1.00 17.02 ? 139 GLN E N   1 
ATOM 8310  C CA  . GLN E 1 139 ? 29.716  70.271  31.203  1.00 20.05 ? 139 GLN E CA  1 
ATOM 8311  C C   . GLN E 1 139 ? 30.973  70.936  31.768  1.00 20.09 ? 139 GLN E C   1 
ATOM 8312  O O   . GLN E 1 139 ? 31.921  71.216  31.034  1.00 18.74 ? 139 GLN E O   1 
ATOM 8313  C CB  . GLN E 1 139 ? 28.732  71.329  30.697  1.00 24.25 ? 139 GLN E CB  1 
ATOM 8314  C CG  . GLN E 1 139 ? 27.553  70.736  29.934  1.00 27.25 ? 139 GLN E CG  1 
ATOM 8315  C CD  . GLN E 1 139 ? 26.546  71.779  29.488  1.00 27.35 ? 139 GLN E CD  1 
ATOM 8316  O OE1 . GLN E 1 139 ? 26.094  72.605  30.278  1.00 24.92 ? 139 GLN E OE1 1 
ATOM 8317  N NE2 . GLN E 1 139 ? 26.161  71.720  28.219  1.00 25.57 ? 139 GLN E NE2 1 
ATOM 8318  N N   . PHE E 1 140 ? 30.983  71.150  33.079  1.00 18.79 ? 140 PHE E N   1 
ATOM 8319  C CA  . PHE E 1 140 ? 32.109  71.780  33.757  1.00 18.81 ? 140 PHE E CA  1 
ATOM 8320  C C   . PHE E 1 140 ? 33.291  70.819  33.831  1.00 17.92 ? 140 PHE E C   1 
ATOM 8321  O O   . PHE E 1 140 ? 34.443  71.223  33.668  1.00 19.66 ? 140 PHE E O   1 
ATOM 8322  C CB  . PHE E 1 140 ? 31.696  72.199  35.166  1.00 20.18 ? 140 PHE E CB  1 
ATOM 8323  C CG  . PHE E 1 140 ? 32.542  73.293  35.750  1.00 15.17 ? 140 PHE E CG  1 
ATOM 8324  C CD1 . PHE E 1 140 ? 32.265  74.627  35.464  1.00 13.81 ? 140 PHE E CD1 1 
ATOM 8325  C CD2 . PHE E 1 140 ? 33.581  72.981  36.617  1.00 11.70 ? 140 PHE E CD2 1 
ATOM 8326  C CE1 . PHE E 1 140 ? 33.008  75.645  36.033  1.00 11.33 ? 140 PHE E CE1 1 
ATOM 8327  C CE2 . PHE E 1 140 ? 34.329  74.013  37.190  1.00 14.97 ? 140 PHE E CE2 1 
ATOM 8328  C CZ  . PHE E 1 140 ? 34.039  75.342  36.898  1.00 13.74 ? 140 PHE E CZ  1 
ATOM 8329  N N   . LEU E 1 141 ? 32.993  69.562  34.147  1.00 11.88 ? 141 LEU E N   1 
ATOM 8330  C CA  . LEU E 1 141 ? 34.008  68.524  34.232  1.00 11.91 ? 141 LEU E CA  1 
ATOM 8331  C C   . LEU E 1 141 ? 34.447  68.291  32.796  1.00 13.54 ? 141 LEU E C   1 
ATOM 8332  O O   . LEU E 1 141 ? 35.610  68.491  32.445  1.00 11.89 ? 141 LEU E O   1 
ATOM 8333  C CB  . LEU E 1 141 ? 33.398  67.255  34.835  1.00 10.38 ? 141 LEU E CB  1 
ATOM 8334  C CG  . LEU E 1 141 ? 34.253  66.004  35.045  1.00 9.19  ? 141 LEU E CG  1 
ATOM 8335  C CD1 . LEU E 1 141 ? 35.497  66.309  35.863  1.00 4.02  ? 141 LEU E CD1 1 
ATOM 8336  C CD2 . LEU E 1 141 ? 33.405  64.958  35.740  1.00 8.69  ? 141 LEU E CD2 1 
ATOM 8337  N N   . GLY E 1 142 ? 33.485  67.911  31.962  1.00 16.33 ? 142 GLY E N   1 
ATOM 8338  C CA  . GLY E 1 142 ? 33.757  67.689  30.559  1.00 17.47 ? 142 GLY E CA  1 
ATOM 8339  C C   . GLY E 1 142 ? 34.921  66.777  30.236  1.00 18.39 ? 142 GLY E C   1 
ATOM 8340  O O   . GLY E 1 142 ? 34.970  65.630  30.687  1.00 18.62 ? 142 GLY E O   1 
ATOM 8341  N N   . LYS E 1 143 ? 35.884  67.306  29.488  1.00 19.14 ? 143 LYS E N   1 
ATOM 8342  C CA  . LYS E 1 143 ? 37.040  66.529  29.054  1.00 21.88 ? 143 LYS E CA  1 
ATOM 8343  C C   . LYS E 1 143 ? 38.245  66.515  29.986  1.00 21.02 ? 143 LYS E C   1 
ATOM 8344  O O   . LYS E 1 143 ? 39.314  67.031  29.635  1.00 22.18 ? 143 LYS E O   1 
ATOM 8345  C CB  . LYS E 1 143 ? 37.461  66.986  27.663  1.00 23.62 ? 143 LYS E CB  1 
ATOM 8346  C CG  . LYS E 1 143 ? 36.322  66.970  26.677  1.00 26.66 ? 143 LYS E CG  1 
ATOM 8347  C CD  . LYS E 1 143 ? 36.771  67.365  25.298  1.00 29.73 ? 143 LYS E CD  1 
ATOM 8348  C CE  . LYS E 1 143 ? 35.590  67.368  24.356  1.00 28.98 ? 143 LYS E CE  1 
ATOM 8349  N NZ  . LYS E 1 143 ? 36.005  67.751  22.988  1.00 26.86 ? 143 LYS E NZ  1 
ATOM 8350  N N   . ARG E 1 144 ? 38.083  65.895  31.152  1.00 19.32 ? 144 ARG E N   1 
ATOM 8351  C CA  . ARG E 1 144 ? 39.161  65.795  32.131  1.00 14.51 ? 144 ARG E CA  1 
ATOM 8352  C C   . ARG E 1 144 ? 38.755  64.960  33.337  1.00 13.58 ? 144 ARG E C   1 
ATOM 8353  O O   . ARG E 1 144 ? 37.572  64.858  33.662  1.00 15.16 ? 144 ARG E O   1 
ATOM 8354  C CB  . ARG E 1 144 ? 39.611  67.186  32.594  1.00 9.00  ? 144 ARG E CB  1 
ATOM 8355  C CG  . ARG E 1 144 ? 38.499  68.100  33.091  1.00 9.31  ? 144 ARG E CG  1 
ATOM 8356  C CD  . ARG E 1 144 ? 39.039  69.505  33.238  1.00 11.66 ? 144 ARG E CD  1 
ATOM 8357  N NE  . ARG E 1 144 ? 38.171  70.549  32.699  1.00 6.29  ? 144 ARG E NE  1 
ATOM 8358  C CZ  . ARG E 1 144 ? 37.653  70.554  31.474  1.00 3.12  ? 144 ARG E CZ  1 
ATOM 8359  N NH1 . ARG E 1 144 ? 37.891  69.556  30.633  1.00 6.15  ? 144 ARG E NH1 1 
ATOM 8360  N NH2 . ARG E 1 144 ? 36.945  71.597  31.065  1.00 2.00  ? 144 ARG E NH2 1 
ATOM 8361  N N   . PRO E 1 145 ? 39.736  64.280  33.962  1.00 14.09 ? 145 PRO E N   1 
ATOM 8362  C CA  . PRO E 1 145 ? 39.479  63.449  35.138  1.00 14.62 ? 145 PRO E CA  1 
ATOM 8363  C C   . PRO E 1 145 ? 39.098  64.251  36.389  1.00 13.80 ? 145 PRO E C   1 
ATOM 8364  O O   . PRO E 1 145 ? 38.331  63.765  37.218  1.00 12.79 ? 145 PRO E O   1 
ATOM 8365  C CB  . PRO E 1 145 ? 40.794  62.688  35.318  1.00 16.58 ? 145 PRO E CB  1 
ATOM 8366  C CG  . PRO E 1 145 ? 41.822  63.587  34.679  1.00 15.81 ? 145 PRO E CG  1 
ATOM 8367  C CD  . PRO E 1 145 ? 41.104  64.062  33.455  1.00 14.80 ? 145 PRO E CD  1 
ATOM 8368  N N   . TRP E 1 146 ? 39.619  65.471  36.524  1.00 12.47 ? 146 TRP E N   1 
ATOM 8369  C CA  . TRP E 1 146 ? 39.314  66.309  37.684  1.00 12.63 ? 146 TRP E CA  1 
ATOM 8370  C C   . TRP E 1 146 ? 38.731  67.650  37.245  1.00 13.43 ? 146 TRP E C   1 
ATOM 8371  O O   . TRP E 1 146 ? 39.247  68.283  36.325  1.00 10.72 ? 146 TRP E O   1 
ATOM 8372  C CB  . TRP E 1 146 ? 40.571  66.541  38.536  1.00 11.02 ? 146 TRP E CB  1 
ATOM 8373  C CG  . TRP E 1 146 ? 41.333  65.282  38.881  1.00 11.48 ? 146 TRP E CG  1 
ATOM 8374  C CD1 . TRP E 1 146 ? 42.596  64.960  38.478  1.00 12.80 ? 146 TRP E CD1 1 
ATOM 8375  C CD2 . TRP E 1 146 ? 40.873  64.178  39.679  1.00 9.59  ? 146 TRP E CD2 1 
ATOM 8376  N NE1 . TRP E 1 146 ? 42.950  63.727  38.969  1.00 8.05  ? 146 TRP E NE1 1 
ATOM 8377  C CE2 . TRP E 1 146 ? 41.913  63.223  39.712  1.00 8.82  ? 146 TRP E CE2 1 
ATOM 8378  C CE3 . TRP E 1 146 ? 39.682  63.901  40.368  1.00 8.96  ? 146 TRP E CE3 1 
ATOM 8379  C CZ2 . TRP E 1 146 ? 41.802  62.009  40.407  1.00 8.33  ? 146 TRP E CZ2 1 
ATOM 8380  C CZ3 . TRP E 1 146 ? 39.570  62.691  41.060  1.00 7.80  ? 146 TRP E CZ3 1 
ATOM 8381  C CH2 . TRP E 1 146 ? 40.627  61.763  41.070  1.00 10.87 ? 146 TRP E CH2 1 
ATOM 8382  N N   . PHE E 1 147 ? 37.682  68.088  37.941  1.00 11.17 ? 147 PHE E N   1 
ATOM 8383  C CA  . PHE E 1 147 ? 36.979  69.348  37.662  1.00 10.93 ? 147 PHE E CA  1 
ATOM 8384  C C   . PHE E 1 147 ? 37.861  70.579  37.488  1.00 12.30 ? 147 PHE E C   1 
ATOM 8385  O O   . PHE E 1 147 ? 37.489  71.523  36.804  1.00 12.84 ? 147 PHE E O   1 
ATOM 8386  C CB  . PHE E 1 147 ? 35.973  69.652  38.774  1.00 9.71  ? 147 PHE E CB  1 
ATOM 8387  C CG  . PHE E 1 147 ? 34.706  68.847  38.703  1.00 5.83  ? 147 PHE E CG  1 
ATOM 8388  C CD1 . PHE E 1 147 ? 34.723  67.465  38.882  1.00 3.87  ? 147 PHE E CD1 1 
ATOM 8389  C CD2 . PHE E 1 147 ? 33.487  69.493  38.493  1.00 4.45  ? 147 PHE E CD2 1 
ATOM 8390  C CE1 . PHE E 1 147 ? 33.543  66.724  38.854  1.00 4.93  ? 147 PHE E CE1 1 
ATOM 8391  C CE2 . PHE E 1 147 ? 32.301  68.744  38.464  1.00 2.00  ? 147 PHE E CE2 1 
ATOM 8392  C CZ  . PHE E 1 147 ? 32.332  67.346  38.645  1.00 5.49  ? 147 PHE E CZ  1 
ATOM 8393  N N   . VAL E 1 148 ? 38.997  70.589  38.170  1.00 15.69 ? 148 VAL E N   1 
ATOM 8394  C CA  . VAL E 1 148 ? 39.928  71.706  38.113  1.00 14.43 ? 148 VAL E CA  1 
ATOM 8395  C C   . VAL E 1 148 ? 40.809  71.633  36.880  1.00 14.85 ? 148 VAL E C   1 
ATOM 8396  O O   . VAL E 1 148 ? 41.237  72.657  36.344  1.00 11.76 ? 148 VAL E O   1 
ATOM 8397  C CB  . VAL E 1 148 ? 40.828  71.704  39.344  1.00 12.02 ? 148 VAL E CB  1 
ATOM 8398  C CG1 . VAL E 1 148 ? 41.739  72.914  39.340  1.00 11.43 ? 148 VAL E CG1 1 
ATOM 8399  C CG2 . VAL E 1 148 ? 39.986  71.664  40.576  1.00 9.97  ? 148 VAL E CG2 1 
ATOM 8400  N N   . GLY E 1 149 ? 41.111  70.409  36.466  1.00 14.01 ? 149 GLY E N   1 
ATOM 8401  C CA  . GLY E 1 149 ? 41.948  70.210  35.304  1.00 14.31 ? 149 GLY E CA  1 
ATOM 8402  C C   . GLY E 1 149 ? 42.682  68.892  35.364  1.00 15.43 ? 149 GLY E C   1 
ATOM 8403  O O   . GLY E 1 149 ? 42.091  67.841  35.634  1.00 16.82 ? 149 GLY E O   1 
ATOM 8404  N N   . ASP E 1 150 ? 43.986  68.957  35.123  1.00 15.06 ? 150 ASP E N   1 
ATOM 8405  C CA  . ASP E 1 150 ? 44.840  67.780  35.134  1.00 17.62 ? 150 ASP E CA  1 
ATOM 8406  C C   . ASP E 1 150 ? 45.207  67.334  36.547  1.00 17.34 ? 150 ASP E C   1 
ATOM 8407  O O   . ASP E 1 150 ? 45.640  66.198  36.750  1.00 15.15 ? 150 ASP E O   1 
ATOM 8408  C CB  . ASP E 1 150 ? 46.117  68.057  34.334  1.00 21.54 ? 150 ASP E CB  1 
ATOM 8409  C CG  . ASP E 1 150 ? 45.845  68.297  32.855  1.00 22.02 ? 150 ASP E CG  1 
ATOM 8410  O OD1 . ASP E 1 150 ? 45.472  69.433  32.482  1.00 23.98 ? 150 ASP E OD1 1 
ATOM 8411  O OD2 . ASP E 1 150 ? 46.013  67.344  32.061  1.00 25.05 ? 150 ASP E OD2 1 
ATOM 8412  N N   . LYS E 1 151 ? 45.008  68.213  37.525  1.00 16.68 ? 151 LYS E N   1 
ATOM 8413  C CA  . LYS E 1 151 ? 45.348  67.907  38.914  1.00 16.06 ? 151 LYS E CA  1 
ATOM 8414  C C   . LYS E 1 151 ? 44.177  67.954  39.893  1.00 14.80 ? 151 LYS E C   1 
ATOM 8415  O O   . LYS E 1 151 ? 43.294  68.809  39.786  1.00 17.04 ? 151 LYS E O   1 
ATOM 8416  C CB  . LYS E 1 151 ? 46.454  68.850  39.385  1.00 19.98 ? 151 LYS E CB  1 
ATOM 8417  C CG  . LYS E 1 151 ? 46.283  70.274  38.889  1.00 20.93 ? 151 LYS E CG  1 
ATOM 8418  C CD  . LYS E 1 151 ? 47.308  71.210  39.503  1.00 19.95 ? 151 LYS E CD  1 
ATOM 8419  C CE  . LYS E 1 151 ? 47.114  71.328  41.005  1.00 20.11 ? 151 LYS E CE  1 
ATOM 8420  N NZ  . LYS E 1 151 ? 45.724  71.744  41.335  1.00 23.06 ? 151 LYS E NZ  1 
ATOM 8421  N N   . ILE E 1 152 ? 44.189  67.040  40.860  1.00 12.59 ? 152 ILE E N   1 
ATOM 8422  C CA  . ILE E 1 152 ? 43.136  66.960  41.877  1.00 9.63  ? 152 ILE E CA  1 
ATOM 8423  C C   . ILE E 1 152 ? 43.304  68.043  42.952  1.00 10.03 ? 152 ILE E C   1 
ATOM 8424  O O   . ILE E 1 152 ? 44.425  68.454  43.270  1.00 9.44  ? 152 ILE E O   1 
ATOM 8425  C CB  . ILE E 1 152 ? 43.094  65.565  42.552  1.00 3.73  ? 152 ILE E CB  1 
ATOM 8426  C CG1 . ILE E 1 152 ? 41.921  65.488  43.527  1.00 4.57  ? 152 ILE E CG1 1 
ATOM 8427  C CG2 . ILE E 1 152 ? 44.401  65.281  43.266  1.00 2.00  ? 152 ILE E CG2 1 
ATOM 8428  C CD1 . ILE E 1 152 ? 41.724  64.130  44.137  1.00 10.12 ? 152 ILE E CD1 1 
ATOM 8429  N N   . THR E 1 153 ? 42.185  68.491  43.513  1.00 9.08  ? 153 THR E N   1 
ATOM 8430  C CA  . THR E 1 153 ? 42.187  69.528  44.540  1.00 10.21 ? 153 THR E CA  1 
ATOM 8431  C C   . THR E 1 153 ? 41.088  69.238  45.563  1.00 9.32  ? 153 THR E C   1 
ATOM 8432  O O   . THR E 1 153 ? 40.326  68.283  45.406  1.00 9.41  ? 153 THR E O   1 
ATOM 8433  C CB  . THR E 1 153 ? 41.918  70.912  43.921  1.00 10.86 ? 153 THR E CB  1 
ATOM 8434  O OG1 . THR E 1 153 ? 40.628  70.906  43.302  1.00 18.27 ? 153 THR E OG1 1 
ATOM 8435  C CG2 . THR E 1 153 ? 42.966  71.250  42.865  1.00 8.50  ? 153 THR E CG2 1 
ATOM 8436  N N   . PHE E 1 154 ? 40.974  70.081  46.584  1.00 9.56  ? 154 PHE E N   1 
ATOM 8437  C CA  . PHE E 1 154 ? 39.956  69.884  47.612  1.00 10.55 ? 154 PHE E CA  1 
ATOM 8438  C C   . PHE E 1 154 ? 38.528  69.981  47.071  1.00 13.13 ? 154 PHE E C   1 
ATOM 8439  O O   . PHE E 1 154 ? 37.645  69.239  47.503  1.00 14.64 ? 154 PHE E O   1 
ATOM 8440  C CB  . PHE E 1 154 ? 40.155  70.861  48.785  1.00 7.17  ? 154 PHE E CB  1 
ATOM 8441  C CG  . PHE E 1 154 ? 39.752  72.289  48.485  1.00 5.58  ? 154 PHE E CG  1 
ATOM 8442  C CD1 . PHE E 1 154 ? 40.609  73.140  47.790  1.00 3.99  ? 154 PHE E CD1 1 
ATOM 8443  C CD2 . PHE E 1 154 ? 38.513  72.787  48.932  1.00 2.87  ? 154 PHE E CD2 1 
ATOM 8444  C CE1 . PHE E 1 154 ? 40.256  74.459  47.546  1.00 2.00  ? 154 PHE E CE1 1 
ATOM 8445  C CE2 . PHE E 1 154 ? 38.169  74.100  48.693  1.00 2.00  ? 154 PHE E CE2 1 
ATOM 8446  C CZ  . PHE E 1 154 ? 39.035  74.942  47.999  1.00 2.00  ? 154 PHE E CZ  1 
ATOM 8447  N N   . VAL E 1 155 ? 38.309  70.876  46.108  1.00 13.82 ? 155 VAL E N   1 
ATOM 8448  C CA  . VAL E 1 155 ? 36.979  71.064  45.524  1.00 11.15 ? 155 VAL E CA  1 
ATOM 8449  C C   . VAL E 1 155 ? 36.426  69.776  44.940  1.00 11.48 ? 155 VAL E C   1 
ATOM 8450  O O   . VAL E 1 155 ? 35.211  69.609  44.815  1.00 8.49  ? 155 VAL E O   1 
ATOM 8451  C CB  . VAL E 1 155 ? 36.964  72.151  44.431  1.00 10.70 ? 155 VAL E CB  1 
ATOM 8452  C CG1 . VAL E 1 155 ? 37.321  73.487  45.028  1.00 7.18  ? 155 VAL E CG1 1 
ATOM 8453  C CG2 . VAL E 1 155 ? 37.906  71.792  43.309  1.00 9.06  ? 155 VAL E CG2 1 
ATOM 8454  N N   . ASP E 1 156 ? 37.321  68.864  44.587  1.00 11.32 ? 156 ASP E N   1 
ATOM 8455  C CA  . ASP E 1 156 ? 36.905  67.593  44.032  1.00 14.27 ? 156 ASP E CA  1 
ATOM 8456  C C   . ASP E 1 156 ? 36.231  66.788  45.140  1.00 14.64 ? 156 ASP E C   1 
ATOM 8457  O O   . ASP E 1 156 ? 35.215  66.129  44.904  1.00 15.00 ? 156 ASP E O   1 
ATOM 8458  C CB  . ASP E 1 156 ? 38.109  66.864  43.433  1.00 15.42 ? 156 ASP E CB  1 
ATOM 8459  C CG  . ASP E 1 156 ? 38.750  67.639  42.281  1.00 16.27 ? 156 ASP E CG  1 
ATOM 8460  O OD1 . ASP E 1 156 ? 38.208  68.685  41.867  1.00 14.24 ? 156 ASP E OD1 1 
ATOM 8461  O OD2 . ASP E 1 156 ? 39.803  67.203  41.782  1.00 18.45 ? 156 ASP E OD2 1 
ATOM 8462  N N   . PHE E 1 157 ? 36.753  66.914  46.359  1.00 15.13 ? 157 PHE E N   1 
ATOM 8463  C CA  . PHE E 1 157 ? 36.197  66.223  47.525  1.00 13.43 ? 157 PHE E CA  1 
ATOM 8464  C C   . PHE E 1 157 ? 34.779  66.729  47.756  1.00 9.13  ? 157 PHE E C   1 
ATOM 8465  O O   . PHE E 1 157 ? 33.866  65.945  48.003  1.00 3.39  ? 157 PHE E O   1 
ATOM 8466  C CB  . PHE E 1 157 ? 37.038  66.496  48.781  1.00 15.55 ? 157 PHE E CB  1 
ATOM 8467  C CG  . PHE E 1 157 ? 38.430  65.926  48.722  1.00 14.22 ? 157 PHE E CG  1 
ATOM 8468  C CD1 . PHE E 1 157 ? 39.345  66.382  47.778  1.00 11.74 ? 157 PHE E CD1 1 
ATOM 8469  C CD2 . PHE E 1 157 ? 38.826  64.938  49.615  1.00 14.71 ? 157 PHE E CD2 1 
ATOM 8470  C CE1 . PHE E 1 157 ? 40.629  65.864  47.724  1.00 11.12 ? 157 PHE E CE1 1 
ATOM 8471  C CE2 . PHE E 1 157 ? 40.108  64.413  49.568  1.00 13.16 ? 157 PHE E CE2 1 
ATOM 8472  C CZ  . PHE E 1 157 ? 41.012  64.875  48.623  1.00 13.87 ? 157 PHE E CZ  1 
ATOM 8473  N N   . LEU E 1 158 ? 34.612  68.049  47.677  1.00 8.48  ? 158 LEU E N   1 
ATOM 8474  C CA  . LEU E 1 158 ? 33.308  68.691  47.856  1.00 10.17 ? 158 LEU E CA  1 
ATOM 8475  C C   . LEU E 1 158 ? 32.349  68.186  46.795  1.00 11.49 ? 158 LEU E C   1 
ATOM 8476  O O   . LEU E 1 158 ? 31.267  67.682  47.117  1.00 9.93  ? 158 LEU E O   1 
ATOM 8477  C CB  . LEU E 1 158 ? 33.440  70.208  47.716  1.00 8.61  ? 158 LEU E CB  1 
ATOM 8478  C CG  . LEU E 1 158 ? 33.975  71.001  48.899  1.00 8.06  ? 158 LEU E CG  1 
ATOM 8479  C CD1 . LEU E 1 158 ? 34.145  72.450  48.487  1.00 6.80  ? 158 LEU E CD1 1 
ATOM 8480  C CD2 . LEU E 1 158 ? 33.001  70.884  50.057  1.00 2.90  ? 158 LEU E CD2 1 
ATOM 8481  N N   . ALA E 1 159 ? 32.778  68.320  45.542  1.00 11.10 ? 159 ALA E N   1 
ATOM 8482  C CA  . ALA E 1 159 ? 32.007  67.895  44.391  1.00 7.82  ? 159 ALA E CA  1 
ATOM 8483  C C   . ALA E 1 159 ? 31.512  66.484  44.631  1.00 7.35  ? 159 ALA E C   1 
ATOM 8484  O O   . ALA E 1 159 ? 30.314  66.235  44.509  1.00 3.32  ? 159 ALA E O   1 
ATOM 8485  C CB  . ALA E 1 159 ? 32.864  67.949  43.151  1.00 9.92  ? 159 ALA E CB  1 
ATOM 8486  N N   . TYR E 1 160 ? 32.421  65.605  45.050  1.00 10.35 ? 160 TYR E N   1 
ATOM 8487  C CA  . TYR E 1 160 ? 32.080  64.212  45.320  1.00 10.93 ? 160 TYR E CA  1 
ATOM 8488  C C   . TYR E 1 160 ? 30.942  64.073  46.321  1.00 10.81 ? 160 TYR E C   1 
ATOM 8489  O O   . TYR E 1 160 ? 30.092  63.178  46.162  1.00 9.80  ? 160 TYR E O   1 
ATOM 8490  C CB  . TYR E 1 160 ? 33.299  63.413  45.799  1.00 9.66  ? 160 TYR E CB  1 
ATOM 8491  C CG  . TYR E 1 160 ? 32.944  62.018  46.274  1.00 8.46  ? 160 TYR E CG  1 
ATOM 8492  C CD1 . TYR E 1 160 ? 32.848  60.954  45.378  1.00 6.90  ? 160 TYR E CD1 1 
ATOM 8493  C CD2 . TYR E 1 160 ? 32.635  61.779  47.609  1.00 7.20  ? 160 TYR E CD2 1 
ATOM 8494  C CE1 . TYR E 1 160 ? 32.446  59.689  45.802  1.00 7.63  ? 160 TYR E CE1 1 
ATOM 8495  C CE2 . TYR E 1 160 ? 32.228  60.522  48.043  1.00 11.52 ? 160 TYR E CE2 1 
ATOM 8496  C CZ  . TYR E 1 160 ? 32.133  59.481  47.137  1.00 9.49  ? 160 TYR E CZ  1 
ATOM 8497  O OH  . TYR E 1 160 ? 31.709  58.244  47.576  1.00 13.00 ? 160 TYR E OH  1 
ATOM 8498  N N   . ASP E 1 161 ? 30.936  64.885  47.362  1.00 12.98 ? 161 ASP E N   1 
ATOM 8499  C CA  . ASP E 1 161 ? 29.884  64.812  48.373  1.00 14.41 ? 161 ASP E CA  1 
ATOM 8500  C C   . ASP E 1 161 ? 28.547  65.257  47.783  1.00 14.47 ? 161 ASP E C   1 
ATOM 8501  O O   . ASP E 1 161 ? 27.512  64.628  48.013  1.00 9.83  ? 161 ASP E O   1 
ATOM 8502  C CB  . ASP E 1 161 ? 30.251  65.667  49.599  1.00 13.93 ? 161 ASP E CB  1 
ATOM 8503  C CG  . ASP E 1 161 ? 29.178  65.628  50.694  1.00 15.25 ? 161 ASP E CG  1 
ATOM 8504  O OD1 . ASP E 1 161 ? 28.697  64.526  51.035  1.00 20.47 ? 161 ASP E OD1 1 
ATOM 8505  O OD2 . ASP E 1 161 ? 28.814  66.705  51.217  1.00 17.28 ? 161 ASP E OD2 1 
ATOM 8506  N N   . VAL E 1 162 ? 28.583  66.329  46.998  1.00 14.08 ? 162 VAL E N   1 
ATOM 8507  C CA  . VAL E 1 162 ? 27.383  66.866  46.369  1.00 17.28 ? 162 VAL E CA  1 
ATOM 8508  C C   . VAL E 1 162 ? 26.795  65.827  45.435  1.00 21.64 ? 162 VAL E C   1 
ATOM 8509  O O   . VAL E 1 162 ? 25.557  65.677  45.357  1.00 24.07 ? 162 VAL E O   1 
ATOM 8510  C CB  . VAL E 1 162 ? 27.695  68.143  45.576  1.00 19.91 ? 162 VAL E CB  1 
ATOM 8511  C CG1 . VAL E 1 162 ? 26.470  68.599  44.801  1.00 20.94 ? 162 VAL E CG1 1 
ATOM 8512  C CG2 . VAL E 1 162 ? 28.159  69.234  46.521  1.00 21.40 ? 162 VAL E CG2 1 
ATOM 8513  N N   . LEU E 1 163 ? 27.638  65.133  44.700  1.00 20.80 ? 163 LEU E N   1 
ATOM 8514  C CA  . LEU E 1 163 ? 27.181  64.098  43.788  1.00 19.21 ? 163 LEU E CA  1 
ATOM 8515  C C   . LEU E 1 163 ? 26.593  62.952  44.593  1.00 18.03 ? 163 LEU E C   1 
ATOM 8516  O O   . LEU E 1 163 ? 25.395  62.682  44.527  1.00 20.92 ? 163 LEU E O   1 
ATOM 8517  C CB  . LEU E 1 163 ? 28.341  63.593  42.927  1.00 19.11 ? 163 LEU E CB  1 
ATOM 8518  C CG  . LEU E 1 163 ? 28.900  64.612  41.933  1.00 19.36 ? 163 LEU E CG  1 
ATOM 8519  C CD1 . LEU E 1 163 ? 30.063  64.010  41.168  1.00 17.41 ? 163 LEU E CD1 1 
ATOM 8520  C CD2 . LEU E 1 163 ? 27.802  65.061  40.980  1.00 14.41 ? 163 LEU E CD2 1 
ATOM 8521  N N   . ASP E 1 164 ? 27.432  62.342  45.419  1.00 16.92 ? 164 ASP E N   1 
ATOM 8522  C CA  . ASP E 1 164 ? 27.045  61.212  46.249  1.00 13.64 ? 164 ASP E CA  1 
ATOM 8523  C C   . ASP E 1 164 ? 25.751  61.352  47.070  1.00 13.31 ? 164 ASP E C   1 
ATOM 8524  O O   . ASP E 1 164 ? 25.048  60.357  47.273  1.00 9.72  ? 164 ASP E O   1 
ATOM 8525  C CB  . ASP E 1 164 ? 28.201  60.820  47.166  1.00 10.25 ? 164 ASP E CB  1 
ATOM 8526  C CG  . ASP E 1 164 ? 27.831  59.716  48.110  1.00 10.08 ? 164 ASP E CG  1 
ATOM 8527  O OD1 . ASP E 1 164 ? 27.267  58.707  47.643  1.00 8.03  ? 164 ASP E OD1 1 
ATOM 8528  O OD2 . ASP E 1 164 ? 28.070  59.869  49.321  1.00 12.67 ? 164 ASP E OD2 1 
ATOM 8529  N N   . LEU E 1 165 ? 25.452  62.551  47.573  1.00 15.78 ? 165 LEU E N   1 
ATOM 8530  C CA  . LEU E 1 165 ? 24.231  62.754  48.364  1.00 13.34 ? 165 LEU E CA  1 
ATOM 8531  C C   . LEU E 1 165 ? 23.014  62.585  47.466  1.00 14.86 ? 165 LEU E C   1 
ATOM 8532  O O   . LEU E 1 165 ? 22.099  61.812  47.767  1.00 16.54 ? 165 LEU E O   1 
ATOM 8533  C CB  . LEU E 1 165 ? 24.212  64.143  49.001  1.00 10.60 ? 165 LEU E CB  1 
ATOM 8534  C CG  . LEU E 1 165 ? 25.168  64.372  50.167  1.00 6.78  ? 165 LEU E CG  1 
ATOM 8535  C CD1 . LEU E 1 165 ? 25.140  65.837  50.566  1.00 2.14  ? 165 LEU E CD1 1 
ATOM 8536  C CD2 . LEU E 1 165 ? 24.778  63.487  51.339  1.00 4.94  ? 165 LEU E CD2 1 
ATOM 8537  N N   . HIS E 1 166 ? 23.025  63.299  46.345  1.00 16.49 ? 166 HIS E N   1 
ATOM 8538  C CA  . HIS E 1 166 ? 21.938  63.229  45.382  1.00 16.61 ? 166 HIS E CA  1 
ATOM 8539  C C   . HIS E 1 166 ? 21.836  61.791  44.909  1.00 18.49 ? 166 HIS E C   1 
ATOM 8540  O O   . HIS E 1 166 ? 20.749  61.260  44.737  1.00 22.64 ? 166 HIS E O   1 
ATOM 8541  C CB  . HIS E 1 166 ? 22.218  64.154  44.195  1.00 14.93 ? 166 HIS E CB  1 
ATOM 8542  C CG  . HIS E 1 166 ? 22.128  65.607  44.531  1.00 10.77 ? 166 HIS E CG  1 
ATOM 8543  N ND1 . HIS E 1 166 ? 23.190  66.474  44.384  1.00 7.68  ? 166 HIS E ND1 1 
ATOM 8544  C CD2 . HIS E 1 166 ? 21.101  66.348  45.013  1.00 9.73  ? 166 HIS E CD2 1 
ATOM 8545  C CE1 . HIS E 1 166 ? 22.818  67.686  44.758  1.00 9.22  ? 166 HIS E CE1 1 
ATOM 8546  N NE2 . HIS E 1 166 ? 21.557  67.636  45.144  1.00 11.27 ? 166 HIS E NE2 1 
ATOM 8547  N N   . ARG E 1 167 ? 22.991  61.153  44.776  1.00 19.92 ? 167 ARG E N   1 
ATOM 8548  C CA  . ARG E 1 167 ? 23.107  59.770  44.333  1.00 20.64 ? 167 ARG E CA  1 
ATOM 8549  C C   . ARG E 1 167 ? 22.155  58.842  45.080  1.00 21.38 ? 167 ARG E C   1 
ATOM 8550  O O   . ARG E 1 167 ? 21.649  57.879  44.519  1.00 21.48 ? 167 ARG E O   1 
ATOM 8551  C CB  . ARG E 1 167 ? 24.538  59.315  44.562  1.00 19.03 ? 167 ARG E CB  1 
ATOM 8552  C CG  . ARG E 1 167 ? 24.908  58.006  43.955  1.00 15.80 ? 167 ARG E CG  1 
ATOM 8553  C CD  . ARG E 1 167 ? 26.348  57.737  44.268  1.00 14.94 ? 167 ARG E CD  1 
ATOM 8554  N NE  . ARG E 1 167 ? 27.023  57.086  43.156  1.00 11.27 ? 167 ARG E NE  1 
ATOM 8555  C CZ  . ARG E 1 167 ? 28.197  56.477  43.260  1.00 13.09 ? 167 ARG E CZ  1 
ATOM 8556  N NH1 . ARG E 1 167 ? 28.818  56.442  44.430  1.00 5.53  ? 167 ARG E NH1 1 
ATOM 8557  N NH2 . ARG E 1 167 ? 28.754  55.915  42.192  1.00 15.04 ? 167 ARG E NH2 1 
ATOM 8558  N N   . ILE E 1 168 ? 21.948  59.117  46.361  1.00 19.28 ? 168 ILE E N   1 
ATOM 8559  C CA  . ILE E 1 168 ? 21.056  58.313  47.183  1.00 19.05 ? 168 ILE E CA  1 
ATOM 8560  C C   . ILE E 1 168 ? 19.644  58.888  47.116  1.00 19.72 ? 168 ILE E C   1 
ATOM 8561  O O   . ILE E 1 168 ? 18.696  58.135  47.052  1.00 22.33 ? 168 ILE E O   1 
ATOM 8562  C CB  . ILE E 1 168 ? 21.522  58.301  48.646  1.00 19.34 ? 168 ILE E CB  1 
ATOM 8563  C CG1 . ILE E 1 168 ? 23.017  57.982  48.708  1.00 18.18 ? 168 ILE E CG1 1 
ATOM 8564  C CG2 . ILE E 1 168 ? 20.727  57.274  49.445  1.00 18.36 ? 168 ILE E CG2 1 
ATOM 8565  C CD1 . ILE E 1 168 ? 23.667  58.350  50.017  1.00 16.85 ? 168 ILE E CD1 1 
ATOM 8566  N N   . PHE E 1 169 ? 19.536  60.218  47.120  1.00 21.76 ? 169 PHE E N   1 
ATOM 8567  C CA  . PHE E 1 169 ? 18.243  60.911  47.074  1.00 23.25 ? 169 PHE E CA  1 
ATOM 8568  C C   . PHE E 1 169 ? 17.458  60.583  45.807  1.00 24.91 ? 169 PHE E C   1 
ATOM 8569  O O   . PHE E 1 169 ? 16.262  60.289  45.858  1.00 24.20 ? 169 PHE E O   1 
ATOM 8570  C CB  . PHE E 1 169 ? 18.453  62.425  47.145  1.00 22.29 ? 169 PHE E CB  1 
ATOM 8571  C CG  . PHE E 1 169 ? 17.225  63.202  47.558  1.00 21.72 ? 169 PHE E CG  1 
ATOM 8572  C CD1 . PHE E 1 169 ? 16.303  62.663  48.451  1.00 20.78 ? 169 PHE E CD1 1 
ATOM 8573  C CD2 . PHE E 1 169 ? 17.028  64.501  47.108  1.00 22.53 ? 169 PHE E CD2 1 
ATOM 8574  C CE1 . PHE E 1 169 ? 15.212  63.407  48.897  1.00 17.51 ? 169 PHE E CE1 1 
ATOM 8575  C CE2 . PHE E 1 169 ? 15.937  65.250  47.548  1.00 22.75 ? 169 PHE E CE2 1 
ATOM 8576  C CZ  . PHE E 1 169 ? 15.031  64.700  48.460  1.00 19.74 ? 169 PHE E CZ  1 
ATOM 8577  N N   . GLU E 1 170 ? 18.136  60.698  44.673  1.00 26.54 ? 170 GLU E N   1 
ATOM 8578  C CA  . GLU E 1 170 ? 17.578  60.427  43.354  1.00 26.78 ? 170 GLU E CA  1 
ATOM 8579  C C   . GLU E 1 170 ? 18.674  59.679  42.602  1.00 28.15 ? 170 GLU E C   1 
ATOM 8580  O O   . GLU E 1 170 ? 19.456  60.276  41.864  1.00 28.92 ? 170 GLU E O   1 
ATOM 8581  C CB  . GLU E 1 170 ? 17.229  61.747  42.643  1.00 25.96 ? 170 GLU E CB  1 
ATOM 8582  C CG  . GLU E 1 170 ? 16.832  61.625  41.165  1.00 29.55 ? 170 GLU E CG  1 
ATOM 8583  C CD  . GLU E 1 170 ? 15.691  60.656  40.933  1.00 31.86 ? 170 GLU E CD  1 
ATOM 8584  O OE1 . GLU E 1 170 ? 14.541  60.982  41.301  1.00 35.10 ? 170 GLU E OE1 1 
ATOM 8585  O OE2 . GLU E 1 170 ? 15.953  59.567  40.377  1.00 31.40 ? 170 GLU E OE2 1 
ATOM 8586  N N   . PRO E 1 171 ? 18.710  58.350  42.752  1.00 27.52 ? 171 PRO E N   1 
ATOM 8587  C CA  . PRO E 1 171 ? 19.702  57.480  42.112  1.00 28.76 ? 171 PRO E CA  1 
ATOM 8588  C C   . PRO E 1 171 ? 19.987  57.802  40.649  1.00 28.51 ? 171 PRO E C   1 
ATOM 8589  O O   . PRO E 1 171 ? 21.124  58.107  40.263  1.00 28.39 ? 171 PRO E O   1 
ATOM 8590  C CB  . PRO E 1 171 ? 19.072  56.092  42.253  1.00 32.44 ? 171 PRO E CB  1 
ATOM 8591  C CG  . PRO E 1 171 ? 18.327  56.194  43.532  1.00 32.19 ? 171 PRO E CG  1 
ATOM 8592  C CD  . PRO E 1 171 ? 17.675  57.550  43.432  1.00 27.08 ? 171 PRO E CD  1 
ATOM 8593  N N   . ASN E 1 172 ? 18.927  57.808  39.852  1.00 28.23 ? 172 ASN E N   1 
ATOM 8594  C CA  . ASN E 1 172 ? 19.020  58.016  38.416  1.00 27.15 ? 172 ASN E CA  1 
ATOM 8595  C C   . ASN E 1 172 ? 19.578  59.338  37.910  1.00 23.95 ? 172 ASN E C   1 
ATOM 8596  O O   . ASN E 1 172 ? 20.027  59.387  36.765  1.00 24.51 ? 172 ASN E O   1 
ATOM 8597  C CB  . ASN E 1 172 ? 17.664  57.753  37.769  1.00 27.71 ? 172 ASN E CB  1 
ATOM 8598  C CG  . ASN E 1 172 ? 17.119  56.391  38.126  1.00 28.25 ? 172 ASN E CG  1 
ATOM 8599  O OD1 . ASN E 1 172 ? 16.525  56.211  39.191  1.00 25.77 ? 172 ASN E OD1 1 
ATOM 8600  N ND2 . ASN E 1 172 ? 17.385  55.405  37.278  1.00 29.60 ? 172 ASN E ND2 1 
ATOM 8601  N N   . CYS E 1 173 ? 19.616  60.368  38.753  1.00 22.72 ? 173 CYS E N   1 
ATOM 8602  C CA  . CYS E 1 173 ? 20.119  61.672  38.311  1.00 21.61 ? 173 CYS E CA  1 
ATOM 8603  C C   . CYS E 1 173 ? 21.549  61.589  37.789  1.00 20.14 ? 173 CYS E C   1 
ATOM 8604  O O   . CYS E 1 173 ? 22.011  62.491  37.094  1.00 21.16 ? 173 CYS E O   1 
ATOM 8605  C CB  . CYS E 1 173 ? 20.010  62.730  39.422  1.00 19.90 ? 173 CYS E CB  1 
ATOM 8606  S SG  . CYS E 1 173 ? 21.226  62.631  40.767  1.00 8.21  ? 173 CYS E SG  1 
ATOM 8607  N N   . LEU E 1 174 ? 22.228  60.485  38.093  1.00 19.80 ? 174 LEU E N   1 
ATOM 8608  C CA  . LEU E 1 174 ? 23.605  60.282  37.649  1.00 20.50 ? 174 LEU E CA  1 
ATOM 8609  C C   . LEU E 1 174 ? 23.723  59.599  36.297  1.00 19.32 ? 174 LEU E C   1 
ATOM 8610  O O   . LEU E 1 174 ? 24.580  59.960  35.488  1.00 12.76 ? 174 LEU E O   1 
ATOM 8611  C CB  . LEU E 1 174 ? 24.383  59.469  38.681  1.00 18.80 ? 174 LEU E CB  1 
ATOM 8612  C CG  . LEU E 1 174 ? 24.805  60.186  39.961  1.00 18.53 ? 174 LEU E CG  1 
ATOM 8613  C CD1 . LEU E 1 174 ? 25.628  59.227  40.791  1.00 20.42 ? 174 LEU E CD1 1 
ATOM 8614  C CD2 . LEU E 1 174 ? 25.611  61.442  39.636  1.00 17.11 ? 174 LEU E CD2 1 
ATOM 8615  N N   . ASP E 1 175 ? 22.848  58.624  36.062  1.00 21.32 ? 175 ASP E N   1 
ATOM 8616  C CA  . ASP E 1 175 ? 22.837  57.839  34.828  1.00 21.37 ? 175 ASP E CA  1 
ATOM 8617  C C   . ASP E 1 175 ? 22.988  58.616  33.525  1.00 24.42 ? 175 ASP E C   1 
ATOM 8618  O O   . ASP E 1 175 ? 23.795  58.252  32.675  1.00 27.15 ? 175 ASP E O   1 
ATOM 8619  C CB  . ASP E 1 175 ? 21.572  56.988  34.766  1.00 22.11 ? 175 ASP E CB  1 
ATOM 8620  C CG  . ASP E 1 175 ? 21.562  55.884  35.804  1.00 25.60 ? 175 ASP E CG  1 
ATOM 8621  O OD1 . ASP E 1 175 ? 21.541  56.208  37.008  1.00 27.66 ? 175 ASP E OD1 1 
ATOM 8622  O OD2 . ASP E 1 175 ? 21.578  54.693  35.415  1.00 26.01 ? 175 ASP E OD2 1 
ATOM 8623  N N   . ALA E 1 176 ? 22.216  59.685  33.370  1.00 24.27 ? 176 ALA E N   1 
ATOM 8624  C CA  . ALA E 1 176 ? 22.261  60.500  32.159  1.00 23.86 ? 176 ALA E CA  1 
ATOM 8625  C C   . ALA E 1 176 ? 23.606  61.179  31.886  1.00 21.20 ? 176 ALA E C   1 
ATOM 8626  O O   . ALA E 1 176 ? 23.838  61.671  30.781  1.00 21.91 ? 176 ALA E O   1 
ATOM 8627  C CB  . ALA E 1 176 ? 21.160  61.539  32.203  1.00 22.98 ? 176 ALA E CB  1 
ATOM 8628  N N   . PHE E 1 177 ? 24.493  61.190  32.877  1.00 21.58 ? 177 PHE E N   1 
ATOM 8629  C CA  . PHE E 1 177 ? 25.794  61.838  32.732  1.00 19.63 ? 177 PHE E CA  1 
ATOM 8630  C C   . PHE E 1 177 ? 26.933  60.885  33.067  1.00 18.14 ? 177 PHE E C   1 
ATOM 8631  O O   . PHE E 1 177 ? 27.403  60.835  34.201  1.00 16.27 ? 177 PHE E O   1 
ATOM 8632  C CB  . PHE E 1 177 ? 25.866  63.053  33.647  1.00 18.72 ? 177 PHE E CB  1 
ATOM 8633  C CG  . PHE E 1 177 ? 24.581  63.806  33.744  1.00 13.99 ? 177 PHE E CG  1 
ATOM 8634  C CD1 . PHE E 1 177 ? 23.582  63.384  34.613  1.00 16.80 ? 177 PHE E CD1 1 
ATOM 8635  C CD2 . PHE E 1 177 ? 24.358  64.926  32.954  1.00 13.26 ? 177 PHE E CD2 1 
ATOM 8636  C CE1 . PHE E 1 177 ? 22.373  64.069  34.694  1.00 16.76 ? 177 PHE E CE1 1 
ATOM 8637  C CE2 . PHE E 1 177 ? 23.149  65.641  33.026  1.00 11.26 ? 177 PHE E CE2 1 
ATOM 8638  C CZ  . PHE E 1 177 ? 22.153  65.193  33.899  1.00 14.23 ? 177 PHE E CZ  1 
ATOM 8639  N N   . PRO E 1 178 ? 27.480  60.227  32.049  1.00 17.04 ? 178 PRO E N   1 
ATOM 8640  C CA  . PRO E 1 178 ? 28.578  59.254  32.224  1.00 17.22 ? 178 PRO E CA  1 
ATOM 8641  C C   . PRO E 1 178 ? 29.792  59.778  32.986  1.00 15.34 ? 178 PRO E C   1 
ATOM 8642  O O   . PRO E 1 178 ? 30.162  59.238  34.028  1.00 15.84 ? 178 PRO E O   1 
ATOM 8643  C CB  . PRO E 1 178 ? 28.932  58.869  30.782  1.00 15.85 ? 178 PRO E CB  1 
ATOM 8644  C CG  . PRO E 1 178 ? 28.544  60.088  29.995  1.00 19.53 ? 178 PRO E CG  1 
ATOM 8645  C CD  . PRO E 1 178 ? 27.219  60.453  30.620  1.00 18.65 ? 178 PRO E CD  1 
ATOM 8646  N N   . ASN E 1 179 ? 30.395  60.846  32.476  1.00 13.13 ? 179 ASN E N   1 
ATOM 8647  C CA  . ASN E 1 179 ? 31.579  61.421  33.100  1.00 11.37 ? 179 ASN E CA  1 
ATOM 8648  C C   . ASN E 1 179 ? 31.442  61.659  34.600  1.00 14.66 ? 179 ASN E C   1 
ATOM 8649  O O   . ASN E 1 179 ? 32.410  61.478  35.336  1.00 16.37 ? 179 ASN E O   1 
ATOM 8650  C CB  . ASN E 1 179 ? 32.008  62.708  32.383  1.00 7.10  ? 179 ASN E CB  1 
ATOM 8651  C CG  . ASN E 1 179 ? 31.083  63.877  32.657  1.00 2.00  ? 179 ASN E CG  1 
ATOM 8652  O OD1 . ASN E 1 179 ? 31.527  65.019  32.744  1.00 7.37  ? 179 ASN E OD1 1 
ATOM 8653  N ND2 . ASN E 1 179 ? 29.791  63.602  32.770  1.00 2.00  ? 179 ASN E ND2 1 
ATOM 8654  N N   . LEU E 1 180 ? 30.244  62.020  35.060  1.00 15.04 ? 180 LEU E N   1 
ATOM 8655  C CA  . LEU E 1 180 ? 30.028  62.254  36.485  1.00 14.42 ? 180 LEU E CA  1 
ATOM 8656  C C   . LEU E 1 180 ? 30.090  60.935  37.249  1.00 17.91 ? 180 LEU E C   1 
ATOM 8657  O O   . LEU E 1 180 ? 30.726  60.868  38.310  1.00 20.48 ? 180 LEU E O   1 
ATOM 8658  C CB  . LEU E 1 180 ? 28.690  62.958  36.747  1.00 12.88 ? 180 LEU E CB  1 
ATOM 8659  C CG  . LEU E 1 180 ? 28.497  64.375  36.184  1.00 13.01 ? 180 LEU E CG  1 
ATOM 8660  C CD1 . LEU E 1 180 ? 27.144  64.925  36.613  1.00 12.59 ? 180 LEU E CD1 1 
ATOM 8661  C CD2 . LEU E 1 180 ? 29.611  65.292  36.660  1.00 17.02 ? 180 LEU E CD2 1 
ATOM 8662  N N   . LYS E 1 181 ? 29.522  59.876  36.695  1.00 18.04 ? 181 LYS E N   1 
ATOM 8663  C CA  . LYS E 1 181 ? 29.572  58.575  37.350  1.00 19.14 ? 181 LYS E CA  1 
ATOM 8664  C C   . LYS E 1 181 ? 30.998  58.044  37.393  1.00 18.17 ? 181 LYS E C   1 
ATOM 8665  O O   . LYS E 1 181 ? 31.419  57.459  38.394  1.00 16.77 ? 181 LYS E O   1 
ATOM 8666  C CB  . LYS E 1 181 ? 28.645  57.573  36.668  1.00 14.31 ? 181 LYS E CB  1 
ATOM 8667  C CG  . LYS E 1 181 ? 27.189  57.767  37.051  1.00 12.64 ? 181 LYS E CG  1 
ATOM 8668  C CD  . LYS E 1 181 ? 26.339  56.562  36.704  1.00 17.26 ? 181 LYS E CD  1 
ATOM 8669  C CE  . LYS E 1 181 ? 26.346  56.288  35.214  1.00 19.29 ? 181 LYS E CE  1 
ATOM 8670  N NZ  . LYS E 1 181 ? 25.308  55.287  34.856  1.00 15.75 ? 181 LYS E NZ  1 
ATOM 8671  N N   . ASP E 1 182 ? 31.748  58.273  36.319  1.00 17.99 ? 182 ASP E N   1 
ATOM 8672  C CA  . ASP E 1 182 ? 33.142  57.838  36.255  1.00 17.32 ? 182 ASP E CA  1 
ATOM 8673  C C   . ASP E 1 182 ? 33.981  58.631  37.254  1.00 16.69 ? 182 ASP E C   1 
ATOM 8674  O O   . ASP E 1 182 ? 34.922  58.105  37.831  1.00 15.03 ? 182 ASP E O   1 
ATOM 8675  C CB  . ASP E 1 182 ? 33.704  58.000  34.838  1.00 19.34 ? 182 ASP E CB  1 
ATOM 8676  C CG  . ASP E 1 182 ? 33.346  56.834  33.923  1.00 16.55 ? 182 ASP E CG  1 
ATOM 8677  O OD1 . ASP E 1 182 ? 32.146  56.651  33.620  1.00 11.52 ? 182 ASP E OD1 1 
ATOM 8678  O OD2 . ASP E 1 182 ? 34.272  56.108  33.500  1.00 14.37 ? 182 ASP E OD2 1 
ATOM 8679  N N   . PHE E 1 183 ? 33.619  59.892  37.466  1.00 17.88 ? 183 PHE E N   1 
ATOM 8680  C CA  . PHE E 1 183 ? 34.313  60.759  38.416  1.00 19.05 ? 183 PHE E CA  1 
ATOM 8681  C C   . PHE E 1 183 ? 34.187  60.186  39.817  1.00 19.32 ? 183 PHE E C   1 
ATOM 8682  O O   . PHE E 1 183 ? 35.164  60.139  40.560  1.00 21.18 ? 183 PHE E O   1 
ATOM 8683  C CB  . PHE E 1 183 ? 33.715  62.160  38.379  1.00 18.25 ? 183 PHE E CB  1 
ATOM 8684  C CG  . PHE E 1 183 ? 34.235  63.076  39.446  1.00 17.58 ? 183 PHE E CG  1 
ATOM 8685  C CD1 . PHE E 1 183 ? 35.509  63.625  39.349  1.00 16.07 ? 183 PHE E CD1 1 
ATOM 8686  C CD2 . PHE E 1 183 ? 33.425  63.438  40.520  1.00 16.22 ? 183 PHE E CD2 1 
ATOM 8687  C CE1 . PHE E 1 183 ? 35.970  64.529  40.301  1.00 17.12 ? 183 PHE E CE1 1 
ATOM 8688  C CE2 . PHE E 1 183 ? 33.857  64.341  41.480  1.00 13.34 ? 183 PHE E CE2 1 
ATOM 8689  C CZ  . PHE E 1 183 ? 35.150  64.890  41.369  1.00 14.07 ? 183 PHE E CZ  1 
ATOM 8690  N N   . ILE E 1 184 ? 32.977  59.758  40.168  1.00 16.86 ? 184 ILE E N   1 
ATOM 8691  C CA  . ILE E 1 184 ? 32.704  59.162  41.473  1.00 16.77 ? 184 ILE E CA  1 
ATOM 8692  C C   . ILE E 1 184 ? 33.560  57.915  41.690  1.00 16.39 ? 184 ILE E C   1 
ATOM 8693  O O   . ILE E 1 184 ? 34.214  57.780  42.722  1.00 17.92 ? 184 ILE E O   1 
ATOM 8694  C CB  . ILE E 1 184 ? 31.221  58.761  41.616  1.00 17.14 ? 184 ILE E CB  1 
ATOM 8695  C CG1 . ILE E 1 184 ? 30.323  59.998  41.617  1.00 16.35 ? 184 ILE E CG1 1 
ATOM 8696  C CG2 . ILE E 1 184 ? 31.018  57.974  42.890  1.00 11.22 ? 184 ILE E CG2 1 
ATOM 8697  C CD1 . ILE E 1 184 ? 30.365  60.802  42.906  1.00 14.36 ? 184 ILE E CD1 1 
ATOM 8698  N N   . SER E 1 185 ? 33.559  57.021  40.706  1.00 13.18 ? 185 SER E N   1 
ATOM 8699  C CA  . SER E 1 185 ? 34.334  55.787  40.770  1.00 14.15 ? 185 SER E CA  1 
ATOM 8700  C C   . SER E 1 185 ? 35.828  56.058  40.620  1.00 16.21 ? 185 SER E C   1 
ATOM 8701  O O   . SER E 1 185 ? 36.659  55.176  40.866  1.00 16.35 ? 185 SER E O   1 
ATOM 8702  C CB  . SER E 1 185 ? 33.868  54.831  39.678  1.00 15.08 ? 185 SER E CB  1 
ATOM 8703  O OG  . SER E 1 185 ? 32.455  54.708  39.706  1.00 15.09 ? 185 SER E OG  1 
ATOM 8704  N N   . ARG E 1 186 ? 36.151  57.279  40.198  1.00 17.84 ? 186 ARG E N   1 
ATOM 8705  C CA  . ARG E 1 186 ? 37.530  57.717  40.016  1.00 19.96 ? 186 ARG E CA  1 
ATOM 8706  C C   . ARG E 1 186 ? 38.039  58.280  41.338  1.00 19.84 ? 186 ARG E C   1 
ATOM 8707  O O   . ARG E 1 186 ? 39.159  57.993  41.760  1.00 20.56 ? 186 ARG E O   1 
ATOM 8708  C CB  . ARG E 1 186 ? 37.602  58.777  38.914  1.00 19.67 ? 186 ARG E CB  1 
ATOM 8709  C CG  . ARG E 1 186 ? 39.000  59.065  38.407  1.00 20.17 ? 186 ARG E CG  1 
ATOM 8710  C CD  . ARG E 1 186 ? 38.989  59.587  36.972  1.00 18.90 ? 186 ARG E CD  1 
ATOM 8711  N NE  . ARG E 1 186 ? 38.210  60.812  36.809  1.00 20.38 ? 186 ARG E NE  1 
ATOM 8712  C CZ  . ARG E 1 186 ? 37.192  60.950  35.962  1.00 19.92 ? 186 ARG E CZ  1 
ATOM 8713  N NH1 . ARG E 1 186 ? 36.819  59.939  35.192  1.00 18.28 ? 186 ARG E NH1 1 
ATOM 8714  N NH2 . ARG E 1 186 ? 36.537  62.100  35.891  1.00 18.91 ? 186 ARG E NH2 1 
ATOM 8715  N N   . PHE E 1 187 ? 37.204  59.056  42.012  1.00 18.52 ? 187 PHE E N   1 
ATOM 8716  C CA  . PHE E 1 187 ? 37.608  59.608  43.289  1.00 20.01 ? 187 PHE E CA  1 
ATOM 8717  C C   . PHE E 1 187 ? 37.729  58.482  44.304  1.00 21.27 ? 187 PHE E C   1 
ATOM 8718  O O   . PHE E 1 187 ? 38.745  58.365  44.982  1.00 22.01 ? 187 PHE E O   1 
ATOM 8719  C CB  . PHE E 1 187 ? 36.625  60.665  43.792  1.00 16.25 ? 187 PHE E CB  1 
ATOM 8720  C CG  . PHE E 1 187 ? 36.983  61.210  45.143  1.00 10.03 ? 187 PHE E CG  1 
ATOM 8721  C CD1 . PHE E 1 187 ? 38.219  61.796  45.354  1.00 8.68  ? 187 PHE E CD1 1 
ATOM 8722  C CD2 . PHE E 1 187 ? 36.114  61.072  46.218  1.00 5.77  ? 187 PHE E CD2 1 
ATOM 8723  C CE1 . PHE E 1 187 ? 38.588  62.229  46.611  1.00 11.21 ? 187 PHE E CE1 1 
ATOM 8724  C CE2 . PHE E 1 187 ? 36.472  61.505  47.488  1.00 2.48  ? 187 PHE E CE2 1 
ATOM 8725  C CZ  . PHE E 1 187 ? 37.713  62.083  47.686  1.00 7.04  ? 187 PHE E CZ  1 
ATOM 8726  N N   . GLU E 1 188 ? 36.710  57.635  44.400  1.00 20.77 ? 188 GLU E N   1 
ATOM 8727  C CA  . GLU E 1 188 ? 36.772  56.532  45.353  1.00 19.64 ? 188 GLU E CA  1 
ATOM 8728  C C   . GLU E 1 188 ? 37.637  55.339  44.898  1.00 20.57 ? 188 GLU E C   1 
ATOM 8729  O O   . GLU E 1 188 ? 37.608  54.265  45.505  1.00 18.88 ? 188 GLU E O   1 
ATOM 8730  C CB  . GLU E 1 188 ? 35.366  56.097  45.800  1.00 22.97 ? 188 GLU E CB  1 
ATOM 8731  C CG  . GLU E 1 188 ? 34.436  55.578  44.713  1.00 25.40 ? 188 GLU E CG  1 
ATOM 8732  C CD  . GLU E 1 188 ? 33.092  55.130  45.272  1.00 27.87 ? 188 GLU E CD  1 
ATOM 8733  O OE1 . GLU E 1 188 ? 32.286  56.001  45.661  1.00 28.48 ? 188 GLU E OE1 1 
ATOM 8734  O OE2 . GLU E 1 188 ? 32.841  53.906  45.333  1.00 26.32 ? 188 GLU E OE2 1 
ATOM 8735  N N   . GLY E 1 189 ? 38.421  55.532  43.843  1.00 19.86 ? 189 GLY E N   1 
ATOM 8736  C CA  . GLY E 1 189 ? 39.308  54.513  43.348  1.00 20.06 ? 189 GLY E CA  1 
ATOM 8737  C C   . GLY E 1 189 ? 40.705  54.710  43.918  1.00 18.74 ? 189 GLY E C   1 
ATOM 8738  O O   . GLY E 1 189 ? 41.574  53.848  43.760  1.00 14.65 ? 189 GLY E O   1 
ATOM 8739  N N   . LEU E 1 190 ? 40.933  55.862  44.550  1.00 17.60 ? 190 LEU E N   1 
ATOM 8740  C CA  . LEU E 1 190 ? 42.222  56.192  45.164  1.00 15.88 ? 190 LEU E CA  1 
ATOM 8741  C C   . LEU E 1 190 ? 42.390  55.304  46.391  1.00 16.51 ? 190 LEU E C   1 
ATOM 8742  O O   . LEU E 1 190 ? 41.488  55.235  47.230  1.00 16.83 ? 190 LEU E O   1 
ATOM 8743  C CB  . LEU E 1 190 ? 42.254  57.663  45.604  1.00 12.70 ? 190 LEU E CB  1 
ATOM 8744  C CG  . LEU E 1 190 ? 41.986  58.755  44.568  1.00 12.12 ? 190 LEU E CG  1 
ATOM 8745  C CD1 . LEU E 1 190 ? 41.852  60.117  45.235  1.00 11.25 ? 190 LEU E CD1 1 
ATOM 8746  C CD2 . LEU E 1 190 ? 43.099  58.766  43.553  1.00 13.58 ? 190 LEU E CD2 1 
ATOM 8747  N N   . GLU E 1 191 ? 43.550  54.665  46.519  1.00 18.24 ? 191 GLU E N   1 
ATOM 8748  C CA  . GLU E 1 191 ? 43.814  53.773  47.649  1.00 19.97 ? 191 GLU E CA  1 
ATOM 8749  C C   . GLU E 1 191 ? 43.526  54.331  49.050  1.00 16.90 ? 191 GLU E C   1 
ATOM 8750  O O   . GLU E 1 191 ? 42.962  53.629  49.890  1.00 16.81 ? 191 GLU E O   1 
ATOM 8751  C CB  . GLU E 1 191 ? 45.238  53.212  47.575  1.00 20.85 ? 191 GLU E CB  1 
ATOM 8752  C CG  . GLU E 1 191 ? 45.419  52.141  46.494  1.00 25.26 ? 191 GLU E CG  1 
ATOM 8753  C CD  . GLU E 1 191 ? 46.821  51.534  46.479  1.00 29.39 ? 191 GLU E CD  1 
ATOM 8754  O OE1 . GLU E 1 191 ? 47.806  52.288  46.625  1.00 32.99 ? 191 GLU E OE1 1 
ATOM 8755  O OE2 . GLU E 1 191 ? 46.942  50.302  46.299  1.00 31.08 ? 191 GLU E OE2 1 
ATOM 8756  N N   . LYS E 1 192 ? 43.893  55.585  49.304  1.00 17.58 ? 192 LYS E N   1 
ATOM 8757  C CA  . LYS E 1 192 ? 43.650  56.187  50.617  1.00 20.86 ? 192 LYS E CA  1 
ATOM 8758  C C   . LYS E 1 192 ? 42.172  56.419  50.905  1.00 22.88 ? 192 LYS E C   1 
ATOM 8759  O O   . LYS E 1 192 ? 41.719  56.286  52.039  1.00 24.37 ? 192 LYS E O   1 
ATOM 8760  C CB  . LYS E 1 192 ? 44.431  57.489  50.770  1.00 22.02 ? 192 LYS E CB  1 
ATOM 8761  C CG  . LYS E 1 192 ? 45.918  57.256  50.862  1.00 24.59 ? 192 LYS E CG  1 
ATOM 8762  C CD  . LYS E 1 192 ? 46.689  58.536  51.001  1.00 25.98 ? 192 LYS E CD  1 
ATOM 8763  C CE  . LYS E 1 192 ? 48.170  58.255  51.115  1.00 25.34 ? 192 LYS E CE  1 
ATOM 8764  N NZ  . LYS E 1 192 ? 48.952  59.511  51.080  1.00 25.72 ? 192 LYS E NZ  1 
ATOM 8765  N N   . ILE E 1 193 ? 41.419  56.764  49.870  1.00 22.80 ? 193 ILE E N   1 
ATOM 8766  C CA  . ILE E 1 193 ? 39.989  56.993  50.017  1.00 20.44 ? 193 ILE E CA  1 
ATOM 8767  C C   . ILE E 1 193 ? 39.297  55.652  50.236  1.00 20.59 ? 193 ILE E C   1 
ATOM 8768  O O   . ILE E 1 193 ? 38.504  55.505  51.168  1.00 16.26 ? 193 ILE E O   1 
ATOM 8769  C CB  . ILE E 1 193 ? 39.403  57.705  48.775  1.00 20.61 ? 193 ILE E CB  1 
ATOM 8770  C CG1 . ILE E 1 193 ? 40.070  59.074  48.601  1.00 17.78 ? 193 ILE E CG1 1 
ATOM 8771  C CG2 . ILE E 1 193 ? 37.897  57.873  48.919  1.00 20.19 ? 193 ILE E CG2 1 
ATOM 8772  C CD1 . ILE E 1 193 ? 39.868  60.022  49.778  1.00 20.75 ? 193 ILE E CD1 1 
ATOM 8773  N N   . SER E 1 194 ? 39.632  54.670  49.400  1.00 21.83 ? 194 SER E N   1 
ATOM 8774  C CA  . SER E 1 194 ? 39.054  53.334  49.505  1.00 22.04 ? 194 SER E CA  1 
ATOM 8775  C C   . SER E 1 194 ? 39.344  52.747  50.884  1.00 23.64 ? 194 SER E C   1 
ATOM 8776  O O   . SER E 1 194 ? 38.457  52.178  51.527  1.00 22.44 ? 194 SER E O   1 
ATOM 8777  C CB  . SER E 1 194 ? 39.584  52.417  48.395  1.00 17.52 ? 194 SER E CB  1 
ATOM 8778  O OG  . SER E 1 194 ? 41.001  52.383  48.357  1.00 12.21 ? 194 SER E OG  1 
ATOM 8779  N N   . ALA E 1 195 ? 40.577  52.932  51.350  1.00 26.52 ? 195 ALA E N   1 
ATOM 8780  C CA  . ALA E 1 195 ? 40.999  52.450  52.661  1.00 27.15 ? 195 ALA E CA  1 
ATOM 8781  C C   . ALA E 1 195 ? 40.128  53.076  53.750  1.00 28.75 ? 195 ALA E C   1 
ATOM 8782  O O   . ALA E 1 195 ? 39.645  52.381  54.649  1.00 29.24 ? 195 ALA E O   1 
ATOM 8783  C CB  . ALA E 1 195 ? 42.461  52.801  52.899  1.00 27.09 ? 195 ALA E CB  1 
ATOM 8784  N N   . TYR E 1 196 ? 39.924  54.389  53.651  1.00 27.40 ? 196 TYR E N   1 
ATOM 8785  C CA  . TYR E 1 196 ? 39.099  55.120  54.606  1.00 27.16 ? 196 TYR E CA  1 
ATOM 8786  C C   . TYR E 1 196 ? 37.684  54.542  54.614  1.00 29.71 ? 196 TYR E C   1 
ATOM 8787  O O   . TYR E 1 196 ? 37.060  54.427  55.671  1.00 31.32 ? 196 TYR E O   1 
ATOM 8788  C CB  . TYR E 1 196 ? 39.058  56.611  54.256  1.00 28.23 ? 196 TYR E CB  1 
ATOM 8789  C CG  . TYR E 1 196 ? 38.150  57.417  55.152  1.00 30.92 ? 196 TYR E CG  1 
ATOM 8790  C CD1 . TYR E 1 196 ? 38.175  57.249  56.536  1.00 33.32 ? 196 TYR E CD1 1 
ATOM 8791  C CD2 . TYR E 1 196 ? 37.255  58.335  54.619  1.00 30.88 ? 196 TYR E CD2 1 
ATOM 8792  C CE1 . TYR E 1 196 ? 37.328  57.973  57.365  1.00 32.41 ? 196 TYR E CE1 1 
ATOM 8793  C CE2 . TYR E 1 196 ? 36.401  59.069  55.440  1.00 31.49 ? 196 TYR E CE2 1 
ATOM 8794  C CZ  . TYR E 1 196 ? 36.441  58.879  56.812  1.00 31.46 ? 196 TYR E CZ  1 
ATOM 8795  O OH  . TYR E 1 196 ? 35.577  59.575  57.626  1.00 28.34 ? 196 TYR E OH  1 
ATOM 8796  N N   . MET E 1 197 ? 37.186  54.173  53.436  1.00 28.77 ? 197 MET E N   1 
ATOM 8797  C CA  . MET E 1 197 ? 35.856  53.586  53.319  1.00 24.76 ? 197 MET E CA  1 
ATOM 8798  C C   . MET E 1 197 ? 35.817  52.208  53.970  1.00 24.28 ? 197 MET E C   1 
ATOM 8799  O O   . MET E 1 197 ? 34.831  51.852  54.618  1.00 25.41 ? 197 MET E O   1 
ATOM 8800  C CB  . MET E 1 197 ? 35.429  53.472  51.851  1.00 22.95 ? 197 MET E CB  1 
ATOM 8801  C CG  . MET E 1 197 ? 34.509  54.588  51.374  1.00 21.45 ? 197 MET E CG  1 
ATOM 8802  S SD  . MET E 1 197 ? 35.297  56.213  51.248  1.00 23.70 ? 197 MET E SD  1 
ATOM 8803  C CE  . MET E 1 197 ? 34.708  56.738  49.642  1.00 20.60 ? 197 MET E CE  1 
ATOM 8804  N N   . LYS E 1 198 ? 36.903  51.452  53.823  1.00 26.19 ? 198 LYS E N   1 
ATOM 8805  C CA  . LYS E 1 198 ? 36.984  50.103  54.384  1.00 27.61 ? 198 LYS E CA  1 
ATOM 8806  C C   . LYS E 1 198 ? 37.360  50.067  55.873  1.00 28.53 ? 198 LYS E C   1 
ATOM 8807  O O   . LYS E 1 198 ? 37.662  48.997  56.413  1.00 28.36 ? 198 LYS E O   1 
ATOM 8808  C CB  . LYS E 1 198 ? 37.989  49.250  53.595  1.00 28.39 ? 198 LYS E CB  1 
ATOM 8809  C CG  . LYS E 1 198 ? 37.913  49.371  52.070  1.00 31.47 ? 198 LYS E CG  1 
ATOM 8810  C CD  . LYS E 1 198 ? 36.583  48.942  51.459  1.00 30.33 ? 198 LYS E CD  1 
ATOM 8811  C CE  . LYS E 1 198 ? 36.430  47.431  51.396  1.00 26.92 ? 198 LYS E CE  1 
ATOM 8812  N NZ  . LYS E 1 198 ? 36.112  46.849  52.725  1.00 26.93 ? 198 LYS E NZ  1 
ATOM 8813  N N   . SER E 1 199 ? 37.324  51.217  56.541  1.00 29.57 ? 199 SER E N   1 
ATOM 8814  C CA  . SER E 1 199 ? 37.680  51.281  57.955  1.00 26.08 ? 199 SER E CA  1 
ATOM 8815  C C   . SER E 1 199 ? 36.473  51.572  58.834  1.00 26.36 ? 199 SER E C   1 
ATOM 8816  O O   . SER E 1 199 ? 35.380  51.840  58.337  1.00 25.30 ? 199 SER E O   1 
ATOM 8817  C CB  . SER E 1 199 ? 38.742  52.360  58.183  1.00 25.03 ? 199 SER E CB  1 
ATOM 8818  O OG  . SER E 1 199 ? 38.182  53.663  58.132  1.00 16.45 ? 199 SER E OG  1 
ATOM 8819  N N   . SER E 1 200 ? 36.684  51.557  60.146  1.00 28.10 ? 200 SER E N   1 
ATOM 8820  C CA  . SER E 1 200 ? 35.618  51.851  61.095  1.00 26.78 ? 200 SER E CA  1 
ATOM 8821  C C   . SER E 1 200 ? 35.501  53.355  61.332  1.00 25.45 ? 200 SER E C   1 
ATOM 8822  O O   . SER E 1 200 ? 34.607  53.807  62.045  1.00 27.06 ? 200 SER E O   1 
ATOM 8823  C CB  . SER E 1 200 ? 35.864  51.127  62.424  1.00 25.03 ? 200 SER E CB  1 
ATOM 8824  O OG  . SER E 1 200 ? 35.889  49.721  62.247  1.00 26.70 ? 200 SER E OG  1 
ATOM 8825  N N   . ARG E 1 201 ? 36.410  54.125  60.736  1.00 23.98 ? 201 ARG E N   1 
ATOM 8826  C CA  . ARG E 1 201 ? 36.392  55.577  60.889  1.00 25.80 ? 201 ARG E CA  1 
ATOM 8827  C C   . ARG E 1 201 ? 35.574  56.255  59.791  1.00 25.19 ? 201 ARG E C   1 
ATOM 8828  O O   . ARG E 1 201 ? 35.436  57.483  59.784  1.00 24.07 ? 201 ARG E O   1 
ATOM 8829  C CB  . ARG E 1 201 ? 37.811  56.155  60.892  1.00 27.39 ? 201 ARG E CB  1 
ATOM 8830  C CG  . ARG E 1 201 ? 38.759  55.543  61.906  1.00 26.90 ? 201 ARG E CG  1 
ATOM 8831  C CD  . ARG E 1 201 ? 39.625  54.470  61.267  1.00 30.94 ? 201 ARG E CD  1 
ATOM 8832  N NE  . ARG E 1 201 ? 40.414  55.000  60.154  1.00 26.75 ? 201 ARG E NE  1 
ATOM 8833  C CZ  . ARG E 1 201 ? 41.542  54.453  59.707  1.00 27.40 ? 201 ARG E CZ  1 
ATOM 8834  N NH1 . ARG E 1 201 ? 42.023  53.358  60.278  1.00 28.73 ? 201 ARG E NH1 1 
ATOM 8835  N NH2 . ARG E 1 201 ? 42.187  54.993  58.680  1.00 29.60 ? 201 ARG E NH2 1 
ATOM 8836  N N   . PHE E 1 202 ? 35.084  55.465  58.839  1.00 23.84 ? 202 PHE E N   1 
ATOM 8837  C CA  . PHE E 1 202 ? 34.280  56.000  57.750  1.00 24.96 ? 202 PHE E CA  1 
ATOM 8838  C C   . PHE E 1 202 ? 32.905  56.397  58.286  1.00 24.29 ? 202 PHE E C   1 
ATOM 8839  O O   . PHE E 1 202 ? 32.260  55.620  58.983  1.00 22.99 ? 202 PHE E O   1 
ATOM 8840  C CB  . PHE E 1 202 ? 34.140  54.963  56.632  1.00 25.99 ? 202 PHE E CB  1 
ATOM 8841  C CG  . PHE E 1 202 ? 33.372  55.458  55.437  1.00 27.17 ? 202 PHE E CG  1 
ATOM 8842  C CD1 . PHE E 1 202 ? 33.666  56.694  54.864  1.00 23.95 ? 202 PHE E CD1 1 
ATOM 8843  C CD2 . PHE E 1 202 ? 32.339  54.700  54.900  1.00 27.22 ? 202 PHE E CD2 1 
ATOM 8844  C CE1 . PHE E 1 202 ? 32.939  57.171  53.779  1.00 20.73 ? 202 PHE E CE1 1 
ATOM 8845  C CE2 . PHE E 1 202 ? 31.610  55.169  53.818  1.00 27.29 ? 202 PHE E CE2 1 
ATOM 8846  C CZ  . PHE E 1 202 ? 31.910  56.410  53.257  1.00 20.59 ? 202 PHE E CZ  1 
ATOM 8847  N N   . LEU E 1 203 ? 32.475  57.617  57.975  1.00 23.69 ? 203 LEU E N   1 
ATOM 8848  C CA  . LEU E 1 203 ? 31.182  58.115  58.428  1.00 24.77 ? 203 LEU E CA  1 
ATOM 8849  C C   . LEU E 1 203 ? 30.270  58.491  57.261  1.00 26.99 ? 203 LEU E C   1 
ATOM 8850  O O   . LEU E 1 203 ? 30.306  59.634  56.778  1.00 26.93 ? 203 LEU E O   1 
ATOM 8851  C CB  . LEU E 1 203 ? 31.373  59.313  59.366  1.00 23.63 ? 203 LEU E CB  1 
ATOM 8852  C CG  . LEU E 1 203 ? 30.143  59.908  60.066  1.00 23.39 ? 203 LEU E CG  1 
ATOM 8853  C CD1 . LEU E 1 203 ? 29.484  58.871  60.974  1.00 19.01 ? 203 LEU E CD1 1 
ATOM 8854  C CD2 . LEU E 1 203 ? 30.554  61.126  60.874  1.00 22.00 ? 203 LEU E CD2 1 
ATOM 8855  N N   . PRO E 1 204 ? 29.501  57.516  56.739  1.00 26.40 ? 204 PRO E N   1 
ATOM 8856  C CA  . PRO E 1 204 ? 28.567  57.709  55.622  1.00 25.31 ? 204 PRO E CA  1 
ATOM 8857  C C   . PRO E 1 204 ? 27.319  58.466  56.107  1.00 25.78 ? 204 PRO E C   1 
ATOM 8858  O O   . PRO E 1 204 ? 27.313  59.684  56.120  1.00 26.36 ? 204 PRO E O   1 
ATOM 8859  C CB  . PRO E 1 204 ? 28.259  56.271  55.196  1.00 26.76 ? 204 PRO E CB  1 
ATOM 8860  C CG  . PRO E 1 204 ? 28.346  55.514  56.480  1.00 27.21 ? 204 PRO E CG  1 
ATOM 8861  C CD  . PRO E 1 204 ? 29.574  56.095  57.126  1.00 28.79 ? 204 PRO E CD  1 
ATOM 8862  N N   . LYS E 1 205 ? 26.262  57.747  56.476  1.00 25.54 ? 205 LYS E N   1 
ATOM 8863  C CA  . LYS E 1 205 ? 25.055  58.390  56.989  1.00 25.33 ? 205 LYS E CA  1 
ATOM 8864  C C   . LYS E 1 205 ? 25.272  58.453  58.504  1.00 23.27 ? 205 LYS E C   1 
ATOM 8865  O O   . LYS E 1 205 ? 26.214  57.825  59.005  1.00 21.65 ? 205 LYS E O   1 
ATOM 8866  C CB  . LYS E 1 205 ? 23.800  57.575  56.621  1.00 23.24 ? 205 LYS E CB  1 
ATOM 8867  C CG  . LYS E 1 205 ? 23.442  56.413  57.554  1.00 21.74 ? 205 LYS E CG  1 
ATOM 8868  C CD  . LYS E 1 205 ? 24.446  55.274  57.490  1.00 20.11 ? 205 LYS E CD  1 
ATOM 8869  C CE  . LYS E 1 205 ? 24.488  54.632  56.110  1.00 21.60 ? 205 LYS E CE  1 
ATOM 8870  N NZ  . LYS E 1 205 ? 23.216  53.947  55.767  1.00 20.45 ? 205 LYS E NZ  1 
ATOM 8871  N N   . PRO E 1 206 ? 24.422  59.156  59.255  1.00 21.45 ? 206 PRO E N   1 
ATOM 8872  C CA  . PRO E 1 206 ? 23.256  59.953  58.861  1.00 21.94 ? 206 PRO E CA  1 
ATOM 8873  C C   . PRO E 1 206 ? 23.702  61.142  58.031  1.00 22.88 ? 206 PRO E C   1 
ATOM 8874  O O   . PRO E 1 206 ? 24.722  61.754  58.331  1.00 24.05 ? 206 PRO E O   1 
ATOM 8875  C CB  . PRO E 1 206 ? 22.693  60.423  60.203  1.00 24.15 ? 206 PRO E CB  1 
ATOM 8876  C CG  . PRO E 1 206 ? 23.162  59.370  61.173  1.00 22.81 ? 206 PRO E CG  1 
ATOM 8877  C CD  . PRO E 1 206 ? 24.572  59.159  60.720  1.00 21.42 ? 206 PRO E CD  1 
ATOM 8878  N N   . LEU E 1 207 ? 22.934  61.465  56.997  1.00 21.88 ? 207 LEU E N   1 
ATOM 8879  C CA  . LEU E 1 207 ? 23.278  62.583  56.131  1.00 21.96 ? 207 LEU E CA  1 
ATOM 8880  C C   . LEU E 1 207 ? 22.955  63.881  56.841  1.00 20.72 ? 207 LEU E C   1 
ATOM 8881  O O   . LEU E 1 207 ? 23.689  64.859  56.729  1.00 20.91 ? 207 LEU E O   1 
ATOM 8882  C CB  . LEU E 1 207 ? 22.504  62.503  54.815  1.00 20.89 ? 207 LEU E CB  1 
ATOM 8883  C CG  . LEU E 1 207 ? 22.588  61.189  54.035  1.00 19.29 ? 207 LEU E CG  1 
ATOM 8884  C CD1 . LEU E 1 207 ? 21.735  61.293  52.788  1.00 16.17 ? 207 LEU E CD1 1 
ATOM 8885  C CD2 . LEU E 1 207 ? 24.025  60.875  53.679  1.00 20.27 ? 207 LEU E CD2 1 
ATOM 8886  N N   . TYR E 1 208 ? 21.865  63.867  57.599  1.00 20.60 ? 208 TYR E N   1 
ATOM 8887  C CA  . TYR E 1 208 ? 21.443  65.047  58.329  1.00 21.04 ? 208 TYR E CA  1 
ATOM 8888  C C   . TYR E 1 208 ? 21.274  64.703  59.800  1.00 21.68 ? 208 TYR E C   1 
ATOM 8889  O O   . TYR E 1 208 ? 21.320  63.529  60.186  1.00 21.33 ? 208 TYR E O   1 
ATOM 8890  C CB  . TYR E 1 208 ? 20.136  65.596  57.743  1.00 22.66 ? 208 TYR E CB  1 
ATOM 8891  C CG  . TYR E 1 208 ? 20.243  65.997  56.287  1.00 24.39 ? 208 TYR E CG  1 
ATOM 8892  C CD1 . TYR E 1 208 ? 20.150  65.043  55.273  1.00 23.55 ? 208 TYR E CD1 1 
ATOM 8893  C CD2 . TYR E 1 208 ? 20.475  67.325  55.924  1.00 26.51 ? 208 TYR E CD2 1 
ATOM 8894  C CE1 . TYR E 1 208 ? 20.290  65.375  53.939  1.00 23.00 ? 208 TYR E CE1 1 
ATOM 8895  C CE2 . TYR E 1 208 ? 20.616  67.706  54.588  1.00 24.24 ? 208 TYR E CE2 1 
ATOM 8896  C CZ  . TYR E 1 208 ? 20.525  66.716  53.600  1.00 21.89 ? 208 TYR E CZ  1 
ATOM 8897  O OH  . TYR E 1 208 ? 20.675  67.066  52.273  1.00 20.28 ? 208 TYR E OH  1 
ATOM 8898  N N   . THR E 1 209 ? 21.139  65.738  60.623  1.00 19.51 ? 209 THR E N   1 
ATOM 8899  C CA  . THR E 1 209 ? 20.962  65.567  62.058  1.00 16.99 ? 209 THR E CA  1 
ATOM 8900  C C   . THR E 1 209 ? 19.566  65.030  62.297  1.00 16.49 ? 209 THR E C   1 
ATOM 8901  O O   . THR E 1 209 ? 18.679  65.204  61.442  1.00 14.71 ? 209 THR E O   1 
ATOM 8902  C CB  . THR E 1 209 ? 21.165  66.909  62.794  1.00 17.26 ? 209 THR E CB  1 
ATOM 8903  O OG1 . THR E 1 209 ? 20.370  67.924  62.168  1.00 18.60 ? 209 THR E OG1 1 
ATOM 8904  C CG2 . THR E 1 209 ? 22.624  67.331  62.741  1.00 14.13 ? 209 THR E CG2 1 
ATOM 8905  N N   . ARG E 1 210 ? 19.306  64.455  63.460  1.00 18.89 ? 210 ARG E N   1 
ATOM 8906  C CA  . ARG E 1 210 ? 17.981  63.920  63.769  1.00 21.72 ? 210 ARG E CA  1 
ATOM 8907  C C   . ARG E 1 210 ? 16.837  64.935  63.889  1.00 19.50 ? 210 ARG E C   1 
ATOM 8908  O O   . ARG E 1 210 ? 15.806  64.630  64.483  1.00 20.22 ? 210 ARG E O   1 
ATOM 8909  C CB  . ARG E 1 210 ? 18.030  63.027  65.014  1.00 20.68 ? 210 ARG E CB  1 
ATOM 8910  C CG  . ARG E 1 210 ? 18.913  63.540  66.128  1.00 28.46 ? 210 ARG E CG  1 
ATOM 8911  C CD  . ARG E 1 210 ? 20.184  62.711  66.245  1.00 27.69 ? 210 ARG E CD  1 
ATOM 8912  N NE  . ARG E 1 210 ? 20.183  61.874  67.441  1.00 32.08 ? 210 ARG E NE  1 
ATOM 8913  C CZ  . ARG E 1 210 ? 19.437  60.785  67.600  1.00 34.20 ? 210 ARG E CZ  1 
ATOM 8914  N NH1 . ARG E 1 210 ? 18.618  60.380  66.640  1.00 34.02 ? 210 ARG E NH1 1 
ATOM 8915  N NH2 . ARG E 1 210 ? 19.514  60.087  68.720  1.00 31.88 ? 210 ARG E NH2 1 
ATOM 8916  N N   . VAL E 1 211 ? 17.014  66.126  63.318  1.00 18.00 ? 211 VAL E N   1 
ATOM 8917  C CA  . VAL E 1 211 ? 15.988  67.166  63.357  1.00 15.60 ? 211 VAL E CA  1 
ATOM 8918  C C   . VAL E 1 211 ? 15.419  67.434  61.957  1.00 15.80 ? 211 VAL E C   1 
ATOM 8919  O O   . VAL E 1 211 ? 14.300  67.934  61.825  1.00 13.45 ? 211 VAL E O   1 
ATOM 8920  C CB  . VAL E 1 211 ? 16.524  68.479  64.001  1.00 15.70 ? 211 VAL E CB  1 
ATOM 8921  C CG1 . VAL E 1 211 ? 17.596  69.100  63.134  1.00 16.30 ? 211 VAL E CG1 1 
ATOM 8922  C CG2 . VAL E 1 211 ? 15.387  69.463  64.258  1.00 15.68 ? 211 VAL E CG2 1 
ATOM 8923  N N   . ALA E 1 212 ? 16.172  67.058  60.922  1.00 15.51 ? 212 ALA E N   1 
ATOM 8924  C CA  . ALA E 1 212 ? 15.751  67.237  59.528  1.00 14.80 ? 212 ALA E CA  1 
ATOM 8925  C C   . ALA E 1 212 ? 14.709  66.181  59.127  1.00 13.13 ? 212 ALA E C   1 
ATOM 8926  O O   . ALA E 1 212 ? 14.912  64.989  59.372  1.00 11.53 ? 212 ALA E O   1 
ATOM 8927  C CB  . ALA E 1 212 ? 16.958  67.155  58.608  1.00 12.95 ? 212 ALA E CB  1 
ATOM 8928  N N   . VAL E 1 213 ? 13.628  66.606  58.469  1.00 15.76 ? 213 VAL E N   1 
ATOM 8929  C CA  . VAL E 1 213 ? 12.566  65.679  58.061  1.00 17.27 ? 213 VAL E CA  1 
ATOM 8930  C C   . VAL E 1 213 ? 13.078  64.519  57.222  1.00 19.02 ? 213 VAL E C   1 
ATOM 8931  O O   . VAL E 1 213 ? 12.557  63.410  57.316  1.00 19.78 ? 213 VAL E O   1 
ATOM 8932  C CB  . VAL E 1 213 ? 11.407  66.374  57.290  1.00 14.56 ? 213 VAL E CB  1 
ATOM 8933  C CG1 . VAL E 1 213 ? 10.644  67.316  58.199  1.00 15.67 ? 213 VAL E CG1 1 
ATOM 8934  C CG2 . VAL E 1 213 ? 11.930  67.105  56.071  1.00 17.07 ? 213 VAL E CG2 1 
ATOM 8935  N N   . TRP E 1 214 ? 14.103  64.773  56.417  1.00 19.79 ? 214 TRP E N   1 
ATOM 8936  C CA  . TRP E 1 214 ? 14.678  63.740  55.573  1.00 22.71 ? 214 TRP E CA  1 
ATOM 8937  C C   . TRP E 1 214 ? 16.156  63.581  55.894  1.00 24.48 ? 214 TRP E C   1 
ATOM 8938  O O   . TRP E 1 214 ? 16.799  64.519  56.355  1.00 27.47 ? 214 TRP E O   1 
ATOM 8939  C CB  . TRP E 1 214 ? 14.497  64.093  54.093  1.00 18.31 ? 214 TRP E CB  1 
ATOM 8940  C CG  . TRP E 1 214 ? 14.919  62.988  53.170  1.00 22.24 ? 214 TRP E CG  1 
ATOM 8941  C CD1 . TRP E 1 214 ? 14.223  61.847  52.885  1.00 22.70 ? 214 TRP E CD1 1 
ATOM 8942  C CD2 . TRP E 1 214 ? 16.171  62.877  52.477  1.00 23.74 ? 214 TRP E CD2 1 
ATOM 8943  N NE1 . TRP E 1 214 ? 14.968  61.028  52.072  1.00 21.70 ? 214 TRP E NE1 1 
ATOM 8944  C CE2 . TRP E 1 214 ? 16.167  61.632  51.808  1.00 22.40 ? 214 TRP E CE2 1 
ATOM 8945  C CE3 . TRP E 1 214 ? 17.297  63.705  52.365  1.00 20.91 ? 214 TRP E CE3 1 
ATOM 8946  C CZ2 . TRP E 1 214 ? 17.250  61.177  51.035  1.00 20.82 ? 214 TRP E CZ2 1 
ATOM 8947  C CZ3 . TRP E 1 214 ? 18.371  63.285  51.596  1.00 17.87 ? 214 TRP E CZ3 1 
ATOM 8948  C CH2 . TRP E 1 214 ? 18.339  62.022  50.943  1.00 19.47 ? 214 TRP E CH2 1 
ATOM 8949  N N   . GLY E 1 215 ? 16.675  62.375  55.693  1.00 24.08 ? 215 GLY E N   1 
ATOM 8950  C CA  . GLY E 1 215 ? 18.084  62.112  55.939  1.00 25.77 ? 215 GLY E CA  1 
ATOM 8951  C C   . GLY E 1 215 ? 18.510  61.991  57.391  1.00 27.93 ? 215 GLY E C   1 
ATOM 8952  O O   . GLY E 1 215 ? 19.680  61.729  57.672  1.00 28.03 ? 215 GLY E O   1 
ATOM 8953  N N   . ASN E 1 216 ? 17.582  62.221  58.312  1.00 28.39 ? 216 ASN E N   1 
ATOM 8954  C CA  . ASN E 1 216 ? 17.888  62.106  59.732  1.00 28.72 ? 216 ASN E CA  1 
ATOM 8955  C C   . ASN E 1 216 ? 17.851  60.627  60.124  1.00 30.65 ? 216 ASN E C   1 
ATOM 8956  O O   . ASN E 1 216 ? 17.081  59.845  59.560  1.00 31.61 ? 216 ASN E O   1 
ATOM 8957  C CB  . ASN E 1 216 ? 16.894  62.918  60.579  1.00 29.84 ? 216 ASN E CB  1 
ATOM 8958  C CG  . ASN E 1 216 ? 15.523  62.262  60.683  1.00 28.97 ? 216 ASN E CG  1 
ATOM 8959  O OD1 . ASN E 1 216 ? 15.216  61.591  61.670  1.00 29.02 ? 216 ASN E OD1 1 
ATOM 8960  N ND2 . ASN E 1 216 ? 14.681  62.483  59.680  1.00 28.49 ? 216 ASN E ND2 1 
ATOM 8961  N N   . LYS E 1 217 ? 18.723  60.243  61.050  1.00 31.64 ? 217 LYS E N   1 
ATOM 8962  C CA  . LYS E 1 217 ? 18.803  58.865  61.522  1.00 31.44 ? 217 LYS E CA  1 
ATOM 8963  C C   . LYS E 1 217 ? 19.079  58.911  63.022  1.00 32.39 ? 217 LYS E C   1 
ATOM 8964  O O   . LYS E 1 217 ? 18.301  58.299  63.784  1.00 30.68 ? 217 LYS E O   1 
ATOM 8965  C CB  . LYS E 1 217 ? 19.940  58.110  60.816  1.00 29.85 ? 217 LYS E CB  1 
ATOM 8966  C CG  . LYS E 1 217 ? 19.914  58.163  59.289  1.00 28.36 ? 217 LYS E CG  1 
ATOM 8967  C CD  . LYS E 1 217 ? 18.819  57.296  58.691  1.00 29.98 ? 217 LYS E CD  1 
ATOM 8968  C CE  . LYS E 1 217 ? 19.119  55.820  58.879  1.00 29.60 ? 217 LYS E CE  1 
ATOM 8969  N NZ  . LYS E 1 217 ? 20.460  55.470  58.339  1.00 28.40 ? 217 LYS E NZ  1 
ATOM 8970  O OXT . LYS E 1 217 ? 20.061  59.584  63.417  1.00 32.48 ? 217 LYS E OXT 1 
ATOM 8971  N N   . SER F 1 1   ? 37.913  94.379  28.696  1.00 15.79 ? 1   SER F N   1 
ATOM 8972  C CA  . SER F 1 1   ? 36.844  94.959  29.555  1.00 18.40 ? 1   SER F CA  1 
ATOM 8973  C C   . SER F 1 1   ? 36.108  93.793  30.230  1.00 19.61 ? 1   SER F C   1 
ATOM 8974  O O   . SER F 1 1   ? 36.376  92.630  29.903  1.00 20.86 ? 1   SER F O   1 
ATOM 8975  C CB  . SER F 1 1   ? 35.867  95.787  28.701  1.00 19.80 ? 1   SER F CB  1 
ATOM 8976  O OG  . SER F 1 1   ? 36.579  96.609  27.791  1.00 13.05 ? 1   SER F OG  1 
ATOM 8977  N N   . MET F 1 2   ? 35.241  94.107  31.168  1.00 18.79 ? 2   MET F N   1 
ATOM 8978  C CA  . MET F 1 2   ? 34.499  93.093  31.898  1.00 20.25 ? 2   MET F CA  1 
ATOM 8979  C C   . MET F 1 2   ? 33.044  93.512  32.008  1.00 21.63 ? 2   MET F C   1 
ATOM 8980  O O   . MET F 1 2   ? 32.732  94.714  31.854  1.00 24.21 ? 2   MET F O   1 
ATOM 8981  C CB  . MET F 1 2   ? 35.100  92.923  33.296  1.00 16.19 ? 2   MET F CB  1 
ATOM 8982  C CG  . MET F 1 2   ? 35.301  94.244  34.034  1.00 17.52 ? 2   MET F CG  1 
ATOM 8983  S SD  . MET F 1 2   ? 35.649  94.057  35.779  1.00 27.04 ? 2   MET F SD  1 
ATOM 8984  C CE  . MET F 1 2   ? 34.025  93.544  36.370  1.00 12.53 ? 2   MET F CE  1 
ATOM 8985  N N   . THR F 1 3   ? 32.159  92.577  32.279  1.00 21.18 ? 3   THR F N   1 
ATOM 8986  C CA  . THR F 1 3   ? 30.742  92.886  32.411  1.00 20.65 ? 3   THR F CA  1 
ATOM 8987  C C   . THR F 1 3   ? 30.215  92.339  33.729  1.00 20.13 ? 3   THR F C   1 
ATOM 8988  O O   . THR F 1 3   ? 30.501  91.203  34.093  1.00 17.53 ? 3   THR F O   1 
ATOM 8989  C CB  . THR F 1 3   ? 29.926  92.297  31.235  1.00 22.93 ? 3   THR F CB  1 
ATOM 8990  O OG1 . THR F 1 3   ? 30.545  92.662  29.994  1.00 23.55 ? 3   THR F OG1 1 
ATOM 8991  C CG2 . THR F 1 3   ? 28.497  92.834  31.246  1.00 22.33 ? 3   THR F CG2 1 
ATOM 8992  N N   . LEU F 1 4   ? 29.460  93.167  34.439  1.00 18.13 ? 4   LEU F N   1 
ATOM 8993  C CA  . LEU F 1 4   ? 28.883  92.805  35.724  1.00 13.07 ? 4   LEU F CA  1 
ATOM 8994  C C   . LEU F 1 4   ? 27.373  92.633  35.532  1.00 13.73 ? 4   LEU F C   1 
ATOM 8995  O O   . LEU F 1 4   ? 26.654  93.667  35.408  1.00 15.78 ? 4   LEU F O   1 
ATOM 8996  C CB  . LEU F 1 4   ? 29.173  93.925  36.732  1.00 10.08 ? 4   LEU F CB  1 
ATOM 8997  C CG  . LEU F 1 4   ? 28.807  93.744  38.208  1.00 7.96  ? 4   LEU F CG  1 
ATOM 8998  C CD1 . LEU F 1 4   ? 29.797  92.811  38.874  1.00 3.89  ? 4   LEU F CD1 1 
ATOM 8999  C CD2 . LEU F 1 4   ? 28.814  95.088  38.907  1.00 3.38  ? 4   LEU F CD2 1 
ATOM 9000  N N   . GLY F 1 5   ? 26.896  91.405  35.489  1.00 12.48 ? 5   GLY F N   1 
ATOM 9001  C CA  . GLY F 1 5   ? 25.474  91.166  35.294  1.00 13.36 ? 5   GLY F CA  1 
ATOM 9002  C C   . GLY F 1 5   ? 24.701  90.895  36.556  1.00 13.35 ? 5   GLY F C   1 
ATOM 9003  O O   . GLY F 1 5   ? 25.099  90.032  37.357  1.00 14.31 ? 5   GLY F O   1 
ATOM 9004  N N   . TYR F 1 6   ? 23.606  91.628  36.784  1.00 15.06 ? 6   TYR F N   1 
ATOM 9005  C CA  . TYR F 1 6   ? 22.757  91.477  37.973  1.00 13.32 ? 6   TYR F CA  1 
ATOM 9006  C C   . TYR F 1 6   ? 21.556  92.416  37.869  1.00 14.85 ? 6   TYR F C   1 
ATOM 9007  O O   . TYR F 1 6   ? 21.576  93.369  37.090  1.00 11.35 ? 6   TYR F O   1 
ATOM 9008  C CB  . TYR F 1 6   ? 23.546  91.800  39.253  1.00 8.70  ? 6   TYR F CB  1 
ATOM 9009  C CG  . TYR F 1 6   ? 22.813  91.460  40.530  1.00 6.89  ? 6   TYR F CG  1 
ATOM 9010  C CD1 . TYR F 1 6   ? 22.660  90.136  40.925  1.00 7.49  ? 6   TYR F CD1 1 
ATOM 9011  C CD2 . TYR F 1 6   ? 22.245  92.457  41.328  1.00 5.80  ? 6   TYR F CD2 1 
ATOM 9012  C CE1 . TYR F 1 6   ? 21.959  89.797  42.083  1.00 8.45  ? 6   TYR F CE1 1 
ATOM 9013  C CE2 . TYR F 1 6   ? 21.543  92.137  42.480  1.00 2.00  ? 6   TYR F CE2 1 
ATOM 9014  C CZ  . TYR F 1 6   ? 21.401  90.811  42.850  1.00 6.90  ? 6   TYR F CZ  1 
ATOM 9015  O OH  . TYR F 1 6   ? 20.678  90.485  43.970  1.00 6.28  ? 6   TYR F OH  1 
ATOM 9016  N N   . TRP F 1 7   ? 20.522  92.149  38.666  1.00 16.50 ? 7   TRP F N   1 
ATOM 9017  C CA  . TRP F 1 7   ? 19.295  92.956  38.679  1.00 18.46 ? 7   TRP F CA  1 
ATOM 9018  C C   . TRP F 1 7   ? 19.560  94.416  39.041  1.00 18.80 ? 7   TRP F C   1 
ATOM 9019  O O   . TRP F 1 7   ? 20.702  94.821  39.251  1.00 19.83 ? 7   TRP F O   1 
ATOM 9020  C CB  . TRP F 1 7   ? 18.290  92.400  39.698  1.00 17.10 ? 7   TRP F CB  1 
ATOM 9021  C CG  . TRP F 1 7   ? 17.979  90.945  39.558  1.00 18.98 ? 7   TRP F CG  1 
ATOM 9022  C CD1 . TRP F 1 7   ? 18.504  89.923  40.296  1.00 19.16 ? 7   TRP F CD1 1 
ATOM 9023  C CD2 . TRP F 1 7   ? 17.050  90.347  38.645  1.00 20.75 ? 7   TRP F CD2 1 
ATOM 9024  N NE1 . TRP F 1 7   ? 17.961  88.725  39.902  1.00 21.85 ? 7   TRP F NE1 1 
ATOM 9025  C CE2 . TRP F 1 7   ? 17.063  88.952  38.891  1.00 20.36 ? 7   TRP F CE2 1 
ATOM 9026  C CE3 . TRP F 1 7   ? 16.203  90.867  37.646  1.00 17.11 ? 7   TRP F CE3 1 
ATOM 9027  C CZ2 . TRP F 1 7   ? 16.262  88.037  38.174  1.00 19.21 ? 7   TRP F CZ2 1 
ATOM 9028  C CZ3 . TRP F 1 7   ? 15.406  89.975  36.932  1.00 20.31 ? 7   TRP F CZ3 1 
ATOM 9029  C CH2 . TRP F 1 7   ? 15.443  88.573  37.202  1.00 19.00 ? 7   TRP F CH2 1 
ATOM 9030  N N   . ASP F 1 8   ? 18.487  95.197  39.122  1.00 20.09 ? 8   ASP F N   1 
ATOM 9031  C CA  . ASP F 1 8   ? 18.592  96.604  39.495  1.00 21.52 ? 8   ASP F CA  1 
ATOM 9032  C C   . ASP F 1 8   ? 18.656  96.669  41.020  1.00 21.11 ? 8   ASP F C   1 
ATOM 9033  O O   . ASP F 1 8   ? 18.878  97.733  41.597  1.00 20.81 ? 8   ASP F O   1 
ATOM 9034  C CB  . ASP F 1 8   ? 17.368  97.406  39.030  1.00 22.22 ? 8   ASP F CB  1 
ATOM 9035  C CG  . ASP F 1 8   ? 16.814  96.931  37.703  1.00 23.83 ? 8   ASP F CG  1 
ATOM 9036  O OD1 . ASP F 1 8   ? 17.597  96.751  36.744  1.00 20.05 ? 8   ASP F OD1 1 
ATOM 9037  O OD2 . ASP F 1 8   ? 15.580  96.746  37.624  1.00 26.13 ? 8   ASP F OD2 1 
ATOM 9038  N N   . ILE F 1 9   ? 18.376  95.540  41.665  1.00 20.94 ? 9   ILE F N   1 
ATOM 9039  C CA  . ILE F 1 9   ? 18.394  95.460  43.119  1.00 17.99 ? 9   ILE F CA  1 
ATOM 9040  C C   . ILE F 1 9   ? 19.837  95.372  43.610  1.00 18.12 ? 9   ILE F C   1 
ATOM 9041  O O   . ILE F 1 9   ? 20.673  94.737  42.970  1.00 18.73 ? 9   ILE F O   1 
ATOM 9042  C CB  . ILE F 1 9   ? 17.582  94.232  43.625  1.00 18.85 ? 9   ILE F CB  1 
ATOM 9043  C CG1 . ILE F 1 9   ? 16.075  94.479  43.492  1.00 21.10 ? 9   ILE F CG1 1 
ATOM 9044  C CG2 . ILE F 1 9   ? 17.901  93.934  45.070  1.00 19.28 ? 9   ILE F CG2 1 
ATOM 9045  C CD1 . ILE F 1 9   ? 15.537  94.479  42.069  1.00 19.98 ? 9   ILE F CD1 1 
ATOM 9046  N N   . ARG F 1 10  ? 20.116  96.035  44.732  1.00 16.21 ? 10  ARG F N   1 
ATOM 9047  C CA  . ARG F 1 10  ? 21.442  96.053  45.343  1.00 11.10 ? 10  ARG F CA  1 
ATOM 9048  C C   . ARG F 1 10  ? 21.903  94.622  45.552  1.00 10.71 ? 10  ARG F C   1 
ATOM 9049  O O   . ARG F 1 10  ? 22.912  94.187  44.983  1.00 8.45  ? 10  ARG F O   1 
ATOM 9050  C CB  . ARG F 1 10  ? 21.372  96.764  46.691  1.00 13.47 ? 10  ARG F CB  1 
ATOM 9051  C CG  . ARG F 1 10  ? 22.709  96.909  47.388  1.00 15.47 ? 10  ARG F CG  1 
ATOM 9052  C CD  . ARG F 1 10  ? 22.560  97.518  48.773  1.00 15.59 ? 10  ARG F CD  1 
ATOM 9053  N NE  . ARG F 1 10  ? 23.854  97.795  49.394  1.00 15.79 ? 10  ARG F NE  1 
ATOM 9054  C CZ  . ARG F 1 10  ? 24.126  97.627  50.684  1.00 17.85 ? 10  ARG F CZ  1 
ATOM 9055  N NH1 . ARG F 1 10  ? 23.190  97.192  51.515  1.00 18.80 ? 10  ARG F NH1 1 
ATOM 9056  N NH2 . ARG F 1 10  ? 25.353  97.851  51.134  1.00 15.54 ? 10  ARG F NH2 1 
ATOM 9057  N N   . GLY F 1 11  ? 21.155  93.911  46.391  1.00 9.39  ? 11  GLY F N   1 
ATOM 9058  C CA  . GLY F 1 11  ? 21.433  92.518  46.687  1.00 7.10  ? 11  GLY F CA  1 
ATOM 9059  C C   . GLY F 1 11  ? 22.887  92.112  46.816  1.00 7.72  ? 11  GLY F C   1 
ATOM 9060  O O   . GLY F 1 11  ? 23.748  92.926  47.180  1.00 11.99 ? 11  GLY F O   1 
ATOM 9061  N N   . LEU F 1 12  ? 23.163  90.863  46.457  1.00 5.49  ? 12  LEU F N   1 
ATOM 9062  C CA  . LEU F 1 12  ? 24.501  90.293  46.530  1.00 6.02  ? 12  LEU F CA  1 
ATOM 9063  C C   . LEU F 1 12  ? 25.530  90.845  45.566  1.00 7.64  ? 12  LEU F C   1 
ATOM 9064  O O   . LEU F 1 12  ? 26.635  90.317  45.475  1.00 12.00 ? 12  LEU F O   1 
ATOM 9065  C CB  . LEU F 1 12  ? 24.434  88.767  46.421  1.00 4.43  ? 12  LEU F CB  1 
ATOM 9066  C CG  . LEU F 1 12  ? 23.936  87.992  47.648  1.00 5.41  ? 12  LEU F CG  1 
ATOM 9067  C CD1 . LEU F 1 12  ? 24.758  88.399  48.853  1.00 10.38 ? 12  LEU F CD1 1 
ATOM 9068  C CD2 . LEU F 1 12  ? 22.461  88.240  47.922  1.00 3.40  ? 12  LEU F CD2 1 
ATOM 9069  N N   . ALA F 1 13  ? 25.190  91.925  44.872  1.00 6.83  ? 13  ALA F N   1 
ATOM 9070  C CA  . ALA F 1 13  ? 26.100  92.519  43.898  1.00 8.74  ? 13  ALA F CA  1 
ATOM 9071  C C   . ALA F 1 13  ? 26.840  93.742  44.412  1.00 8.85  ? 13  ALA F C   1 
ATOM 9072  O O   . ALA F 1 13  ? 27.940  94.047  43.944  1.00 6.23  ? 13  ALA F O   1 
ATOM 9073  C CB  . ALA F 1 13  ? 25.341  92.882  42.638  1.00 7.26  ? 13  ALA F CB  1 
ATOM 9074  N N   . HIS F 1 14  ? 26.237  94.430  45.378  1.00 9.72  ? 14  HIS F N   1 
ATOM 9075  C CA  . HIS F 1 14  ? 26.811  95.651  45.937  1.00 9.68  ? 14  HIS F CA  1 
ATOM 9076  C C   . HIS F 1 14  ? 28.297  95.567  46.263  1.00 11.46 ? 14  HIS F C   1 
ATOM 9077  O O   . HIS F 1 14  ? 29.089  96.359  45.738  1.00 10.67 ? 14  HIS F O   1 
ATOM 9078  C CB  . HIS F 1 14  ? 26.054  96.085  47.183  1.00 7.27  ? 14  HIS F CB  1 
ATOM 9079  C CG  . HIS F 1 14  ? 26.175  97.545  47.475  1.00 8.21  ? 14  HIS F CG  1 
ATOM 9080  N ND1 . HIS F 1 14  ? 25.501  98.506  46.750  1.00 12.66 ? 14  HIS F ND1 1 
ATOM 9081  C CD2 . HIS F 1 14  ? 26.885  98.214  48.414  1.00 11.51 ? 14  HIS F CD2 1 
ATOM 9082  C CE1 . HIS F 1 14  ? 25.793  99.705  47.230  1.00 12.67 ? 14  HIS F CE1 1 
ATOM 9083  N NE2 . HIS F 1 14  ? 26.630  99.554  48.240  1.00 9.72  ? 14  HIS F NE2 1 
ATOM 9084  N N   . ALA F 1 15  ? 28.669  94.602  47.078  1.00 9.25  ? 15  ALA F N   1 
ATOM 9085  C CA  . ALA F 1 15  ? 30.060  94.409  47.458  1.00 7.02  ? 15  ALA F CA  1 
ATOM 9086  C C   . ALA F 1 15  ? 30.999  94.363  46.251  1.00 9.11  ? 15  ALA F C   1 
ATOM 9087  O O   . ALA F 1 15  ? 31.993  95.081  46.213  1.00 8.81  ? 15  ALA F O   1 
ATOM 9088  C CB  . ALA F 1 15  ? 30.207  93.139  48.275  1.00 10.95 ? 15  ALA F CB  1 
ATOM 9089  N N   . ILE F 1 16  ? 30.669  93.538  45.260  1.00 10.30 ? 16  ILE F N   1 
ATOM 9090  C CA  . ILE F 1 16  ? 31.493  93.391  44.054  1.00 8.45  ? 16  ILE F CA  1 
ATOM 9091  C C   . ILE F 1 16  ? 31.744  94.740  43.410  1.00 9.57  ? 16  ILE F C   1 
ATOM 9092  O O   . ILE F 1 16  ? 32.862  95.050  42.999  1.00 5.56  ? 16  ILE F O   1 
ATOM 9093  C CB  . ILE F 1 16  ? 30.811  92.517  43.002  1.00 2.00  ? 16  ILE F CB  1 
ATOM 9094  C CG1 . ILE F 1 16  ? 30.258  91.254  43.645  1.00 2.00  ? 16  ILE F CG1 1 
ATOM 9095  C CG2 . ILE F 1 16  ? 31.802  92.166  41.907  1.00 4.71  ? 16  ILE F CG2 1 
ATOM 9096  C CD1 . ILE F 1 16  ? 29.242  90.557  42.797  1.00 2.00  ? 16  ILE F CD1 1 
ATOM 9097  N N   . ARG F 1 17  ? 30.682  95.532  43.321  1.00 12.49 ? 17  ARG F N   1 
ATOM 9098  C CA  . ARG F 1 17  ? 30.762  96.853  42.726  1.00 16.71 ? 17  ARG F CA  1 
ATOM 9099  C C   . ARG F 1 17  ? 31.714  97.701  43.552  1.00 18.89 ? 17  ARG F C   1 
ATOM 9100  O O   . ARG F 1 17  ? 32.482  98.500  43.012  1.00 19.47 ? 17  ARG F O   1 
ATOM 9101  C CB  . ARG F 1 17  ? 29.378  97.494  42.688  1.00 18.61 ? 17  ARG F CB  1 
ATOM 9102  C CG  . ARG F 1 17  ? 28.321  96.608  42.078  1.00 19.66 ? 17  ARG F CG  1 
ATOM 9103  C CD  . ARG F 1 17  ? 27.007  97.339  41.958  1.00 21.13 ? 17  ARG F CD  1 
ATOM 9104  N NE  . ARG F 1 17  ? 25.912  96.425  41.666  1.00 19.63 ? 17  ARG F NE  1 
ATOM 9105  C CZ  . ARG F 1 17  ? 24.660  96.625  42.055  1.00 18.89 ? 17  ARG F CZ  1 
ATOM 9106  N NH1 . ARG F 1 17  ? 24.347  97.712  42.742  1.00 18.39 ? 17  ARG F NH1 1 
ATOM 9107  N NH2 . ARG F 1 17  ? 23.730  95.723  41.792  1.00 19.69 ? 17  ARG F NH2 1 
ATOM 9108  N N   . LEU F 1 18  ? 31.699  97.486  44.863  1.00 17.31 ? 18  LEU F N   1 
ATOM 9109  C CA  . LEU F 1 18  ? 32.568  98.230  45.764  1.00 14.63 ? 18  LEU F CA  1 
ATOM 9110  C C   . LEU F 1 18  ? 34.042  98.039  45.412  1.00 14.96 ? 18  LEU F C   1 
ATOM 9111  O O   . LEU F 1 18  ? 34.727  99.011  45.076  1.00 16.50 ? 18  LEU F O   1 
ATOM 9112  C CB  . LEU F 1 18  ? 32.300  97.831  47.216  1.00 12.77 ? 18  LEU F CB  1 
ATOM 9113  C CG  . LEU F 1 18  ? 30.893  98.141  47.734  1.00 8.64  ? 18  LEU F CG  1 
ATOM 9114  C CD1 . LEU F 1 18  ? 30.701  97.570  49.135  1.00 11.23 ? 18  LEU F CD1 1 
ATOM 9115  C CD2 . LEU F 1 18  ? 30.649  99.649  47.722  1.00 3.18  ? 18  LEU F CD2 1 
ATOM 9116  N N   . LEU F 1 19  ? 34.529  96.798  45.422  1.00 14.35 ? 19  LEU F N   1 
ATOM 9117  C CA  . LEU F 1 19  ? 35.936  96.576  45.094  1.00 13.37 ? 19  LEU F CA  1 
ATOM 9118  C C   . LEU F 1 19  ? 36.219  96.607  43.597  1.00 12.95 ? 19  LEU F C   1 
ATOM 9119  O O   . LEU F 1 19  ? 37.299  96.219  43.156  1.00 13.51 ? 19  LEU F O   1 
ATOM 9120  C CB  . LEU F 1 19  ? 36.487  95.292  45.724  1.00 11.54 ? 19  LEU F CB  1 
ATOM 9121  C CG  . LEU F 1 19  ? 36.287  93.921  45.085  1.00 10.73 ? 19  LEU F CG  1 
ATOM 9122  C CD1 . LEU F 1 19  ? 37.298  92.948  45.674  1.00 2.00  ? 19  LEU F CD1 1 
ATOM 9123  C CD2 . LEU F 1 19  ? 34.871  93.428  45.288  1.00 7.86  ? 19  LEU F CD2 1 
ATOM 9124  N N   . LEU F 1 20  ? 35.244  97.078  42.826  1.00 12.78 ? 20  LEU F N   1 
ATOM 9125  C CA  . LEU F 1 20  ? 35.367  97.200  41.375  1.00 14.39 ? 20  LEU F CA  1 
ATOM 9126  C C   . LEU F 1 20  ? 35.642  98.681  41.089  1.00 15.26 ? 20  LEU F C   1 
ATOM 9127  O O   . LEU F 1 20  ? 36.556  99.044  40.338  1.00 17.49 ? 20  LEU F O   1 
ATOM 9128  C CB  . LEU F 1 20  ? 34.047  96.786  40.712  1.00 14.29 ? 20  LEU F CB  1 
ATOM 9129  C CG  . LEU F 1 20  ? 34.073  95.813  39.537  1.00 14.41 ? 20  LEU F CG  1 
ATOM 9130  C CD1 . LEU F 1 20  ? 34.480  94.431  40.010  1.00 12.39 ? 20  LEU F CD1 1 
ATOM 9131  C CD2 . LEU F 1 20  ? 32.698  95.763  38.907  1.00 14.24 ? 20  LEU F CD2 1 
ATOM 9132  N N   . GLU F 1 21  ? 34.846  99.528  41.737  1.00 16.35 ? 21  GLU F N   1 
ATOM 9133  C CA  . GLU F 1 21  ? 34.941  100.973 41.604  1.00 18.23 ? 21  GLU F CA  1 
ATOM 9134  C C   . GLU F 1 21  ? 36.226  101.465 42.247  1.00 18.87 ? 21  GLU F C   1 
ATOM 9135  O O   . GLU F 1 21  ? 37.027  102.169 41.628  1.00 18.97 ? 21  GLU F O   1 
ATOM 9136  C CB  . GLU F 1 21  ? 33.749  101.629 42.303  1.00 17.92 ? 21  GLU F CB  1 
ATOM 9137  C CG  . GLU F 1 21  ? 33.727  103.128 42.190  1.00 20.51 ? 21  GLU F CG  1 
ATOM 9138  C CD  . GLU F 1 21  ? 33.552  103.596 40.770  1.00 20.55 ? 21  GLU F CD  1 
ATOM 9139  O OE1 . GLU F 1 21  ? 32.468  103.364 40.196  1.00 21.23 ? 21  GLU F OE1 1 
ATOM 9140  O OE2 . GLU F 1 21  ? 34.503  104.191 40.227  1.00 22.92 ? 21  GLU F OE2 1 
ATOM 9141  N N   . TYR F 1 22  ? 36.410  101.071 43.500  1.00 20.09 ? 22  TYR F N   1 
ATOM 9142  C CA  . TYR F 1 22  ? 37.576  101.450 44.279  1.00 18.99 ? 22  TYR F CA  1 
ATOM 9143  C C   . TYR F 1 22  ? 38.871  101.044 43.583  1.00 18.56 ? 22  TYR F C   1 
ATOM 9144  O O   . TYR F 1 22  ? 39.866  101.761 43.662  1.00 17.57 ? 22  TYR F O   1 
ATOM 9145  C CB  . TYR F 1 22  ? 37.478  100.814 45.675  1.00 19.16 ? 22  TYR F CB  1 
ATOM 9146  C CG  . TYR F 1 22  ? 38.701  100.961 46.557  1.00 19.83 ? 22  TYR F CG  1 
ATOM 9147  C CD1 . TYR F 1 22  ? 39.000  102.169 47.190  1.00 18.37 ? 22  TYR F CD1 1 
ATOM 9148  C CD2 . TYR F 1 22  ? 39.548  99.876  46.774  1.00 19.61 ? 22  TYR F CD2 1 
ATOM 9149  C CE1 . TYR F 1 22  ? 40.111  102.303 48.018  1.00 19.21 ? 22  TYR F CE1 1 
ATOM 9150  C CE2 . TYR F 1 22  ? 40.654  99.983  47.594  1.00 18.37 ? 22  TYR F CE2 1 
ATOM 9151  C CZ  . TYR F 1 22  ? 40.932  101.186 48.213  1.00 19.52 ? 22  TYR F CZ  1 
ATOM 9152  O OH  . TYR F 1 22  ? 42.036  101.270 49.027  1.00 20.48 ? 22  TYR F OH  1 
ATOM 9153  N N   . THR F 1 23  ? 38.848  99.920  42.875  1.00 18.39 ? 23  THR F N   1 
ATOM 9154  C CA  . THR F 1 23  ? 40.043  99.445  42.191  1.00 19.41 ? 23  THR F CA  1 
ATOM 9155  C C   . THR F 1 23  ? 40.219  100.047 40.797  1.00 18.62 ? 23  THR F C   1 
ATOM 9156  O O   . THR F 1 23  ? 41.023  99.539  39.997  1.00 19.09 ? 23  THR F O   1 
ATOM 9157  C CB  . THR F 1 23  ? 40.063  97.922  42.131  1.00 18.31 ? 23  THR F CB  1 
ATOM 9158  O OG1 . THR F 1 23  ? 38.872  97.454  41.491  1.00 17.41 ? 23  THR F OG1 1 
ATOM 9159  C CG2 . THR F 1 23  ? 40.145  97.347  43.540  1.00 19.21 ? 23  THR F CG2 1 
ATOM 9160  N N   . ASP F 1 24  ? 39.466  101.117 40.528  1.00 18.82 ? 24  ASP F N   1 
ATOM 9161  C CA  . ASP F 1 24  ? 39.514  101.854 39.262  1.00 19.80 ? 24  ASP F CA  1 
ATOM 9162  C C   . ASP F 1 24  ? 39.295  100.994 38.018  1.00 21.68 ? 24  ASP F C   1 
ATOM 9163  O O   . ASP F 1 24  ? 39.742  101.345 36.904  1.00 19.59 ? 24  ASP F O   1 
ATOM 9164  C CB  . ASP F 1 24  ? 40.845  102.618 39.141  1.00 19.84 ? 24  ASP F CB  1 
ATOM 9165  C CG  . ASP F 1 24  ? 41.037  103.650 40.247  1.00 23.08 ? 24  ASP F CG  1 
ATOM 9166  O OD1 . ASP F 1 24  ? 40.123  104.472 40.470  1.00 20.96 ? 24  ASP F OD1 1 
ATOM 9167  O OD2 . ASP F 1 24  ? 42.110  103.649 40.887  1.00 24.31 ? 24  ASP F OD2 1 
ATOM 9168  N N   . SER F 1 25  ? 38.571  99.894  38.179  1.00 19.51 ? 25  SER F N   1 
ATOM 9169  C CA  . SER F 1 25  ? 38.322  98.997  37.066  1.00 20.67 ? 25  SER F CA  1 
ATOM 9170  C C   . SER F 1 25  ? 37.197  99.446  36.125  1.00 21.48 ? 25  SER F C   1 
ATOM 9171  O O   . SER F 1 25  ? 36.138  99.908  36.558  1.00 20.28 ? 25  SER F O   1 
ATOM 9172  C CB  . SER F 1 25  ? 38.091  97.575  37.589  1.00 21.38 ? 25  SER F CB  1 
ATOM 9173  O OG  . SER F 1 25  ? 39.305  97.059  38.155  1.00 19.74 ? 25  SER F OG  1 
ATOM 9174  N N   . SER F 1 26  ? 37.473  99.344  34.829  1.00 22.24 ? 26  SER F N   1 
ATOM 9175  C CA  . SER F 1 26  ? 36.535  99.706  33.777  1.00 20.85 ? 26  SER F CA  1 
ATOM 9176  C C   . SER F 1 26  ? 35.455  98.636  33.650  1.00 20.83 ? 26  SER F C   1 
ATOM 9177  O O   . SER F 1 26  ? 35.686  97.566  33.088  1.00 23.49 ? 26  SER F O   1 
ATOM 9178  C CB  . SER F 1 26  ? 37.296  99.856  32.460  1.00 19.31 ? 26  SER F CB  1 
ATOM 9179  O OG  . SER F 1 26  ? 38.660  99.425  32.596  1.00 10.34 ? 26  SER F OG  1 
ATOM 9180  N N   . TYR F 1 27  ? 34.286  98.940  34.165  1.00 20.01 ? 27  TYR F N   1 
ATOM 9181  C CA  . TYR F 1 27  ? 33.152  97.997  34.147  1.00 19.35 ? 27  TYR F CA  1 
ATOM 9182  C C   . TYR F 1 27  ? 31.920  98.510  33.400  1.00 19.89 ? 27  TYR F C   1 
ATOM 9183  O O   . TYR F 1 27  ? 31.738  99.716  33.208  1.00 19.68 ? 27  TYR F O   1 
ATOM 9184  C CB  . TYR F 1 27  ? 32.731  97.660  35.589  1.00 16.88 ? 27  TYR F CB  1 
ATOM 9185  C CG  . TYR F 1 27  ? 32.101  98.836  36.315  1.00 17.97 ? 27  TYR F CG  1 
ATOM 9186  C CD1 . TYR F 1 27  ? 32.895  99.820  36.920  1.00 19.61 ? 27  TYR F CD1 1 
ATOM 9187  C CD2 . TYR F 1 27  ? 30.716  99.005  36.331  1.00 16.54 ? 27  TYR F CD2 1 
ATOM 9188  C CE1 . TYR F 1 27  ? 32.317  100.949 37.515  1.00 16.00 ? 27  TYR F CE1 1 
ATOM 9189  C CE2 . TYR F 1 27  ? 30.113  100.128 36.923  1.00 17.26 ? 27  TYR F CE2 1 
ATOM 9190  C CZ  . TYR F 1 27  ? 30.934  101.112 37.509  1.00 15.26 ? 27  TYR F CZ  1 
ATOM 9191  O OH  . TYR F 1 27  ? 30.360  102.222 38.065  1.00 14.16 ? 27  TYR F OH  1 
ATOM 9192  N N   . GLU F 1 28  ? 31.057  97.571  33.034  1.00 18.74 ? 28  GLU F N   1 
ATOM 9193  C CA  . GLU F 1 28  ? 29.802  97.857  32.355  1.00 20.92 ? 28  GLU F CA  1 
ATOM 9194  C C   . GLU F 1 28  ? 28.745  97.032  33.079  1.00 21.60 ? 28  GLU F C   1 
ATOM 9195  O O   . GLU F 1 28  ? 28.902  95.824  33.246  1.00 21.87 ? 28  GLU F O   1 
ATOM 9196  C CB  . GLU F 1 28  ? 29.854  97.443  30.883  1.00 23.67 ? 28  GLU F CB  1 
ATOM 9197  C CG  . GLU F 1 28  ? 30.664  98.368  29.983  1.00 26.10 ? 28  GLU F CG  1 
ATOM 9198  C CD  . GLU F 1 28  ? 30.512  98.025  28.507  1.00 28.38 ? 28  GLU F CD  1 
ATOM 9199  O OE1 . GLU F 1 28  ? 29.360  97.838  28.053  1.00 30.08 ? 28  GLU F OE1 1 
ATOM 9200  O OE2 . GLU F 1 28  ? 31.542  97.947  27.801  1.00 28.22 ? 28  GLU F OE2 1 
ATOM 9201  N N   . GLU F 1 29  ? 27.694  97.696  33.544  1.00 20.52 ? 29  GLU F N   1 
ATOM 9202  C CA  . GLU F 1 29  ? 26.616  97.025  34.270  1.00 21.87 ? 29  GLU F CA  1 
ATOM 9203  C C   . GLU F 1 29  ? 25.491  96.555  33.354  1.00 22.89 ? 29  GLU F C   1 
ATOM 9204  O O   . GLU F 1 29  ? 25.011  97.330  32.514  1.00 22.63 ? 29  GLU F O   1 
ATOM 9205  C CB  . GLU F 1 29  ? 26.014  97.953  35.329  1.00 23.78 ? 29  GLU F CB  1 
ATOM 9206  C CG  . GLU F 1 29  ? 26.970  98.447  36.392  1.00 17.62 ? 29  GLU F CG  1 
ATOM 9207  C CD  . GLU F 1 29  ? 26.297  99.397  37.362  1.00 20.19 ? 29  GLU F CD  1 
ATOM 9208  O OE1 . GLU F 1 29  ? 25.948  100.523 36.945  1.00 17.70 ? 29  GLU F OE1 1 
ATOM 9209  O OE2 . GLU F 1 29  ? 26.101  99.012  38.535  1.00 19.30 ? 29  GLU F OE2 1 
ATOM 9210  N N   . LYS F 1 30  ? 25.045  95.341  33.545  1.00 24.30 ? 30  LYS F N   1 
ATOM 9211  C CA  . LYS F 1 30  ? 23.951  94.813  32.756  1.00 24.33 ? 30  LYS F CA  1 
ATOM 9212  C C   . LYS F 1 30  ? 22.846  94.496  33.752  1.00 24.39 ? 30  LYS F C   1 
ATOM 9213  O O   . LYS F 1 30  ? 22.769  93.393  34.295  1.00 23.42 ? 30  LYS F O   1 
ATOM 9214  C CB  . LYS F 1 30  ? 24.398  93.568  31.989  1.00 24.63 ? 30  LYS F CB  1 
ATOM 9215  C CG  . LYS F 1 30  ? 23.417  93.092  30.920  1.00 23.86 ? 30  LYS F CG  1 
ATOM 9216  C CD  . LYS F 1 30  ? 24.125  92.246  29.867  1.00 23.79 ? 30  LYS F CD  1 
ATOM 9217  C CE  . LYS F 1 30  ? 24.931  91.128  30.508  1.00 18.39 ? 30  LYS F CE  1 
ATOM 9218  N NZ  . LYS F 1 30  ? 25.623  90.256  29.524  1.00 20.14 ? 30  LYS F NZ  1 
ATOM 9219  N N   . LYS F 1 31  ? 22.054  95.517  34.055  1.00 22.57 ? 31  LYS F N   1 
ATOM 9220  C CA  . LYS F 1 31  ? 20.955  95.393  35.001  1.00 18.76 ? 31  LYS F CA  1 
ATOM 9221  C C   . LYS F 1 31  ? 19.687  94.824  34.385  1.00 19.81 ? 31  LYS F C   1 
ATOM 9222  O O   . LYS F 1 31  ? 19.170  95.347  33.400  1.00 19.60 ? 31  LYS F O   1 
ATOM 9223  C CB  . LYS F 1 31  ? 20.666  96.745  35.662  1.00 16.47 ? 31  LYS F CB  1 
ATOM 9224  C CG  . LYS F 1 31  ? 21.357  96.921  37.005  1.00 18.23 ? 31  LYS F CG  1 
ATOM 9225  C CD  . LYS F 1 31  ? 21.279  98.350  37.526  1.00 15.74 ? 31  LYS F CD  1 
ATOM 9226  C CE  . LYS F 1 31  ? 22.410  99.211  36.971  1.00 15.11 ? 31  LYS F CE  1 
ATOM 9227  N NZ  . LYS F 1 31  ? 22.383  100.605 37.514  1.00 18.46 ? 31  LYS F NZ  1 
ATOM 9228  N N   . TYR F 1 32  ? 19.220  93.718  34.949  1.00 19.82 ? 32  TYR F N   1 
ATOM 9229  C CA  . TYR F 1 32  ? 18.001  93.069  34.486  1.00 19.76 ? 32  TYR F CA  1 
ATOM 9230  C C   . TYR F 1 32  ? 16.865  93.598  35.345  1.00 20.09 ? 32  TYR F C   1 
ATOM 9231  O O   . TYR F 1 32  ? 17.104  94.110  36.436  1.00 18.53 ? 32  TYR F O   1 
ATOM 9232  C CB  . TYR F 1 32  ? 18.110  91.550  34.645  1.00 18.12 ? 32  TYR F CB  1 
ATOM 9233  C CG  . TYR F 1 32  ? 19.137  90.915  33.734  1.00 16.42 ? 32  TYR F CG  1 
ATOM 9234  C CD1 . TYR F 1 32  ? 20.474  90.845  34.103  1.00 18.74 ? 32  TYR F CD1 1 
ATOM 9235  C CD2 . TYR F 1 32  ? 18.767  90.373  32.506  1.00 14.90 ? 32  TYR F CD2 1 
ATOM 9236  C CE1 . TYR F 1 32  ? 21.421  90.249  33.274  1.00 19.64 ? 32  TYR F CE1 1 
ATOM 9237  C CE2 . TYR F 1 32  ? 19.703  89.772  31.673  1.00 15.48 ? 32  TYR F CE2 1 
ATOM 9238  C CZ  . TYR F 1 32  ? 21.028  89.713  32.061  1.00 17.56 ? 32  TYR F CZ  1 
ATOM 9239  O OH  . TYR F 1 32  ? 21.954  89.116  31.230  1.00 13.62 ? 32  TYR F OH  1 
ATOM 9240  N N   . THR F 1 33  ? 15.632  93.476  34.867  1.00 21.11 ? 33  THR F N   1 
ATOM 9241  C CA  . THR F 1 33  ? 14.485  93.956  35.634  1.00 22.36 ? 33  THR F CA  1 
ATOM 9242  C C   . THR F 1 33  ? 13.436  92.877  35.857  1.00 22.22 ? 33  THR F C   1 
ATOM 9243  O O   . THR F 1 33  ? 13.270  91.972  35.036  1.00 22.27 ? 33  THR F O   1 
ATOM 9244  C CB  . THR F 1 33  ? 13.832  95.191  34.975  1.00 21.50 ? 33  THR F CB  1 
ATOM 9245  O OG1 . THR F 1 33  ? 14.833  96.194  34.749  1.00 18.41 ? 33  THR F OG1 1 
ATOM 9246  C CG2 . THR F 1 33  ? 12.749  95.772  35.879  1.00 21.70 ? 33  THR F CG2 1 
ATOM 9247  N N   . MET F 1 34  ? 12.765  92.976  36.999  1.00 22.87 ? 34  MET F N   1 
ATOM 9248  C CA  . MET F 1 34  ? 11.716  92.048  37.392  1.00 23.00 ? 34  MET F CA  1 
ATOM 9249  C C   . MET F 1 34  ? 10.380  92.794  37.388  1.00 24.73 ? 34  MET F C   1 
ATOM 9250  O O   . MET F 1 34  ? 10.312  93.973  37.750  1.00 23.91 ? 34  MET F O   1 
ATOM 9251  C CB  . MET F 1 34  ? 12.010  91.492  38.788  1.00 21.02 ? 34  MET F CB  1 
ATOM 9252  C CG  . MET F 1 34  ? 11.010  90.468  39.276  1.00 14.96 ? 34  MET F CG  1 
ATOM 9253  S SD  . MET F 1 34  ? 11.445  89.847  40.897  1.00 13.10 ? 34  MET F SD  1 
ATOM 9254  C CE  . MET F 1 34  ? 12.909  88.881  40.499  1.00 14.45 ? 34  MET F CE  1 
ATOM 9255  N N   . GLY F 1 35  ? 9.303   92.108  36.960  1.00 27.81 ? 35  GLY F N   1 
ATOM 9256  C CA  . GLY F 1 35  ? 7.971   92.695  36.887  1.00 29.56 ? 35  GLY F CA  1 
ATOM 9257  C C   . GLY F 1 35  ? 7.172   92.614  38.174  1.00 29.72 ? 35  GLY F C   1 
ATOM 9258  O O   . GLY F 1 35  ? 7.470   91.799  39.026  1.00 27.30 ? 35  GLY F O   1 
ATOM 9259  N N   . ASP F 1 36  ? 6.029   93.300  38.215  1.00 30.27 ? 36  ASP F N   1 
ATOM 9260  C CA  . ASP F 1 36  ? 5.215   93.338  39.430  1.00 30.94 ? 36  ASP F CA  1 
ATOM 9261  C C   . ASP F 1 36  ? 4.156   92.259  39.468  1.00 30.49 ? 36  ASP F C   1 
ATOM 9262  O O   . ASP F 1 36  ? 4.380   91.163  38.982  1.00 31.16 ? 36  ASP F O   1 
ATOM 9263  C CB  . ASP F 1 36  ? 4.566   94.720  39.591  1.00 29.26 ? 36  ASP F CB  1 
ATOM 9264  C CG  . ASP F 1 36  ? 5.583   95.838  39.783  1.00 32.19 ? 36  ASP F CG  1 
ATOM 9265  O OD1 . ASP F 1 36  ? 6.057   96.027  40.926  1.00 28.88 ? 36  ASP F OD1 1 
ATOM 9266  O OD2 . ASP F 1 36  ? 5.865   96.575  38.811  1.00 34.53 ? 36  ASP F OD2 1 
ATOM 9267  N N   . ALA F 1 37  ? 2.993   92.605  40.014  1.00 29.98 ? 37  ALA F N   1 
ATOM 9268  C CA  . ALA F 1 37  ? 1.880   91.681  40.104  1.00 31.46 ? 37  ALA F CA  1 
ATOM 9269  C C   . ALA F 1 37  ? 2.308   90.501  40.981  1.00 30.73 ? 37  ALA F C   1 
ATOM 9270  O O   . ALA F 1 37  ? 3.453   90.445  41.446  1.00 29.25 ? 37  ALA F O   1 
ATOM 9271  C CB  . ALA F 1 37  ? 1.470   91.213  38.702  1.00 28.85 ? 37  ALA F CB  1 
ATOM 9272  N N   . PRO F 1 38  ? 1.375   89.573  41.261  1.00 30.69 ? 38  PRO F N   1 
ATOM 9273  C CA  . PRO F 1 38  ? 1.776   88.447  42.098  1.00 31.84 ? 38  PRO F CA  1 
ATOM 9274  C C   . PRO F 1 38  ? 2.792   87.511  41.422  1.00 32.30 ? 38  PRO F C   1 
ATOM 9275  O O   . PRO F 1 38  ? 3.595   86.847  42.101  1.00 31.39 ? 38  PRO F O   1 
ATOM 9276  C CB  . PRO F 1 38  ? 0.446   87.718  42.336  1.00 30.77 ? 38  PRO F CB  1 
ATOM 9277  C CG  . PRO F 1 38  ? -0.349  88.044  41.097  1.00 29.03 ? 38  PRO F CG  1 
ATOM 9278  C CD  . PRO F 1 38  ? -0.063  89.499  40.931  1.00 30.39 ? 38  PRO F CD  1 
ATOM 9279  N N   . ASP F 1 39  ? 2.858   87.591  40.094  1.00 33.60 ? 39  ASP F N   1 
ATOM 9280  C CA  . ASP F 1 39  ? 3.705   86.703  39.311  1.00 33.64 ? 39  ASP F CA  1 
ATOM 9281  C C   . ASP F 1 39  ? 5.172   87.078  39.198  1.00 30.37 ? 39  ASP F C   1 
ATOM 9282  O O   . ASP F 1 39  ? 6.015   86.219  38.971  1.00 32.53 ? 39  ASP F O   1 
ATOM 9283  C CB  . ASP F 1 39  ? 3.088   86.512  37.924  1.00 36.33 ? 39  ASP F CB  1 
ATOM 9284  C CG  . ASP F 1 39  ? 1.693   85.886  37.984  1.00 35.09 ? 39  ASP F CG  1 
ATOM 9285  O OD1 . ASP F 1 39  ? 0.703   86.629  38.182  1.00 31.68 ? 39  ASP F OD1 1 
ATOM 9286  O OD2 . ASP F 1 39  ? 1.595   84.649  37.823  1.00 34.77 ? 39  ASP F OD2 1 
ATOM 9287  N N   . TYR F 1 40  ? 5.461   88.367  39.293  1.00 29.40 ? 40  TYR F N   1 
ATOM 9288  C CA  . TYR F 1 40  ? 6.825   88.871  39.218  1.00 27.93 ? 40  TYR F CA  1 
ATOM 9289  C C   . TYR F 1 40  ? 7.624   88.402  37.999  1.00 24.49 ? 40  TYR F C   1 
ATOM 9290  O O   . TYR F 1 40  ? 8.488   87.528  38.096  1.00 22.90 ? 40  TYR F O   1 
ATOM 9291  C CB  . TYR F 1 40  ? 7.568   88.531  40.510  1.00 28.07 ? 40  TYR F CB  1 
ATOM 9292  C CG  . TYR F 1 40  ? 6.916   89.105  41.749  1.00 25.95 ? 40  TYR F CG  1 
ATOM 9293  C CD1 . TYR F 1 40  ? 6.891   90.482  41.961  1.00 23.01 ? 40  TYR F CD1 1 
ATOM 9294  C CD2 . TYR F 1 40  ? 6.333   88.280  42.704  1.00 24.43 ? 40  TYR F CD2 1 
ATOM 9295  C CE1 . TYR F 1 40  ? 6.300   91.026  43.103  1.00 22.78 ? 40  TYR F CE1 1 
ATOM 9296  C CE2 . TYR F 1 40  ? 5.739   88.807  43.854  1.00 23.45 ? 40  TYR F CE2 1 
ATOM 9297  C CZ  . TYR F 1 40  ? 5.727   90.179  44.050  1.00 24.05 ? 40  TYR F CZ  1 
ATOM 9298  O OH  . TYR F 1 40  ? 5.172   90.705  45.192  1.00 21.02 ? 40  TYR F OH  1 
ATOM 9299  N N   . ASP F 1 41  ? 7.381   89.043  36.864  1.00 23.84 ? 41  ASP F N   1 
ATOM 9300  C CA  . ASP F 1 41  ? 8.050   88.704  35.608  1.00 21.99 ? 41  ASP F CA  1 
ATOM 9301  C C   . ASP F 1 41  ? 9.572   88.894  35.625  1.00 20.70 ? 41  ASP F C   1 
ATOM 9302  O O   . ASP F 1 41  ? 10.068  90.004  35.461  1.00 23.42 ? 41  ASP F O   1 
ATOM 9303  C CB  . ASP F 1 41  ? 7.439   89.517  34.455  1.00 23.11 ? 41  ASP F CB  1 
ATOM 9304  C CG  . ASP F 1 41  ? 7.881   89.024  33.079  1.00 21.10 ? 41  ASP F CG  1 
ATOM 9305  O OD1 . ASP F 1 41  ? 7.329   88.007  32.602  1.00 20.27 ? 41  ASP F OD1 1 
ATOM 9306  O OD2 . ASP F 1 41  ? 8.773   89.655  32.472  1.00 17.00 ? 41  ASP F OD2 1 
ATOM 9307  N N   . ARG F 1 42  ? 10.309  87.803  35.798  1.00 19.62 ? 42  ARG F N   1 
ATOM 9308  C CA  . ARG F 1 42  ? 11.768  87.858  35.807  1.00 22.30 ? 42  ARG F CA  1 
ATOM 9309  C C   . ARG F 1 42  ? 12.311  87.618  34.398  1.00 22.20 ? 42  ARG F C   1 
ATOM 9310  O O   . ARG F 1 42  ? 13.518  87.666  34.169  1.00 23.92 ? 42  ARG F O   1 
ATOM 9311  C CB  . ARG F 1 42  ? 12.328  86.767  36.716  1.00 25.83 ? 42  ARG F CB  1 
ATOM 9312  C CG  . ARG F 1 42  ? 11.694  86.681  38.081  1.00 25.45 ? 42  ARG F CG  1 
ATOM 9313  C CD  . ARG F 1 42  ? 11.351  85.238  38.393  1.00 24.98 ? 42  ARG F CD  1 
ATOM 9314  N NE  . ARG F 1 42  ? 11.078  84.999  39.810  1.00 26.84 ? 42  ARG F NE  1 
ATOM 9315  C CZ  . ARG F 1 42  ? 11.975  84.532  40.675  1.00 29.29 ? 42  ARG F CZ  1 
ATOM 9316  N NH1 . ARG F 1 42  ? 13.210  84.256  40.278  1.00 28.59 ? 42  ARG F NH1 1 
ATOM 9317  N NH2 . ARG F 1 42  ? 11.626  84.300  41.932  1.00 29.35 ? 42  ARG F NH2 1 
ATOM 9318  N N   . SER F 1 43  ? 11.426  87.389  33.450  1.00 21.29 ? 43  SER F N   1 
ATOM 9319  C CA  . SER F 1 43  ? 11.783  87.077  32.074  1.00 20.54 ? 43  SER F CA  1 
ATOM 9320  C C   . SER F 1 43  ? 12.891  87.882  31.402  1.00 20.51 ? 43  SER F C   1 
ATOM 9321  O O   . SER F 1 43  ? 13.554  87.358  30.507  1.00 21.81 ? 43  SER F O   1 
ATOM 9322  C CB  . SER F 1 43  ? 10.546  87.037  31.174  1.00 21.37 ? 43  SER F CB  1 
ATOM 9323  O OG  . SER F 1 43  ? 10.725  86.094  30.115  1.00 22.23 ? 43  SER F OG  1 
ATOM 9324  N N   . GLN F 1 44  ? 13.129  89.118  31.835  1.00 19.08 ? 44  GLN F N   1 
ATOM 9325  C CA  . GLN F 1 44  ? 14.183  89.919  31.217  1.00 21.15 ? 44  GLN F CA  1 
ATOM 9326  C C   . GLN F 1 44  ? 15.541  89.219  31.332  1.00 17.72 ? 44  GLN F C   1 
ATOM 9327  O O   . GLN F 1 44  ? 16.435  89.442  30.517  1.00 16.75 ? 44  GLN F O   1 
ATOM 9328  C CB  . GLN F 1 44  ? 14.235  91.324  31.824  1.00 22.16 ? 44  GLN F CB  1 
ATOM 9329  C CG  . GLN F 1 44  ? 14.990  92.315  30.948  1.00 22.17 ? 44  GLN F CG  1 
ATOM 9330  C CD  . GLN F 1 44  ? 14.806  93.759  31.367  1.00 22.25 ? 44  GLN F CD  1 
ATOM 9331  O OE1 . GLN F 1 44  ? 15.753  94.419  31.781  1.00 20.78 ? 44  GLN F OE1 1 
ATOM 9332  N NE2 . GLN F 1 44  ? 13.587  94.260  31.248  1.00 23.97 ? 44  GLN F NE2 1 
ATOM 9333  N N   . TRP F 1 45  ? 15.672  88.366  32.346  1.00 16.09 ? 45  TRP F N   1 
ATOM 9334  C CA  . TRP F 1 45  ? 16.888  87.585  32.595  1.00 15.91 ? 45  TRP F CA  1 
ATOM 9335  C C   . TRP F 1 45  ? 16.780  86.231  31.881  1.00 15.80 ? 45  TRP F C   1 
ATOM 9336  O O   . TRP F 1 45  ? 17.590  85.916  31.001  1.00 15.26 ? 45  TRP F O   1 
ATOM 9337  C CB  . TRP F 1 45  ? 17.077  87.399  34.119  1.00 13.74 ? 45  TRP F CB  1 
ATOM 9338  C CG  . TRP F 1 45  ? 18.013  86.291  34.578  1.00 13.78 ? 45  TRP F CG  1 
ATOM 9339  C CD1 . TRP F 1 45  ? 17.706  85.274  35.442  1.00 13.99 ? 45  TRP F CD1 1 
ATOM 9340  C CD2 . TRP F 1 45  ? 19.389  86.095  34.208  1.00 14.14 ? 45  TRP F CD2 1 
ATOM 9341  N NE1 . TRP F 1 45  ? 18.796  84.461  35.628  1.00 16.71 ? 45  TRP F NE1 1 
ATOM 9342  C CE2 . TRP F 1 45  ? 19.842  84.940  34.885  1.00 16.89 ? 45  TRP F CE2 1 
ATOM 9343  C CE3 . TRP F 1 45  ? 20.280  86.780  33.372  1.00 13.39 ? 45  TRP F CE3 1 
ATOM 9344  C CZ2 . TRP F 1 45  ? 21.146  84.455  34.749  1.00 17.98 ? 45  TRP F CZ2 1 
ATOM 9345  C CZ3 . TRP F 1 45  ? 21.577  86.295  33.238  1.00 13.27 ? 45  TRP F CZ3 1 
ATOM 9346  C CH2 . TRP F 1 45  ? 21.995  85.143  33.924  1.00 17.06 ? 45  TRP F CH2 1 
ATOM 9347  N N   . LEU F 1 46  ? 15.722  85.494  32.223  1.00 16.66 ? 46  LEU F N   1 
ATOM 9348  C CA  . LEU F 1 46  ? 15.411  84.161  31.700  1.00 18.59 ? 46  LEU F CA  1 
ATOM 9349  C C   . LEU F 1 46  ? 16.003  83.706  30.365  1.00 20.19 ? 46  LEU F C   1 
ATOM 9350  O O   . LEU F 1 46  ? 16.799  82.766  30.337  1.00 20.41 ? 46  LEU F O   1 
ATOM 9351  C CB  . LEU F 1 46  ? 13.897  83.944  31.704  1.00 16.67 ? 46  LEU F CB  1 
ATOM 9352  C CG  . LEU F 1 46  ? 13.300  83.208  32.914  1.00 17.82 ? 46  LEU F CG  1 
ATOM 9353  C CD1 . LEU F 1 46  ? 13.523  81.702  32.785  1.00 18.02 ? 46  LEU F CD1 1 
ATOM 9354  C CD2 . LEU F 1 46  ? 13.869  83.741  34.231  1.00 15.77 ? 46  LEU F CD2 1 
ATOM 9355  N N   . ASN F 1 47  ? 15.608  84.341  29.265  1.00 21.53 ? 47  ASN F N   1 
ATOM 9356  C CA  . ASN F 1 47  ? 16.120  83.948  27.949  1.00 21.86 ? 47  ASN F CA  1 
ATOM 9357  C C   . ASN F 1 47  ? 17.642  84.032  27.806  1.00 22.88 ? 47  ASN F C   1 
ATOM 9358  O O   . ASN F 1 47  ? 18.279  83.077  27.347  1.00 21.15 ? 47  ASN F O   1 
ATOM 9359  C CB  . ASN F 1 47  ? 15.429  84.725  26.817  1.00 21.91 ? 47  ASN F CB  1 
ATOM 9360  C CG  . ASN F 1 47  ? 14.881  86.065  27.269  1.00 26.23 ? 47  ASN F CG  1 
ATOM 9361  O OD1 . ASN F 1 47  ? 13.817  86.130  27.889  1.00 30.45 ? 47  ASN F OD1 1 
ATOM 9362  N ND2 . ASN F 1 47  ? 15.598  87.140  26.956  1.00 27.00 ? 47  ASN F ND2 1 
ATOM 9363  N N   . GLU F 1 48  ? 18.224  85.154  28.230  1.00 21.15 ? 48  GLU F N   1 
ATOM 9364  C CA  . GLU F 1 48  ? 19.670  85.362  28.133  1.00 18.50 ? 48  GLU F CA  1 
ATOM 9365  C C   . GLU F 1 48  ? 20.480  84.331  28.916  1.00 17.08 ? 48  GLU F C   1 
ATOM 9366  O O   . GLU F 1 48  ? 21.527  83.865  28.455  1.00 16.36 ? 48  GLU F O   1 
ATOM 9367  C CB  . GLU F 1 48  ? 20.038  86.764  28.615  1.00 16.98 ? 48  GLU F CB  1 
ATOM 9368  C CG  . GLU F 1 48  ? 19.510  87.867  27.738  1.00 16.54 ? 48  GLU F CG  1 
ATOM 9369  C CD  . GLU F 1 48  ? 20.204  89.192  27.984  1.00 15.95 ? 48  GLU F CD  1 
ATOM 9370  O OE1 . GLU F 1 48  ? 21.454  89.221  28.040  1.00 11.85 ? 48  GLU F OE1 1 
ATOM 9371  O OE2 . GLU F 1 48  ? 19.490  90.211  28.111  1.00 14.24 ? 48  GLU F OE2 1 
ATOM 9372  N N   . LYS F 1 49  ? 19.976  83.995  30.099  1.00 15.33 ? 49  LYS F N   1 
ATOM 9373  C CA  . LYS F 1 49  ? 20.586  83.038  31.017  1.00 15.41 ? 49  LYS F CA  1 
ATOM 9374  C C   . LYS F 1 49  ? 21.411  81.934  30.346  1.00 13.73 ? 49  LYS F C   1 
ATOM 9375  O O   . LYS F 1 49  ? 22.633  81.892  30.486  1.00 13.78 ? 49  LYS F O   1 
ATOM 9376  C CB  . LYS F 1 49  ? 19.483  82.420  31.893  1.00 15.91 ? 49  LYS F CB  1 
ATOM 9377  C CG  . LYS F 1 49  ? 19.928  81.364  32.893  1.00 18.94 ? 49  LYS F CG  1 
ATOM 9378  C CD  . LYS F 1 49  ? 18.745  80.931  33.758  1.00 19.56 ? 49  LYS F CD  1 
ATOM 9379  C CE  . LYS F 1 49  ? 19.132  79.907  34.813  1.00 13.16 ? 49  LYS F CE  1 
ATOM 9380  N NZ  . LYS F 1 49  ? 17.956  79.549  35.655  1.00 9.36  ? 49  LYS F NZ  1 
ATOM 9381  N N   . PHE F 1 50  ? 20.744  81.098  29.560  1.00 12.64 ? 50  PHE F N   1 
ATOM 9382  C CA  . PHE F 1 50  ? 21.390  79.969  28.903  1.00 13.11 ? 50  PHE F CA  1 
ATOM 9383  C C   . PHE F 1 50  ? 22.182  80.243  27.634  1.00 14.20 ? 50  PHE F C   1 
ATOM 9384  O O   . PHE F 1 50  ? 22.813  79.336  27.088  1.00 15.52 ? 50  PHE F O   1 
ATOM 9385  C CB  . PHE F 1 50  ? 20.354  78.895  28.629  1.00 10.21 ? 50  PHE F CB  1 
ATOM 9386  C CG  . PHE F 1 50  ? 19.539  78.547  29.823  1.00 13.62 ? 50  PHE F CG  1 
ATOM 9387  C CD1 . PHE F 1 50  ? 18.395  79.271  30.130  1.00 11.79 ? 50  PHE F CD1 1 
ATOM 9388  C CD2 . PHE F 1 50  ? 19.941  77.508  30.659  1.00 14.60 ? 50  PHE F CD2 1 
ATOM 9389  C CE1 . PHE F 1 50  ? 17.642  78.965  31.257  1.00 8.98  ? 50  PHE F CE1 1 
ATOM 9390  C CE2 . PHE F 1 50  ? 19.175  77.193  31.791  1.00 8.29  ? 50  PHE F CE2 1 
ATOM 9391  C CZ  . PHE F 1 50  ? 18.031  77.926  32.087  1.00 4.48  ? 50  PHE F CZ  1 
ATOM 9392  N N   . LYS F 1 51  ? 22.110  81.464  27.125  1.00 16.32 ? 51  LYS F N   1 
ATOM 9393  C CA  . LYS F 1 51  ? 22.855  81.793  25.925  1.00 14.77 ? 51  LYS F CA  1 
ATOM 9394  C C   . LYS F 1 51  ? 24.304  82.101  26.278  1.00 14.64 ? 51  LYS F C   1 
ATOM 9395  O O   . LYS F 1 51  ? 25.232  81.607  25.630  1.00 17.60 ? 51  LYS F O   1 
ATOM 9396  C CB  . LYS F 1 51  ? 22.190  82.952  25.178  1.00 18.07 ? 51  LYS F CB  1 
ATOM 9397  C CG  . LYS F 1 51  ? 21.287  82.481  24.044  1.00 23.05 ? 51  LYS F CG  1 
ATOM 9398  C CD  . LYS F 1 51  ? 20.435  83.597  23.461  1.00 25.93 ? 51  LYS F CD  1 
ATOM 9399  C CE  . LYS F 1 51  ? 19.233  83.906  24.349  1.00 24.90 ? 51  LYS F CE  1 
ATOM 9400  N NZ  . LYS F 1 51  ? 18.315  82.737  24.483  1.00 27.89 ? 51  LYS F NZ  1 
ATOM 9401  N N   . LEU F 1 52  ? 24.497  82.883  27.335  1.00 11.98 ? 52  LEU F N   1 
ATOM 9402  C CA  . LEU F 1 52  ? 25.839  83.241  27.780  1.00 11.08 ? 52  LEU F CA  1 
ATOM 9403  C C   . LEU F 1 52  ? 26.570  81.955  28.145  1.00 9.97  ? 52  LEU F C   1 
ATOM 9404  O O   . LEU F 1 52  ? 26.034  81.137  28.859  1.00 8.81  ? 52  LEU F O   1 
ATOM 9405  C CB  . LEU F 1 52  ? 25.768  84.186  28.988  1.00 10.36 ? 52  LEU F CB  1 
ATOM 9406  C CG  . LEU F 1 52  ? 25.116  85.556  28.737  1.00 10.60 ? 52  LEU F CG  1 
ATOM 9407  C CD1 . LEU F 1 52  ? 24.776  86.238  30.048  1.00 6.65  ? 52  LEU F CD1 1 
ATOM 9408  C CD2 . LEU F 1 52  ? 26.027  86.427  27.886  1.00 7.09  ? 52  LEU F CD2 1 
ATOM 9409  N N   . GLY F 1 53  ? 27.785  81.795  27.637  1.00 10.11 ? 53  GLY F N   1 
ATOM 9410  C CA  . GLY F 1 53  ? 28.564  80.597  27.906  1.00 10.94 ? 53  GLY F CA  1 
ATOM 9411  C C   . GLY F 1 53  ? 29.034  80.401  29.336  1.00 11.80 ? 53  GLY F C   1 
ATOM 9412  O O   . GLY F 1 53  ? 30.182  80.039  29.567  1.00 14.00 ? 53  GLY F O   1 
ATOM 9413  N N   . LEU F 1 54  ? 28.163  80.629  30.295  1.00 8.45  ? 54  LEU F N   1 
ATOM 9414  C CA  . LEU F 1 54  ? 28.461  80.467  31.705  1.00 8.31  ? 54  LEU F CA  1 
ATOM 9415  C C   . LEU F 1 54  ? 28.131  79.022  32.035  1.00 6.54  ? 54  LEU F C   1 
ATOM 9416  O O   . LEU F 1 54  ? 26.967  78.631  32.007  1.00 4.12  ? 54  LEU F O   1 
ATOM 9417  C CB  . LEU F 1 54  ? 27.583  81.398  32.549  1.00 5.55  ? 54  LEU F CB  1 
ATOM 9418  C CG  . LEU F 1 54  ? 27.691  82.908  32.324  1.00 3.15  ? 54  LEU F CG  1 
ATOM 9419  C CD1 . LEU F 1 54  ? 26.607  83.643  33.104  1.00 2.00  ? 54  LEU F CD1 1 
ATOM 9420  C CD2 . LEU F 1 54  ? 29.061  83.383  32.743  1.00 2.32  ? 54  LEU F CD2 1 
ATOM 9421  N N   . ASP F 1 55  ? 29.125  78.237  32.422  1.00 6.74  ? 55  ASP F N   1 
ATOM 9422  C CA  . ASP F 1 55  ? 28.918  76.826  32.771  1.00 9.74  ? 55  ASP F CA  1 
ATOM 9423  C C   . ASP F 1 55  ? 28.027  76.575  33.988  1.00 9.03  ? 55  ASP F C   1 
ATOM 9424  O O   . ASP F 1 55  ? 27.834  75.433  34.373  1.00 10.40 ? 55  ASP F O   1 
ATOM 9425  C CB  . ASP F 1 55  ? 30.228  76.025  32.923  1.00 7.85  ? 55  ASP F CB  1 
ATOM 9426  C CG  . ASP F 1 55  ? 31.478  76.886  32.878  1.00 7.16  ? 55  ASP F CG  1 
ATOM 9427  O OD1 . ASP F 1 55  ? 31.525  77.927  33.568  1.00 13.31 ? 55  ASP F OD1 1 
ATOM 9428  O OD2 . ASP F 1 55  ? 32.432  76.499  32.168  1.00 2.00  ? 55  ASP F OD2 1 
ATOM 9429  N N   . PHE F 1 56  ? 27.511  77.640  34.612  1.00 8.26  ? 56  PHE F N   1 
ATOM 9430  C CA  . PHE F 1 56  ? 26.617  77.551  35.755  1.00 9.56  ? 56  PHE F CA  1 
ATOM 9431  C C   . PHE F 1 56  ? 25.769  78.821  35.802  1.00 9.00  ? 56  PHE F C   1 
ATOM 9432  O O   . PHE F 1 56  ? 25.854  79.592  36.754  1.00 8.08  ? 56  PHE F O   1 
ATOM 9433  C CB  . PHE F 1 56  ? 27.411  77.422  37.060  1.00 8.95  ? 56  PHE F CB  1 
ATOM 9434  C CG  . PHE F 1 56  ? 27.923  76.041  37.325  1.00 6.90  ? 56  PHE F CG  1 
ATOM 9435  C CD1 . PHE F 1 56  ? 27.040  74.978  37.459  1.00 5.27  ? 56  PHE F CD1 1 
ATOM 9436  C CD2 . PHE F 1 56  ? 29.289  75.795  37.428  1.00 2.92  ? 56  PHE F CD2 1 
ATOM 9437  C CE1 . PHE F 1 56  ? 27.511  73.693  37.690  1.00 2.34  ? 56  PHE F CE1 1 
ATOM 9438  C CE2 . PHE F 1 56  ? 29.766  74.514  37.660  1.00 2.00  ? 56  PHE F CE2 1 
ATOM 9439  C CZ  . PHE F 1 56  ? 28.877  73.461  37.789  1.00 2.00  ? 56  PHE F CZ  1 
ATOM 9440  N N   . PRO F 1 57  ? 24.915  79.037  34.789  1.00 8.43  ? 57  PRO F N   1 
ATOM 9441  C CA  . PRO F 1 57  ? 24.049  80.215  34.699  1.00 6.88  ? 57  PRO F CA  1 
ATOM 9442  C C   . PRO F 1 57  ? 23.421  80.648  36.015  1.00 7.38  ? 57  PRO F C   1 
ATOM 9443  O O   . PRO F 1 57  ? 22.592  79.942  36.592  1.00 9.94  ? 57  PRO F O   1 
ATOM 9444  C CB  . PRO F 1 57  ? 22.994  79.794  33.672  1.00 6.58  ? 57  PRO F CB  1 
ATOM 9445  C CG  . PRO F 1 57  ? 23.001  78.321  33.749  1.00 7.72  ? 57  PRO F CG  1 
ATOM 9446  C CD  . PRO F 1 57  ? 24.463  78.011  33.840  1.00 12.73 ? 57  PRO F CD  1 
ATOM 9447  N N   . ASN F 1 58  ? 23.832  81.826  36.472  1.00 9.59  ? 58  ASN F N   1 
ATOM 9448  C CA  . ASN F 1 58  ? 23.344  82.398  37.718  1.00 8.19  ? 58  ASN F CA  1 
ATOM 9449  C C   . ASN F 1 58  ? 23.739  83.864  37.832  1.00 7.56  ? 58  ASN F C   1 
ATOM 9450  O O   . ASN F 1 58  ? 24.680  84.330  37.185  1.00 4.17  ? 58  ASN F O   1 
ATOM 9451  C CB  . ASN F 1 58  ? 23.914  81.625  38.913  1.00 10.66 ? 58  ASN F CB  1 
ATOM 9452  C CG  . ASN F 1 58  ? 23.477  82.202  40.249  1.00 13.33 ? 58  ASN F CG  1 
ATOM 9453  O OD1 . ASN F 1 58  ? 22.288  82.378  40.503  1.00 15.79 ? 58  ASN F OD1 1 
ATOM 9454  N ND2 . ASN F 1 58  ? 24.439  82.508  41.104  1.00 16.30 ? 58  ASN F ND2 1 
ATOM 9455  N N   . LEU F 1 59  ? 22.981  84.589  38.640  1.00 9.68  ? 59  LEU F N   1 
ATOM 9456  C CA  . LEU F 1 59  ? 23.225  85.994  38.884  1.00 10.55 ? 59  LEU F CA  1 
ATOM 9457  C C   . LEU F 1 59  ? 23.840  86.087  40.266  1.00 10.31 ? 59  LEU F C   1 
ATOM 9458  O O   . LEU F 1 59  ? 23.327  85.489  41.210  1.00 9.56  ? 59  LEU F O   1 
ATOM 9459  C CB  . LEU F 1 59  ? 21.908  86.766  38.868  1.00 7.12  ? 59  LEU F CB  1 
ATOM 9460  C CG  . LEU F 1 59  ? 21.315  87.116  37.508  1.00 6.75  ? 59  LEU F CG  1 
ATOM 9461  C CD1 . LEU F 1 59  ? 19.958  87.747  37.696  1.00 9.28  ? 59  LEU F CD1 1 
ATOM 9462  C CD2 . LEU F 1 59  ? 22.233  88.066  36.770  1.00 8.41  ? 59  LEU F CD2 1 
ATOM 9463  N N   . PRO F 1 60  ? 24.938  86.849  40.410  1.00 8.56  ? 60  PRO F N   1 
ATOM 9464  C CA  . PRO F 1 60  ? 25.621  87.608  39.359  1.00 9.67  ? 60  PRO F CA  1 
ATOM 9465  C C   . PRO F 1 60  ? 26.735  86.822  38.666  1.00 8.80  ? 60  PRO F C   1 
ATOM 9466  O O   . PRO F 1 60  ? 27.066  85.699  39.056  1.00 9.62  ? 60  PRO F O   1 
ATOM 9467  C CB  . PRO F 1 60  ? 26.203  88.813  40.114  1.00 11.79 ? 60  PRO F CB  1 
ATOM 9468  C CG  . PRO F 1 60  ? 25.528  88.780  41.466  1.00 16.05 ? 60  PRO F CG  1 
ATOM 9469  C CD  . PRO F 1 60  ? 25.374  87.320  41.728  1.00 12.62 ? 60  PRO F CD  1 
ATOM 9470  N N   . TYR F 1 61  ? 27.349  87.458  37.676  1.00 6.42  ? 61  TYR F N   1 
ATOM 9471  C CA  . TYR F 1 61  ? 28.426  86.859  36.894  1.00 7.48  ? 61  TYR F CA  1 
ATOM 9472  C C   . TYR F 1 61  ? 29.248  87.978  36.245  1.00 6.80  ? 61  TYR F C   1 
ATOM 9473  O O   . TYR F 1 61  ? 28.757  89.137  36.143  1.00 10.23 ? 61  TYR F O   1 
ATOM 9474  C CB  . TYR F 1 61  ? 27.839  85.994  35.788  1.00 8.59  ? 61  TYR F CB  1 
ATOM 9475  C CG  . TYR F 1 61  ? 26.913  86.755  34.887  1.00 11.78 ? 61  TYR F CG  1 
ATOM 9476  C CD1 . TYR F 1 61  ? 27.413  87.446  33.764  1.00 12.81 ? 61  TYR F CD1 1 
ATOM 9477  C CD2 . TYR F 1 61  ? 25.554  86.881  35.184  1.00 12.27 ? 61  TYR F CD2 1 
ATOM 9478  C CE1 . TYR F 1 61  ? 26.557  88.220  32.962  1.00 9.29  ? 61  TYR F CE1 1 
ATOM 9479  C CE2 . TYR F 1 61  ? 24.704  87.648  34.390  1.00 12.66 ? 61  TYR F CE2 1 
ATOM 9480  C CZ  . TYR F 1 61  ? 25.210  88.315  33.283  1.00 8.84  ? 61  TYR F CZ  1 
ATOM 9481  O OH  . TYR F 1 61  ? 24.363  89.072  32.512  1.00 6.95  ? 61  TYR F OH  1 
ATOM 9482  N N   . LEU F 1 62  ? 30.439  87.655  35.793  1.00 6.73  ? 62  LEU F N   1 
ATOM 9483  C CA  . LEU F 1 62  ? 31.269  88.630  35.127  1.00 8.95  ? 62  LEU F CA  1 
ATOM 9484  C C   . LEU F 1 62  ? 32.026  88.052  33.953  1.00 13.89 ? 62  LEU F C   1 
ATOM 9485  O O   . LEU F 1 62  ? 32.586  86.955  34.031  1.00 13.40 ? 62  LEU F O   1 
ATOM 9486  C CB  . LEU F 1 62  ? 32.245  89.343  36.086  1.00 2.92  ? 62  LEU F CB  1 
ATOM 9487  C CG  . LEU F 1 62  ? 33.617  88.720  36.349  1.00 3.71  ? 62  LEU F CG  1 
ATOM 9488  C CD1 . LEU F 1 62  ? 34.590  89.756  36.881  1.00 3.93  ? 62  LEU F CD1 1 
ATOM 9489  C CD2 . LEU F 1 62  ? 33.465  87.569  37.313  1.00 8.97  ? 62  LEU F CD2 1 
ATOM 9490  N N   . ILE F 1 63  ? 32.021  88.800  32.861  1.00 14.97 ? 63  ILE F N   1 
ATOM 9491  C CA  . ILE F 1 63  ? 32.681  88.395  31.635  1.00 15.54 ? 63  ILE F CA  1 
ATOM 9492  C C   . ILE F 1 63  ? 33.959  89.208  31.469  1.00 15.41 ? 63  ILE F C   1 
ATOM 9493  O O   . ILE F 1 63  ? 33.910  90.380  31.085  1.00 15.02 ? 63  ILE F O   1 
ATOM 9494  C CB  . ILE F 1 63  ? 31.754  88.640  30.411  1.00 16.22 ? 63  ILE F CB  1 
ATOM 9495  C CG1 . ILE F 1 63  ? 30.385  87.982  30.636  1.00 16.73 ? 63  ILE F CG1 1 
ATOM 9496  C CG2 . ILE F 1 63  ? 32.415  88.148  29.129  1.00 15.71 ? 63  ILE F CG2 1 
ATOM 9497  C CD1 . ILE F 1 63  ? 30.438  86.505  30.955  1.00 8.39  ? 63  ILE F CD1 1 
ATOM 9498  N N   . ASP F 1 64  ? 35.087  88.616  31.845  1.00 15.92 ? 64  ASP F N   1 
ATOM 9499  C CA  . ASP F 1 64  ? 36.376  89.278  31.709  1.00 18.24 ? 64  ASP F CA  1 
ATOM 9500  C C   . ASP F 1 64  ? 37.088  88.581  30.566  1.00 19.40 ? 64  ASP F C   1 
ATOM 9501  O O   . ASP F 1 64  ? 37.885  87.649  30.784  1.00 19.35 ? 64  ASP F O   1 
ATOM 9502  C CB  . ASP F 1 64  ? 37.185  89.170  33.007  1.00 17.86 ? 64  ASP F CB  1 
ATOM 9503  C CG  . ASP F 1 64  ? 38.378  90.124  33.045  1.00 14.28 ? 64  ASP F CG  1 
ATOM 9504  O OD1 . ASP F 1 64  ? 39.343  89.932  32.273  1.00 10.23 ? 64  ASP F OD1 1 
ATOM 9505  O OD2 . ASP F 1 64  ? 38.354  91.064  33.865  1.00 9.81  ? 64  ASP F OD2 1 
ATOM 9506  N N   . GLY F 1 65  ? 36.817  89.012  29.343  1.00 17.35 ? 65  GLY F N   1 
ATOM 9507  C CA  . GLY F 1 65  ? 37.446  88.418  28.177  1.00 15.72 ? 65  GLY F CA  1 
ATOM 9508  C C   . GLY F 1 65  ? 36.915  87.017  27.971  1.00 17.60 ? 65  GLY F C   1 
ATOM 9509  O O   . GLY F 1 65  ? 35.760  86.837  27.594  1.00 19.29 ? 65  GLY F O   1 
ATOM 9510  N N   . ALA F 1 66  ? 37.761  86.040  28.222  1.00 16.92 ? 66  ALA F N   1 
ATOM 9511  C CA  . ALA F 1 66  ? 37.379  84.615  28.089  1.00 17.68 ? 66  ALA F CA  1 
ATOM 9512  C C   . ALA F 1 66  ? 36.912  84.086  29.454  1.00 20.52 ? 66  ALA F C   1 
ATOM 9513  O O   . ALA F 1 66  ? 36.459  82.947  29.585  1.00 19.58 ? 66  ALA F O   1 
ATOM 9514  C CB  . ALA F 1 66  ? 38.571  83.805  27.590  1.00 16.73 ? 66  ALA F CB  1 
ATOM 9515  N N   . HIS F 1 67  ? 37.037  84.934  30.472  1.00 21.56 ? 67  HIS F N   1 
ATOM 9516  C CA  . HIS F 1 67  ? 36.662  84.585  31.830  1.00 18.75 ? 67  HIS F CA  1 
ATOM 9517  C C   . HIS F 1 67  ? 35.188  84.831  32.062  1.00 19.43 ? 67  HIS F C   1 
ATOM 9518  O O   . HIS F 1 67  ? 34.720  85.965  31.986  1.00 20.67 ? 67  HIS F O   1 
ATOM 9519  C CB  . HIS F 1 67  ? 37.483  85.405  32.822  1.00 16.44 ? 67  HIS F CB  1 
ATOM 9520  C CG  . HIS F 1 67  ? 38.952  85.357  32.562  1.00 11.11 ? 67  HIS F CG  1 
ATOM 9521  N ND1 . HIS F 1 67  ? 39.706  86.488  32.331  1.00 11.39 ? 67  HIS F ND1 1 
ATOM 9522  C CD2 . HIS F 1 67  ? 39.803  84.310  32.447  1.00 10.17 ? 67  HIS F CD2 1 
ATOM 9523  C CE1 . HIS F 1 67  ? 40.955  86.142  32.082  1.00 10.70 ? 67  HIS F CE1 1 
ATOM 9524  N NE2 . HIS F 1 67  ? 41.042  84.824  32.144  1.00 8.43  ? 67  HIS F NE2 1 
ATOM 9525  N N   . LYS F 1 68  ? 34.467  83.756  32.348  1.00 18.78 ? 68  LYS F N   1 
ATOM 9526  C CA  . LYS F 1 68  ? 33.037  83.824  32.601  1.00 17.17 ? 68  LYS F CA  1 
ATOM 9527  C C   . LYS F 1 68  ? 32.809  83.213  33.978  1.00 15.98 ? 68  LYS F C   1 
ATOM 9528  O O   . LYS F 1 68  ? 32.588  82.011  34.108  1.00 17.25 ? 68  LYS F O   1 
ATOM 9529  C CB  . LYS F 1 68  ? 32.292  83.034  31.522  1.00 15.31 ? 68  LYS F CB  1 
ATOM 9530  C CG  . LYS F 1 68  ? 32.749  83.356  30.096  1.00 17.34 ? 68  LYS F CG  1 
ATOM 9531  C CD  . LYS F 1 68  ? 31.932  82.601  29.058  1.00 17.62 ? 68  LYS F CD  1 
ATOM 9532  C CE  . LYS F 1 68  ? 32.496  82.793  27.662  1.00 16.42 ? 68  LYS F CE  1 
ATOM 9533  N NZ  . LYS F 1 68  ? 32.543  84.221  27.247  1.00 14.91 ? 68  LYS F NZ  1 
ATOM 9534  N N   . ILE F 1 69  ? 32.892  84.052  35.004  1.00 19.03 ? 69  ILE F N   1 
ATOM 9535  C CA  . ILE F 1 69  ? 32.742  83.601  36.381  1.00 19.23 ? 69  ILE F CA  1 
ATOM 9536  C C   . ILE F 1 69  ? 31.385  83.939  36.986  1.00 15.88 ? 69  ILE F C   1 
ATOM 9537  O O   . ILE F 1 69  ? 30.842  85.024  36.760  1.00 15.86 ? 69  ILE F O   1 
ATOM 9538  C CB  . ILE F 1 69  ? 33.838  84.220  37.301  1.00 20.98 ? 69  ILE F CB  1 
ATOM 9539  C CG1 . ILE F 1 69  ? 35.223  84.093  36.663  1.00 23.92 ? 69  ILE F CG1 1 
ATOM 9540  C CG2 . ILE F 1 69  ? 33.839  83.553  38.674  1.00 19.55 ? 69  ILE F CG2 1 
ATOM 9541  C CD1 . ILE F 1 69  ? 35.558  85.179  35.673  1.00 17.42 ? 69  ILE F CD1 1 
ATOM 9542  N N   . THR F 1 70  ? 30.845  82.998  37.737  1.00 16.78 ? 70  THR F N   1 
ATOM 9543  C CA  . THR F 1 70  ? 29.577  83.172  38.450  1.00 14.30 ? 70  THR F CA  1 
ATOM 9544  C C   . THR F 1 70  ? 29.871  83.051  39.952  1.00 13.39 ? 70  THR F C   1 
ATOM 9545  O O   . THR F 1 70  ? 31.023  82.852  40.347  1.00 12.31 ? 70  THR F O   1 
ATOM 9546  C CB  . THR F 1 70  ? 28.532  82.105  38.021  1.00 12.19 ? 70  THR F CB  1 
ATOM 9547  O OG1 . THR F 1 70  ? 29.148  80.797  37.946  1.00 7.37  ? 70  THR F OG1 1 
ATOM 9548  C CG2 . THR F 1 70  ? 27.934  82.465  36.673  1.00 9.43  ? 70  THR F CG2 1 
ATOM 9549  N N   . GLN F 1 71  ? 28.838  83.167  40.780  1.00 13.28 ? 71  GLN F N   1 
ATOM 9550  C CA  . GLN F 1 71  ? 28.982  83.077  42.235  1.00 12.65 ? 71  GLN F CA  1 
ATOM 9551  C C   . GLN F 1 71  ? 29.731  84.254  42.834  1.00 13.18 ? 71  GLN F C   1 
ATOM 9552  O O   . GLN F 1 71  ? 30.941  84.396  42.653  1.00 11.99 ? 71  GLN F O   1 
ATOM 9553  C CB  . GLN F 1 71  ? 29.641  81.760  42.670  1.00 14.04 ? 71  GLN F CB  1 
ATOM 9554  C CG  . GLN F 1 71  ? 28.659  80.649  43.015  1.00 12.31 ? 71  GLN F CG  1 
ATOM 9555  C CD  . GLN F 1 71  ? 27.717  81.021  44.148  1.00 13.27 ? 71  GLN F CD  1 
ATOM 9556  O OE1 . GLN F 1 71  ? 27.146  82.110  44.162  1.00 13.55 ? 71  GLN F OE1 1 
ATOM 9557  N NE2 . GLN F 1 71  ? 27.543  80.114  45.099  1.00 12.19 ? 71  GLN F NE2 1 
ATOM 9558  N N   . SER F 1 72  ? 28.986  85.076  43.568  1.00 14.31 ? 72  SER F N   1 
ATOM 9559  C CA  . SER F 1 72  ? 29.493  86.275  44.233  1.00 15.10 ? 72  SER F CA  1 
ATOM 9560  C C   . SER F 1 72  ? 30.945  86.174  44.701  1.00 14.53 ? 72  SER F C   1 
ATOM 9561  O O   . SER F 1 72  ? 31.824  86.866  44.205  1.00 10.36 ? 72  SER F O   1 
ATOM 9562  C CB  . SER F 1 72  ? 28.590  86.600  45.423  1.00 16.16 ? 72  SER F CB  1 
ATOM 9563  O OG  . SER F 1 72  ? 28.288  85.402  46.158  1.00 15.07 ? 72  SER F OG  1 
ATOM 9564  N N   . ASN F 1 73  ? 31.189  85.237  45.631  1.00 13.93 ? 73  ASN F N   1 
ATOM 9565  C CA  . ASN F 1 73  ? 32.526  85.026  46.168  1.00 12.12 ? 73  ASN F CA  1 
ATOM 9566  C C   . ASN F 1 73  ? 33.557  84.806  45.077  1.00 12.05 ? 73  ASN F C   1 
ATOM 9567  O O   . ASN F 1 73  ? 34.538  85.537  45.005  1.00 15.91 ? 73  ASN F O   1 
ATOM 9568  C CB  . ASN F 1 73  ? 32.552  83.848  47.144  1.00 14.09 ? 73  ASN F CB  1 
ATOM 9569  C CG  . ASN F 1 73  ? 31.924  84.179  48.493  1.00 18.42 ? 73  ASN F CG  1 
ATOM 9570  O OD1 . ASN F 1 73  ? 31.717  85.351  48.832  1.00 17.08 ? 73  ASN F OD1 1 
ATOM 9571  N ND2 . ASN F 1 73  ? 31.626  83.143  49.275  1.00 11.44 ? 73  ASN F ND2 1 
ATOM 9572  N N   . ALA F 1 74  ? 33.322  83.823  44.211  1.00 11.99 ? 74  ALA F N   1 
ATOM 9573  C CA  . ALA F 1 74  ? 34.247  83.510  43.119  1.00 11.31 ? 74  ALA F CA  1 
ATOM 9574  C C   . ALA F 1 74  ? 34.594  84.756  42.309  1.00 11.72 ? 74  ALA F C   1 
ATOM 9575  O O   . ALA F 1 74  ? 35.759  84.940  41.893  1.00 10.93 ? 74  ALA F O   1 
ATOM 9576  C CB  . ALA F 1 74  ? 33.648  82.452  42.213  1.00 11.47 ? 74  ALA F CB  1 
ATOM 9577  N N   . ILE F 1 75  ? 33.592  85.604  42.095  1.00 12.58 ? 75  ILE F N   1 
ATOM 9578  C CA  . ILE F 1 75  ? 33.772  86.846  41.357  1.00 13.19 ? 75  ILE F CA  1 
ATOM 9579  C C   . ILE F 1 75  ? 34.686  87.736  42.191  1.00 14.75 ? 75  ILE F C   1 
ATOM 9580  O O   . ILE F 1 75  ? 35.695  88.250  41.692  1.00 17.80 ? 75  ILE F O   1 
ATOM 9581  C CB  . ILE F 1 75  ? 32.424  87.565  41.137  1.00 15.81 ? 75  ILE F CB  1 
ATOM 9582  C CG1 . ILE F 1 75  ? 31.476  86.668  40.341  1.00 15.86 ? 75  ILE F CG1 1 
ATOM 9583  C CG2 . ILE F 1 75  ? 32.638  88.884  40.409  1.00 15.04 ? 75  ILE F CG2 1 
ATOM 9584  C CD1 . ILE F 1 75  ? 30.059  87.189  40.265  1.00 12.61 ? 75  ILE F CD1 1 
ATOM 9585  N N   . LEU F 1 76  ? 34.356  87.851  43.477  1.00 15.91 ? 76  LEU F N   1 
ATOM 9586  C CA  . LEU F 1 76  ? 35.111  88.660  44.430  1.00 14.88 ? 76  LEU F CA  1 
ATOM 9587  C C   . LEU F 1 76  ? 36.603  88.348  44.420  1.00 14.47 ? 76  LEU F C   1 
ATOM 9588  O O   . LEU F 1 76  ? 37.428  89.233  44.187  1.00 13.95 ? 76  LEU F O   1 
ATOM 9589  C CB  . LEU F 1 76  ? 34.554  88.466  45.840  1.00 9.55  ? 76  LEU F CB  1 
ATOM 9590  C CG  . LEU F 1 76  ? 33.167  89.041  46.120  1.00 6.87  ? 76  LEU F CG  1 
ATOM 9591  C CD1 . LEU F 1 76  ? 32.593  88.426  47.382  1.00 5.11  ? 76  LEU F CD1 1 
ATOM 9592  C CD2 . LEU F 1 76  ? 33.250  90.554  46.239  1.00 2.14  ? 76  LEU F CD2 1 
ATOM 9593  N N   . CYS F 1 77  ? 36.952  87.093  44.669  1.00 10.61 ? 77  CYS F N   1 
ATOM 9594  C CA  . CYS F 1 77  ? 38.349  86.693  44.681  1.00 11.51 ? 77  CYS F CA  1 
ATOM 9595  C C   . CYS F 1 77  ? 39.042  87.054  43.378  1.00 12.34 ? 77  CYS F C   1 
ATOM 9596  O O   . CYS F 1 77  ? 40.156  87.568  43.389  1.00 9.70  ? 77  CYS F O   1 
ATOM 9597  C CB  . CYS F 1 77  ? 38.485  85.192  44.935  1.00 14.81 ? 77  CYS F CB  1 
ATOM 9598  S SG  . CYS F 1 77  ? 38.161  84.690  46.607  1.00 22.16 ? 77  CYS F SG  1 
ATOM 9599  N N   . TYR F 1 78  ? 38.366  86.831  42.259  1.00 13.99 ? 78  TYR F N   1 
ATOM 9600  C CA  . TYR F 1 78  ? 38.953  87.117  40.959  1.00 14.61 ? 78  TYR F CA  1 
ATOM 9601  C C   . TYR F 1 78  ? 39.518  88.535  40.820  1.00 11.67 ? 78  TYR F C   1 
ATOM 9602  O O   . TYR F 1 78  ? 40.688  88.712  40.457  1.00 6.47  ? 78  TYR F O   1 
ATOM 9603  C CB  . TYR F 1 78  ? 37.941  86.856  39.841  1.00 16.04 ? 78  TYR F CB  1 
ATOM 9604  C CG  . TYR F 1 78  ? 38.494  87.167  38.468  1.00 19.69 ? 78  TYR F CG  1 
ATOM 9605  C CD1 . TYR F 1 78  ? 39.512  86.370  37.918  1.00 21.70 ? 78  TYR F CD1 1 
ATOM 9606  C CD2 . TYR F 1 78  ? 38.040  88.277  37.742  1.00 19.24 ? 78  TYR F CD2 1 
ATOM 9607  C CE1 . TYR F 1 78  ? 40.075  86.704  36.689  1.00 21.24 ? 78  TYR F CE1 1 
ATOM 9608  C CE2 . TYR F 1 78  ? 38.604  88.603  36.510  1.00 19.56 ? 78  TYR F CE2 1 
ATOM 9609  C CZ  . TYR F 1 78  ? 39.618  87.811  35.992  1.00 20.92 ? 78  TYR F CZ  1 
ATOM 9610  O OH  . TYR F 1 78  ? 40.179  88.117  34.776  1.00 23.55 ? 78  TYR F OH  1 
ATOM 9611  N N   . ILE F 1 79  ? 38.678  89.530  41.104  1.00 11.14 ? 79  ILE F N   1 
ATOM 9612  C CA  . ILE F 1 79  ? 39.049  90.945  40.994  1.00 9.55  ? 79  ILE F CA  1 
ATOM 9613  C C   . ILE F 1 79  ? 40.111  91.363  42.020  1.00 8.17  ? 79  ILE F C   1 
ATOM 9614  O O   . ILE F 1 79  ? 40.973  92.197  41.732  1.00 12.19 ? 79  ILE F O   1 
ATOM 9615  C CB  . ILE F 1 79  ? 37.781  91.849  41.073  1.00 7.95  ? 79  ILE F CB  1 
ATOM 9616  C CG1 . ILE F 1 79  ? 37.816  92.919  39.986  1.00 10.36 ? 79  ILE F CG1 1 
ATOM 9617  C CG2 . ILE F 1 79  ? 37.633  92.496  42.402  1.00 11.87 ? 79  ILE F CG2 1 
ATOM 9618  C CD1 . ILE F 1 79  ? 37.512  92.397  38.606  1.00 7.85  ? 79  ILE F CD1 1 
ATOM 9619  N N   . ALA F 1 80  ? 40.055  90.763  43.204  1.00 7.59  ? 80  ALA F N   1 
ATOM 9620  C CA  . ALA F 1 80  ? 41.021  91.048  44.257  1.00 9.03  ? 80  ALA F CA  1 
ATOM 9621  C C   . ALA F 1 80  ? 42.348  90.376  43.912  1.00 10.07 ? 80  ALA F C   1 
ATOM 9622  O O   . ALA F 1 80  ? 43.406  90.819  44.360  1.00 8.25  ? 80  ALA F O   1 
ATOM 9623  C CB  . ALA F 1 80  ? 40.507  90.552  45.596  1.00 14.75 ? 80  ALA F CB  1 
ATOM 9624  N N   . ARG F 1 81  ? 42.299  89.306  43.122  1.00 10.89 ? 81  ARG F N   1 
ATOM 9625  C CA  . ARG F 1 81  ? 43.472  88.587  42.679  1.00 9.94  ? 81  ARG F CA  1 
ATOM 9626  C C   . ARG F 1 81  ? 44.364  89.539  41.909  1.00 9.72  ? 81  ARG F C   1 
ATOM 9627  O O   . ARG F 1 81  ? 45.546  89.713  42.239  1.00 13.77 ? 81  ARG F O   1 
ATOM 9628  C CB  . ARG F 1 81  ? 43.097  87.442  41.739  1.00 10.90 ? 81  ARG F CB  1 
ATOM 9629  C CG  . ARG F 1 81  ? 42.606  86.190  42.425  1.00 12.07 ? 81  ARG F CG  1 
ATOM 9630  C CD  . ARG F 1 81  ? 42.516  85.040  41.438  1.00 15.52 ? 81  ARG F CD  1 
ATOM 9631  N NE  . ARG F 1 81  ? 42.387  83.759  42.122  1.00 20.58 ? 81  ARG F NE  1 
ATOM 9632  C CZ  . ARG F 1 81  ? 41.250  83.294  42.628  1.00 21.58 ? 81  ARG F CZ  1 
ATOM 9633  N NH1 . ARG F 1 81  ? 40.133  83.999  42.513  1.00 19.45 ? 81  ARG F NH1 1 
ATOM 9634  N NH2 . ARG F 1 81  ? 41.242  82.150  43.302  1.00 23.18 ? 81  ARG F NH2 1 
ATOM 9635  N N   . LYS F 1 82  ? 43.766  90.248  40.963  1.00 11.83 ? 82  LYS F N   1 
ATOM 9636  C CA  . LYS F 1 82  ? 44.482  91.219  40.151  1.00 14.27 ? 82  LYS F CA  1 
ATOM 9637  C C   . LYS F 1 82  ? 44.795  92.526  40.885  1.00 17.75 ? 82  LYS F C   1 
ATOM 9638  O O   . LYS F 1 82  ? 45.121  93.537  40.262  1.00 19.42 ? 82  LYS F O   1 
ATOM 9639  C CB  . LYS F 1 82  ? 43.714  91.481  38.854  1.00 14.61 ? 82  LYS F CB  1 
ATOM 9640  C CG  . LYS F 1 82  ? 43.699  90.284  37.928  1.00 14.95 ? 82  LYS F CG  1 
ATOM 9641  C CD  . LYS F 1 82  ? 42.981  90.578  36.632  1.00 13.92 ? 82  LYS F CD  1 
ATOM 9642  C CE  . LYS F 1 82  ? 43.116  89.414  35.667  1.00 12.99 ? 82  LYS F CE  1 
ATOM 9643  N NZ  . LYS F 1 82  ? 42.538  89.704  34.327  1.00 12.92 ? 82  LYS F NZ  1 
ATOM 9644  N N   . HIS F 1 83  ? 44.686  92.508  42.193  1.00 19.78 ? 83  HIS F N   1 
ATOM 9645  C CA  . HIS F 1 83  ? 44.985  93.679  43.034  1.00 21.34 ? 83  HIS F CA  1 
ATOM 9646  C C   . HIS F 1 83  ? 45.583  93.262  44.384  1.00 19.93 ? 83  HIS F C   1 
ATOM 9647  O O   . HIS F 1 83  ? 45.760  94.109  45.283  1.00 17.68 ? 83  HIS F O   1 
ATOM 9648  C CB  . HIS F 1 83  ? 43.731  94.534  43.234  1.00 24.17 ? 83  HIS F CB  1 
ATOM 9649  C CG  . HIS F 1 83  ? 43.286  95.252  41.997  1.00 27.16 ? 83  HIS F CG  1 
ATOM 9650  N ND1 . HIS F 1 83  ? 44.169  95.848  41.121  1.00 29.84 ? 83  HIS F ND1 1 
ATOM 9651  C CD2 . HIS F 1 83  ? 42.051  95.488  41.499  1.00 29.40 ? 83  HIS F CD2 1 
ATOM 9652  C CE1 . HIS F 1 83  ? 43.496  96.426  40.141  1.00 29.83 ? 83  HIS F CE1 1 
ATOM 9653  N NE2 . HIS F 1 83  ? 42.208  96.222  40.348  1.00 31.58 ? 83  HIS F NE2 1 
ATOM 9654  N N   . ASN F 1 84  ? 45.884  91.967  44.508  1.00 19.06 ? 84  ASN F N   1 
ATOM 9655  C CA  . ASN F 1 84  ? 46.479  91.375  45.707  1.00 18.37 ? 84  ASN F CA  1 
ATOM 9656  C C   . ASN F 1 84  ? 45.678  91.597  46.986  1.00 16.67 ? 84  ASN F C   1 
ATOM 9657  O O   . ASN F 1 84  ? 46.172  91.366  48.085  1.00 16.60 ? 84  ASN F O   1 
ATOM 9658  C CB  . ASN F 1 84  ? 47.910  91.887  45.891  1.00 19.05 ? 84  ASN F CB  1 
ATOM 9659  C CG  . ASN F 1 84  ? 48.936  90.766  45.925  1.00 15.75 ? 84  ASN F CG  1 
ATOM 9660  O OD1 . ASN F 1 84  ? 49.689  90.626  46.884  1.00 11.22 ? 84  ASN F OD1 1 
ATOM 9661  N ND2 . ASN F 1 84  ? 48.991  89.983  44.857  1.00 19.46 ? 84  ASN F ND2 1 
ATOM 9662  N N   . LEU F 1 85  ? 44.412  91.960  46.834  1.00 15.28 ? 85  LEU F N   1 
ATOM 9663  C CA  . LEU F 1 85  ? 43.539  92.222  47.972  1.00 11.68 ? 85  LEU F CA  1 
ATOM 9664  C C   . LEU F 1 85  ? 43.072  90.928  48.624  1.00 14.12 ? 85  LEU F C   1 
ATOM 9665  O O   . LEU F 1 85  ? 41.892  90.827  49.023  1.00 15.96 ? 85  LEU F O   1 
ATOM 9666  C CB  . LEU F 1 85  ? 42.340  93.069  47.525  1.00 8.53  ? 85  LEU F CB  1 
ATOM 9667  C CG  . LEU F 1 85  ? 42.655  94.463  46.966  1.00 8.37  ? 85  LEU F CG  1 
ATOM 9668  C CD1 . LEU F 1 85  ? 41.451  95.025  46.237  1.00 5.96  ? 85  LEU F CD1 1 
ATOM 9669  C CD2 . LEU F 1 85  ? 43.097  95.410  48.078  1.00 7.21  ? 85  LEU F CD2 1 
ATOM 9670  N N   . CYS F 1 86  ? 43.943  89.941  48.715  1.00 10.18 ? 86  CYS F N   1 
ATOM 9671  C CA  . CYS F 1 86  ? 43.629  88.648  49.324  1.00 12.01 ? 86  CYS F CA  1 
ATOM 9672  C C   . CYS F 1 86  ? 44.558  88.429  50.524  1.00 12.34 ? 86  CYS F C   1 
ATOM 9673  O O   . CYS F 1 86  ? 45.110  89.388  51.062  1.00 12.51 ? 86  CYS F O   1 
ATOM 9674  C CB  . CYS F 1 86  ? 43.787  87.509  48.301  1.00 15.89 ? 86  CYS F CB  1 
ATOM 9675  S SG  . CYS F 1 86  ? 42.357  87.218  47.186  1.00 20.17 ? 86  CYS F SG  1 
ATOM 9676  N N   . GLY F 1 87  ? 44.708  87.183  50.962  1.00 14.39 ? 87  GLY F N   1 
ATOM 9677  C CA  . GLY F 1 87  ? 45.582  86.906  52.087  1.00 13.89 ? 87  GLY F CA  1 
ATOM 9678  C C   . GLY F 1 87  ? 47.040  86.865  51.665  1.00 13.08 ? 87  GLY F C   1 
ATOM 9679  O O   . GLY F 1 87  ? 47.348  86.570  50.510  1.00 13.84 ? 87  GLY F O   1 
ATOM 9680  N N   . GLU F 1 88  ? 47.932  87.221  52.587  1.00 13.12 ? 88  GLU F N   1 
ATOM 9681  C CA  . GLU F 1 88  ? 49.370  87.198  52.327  1.00 13.20 ? 88  GLU F CA  1 
ATOM 9682  C C   . GLU F 1 88  ? 50.005  86.101  53.176  1.00 13.67 ? 88  GLU F C   1 
ATOM 9683  O O   . GLU F 1 88  ? 50.591  85.152  52.658  1.00 14.75 ? 88  GLU F O   1 
ATOM 9684  C CB  . GLU F 1 88  ? 50.023  88.548  52.660  1.00 14.26 ? 88  GLU F CB  1 
ATOM 9685  C CG  . GLU F 1 88  ? 50.087  89.551  51.506  1.00 15.34 ? 88  GLU F CG  1 
ATOM 9686  C CD  . GLU F 1 88  ? 50.731  90.879  51.906  1.00 17.31 ? 88  GLU F CD  1 
ATOM 9687  O OE1 . GLU F 1 88  ? 50.245  91.514  52.868  1.00 13.07 ? 88  GLU F OE1 1 
ATOM 9688  O OE2 . GLU F 1 88  ? 51.720  91.291  51.257  1.00 15.44 ? 88  GLU F OE2 1 
ATOM 9689  N N   . THR F 1 89  ? 49.886  86.243  54.489  1.00 14.07 ? 89  THR F N   1 
ATOM 9690  C CA  . THR F 1 89  ? 50.445  85.268  55.410  1.00 15.64 ? 89  THR F CA  1 
ATOM 9691  C C   . THR F 1 89  ? 49.317  84.324  55.782  1.00 15.10 ? 89  THR F C   1 
ATOM 9692  O O   . THR F 1 89  ? 48.156  84.755  55.796  1.00 12.67 ? 89  THR F O   1 
ATOM 9693  C CB  . THR F 1 89  ? 51.015  85.968  56.670  1.00 15.44 ? 89  THR F CB  1 
ATOM 9694  O OG1 . THR F 1 89  ? 49.950  86.539  57.441  1.00 17.25 ? 89  THR F OG1 1 
ATOM 9695  C CG2 . THR F 1 89  ? 51.981  87.083  56.268  1.00 13.88 ? 89  THR F CG2 1 
ATOM 9696  N N   . GLU F 1 90  ? 49.643  83.064  56.099  1.00 16.87 ? 90  GLU F N   1 
ATOM 9697  C CA  . GLU F 1 90  ? 48.629  82.081  56.494  1.00 16.21 ? 90  GLU F CA  1 
ATOM 9698  C C   . GLU F 1 90  ? 47.720  82.647  57.579  1.00 15.55 ? 90  GLU F C   1 
ATOM 9699  O O   . GLU F 1 90  ? 46.550  82.286  57.672  1.00 16.41 ? 90  GLU F O   1 
ATOM 9700  C CB  . GLU F 1 90  ? 49.271  80.791  56.982  1.00 16.22 ? 90  GLU F CB  1 
ATOM 9701  C CG  . GLU F 1 90  ? 48.258  79.702  57.401  1.00 18.81 ? 90  GLU F CG  1 
ATOM 9702  C CD  . GLU F 1 90  ? 48.296  78.435  56.534  1.00 18.86 ? 90  GLU F CD  1 
ATOM 9703  O OE1 . GLU F 1 90  ? 48.708  78.511  55.354  1.00 17.16 ? 90  GLU F OE1 1 
ATOM 9704  O OE2 . GLU F 1 90  ? 47.902  77.340  57.036  1.00 19.29 ? 90  GLU F OE2 1 
ATOM 9705  N N   . GLU F 1 91  ? 48.265  83.565  58.379  1.00 16.77 ? 91  GLU F N   1 
ATOM 9706  C CA  . GLU F 1 91  ? 47.510  84.221  59.440  1.00 17.62 ? 91  GLU F CA  1 
ATOM 9707  C C   . GLU F 1 91  ? 46.441  85.099  58.830  1.00 15.39 ? 91  GLU F C   1 
ATOM 9708  O O   . GLU F 1 91  ? 45.335  85.141  59.316  1.00 16.06 ? 91  GLU F O   1 
ATOM 9709  C CB  . GLU F 1 91  ? 48.418  85.094  60.303  1.00 20.29 ? 91  GLU F CB  1 
ATOM 9710  C CG  . GLU F 1 91  ? 49.257  84.351  61.317  1.00 23.96 ? 91  GLU F CG  1 
ATOM 9711  C CD  . GLU F 1 91  ? 49.857  85.291  62.346  1.00 25.53 ? 91  GLU F CD  1 
ATOM 9712  O OE1 . GLU F 1 91  ? 49.193  85.554  63.376  1.00 26.48 ? 91  GLU F OE1 1 
ATOM 9713  O OE2 . GLU F 1 91  ? 50.989  85.771  62.121  1.00 20.03 ? 91  GLU F OE2 1 
ATOM 9714  N N   . GLU F 1 92  ? 46.809  85.816  57.774  1.00 15.34 ? 92  GLU F N   1 
ATOM 9715  C CA  . GLU F 1 92  ? 45.878  86.697  57.081  1.00 14.92 ? 92  GLU F CA  1 
ATOM 9716  C C   . GLU F 1 92  ? 44.918  85.902  56.186  1.00 16.99 ? 92  GLU F C   1 
ATOM 9717  O O   . GLU F 1 92  ? 43.772  86.311  55.972  1.00 14.84 ? 92  GLU F O   1 
ATOM 9718  C CB  . GLU F 1 92  ? 46.652  87.759  56.289  1.00 15.32 ? 92  GLU F CB  1 
ATOM 9719  C CG  . GLU F 1 92  ? 47.519  88.664  57.182  1.00 19.69 ? 92  GLU F CG  1 
ATOM 9720  C CD  . GLU F 1 92  ? 48.190  89.814  56.438  1.00 19.43 ? 92  GLU F CD  1 
ATOM 9721  O OE1 . GLU F 1 92  ? 48.917  89.567  55.449  1.00 21.18 ? 92  GLU F OE1 1 
ATOM 9722  O OE2 . GLU F 1 92  ? 48.007  90.974  56.865  1.00 17.32 ? 92  GLU F OE2 1 
ATOM 9723  N N   . LYS F 1 93  ? 45.382  84.751  55.700  1.00 16.30 ? 93  LYS F N   1 
ATOM 9724  C CA  . LYS F 1 93  ? 44.582  83.862  54.852  1.00 11.76 ? 93  LYS F CA  1 
ATOM 9725  C C   . LYS F 1 93  ? 43.397  83.320  55.624  1.00 13.11 ? 93  LYS F C   1 
ATOM 9726  O O   . LYS F 1 93  ? 42.256  83.410  55.173  1.00 15.52 ? 93  LYS F O   1 
ATOM 9727  C CB  . LYS F 1 93  ? 45.412  82.672  54.373  1.00 8.15  ? 93  LYS F CB  1 
ATOM 9728  C CG  . LYS F 1 93  ? 46.379  83.013  53.277  1.00 7.89  ? 93  LYS F CG  1 
ATOM 9729  C CD  . LYS F 1 93  ? 47.445  81.961  53.147  1.00 4.10  ? 93  LYS F CD  1 
ATOM 9730  C CE  . LYS F 1 93  ? 48.526  82.450  52.219  1.00 5.39  ? 93  LYS F CE  1 
ATOM 9731  N NZ  . LYS F 1 93  ? 49.775  81.669  52.378  1.00 9.77  ? 93  LYS F NZ  1 
ATOM 9732  N N   . ILE F 1 94  ? 43.672  82.740  56.785  1.00 13.36 ? 94  ILE F N   1 
ATOM 9733  C CA  . ILE F 1 94  ? 42.615  82.176  57.608  1.00 14.55 ? 94  ILE F CA  1 
ATOM 9734  C C   . ILE F 1 94  ? 41.530  83.208  57.900  1.00 15.29 ? 94  ILE F C   1 
ATOM 9735  O O   . ILE F 1 94  ? 40.346  82.931  57.722  1.00 15.70 ? 94  ILE F O   1 
ATOM 9736  C CB  . ILE F 1 94  ? 43.161  81.589  58.927  1.00 14.77 ? 94  ILE F CB  1 
ATOM 9737  C CG1 . ILE F 1 94  ? 44.183  80.494  58.621  1.00 11.46 ? 94  ILE F CG1 1 
ATOM 9738  C CG2 . ILE F 1 94  ? 42.029  80.975  59.738  1.00 12.10 ? 94  ILE F CG2 1 
ATOM 9739  C CD1 . ILE F 1 94  ? 44.874  79.941  59.848  1.00 8.12  ? 94  ILE F CD1 1 
ATOM 9740  N N   . ARG F 1 95  ? 41.928  84.409  58.304  1.00 14.91 ? 95  ARG F N   1 
ATOM 9741  C CA  . ARG F 1 95  ? 40.953  85.454  58.602  1.00 18.50 ? 95  ARG F CA  1 
ATOM 9742  C C   . ARG F 1 95  ? 40.065  85.620  57.374  1.00 16.81 ? 95  ARG F C   1 
ATOM 9743  O O   . ARG F 1 95  ? 38.838  85.687  57.482  1.00 16.34 ? 95  ARG F O   1 
ATOM 9744  C CB  . ARG F 1 95  ? 41.648  86.782  58.930  1.00 16.29 ? 95  ARG F CB  1 
ATOM 9745  C CG  . ARG F 1 95  ? 42.949  86.636  59.686  1.00 11.26 ? 95  ARG F CG  1 
ATOM 9746  C CD  . ARG F 1 95  ? 43.341  87.843  60.471  1.00 14.19 ? 95  ARG F CD  1 
ATOM 9747  N NE  . ARG F 1 95  ? 42.949  87.692  61.866  1.00 14.61 ? 95  ARG F NE  1 
ATOM 9748  C CZ  . ARG F 1 95  ? 41.851  88.218  62.398  1.00 14.86 ? 95  ARG F CZ  1 
ATOM 9749  N NH1 . ARG F 1 95  ? 41.030  88.943  61.653  1.00 14.31 ? 95  ARG F NH1 1 
ATOM 9750  N NH2 . ARG F 1 95  ? 41.568  88.005  63.678  1.00 13.18 ? 95  ARG F NH2 1 
ATOM 9751  N N   . VAL F 1 96  ? 40.697  85.619  56.204  1.00 15.08 ? 96  VAL F N   1 
ATOM 9752  C CA  . VAL F 1 96  ? 39.996  85.761  54.934  1.00 14.79 ? 96  VAL F CA  1 
ATOM 9753  C C   . VAL F 1 96  ? 38.980  84.638  54.730  1.00 13.51 ? 96  VAL F C   1 
ATOM 9754  O O   . VAL F 1 96  ? 37.830  84.907  54.454  1.00 9.65  ? 96  VAL F O   1 
ATOM 9755  C CB  . VAL F 1 96  ? 40.999  85.813  53.757  1.00 14.32 ? 96  VAL F CB  1 
ATOM 9756  C CG1 . VAL F 1 96  ? 40.288  85.634  52.425  1.00 14.95 ? 96  VAL F CG1 1 
ATOM 9757  C CG2 . VAL F 1 96  ? 41.752  87.139  53.783  1.00 16.73 ? 96  VAL F CG2 1 
ATOM 9758  N N   . ASP F 1 97  ? 39.410  83.390  54.890  1.00 11.64 ? 97  ASP F N   1 
ATOM 9759  C CA  . ASP F 1 97  ? 38.520  82.237  54.730  1.00 12.40 ? 97  ASP F CA  1 
ATOM 9760  C C   . ASP F 1 97  ? 37.322  82.338  55.667  1.00 14.55 ? 97  ASP F C   1 
ATOM 9761  O O   . ASP F 1 97  ? 36.168  82.363  55.233  1.00 14.99 ? 97  ASP F O   1 
ATOM 9762  C CB  . ASP F 1 97  ? 39.251  80.926  55.053  1.00 9.94  ? 97  ASP F CB  1 
ATOM 9763  C CG  . ASP F 1 97  ? 40.202  80.488  53.962  1.00 10.55 ? 97  ASP F CG  1 
ATOM 9764  O OD1 . ASP F 1 97  ? 40.386  81.218  52.966  1.00 16.70 ? 97  ASP F OD1 1 
ATOM 9765  O OD2 . ASP F 1 97  ? 40.774  79.396  54.108  1.00 3.23  ? 97  ASP F OD2 1 
ATOM 9766  N N   . ILE F 1 98  ? 37.621  82.365  56.960  1.00 15.08 ? 98  ILE F N   1 
ATOM 9767  C CA  . ILE F 1 98  ? 36.614  82.445  58.005  1.00 11.99 ? 98  ILE F CA  1 
ATOM 9768  C C   . ILE F 1 98  ? 35.640  83.593  57.775  1.00 12.01 ? 98  ILE F C   1 
ATOM 9769  O O   . ILE F 1 98  ? 34.432  83.373  57.663  1.00 7.03  ? 98  ILE F O   1 
ATOM 9770  C CB  . ILE F 1 98  ? 37.288  82.573  59.390  1.00 9.91  ? 98  ILE F CB  1 
ATOM 9771  C CG1 . ILE F 1 98  ? 37.953  81.241  59.752  1.00 8.24  ? 98  ILE F CG1 1 
ATOM 9772  C CG2 . ILE F 1 98  ? 36.280  82.996  60.453  1.00 7.69  ? 98  ILE F CG2 1 
ATOM 9773  C CD1 . ILE F 1 98  ? 38.578  81.197  61.134  1.00 7.87  ? 98  ILE F CD1 1 
ATOM 9774  N N   . LEU F 1 99  ? 36.167  84.809  57.666  1.00 12.32 ? 99  LEU F N   1 
ATOM 9775  C CA  . LEU F 1 99  ? 35.323  85.974  57.453  1.00 13.94 ? 99  LEU F CA  1 
ATOM 9776  C C   . LEU F 1 99  ? 34.525  85.802  56.166  1.00 16.01 ? 99  LEU F C   1 
ATOM 9777  O O   . LEU F 1 99  ? 33.315  85.928  56.202  1.00 15.65 ? 99  LEU F O   1 
ATOM 9778  C CB  . LEU F 1 99  ? 36.164  87.259  57.428  1.00 13.45 ? 99  LEU F CB  1 
ATOM 9779  C CG  . LEU F 1 99  ? 35.559  88.529  58.046  1.00 10.02 ? 99  LEU F CG  1 
ATOM 9780  C CD1 . LEU F 1 99  ? 34.901  89.396  56.998  1.00 8.42  ? 99  LEU F CD1 1 
ATOM 9781  C CD2 . LEU F 1 99  ? 34.583  88.172  59.155  1.00 14.20 ? 99  LEU F CD2 1 
ATOM 9782  N N   . GLU F 1 100 ? 35.185  85.412  55.088  1.00 19.18 ? 100 GLU F N   1 
ATOM 9783  C CA  . GLU F 1 100 ? 34.568  85.210  53.783  1.00 19.94 ? 100 GLU F CA  1 
ATOM 9784  C C   . GLU F 1 100 ? 33.206  84.541  53.917  1.00 17.88 ? 100 GLU F C   1 
ATOM 9785  O O   . GLU F 1 100 ? 32.172  85.168  53.688  1.00 17.75 ? 100 GLU F O   1 
ATOM 9786  C CB  . GLU F 1 100 ? 35.461  84.350  52.871  1.00 22.13 ? 100 GLU F CB  1 
ATOM 9787  C CG  . GLU F 1 100 ? 34.924  84.152  51.445  1.00 25.80 ? 100 GLU F CG  1 
ATOM 9788  C CD  . GLU F 1 100 ? 35.705  83.116  50.622  1.00 27.86 ? 100 GLU F CD  1 
ATOM 9789  O OE1 . GLU F 1 100 ? 36.954  83.080  50.696  1.00 26.12 ? 100 GLU F OE1 1 
ATOM 9790  O OE2 . GLU F 1 100 ? 35.055  82.342  49.881  1.00 25.67 ? 100 GLU F OE2 1 
ATOM 9791  N N   . ASN F 1 101 ? 33.208  83.305  54.364  1.00 17.48 ? 101 ASN F N   1 
ATOM 9792  C CA  . ASN F 1 101 ? 31.970  82.525  54.531  1.00 18.44 ? 101 ASN F CA  1 
ATOM 9793  C C   . ASN F 1 101 ? 31.069  83.084  55.605  1.00 20.06 ? 101 ASN F C   1 
ATOM 9794  O O   . ASN F 1 101 ? 29.845  83.016  55.499  1.00 25.18 ? 101 ASN F O   1 
ATOM 9795  C CB  . ASN F 1 101 ? 32.260  81.056  54.825  1.00 15.14 ? 101 ASN F CB  1 
ATOM 9796  C CG  . ASN F 1 101 ? 33.314  80.439  53.910  1.00 16.68 ? 101 ASN F CG  1 
ATOM 9797  O OD1 . ASN F 1 101 ? 33.787  79.337  54.179  1.00 17.31 ? 101 ASN F OD1 1 
ATOM 9798  N ND2 . ASN F 1 101 ? 33.683  81.116  52.835  1.00 9.68  ? 101 ASN F ND2 1 
ATOM 9799  N N   . GLN F 1 102 ? 31.672  83.653  56.642  1.00 19.65 ? 102 GLN F N   1 
ATOM 9800  C CA  . GLN F 1 102 ? 30.910  84.212  57.750  1.00 15.80 ? 102 GLN F CA  1 
ATOM 9801  C C   . GLN F 1 102 ? 30.089  85.413  57.321  1.00 15.98 ? 102 GLN F C   1 
ATOM 9802  O O   . GLN F 1 102 ? 28.900  85.512  57.681  1.00 18.59 ? 102 GLN F O   1 
ATOM 9803  C CB  . GLN F 1 102 ? 31.836  84.580  58.910  1.00 13.15 ? 102 GLN F CB  1 
ATOM 9804  C CG  . GLN F 1 102 ? 31.213  84.360  60.288  1.00 7.07  ? 102 GLN F CG  1 
ATOM 9805  C CD  . GLN F 1 102 ? 30.899  82.892  60.584  1.00 2.50  ? 102 GLN F CD  1 
ATOM 9806  O OE1 . GLN F 1 102 ? 31.493  81.984  60.007  1.00 3.04  ? 102 GLN F OE1 1 
ATOM 9807  N NE2 . GLN F 1 102 ? 29.962  82.662  61.493  1.00 2.00  ? 102 GLN F NE2 1 
ATOM 9808  N N   . ALA F 1 103 ? 30.663  86.296  56.520  1.00 17.19 ? 103 ALA F N   1 
ATOM 9809  C CA  . ALA F 1 103 ? 29.969  87.480  56.021  1.00 15.33 ? 103 ALA F CA  1 
ATOM 9810  C C   . ALA F 1 103 ? 28.766  87.010  55.221  1.00 14.40 ? 103 ALA F C   1 
ATOM 9811  O O   . ALA F 1 103 ? 27.667  87.554  55.358  1.00 12.06 ? 103 ALA F O   1 
ATOM 9812  C CB  . ALA F 1 103 ? 30.891  88.308  55.141  1.00 12.50 ? 103 ALA F CB  1 
ATOM 9813  N N   . MET F 1 104 ? 28.977  85.971  54.417  1.00 15.31 ? 104 MET F N   1 
ATOM 9814  C CA  . MET F 1 104 ? 27.919  85.389  53.600  1.00 16.66 ? 104 MET F CA  1 
ATOM 9815  C C   . MET F 1 104 ? 26.756  84.886  54.450  1.00 14.36 ? 104 MET F C   1 
ATOM 9816  O O   . MET F 1 104 ? 25.611  85.305  54.229  1.00 14.59 ? 104 MET F O   1 
ATOM 9817  C CB  . MET F 1 104 ? 28.465  84.239  52.758  1.00 16.98 ? 104 MET F CB  1 
ATOM 9818  C CG  . MET F 1 104 ? 29.106  84.681  51.458  1.00 25.27 ? 104 MET F CG  1 
ATOM 9819  S SD  . MET F 1 104 ? 28.019  84.426  50.043  1.00 23.63 ? 104 MET F SD  1 
ATOM 9820  C CE  . MET F 1 104 ? 26.943  85.836  50.139  1.00 31.53 ? 104 MET F CE  1 
ATOM 9821  N N   . ASP F 1 105 ? 27.051  84.074  55.446  1.00 10.70 ? 105 ASP F N   1 
ATOM 9822  C CA  . ASP F 1 105 ? 26.019  83.541  56.329  1.00 11.07 ? 105 ASP F CA  1 
ATOM 9823  C C   . ASP F 1 105 ? 25.131  84.601  56.972  1.00 12.24 ? 105 ASP F C   1 
ATOM 9824  O O   . ASP F 1 105 ? 23.923  84.402  57.086  1.00 11.04 ? 105 ASP F O   1 
ATOM 9825  C CB  . ASP F 1 105 ? 26.631  82.659  57.415  1.00 10.64 ? 105 ASP F CB  1 
ATOM 9826  C CG  . ASP F 1 105 ? 26.569  81.189  57.072  1.00 7.91  ? 105 ASP F CG  1 
ATOM 9827  O OD1 . ASP F 1 105 ? 25.473  80.601  57.189  1.00 7.92  ? 105 ASP F OD1 1 
ATOM 9828  O OD2 . ASP F 1 105 ? 27.610  80.623  56.679  1.00 9.41  ? 105 ASP F OD2 1 
ATOM 9829  N N   . VAL F 1 106 ? 25.712  85.735  57.355  1.00 13.67 ? 106 VAL F N   1 
ATOM 9830  C CA  . VAL F 1 106 ? 24.934  86.801  57.987  1.00 14.82 ? 106 VAL F CA  1 
ATOM 9831  C C   . VAL F 1 106 ? 23.959  87.436  57.006  1.00 17.78 ? 106 VAL F C   1 
ATOM 9832  O O   . VAL F 1 106 ? 22.910  87.952  57.409  1.00 15.82 ? 106 VAL F O   1 
ATOM 9833  C CB  . VAL F 1 106 ? 25.810  87.918  58.591  1.00 9.68  ? 106 VAL F CB  1 
ATOM 9834  C CG1 . VAL F 1 106 ? 25.161  88.448  59.857  1.00 8.79  ? 106 VAL F CG1 1 
ATOM 9835  C CG2 . VAL F 1 106 ? 27.197  87.427  58.873  1.00 9.05  ? 106 VAL F CG2 1 
ATOM 9836  N N   . SER F 1 107 ? 24.326  87.426  55.728  1.00 17.33 ? 107 SER F N   1 
ATOM 9837  C CA  . SER F 1 107 ? 23.474  87.977  54.680  1.00 19.57 ? 107 SER F CA  1 
ATOM 9838  C C   . SER F 1 107 ? 22.424  86.939  54.310  1.00 21.11 ? 107 SER F C   1 
ATOM 9839  O O   . SER F 1 107 ? 21.272  87.279  54.042  1.00 20.83 ? 107 SER F O   1 
ATOM 9840  C CB  . SER F 1 107 ? 24.298  88.350  53.446  1.00 20.91 ? 107 SER F CB  1 
ATOM 9841  O OG  . SER F 1 107 ? 25.246  89.360  53.742  1.00 24.25 ? 107 SER F OG  1 
ATOM 9842  N N   . ASN F 1 108 ? 22.832  85.673  54.303  1.00 19.15 ? 108 ASN F N   1 
ATOM 9843  C CA  . ASN F 1 108 ? 21.927  84.573  53.987  1.00 19.35 ? 108 ASN F CA  1 
ATOM 9844  C C   . ASN F 1 108 ? 20.799  84.565  55.003  1.00 20.76 ? 108 ASN F C   1 
ATOM 9845  O O   . ASN F 1 108 ? 19.638  84.741  54.652  1.00 21.27 ? 108 ASN F O   1 
ATOM 9846  C CB  . ASN F 1 108 ? 22.652  83.215  54.043  1.00 20.18 ? 108 ASN F CB  1 
ATOM 9847  C CG  . ASN F 1 108 ? 23.250  82.790  52.700  1.00 17.70 ? 108 ASN F CG  1 
ATOM 9848  O OD1 . ASN F 1 108 ? 24.016  81.825  52.637  1.00 10.95 ? 108 ASN F OD1 1 
ATOM 9849  N ND2 . ASN F 1 108 ? 22.889  83.489  51.626  1.00 19.47 ? 108 ASN F ND2 1 
ATOM 9850  N N   . GLN F 1 109 ? 21.161  84.410  56.271  1.00 22.94 ? 109 GLN F N   1 
ATOM 9851  C CA  . GLN F 1 109 ? 20.198  84.368  57.362  1.00 23.39 ? 109 GLN F CA  1 
ATOM 9852  C C   . GLN F 1 109 ? 19.201  85.521  57.344  1.00 22.33 ? 109 GLN F C   1 
ATOM 9853  O O   . GLN F 1 109 ? 18.007  85.301  57.579  1.00 23.63 ? 109 GLN F O   1 
ATOM 9854  C CB  . GLN F 1 109 ? 20.934  84.324  58.696  1.00 24.62 ? 109 GLN F CB  1 
ATOM 9855  C CG  . GLN F 1 109 ? 21.661  83.022  58.935  1.00 23.72 ? 109 GLN F CG  1 
ATOM 9856  C CD  . GLN F 1 109 ? 22.934  83.204  59.725  1.00 26.51 ? 109 GLN F CD  1 
ATOM 9857  O OE1 . GLN F 1 109 ? 23.089  84.177  60.463  1.00 26.85 ? 109 GLN F OE1 1 
ATOM 9858  N NE2 . GLN F 1 109 ? 23.865  82.275  59.561  1.00 27.50 ? 109 GLN F NE2 1 
ATOM 9859  N N   . LEU F 1 110 ? 19.683  86.730  57.064  1.00 20.60 ? 110 LEU F N   1 
ATOM 9860  C CA  . LEU F 1 110 ? 18.811  87.897  57.013  1.00 19.64 ? 110 LEU F CA  1 
ATOM 9861  C C   . LEU F 1 110 ? 17.933  87.865  55.772  1.00 22.36 ? 110 LEU F C   1 
ATOM 9862  O O   . LEU F 1 110 ? 16.746  88.194  55.826  1.00 23.02 ? 110 LEU F O   1 
ATOM 9863  C CB  . LEU F 1 110 ? 19.622  89.189  57.043  1.00 15.97 ? 110 LEU F CB  1 
ATOM 9864  C CG  . LEU F 1 110 ? 18.768  90.458  57.032  1.00 15.19 ? 110 LEU F CG  1 
ATOM 9865  C CD1 . LEU F 1 110 ? 17.763  90.437  58.170  1.00 16.63 ? 110 LEU F CD1 1 
ATOM 9866  C CD2 . LEU F 1 110 ? 19.651  91.671  57.135  1.00 14.62 ? 110 LEU F CD2 1 
ATOM 9867  N N   . ALA F 1 111 ? 18.522  87.468  54.651  1.00 22.12 ? 111 ALA F N   1 
ATOM 9868  C CA  . ALA F 1 111 ? 17.782  87.381  53.406  1.00 19.36 ? 111 ALA F CA  1 
ATOM 9869  C C   . ALA F 1 111 ? 16.595  86.460  53.623  1.00 20.16 ? 111 ALA F C   1 
ATOM 9870  O O   . ALA F 1 111 ? 15.467  86.816  53.305  1.00 21.81 ? 111 ALA F O   1 
ATOM 9871  C CB  . ALA F 1 111 ? 18.669  86.855  52.291  1.00 15.92 ? 111 ALA F CB  1 
ATOM 9872  N N   . ARG F 1 112 ? 16.826  85.305  54.232  1.00 20.86 ? 112 ARG F N   1 
ATOM 9873  C CA  . ARG F 1 112 ? 15.781  84.344  54.503  1.00 20.76 ? 112 ARG F CA  1 
ATOM 9874  C C   . ARG F 1 112 ? 14.659  85.001  55.290  1.00 21.31 ? 112 ARG F C   1 
ATOM 9875  O O   . ARG F 1 112 ? 13.491  84.864  54.939  1.00 22.17 ? 112 ARG F O   1 
ATOM 9876  C CB  . ARG F 1 112 ? 16.329  83.126  55.250  1.00 20.99 ? 112 ARG F CB  1 
ATOM 9877  C CG  . ARG F 1 112 ? 17.300  82.303  54.413  1.00 25.44 ? 112 ARG F CG  1 
ATOM 9878  C CD  . ARG F 1 112 ? 17.819  81.086  55.146  1.00 26.85 ? 112 ARG F CD  1 
ATOM 9879  N NE  . ARG F 1 112 ? 19.025  80.573  54.502  1.00 34.51 ? 112 ARG F NE  1 
ATOM 9880  C CZ  . ARG F 1 112 ? 20.190  80.420  55.124  1.00 37.21 ? 112 ARG F CZ  1 
ATOM 9881  N NH1 . ARG F 1 112 ? 20.303  80.732  56.406  1.00 38.70 ? 112 ARG F NH1 1 
ATOM 9882  N NH2 . ARG F 1 112 ? 21.252  79.985  54.461  1.00 36.37 ? 112 ARG F NH2 1 
ATOM 9883  N N   . VAL F 1 113 ? 15.019  85.767  56.298  1.00 21.90 ? 113 VAL F N   1 
ATOM 9884  C CA  . VAL F 1 113 ? 14.031  86.460  57.137  1.00 21.66 ? 113 VAL F CA  1 
ATOM 9885  C C   . VAL F 1 113 ? 13.269  87.486  56.317  1.00 22.04 ? 113 VAL F C   1 
ATOM 9886  O O   . VAL F 1 113 ? 12.081  87.710  56.536  1.00 22.58 ? 113 VAL F O   1 
ATOM 9887  C CB  . VAL F 1 113 ? 14.677  87.153  58.347  1.00 20.72 ? 113 VAL F CB  1 
ATOM 9888  C CG1 . VAL F 1 113 ? 13.644  87.973  59.105  1.00 20.56 ? 113 VAL F CG1 1 
ATOM 9889  C CG2 . VAL F 1 113 ? 15.292  86.113  59.268  1.00 18.82 ? 113 VAL F CG2 1 
ATOM 9890  N N   . CYS F 1 114 ? 13.952  88.117  55.376  1.00 21.54 ? 114 CYS F N   1 
ATOM 9891  C CA  . CYS F 1 114 ? 13.288  89.092  54.524  1.00 22.97 ? 114 CYS F CA  1 
ATOM 9892  C C   . CYS F 1 114 ? 12.524  88.407  53.380  1.00 23.40 ? 114 CYS F C   1 
ATOM 9893  O O   . CYS F 1 114 ? 11.828  89.066  52.608  1.00 23.60 ? 114 CYS F O   1 
ATOM 9894  C CB  . CYS F 1 114 ? 14.289  90.124  53.995  1.00 23.62 ? 114 CYS F CB  1 
ATOM 9895  S SG  . CYS F 1 114 ? 14.752  91.395  55.217  1.00 22.28 ? 114 CYS F SG  1 
ATOM 9896  N N   . TYR F 1 115 ? 12.650  87.084  53.284  1.00 22.85 ? 115 TYR F N   1 
ATOM 9897  C CA  . TYR F 1 115 ? 11.960  86.303  52.254  1.00 25.18 ? 115 TYR F CA  1 
ATOM 9898  C C   . TYR F 1 115 ? 10.886  85.375  52.825  1.00 26.47 ? 115 TYR F C   1 
ATOM 9899  O O   . TYR F 1 115 ? 10.173  84.706  52.075  1.00 26.98 ? 115 TYR F O   1 
ATOM 9900  C CB  . TYR F 1 115 ? 12.950  85.487  51.418  1.00 26.54 ? 115 TYR F CB  1 
ATOM 9901  C CG  . TYR F 1 115 ? 13.625  86.279  50.321  1.00 30.00 ? 115 TYR F CG  1 
ATOM 9902  C CD1 . TYR F 1 115 ? 12.879  87.033  49.416  1.00 30.30 ? 115 TYR F CD1 1 
ATOM 9903  C CD2 . TYR F 1 115 ? 15.013  86.288  50.196  1.00 33.43 ? 115 TYR F CD2 1 
ATOM 9904  C CE1 . TYR F 1 115 ? 13.500  87.779  48.418  1.00 32.93 ? 115 TYR F CE1 1 
ATOM 9905  C CE2 . TYR F 1 115 ? 15.642  87.032  49.202  1.00 33.50 ? 115 TYR F CE2 1 
ATOM 9906  C CZ  . TYR F 1 115 ? 14.881  87.776  48.319  1.00 34.51 ? 115 TYR F CZ  1 
ATOM 9907  O OH  . TYR F 1 115 ? 15.501  88.533  47.352  1.00 32.76 ? 115 TYR F OH  1 
ATOM 9908  N N   . SER F 1 116 ? 10.799  85.294  54.147  1.00 23.87 ? 116 SER F N   1 
ATOM 9909  C CA  . SER F 1 116 ? 9.791   84.458  54.783  1.00 22.82 ? 116 SER F CA  1 
ATOM 9910  C C   . SER F 1 116 ? 8.524   85.287  54.910  1.00 23.44 ? 116 SER F C   1 
ATOM 9911  O O   . SER F 1 116 ? 8.540   86.361  55.514  1.00 19.88 ? 116 SER F O   1 
ATOM 9912  C CB  . SER F 1 116 ? 10.254  83.999  56.167  1.00 26.72 ? 116 SER F CB  1 
ATOM 9913  O OG  . SER F 1 116 ? 9.221   83.311  56.854  1.00 26.28 ? 116 SER F OG  1 
ATOM 9914  N N   . PRO F 1 117 ? 7.396   84.784  54.379  1.00 25.30 ? 117 PRO F N   1 
ATOM 9915  C CA  . PRO F 1 117 ? 6.124   85.513  54.448  1.00 23.73 ? 117 PRO F CA  1 
ATOM 9916  C C   . PRO F 1 117 ? 5.720   85.833  55.882  1.00 25.13 ? 117 PRO F C   1 
ATOM 9917  O O   . PRO F 1 117 ? 5.066   86.843  56.147  1.00 25.26 ? 117 PRO F O   1 
ATOM 9918  C CB  . PRO F 1 117 ? 5.140   84.547  53.780  1.00 24.51 ? 117 PRO F CB  1 
ATOM 9919  C CG  . PRO F 1 117 ? 5.736   83.191  54.066  1.00 22.74 ? 117 PRO F CG  1 
ATOM 9920  C CD  . PRO F 1 117 ? 7.201   83.442  53.797  1.00 25.30 ? 117 PRO F CD  1 
ATOM 9921  N N   . ASP F 1 118 ? 6.132   84.967  56.802  1.00 27.13 ? 118 ASP F N   1 
ATOM 9922  C CA  . ASP F 1 118 ? 5.823   85.136  58.212  1.00 30.14 ? 118 ASP F CA  1 
ATOM 9923  C C   . ASP F 1 118 ? 6.424   86.441  58.723  1.00 31.48 ? 118 ASP F C   1 
ATOM 9924  O O   . ASP F 1 118 ? 5.835   87.096  59.593  1.00 30.93 ? 118 ASP F O   1 
ATOM 9925  C CB  . ASP F 1 118 ? 6.388   83.958  59.015  1.00 35.08 ? 118 ASP F CB  1 
ATOM 9926  C CG  . ASP F 1 118 ? 5.909   82.611  58.497  1.00 40.08 ? 118 ASP F CG  1 
ATOM 9927  O OD1 . ASP F 1 118 ? 6.551   82.063  57.575  1.00 41.24 ? 118 ASP F OD1 1 
ATOM 9928  O OD2 . ASP F 1 118 ? 4.891   82.100  59.011  1.00 38.74 ? 118 ASP F OD2 1 
ATOM 9929  N N   . PHE F 1 119 ? 7.570   86.811  58.152  1.00 29.64 ? 119 PHE F N   1 
ATOM 9930  C CA  . PHE F 1 119 ? 8.317   88.012  58.514  1.00 26.78 ? 119 PHE F CA  1 
ATOM 9931  C C   . PHE F 1 119 ? 8.150   88.436  59.965  1.00 26.50 ? 119 PHE F C   1 
ATOM 9932  O O   . PHE F 1 119 ? 8.946   88.054  60.826  1.00 26.04 ? 119 PHE F O   1 
ATOM 9933  C CB  . PHE F 1 119 ? 7.983   89.188  57.595  1.00 24.87 ? 119 PHE F CB  1 
ATOM 9934  C CG  . PHE F 1 119 ? 8.752   90.439  57.924  1.00 26.46 ? 119 PHE F CG  1 
ATOM 9935  C CD1 . PHE F 1 119 ? 10.132  90.388  58.089  1.00 27.64 ? 119 PHE F CD1 1 
ATOM 9936  C CD2 . PHE F 1 119 ? 8.099   91.656  58.102  1.00 27.33 ? 119 PHE F CD2 1 
ATOM 9937  C CE1 . PHE F 1 119 ? 10.850  91.538  58.432  1.00 26.18 ? 119 PHE F CE1 1 
ATOM 9938  C CE2 . PHE F 1 119 ? 8.810   92.828  58.447  1.00 24.75 ? 119 PHE F CE2 1 
ATOM 9939  C CZ  . PHE F 1 119 ? 10.186  92.767  58.611  1.00 24.37 ? 119 PHE F CZ  1 
ATOM 9940  N N   . GLU F 1 120 ? 7.079   89.176  60.233  1.00 23.53 ? 120 GLU F N   1 
ATOM 9941  C CA  . GLU F 1 120 ? 6.788   89.686  61.566  1.00 25.76 ? 120 GLU F CA  1 
ATOM 9942  C C   . GLU F 1 120 ? 6.943   88.665  62.706  1.00 26.02 ? 120 GLU F C   1 
ATOM 9943  O O   . GLU F 1 120 ? 7.185   89.052  63.852  1.00 24.26 ? 120 GLU F O   1 
ATOM 9944  C CB  . GLU F 1 120 ? 5.382   90.304  61.591  1.00 25.31 ? 120 GLU F CB  1 
ATOM 9945  C CG  . GLU F 1 120 ? 5.177   91.509  60.654  1.00 24.04 ? 120 GLU F CG  1 
ATOM 9946  C CD  . GLU F 1 120 ? 5.883   92.789  61.109  1.00 25.99 ? 120 GLU F CD  1 
ATOM 9947  O OE1 . GLU F 1 120 ? 6.426   92.846  62.235  1.00 24.09 ? 120 GLU F OE1 1 
ATOM 9948  O OE2 . GLU F 1 120 ? 5.884   93.770  60.330  1.00 23.33 ? 120 GLU F OE2 1 
ATOM 9949  N N   . LYS F 1 121 ? 6.818   87.375  62.397  1.00 27.15 ? 121 LYS F N   1 
ATOM 9950  C CA  . LYS F 1 121 ? 6.950   86.329  63.414  1.00 27.60 ? 121 LYS F CA  1 
ATOM 9951  C C   . LYS F 1 121 ? 8.401   85.996  63.761  1.00 28.80 ? 121 LYS F C   1 
ATOM 9952  O O   . LYS F 1 121 ? 8.779   85.952  64.931  1.00 29.39 ? 121 LYS F O   1 
ATOM 9953  C CB  . LYS F 1 121 ? 6.236   85.053  62.968  1.00 29.12 ? 121 LYS F CB  1 
ATOM 9954  C CG  . LYS F 1 121 ? 5.238   84.517  63.982  1.00 29.81 ? 121 LYS F CG  1 
ATOM 9955  C CD  . LYS F 1 121 ? 3.991   85.388  64.047  1.00 30.71 ? 121 LYS F CD  1 
ATOM 9956  C CE  . LYS F 1 121 ? 3.063   84.967  65.179  1.00 28.75 ? 121 LYS F CE  1 
ATOM 9957  N NZ  . LYS F 1 121 ? 2.617   83.554  65.065  1.00 25.68 ? 121 LYS F NZ  1 
ATOM 9958  N N   . LEU F 1 122 ? 9.213   85.753  62.740  1.00 30.73 ? 122 LEU F N   1 
ATOM 9959  C CA  . LEU F 1 122 ? 10.614  85.412  62.961  1.00 28.10 ? 122 LEU F CA  1 
ATOM 9960  C C   . LEU F 1 122 ? 11.562  86.611  63.038  1.00 25.70 ? 122 LEU F C   1 
ATOM 9961  O O   . LEU F 1 122 ? 12.693  86.484  63.516  1.00 26.26 ? 122 LEU F O   1 
ATOM 9962  C CB  . LEU F 1 122 ? 11.103  84.402  61.917  1.00 28.62 ? 122 LEU F CB  1 
ATOM 9963  C CG  . LEU F 1 122 ? 10.211  84.044  60.726  1.00 31.84 ? 122 LEU F CG  1 
ATOM 9964  C CD1 . LEU F 1 122 ? 10.085  85.222  59.781  1.00 30.55 ? 122 LEU F CD1 1 
ATOM 9965  C CD2 . LEU F 1 122 ? 10.807  82.847  60.003  1.00 32.94 ? 122 LEU F CD2 1 
ATOM 9966  N N   . LYS F 1 123 ? 11.095  87.778  62.599  1.00 23.45 ? 123 LYS F N   1 
ATOM 9967  C CA  . LYS F 1 123 ? 11.910  88.990  62.627  1.00 24.02 ? 123 LYS F CA  1 
ATOM 9968  C C   . LYS F 1 123 ? 12.351  89.366  64.048  1.00 24.79 ? 123 LYS F C   1 
ATOM 9969  O O   . LYS F 1 123 ? 13.543  89.568  64.290  1.00 24.72 ? 123 LYS F O   1 
ATOM 9970  C CB  . LYS F 1 123 ? 11.164  90.143  61.947  1.00 21.61 ? 123 LYS F CB  1 
ATOM 9971  C CG  . LYS F 1 123 ? 11.945  91.442  61.817  1.00 14.42 ? 123 LYS F CG  1 
ATOM 9972  C CD  . LYS F 1 123 ? 11.682  92.381  62.987  1.00 13.25 ? 123 LYS F CD  1 
ATOM 9973  C CE  . LYS F 1 123 ? 11.406  93.798  62.508  1.00 12.01 ? 123 LYS F CE  1 
ATOM 9974  N NZ  . LYS F 1 123 ? 10.156  93.856  61.693  1.00 8.95  ? 123 LYS F NZ  1 
ATOM 9975  N N   . PRO F 1 124 ? 11.405  89.445  65.010  1.00 27.24 ? 124 PRO F N   1 
ATOM 9976  C CA  . PRO F 1 124 ? 11.766  89.797  66.389  1.00 28.01 ? 124 PRO F CA  1 
ATOM 9977  C C   . PRO F 1 124 ? 12.704  88.792  67.063  1.00 30.12 ? 124 PRO F C   1 
ATOM 9978  O O   . PRO F 1 124 ? 13.572  89.187  67.848  1.00 30.25 ? 124 PRO F O   1 
ATOM 9979  C CB  . PRO F 1 124 ? 10.408  89.885  67.093  1.00 26.87 ? 124 PRO F CB  1 
ATOM 9980  C CG  . PRO F 1 124 ? 9.551   88.946  66.310  1.00 28.05 ? 124 PRO F CG  1 
ATOM 9981  C CD  . PRO F 1 124 ? 9.945   89.280  64.911  1.00 29.31 ? 124 PRO F CD  1 
ATOM 9982  N N   . GLU F 1 125 ? 12.531  87.500  66.779  1.00 29.99 ? 125 GLU F N   1 
ATOM 9983  C CA  . GLU F 1 125 ? 13.421  86.508  67.368  1.00 29.53 ? 125 GLU F CA  1 
ATOM 9984  C C   . GLU F 1 125 ? 14.814  86.665  66.765  1.00 29.32 ? 125 GLU F C   1 
ATOM 9985  O O   . GLU F 1 125 ? 15.816  86.430  67.439  1.00 31.70 ? 125 GLU F O   1 
ATOM 9986  C CB  . GLU F 1 125 ? 12.874  85.083  67.223  1.00 31.14 ? 125 GLU F CB  1 
ATOM 9987  C CG  . GLU F 1 125 ? 12.462  84.665  65.830  1.00 32.34 ? 125 GLU F CG  1 
ATOM 9988  C CD  . GLU F 1 125 ? 11.680  83.363  65.820  1.00 30.03 ? 125 GLU F CD  1 
ATOM 9989  O OE1 . GLU F 1 125 ? 12.313  82.289  65.782  1.00 21.39 ? 125 GLU F OE1 1 
ATOM 9990  O OE2 . GLU F 1 125 ? 10.432  83.413  65.853  1.00 29.65 ? 125 GLU F OE2 1 
ATOM 9991  N N   . TYR F 1 126 ? 14.870  87.137  65.521  1.00 27.30 ? 126 TYR F N   1 
ATOM 9992  C CA  . TYR F 1 126 ? 16.144  87.372  64.848  1.00 27.33 ? 126 TYR F CA  1 
ATOM 9993  C C   . TYR F 1 126 ? 16.902  88.444  65.614  1.00 27.11 ? 126 TYR F C   1 
ATOM 9994  O O   . TYR F 1 126 ? 18.100  88.306  65.877  1.00 29.25 ? 126 TYR F O   1 
ATOM 9995  C CB  . TYR F 1 126 ? 15.928  87.846  63.409  1.00 24.69 ? 126 TYR F CB  1 
ATOM 9996  C CG  . TYR F 1 126 ? 17.216  88.121  62.664  1.00 22.51 ? 126 TYR F CG  1 
ATOM 9997  C CD1 . TYR F 1 126 ? 18.267  87.202  62.692  1.00 23.61 ? 126 TYR F CD1 1 
ATOM 9998  C CD2 . TYR F 1 126 ? 17.383  89.294  61.935  1.00 21.36 ? 126 TYR F CD2 1 
ATOM 9999  C CE1 . TYR F 1 126 ? 19.463  87.446  62.009  1.00 24.55 ? 126 TYR F CE1 1 
ATOM 10000 C CE2 . TYR F 1 126 ? 18.583  89.548  61.251  1.00 22.23 ? 126 TYR F CE2 1 
ATOM 10001 C CZ  . TYR F 1 126 ? 19.616  88.619  61.292  1.00 22.37 ? 126 TYR F CZ  1 
ATOM 10002 O OH  . TYR F 1 126 ? 20.801  88.851  60.621  1.00 22.47 ? 126 TYR F OH  1 
ATOM 10003 N N   . LEU F 1 127 ? 16.192  89.507  65.980  1.00 26.84 ? 127 LEU F N   1 
ATOM 10004 C CA  . LEU F 1 127 ? 16.779  90.615  66.730  1.00 24.43 ? 127 LEU F CA  1 
ATOM 10005 C C   . LEU F 1 127 ? 17.333  90.157  68.080  1.00 24.18 ? 127 LEU F C   1 
ATOM 10006 O O   . LEU F 1 127 ? 18.101  90.881  68.716  1.00 22.98 ? 127 LEU F O   1 
ATOM 10007 C CB  . LEU F 1 127 ? 15.753  91.733  66.946  1.00 20.61 ? 127 LEU F CB  1 
ATOM 10008 C CG  . LEU F 1 127 ? 15.233  92.488  65.718  1.00 19.08 ? 127 LEU F CG  1 
ATOM 10009 C CD1 . LEU F 1 127 ? 14.200  93.528  66.141  1.00 14.44 ? 127 LEU F CD1 1 
ATOM 10010 C CD2 . LEU F 1 127 ? 16.386  93.148  64.975  1.00 17.12 ? 127 LEU F CD2 1 
ATOM 10011 N N   . GLU F 1 128 ? 16.939  88.960  68.514  1.00 26.15 ? 128 GLU F N   1 
ATOM 10012 C CA  . GLU F 1 128 ? 17.414  88.406  69.778  1.00 27.36 ? 128 GLU F CA  1 
ATOM 10013 C C   . GLU F 1 128 ? 18.886  88.008  69.682  1.00 28.29 ? 128 GLU F C   1 
ATOM 10014 O O   . GLU F 1 128 ? 19.707  88.483  70.468  1.00 28.82 ? 128 GLU F O   1 
ATOM 10015 C CB  . GLU F 1 128 ? 16.556  87.206  70.210  1.00 24.33 ? 128 GLU F CB  1 
ATOM 10016 C CG  . GLU F 1 128 ? 15.099  87.562  70.531  1.00 24.93 ? 128 GLU F CG  1 
ATOM 10017 C CD  . GLU F 1 128 ? 14.286  86.382  71.051  1.00 27.05 ? 128 GLU F CD  1 
ATOM 10018 O OE1 . GLU F 1 128 ? 14.862  85.519  71.744  1.00 25.53 ? 128 GLU F OE1 1 
ATOM 10019 O OE2 . GLU F 1 128 ? 13.066  86.322  70.779  1.00 26.19 ? 128 GLU F OE2 1 
ATOM 10020 N N   . GLU F 1 129 ? 19.229  87.170  68.703  1.00 28.50 ? 129 GLU F N   1 
ATOM 10021 C CA  . GLU F 1 129 ? 20.618  86.725  68.540  1.00 26.97 ? 129 GLU F CA  1 
ATOM 10022 C C   . GLU F 1 129 ? 21.469  87.687  67.728  1.00 23.21 ? 129 GLU F C   1 
ATOM 10023 O O   . GLU F 1 129 ? 22.696  87.611  67.753  1.00 21.78 ? 129 GLU F O   1 
ATOM 10024 C CB  . GLU F 1 129 ? 20.705  85.346  67.881  1.00 26.88 ? 129 GLU F CB  1 
ATOM 10025 C CG  . GLU F 1 129 ? 19.701  84.329  68.363  1.00 26.57 ? 129 GLU F CG  1 
ATOM 10026 C CD  . GLU F 1 129 ? 18.466  84.283  67.491  1.00 26.62 ? 129 GLU F CD  1 
ATOM 10027 O OE1 . GLU F 1 129 ? 18.564  84.629  66.294  1.00 24.52 ? 129 GLU F OE1 1 
ATOM 10028 O OE2 . GLU F 1 129 ? 17.395  83.896  67.999  1.00 26.87 ? 129 GLU F OE2 1 
ATOM 10029 N N   . LEU F 1 130 ? 20.822  88.580  66.992  1.00 21.90 ? 130 LEU F N   1 
ATOM 10030 C CA  . LEU F 1 130 ? 21.540  89.542  66.169  1.00 20.91 ? 130 LEU F CA  1 
ATOM 10031 C C   . LEU F 1 130 ? 22.703  90.223  66.901  1.00 22.10 ? 130 LEU F C   1 
ATOM 10032 O O   . LEU F 1 130 ? 23.836  90.184  66.421  1.00 21.56 ? 130 LEU F O   1 
ATOM 10033 C CB  . LEU F 1 130 ? 20.559  90.560  65.578  1.00 15.94 ? 130 LEU F CB  1 
ATOM 10034 C CG  . LEU F 1 130 ? 21.102  91.596  64.597  1.00 13.60 ? 130 LEU F CG  1 
ATOM 10035 C CD1 . LEU F 1 130 ? 20.008  91.996  63.618  1.00 12.20 ? 130 LEU F CD1 1 
ATOM 10036 C CD2 . LEU F 1 130 ? 21.637  92.800  65.347  1.00 7.46  ? 130 LEU F CD2 1 
ATOM 10037 N N   . PRO F 1 131 ? 22.448  90.831  68.075  1.00 22.76 ? 131 PRO F N   1 
ATOM 10038 C CA  . PRO F 1 131 ? 23.511  91.501  68.832  1.00 24.54 ? 131 PRO F CA  1 
ATOM 10039 C C   . PRO F 1 131 ? 24.727  90.630  69.173  1.00 26.48 ? 131 PRO F C   1 
ATOM 10040 O O   . PRO F 1 131 ? 25.862  91.045  68.935  1.00 27.21 ? 131 PRO F O   1 
ATOM 10041 C CB  . PRO F 1 131 ? 22.781  91.963  70.095  1.00 23.46 ? 131 PRO F CB  1 
ATOM 10042 C CG  . PRO F 1 131 ? 21.424  92.280  69.575  1.00 20.96 ? 131 PRO F CG  1 
ATOM 10043 C CD  . PRO F 1 131 ? 21.142  91.067  68.734  1.00 21.10 ? 131 PRO F CD  1 
ATOM 10044 N N   . THR F 1 132 ? 24.506  89.431  69.712  1.00 24.38 ? 132 THR F N   1 
ATOM 10045 C CA  . THR F 1 132 ? 25.632  88.564  70.064  1.00 24.23 ? 132 THR F CA  1 
ATOM 10046 C C   . THR F 1 132 ? 26.401  88.190  68.797  1.00 27.48 ? 132 THR F C   1 
ATOM 10047 O O   . THR F 1 132 ? 27.651  88.039  68.823  1.00 29.31 ? 132 THR F O   1 
ATOM 10048 C CB  . THR F 1 132 ? 25.195  87.283  70.850  1.00 22.93 ? 132 THR F CB  1 
ATOM 10049 O OG1 . THR F 1 132 ? 24.928  86.186  69.945  1.00 18.46 ? 132 THR F OG1 1 
ATOM 10050 C CG2 . THR F 1 132 ? 23.955  87.558  71.690  1.00 21.53 ? 132 THR F CG2 1 
ATOM 10051 N N   . MET F 1 133 ? 25.673  88.066  67.687  1.00 28.90 ? 133 MET F N   1 
ATOM 10052 C CA  . MET F 1 133 ? 26.286  87.740  66.405  1.00 27.85 ? 133 MET F CA  1 
ATOM 10053 C C   . MET F 1 133 ? 27.244  88.873  66.061  1.00 27.65 ? 133 MET F C   1 
ATOM 10054 O O   . MET F 1 133 ? 28.387  88.631  65.666  1.00 29.02 ? 133 MET F O   1 
ATOM 10055 C CB  . MET F 1 133 ? 25.224  87.549  65.310  1.00 26.41 ? 133 MET F CB  1 
ATOM 10056 C CG  . MET F 1 133 ? 24.320  86.331  65.550  1.00 25.77 ? 133 MET F CG  1 
ATOM 10057 S SD  . MET F 1 133 ? 23.337  85.699  64.131  1.00 24.45 ? 133 MET F SD  1 
ATOM 10058 C CE  . MET F 1 133 ? 21.705  86.260  64.550  1.00 27.61 ? 133 MET F CE  1 
ATOM 10059 N N   . MET F 1 134 ? 26.809  90.103  66.315  1.00 25.99 ? 134 MET F N   1 
ATOM 10060 C CA  . MET F 1 134 ? 27.623  91.287  66.058  1.00 25.08 ? 134 MET F CA  1 
ATOM 10061 C C   . MET F 1 134 ? 28.735  91.446  67.087  1.00 24.52 ? 134 MET F C   1 
ATOM 10062 O O   . MET F 1 134 ? 29.792  92.020  66.801  1.00 23.23 ? 134 MET F O   1 
ATOM 10063 C CB  . MET F 1 134 ? 26.757  92.540  66.044  1.00 27.32 ? 134 MET F CB  1 
ATOM 10064 C CG  . MET F 1 134 ? 26.095  92.819  64.718  1.00 29.62 ? 134 MET F CG  1 
ATOM 10065 S SD  . MET F 1 134 ? 25.521  94.500  64.727  1.00 33.54 ? 134 MET F SD  1 
ATOM 10066 C CE  . MET F 1 134 ? 26.941  95.321  65.308  1.00 25.24 ? 134 MET F CE  1 
ATOM 10067 N N   . GLN F 1 135 ? 28.488  90.930  68.286  1.00 24.96 ? 135 GLN F N   1 
ATOM 10068 C CA  . GLN F 1 135 ? 29.457  90.977  69.371  1.00 24.18 ? 135 GLN F CA  1 
ATOM 10069 C C   . GLN F 1 135 ? 30.721  90.293  68.866  1.00 24.57 ? 135 GLN F C   1 
ATOM 10070 O O   . GLN F 1 135 ? 31.830  90.817  68.994  1.00 24.09 ? 135 GLN F O   1 
ATOM 10071 C CB  . GLN F 1 135 ? 28.888  90.225  70.581  1.00 23.37 ? 135 GLN F CB  1 
ATOM 10072 C CG  . GLN F 1 135 ? 29.715  90.265  71.850  1.00 25.94 ? 135 GLN F CG  1 
ATOM 10073 C CD  . GLN F 1 135 ? 28.978  89.659  73.038  1.00 23.97 ? 135 GLN F CD  1 
ATOM 10074 O OE1 . GLN F 1 135 ? 28.232  88.693  72.892  1.00 22.84 ? 135 GLN F OE1 1 
ATOM 10075 N NE2 . GLN F 1 135 ? 29.181  90.231  74.216  1.00 24.01 ? 135 GLN F NE2 1 
ATOM 10076 N N   . HIS F 1 136 ? 30.514  89.166  68.197  1.00 23.99 ? 136 HIS F N   1 
ATOM 10077 C CA  . HIS F 1 136 ? 31.597  88.366  67.650  1.00 22.74 ? 136 HIS F CA  1 
ATOM 10078 C C   . HIS F 1 136 ? 32.342  89.049  66.526  1.00 21.20 ? 136 HIS F C   1 
ATOM 10079 O O   . HIS F 1 136 ? 33.555  88.828  66.363  1.00 22.18 ? 136 HIS F O   1 
ATOM 10080 C CB  . HIS F 1 136 ? 31.053  87.020  67.207  1.00 24.08 ? 136 HIS F CB  1 
ATOM 10081 C CG  . HIS F 1 136 ? 30.227  86.352  68.255  1.00 24.41 ? 136 HIS F CG  1 
ATOM 10082 N ND1 . HIS F 1 136 ? 29.031  85.727  67.985  1.00 25.26 ? 136 HIS F ND1 1 
ATOM 10083 C CD2 . HIS F 1 136 ? 30.402  86.264  69.597  1.00 26.80 ? 136 HIS F CD2 1 
ATOM 10084 C CE1 . HIS F 1 136 ? 28.503  85.283  69.110  1.00 29.81 ? 136 HIS F CE1 1 
ATOM 10085 N NE2 . HIS F 1 136 ? 29.313  85.599  70.103  1.00 31.73 ? 136 HIS F NE2 1 
ATOM 10086 N N   . PHE F 1 137 ? 31.679  89.881  65.749  1.00 18.96 ? 137 PHE F N   1 
ATOM 10087 C CA  . PHE F 1 137 ? 32.359  90.604  64.679  1.00 20.26 ? 137 PHE F CA  1 
ATOM 10088 C C   . PHE F 1 137 ? 33.215  91.708  65.293  1.00 19.60 ? 137 PHE F C   1 
ATOM 10089 O O   . PHE F 1 137 ? 34.350  91.935  64.861  1.00 20.19 ? 137 PHE F O   1 
ATOM 10090 C CB  . PHE F 1 137 ? 31.360  91.194  63.676  1.00 20.16 ? 137 PHE F CB  1 
ATOM 10091 C CG  . PHE F 1 137 ? 30.915  90.220  62.619  1.00 18.17 ? 137 PHE F CG  1 
ATOM 10092 C CD1 . PHE F 1 137 ? 29.947  89.264  62.896  1.00 14.76 ? 137 PHE F CD1 1 
ATOM 10093 C CD2 . PHE F 1 137 ? 31.474  90.258  61.347  1.00 18.26 ? 137 PHE F CD2 1 
ATOM 10094 C CE1 . PHE F 1 137 ? 29.546  88.365  61.928  1.00 15.99 ? 137 PHE F CE1 1 
ATOM 10095 C CE2 . PHE F 1 137 ? 31.078  89.358  60.367  1.00 16.15 ? 137 PHE F CE2 1 
ATOM 10096 C CZ  . PHE F 1 137 ? 30.113  88.410  60.657  1.00 14.81 ? 137 PHE F CZ  1 
ATOM 10097 N N   . SER F 1 138 ? 32.682  92.364  66.323  1.00 18.78 ? 138 SER F N   1 
ATOM 10098 C CA  . SER F 1 138 ? 33.404  93.436  67.001  1.00 18.65 ? 138 SER F CA  1 
ATOM 10099 C C   . SER F 1 138 ? 34.750  92.909  67.501  1.00 21.31 ? 138 SER F C   1 
ATOM 10100 O O   . SER F 1 138 ? 35.792  93.505  67.241  1.00 18.98 ? 138 SER F O   1 
ATOM 10101 C CB  . SER F 1 138 ? 32.583  93.989  68.170  1.00 15.67 ? 138 SER F CB  1 
ATOM 10102 O OG  . SER F 1 138 ? 33.122  95.228  68.656  1.00 8.74  ? 138 SER F OG  1 
ATOM 10103 N N   . GLN F 1 139 ? 34.734  91.772  68.189  1.00 21.65 ? 139 GLN F N   1 
ATOM 10104 C CA  . GLN F 1 139 ? 35.968  91.185  68.694  1.00 21.85 ? 139 GLN F CA  1 
ATOM 10105 C C   . GLN F 1 139 ? 36.953  90.850  67.576  1.00 21.83 ? 139 GLN F C   1 
ATOM 10106 O O   . GLN F 1 139 ? 38.145  91.156  67.680  1.00 22.35 ? 139 GLN F O   1 
ATOM 10107 C CB  . GLN F 1 139 ? 35.678  89.919  69.498  1.00 25.22 ? 139 GLN F CB  1 
ATOM 10108 C CG  . GLN F 1 139 ? 35.030  90.168  70.839  1.00 25.18 ? 139 GLN F CG  1 
ATOM 10109 C CD  . GLN F 1 139 ? 35.177  88.983  71.770  1.00 24.69 ? 139 GLN F CD  1 
ATOM 10110 O OE1 . GLN F 1 139 ? 34.283  88.142  71.870  1.00 25.15 ? 139 GLN F OE1 1 
ATOM 10111 N NE2 . GLN F 1 139 ? 36.310  88.912  72.461  1.00 24.70 ? 139 GLN F NE2 1 
ATOM 10112 N N   . PHE F 1 140 ? 36.452  90.216  66.518  1.00 20.50 ? 140 PHE F N   1 
ATOM 10113 C CA  . PHE F 1 140 ? 37.280  89.820  65.382  1.00 17.66 ? 140 PHE F CA  1 
ATOM 10114 C C   . PHE F 1 140 ? 38.062  91.029  64.832  1.00 14.91 ? 140 PHE F C   1 
ATOM 10115 O O   . PHE F 1 140 ? 39.214  90.887  64.462  1.00 16.87 ? 140 PHE F O   1 
ATOM 10116 C CB  . PHE F 1 140 ? 36.416  89.198  64.280  1.00 18.30 ? 140 PHE F CB  1 
ATOM 10117 C CG  . PHE F 1 140 ? 37.163  88.242  63.390  1.00 14.05 ? 140 PHE F CG  1 
ATOM 10118 C CD1 . PHE F 1 140 ? 37.738  87.091  63.917  1.00 8.86  ? 140 PHE F CD1 1 
ATOM 10119 C CD2 . PHE F 1 140 ? 37.284  88.486  62.024  1.00 13.40 ? 140 PHE F CD2 1 
ATOM 10120 C CE1 . PHE F 1 140 ? 38.424  86.193  63.095  1.00 7.32  ? 140 PHE F CE1 1 
ATOM 10121 C CE2 . PHE F 1 140 ? 37.969  87.593  61.186  1.00 9.87  ? 140 PHE F CE2 1 
ATOM 10122 C CZ  . PHE F 1 140 ? 38.539  86.445  61.733  1.00 10.49 ? 140 PHE F CZ  1 
ATOM 10123 N N   . LEU F 1 141 ? 37.414  92.169  64.778  1.00 12.25 ? 141 LEU F N   1 
ATOM 10124 C CA  . LEU F 1 141 ? 38.047  93.381  64.284  1.00 10.97 ? 141 LEU F CA  1 
ATOM 10125 C C   . LEU F 1 141 ? 38.972  93.915  65.380  1.00 14.81 ? 141 LEU F C   1 
ATOM 10126 O O   . LEU F 1 141 ? 40.196  94.104  65.175  1.00 14.06 ? 141 LEU F O   1 
ATOM 10127 C CB  . LEU F 1 141 ? 36.963  94.407  63.953  1.00 7.73  ? 141 LEU F CB  1 
ATOM 10128 C CG  . LEU F 1 141 ? 37.362  95.765  63.388  1.00 3.05  ? 141 LEU F CG  1 
ATOM 10129 C CD1 . LEU F 1 141 ? 38.150  95.600  62.108  1.00 2.00  ? 141 LEU F CD1 1 
ATOM 10130 C CD2 . LEU F 1 141 ? 36.104  96.566  63.140  1.00 2.70  ? 141 LEU F CD2 1 
ATOM 10131 N N   . GLY F 1 142 ? 38.387  94.153  66.548  1.00 17.68 ? 142 GLY F N   1 
ATOM 10132 C CA  . GLY F 1 142 ? 39.136  94.649  67.683  1.00 17.96 ? 142 GLY F CA  1 
ATOM 10133 C C   . GLY F 1 142 ? 39.962  95.888  67.424  1.00 19.62 ? 142 GLY F C   1 
ATOM 10134 O O   . GLY F 1 142 ? 39.427  96.978  67.252  1.00 17.52 ? 142 GLY F O   1 
ATOM 10135 N N   . LYS F 1 143 ? 41.275  95.708  67.382  1.00 20.87 ? 143 LYS F N   1 
ATOM 10136 C CA  . LYS F 1 143 ? 42.199  96.814  67.184  1.00 21.05 ? 143 LYS F CA  1 
ATOM 10137 C C   . LYS F 1 143 ? 42.689  97.025  65.768  1.00 22.20 ? 143 LYS F C   1 
ATOM 10138 O O   . LYS F 1 143 ? 43.124  98.133  65.423  1.00 24.59 ? 143 LYS F O   1 
ATOM 10139 C CB  . LYS F 1 143 ? 43.390  96.682  68.139  1.00 21.03 ? 143 LYS F CB  1 
ATOM 10140 C CG  . LYS F 1 143 ? 43.272  97.529  69.392  1.00 25.25 ? 143 LYS F CG  1 
ATOM 10141 C CD  . LYS F 1 143 ? 41.987  97.246  70.158  1.00 24.87 ? 143 LYS F CD  1 
ATOM 10142 C CE  . LYS F 1 143 ? 41.788  98.241  71.287  1.00 26.36 ? 143 LYS F CE  1 
ATOM 10143 N NZ  . LYS F 1 143 ? 40.486  98.052  71.979  1.00 27.05 ? 143 LYS F NZ  1 
ATOM 10144 N N   . ARG F 1 144 ? 42.686  95.980  64.948  1.00 18.45 ? 144 ARG F N   1 
ATOM 10145 C CA  . ARG F 1 144 ? 43.181  96.098  63.584  1.00 14.79 ? 144 ARG F CA  1 
ATOM 10146 C C   . ARG F 1 144 ? 42.181  96.896  62.748  1.00 16.36 ? 144 ARG F C   1 
ATOM 10147 O O   . ARG F 1 144 ? 41.008  96.540  62.688  1.00 17.81 ? 144 ARG F O   1 
ATOM 10148 C CB  . ARG F 1 144 ? 43.492  94.742  62.983  1.00 14.49 ? 144 ARG F CB  1 
ATOM 10149 C CG  . ARG F 1 144 ? 42.356  93.768  62.998  1.00 14.73 ? 144 ARG F CG  1 
ATOM 10150 C CD  . ARG F 1 144 ? 42.799  92.365  62.656  1.00 10.20 ? 144 ARG F CD  1 
ATOM 10151 N NE  . ARG F 1 144 ? 43.380  91.671  63.800  1.00 10.67 ? 144 ARG F NE  1 
ATOM 10152 C CZ  . ARG F 1 144 ? 42.698  91.323  64.888  1.00 8.41  ? 144 ARG F CZ  1 
ATOM 10153 N NH1 . ARG F 1 144 ? 41.416  91.613  64.989  1.00 9.30  ? 144 ARG F NH1 1 
ATOM 10154 N NH2 . ARG F 1 144 ? 43.285  90.647  65.862  1.00 6.34  ? 144 ARG F NH2 1 
ATOM 10155 N N   . PRO F 1 145 ? 42.636  97.975  62.088  1.00 17.52 ? 145 PRO F N   1 
ATOM 10156 C CA  . PRO F 1 145 ? 41.772  98.819  61.260  1.00 16.92 ? 145 PRO F CA  1 
ATOM 10157 C C   . PRO F 1 145 ? 40.964  97.996  60.278  1.00 16.81 ? 145 PRO F C   1 
ATOM 10158 O O   . PRO F 1 145 ? 39.740  97.956  60.333  1.00 13.49 ? 145 PRO F O   1 
ATOM 10159 C CB  . PRO F 1 145 ? 42.774  99.720  60.529  1.00 18.11 ? 145 PRO F CB  1 
ATOM 10160 C CG  . PRO F 1 145 ? 43.927  99.792  61.474  1.00 18.01 ? 145 PRO F CG  1 
ATOM 10161 C CD  . PRO F 1 145 ? 44.047  98.359  61.919  1.00 20.52 ? 145 PRO F CD  1 
ATOM 10162 N N   . TRP F 1 146 ? 41.664  97.340  59.369  1.00 15.83 ? 146 TRP F N   1 
ATOM 10163 C CA  . TRP F 1 146 ? 41.008  96.522  58.376  1.00 12.70 ? 146 TRP F CA  1 
ATOM 10164 C C   . TRP F 1 146 ? 40.895  95.128  58.933  1.00 14.08 ? 146 TRP F C   1 
ATOM 10165 O O   . TRP F 1 146 ? 41.883  94.564  59.376  1.00 15.48 ? 146 TRP F O   1 
ATOM 10166 C CB  . TRP F 1 146 ? 41.812  96.547  57.080  1.00 11.10 ? 146 TRP F CB  1 
ATOM 10167 C CG  . TRP F 1 146 ? 41.942  97.931  56.511  1.00 14.18 ? 146 TRP F CG  1 
ATOM 10168 C CD1 . TRP F 1 146 ? 43.097  98.565  56.143  1.00 13.27 ? 146 TRP F CD1 1 
ATOM 10169 C CD2 . TRP F 1 146 ? 40.876  98.864  56.262  1.00 13.26 ? 146 TRP F CD2 1 
ATOM 10170 N NE1 . TRP F 1 146 ? 42.815  99.832  55.683  1.00 16.56 ? 146 TRP F NE1 1 
ATOM 10171 C CE2 . TRP F 1 146 ? 41.469  100.043 55.746  1.00 14.31 ? 146 TRP F CE2 1 
ATOM 10172 C CE3 . TRP F 1 146 ? 39.483  98.821  56.426  1.00 12.35 ? 146 TRP F CE3 1 
ATOM 10173 C CZ2 . TRP F 1 146 ? 40.707  101.166 55.392  1.00 11.86 ? 146 TRP F CZ2 1 
ATOM 10174 C CZ3 . TRP F 1 146 ? 38.733  99.939  56.075  1.00 10.93 ? 146 TRP F CZ3 1 
ATOM 10175 C CH2 . TRP F 1 146 ? 39.348  101.095 55.565  1.00 10.99 ? 146 TRP F CH2 1 
ATOM 10176 N N   . PHE F 1 147 ? 39.677  94.575  58.943  1.00 14.04 ? 147 PHE F N   1 
ATOM 10177 C CA  . PHE F 1 147 ? 39.376  93.231  59.447  1.00 10.92 ? 147 PHE F CA  1 
ATOM 10178 C C   . PHE F 1 147 ? 40.496  92.207  59.359  1.00 11.46 ? 147 PHE F C   1 
ATOM 10179 O O   . PHE F 1 147 ? 40.591  91.325  60.206  1.00 15.10 ? 147 PHE F O   1 
ATOM 10180 C CB  . PHE F 1 147 ? 38.158  92.666  58.718  1.00 7.35  ? 147 PHE F CB  1 
ATOM 10181 C CG  . PHE F 1 147 ? 36.935  92.623  59.552  1.00 2.68  ? 147 PHE F CG  1 
ATOM 10182 C CD1 . PHE F 1 147 ? 36.706  91.577  60.447  1.00 3.98  ? 147 PHE F CD1 1 
ATOM 10183 C CD2 . PHE F 1 147 ? 35.946  93.609  59.427  1.00 2.00  ? 147 PHE F CD2 1 
ATOM 10184 C CE1 . PHE F 1 147 ? 35.540  91.511  61.202  1.00 2.00  ? 147 PHE F CE1 1 
ATOM 10185 C CE2 . PHE F 1 147 ? 34.772  93.552  60.181  1.00 2.00  ? 147 PHE F CE2 1 
ATOM 10186 C CZ  . PHE F 1 147 ? 34.572  92.495  61.070  1.00 2.00  ? 147 PHE F CZ  1 
ATOM 10187 N N   . VAL F 1 148 ? 41.318  92.305  58.318  1.00 12.73 ? 148 VAL F N   1 
ATOM 10188 C CA  . VAL F 1 148 ? 42.410  91.360  58.115  1.00 15.65 ? 148 VAL F CA  1 
ATOM 10189 C C   . VAL F 1 148 ? 43.764  91.869  58.636  1.00 17.57 ? 148 VAL F C   1 
ATOM 10190 O O   . VAL F 1 148 ? 44.816  91.301  58.330  1.00 18.61 ? 148 VAL F O   1 
ATOM 10191 C CB  . VAL F 1 148 ? 42.503  90.968  56.617  1.00 11.14 ? 148 VAL F CB  1 
ATOM 10192 C CG1 . VAL F 1 148 ? 43.383  91.938  55.856  1.00 8.33  ? 148 VAL F CG1 1 
ATOM 10193 C CG2 . VAL F 1 148 ? 42.975  89.531  56.466  1.00 6.11  ? 148 VAL F CG2 1 
ATOM 10194 N N   . GLY F 1 149 ? 43.733  92.891  59.485  1.00 15.49 ? 149 GLY F N   1 
ATOM 10195 C CA  . GLY F 1 149 ? 44.933  93.464  60.040  1.00 15.55 ? 149 GLY F CA  1 
ATOM 10196 C C   . GLY F 1 149 ? 45.240  94.867  59.554  1.00 15.65 ? 149 GLY F C   1 
ATOM 10197 O O   . GLY F 1 149 ? 44.395  95.756  59.600  1.00 16.75 ? 149 GLY F O   1 
ATOM 10198 N N   . ASP F 1 150 ? 46.485  95.072  59.143  1.00 15.03 ? 150 ASP F N   1 
ATOM 10199 C CA  . ASP F 1 150 ? 46.940  96.362  58.642  1.00 17.52 ? 150 ASP F CA  1 
ATOM 10200 C C   . ASP F 1 150 ? 46.498  96.545  57.193  1.00 17.55 ? 150 ASP F C   1 
ATOM 10201 O O   . ASP F 1 150 ? 46.283  97.672  56.726  1.00 17.57 ? 150 ASP F O   1 
ATOM 10202 C CB  . ASP F 1 150 ? 48.475  96.454  58.694  1.00 18.92 ? 150 ASP F CB  1 
ATOM 10203 C CG  . ASP F 1 150 ? 49.027  96.449  60.111  1.00 19.00 ? 150 ASP F CG  1 
ATOM 10204 O OD1 . ASP F 1 150 ? 48.239  96.369  61.079  1.00 21.19 ? 150 ASP F OD1 1 
ATOM 10205 O OD2 . ASP F 1 150 ? 50.267  96.528  60.253  1.00 19.00 ? 150 ASP F OD2 1 
ATOM 10206 N N   . LYS F 1 151 ? 46.401  95.435  56.472  1.00 16.74 ? 151 LYS F N   1 
ATOM 10207 C CA  . LYS F 1 151 ? 46.017  95.501  55.074  1.00 16.91 ? 151 LYS F CA  1 
ATOM 10208 C C   . LYS F 1 151 ? 44.520  95.390  54.831  1.00 14.82 ? 151 LYS F C   1 
ATOM 10209 O O   . LYS F 1 151 ? 43.777  94.825  55.643  1.00 16.23 ? 151 LYS F O   1 
ATOM 10210 C CB  . LYS F 1 151 ? 46.779  94.454  54.254  1.00 17.32 ? 151 LYS F CB  1 
ATOM 10211 C CG  . LYS F 1 151 ? 46.547  93.019  54.674  1.00 22.68 ? 151 LYS F CG  1 
ATOM 10212 C CD  . LYS F 1 151 ? 47.249  92.062  53.726  1.00 25.63 ? 151 LYS F CD  1 
ATOM 10213 C CE  . LYS F 1 151 ? 46.787  92.261  52.295  1.00 25.30 ? 151 LYS F CE  1 
ATOM 10214 N NZ  . LYS F 1 151 ? 47.315  91.209  51.396  1.00 19.61 ? 151 LYS F NZ  1 
ATOM 10215 N N   . ILE F 1 152 ? 44.090  95.991  53.725  1.00 13.84 ? 152 ILE F N   1 
ATOM 10216 C CA  . ILE F 1 152 ? 42.698  95.980  53.305  1.00 11.46 ? 152 ILE F CA  1 
ATOM 10217 C C   . ILE F 1 152 ? 42.567  94.816  52.314  1.00 11.53 ? 152 ILE F C   1 
ATOM 10218 O O   . ILE F 1 152 ? 43.469  94.576  51.502  1.00 11.12 ? 152 ILE F O   1 
ATOM 10219 C CB  . ILE F 1 152 ? 42.317  97.345  52.651  1.00 11.04 ? 152 ILE F CB  1 
ATOM 10220 C CG1 . ILE F 1 152 ? 40.811  97.443  52.413  1.00 10.24 ? 152 ILE F CG1 1 
ATOM 10221 C CG2 . ILE F 1 152 ? 43.075  97.554  51.352  1.00 9.75  ? 152 ILE F CG2 1 
ATOM 10222 C CD1 . ILE F 1 152 ? 40.399  98.759  51.770  1.00 3.94  ? 152 ILE F CD1 1 
ATOM 10223 N N   . THR F 1 153 ? 41.481  94.061  52.427  1.00 12.07 ? 153 THR F N   1 
ATOM 10224 C CA  . THR F 1 153 ? 41.236  92.912  51.558  1.00 12.03 ? 153 THR F CA  1 
ATOM 10225 C C   . THR F 1 153 ? 39.794  92.912  51.061  1.00 13.79 ? 153 THR F C   1 
ATOM 10226 O O   . THR F 1 153 ? 38.977  93.713  51.518  1.00 14.10 ? 153 THR F O   1 
ATOM 10227 C CB  . THR F 1 153 ? 41.506  91.594  52.312  1.00 10.33 ? 153 THR F CB  1 
ATOM 10228 O OG1 . THR F 1 153 ? 41.071  91.722  53.673  1.00 6.31  ? 153 THR F OG1 1 
ATOM 10229 C CG2 . THR F 1 153 ? 42.979  91.248  52.289  1.00 8.86  ? 153 THR F CG2 1 
ATOM 10230 N N   . PHE F 1 154 ? 39.462  92.006  50.147  1.00 12.52 ? 154 PHE F N   1 
ATOM 10231 C CA  . PHE F 1 154 ? 38.096  91.955  49.636  1.00 13.74 ? 154 PHE F CA  1 
ATOM 10232 C C   . PHE F 1 154 ? 37.092  91.719  50.763  1.00 14.24 ? 154 PHE F C   1 
ATOM 10233 O O   . PHE F 1 154 ? 35.960  92.211  50.723  1.00 17.05 ? 154 PHE F O   1 
ATOM 10234 C CB  . PHE F 1 154 ? 37.939  90.908  48.517  1.00 6.85  ? 154 PHE F CB  1 
ATOM 10235 C CG  . PHE F 1 154 ? 38.055  89.475  48.974  1.00 8.09  ? 154 PHE F CG  1 
ATOM 10236 C CD1 . PHE F 1 154 ? 36.945  88.784  49.457  1.00 6.82  ? 154 PHE F CD1 1 
ATOM 10237 C CD2 . PHE F 1 154 ? 39.261  88.792  48.842  1.00 9.22  ? 154 PHE F CD2 1 
ATOM 10238 C CE1 . PHE F 1 154 ? 37.036  87.436  49.794  1.00 6.98  ? 154 PHE F CE1 1 
ATOM 10239 C CE2 . PHE F 1 154 ? 39.358  87.447  49.176  1.00 7.16  ? 154 PHE F CE2 1 
ATOM 10240 C CZ  . PHE F 1 154 ? 38.246  86.769  49.650  1.00 4.18  ? 154 PHE F CZ  1 
ATOM 10241 N N   . VAL F 1 155 ? 37.538  91.030  51.805  1.00 12.29 ? 155 VAL F N   1 
ATOM 10242 C CA  . VAL F 1 155 ? 36.673  90.740  52.934  1.00 13.87 ? 155 VAL F CA  1 
ATOM 10243 C C   . VAL F 1 155 ? 36.228  92.020  53.642  1.00 13.38 ? 155 VAL F C   1 
ATOM 10244 O O   . VAL F 1 155 ? 35.218  92.039  54.342  1.00 10.51 ? 155 VAL F O   1 
ATOM 10245 C CB  . VAL F 1 155 ? 37.343  89.755  53.930  1.00 16.21 ? 155 VAL F CB  1 
ATOM 10246 C CG1 . VAL F 1 155 ? 37.785  88.489  53.203  1.00 12.64 ? 155 VAL F CG1 1 
ATOM 10247 C CG2 . VAL F 1 155 ? 38.522  90.407  54.633  1.00 14.49 ? 155 VAL F CG2 1 
ATOM 10248 N N   . ASP F 1 156 ? 36.969  93.099  53.431  1.00 13.77 ? 156 ASP F N   1 
ATOM 10249 C CA  . ASP F 1 156 ? 36.624  94.373  54.044  1.00 16.10 ? 156 ASP F CA  1 
ATOM 10250 C C   . ASP F 1 156 ? 35.411  94.999  53.352  1.00 16.27 ? 156 ASP F C   1 
ATOM 10251 O O   . ASP F 1 156 ? 34.669  95.776  53.960  1.00 16.28 ? 156 ASP F O   1 
ATOM 10252 C CB  . ASP F 1 156 ? 37.836  95.315  54.054  1.00 16.04 ? 156 ASP F CB  1 
ATOM 10253 C CG  . ASP F 1 156 ? 38.885  94.906  55.087  1.00 15.68 ? 156 ASP F CG  1 
ATOM 10254 O OD1 . ASP F 1 156 ? 39.731  94.033  54.793  1.00 16.26 ? 156 ASP F OD1 1 
ATOM 10255 O OD2 . ASP F 1 156 ? 38.849  95.453  56.207  1.00 17.65 ? 156 ASP F OD2 1 
ATOM 10256 N N   . PHE F 1 157 ? 35.196  94.632  52.092  1.00 15.86 ? 157 PHE F N   1 
ATOM 10257 C CA  . PHE F 1 157 ? 34.049  95.129  51.344  1.00 14.75 ? 157 PHE F CA  1 
ATOM 10258 C C   . PHE F 1 157 ? 32.830  94.297  51.742  1.00 12.82 ? 157 PHE F C   1 
ATOM 10259 O O   . PHE F 1 157 ? 31.768  94.850  52.053  1.00 14.24 ? 157 PHE F O   1 
ATOM 10260 C CB  . PHE F 1 157 ? 34.296  95.027  49.843  1.00 15.31 ? 157 PHE F CB  1 
ATOM 10261 C CG  . PHE F 1 157 ? 35.396  95.913  49.351  1.00 15.02 ? 157 PHE F CG  1 
ATOM 10262 C CD1 . PHE F 1 157 ? 36.709  95.452  49.319  1.00 12.58 ? 157 PHE F CD1 1 
ATOM 10263 C CD2 . PHE F 1 157 ? 35.121  97.205  48.913  1.00 15.07 ? 157 PHE F CD2 1 
ATOM 10264 C CE1 . PHE F 1 157 ? 37.731  96.277  48.856  1.00 14.17 ? 157 PHE F CE1 1 
ATOM 10265 C CE2 . PHE F 1 157 ? 36.137  98.053  48.446  1.00 10.76 ? 157 PHE F CE2 1 
ATOM 10266 C CZ  . PHE F 1 157 ? 37.443  97.573  48.416  1.00 7.46  ? 157 PHE F CZ  1 
ATOM 10267 N N   . LEU F 1 158 ? 32.992  92.971  51.737  1.00 11.65 ? 158 LEU F N   1 
ATOM 10268 C CA  . LEU F 1 158 ? 31.924  92.054  52.139  1.00 12.14 ? 158 LEU F CA  1 
ATOM 10269 C C   . LEU F 1 158 ? 31.390  92.544  53.484  1.00 13.93 ? 158 LEU F C   1 
ATOM 10270 O O   . LEU F 1 158 ? 30.185  92.713  53.675  1.00 16.77 ? 158 LEU F O   1 
ATOM 10271 C CB  . LEU F 1 158 ? 32.471  90.629  52.331  1.00 10.31 ? 158 LEU F CB  1 
ATOM 10272 C CG  . LEU F 1 158 ? 32.563  89.629  51.171  1.00 9.96  ? 158 LEU F CG  1 
ATOM 10273 C CD1 . LEU F 1 158 ? 33.422  88.435  51.571  1.00 7.94  ? 158 LEU F CD1 1 
ATOM 10274 C CD2 . LEU F 1 158 ? 31.167  89.164  50.764  1.00 8.26  ? 158 LEU F CD2 1 
ATOM 10275 N N   . ALA F 1 159 ? 32.322  92.812  54.396  1.00 14.72 ? 159 ALA F N   1 
ATOM 10276 C CA  . ALA F 1 159 ? 32.008  93.284  55.741  1.00 12.24 ? 159 ALA F CA  1 
ATOM 10277 C C   . ALA F 1 159 ? 31.156  94.540  55.703  1.00 11.44 ? 159 ALA F C   1 
ATOM 10278 O O   . ALA F 1 159 ? 30.050  94.556  56.248  1.00 9.60  ? 159 ALA F O   1 
ATOM 10279 C CB  . ALA F 1 159 ? 33.290  93.552  56.514  1.00 6.79  ? 159 ALA F CB  1 
ATOM 10280 N N   . TYR F 1 160 ? 31.660  95.579  55.041  1.00 10.54 ? 160 TYR F N   1 
ATOM 10281 C CA  . TYR F 1 160 ? 30.936  96.842  54.950  1.00 11.92 ? 160 TYR F CA  1 
ATOM 10282 C C   . TYR F 1 160 ? 29.486  96.635  54.525  1.00 13.69 ? 160 TYR F C   1 
ATOM 10283 O O   . TYR F 1 160 ? 28.575  97.247  55.092  1.00 12.69 ? 160 TYR F O   1 
ATOM 10284 C CB  . TYR F 1 160 ? 31.634  97.810  53.989  1.00 5.18  ? 160 TYR F CB  1 
ATOM 10285 C CG  . TYR F 1 160 ? 30.928  99.143  53.861  1.00 7.21  ? 160 TYR F CG  1 
ATOM 10286 C CD1 . TYR F 1 160 ? 30.147  99.643  54.904  1.00 5.51  ? 160 TYR F CD1 1 
ATOM 10287 C CD2 . TYR F 1 160 ? 31.019  99.895  52.694  1.00 11.95 ? 160 TYR F CD2 1 
ATOM 10288 C CE1 . TYR F 1 160 ? 29.467  100.852 54.791  1.00 10.36 ? 160 TYR F CE1 1 
ATOM 10289 C CE2 . TYR F 1 160 ? 30.345  101.116 52.568  1.00 10.03 ? 160 TYR F CE2 1 
ATOM 10290 C CZ  . TYR F 1 160 ? 29.568  101.586 53.624  1.00 7.99  ? 160 TYR F CZ  1 
ATOM 10291 O OH  . TYR F 1 160 ? 28.883  102.776 53.517  1.00 2.86  ? 160 TYR F OH  1 
ATOM 10292 N N   . ASP F 1 161 ? 29.275  95.757  53.550  1.00 15.55 ? 161 ASP F N   1 
ATOM 10293 C CA  . ASP F 1 161 ? 27.932  95.480  53.062  1.00 17.35 ? 161 ASP F CA  1 
ATOM 10294 C C   . ASP F 1 161 ? 27.052  94.972  54.204  1.00 19.18 ? 161 ASP F C   1 
ATOM 10295 O O   . ASP F 1 161 ? 26.041  95.592  54.547  1.00 16.37 ? 161 ASP F O   1 
ATOM 10296 C CB  . ASP F 1 161 ? 27.985  94.444  51.936  1.00 18.33 ? 161 ASP F CB  1 
ATOM 10297 C CG  . ASP F 1 161 ? 26.790  94.530  51.007  1.00 21.46 ? 161 ASP F CG  1 
ATOM 10298 O OD1 . ASP F 1 161 ? 25.655  94.741  51.489  1.00 13.05 ? 161 ASP F OD1 1 
ATOM 10299 O OD2 . ASP F 1 161 ? 26.990  94.391  49.784  1.00 24.46 ? 161 ASP F OD2 1 
ATOM 10300 N N   . VAL F 1 162 ? 27.480  93.876  54.824  1.00 19.76 ? 162 VAL F N   1 
ATOM 10301 C CA  . VAL F 1 162 ? 26.747  93.253  55.926  1.00 18.37 ? 162 VAL F CA  1 
ATOM 10302 C C   . VAL F 1 162 ? 26.482  94.220  57.082  1.00 18.98 ? 162 VAL F C   1 
ATOM 10303 O O   . VAL F 1 162 ? 25.418  94.180  57.711  1.00 20.59 ? 162 VAL F O   1 
ATOM 10304 C CB  . VAL F 1 162 ? 27.516  92.043  56.476  1.00 18.18 ? 162 VAL F CB  1 
ATOM 10305 C CG1 . VAL F 1 162 ? 26.705  91.346  57.550  1.00 18.10 ? 162 VAL F CG1 1 
ATOM 10306 C CG2 . VAL F 1 162 ? 27.857  91.090  55.347  1.00 20.34 ? 162 VAL F CG2 1 
ATOM 10307 N N   . LEU F 1 163 ? 27.449  95.088  57.356  1.00 17.39 ? 163 LEU F N   1 
ATOM 10308 C CA  . LEU F 1 163 ? 27.328  96.049  58.441  1.00 17.13 ? 163 LEU F CA  1 
ATOM 10309 C C   . LEU F 1 163 ? 26.291  97.143  58.187  1.00 18.60 ? 163 LEU F C   1 
ATOM 10310 O O   . LEU F 1 163 ? 25.449  97.402  59.045  1.00 18.05 ? 163 LEU F O   1 
ATOM 10311 C CB  . LEU F 1 163 ? 28.700  96.649  58.791  1.00 17.93 ? 163 LEU F CB  1 
ATOM 10312 C CG  . LEU F 1 163 ? 29.753  95.678  59.365  1.00 18.31 ? 163 LEU F CG  1 
ATOM 10313 C CD1 . LEU F 1 163 ? 31.101  96.363  59.497  1.00 17.53 ? 163 LEU F CD1 1 
ATOM 10314 C CD2 . LEU F 1 163 ? 29.316  95.131  60.712  1.00 15.23 ? 163 LEU F CD2 1 
ATOM 10315 N N   . ASP F 1 164 ? 26.309  97.763  57.013  1.00 18.26 ? 164 ASP F N   1 
ATOM 10316 C CA  . ASP F 1 164 ? 25.328  98.805  56.727  1.00 14.44 ? 164 ASP F CA  1 
ATOM 10317 C C   . ASP F 1 164 ? 23.932  98.224  56.494  1.00 12.30 ? 164 ASP F C   1 
ATOM 10318 O O   . ASP F 1 164 ? 22.931  98.935  56.570  1.00 11.42 ? 164 ASP F O   1 
ATOM 10319 C CB  . ASP F 1 164 ? 25.766  99.703  55.587  1.00 12.97 ? 164 ASP F CB  1 
ATOM 10320 C CG  . ASP F 1 164 ? 25.481  99.098  54.237  1.00 11.06 ? 164 ASP F CG  1 
ATOM 10321 O OD1 . ASP F 1 164 ? 24.350  99.271  53.739  1.00 6.76  ? 164 ASP F OD1 1 
ATOM 10322 O OD2 . ASP F 1 164 ? 26.389  98.460  53.670  1.00 14.91 ? 164 ASP F OD2 1 
ATOM 10323 N N   . LEU F 1 165 ? 23.879  96.933  56.181  1.00 13.03 ? 165 LEU F N   1 
ATOM 10324 C CA  . LEU F 1 165 ? 22.618  96.229  55.941  1.00 13.38 ? 165 LEU F CA  1 
ATOM 10325 C C   . LEU F 1 165 ? 21.797  96.301  57.230  1.00 13.79 ? 165 LEU F C   1 
ATOM 10326 O O   . LEU F 1 165 ? 20.724  96.900  57.273  1.00 14.01 ? 165 LEU F O   1 
ATOM 10327 C CB  . LEU F 1 165 ? 22.912  94.762  55.600  1.00 9.77  ? 165 LEU F CB  1 
ATOM 10328 C CG  . LEU F 1 165 ? 22.176  94.067  54.454  1.00 5.35  ? 165 LEU F CG  1 
ATOM 10329 C CD1 . LEU F 1 165 ? 20.746  93.791  54.843  1.00 5.87  ? 165 LEU F CD1 1 
ATOM 10330 C CD2 . LEU F 1 165 ? 22.250  94.906  53.187  1.00 2.00  ? 165 LEU F CD2 1 
ATOM 10331 N N   . HIS F 1 166 ? 22.344  95.710  58.289  1.00 15.27 ? 166 HIS F N   1 
ATOM 10332 C CA  . HIS F 1 166 ? 21.709  95.697  59.605  1.00 17.50 ? 166 HIS F CA  1 
ATOM 10333 C C   . HIS F 1 166 ? 21.594  97.125  60.131  1.00 20.51 ? 166 HIS F C   1 
ATOM 10334 O O   . HIS F 1 166 ? 20.679  97.450  60.878  1.00 23.06 ? 166 HIS F O   1 
ATOM 10335 C CB  . HIS F 1 166 ? 22.528  94.853  60.582  1.00 13.11 ? 166 HIS F CB  1 
ATOM 10336 C CG  . HIS F 1 166 ? 22.569  93.401  60.234  1.00 11.94 ? 166 HIS F CG  1 
ATOM 10337 N ND1 . HIS F 1 166 ? 23.436  92.880  59.298  1.00 7.75  ? 166 HIS F ND1 1 
ATOM 10338 C CD2 . HIS F 1 166 ? 21.836  92.356  60.689  1.00 10.83 ? 166 HIS F CD2 1 
ATOM 10339 C CE1 . HIS F 1 166 ? 23.235  91.581  59.190  1.00 5.27  ? 166 HIS F CE1 1 
ATOM 10340 N NE2 . HIS F 1 166 ? 22.270  91.238  60.022  1.00 7.66  ? 166 HIS F NE2 1 
ATOM 10341 N N   . ARG F 1 167 ? 22.544  97.961  59.734  1.00 19.98 ? 167 ARG F N   1 
ATOM 10342 C CA  . ARG F 1 167 ? 22.585  99.363  60.117  1.00 21.81 ? 167 ARG F CA  1 
ATOM 10343 C C   . ARG F 1 167 ? 21.224  99.988  59.781  1.00 22.84 ? 167 ARG F C   1 
ATOM 10344 O O   . ARG F 1 167 ? 20.656  100.733 60.584  1.00 25.97 ? 167 ARG F O   1 
ATOM 10345 C CB  . ARG F 1 167 ? 23.710  100.031 59.337  1.00 20.48 ? 167 ARG F CB  1 
ATOM 10346 C CG  . ARG F 1 167 ? 24.069  101.453 59.643  1.00 14.20 ? 167 ARG F CG  1 
ATOM 10347 C CD  . ARG F 1 167 ? 25.137  101.910 58.645  1.00 15.13 ? 167 ARG F CD  1 
ATOM 10348 N NE  . ARG F 1 167 ? 25.617  103.273 58.892  1.00 14.35 ? 167 ARG F NE  1 
ATOM 10349 C CZ  . ARG F 1 167 ? 26.439  103.944 58.085  1.00 12.46 ? 167 ARG F CZ  1 
ATOM 10350 N NH1 . ARG F 1 167 ? 26.885  103.397 56.961  1.00 8.90  ? 167 ARG F NH1 1 
ATOM 10351 N NH2 . ARG F 1 167 ? 26.833  105.166 58.411  1.00 14.81 ? 167 ARG F NH2 1 
ATOM 10352 N N   . ILE F 1 168 ? 20.676  99.624  58.622  1.00 22.00 ? 168 ILE F N   1 
ATOM 10353 C CA  . ILE F 1 168 ? 19.383  100.149 58.179  1.00 20.47 ? 168 ILE F CA  1 
ATOM 10354 C C   . ILE F 1 168 ? 18.214  99.310  58.696  1.00 19.18 ? 168 ILE F C   1 
ATOM 10355 O O   . ILE F 1 168 ? 17.137  99.839  58.975  1.00 21.12 ? 168 ILE F O   1 
ATOM 10356 C CB  . ILE F 1 168 ? 19.296  100.218 56.632  1.00 17.72 ? 168 ILE F CB  1 
ATOM 10357 C CG1 . ILE F 1 168 ? 20.513  100.953 56.060  1.00 16.91 ? 168 ILE F CG1 1 
ATOM 10358 C CG2 . ILE F 1 168 ? 18.012  100.917 56.203  1.00 12.81 ? 168 ILE F CG2 1 
ATOM 10359 C CD1 . ILE F 1 168 ? 20.706  102.353 56.605  1.00 18.17 ? 168 ILE F CD1 1 
ATOM 10360 N N   . PHE F 1 169 ? 18.420  98.001  58.804  1.00 19.67 ? 169 PHE F N   1 
ATOM 10361 C CA  . PHE F 1 169 ? 17.368  97.116  59.285  1.00 23.30 ? 169 PHE F CA  1 
ATOM 10362 C C   . PHE F 1 169 ? 17.054  97.422  60.742  1.00 24.26 ? 169 PHE F C   1 
ATOM 10363 O O   . PHE F 1 169 ? 15.904  97.355  61.170  1.00 22.73 ? 169 PHE F O   1 
ATOM 10364 C CB  . PHE F 1 169 ? 17.786  95.650  59.142  1.00 22.01 ? 169 PHE F CB  1 
ATOM 10365 C CG  . PHE F 1 169 ? 16.647  94.687  59.287  1.00 20.92 ? 169 PHE F CG  1 
ATOM 10366 C CD1 . PHE F 1 169 ? 16.026  94.501  60.518  1.00 19.95 ? 169 PHE F CD1 1 
ATOM 10367 C CD2 . PHE F 1 169 ? 16.154  94.009  58.179  1.00 20.22 ? 169 PHE F CD2 1 
ATOM 10368 C CE1 . PHE F 1 169 ? 14.929  93.661  60.642  1.00 21.33 ? 169 PHE F CE1 1 
ATOM 10369 C CE2 . PHE F 1 169 ? 15.054  93.162  58.291  1.00 19.34 ? 169 PHE F CE2 1 
ATOM 10370 C CZ  . PHE F 1 169 ? 14.439  92.990  59.525  1.00 24.38 ? 169 PHE F CZ  1 
ATOM 10371 N N   . GLU F 1 170 ? 18.102  97.728  61.496  1.00 27.48 ? 170 GLU F N   1 
ATOM 10372 C CA  . GLU F 1 170 ? 18.006  98.058  62.909  1.00 28.85 ? 170 GLU F CA  1 
ATOM 10373 C C   . GLU F 1 170 ? 19.264  98.829  63.289  1.00 29.14 ? 170 GLU F C   1 
ATOM 10374 O O   . GLU F 1 170 ? 20.268  98.240  63.706  1.00 29.07 ? 170 GLU F O   1 
ATOM 10375 C CB  . GLU F 1 170 ? 17.870  96.793  63.760  1.00 25.85 ? 170 GLU F CB  1 
ATOM 10376 C CG  . GLU F 1 170 ? 17.772  97.072  65.251  1.00 30.79 ? 170 GLU F CG  1 
ATOM 10377 C CD  . GLU F 1 170 ? 16.727  98.127  65.577  1.00 32.31 ? 170 GLU F CD  1 
ATOM 10378 O OE1 . GLU F 1 170 ? 15.539  97.765  65.707  1.00 31.66 ? 170 GLU F OE1 1 
ATOM 10379 O OE2 . GLU F 1 170 ? 17.092  99.319  65.697  1.00 32.36 ? 170 GLU F OE2 1 
ATOM 10380 N N   . PRO F 1 171 ? 19.201  100.168 63.243  1.00 28.98 ? 171 PRO F N   1 
ATOM 10381 C CA  . PRO F 1 171 ? 20.320  101.051 63.586  1.00 29.96 ? 171 PRO F CA  1 
ATOM 10382 C C   . PRO F 1 171 ? 20.957  100.851 64.968  1.00 28.94 ? 171 PRO F C   1 
ATOM 10383 O O   . PRO F 1 171 ? 22.107  101.239 65.185  1.00 28.43 ? 171 PRO F O   1 
ATOM 10384 C CB  . PRO F 1 171 ? 19.712  102.446 63.428  1.00 32.19 ? 171 PRO F CB  1 
ATOM 10385 C CG  . PRO F 1 171 ? 18.239  102.214 63.660  1.00 30.46 ? 171 PRO F CG  1 
ATOM 10386 C CD  . PRO F 1 171 ? 18.008  100.957 62.889  1.00 27.61 ? 171 PRO F CD  1 
ATOM 10387 N N   . ASN F 1 172 ? 20.228  100.231 65.892  1.00 27.57 ? 172 ASN F N   1 
ATOM 10388 C CA  . ASN F 1 172 ? 20.741  99.997  67.244  1.00 27.66 ? 172 ASN F CA  1 
ATOM 10389 C C   . ASN F 1 172 ? 21.967  99.088  67.318  1.00 24.89 ? 172 ASN F C   1 
ATOM 10390 O O   . ASN F 1 172 ? 22.977  99.446  67.917  1.00 23.76 ? 172 ASN F O   1 
ATOM 10391 C CB  . ASN F 1 172 ? 19.650  99.416  68.153  1.00 25.54 ? 172 ASN F CB  1 
ATOM 10392 C CG  . ASN F 1 172 ? 18.641  100.453 68.601  1.00 24.31 ? 172 ASN F CG  1 
ATOM 10393 O OD1 . ASN F 1 172 ? 19.002  101.549 69.021  1.00 21.76 ? 172 ASN F OD1 1 
ATOM 10394 N ND2 . ASN F 1 172 ? 17.367  100.101 68.533  1.00 21.97 ? 172 ASN F ND2 1 
ATOM 10395 N N   . CYS F 1 173 ? 21.880  97.922  66.687  1.00 23.52 ? 173 CYS F N   1 
ATOM 10396 C CA  . CYS F 1 173 ? 22.949  96.925  66.708  1.00 24.24 ? 173 CYS F CA  1 
ATOM 10397 C C   . CYS F 1 173 ? 24.411  97.385  66.651  1.00 23.56 ? 173 CYS F C   1 
ATOM 10398 O O   . CYS F 1 173 ? 25.193  97.055  67.543  1.00 24.83 ? 173 CYS F O   1 
ATOM 10399 C CB  . CYS F 1 173 ? 22.686  95.868  65.645  1.00 26.44 ? 173 CYS F CB  1 
ATOM 10400 S SG  . CYS F 1 173 ? 22.250  96.529  64.041  1.00 33.58 ? 173 CYS F SG  1 
ATOM 10401 N N   . LEU F 1 174 ? 24.792  98.106  65.601  1.00 21.35 ? 174 LEU F N   1 
ATOM 10402 C CA  . LEU F 1 174 ? 26.170  98.581  65.471  1.00 21.04 ? 174 LEU F CA  1 
ATOM 10403 C C   . LEU F 1 174 ? 26.518  99.637  66.518  1.00 21.63 ? 174 LEU F C   1 
ATOM 10404 O O   . LEU F 1 174 ? 27.628  99.659  67.050  1.00 20.32 ? 174 LEU F O   1 
ATOM 10405 C CB  . LEU F 1 174 ? 26.425  99.151  64.068  1.00 19.80 ? 174 LEU F CB  1 
ATOM 10406 C CG  . LEU F 1 174 ? 26.718  98.249  62.862  1.00 15.49 ? 174 LEU F CG  1 
ATOM 10407 C CD1 . LEU F 1 174 ? 28.073  97.603  63.005  1.00 15.98 ? 174 LEU F CD1 1 
ATOM 10408 C CD2 . LEU F 1 174 ? 25.635  97.217  62.686  1.00 16.55 ? 174 LEU F CD2 1 
ATOM 10409 N N   . ASP F 1 175 ? 25.552  100.504 66.806  1.00 22.57 ? 175 ASP F N   1 
ATOM 10410 C CA  . ASP F 1 175 ? 25.713  101.582 67.774  1.00 23.05 ? 175 ASP F CA  1 
ATOM 10411 C C   . ASP F 1 175 ? 26.276  101.104 69.124  1.00 24.21 ? 175 ASP F C   1 
ATOM 10412 O O   . ASP F 1 175 ? 27.058  101.813 69.764  1.00 26.17 ? 175 ASP F O   1 
ATOM 10413 C CB  . ASP F 1 175 ? 24.361  102.291 67.953  1.00 22.61 ? 175 ASP F CB  1 
ATOM 10414 C CG  . ASP F 1 175 ? 24.430  103.474 68.901  1.00 26.30 ? 175 ASP F CG  1 
ATOM 10415 O OD1 . ASP F 1 175 ? 25.475  104.159 68.945  1.00 21.73 ? 175 ASP F OD1 1 
ATOM 10416 O OD2 . ASP F 1 175 ? 23.423  103.724 69.600  1.00 27.50 ? 175 ASP F OD2 1 
ATOM 10417 N N   . ALA F 1 176 ? 25.900  99.893  69.531  1.00 25.33 ? 176 ALA F N   1 
ATOM 10418 C CA  . ALA F 1 176 ? 26.352  99.319  70.793  1.00 25.04 ? 176 ALA F CA  1 
ATOM 10419 C C   . ALA F 1 176 ? 27.801  98.840  70.746  1.00 24.23 ? 176 ALA F C   1 
ATOM 10420 O O   . ALA F 1 176 ? 28.393  98.528  71.782  1.00 23.15 ? 176 ALA F O   1 
ATOM 10421 C CB  . ALA F 1 176 ? 25.437  98.183  71.203  1.00 28.66 ? 176 ALA F CB  1 
ATOM 10422 N N   . PHE F 1 177 ? 28.358  98.759  69.542  1.00 23.11 ? 177 PHE F N   1 
ATOM 10423 C CA  . PHE F 1 177 ? 29.737  98.328  69.357  1.00 20.80 ? 177 PHE F CA  1 
ATOM 10424 C C   . PHE F 1 177 ? 30.453  99.393  68.550  1.00 18.28 ? 177 PHE F C   1 
ATOM 10425 O O   . PHE F 1 177 ? 30.570  99.296  67.327  1.00 18.11 ? 177 PHE F O   1 
ATOM 10426 C CB  . PHE F 1 177 ? 29.784  96.985  68.635  1.00 18.97 ? 177 PHE F CB  1 
ATOM 10427 C CG  . PHE F 1 177 ? 28.952  95.928  69.291  1.00 17.76 ? 177 PHE F CG  1 
ATOM 10428 C CD1 . PHE F 1 177 ? 29.482  95.133  70.301  1.00 17.90 ? 177 PHE F CD1 1 
ATOM 10429 C CD2 . PHE F 1 177 ? 27.620  95.756  68.931  1.00 14.22 ? 177 PHE F CD2 1 
ATOM 10430 C CE1 . PHE F 1 177 ? 28.696  94.183  70.946  1.00 17.71 ? 177 PHE F CE1 1 
ATOM 10431 C CE2 . PHE F 1 177 ? 26.825  94.811  69.569  1.00 14.96 ? 177 PHE F CE2 1 
ATOM 10432 C CZ  . PHE F 1 177 ? 27.364  94.021  70.580  1.00 12.71 ? 177 PHE F CZ  1 
ATOM 10433 N N   . PRO F 1 178 ? 31.017  100.389 69.248  1.00 17.89 ? 178 PRO F N   1 
ATOM 10434 C CA  . PRO F 1 178 ? 31.748  101.518 68.665  1.00 17.16 ? 178 PRO F CA  1 
ATOM 10435 C C   . PRO F 1 178 ? 32.833  101.059 67.708  1.00 16.42 ? 178 PRO F C   1 
ATOM 10436 O O   . PRO F 1 178 ? 33.032  101.650 66.647  1.00 17.49 ? 178 PRO F O   1 
ATOM 10437 C CB  . PRO F 1 178 ? 32.332  102.211 69.894  1.00 17.63 ? 178 PRO F CB  1 
ATOM 10438 C CG  . PRO F 1 178 ? 32.538  101.076 70.849  1.00 19.40 ? 178 PRO F CG  1 
ATOM 10439 C CD  . PRO F 1 178 ? 31.248  100.319 70.700  1.00 19.72 ? 178 PRO F CD  1 
ATOM 10440 N N   . ASN F 1 179 ? 33.520  99.990  68.094  1.00 14.04 ? 179 ASN F N   1 
ATOM 10441 C CA  . ASN F 1 179 ? 34.582  99.407  67.292  1.00 12.12 ? 179 ASN F CA  1 
ATOM 10442 C C   . ASN F 1 179 ? 34.133  99.206  65.838  1.00 14.52 ? 179 ASN F C   1 
ATOM 10443 O O   . ASN F 1 179 ? 34.798  99.656  64.881  1.00 16.23 ? 179 ASN F O   1 
ATOM 10444 C CB  . ASN F 1 179 ? 34.988  98.075  67.915  1.00 6.96  ? 179 ASN F CB  1 
ATOM 10445 C CG  . ASN F 1 179 ? 35.816  97.234  66.987  1.00 2.00  ? 179 ASN F CG  1 
ATOM 10446 O OD1 . ASN F 1 179 ? 36.690  97.732  66.290  1.00 2.00  ? 179 ASN F OD1 1 
ATOM 10447 N ND2 . ASN F 1 179 ? 35.533  95.967  66.956  1.00 3.68  ? 179 ASN F ND2 1 
ATOM 10448 N N   . LEU F 1 180 ? 32.975  98.574  65.666  1.00 14.38 ? 180 LEU F N   1 
ATOM 10449 C CA  . LEU F 1 180 ? 32.432  98.327  64.338  1.00 16.03 ? 180 LEU F CA  1 
ATOM 10450 C C   . LEU F 1 180 ? 31.973  99.622  63.689  1.00 18.24 ? 180 LEU F C   1 
ATOM 10451 O O   . LEU F 1 180 ? 32.231  99.850  62.504  1.00 17.95 ? 180 LEU F O   1 
ATOM 10452 C CB  . LEU F 1 180 ? 31.293  97.313  64.405  1.00 15.00 ? 180 LEU F CB  1 
ATOM 10453 C CG  . LEU F 1 180 ? 31.787  95.916  64.781  1.00 15.48 ? 180 LEU F CG  1 
ATOM 10454 C CD1 . LEU F 1 180 ? 30.628  94.940  64.867  1.00 15.09 ? 180 LEU F CD1 1 
ATOM 10455 C CD2 . LEU F 1 180 ? 32.803  95.452  63.755  1.00 18.64 ? 180 LEU F CD2 1 
ATOM 10456 N N   . LYS F 1 181 ? 31.335  100.489 64.473  1.00 17.66 ? 181 LYS F N   1 
ATOM 10457 C CA  . LYS F 1 181 ? 30.871  101.771 63.954  1.00 18.82 ? 181 LYS F CA  1 
ATOM 10458 C C   . LYS F 1 181 ? 32.012  102.581 63.362  1.00 18.80 ? 181 LYS F C   1 
ATOM 10459 O O   . LYS F 1 181 ? 31.828  103.288 62.368  1.00 20.10 ? 181 LYS F O   1 
ATOM 10460 C CB  . LYS F 1 181 ? 30.173  102.596 65.032  1.00 17.44 ? 181 LYS F CB  1 
ATOM 10461 C CG  . LYS F 1 181 ? 28.709  102.271 65.206  1.00 18.06 ? 181 LYS F CG  1 
ATOM 10462 C CD  . LYS F 1 181 ? 27.996  103.434 65.858  1.00 15.47 ? 181 LYS F CD  1 
ATOM 10463 C CE  . LYS F 1 181 ? 28.643  103.789 67.185  1.00 17.04 ? 181 LYS F CE  1 
ATOM 10464 N NZ  . LYS F 1 181 ? 28.072  105.012 67.807  1.00 14.85 ? 181 LYS F NZ  1 
ATOM 10465 N N   . ASP F 1 182 ? 33.193  102.468 63.959  1.00 16.85 ? 182 ASP F N   1 
ATOM 10466 C CA  . ASP F 1 182 ? 34.335  103.203 63.454  1.00 17.13 ? 182 ASP F CA  1 
ATOM 10467 C C   . ASP F 1 182 ? 34.854  102.559 62.179  1.00 16.50 ? 182 ASP F C   1 
ATOM 10468 O O   . ASP F 1 182 ? 35.362  103.258 61.301  1.00 15.25 ? 182 ASP F O   1 
ATOM 10469 C CB  . ASP F 1 182 ? 35.439  103.322 64.510  1.00 20.52 ? 182 ASP F CB  1 
ATOM 10470 C CG  . ASP F 1 182 ? 35.897  104.768 64.711  1.00 19.16 ? 182 ASP F CG  1 
ATOM 10471 O OD1 . ASP F 1 182 ? 36.497  105.336 63.755  1.00 22.38 ? 182 ASP F OD1 1 
ATOM 10472 O OD2 . ASP F 1 182 ? 35.641  105.343 65.814  1.00 16.88 ? 182 ASP F OD2 1 
ATOM 10473 N N   . PHE F 1 183 ? 34.687  101.248 62.051  1.00 19.18 ? 183 PHE F N   1 
ATOM 10474 C CA  . PHE F 1 183 ? 35.139  100.566 60.848  1.00 20.01 ? 183 PHE F CA  1 
ATOM 10475 C C   . PHE F 1 183 ? 34.450  101.174 59.638  1.00 20.09 ? 183 PHE F C   1 
ATOM 10476 O O   . PHE F 1 183 ? 35.107  101.700 58.740  1.00 19.27 ? 183 PHE F O   1 
ATOM 10477 C CB  . PHE F 1 183 ? 34.831  99.071  60.901  1.00 17.24 ? 183 PHE F CB  1 
ATOM 10478 C CG  . PHE F 1 183 ? 35.213  98.335  59.641  1.00 19.27 ? 183 PHE F CG  1 
ATOM 10479 C CD1 . PHE F 1 183 ? 36.521  97.904  59.442  1.00 19.11 ? 183 PHE F CD1 1 
ATOM 10480 C CD2 . PHE F 1 183 ? 34.274  98.106  58.639  1.00 19.82 ? 183 PHE F CD2 1 
ATOM 10481 C CE1 . PHE F 1 183 ? 36.891  97.262  58.270  1.00 17.35 ? 183 PHE F CE1 1 
ATOM 10482 C CE2 . PHE F 1 183 ? 34.634  97.464  57.461  1.00 15.38 ? 183 PHE F CE2 1 
ATOM 10483 C CZ  . PHE F 1 183 ? 35.949  97.041  57.276  1.00 16.93 ? 183 PHE F CZ  1 
ATOM 10484 N N   . ILE F 1 184 ? 33.122  101.124 59.633  1.00 19.93 ? 184 ILE F N   1 
ATOM 10485 C CA  . ILE F 1 184 ? 32.349  101.666 58.520  1.00 17.11 ? 184 ILE F CA  1 
ATOM 10486 C C   . ILE F 1 184 ? 32.624  103.144 58.208  1.00 16.67 ? 184 ILE F C   1 
ATOM 10487 O O   . ILE F 1 184 ? 32.701  103.524 57.036  1.00 16.92 ? 184 ILE F O   1 
ATOM 10488 C CB  . ILE F 1 184 ? 30.823  101.374 58.658  1.00 16.03 ? 184 ILE F CB  1 
ATOM 10489 C CG1 . ILE F 1 184 ? 30.350  101.547 60.102  1.00 16.37 ? 184 ILE F CG1 1 
ATOM 10490 C CG2 . ILE F 1 184 ? 30.519  99.967  58.190  1.00 15.28 ? 184 ILE F CG2 1 
ATOM 10491 C CD1 . ILE F 1 184 ? 28.948  101.003 60.345  1.00 16.30 ? 184 ILE F CD1 1 
ATOM 10492 N N   . SER F 1 185 ? 32.823  103.963 59.238  1.00 14.16 ? 185 SER F N   1 
ATOM 10493 C CA  . SER F 1 185 ? 33.117  105.378 59.032  1.00 11.57 ? 185 SER F CA  1 
ATOM 10494 C C   . SER F 1 185 ? 34.459  105.482 58.302  1.00 13.19 ? 185 SER F C   1 
ATOM 10495 O O   . SER F 1 185 ? 34.668  106.380 57.481  1.00 11.22 ? 185 SER F O   1 
ATOM 10496 C CB  . SER F 1 185 ? 33.179  106.116 60.376  1.00 9.29  ? 185 SER F CB  1 
ATOM 10497 O OG  . SER F 1 185 ? 33.296  107.542 60.215  1.00 2.65  ? 185 SER F OG  1 
ATOM 10498 N N   . ARG F 1 186 ? 35.349  104.533 58.582  1.00 18.53 ? 186 ARG F N   1 
ATOM 10499 C CA  . ARG F 1 186 ? 36.671  104.479 57.961  1.00 19.46 ? 186 ARG F CA  1 
ATOM 10500 C C   . ARG F 1 186 ? 36.576  104.074 56.490  1.00 20.03 ? 186 ARG F C   1 
ATOM 10501 O O   . ARG F 1 186 ? 37.513  104.285 55.719  1.00 19.08 ? 186 ARG F O   1 
ATOM 10502 C CB  . ARG F 1 186 ? 37.575  103.508 58.738  1.00 15.18 ? 186 ARG F CB  1 
ATOM 10503 C CG  . ARG F 1 186 ? 38.957  103.280 58.135  1.00 16.85 ? 186 ARG F CG  1 
ATOM 10504 C CD  . ARG F 1 186 ? 39.945  102.669 59.127  1.00 15.09 ? 186 ARG F CD  1 
ATOM 10505 N NE  . ARG F 1 186 ? 39.398  101.516 59.829  1.00 16.57 ? 186 ARG F NE  1 
ATOM 10506 C CZ  . ARG F 1 186 ? 39.188  101.473 61.141  1.00 16.61 ? 186 ARG F CZ  1 
ATOM 10507 N NH1 . ARG F 1 186 ? 39.481  102.521 61.903  1.00 17.18 ? 186 ARG F NH1 1 
ATOM 10508 N NH2 . ARG F 1 186 ? 38.663  100.389 61.695  1.00 11.18 ? 186 ARG F NH2 1 
ATOM 10509 N N   . PHE F 1 187 ? 35.444  103.499 56.096  1.00 18.63 ? 187 PHE F N   1 
ATOM 10510 C CA  . PHE F 1 187 ? 35.263  103.100 54.709  1.00 18.46 ? 187 PHE F CA  1 
ATOM 10511 C C   . PHE F 1 187 ? 34.788  104.279 53.859  1.00 19.85 ? 187 PHE F C   1 
ATOM 10512 O O   . PHE F 1 187 ? 35.384  104.605 52.837  1.00 18.55 ? 187 PHE F O   1 
ATOM 10513 C CB  . PHE F 1 187 ? 34.266  101.948 54.602  1.00 15.31 ? 187 PHE F CB  1 
ATOM 10514 C CG  . PHE F 1 187 ? 34.488  101.084 53.405  1.00 11.17 ? 187 PHE F CG  1 
ATOM 10515 C CD1 . PHE F 1 187 ? 35.409  100.042 53.451  1.00 10.08 ? 187 PHE F CD1 1 
ATOM 10516 C CD2 . PHE F 1 187 ? 33.812  101.333 52.218  1.00 6.74  ? 187 PHE F CD2 1 
ATOM 10517 C CE1 . PHE F 1 187 ? 35.654  99.264  52.331  1.00 9.39  ? 187 PHE F CE1 1 
ATOM 10518 C CE2 . PHE F 1 187 ? 34.047  100.565 51.094  1.00 5.66  ? 187 PHE F CE2 1 
ATOM 10519 C CZ  . PHE F 1 187 ? 34.970  99.528  51.148  1.00 10.04 ? 187 PHE F CZ  1 
ATOM 10520 N N   . GLU F 1 188 ? 33.729  104.939 54.315  1.00 20.68 ? 188 GLU F N   1 
ATOM 10521 C CA  . GLU F 1 188 ? 33.138  106.082 53.609  1.00 21.13 ? 188 GLU F CA  1 
ATOM 10522 C C   . GLU F 1 188 ? 34.079  107.246 53.307  1.00 21.10 ? 188 GLU F C   1 
ATOM 10523 O O   . GLU F 1 188 ? 33.750  108.117 52.505  1.00 20.32 ? 188 GLU F O   1 
ATOM 10524 C CB  . GLU F 1 188 ? 31.930  106.618 54.380  1.00 23.68 ? 188 GLU F CB  1 
ATOM 10525 C CG  . GLU F 1 188 ? 30.788  105.635 54.512  1.00 26.93 ? 188 GLU F CG  1 
ATOM 10526 C CD  . GLU F 1 188 ? 29.545  106.275 55.089  1.00 29.92 ? 188 GLU F CD  1 
ATOM 10527 O OE1 . GLU F 1 188 ? 29.066  107.266 54.498  1.00 29.76 ? 188 GLU F OE1 1 
ATOM 10528 O OE2 . GLU F 1 188 ? 29.047  105.791 56.128  1.00 29.44 ? 188 GLU F OE2 1 
ATOM 10529 N N   . GLY F 1 189 ? 35.213  107.295 53.993  1.00 21.53 ? 189 GLY F N   1 
ATOM 10530 C CA  . GLY F 1 189 ? 36.162  108.368 53.765  1.00 19.21 ? 189 GLY F CA  1 
ATOM 10531 C C   . GLY F 1 189 ? 37.143  108.047 52.659  1.00 17.81 ? 189 GLY F C   1 
ATOM 10532 O O   . GLY F 1 189 ? 37.791  108.947 52.123  1.00 15.75 ? 189 GLY F O   1 
ATOM 10533 N N   . LEU F 1 190 ? 37.251  106.762 52.325  1.00 18.69 ? 190 LEU F N   1 
ATOM 10534 C CA  . LEU F 1 190 ? 38.164  106.295 51.286  1.00 17.49 ? 190 LEU F CA  1 
ATOM 10535 C C   . LEU F 1 190 ? 37.909  106.993 49.948  1.00 16.53 ? 190 LEU F C   1 
ATOM 10536 O O   . LEU F 1 190 ? 36.816  106.909 49.384  1.00 13.90 ? 190 LEU F O   1 
ATOM 10537 C CB  . LEU F 1 190 ? 38.052  104.778 51.121  1.00 13.40 ? 190 LEU F CB  1 
ATOM 10538 C CG  . LEU F 1 190 ? 38.365  103.867 52.316  1.00 12.34 ? 190 LEU F CG  1 
ATOM 10539 C CD1 . LEU F 1 190 ? 38.159  102.408 51.920  1.00 15.32 ? 190 LEU F CD1 1 
ATOM 10540 C CD2 . LEU F 1 190 ? 39.788  104.087 52.801  1.00 14.42 ? 190 LEU F CD2 1 
ATOM 10541 N N   . GLU F 1 191 ? 38.957  107.620 49.423  1.00 16.62 ? 191 GLU F N   1 
ATOM 10542 C CA  . GLU F 1 191 ? 38.913  108.381 48.175  1.00 19.20 ? 191 GLU F CA  1 
ATOM 10543 C C   . GLU F 1 191 ? 37.993  107.869 47.061  1.00 19.69 ? 191 GLU F C   1 
ATOM 10544 O O   . GLU F 1 191 ? 37.005  108.526 46.711  1.00 14.27 ? 191 GLU F O   1 
ATOM 10545 C CB  . GLU F 1 191 ? 40.334  108.586 47.647  1.00 17.67 ? 191 GLU F CB  1 
ATOM 10546 C CG  . GLU F 1 191 ? 40.450  109.688 46.608  1.00 20.68 ? 191 GLU F CG  1 
ATOM 10547 C CD  . GLU F 1 191 ? 41.886  110.079 46.317  1.00 22.46 ? 191 GLU F CD  1 
ATOM 10548 O OE1 . GLU F 1 191 ? 42.741  109.173 46.207  1.00 25.03 ? 191 GLU F OE1 1 
ATOM 10549 O OE2 . GLU F 1 191 ? 42.161  111.294 46.190  1.00 26.34 ? 191 GLU F OE2 1 
ATOM 10550 N N   . LYS F 1 192 ? 38.309  106.705 46.503  1.00 19.70 ? 192 LYS F N   1 
ATOM 10551 C CA  . LYS F 1 192 ? 37.491  106.147 45.431  1.00 19.50 ? 192 LYS F CA  1 
ATOM 10552 C C   . LYS F 1 192 ? 36.050  105.837 45.847  1.00 21.16 ? 192 LYS F C   1 
ATOM 10553 O O   . LYS F 1 192 ? 35.129  105.972 45.038  1.00 24.70 ? 192 LYS F O   1 
ATOM 10554 C CB  . LYS F 1 192 ? 38.152  104.907 44.815  1.00 21.87 ? 192 LYS F CB  1 
ATOM 10555 C CG  . LYS F 1 192 ? 39.029  105.190 43.594  1.00 21.83 ? 192 LYS F CG  1 
ATOM 10556 C CD  . LYS F 1 192 ? 40.485  105.468 43.948  1.00 22.24 ? 192 LYS F CD  1 
ATOM 10557 C CE  . LYS F 1 192 ? 41.185  104.205 44.416  1.00 26.41 ? 192 LYS F CE  1 
ATOM 10558 N NZ  . LYS F 1 192 ? 42.620  104.407 44.741  1.00 27.54 ? 192 LYS F NZ  1 
ATOM 10559 N N   . ILE F 1 193 ? 35.852  105.460 47.108  1.00 20.39 ? 193 ILE F N   1 
ATOM 10560 C CA  . ILE F 1 193 ? 34.519  105.140 47.619  1.00 19.98 ? 193 ILE F CA  1 
ATOM 10561 C C   . ILE F 1 193 ? 33.656  106.386 47.839  1.00 20.36 ? 193 ILE F C   1 
ATOM 10562 O O   . ILE F 1 193 ? 32.443  106.350 47.611  1.00 21.74 ? 193 ILE F O   1 
ATOM 10563 C CB  . ILE F 1 193 ? 34.604  104.322 48.916  1.00 18.96 ? 193 ILE F CB  1 
ATOM 10564 C CG1 . ILE F 1 193 ? 35.333  103.011 48.642  1.00 16.41 ? 193 ILE F CG1 1 
ATOM 10565 C CG2 . ILE F 1 193 ? 33.221  104.041 49.468  1.00 17.16 ? 193 ILE F CG2 1 
ATOM 10566 C CD1 . ILE F 1 193 ? 34.745  102.232 47.492  1.00 20.10 ? 193 ILE F CD1 1 
ATOM 10567 N N   . SER F 1 194 ? 34.288  107.491 48.235  1.00 21.44 ? 194 SER F N   1 
ATOM 10568 C CA  . SER F 1 194 ? 33.595  108.760 48.476  1.00 23.35 ? 194 SER F CA  1 
ATOM 10569 C C   . SER F 1 194 ? 32.928  109.254 47.191  1.00 22.76 ? 194 SER F C   1 
ATOM 10570 O O   . SER F 1 194 ? 31.755  109.698 47.198  1.00 23.55 ? 194 SER F O   1 
ATOM 10571 C CB  . SER F 1 194 ? 34.589  109.807 49.003  1.00 24.44 ? 194 SER F CB  1 
ATOM 10572 O OG  . SER F 1 194 ? 33.944  111.005 49.395  1.00 22.47 ? 194 SER F OG  1 
ATOM 10573 N N   . ALA F 1 195 ? 33.658  109.131 46.085  1.00 26.28 ? 195 ALA F N   1 
ATOM 10574 C CA  . ALA F 1 195 ? 33.169  109.546 44.776  1.00 27.00 ? 195 ALA F CA  1 
ATOM 10575 C C   . ALA F 1 195 ? 32.052  108.639 44.282  1.00 28.15 ? 195 ALA F C   1 
ATOM 10576 O O   . ALA F 1 195 ? 31.008  109.120 43.845  1.00 28.69 ? 195 ALA F O   1 
ATOM 10577 C CB  . ALA F 1 195 ? 34.311  109.568 43.771  1.00 25.55 ? 195 ALA F CB  1 
ATOM 10578 N N   . TYR F 1 196 ? 32.264  107.329 44.379  1.00 28.32 ? 196 TYR F N   1 
ATOM 10579 C CA  . TYR F 1 196 ? 31.272  106.350 43.935  1.00 28.86 ? 196 TYR F CA  1 
ATOM 10580 C C   . TYR F 1 196 ? 29.918  106.496 44.625  1.00 29.20 ? 196 TYR F C   1 
ATOM 10581 O O   . TYR F 1 196 ? 28.875  106.421 43.972  1.00 29.01 ? 196 TYR F O   1 
ATOM 10582 C CB  . TYR F 1 196 ? 31.782  104.923 44.135  1.00 28.90 ? 196 TYR F CB  1 
ATOM 10583 C CG  . TYR F 1 196 ? 30.793  103.862 43.695  1.00 29.55 ? 196 TYR F CG  1 
ATOM 10584 C CD1 . TYR F 1 196 ? 30.262  103.868 42.405  1.00 26.97 ? 196 TYR F CD1 1 
ATOM 10585 C CD2 . TYR F 1 196 ? 30.367  102.869 44.575  1.00 32.75 ? 196 TYR F CD2 1 
ATOM 10586 C CE1 . TYR F 1 196 ? 29.330  102.917 42.004  1.00 28.27 ? 196 TYR F CE1 1 
ATOM 10587 C CE2 . TYR F 1 196 ? 29.435  101.912 44.181  1.00 31.08 ? 196 TYR F CE2 1 
ATOM 10588 C CZ  . TYR F 1 196 ? 28.921  101.945 42.896  1.00 29.14 ? 196 TYR F CZ  1 
ATOM 10589 O OH  . TYR F 1 196 ? 27.994  101.010 42.504  1.00 31.99 ? 196 TYR F OH  1 
ATOM 10590 N N   . MET F 1 197 ? 29.927  106.665 45.944  1.00 25.69 ? 197 MET F N   1 
ATOM 10591 C CA  . MET F 1 197 ? 28.677  106.812 46.681  1.00 25.03 ? 197 MET F CA  1 
ATOM 10592 C C   . MET F 1 197 ? 27.979  108.149 46.425  1.00 25.79 ? 197 MET F C   1 
ATOM 10593 O O   . MET F 1 197 ? 26.766  108.262 46.604  1.00 26.67 ? 197 MET F O   1 
ATOM 10594 C CB  . MET F 1 197 ? 28.891  106.594 48.175  1.00 22.60 ? 197 MET F CB  1 
ATOM 10595 C CG  . MET F 1 197 ? 29.320  105.188 48.536  1.00 18.80 ? 197 MET F CG  1 
ATOM 10596 S SD  . MET F 1 197 ? 29.168  104.889 50.306  1.00 15.22 ? 197 MET F SD  1 
ATOM 10597 C CE  . MET F 1 197 ? 29.994  106.328 50.964  1.00 15.06 ? 197 MET F CE  1 
ATOM 10598 N N   . LYS F 1 198 ? 28.739  109.155 46.004  1.00 27.26 ? 198 LYS F N   1 
ATOM 10599 C CA  . LYS F 1 198 ? 28.157  110.458 45.714  1.00 27.07 ? 198 LYS F CA  1 
ATOM 10600 C C   . LYS F 1 198 ? 28.002  110.622 44.205  1.00 26.73 ? 198 LYS F C   1 
ATOM 10601 O O   . LYS F 1 198 ? 27.904  111.746 43.699  1.00 24.72 ? 198 LYS F O   1 
ATOM 10602 C CB  . LYS F 1 198 ? 29.035  111.574 46.285  1.00 26.59 ? 198 LYS F CB  1 
ATOM 10603 C CG  . LYS F 1 198 ? 28.260  112.605 47.089  1.00 29.10 ? 198 LYS F CG  1 
ATOM 10604 C CD  . LYS F 1 198 ? 27.625  111.958 48.310  1.00 31.61 ? 198 LYS F CD  1 
ATOM 10605 C CE  . LYS F 1 198 ? 26.748  112.928 49.079  1.00 28.61 ? 198 LYS F CE  1 
ATOM 10606 N NZ  . LYS F 1 198 ? 27.503  114.076 49.638  1.00 26.59 ? 198 LYS F NZ  1 
ATOM 10607 N N   . SER F 1 199 ? 27.983  109.494 43.495  1.00 26.13 ? 199 SER F N   1 
ATOM 10608 C CA  . SER F 1 199 ? 27.847  109.501 42.043  1.00 26.60 ? 199 SER F CA  1 
ATOM 10609 C C   . SER F 1 199 ? 26.501  108.934 41.599  1.00 27.45 ? 199 SER F C   1 
ATOM 10610 O O   . SER F 1 199 ? 25.724  108.428 42.411  1.00 28.03 ? 199 SER F O   1 
ATOM 10611 C CB  . SER F 1 199 ? 28.991  108.716 41.383  1.00 25.92 ? 199 SER F CB  1 
ATOM 10612 O OG  . SER F 1 199 ? 28.743  107.317 41.366  1.00 26.41 ? 199 SER F OG  1 
ATOM 10613 N N   . SER F 1 200 ? 26.263  108.981 40.293  1.00 26.15 ? 200 SER F N   1 
ATOM 10614 C CA  . SER F 1 200 ? 25.025  108.493 39.702  1.00 27.73 ? 200 SER F CA  1 
ATOM 10615 C C   . SER F 1 200 ? 24.985  106.972 39.518  1.00 27.88 ? 200 SER F C   1 
ATOM 10616 O O   . SER F 1 200 ? 23.968  106.432 39.081  1.00 27.85 ? 200 SER F O   1 
ATOM 10617 C CB  . SER F 1 200 ? 24.797  109.184 38.353  1.00 28.40 ? 200 SER F CB  1 
ATOM 10618 O OG  . SER F 1 200 ? 25.032  110.582 38.448  1.00 33.38 ? 200 SER F OG  1 
ATOM 10619 N N   . ARG F 1 201 ? 26.085  106.288 39.828  1.00 24.78 ? 201 ARG F N   1 
ATOM 10620 C CA  . ARG F 1 201 ? 26.138  104.836 39.674  1.00 24.71 ? 201 ARG F CA  1 
ATOM 10621 C C   . ARG F 1 201 ? 25.818  104.114 40.971  1.00 25.72 ? 201 ARG F C   1 
ATOM 10622 O O   . ARG F 1 201 ? 25.579  102.904 40.978  1.00 23.01 ? 201 ARG F O   1 
ATOM 10623 C CB  . ARG F 1 201 ? 27.516  104.392 39.189  1.00 24.58 ? 201 ARG F CB  1 
ATOM 10624 C CG  . ARG F 1 201 ? 28.004  105.122 37.961  1.00 24.08 ? 201 ARG F CG  1 
ATOM 10625 C CD  . ARG F 1 201 ? 28.912  106.277 38.331  1.00 24.94 ? 201 ARG F CD  1 
ATOM 10626 N NE  . ARG F 1 201 ? 30.295  105.841 38.527  1.00 26.68 ? 201 ARG F NE  1 
ATOM 10627 C CZ  . ARG F 1 201 ? 31.310  106.659 38.794  1.00 25.89 ? 201 ARG F CZ  1 
ATOM 10628 N NH1 . ARG F 1 201 ? 31.107  107.965 38.911  1.00 27.60 ? 201 ARG F NH1 1 
ATOM 10629 N NH2 . ARG F 1 201 ? 32.543  106.181 38.891  1.00 22.64 ? 201 ARG F NH2 1 
ATOM 10630 N N   . PHE F 1 202 ? 25.803  104.864 42.066  1.00 26.35 ? 202 PHE F N   1 
ATOM 10631 C CA  . PHE F 1 202 ? 25.545  104.296 43.381  1.00 26.46 ? 202 PHE F CA  1 
ATOM 10632 C C   . PHE F 1 202 ? 24.135  103.730 43.569  1.00 25.28 ? 202 PHE F C   1 
ATOM 10633 O O   . PHE F 1 202 ? 23.146  104.466 43.587  1.00 25.68 ? 202 PHE F O   1 
ATOM 10634 C CB  . PHE F 1 202 ? 25.862  105.324 44.474  1.00 24.81 ? 202 PHE F CB  1 
ATOM 10635 C CG  . PHE F 1 202 ? 25.832  104.759 45.863  1.00 20.70 ? 202 PHE F CG  1 
ATOM 10636 C CD1 . PHE F 1 202 ? 26.409  103.522 46.134  1.00 21.83 ? 202 PHE F CD1 1 
ATOM 10637 C CD2 . PHE F 1 202 ? 25.208  105.450 46.895  1.00 19.34 ? 202 PHE F CD2 1 
ATOM 10638 C CE1 . PHE F 1 202 ? 26.363  102.964 47.411  1.00 23.06 ? 202 PHE F CE1 1 
ATOM 10639 C CE2 . PHE F 1 202 ? 25.156  104.918 48.174  1.00 23.45 ? 202 PHE F CE2 1 
ATOM 10640 C CZ  . PHE F 1 202 ? 25.734  103.673 48.435  1.00 22.49 ? 202 PHE F CZ  1 
ATOM 10641 N N   . LEU F 1 203 ? 24.069  102.413 43.737  1.00 25.18 ? 203 LEU F N   1 
ATOM 10642 C CA  . LEU F 1 203 ? 22.808  101.705 43.937  1.00 25.06 ? 203 LEU F CA  1 
ATOM 10643 C C   . LEU F 1 203 ? 22.698  101.204 45.375  1.00 25.97 ? 203 LEU F C   1 
ATOM 10644 O O   . LEU F 1 203 ? 23.285  100.176 45.730  1.00 24.55 ? 203 LEU F O   1 
ATOM 10645 C CB  . LEU F 1 203 ? 22.716  100.505 42.987  1.00 23.99 ? 203 LEU F CB  1 
ATOM 10646 C CG  . LEU F 1 203 ? 21.648  100.421 41.894  1.00 21.43 ? 203 LEU F CG  1 
ATOM 10647 C CD1 . LEU F 1 203 ? 20.258  100.511 42.506  1.00 20.00 ? 203 LEU F CD1 1 
ATOM 10648 C CD2 . LEU F 1 203 ? 21.873  101.513 40.860  1.00 22.45 ? 203 LEU F CD2 1 
ATOM 10649 N N   . PRO F 1 204 ? 22.005  101.957 46.239  1.00 28.36 ? 204 PRO F N   1 
ATOM 10650 C CA  . PRO F 1 204 ? 21.839  101.555 47.640  1.00 27.21 ? 204 PRO F CA  1 
ATOM 10651 C C   . PRO F 1 204 ? 20.607  100.673 47.879  1.00 26.38 ? 204 PRO F C   1 
ATOM 10652 O O   . PRO F 1 204 ? 20.644  99.752  48.684  1.00 25.53 ? 204 PRO F O   1 
ATOM 10653 C CB  . PRO F 1 204 ? 21.710  102.896 48.358  1.00 26.92 ? 204 PRO F CB  1 
ATOM 10654 C CG  . PRO F 1 204 ? 20.958  103.719 47.365  1.00 30.36 ? 204 PRO F CG  1 
ATOM 10655 C CD  . PRO F 1 204 ? 21.620  103.369 46.047  1.00 29.01 ? 204 PRO F CD  1 
ATOM 10656 N N   . LYS F 1 205 ? 19.522  100.939 47.168  1.00 25.08 ? 205 LYS F N   1 
ATOM 10657 C CA  . LYS F 1 205 ? 18.280  100.205 47.325  1.00 24.44 ? 205 LYS F CA  1 
ATOM 10658 C C   . LYS F 1 205 ? 17.593  100.041 45.981  1.00 24.36 ? 205 LYS F C   1 
ATOM 10659 O O   . LYS F 1 205 ? 17.850  100.808 45.053  1.00 26.09 ? 205 LYS F O   1 
ATOM 10660 C CB  . LYS F 1 205 ? 17.324  100.947 48.262  1.00 23.61 ? 205 LYS F CB  1 
ATOM 10661 C CG  . LYS F 1 205 ? 16.918  102.324 47.748  1.00 21.16 ? 205 LYS F CG  1 
ATOM 10662 C CD  . LYS F 1 205 ? 15.737  102.928 48.489  1.00 19.98 ? 205 LYS F CD  1 
ATOM 10663 C CE  . LYS F 1 205 ? 15.925  102.942 49.999  1.00 17.59 ? 205 LYS F CE  1 
ATOM 10664 N NZ  . LYS F 1 205 ? 15.575  101.639 50.627  1.00 15.03 ? 205 LYS F NZ  1 
ATOM 10665 N N   . PRO F 1 206 ? 16.669  99.082  45.871  1.00 22.28 ? 206 PRO F N   1 
ATOM 10666 C CA  . PRO F 1 206 ? 16.257  98.151  46.936  1.00 22.15 ? 206 PRO F CA  1 
ATOM 10667 C C   . PRO F 1 206 ? 17.329  97.124  47.290  1.00 23.07 ? 206 PRO F C   1 
ATOM 10668 O O   . PRO F 1 206 ? 18.125  96.720  46.441  1.00 23.88 ? 206 PRO F O   1 
ATOM 10669 C CB  . PRO F 1 206 ? 15.012  97.482  46.348  1.00 22.12 ? 206 PRO F CB  1 
ATOM 10670 C CG  . PRO F 1 206 ? 15.280  97.502  44.876  1.00 23.17 ? 206 PRO F CG  1 
ATOM 10671 C CD  . PRO F 1 206 ? 15.836  98.889  44.669  1.00 24.61 ? 206 PRO F CD  1 
ATOM 10672 N N   . LEU F 1 207 ? 17.376  96.738  48.558  1.00 24.84 ? 207 LEU F N   1 
ATOM 10673 C CA  . LEU F 1 207 ? 18.359  95.758  48.992  1.00 22.96 ? 207 LEU F CA  1 
ATOM 10674 C C   . LEU F 1 207 ? 17.939  94.380  48.504  1.00 22.34 ? 207 LEU F C   1 
ATOM 10675 O O   . LEU F 1 207 ? 18.776  93.576  48.082  1.00 22.55 ? 207 LEU F O   1 
ATOM 10676 C CB  . LEU F 1 207 ? 18.529  95.752  50.520  1.00 20.65 ? 207 LEU F CB  1 
ATOM 10677 C CG  . LEU F 1 207 ? 17.530  96.416  51.472  1.00 20.04 ? 207 LEU F CG  1 
ATOM 10678 C CD1 . LEU F 1 207 ? 17.779  95.895  52.875  1.00 18.79 ? 207 LEU F CD1 1 
ATOM 10679 C CD2 . LEU F 1 207 ? 17.664  97.939  51.431  1.00 20.00 ? 207 LEU F CD2 1 
ATOM 10680 N N   . TYR F 1 208 ? 16.635  94.133  48.522  1.00 21.65 ? 208 TYR F N   1 
ATOM 10681 C CA  . TYR F 1 208 ? 16.094  92.854  48.090  1.00 22.73 ? 208 TYR F CA  1 
ATOM 10682 C C   . TYR F 1 208 ? 15.218  93.017  46.845  1.00 22.34 ? 208 TYR F C   1 
ATOM 10683 O O   . TYR F 1 208 ? 14.892  94.140  46.439  1.00 22.42 ? 208 TYR F O   1 
ATOM 10684 C CB  . TYR F 1 208 ? 15.294  92.219  49.227  1.00 22.61 ? 208 TYR F CB  1 
ATOM 10685 C CG  . TYR F 1 208 ? 16.108  91.916  50.462  1.00 24.13 ? 208 TYR F CG  1 
ATOM 10686 C CD1 . TYR F 1 208 ? 16.437  92.921  51.375  1.00 24.88 ? 208 TYR F CD1 1 
ATOM 10687 C CD2 . TYR F 1 208 ? 16.546  90.623  50.723  1.00 24.43 ? 208 TYR F CD2 1 
ATOM 10688 C CE1 . TYR F 1 208 ? 17.182  92.639  52.521  1.00 24.15 ? 208 TYR F CE1 1 
ATOM 10689 C CE2 . TYR F 1 208 ? 17.290  90.331  51.863  1.00 23.23 ? 208 TYR F CE2 1 
ATOM 10690 C CZ  . TYR F 1 208 ? 17.605  91.341  52.757  1.00 22.47 ? 208 TYR F CZ  1 
ATOM 10691 O OH  . TYR F 1 208 ? 18.334  91.045  53.887  1.00 17.23 ? 208 TYR F OH  1 
ATOM 10692 N N   . THR F 1 209 ? 14.861  91.895  46.228  1.00 20.38 ? 209 THR F N   1 
ATOM 10693 C CA  . THR F 1 209 ? 14.028  91.910  45.029  1.00 19.94 ? 209 THR F CA  1 
ATOM 10694 C C   . THR F 1 209 ? 12.575  92.222  45.377  1.00 19.73 ? 209 THR F C   1 
ATOM 10695 O O   . THR F 1 209 ? 12.215  92.306  46.552  1.00 17.52 ? 209 THR F O   1 
ATOM 10696 C CB  . THR F 1 209 ? 14.117  90.570  44.272  1.00 18.91 ? 209 THR F CB  1 
ATOM 10697 O OG1 . THR F 1 209 ? 13.632  89.506  45.104  1.00 17.53 ? 209 THR F OG1 1 
ATOM 10698 C CG2 . THR F 1 209 ? 15.567  90.280  43.880  1.00 18.27 ? 209 THR F CG2 1 
ATOM 10699 N N   . ARG F 1 210 ? 11.741  92.358  44.350  1.00 17.85 ? 210 ARG F N   1 
ATOM 10700 C CA  . ARG F 1 210 ? 10.321  92.676  44.522  1.00 19.65 ? 210 ARG F CA  1 
ATOM 10701 C C   . ARG F 1 210 ? 9.578   91.699  45.435  1.00 18.65 ? 210 ARG F C   1 
ATOM 10702 O O   . ARG F 1 210 ? 8.722   92.102  46.220  1.00 16.50 ? 210 ARG F O   1 
ATOM 10703 C CB  . ARG F 1 210 ? 9.617   92.702  43.161  1.00 21.21 ? 210 ARG F CB  1 
ATOM 10704 C CG  . ARG F 1 210 ? 10.268  93.582  42.097  1.00 24.11 ? 210 ARG F CG  1 
ATOM 10705 C CD  . ARG F 1 210 ? 9.631   94.961  42.008  1.00 25.58 ? 210 ARG F CD  1 
ATOM 10706 N NE  . ARG F 1 210 ? 9.689   95.472  40.640  1.00 26.93 ? 210 ARG F NE  1 
ATOM 10707 C CZ  . ARG F 1 210 ? 9.115   96.600  40.229  1.00 26.93 ? 210 ARG F CZ  1 
ATOM 10708 N NH1 . ARG F 1 210 ? 8.439   97.358  41.079  1.00 26.28 ? 210 ARG F NH1 1 
ATOM 10709 N NH2 . ARG F 1 210 ? 9.188   96.951  38.953  1.00 26.73 ? 210 ARG F NH2 1 
ATOM 10710 N N   . VAL F 1 211 ? 9.918   90.418  45.321  1.00 17.93 ? 211 VAL F N   1 
ATOM 10711 C CA  . VAL F 1 211 ? 9.291   89.353  46.106  1.00 16.02 ? 211 VAL F CA  1 
ATOM 10712 C C   . VAL F 1 211 ? 9.618   89.414  47.604  1.00 17.26 ? 211 VAL F C   1 
ATOM 10713 O O   . VAL F 1 211 ? 9.071   88.653  48.405  1.00 15.91 ? 211 VAL F O   1 
ATOM 10714 C CB  . VAL F 1 211 ? 9.681   87.958  45.532  1.00 13.84 ? 211 VAL F CB  1 
ATOM 10715 C CG1 . VAL F 1 211 ? 11.165  87.699  45.720  1.00 12.23 ? 211 VAL F CG1 1 
ATOM 10716 C CG2 . VAL F 1 211 ? 8.835   86.825  46.157  1.00 15.05 ? 211 VAL F CG2 1 
ATOM 10717 N N   . ALA F 1 212 ? 10.504  90.328  47.980  1.00 19.06 ? 212 ALA F N   1 
ATOM 10718 C CA  . ALA F 1 212 ? 10.903  90.488  49.375  1.00 16.18 ? 212 ALA F CA  1 
ATOM 10719 C C   . ALA F 1 212 ? 9.783   91.055  50.248  1.00 15.06 ? 212 ALA F C   1 
ATOM 10720 O O   . ALA F 1 212 ? 9.169   92.067  49.904  1.00 6.20  ? 212 ALA F O   1 
ATOM 10721 C CB  . ALA F 1 212 ? 12.119  91.389  49.459  1.00 15.61 ? 212 ALA F CB  1 
ATOM 10722 N N   . VAL F 1 213 ? 9.528   90.418  51.388  1.00 18.05 ? 213 VAL F N   1 
ATOM 10723 C CA  . VAL F 1 213 ? 8.489   90.903  52.293  1.00 19.96 ? 213 VAL F CA  1 
ATOM 10724 C C   . VAL F 1 213 ? 8.907   92.269  52.853  1.00 22.69 ? 213 VAL F C   1 
ATOM 10725 O O   . VAL F 1 213 ? 8.060   93.085  53.220  1.00 24.41 ? 213 VAL F O   1 
ATOM 10726 C CB  . VAL F 1 213 ? 8.200   89.901  53.452  1.00 17.60 ? 213 VAL F CB  1 
ATOM 10727 C CG1 . VAL F 1 213 ? 7.746   88.564  52.890  1.00 16.32 ? 213 VAL F CG1 1 
ATOM 10728 C CG2 . VAL F 1 213 ? 9.431   89.720  54.332  1.00 19.57 ? 213 VAL F CG2 1 
ATOM 10729 N N   . TRP F 1 214 ? 10.216  92.521  52.867  1.00 24.62 ? 214 TRP F N   1 
ATOM 10730 C CA  . TRP F 1 214 ? 10.782  93.773  53.361  1.00 25.52 ? 214 TRP F CA  1 
ATOM 10731 C C   . TRP F 1 214 ? 11.942  94.198  52.453  1.00 24.43 ? 214 TRP F C   1 
ATOM 10732 O O   . TRP F 1 214 ? 12.517  93.374  51.738  1.00 23.35 ? 214 TRP F O   1 
ATOM 10733 C CB  . TRP F 1 214 ? 11.283  93.593  54.808  1.00 23.83 ? 214 TRP F CB  1 
ATOM 10734 C CG  . TRP F 1 214 ? 11.811  94.855  55.460  1.00 24.18 ? 214 TRP F CG  1 
ATOM 10735 C CD1 . TRP F 1 214 ? 11.085  95.798  56.139  1.00 24.98 ? 214 TRP F CD1 1 
ATOM 10736 C CD2 . TRP F 1 214 ? 13.176  95.307  55.488  1.00 23.76 ? 214 TRP F CD2 1 
ATOM 10737 N NE1 . TRP F 1 214 ? 11.913  96.804  56.583  1.00 23.52 ? 214 TRP F NE1 1 
ATOM 10738 C CE2 . TRP F 1 214 ? 13.199  96.530  56.198  1.00 22.40 ? 214 TRP F CE2 1 
ATOM 10739 C CE3 . TRP F 1 214 ? 14.381  94.798  54.980  1.00 24.31 ? 214 TRP F CE3 1 
ATOM 10740 C CZ2 . TRP F 1 214 ? 14.383  97.253  56.412  1.00 20.79 ? 214 TRP F CZ2 1 
ATOM 10741 C CZ3 . TRP F 1 214 ? 15.556  95.517  55.193  1.00 21.61 ? 214 TRP F CZ3 1 
ATOM 10742 C CH2 . TRP F 1 214 ? 15.546  96.731  55.903  1.00 20.42 ? 214 TRP F CH2 1 
ATOM 10743 N N   . GLY F 1 215 ? 12.248  95.494  52.462  1.00 23.62 ? 215 GLY F N   1 
ATOM 10744 C CA  . GLY F 1 215 ? 13.343  96.032  51.669  1.00 26.48 ? 215 GLY F CA  1 
ATOM 10745 C C   . GLY F 1 215 ? 13.178  95.938  50.165  1.00 26.62 ? 215 GLY F C   1 
ATOM 10746 O O   . GLY F 1 215 ? 14.178  96.033  49.422  1.00 27.73 ? 215 GLY F O   1 
ATOM 10747 N N   . ASN F 1 216 ? 11.940  95.753  49.718  1.00 26.96 ? 216 ASN F N   1 
ATOM 10748 C CA  . ASN F 1 216 ? 11.621  95.644  48.294  1.00 28.41 ? 216 ASN F CA  1 
ATOM 10749 C C   . ASN F 1 216 ? 11.320  97.024  47.723  1.00 30.11 ? 216 ASN F C   1 
ATOM 10750 O O   . ASN F 1 216 ? 11.032  97.964  48.476  1.00 32.86 ? 216 ASN F O   1 
ATOM 10751 C CB  . ASN F 1 216 ? 10.407  94.725  48.088  1.00 28.70 ? 216 ASN F CB  1 
ATOM 10752 C CG  . ASN F 1 216 ? 9.155   95.218  48.817  1.00 28.73 ? 216 ASN F CG  1 
ATOM 10753 O OD1 . ASN F 1 216 ? 8.978   96.409  49.076  1.00 26.56 ? 216 ASN F OD1 1 
ATOM 10754 N ND2 . ASN F 1 216 ? 8.261   94.316  49.134  1.00 29.84 ? 216 ASN F ND2 1 
ATOM 10755 N N   . LYS F 1 217 ? 11.388  97.144  46.416  1.00 30.51 ? 217 LYS F N   1 
ATOM 10756 C CA  . LYS F 1 217 ? 11.110  98.410  45.730  1.00 30.30 ? 217 LYS F CA  1 
ATOM 10757 C C   . LYS F 1 217 ? 11.157  98.251  44.209  1.00 30.23 ? 217 LYS F C   1 
ATOM 10758 O O   . LYS F 1 217 ? 10.317  98.871  43.523  1.00 32.91 ? 217 LYS F O   1 
ATOM 10759 C CB  . LYS F 1 217 ? 12.120  99.467  46.155  1.00 29.74 ? 217 LYS F CB  1 
ATOM 10760 C CG  . LYS F 1 217 ? 11.586  100.881 46.175  1.00 27.25 ? 217 LYS F CG  1 
ATOM 10761 C CD  . LYS F 1 217 ? 12.546  101.817 46.881  1.00 29.65 ? 217 LYS F CD  1 
ATOM 10762 C CE  . LYS F 1 217 ? 12.726  101.436 48.349  1.00 30.19 ? 217 LYS F CE  1 
ATOM 10763 N NZ  . LYS F 1 217 ? 13.621  100.254 48.566  1.00 26.93 ? 217 LYS F NZ  1 
ATOM 10764 O OXT . LYS F 1 217 ? 12.040  97.514  43.721  1.00 29.80 ? 217 LYS F OXT 1 
ATOM 10765 N N   . SER G 1 1   ? 66.085  120.298 46.202  1.00 15.51 ? 1   SER G N   1 
ATOM 10766 C CA  . SER G 1 1   ? 64.606  120.411 46.283  1.00 15.94 ? 1   SER G CA  1 
ATOM 10767 C C   . SER G 1 1   ? 64.269  121.408 47.397  1.00 16.84 ? 1   SER G C   1 
ATOM 10768 O O   . SER G 1 1   ? 65.199  122.130 47.851  1.00 14.19 ? 1   SER G O   1 
ATOM 10769 C CB  . SER G 1 1   ? 64.018  119.025 46.574  1.00 14.95 ? 1   SER G CB  1 
ATOM 10770 O OG  . SER G 1 1   ? 64.870  118.273 47.425  1.00 12.55 ? 1   SER G OG  1 
ATOM 10771 N N   . MET G 1 2   ? 63.023  121.470 47.814  1.00 17.64 ? 2   MET G N   1 
ATOM 10772 C CA  . MET G 1 2   ? 62.612  122.380 48.878  1.00 18.27 ? 2   MET G CA  1 
ATOM 10773 C C   . MET G 1 2   ? 63.016  121.793 50.217  1.00 18.96 ? 2   MET G C   1 
ATOM 10774 O O   . MET G 1 2   ? 63.114  120.577 50.352  1.00 20.43 ? 2   MET G O   1 
ATOM 10775 C CB  . MET G 1 2   ? 61.094  122.557 48.873  1.00 18.57 ? 2   MET G CB  1 
ATOM 10776 C CG  . MET G 1 2   ? 60.480  122.897 47.529  1.00 14.54 ? 2   MET G CG  1 
ATOM 10777 S SD  . MET G 1 2   ? 58.774  123.427 47.734  1.00 7.54  ? 2   MET G SD  1 
ATOM 10778 C CE  . MET G 1 2   ? 57.939  121.928 47.784  1.00 12.75 ? 2   MET G CE  1 
ATOM 10779 N N   . THR G 1 3   ? 63.261  122.647 51.201  1.00 18.41 ? 3   THR G N   1 
ATOM 10780 C CA  . THR G 1 3   ? 63.616  122.169 52.528  1.00 19.12 ? 3   THR G CA  1 
ATOM 10781 C C   . THR G 1 3   ? 62.995  123.063 53.600  1.00 17.37 ? 3   THR G C   1 
ATOM 10782 O O   . THR G 1 3   ? 63.054  124.289 53.526  1.00 15.99 ? 3   THR G O   1 
ATOM 10783 C CB  . THR G 1 3   ? 65.162  122.032 52.712  1.00 18.81 ? 3   THR G CB  1 
ATOM 10784 O OG1 . THR G 1 3   ? 65.465  121.665 54.066  1.00 17.47 ? 3   THR G OG1 1 
ATOM 10785 C CG2 . THR G 1 3   ? 65.884  123.320 52.350  1.00 21.01 ? 3   THR G CG2 1 
ATOM 10786 N N   . LEU G 1 4   ? 62.270  122.443 54.522  1.00 15.15 ? 4   LEU G N   1 
ATOM 10787 C CA  . LEU G 1 4   ? 61.645  123.178 55.609  1.00 11.63 ? 4   LEU G CA  1 
ATOM 10788 C C   . LEU G 1 4   ? 62.293  122.663 56.877  1.00 11.62 ? 4   LEU G C   1 
ATOM 10789 O O   . LEU G 1 4   ? 62.829  121.527 56.904  1.00 11.32 ? 4   LEU G O   1 
ATOM 10790 C CB  . LEU G 1 4   ? 60.134  122.935 55.677  1.00 11.05 ? 4   LEU G CB  1 
ATOM 10791 C CG  . LEU G 1 4   ? 59.646  121.659 56.368  1.00 7.50  ? 4   LEU G CG  1 
ATOM 10792 C CD1 . LEU G 1 4   ? 58.370  121.924 57.131  1.00 2.00  ? 4   LEU G CD1 1 
ATOM 10793 C CD2 . LEU G 1 4   ? 59.477  120.547 55.356  1.00 4.36  ? 4   LEU G CD2 1 
ATOM 10794 N N   . GLY G 1 5   ? 62.234  123.470 57.928  1.00 9.45  ? 5   GLY G N   1 
ATOM 10795 C CA  . GLY G 1 5   ? 62.833  123.064 59.178  1.00 8.80  ? 5   GLY G CA  1 
ATOM 10796 C C   . GLY G 1 5   ? 61.936  123.289 60.368  1.00 9.30  ? 5   GLY G C   1 
ATOM 10797 O O   . GLY G 1 5   ? 61.143  124.272 60.396  1.00 9.54  ? 5   GLY G O   1 
ATOM 10798 N N   . TYR G 1 6   ? 62.064  122.424 61.348  1.00 11.25 ? 6   TYR G N   1 
ATOM 10799 C CA  . TYR G 1 6   ? 61.306  122.502 62.582  1.00 12.15 ? 6   TYR G CA  1 
ATOM 10800 C C   . TYR G 1 6   ? 61.902  121.462 63.523  1.00 15.64 ? 6   TYR G C   1 
ATOM 10801 O O   . TYR G 1 6   ? 62.645  120.574 63.084  1.00 15.05 ? 6   TYR G O   1 
ATOM 10802 C CB  . TYR G 1 6   ? 59.824  122.220 62.333  1.00 9.68  ? 6   TYR G CB  1 
ATOM 10803 C CG  . TYR G 1 6   ? 58.930  122.687 63.460  1.00 7.32  ? 6   TYR G CG  1 
ATOM 10804 C CD1 . TYR G 1 6   ? 58.772  124.046 63.735  1.00 3.86  ? 6   TYR G CD1 1 
ATOM 10805 C CD2 . TYR G 1 6   ? 58.260  121.770 64.269  1.00 3.30  ? 6   TYR G CD2 1 
ATOM 10806 C CE1 . TYR G 1 6   ? 57.972  124.479 64.792  1.00 7.74  ? 6   TYR G CE1 1 
ATOM 10807 C CE2 . TYR G 1 6   ? 57.459  122.193 65.331  1.00 2.00  ? 6   TYR G CE2 1 
ATOM 10808 C CZ  . TYR G 1 6   ? 57.321  123.546 65.587  1.00 4.10  ? 6   TYR G CZ  1 
ATOM 10809 O OH  . TYR G 1 6   ? 56.555  123.966 66.652  1.00 2.00  ? 6   TYR G OH  1 
ATOM 10810 N N   . TRP G 1 7   ? 61.605  121.593 64.812  1.00 17.73 ? 7   TRP G N   1 
ATOM 10811 C CA  . TRP G 1 7   ? 62.122  120.672 65.821  1.00 18.62 ? 7   TRP G CA  1 
ATOM 10812 C C   . TRP G 1 7   ? 61.723  119.223 65.535  1.00 17.13 ? 7   TRP G C   1 
ATOM 10813 O O   . TRP G 1 7   ? 61.014  118.936 64.572  1.00 16.70 ? 7   TRP G O   1 
ATOM 10814 C CB  . TRP G 1 7   ? 61.599  121.065 67.208  1.00 20.26 ? 7   TRP G CB  1 
ATOM 10815 C CG  . TRP G 1 7   ? 61.784  122.513 67.568  1.00 22.13 ? 7   TRP G CG  1 
ATOM 10816 C CD1 . TRP G 1 7   ? 60.844  123.503 67.499  1.00 21.40 ? 7   TRP G CD1 1 
ATOM 10817 C CD2 . TRP G 1 7   ? 62.968  123.126 68.100  1.00 21.15 ? 7   TRP G CD2 1 
ATOM 10818 N NE1 . TRP G 1 7   ? 61.367  124.688 67.959  1.00 18.94 ? 7   TRP G NE1 1 
ATOM 10819 C CE2 . TRP G 1 7   ? 62.668  124.484 68.334  1.00 20.62 ? 7   TRP G CE2 1 
ATOM 10820 C CE3 . TRP G 1 7   ? 64.251  122.653 68.406  1.00 17.50 ? 7   TRP G CE3 1 
ATOM 10821 C CZ2 . TRP G 1 7   ? 63.604  125.377 68.857  1.00 18.99 ? 7   TRP G CZ2 1 
ATOM 10822 C CZ3 . TRP G 1 7   ? 65.181  123.544 68.926  1.00 20.87 ? 7   TRP G CZ3 1 
ATOM 10823 C CH2 . TRP G 1 7   ? 64.850  124.888 69.147  1.00 19.71 ? 7   TRP G CH2 1 
ATOM 10824 N N   . ASP G 1 8   ? 62.202  118.307 66.354  1.00 16.48 ? 8   ASP G N   1 
ATOM 10825 C CA  . ASP G 1 8   ? 61.848  116.900 66.227  1.00 19.25 ? 8   ASP G CA  1 
ATOM 10826 C C   . ASP G 1 8   ? 60.368  116.748 66.584  1.00 20.21 ? 8   ASP G C   1 
ATOM 10827 O O   . ASP G 1 8   ? 59.742  115.729 66.300  1.00 22.09 ? 8   ASP G O   1 
ATOM 10828 C CB  . ASP G 1 8   ? 62.737  115.999 67.116  1.00 21.66 ? 8   ASP G CB  1 
ATOM 10829 C CG  . ASP G 1 8   ? 62.769  116.435 68.605  1.00 21.67 ? 8   ASP G CG  1 
ATOM 10830 O OD1 . ASP G 1 8   ? 61.884  116.038 69.395  1.00 24.22 ? 8   ASP G OD1 1 
ATOM 10831 O OD2 . ASP G 1 8   ? 63.711  117.149 68.975  1.00 19.27 ? 8   ASP G OD2 1 
ATOM 10832 N N   . ILE G 1 9   ? 59.808  117.789 67.198  1.00 19.42 ? 9   ILE G N   1 
ATOM 10833 C CA  . ILE G 1 9   ? 58.424  117.820 67.602  1.00 17.75 ? 9   ILE G CA  1 
ATOM 10834 C C   . ILE G 1 9   ? 57.543  118.174 66.408  1.00 17.27 ? 9   ILE G C   1 
ATOM 10835 O O   . ILE G 1 9   ? 57.974  118.861 65.483  1.00 18.91 ? 9   ILE G O   1 
ATOM 10836 C CB  . ILE G 1 9   ? 58.197  118.884 68.700  1.00 20.32 ? 9   ILE G CB  1 
ATOM 10837 C CG1 . ILE G 1 9   ? 59.150  118.652 69.877  1.00 20.28 ? 9   ILE G CG1 1 
ATOM 10838 C CG2 . ILE G 1 9   ? 56.749  118.883 69.156  1.00 21.59 ? 9   ILE G CG2 1 
ATOM 10839 C CD1 . ILE G 1 9   ? 58.993  117.321 70.574  1.00 17.82 ? 9   ILE G CD1 1 
ATOM 10840 N N   . ARG G 1 10  ? 56.304  117.700 66.446  1.00 15.31 ? 10  ARG G N   1 
ATOM 10841 C CA  . ARG G 1 10  ? 55.324  117.969 65.402  1.00 13.49 ? 10  ARG G CA  1 
ATOM 10842 C C   . ARG G 1 10  ? 55.043  119.465 65.388  1.00 12.92 ? 10  ARG G C   1 
ATOM 10843 O O   . ARG G 1 10  ? 55.236  120.132 64.367  1.00 13.06 ? 10  ARG G O   1 
ATOM 10844 C CB  . ARG G 1 10  ? 54.043  117.185 65.702  1.00 12.23 ? 10  ARG G CB  1 
ATOM 10845 C CG  . ARG G 1 10  ? 52.789  117.677 65.027  1.00 13.52 ? 10  ARG G CG  1 
ATOM 10846 C CD  . ARG G 1 10  ? 51.762  118.083 66.071  1.00 16.96 ? 10  ARG G CD  1 
ATOM 10847 N NE  . ARG G 1 10  ? 50.392  117.906 65.597  1.00 16.37 ? 10  ARG G NE  1 
ATOM 10848 C CZ  . ARG G 1 10  ? 49.750  116.738 65.568  1.00 14.24 ? 10  ARG G CZ  1 
ATOM 10849 N NH1 . ARG G 1 10  ? 50.350  115.629 65.985  1.00 14.35 ? 10  ARG G NH1 1 
ATOM 10850 N NH2 . ARG G 1 10  ? 48.500  116.682 65.127  1.00 14.39 ? 10  ARG G NH2 1 
ATOM 10851 N N   . GLY G 1 11  ? 54.603  119.983 66.535  1.00 13.43 ? 11  GLY G N   1 
ATOM 10852 C CA  . GLY G 1 11  ? 54.302  121.399 66.667  1.00 10.62 ? 11  GLY G CA  1 
ATOM 10853 C C   . GLY G 1 11  ? 53.425  121.918 65.538  1.00 9.27  ? 11  GLY G C   1 
ATOM 10854 O O   . GLY G 1 11  ? 52.633  121.144 64.971  1.00 11.75 ? 11  GLY G O   1 
ATOM 10855 N N   . LEU G 1 12  ? 53.593  123.164 65.169  1.00 7.60  ? 12  LEU G N   1 
ATOM 10856 C CA  . LEU G 1 12  ? 52.798  123.722 64.089  1.00 6.96  ? 12  LEU G CA  1 
ATOM 10857 C C   . LEU G 1 12  ? 53.344  123.417 62.700  1.00 7.13  ? 12  LEU G C   1 
ATOM 10858 O O   . LEU G 1 12  ? 53.101  124.168 61.757  1.00 9.68  ? 12  LEU G O   1 
ATOM 10859 C CB  . LEU G 1 12  ? 52.568  125.225 64.278  1.00 7.39  ? 12  LEU G CB  1 
ATOM 10860 C CG  . LEU G 1 12  ? 53.551  126.126 65.035  1.00 6.47  ? 12  LEU G CG  1 
ATOM 10861 C CD1 . LEU G 1 12  ? 54.955  126.034 64.469  1.00 5.11  ? 12  LEU G CD1 1 
ATOM 10862 C CD2 . LEU G 1 12  ? 53.040  127.559 64.973  1.00 3.27  ? 12  LEU G CD2 1 
ATOM 10863 N N   . ALA G 1 13  ? 54.062  122.302 62.576  1.00 6.14  ? 13  ALA G N   1 
ATOM 10864 C CA  . ALA G 1 13  ? 54.631  121.882 61.292  1.00 6.87  ? 13  ALA G CA  1 
ATOM 10865 C C   . ALA G 1 13  ? 53.842  120.715 60.683  1.00 6.88  ? 13  ALA G C   1 
ATOM 10866 O O   . ALA G 1 13  ? 53.993  120.387 59.501  1.00 7.19  ? 13  ALA G O   1 
ATOM 10867 C CB  . ALA G 1 13  ? 56.084  121.492 61.467  1.00 3.98  ? 13  ALA G CB  1 
ATOM 10868 N N   . HIS G 1 14  ? 52.977  120.104 61.499  1.00 6.89  ? 14  HIS G N   1 
ATOM 10869 C CA  . HIS G 1 14  ? 52.150  118.991 61.101  1.00 7.82  ? 14  HIS G CA  1 
ATOM 10870 C C   . HIS G 1 14  ? 51.365  119.207 59.810  1.00 9.62  ? 14  HIS G C   1 
ATOM 10871 O O   . HIS G 1 14  ? 51.433  118.389 58.894  1.00 8.91  ? 14  HIS G O   1 
ATOM 10872 C CB  . HIS G 1 14  ? 51.184  118.638 62.226  1.00 8.10  ? 14  HIS G CB  1 
ATOM 10873 C CG  . HIS G 1 14  ? 50.542  117.300 62.064  1.00 10.20 ? 14  HIS G CG  1 
ATOM 10874 N ND1 . HIS G 1 14  ? 51.191  116.120 62.368  1.00 8.23  ? 14  HIS G ND1 1 
ATOM 10875 C CD2 . HIS G 1 14  ? 49.308  116.949 61.625  1.00 9.00  ? 14  HIS G CD2 1 
ATOM 10876 C CE1 . HIS G 1 14  ? 50.386  115.101 62.125  1.00 8.75  ? 14  HIS G CE1 1 
ATOM 10877 N NE2 . HIS G 1 14  ? 49.239  115.577 61.674  1.00 11.03 ? 14  HIS G NE2 1 
ATOM 10878 N N   . ALA G 1 15  ? 50.592  120.290 59.756  1.00 8.27  ? 15  ALA G N   1 
ATOM 10879 C CA  . ALA G 1 15  ? 49.791  120.612 58.574  1.00 5.06  ? 15  ALA G CA  1 
ATOM 10880 C C   . ALA G 1 15  ? 50.666  120.745 57.338  1.00 4.35  ? 15  ALA G C   1 
ATOM 10881 O O   . ALA G 1 15  ? 50.298  120.277 56.265  1.00 2.00  ? 15  ALA G O   1 
ATOM 10882 C CB  . ALA G 1 15  ? 49.006  121.888 58.796  1.00 5.98  ? 15  ALA G CB  1 
ATOM 10883 N N   . ILE G 1 16  ? 51.835  121.357 57.505  1.00 7.00  ? 16  ILE G N   1 
ATOM 10884 C CA  . ILE G 1 16  ? 52.783  121.546 56.411  1.00 6.36  ? 16  ILE G CA  1 
ATOM 10885 C C   . ILE G 1 16  ? 53.182  120.206 55.786  1.00 5.94  ? 16  ILE G C   1 
ATOM 10886 O O   . ILE G 1 16  ? 53.192  120.064 54.561  1.00 3.14  ? 16  ILE G O   1 
ATOM 10887 C CB  . ILE G 1 16  ? 54.055  122.302 56.896  1.00 4.93  ? 16  ILE G CB  1 
ATOM 10888 C CG1 . ILE G 1 16  ? 53.968  123.791 56.538  1.00 3.77  ? 16  ILE G CG1 1 
ATOM 10889 C CG2 . ILE G 1 16  ? 55.313  121.709 56.296  1.00 3.37  ? 16  ILE G CG2 1 
ATOM 10890 C CD1 . ILE G 1 16  ? 53.208  124.639 57.538  1.00 6.61  ? 16  ILE G CD1 1 
ATOM 10891 N N   . ARG G 1 17  ? 53.500  119.232 56.636  1.00 10.99 ? 17  ARG G N   1 
ATOM 10892 C CA  . ARG G 1 17  ? 53.906  117.901 56.181  1.00 14.68 ? 17  ARG G CA  1 
ATOM 10893 C C   . ARG G 1 17  ? 52.783  117.179 55.437  1.00 14.30 ? 17  ARG G C   1 
ATOM 10894 O O   . ARG G 1 17  ? 53.046  116.350 54.557  1.00 13.41 ? 17  ARG G O   1 
ATOM 10895 C CB  . ARG G 1 17  ? 54.396  117.047 57.359  1.00 17.08 ? 17  ARG G CB  1 
ATOM 10896 C CG  . ARG G 1 17  ? 55.631  117.604 58.050  1.00 15.93 ? 17  ARG G CG  1 
ATOM 10897 C CD  . ARG G 1 17  ? 56.060  116.763 59.252  1.00 17.82 ? 17  ARG G CD  1 
ATOM 10898 N NE  . ARG G 1 17  ? 57.122  117.422 60.018  1.00 16.01 ? 17  ARG G NE  1 
ATOM 10899 C CZ  . ARG G 1 17  ? 56.916  118.170 61.099  1.00 17.73 ? 17  ARG G CZ  1 
ATOM 10900 N NH1 . ARG G 1 17  ? 55.685  118.353 61.561  1.00 19.62 ? 17  ARG G NH1 1 
ATOM 10901 N NH2 . ARG G 1 17  ? 57.935  118.782 61.687  1.00 15.13 ? 17  ARG G NH2 1 
ATOM 10902 N N   . LEU G 1 18  ? 51.539  117.481 55.801  1.00 17.42 ? 18  LEU G N   1 
ATOM 10903 C CA  . LEU G 1 18  ? 50.394  116.865 55.146  1.00 16.46 ? 18  LEU G CA  1 
ATOM 10904 C C   . LEU G 1 18  ? 50.233  117.459 53.755  1.00 16.21 ? 18  LEU G C   1 
ATOM 10905 O O   . LEU G 1 18  ? 50.161  116.736 52.760  1.00 19.77 ? 18  LEU G O   1 
ATOM 10906 C CB  . LEU G 1 18  ? 49.120  117.088 55.962  1.00 13.47 ? 18  LEU G CB  1 
ATOM 10907 C CG  . LEU G 1 18  ? 49.058  116.414 57.335  1.00 13.05 ? 18  LEU G CG  1 
ATOM 10908 C CD1 . LEU G 1 18  ? 47.715  116.699 58.001  1.00 9.87  ? 18  LEU G CD1 1 
ATOM 10909 C CD2 . LEU G 1 18  ? 49.269  114.913 57.180  1.00 7.55  ? 18  LEU G CD2 1 
ATOM 10910 N N   . LEU G 1 19  ? 50.215  118.784 53.696  1.00 13.21 ? 19  LEU G N   1 
ATOM 10911 C CA  . LEU G 1 19  ? 50.071  119.502 52.441  1.00 13.57 ? 19  LEU G CA  1 
ATOM 10912 C C   . LEU G 1 19  ? 51.174  119.082 51.472  1.00 15.44 ? 19  LEU G C   1 
ATOM 10913 O O   . LEU G 1 19  ? 50.895  118.547 50.401  1.00 14.44 ? 19  LEU G O   1 
ATOM 10914 C CB  . LEU G 1 19  ? 50.124  121.015 52.705  1.00 11.09 ? 19  LEU G CB  1 
ATOM 10915 C CG  . LEU G 1 19  ? 49.880  122.047 51.597  1.00 14.71 ? 19  LEU G CG  1 
ATOM 10916 C CD1 . LEU G 1 19  ? 48.523  121.856 50.944  1.00 8.85  ? 19  LEU G CD1 1 
ATOM 10917 C CD2 . LEU G 1 19  ? 49.967  123.432 52.208  1.00 10.37 ? 19  LEU G CD2 1 
ATOM 10918 N N   . LEU G 1 20  ? 52.424  119.267 51.881  1.00 16.72 ? 20  LEU G N   1 
ATOM 10919 C CA  . LEU G 1 20  ? 53.575  118.927 51.048  1.00 14.26 ? 20  LEU G CA  1 
ATOM 10920 C C   . LEU G 1 20  ? 53.527  117.522 50.449  1.00 15.24 ? 20  LEU G C   1 
ATOM 10921 O O   . LEU G 1 20  ? 53.701  117.357 49.241  1.00 13.84 ? 20  LEU G O   1 
ATOM 10922 C CB  . LEU G 1 20  ? 54.880  119.112 51.837  1.00 11.24 ? 20  LEU G CB  1 
ATOM 10923 C CG  . LEU G 1 20  ? 55.397  120.538 52.042  1.00 11.56 ? 20  LEU G CG  1 
ATOM 10924 C CD1 . LEU G 1 20  ? 56.386  120.558 53.182  1.00 12.97 ? 20  LEU G CD1 1 
ATOM 10925 C CD2 . LEU G 1 20  ? 56.031  121.063 50.765  1.00 8.32  ? 20  LEU G CD2 1 
ATOM 10926 N N   . GLU G 1 21  ? 53.283  116.518 51.287  1.00 18.02 ? 21  GLU G N   1 
ATOM 10927 C CA  . GLU G 1 21  ? 53.233  115.134 50.825  1.00 18.98 ? 21  GLU G CA  1 
ATOM 10928 C C   . GLU G 1 21  ? 52.083  114.856 49.860  1.00 21.51 ? 21  GLU G C   1 
ATOM 10929 O O   . GLU G 1 21  ? 52.279  114.209 48.829  1.00 24.98 ? 21  GLU G O   1 
ATOM 10930 C CB  . GLU G 1 21  ? 53.200  114.167 52.015  1.00 18.50 ? 21  GLU G CB  1 
ATOM 10931 C CG  . GLU G 1 21  ? 54.563  113.951 52.682  1.00 21.50 ? 21  GLU G CG  1 
ATOM 10932 C CD  . GLU G 1 21  ? 55.485  112.992 51.915  1.00 27.70 ? 21  GLU G CD  1 
ATOM 10933 O OE1 . GLU G 1 21  ? 55.458  112.931 50.667  1.00 27.21 ? 21  GLU G OE1 1 
ATOM 10934 O OE2 . GLU G 1 21  ? 56.270  112.280 52.574  1.00 29.75 ? 21  GLU G OE2 1 
ATOM 10935 N N   . TYR G 1 22  ? 50.903  115.387 50.164  1.00 19.20 ? 22  TYR G N   1 
ATOM 10936 C CA  . TYR G 1 22  ? 49.746  115.183 49.303  1.00 17.69 ? 22  TYR G CA  1 
ATOM 10937 C C   . TYR G 1 22  ? 49.965  115.753 47.909  1.00 15.63 ? 22  TYR G C   1 
ATOM 10938 O O   . TYR G 1 22  ? 49.549  115.157 46.921  1.00 15.42 ? 22  TYR G O   1 
ATOM 10939 C CB  . TYR G 1 22  ? 48.493  115.814 49.911  1.00 17.61 ? 22  TYR G CB  1 
ATOM 10940 C CG  . TYR G 1 22  ? 47.261  115.689 49.036  1.00 16.37 ? 22  TYR G CG  1 
ATOM 10941 C CD1 . TYR G 1 22  ? 46.725  114.439 48.734  1.00 12.57 ? 22  TYR G CD1 1 
ATOM 10942 C CD2 . TYR G 1 22  ? 46.630  116.819 48.514  1.00 18.03 ? 22  TYR G CD2 1 
ATOM 10943 C CE1 . TYR G 1 22  ? 45.594  114.310 47.938  1.00 13.50 ? 22  TYR G CE1 1 
ATOM 10944 C CE2 . TYR G 1 22  ? 45.494  116.702 47.713  1.00 17.48 ? 22  TYR G CE2 1 
ATOM 10945 C CZ  . TYR G 1 22  ? 44.979  115.441 47.429  1.00 13.75 ? 22  TYR G CZ  1 
ATOM 10946 O OH  . TYR G 1 22  ? 43.849  115.303 46.644  1.00 14.35 ? 22  TYR G OH  1 
ATOM 10947 N N   . THR G 1 23  ? 50.610  116.908 47.828  1.00 14.80 ? 23  THR G N   1 
ATOM 10948 C CA  . THR G 1 23  ? 50.846  117.526 46.534  1.00 17.56 ? 23  THR G CA  1 
ATOM 10949 C C   . THR G 1 23  ? 52.091  116.997 45.828  1.00 20.44 ? 23  THR G C   1 
ATOM 10950 O O   . THR G 1 23  ? 52.479  117.523 44.778  1.00 23.36 ? 23  THR G O   1 
ATOM 10951 C CB  . THR G 1 23  ? 50.893  119.081 46.628  1.00 16.43 ? 23  THR G CB  1 
ATOM 10952 O OG1 . THR G 1 23  ? 51.864  119.511 47.603  1.00 23.83 ? 23  THR G OG1 1 
ATOM 10953 C CG2 . THR G 1 23  ? 49.532  119.640 47.022  1.00 14.87 ? 23  THR G CG2 1 
ATOM 10954 N N   . ASP G 1 24  ? 52.700  115.959 46.403  1.00 19.81 ? 24  ASP G N   1 
ATOM 10955 C CA  . ASP G 1 24  ? 53.905  115.336 45.851  1.00 18.81 ? 24  ASP G CA  1 
ATOM 10956 C C   . ASP G 1 24  ? 55.065  116.314 45.643  1.00 20.74 ? 24  ASP G C   1 
ATOM 10957 O O   . ASP G 1 24  ? 55.828  116.193 44.681  1.00 22.27 ? 24  ASP G O   1 
ATOM 10958 C CB  . ASP G 1 24  ? 53.586  114.612 44.528  1.00 17.57 ? 24  ASP G CB  1 
ATOM 10959 C CG  . ASP G 1 24  ? 52.972  113.225 44.736  1.00 19.57 ? 24  ASP G CG  1 
ATOM 10960 O OD1 . ASP G 1 24  ? 52.296  113.001 45.767  1.00 19.99 ? 24  ASP G OD1 1 
ATOM 10961 O OD2 . ASP G 1 24  ? 53.166  112.355 43.855  1.00 18.30 ? 24  ASP G OD2 1 
ATOM 10962 N N   . SER G 1 25  ? 55.218  117.252 46.571  1.00 19.71 ? 25  SER G N   1 
ATOM 10963 C CA  . SER G 1 25  ? 56.275  118.246 46.481  1.00 18.08 ? 25  SER G CA  1 
ATOM 10964 C C   . SER G 1 25  ? 57.596  117.724 47.033  1.00 16.84 ? 25  SER G C   1 
ATOM 10965 O O   . SER G 1 25  ? 57.633  117.094 48.092  1.00 16.95 ? 25  SER G O   1 
ATOM 10966 C CB  . SER G 1 25  ? 55.853  119.505 47.210  1.00 21.20 ? 25  SER G CB  1 
ATOM 10967 O OG  . SER G 1 25  ? 54.706  120.128 46.614  1.00 22.55 ? 25  SER G OG  1 
ATOM 10968 N N   . SER G 1 26  ? 58.676  117.988 46.301  1.00 16.71 ? 26  SER G N   1 
ATOM 10969 C CA  . SER G 1 26  ? 60.018  117.559 46.688  1.00 16.95 ? 26  SER G CA  1 
ATOM 10970 C C   . SER G 1 26  ? 60.598  118.403 47.822  1.00 18.11 ? 26  SER G C   1 
ATOM 10971 O O   . SER G 1 26  ? 61.470  119.236 47.603  1.00 18.19 ? 26  SER G O   1 
ATOM 10972 C CB  . SER G 1 26  ? 60.959  117.616 45.480  1.00 14.21 ? 26  SER G CB  1 
ATOM 10973 O OG  . SER G 1 26  ? 60.396  116.981 44.343  1.00 18.32 ? 26  SER G OG  1 
ATOM 10974 N N   . TYR G 1 27  ? 60.080  118.225 49.025  1.00 18.77 ? 27  TYR G N   1 
ATOM 10975 C CA  . TYR G 1 27  ? 60.555  118.948 50.184  1.00 17.38 ? 27  TYR G CA  1 
ATOM 10976 C C   . TYR G 1 27  ? 61.689  118.152 50.844  1.00 19.47 ? 27  TYR G C   1 
ATOM 10977 O O   . TYR G 1 27  ? 61.963  116.988 50.461  1.00 16.27 ? 27  TYR G O   1 
ATOM 10978 C CB  . TYR G 1 27  ? 59.410  119.158 51.178  1.00 16.77 ? 27  TYR G CB  1 
ATOM 10979 C CG  . TYR G 1 27  ? 59.019  117.916 51.918  1.00 15.86 ? 27  TYR G CG  1 
ATOM 10980 C CD1 . TYR G 1 27  ? 58.340  116.868 51.264  1.00 14.11 ? 27  TYR G CD1 1 
ATOM 10981 C CD2 . TYR G 1 27  ? 59.359  117.724 53.261  1.00 13.41 ? 27  TYR G CD2 1 
ATOM 10982 C CE1 . TYR G 1 27  ? 58.013  115.686 51.938  1.00 12.66 ? 27  TYR G CE1 1 
ATOM 10983 C CE2 . TYR G 1 27  ? 59.037  116.555 53.936  1.00 14.25 ? 27  TYR G CE2 1 
ATOM 10984 C CZ  . TYR G 1 27  ? 58.364  115.539 53.270  1.00 12.83 ? 27  TYR G CZ  1 
ATOM 10985 O OH  . TYR G 1 27  ? 58.039  114.381 53.935  1.00 15.90 ? 27  TYR G OH  1 
ATOM 10986 N N   . GLU G 1 28  ? 62.313  118.748 51.858  1.00 20.10 ? 28  GLU G N   1 
ATOM 10987 C CA  . GLU G 1 28  ? 63.408  118.109 52.584  1.00 19.18 ? 28  GLU G CA  1 
ATOM 10988 C C   . GLU G 1 28  ? 63.271  118.443 54.070  1.00 21.21 ? 28  GLU G C   1 
ATOM 10989 O O   . GLU G 1 28  ? 63.022  119.599 54.432  1.00 22.51 ? 28  GLU G O   1 
ATOM 10990 C CB  . GLU G 1 28  ? 64.747  118.600 52.034  1.00 20.01 ? 28  GLU G CB  1 
ATOM 10991 C CG  . GLU G 1 28  ? 65.930  117.722 52.376  1.00 24.00 ? 28  GLU G CG  1 
ATOM 10992 C CD  . GLU G 1 28  ? 67.174  118.108 51.603  1.00 27.05 ? 28  GLU G CD  1 
ATOM 10993 O OE1 . GLU G 1 28  ? 67.103  118.198 50.355  1.00 25.76 ? 28  GLU G OE1 1 
ATOM 10994 O OE2 . GLU G 1 28  ? 68.224  118.322 52.247  1.00 27.01 ? 28  GLU G OE2 1 
ATOM 10995 N N   . GLU G 1 29  ? 63.428  117.431 54.921  1.00 21.86 ? 29  GLU G N   1 
ATOM 10996 C CA  . GLU G 1 29  ? 63.289  117.601 56.366  1.00 21.05 ? 29  GLU G CA  1 
ATOM 10997 C C   . GLU G 1 29  ? 64.532  117.951 57.182  1.00 23.12 ? 29  GLU G C   1 
ATOM 10998 O O   . GLU G 1 29  ? 65.472  117.160 57.290  1.00 23.35 ? 29  GLU G O   1 
ATOM 10999 C CB  . GLU G 1 29  ? 62.606  116.379 56.982  1.00 20.07 ? 29  GLU G CB  1 
ATOM 11000 C CG  . GLU G 1 29  ? 61.101  116.356 56.791  1.00 19.27 ? 29  GLU G CG  1 
ATOM 11001 C CD  . GLU G 1 29  ? 60.435  115.259 57.594  1.00 17.10 ? 29  GLU G CD  1 
ATOM 11002 O OE1 . GLU G 1 29  ? 60.138  115.502 58.783  1.00 19.45 ? 29  GLU G OE1 1 
ATOM 11003 O OE2 . GLU G 1 29  ? 60.213  114.157 57.041  1.00 13.50 ? 29  GLU G OE2 1 
ATOM 11004 N N   . LYS G 1 30  ? 64.477  119.117 57.816  1.00 23.69 ? 30  LYS G N   1 
ATOM 11005 C CA  . LYS G 1 30  ? 65.556  119.614 58.652  1.00 22.77 ? 30  LYS G CA  1 
ATOM 11006 C C   . LYS G 1 30  ? 65.031  119.633 60.090  1.00 22.65 ? 30  LYS G C   1 
ATOM 11007 O O   . LYS G 1 30  ? 64.453  120.631 60.532  1.00 26.09 ? 30  LYS G O   1 
ATOM 11008 C CB  . LYS G 1 30  ? 65.930  121.028 58.202  1.00 25.12 ? 30  LYS G CB  1 
ATOM 11009 C CG  . LYS G 1 30  ? 67.268  121.530 58.695  1.00 25.59 ? 30  LYS G CG  1 
ATOM 11010 C CD  . LYS G 1 30  ? 67.540  122.912 58.149  1.00 24.57 ? 30  LYS G CD  1 
ATOM 11011 C CE  . LYS G 1 30  ? 68.955  123.353 58.440  1.00 24.05 ? 30  LYS G CE  1 
ATOM 11012 N NZ  . LYS G 1 30  ? 69.937  122.616 57.609  1.00 24.03 ? 30  LYS G NZ  1 
ATOM 11013 N N   . LYS G 1 31  ? 65.227  118.531 60.811  1.00 20.38 ? 31  LYS G N   1 
ATOM 11014 C CA  . LYS G 1 31  ? 64.749  118.411 62.188  1.00 20.06 ? 31  LYS G CA  1 
ATOM 11015 C C   . LYS G 1 31  ? 65.759  118.741 63.288  1.00 20.69 ? 31  LYS G C   1 
ATOM 11016 O O   . LYS G 1 31  ? 66.797  118.088 63.408  1.00 19.67 ? 31  LYS G O   1 
ATOM 11017 C CB  . LYS G 1 31  ? 64.172  117.008 62.418  1.00 16.96 ? 31  LYS G CB  1 
ATOM 11018 C CG  . LYS G 1 31  ? 62.768  116.802 61.848  1.00 17.00 ? 31  LYS G CG  1 
ATOM 11019 C CD  . LYS G 1 31  ? 62.340  115.334 61.866  1.00 18.09 ? 31  LYS G CD  1 
ATOM 11020 C CE  . LYS G 1 31  ? 63.070  114.517 60.802  1.00 18.38 ? 31  LYS G CE  1 
ATOM 11021 N NZ  . LYS G 1 31  ? 62.619  113.094 60.733  1.00 11.87 ? 31  LYS G NZ  1 
ATOM 11022 N N   . TYR G 1 32  ? 65.437  119.745 64.102  1.00 19.54 ? 32  TYR G N   1 
ATOM 11023 C CA  . TYR G 1 32  ? 66.302  120.156 65.207  1.00 18.15 ? 32  TYR G CA  1 
ATOM 11024 C C   . TYR G 1 32  ? 65.820  119.497 66.492  1.00 20.20 ? 32  TYR G C   1 
ATOM 11025 O O   . TYR G 1 32  ? 64.617  119.431 66.760  1.00 20.53 ? 32  TYR G O   1 
ATOM 11026 C CB  . TYR G 1 32  ? 66.280  121.669 65.398  1.00 19.17 ? 32  TYR G CB  1 
ATOM 11027 C CG  . TYR G 1 32  ? 66.462  122.450 64.131  1.00 22.81 ? 32  TYR G CG  1 
ATOM 11028 C CD1 . TYR G 1 32  ? 67.709  122.538 63.518  1.00 20.89 ? 32  TYR G CD1 1 
ATOM 11029 C CD2 . TYR G 1 32  ? 65.384  123.100 63.537  1.00 21.99 ? 32  TYR G CD2 1 
ATOM 11030 C CE1 . TYR G 1 32  ? 67.875  123.258 62.336  1.00 20.73 ? 32  TYR G CE1 1 
ATOM 11031 C CE2 . TYR G 1 32  ? 65.538  123.815 62.364  1.00 20.22 ? 32  TYR G CE2 1 
ATOM 11032 C CZ  . TYR G 1 32  ? 66.781  123.891 61.770  1.00 20.99 ? 32  TYR G CZ  1 
ATOM 11033 O OH  . TYR G 1 32  ? 66.915  124.600 60.608  1.00 19.05 ? 32  TYR G OH  1 
ATOM 11034 N N   . THR G 1 33  ? 66.766  119.055 67.309  1.00 21.40 ? 33  THR G N   1 
ATOM 11035 C CA  . THR G 1 33  ? 66.457  118.398 68.562  1.00 20.25 ? 33  THR G CA  1 
ATOM 11036 C C   . THR G 1 33  ? 66.623  119.353 69.732  1.00 19.36 ? 33  THR G C   1 
ATOM 11037 O O   . THR G 1 33  ? 67.472  120.242 69.695  1.00 17.01 ? 33  THR G O   1 
ATOM 11038 C CB  . THR G 1 33  ? 67.322  117.156 68.759  1.00 19.78 ? 33  THR G CB  1 
ATOM 11039 O OG1 . THR G 1 33  ? 67.345  116.401 67.541  1.00 20.39 ? 33  THR G OG1 1 
ATOM 11040 C CG2 . THR G 1 33  ? 66.765  116.280 69.873  1.00 24.30 ? 33  THR G CG2 1 
ATOM 11041 N N   . MET G 1 34  ? 65.787  119.187 70.750  1.00 20.00 ? 34  MET G N   1 
ATOM 11042 C CA  . MET G 1 34  ? 65.840  120.025 71.938  1.00 22.45 ? 34  MET G CA  1 
ATOM 11043 C C   . MET G 1 34  ? 66.232  119.169 73.137  1.00 22.33 ? 34  MET G C   1 
ATOM 11044 O O   . MET G 1 34  ? 65.924  117.983 73.182  1.00 20.05 ? 34  MET G O   1 
ATOM 11045 C CB  . MET G 1 34  ? 64.485  120.696 72.173  1.00 22.60 ? 34  MET G CB  1 
ATOM 11046 C CG  . MET G 1 34  ? 64.473  121.660 73.337  1.00 20.74 ? 34  MET G CG  1 
ATOM 11047 S SD  . MET G 1 34  ? 62.889  122.470 73.529  1.00 20.50 ? 34  MET G SD  1 
ATOM 11048 C CE  . MET G 1 34  ? 63.308  124.131 72.982  1.00 25.61 ? 34  MET G CE  1 
ATOM 11049 N N   . GLY G 1 35  ? 66.920  119.773 74.098  1.00 25.21 ? 35  GLY G N   1 
ATOM 11050 C CA  . GLY G 1 35  ? 67.365  119.041 75.268  1.00 27.87 ? 35  GLY G CA  1 
ATOM 11051 C C   . GLY G 1 35  ? 66.399  118.960 76.431  1.00 27.10 ? 35  GLY G C   1 
ATOM 11052 O O   . GLY G 1 35  ? 65.274  119.451 76.367  1.00 29.07 ? 35  GLY G O   1 
ATOM 11053 N N   . ASP G 1 36  ? 66.874  118.347 77.511  1.00 29.16 ? 36  ASP G N   1 
ATOM 11054 C CA  . ASP G 1 36  ? 66.099  118.162 78.734  1.00 32.70 ? 36  ASP G CA  1 
ATOM 11055 C C   . ASP G 1 36  ? 66.613  119.077 79.844  1.00 31.50 ? 36  ASP G C   1 
ATOM 11056 O O   . ASP G 1 36  ? 66.996  120.214 79.576  1.00 33.59 ? 36  ASP G O   1 
ATOM 11057 C CB  . ASP G 1 36  ? 66.178  116.699 79.161  1.00 32.89 ? 36  ASP G CB  1 
ATOM 11058 C CG  . ASP G 1 36  ? 65.539  115.775 78.157  1.00 35.40 ? 36  ASP G CG  1 
ATOM 11059 O OD1 . ASP G 1 36  ? 66.176  115.467 77.125  1.00 36.08 ? 36  ASP G OD1 1 
ATOM 11060 O OD2 . ASP G 1 36  ? 64.382  115.372 78.395  1.00 37.17 ? 36  ASP G OD2 1 
ATOM 11061 N N   . ALA G 1 37  ? 66.605  118.590 81.086  1.00 30.86 ? 37  ALA G N   1 
ATOM 11062 C CA  . ALA G 1 37  ? 67.086  119.357 82.238  1.00 32.39 ? 37  ALA G CA  1 
ATOM 11063 C C   . ALA G 1 37  ? 66.228  120.609 82.460  1.00 32.04 ? 37  ALA G C   1 
ATOM 11064 O O   . ALA G 1 37  ? 65.262  120.834 81.724  1.00 31.93 ? 37  ALA G O   1 
ATOM 11065 C CB  . ALA G 1 37  ? 68.584  119.729 82.037  1.00 31.95 ? 37  ALA G CB  1 
ATOM 11066 N N   . PRO G 1 38  ? 66.523  121.408 83.508  1.00 32.20 ? 38  PRO G N   1 
ATOM 11067 C CA  . PRO G 1 38  ? 65.712  122.614 83.727  1.00 30.85 ? 38  PRO G CA  1 
ATOM 11068 C C   . PRO G 1 38  ? 65.846  123.604 82.572  1.00 29.97 ? 38  PRO G C   1 
ATOM 11069 O O   . PRO G 1 38  ? 64.974  124.451 82.368  1.00 29.73 ? 38  PRO G O   1 
ATOM 11070 C CB  . PRO G 1 38  ? 66.280  123.178 85.035  1.00 30.12 ? 38  PRO G CB  1 
ATOM 11071 C CG  . PRO G 1 38  ? 67.702  122.694 85.036  1.00 29.40 ? 38  PRO G CG  1 
ATOM 11072 C CD  . PRO G 1 38  ? 67.532  121.267 84.589  1.00 32.19 ? 38  PRO G CD  1 
ATOM 11073 N N   . ASP G 1 39  ? 66.941  123.491 81.823  1.00 29.79 ? 39  ASP G N   1 
ATOM 11074 C CA  . ASP G 1 39  ? 67.190  124.361 80.681  1.00 29.96 ? 39  ASP G CA  1 
ATOM 11075 C C   . ASP G 1 39  ? 67.292  123.534 79.410  1.00 28.50 ? 39  ASP G C   1 
ATOM 11076 O O   . ASP G 1 39  ? 68.381  123.124 79.000  1.00 28.58 ? 39  ASP G O   1 
ATOM 11077 C CB  . ASP G 1 39  ? 68.464  125.173 80.891  1.00 32.44 ? 39  ASP G CB  1 
ATOM 11078 C CG  . ASP G 1 39  ? 68.193  126.653 80.992  1.00 33.96 ? 39  ASP G CG  1 
ATOM 11079 O OD1 . ASP G 1 39  ? 67.365  127.050 81.840  1.00 33.33 ? 39  ASP G OD1 1 
ATOM 11080 O OD2 . ASP G 1 39  ? 68.799  127.417 80.214  1.00 32.08 ? 39  ASP G OD2 1 
ATOM 11081 N N   . TYR G 1 40  ? 66.138  123.309 78.796  1.00 26.69 ? 40  TYR G N   1 
ATOM 11082 C CA  . TYR G 1 40  ? 66.020  122.527 77.575  1.00 25.15 ? 40  TYR G CA  1 
ATOM 11083 C C   . TYR G 1 40  ? 66.909  123.035 76.455  1.00 24.03 ? 40  TYR G C   1 
ATOM 11084 O O   . TYR G 1 40  ? 66.603  124.023 75.786  1.00 23.63 ? 40  TYR G O   1 
ATOM 11085 C CB  . TYR G 1 40  ? 64.562  122.488 77.140  1.00 25.65 ? 40  TYR G CB  1 
ATOM 11086 C CG  . TYR G 1 40  ? 63.665  122.037 78.257  1.00 24.53 ? 40  TYR G CG  1 
ATOM 11087 C CD1 . TYR G 1 40  ? 63.516  120.686 78.550  1.00 22.33 ? 40  TYR G CD1 1 
ATOM 11088 C CD2 . TYR G 1 40  ? 63.008  122.963 79.062  1.00 25.63 ? 40  TYR G CD2 1 
ATOM 11089 C CE1 . TYR G 1 40  ? 62.737  120.262 79.623  1.00 21.36 ? 40  TYR G CE1 1 
ATOM 11090 C CE2 . TYR G 1 40  ? 62.225  122.553 80.139  1.00 25.16 ? 40  TYR G CE2 1 
ATOM 11091 C CZ  . TYR G 1 40  ? 62.095  121.202 80.413  1.00 19.83 ? 40  TYR G CZ  1 
ATOM 11092 O OH  . TYR G 1 40  ? 61.325  120.798 81.477  1.00 16.39 ? 40  TYR G OH  1 
ATOM 11093 N N   . ASP G 1 41  ? 68.025  122.340 76.279  1.00 24.16 ? 41  ASP G N   1 
ATOM 11094 C CA  . ASP G 1 41  ? 69.027  122.655 75.271  1.00 24.64 ? 41  ASP G CA  1 
ATOM 11095 C C   . ASP G 1 41  ? 68.426  123.017 73.905  1.00 24.50 ? 41  ASP G C   1 
ATOM 11096 O O   . ASP G 1 41  ? 68.034  122.142 73.133  1.00 22.99 ? 41  ASP G O   1 
ATOM 11097 C CB  . ASP G 1 41  ? 69.983  121.463 75.137  1.00 24.07 ? 41  ASP G CB  1 
ATOM 11098 C CG  . ASP G 1 41  ? 71.254  121.804 74.387  1.00 24.41 ? 41  ASP G CG  1 
ATOM 11099 O OD1 . ASP G 1 41  ? 72.231  122.229 75.040  1.00 20.78 ? 41  ASP G OD1 1 
ATOM 11100 O OD2 . ASP G 1 41  ? 71.281  121.633 73.148  1.00 24.60 ? 41  ASP G OD2 1 
ATOM 11101 N N   . ARG G 1 42  ? 68.365  124.314 73.619  1.00 23.29 ? 42  ARG G N   1 
ATOM 11102 C CA  . ARG G 1 42  ? 67.828  124.822 72.358  1.00 23.09 ? 42  ARG G CA  1 
ATOM 11103 C C   . ARG G 1 42  ? 68.935  125.006 71.311  1.00 22.67 ? 42  ARG G C   1 
ATOM 11104 O O   . ARG G 1 42  ? 68.666  125.135 70.113  1.00 19.98 ? 42  ARG G O   1 
ATOM 11105 C CB  . ARG G 1 42  ? 67.107  126.150 72.618  1.00 24.28 ? 42  ARG G CB  1 
ATOM 11106 C CG  . ARG G 1 42  ? 66.489  126.795 71.394  1.00 27.26 ? 42  ARG G CG  1 
ATOM 11107 C CD  . ARG G 1 42  ? 65.124  127.391 71.693  1.00 24.74 ? 42  ARG G CD  1 
ATOM 11108 N NE  . ARG G 1 42  ? 65.178  128.542 72.589  1.00 25.88 ? 42  ARG G NE  1 
ATOM 11109 C CZ  . ARG G 1 42  ? 64.861  128.507 73.880  1.00 26.45 ? 42  ARG G CZ  1 
ATOM 11110 N NH1 . ARG G 1 42  ? 64.470  127.372 74.444  1.00 24.43 ? 42  ARG G NH1 1 
ATOM 11111 N NH2 . ARG G 1 42  ? 64.906  129.620 74.602  1.00 25.54 ? 42  ARG G NH2 1 
ATOM 11112 N N   . SER G 1 43  ? 70.177  124.977 71.790  1.00 22.77 ? 43  SER G N   1 
ATOM 11113 C CA  . SER G 1 43  ? 71.397  125.148 70.996  1.00 22.54 ? 43  SER G CA  1 
ATOM 11114 C C   . SER G 1 43  ? 71.368  124.799 69.504  1.00 20.03 ? 43  SER G C   1 
ATOM 11115 O O   . SER G 1 43  ? 71.480  125.710 68.664  1.00 17.88 ? 43  SER G O   1 
ATOM 11116 C CB  . SER G 1 43  ? 72.562  124.426 71.690  1.00 21.89 ? 43  SER G CB  1 
ATOM 11117 O OG  . SER G 1 43  ? 73.751  124.457 70.939  1.00 24.71 ? 43  SER G OG  1 
ATOM 11118 N N   . GLN G 1 44  ? 71.204  123.515 69.184  1.00 17.66 ? 44  GLN G N   1 
ATOM 11119 C CA  . GLN G 1 44  ? 71.183  123.041 67.796  1.00 18.24 ? 44  GLN G CA  1 
ATOM 11120 C C   . GLN G 1 44  ? 70.559  124.042 66.805  1.00 18.21 ? 44  GLN G C   1 
ATOM 11121 O O   . GLN G 1 44  ? 71.171  124.402 65.807  1.00 19.86 ? 44  GLN G O   1 
ATOM 11122 C CB  . GLN G 1 44  ? 70.461  121.690 67.711  1.00 16.39 ? 44  GLN G CB  1 
ATOM 11123 C CG  . GLN G 1 44  ? 70.630  120.964 66.382  1.00 16.87 ? 44  GLN G CG  1 
ATOM 11124 C CD  . GLN G 1 44  ? 70.359  119.466 66.484  1.00 19.97 ? 44  GLN G CD  1 
ATOM 11125 O OE1 . GLN G 1 44  ? 69.512  119.027 67.259  1.00 19.07 ? 44  GLN G OE1 1 
ATOM 11126 N NE2 . GLN G 1 44  ? 71.088  118.676 65.705  1.00 18.29 ? 44  GLN G NE2 1 
ATOM 11127 N N   . TRP G 1 45  ? 69.362  124.513 67.155  1.00 16.94 ? 45  TRP G N   1 
ATOM 11128 C CA  . TRP G 1 45  ? 68.640  125.479 66.338  1.00 15.33 ? 45  TRP G CA  1 
ATOM 11129 C C   . TRP G 1 45  ? 69.345  126.834 66.374  1.00 14.88 ? 45  TRP G C   1 
ATOM 11130 O O   . TRP G 1 45  ? 69.825  127.319 65.324  1.00 13.11 ? 45  TRP G O   1 
ATOM 11131 C CB  . TRP G 1 45  ? 67.193  125.593 66.849  1.00 14.12 ? 45  TRP G CB  1 
ATOM 11132 C CG  . TRP G 1 45  ? 66.437  126.861 66.496  1.00 13.98 ? 45  TRP G CG  1 
ATOM 11133 C CD1 . TRP G 1 45  ? 65.788  127.689 67.370  1.00 10.86 ? 45  TRP G CD1 1 
ATOM 11134 C CD2 . TRP G 1 45  ? 66.237  127.424 65.189  1.00 13.33 ? 45  TRP G CD2 1 
ATOM 11135 N NE1 . TRP G 1 45  ? 65.199  128.727 66.692  1.00 10.48 ? 45  TRP G NE1 1 
ATOM 11136 C CE2 . TRP G 1 45  ? 65.459  128.594 65.353  1.00 13.42 ? 45  TRP G CE2 1 
ATOM 11137 C CE3 . TRP G 1 45  ? 66.638  127.059 63.897  1.00 11.01 ? 45  TRP G CE3 1 
ATOM 11138 C CZ2 . TRP G 1 45  ? 65.077  129.400 64.278  1.00 15.98 ? 45  TRP G CZ2 1 
ATOM 11139 C CZ3 . TRP G 1 45  ? 66.258  127.861 62.821  1.00 13.02 ? 45  TRP G CZ3 1 
ATOM 11140 C CH2 . TRP G 1 45  ? 65.484  129.018 63.025  1.00 16.11 ? 45  TRP G CH2 1 
ATOM 11141 N N   . LEU G 1 46  ? 69.446  127.406 67.576  1.00 17.92 ? 46  LEU G N   1 
ATOM 11142 C CA  . LEU G 1 46  ? 70.059  128.717 67.802  1.00 18.35 ? 46  LEU G CA  1 
ATOM 11143 C C   . LEU G 1 46  ? 71.344  129.023 67.068  1.00 20.43 ? 46  LEU G C   1 
ATOM 11144 O O   . LEU G 1 46  ? 71.481  130.103 66.487  1.00 20.79 ? 46  LEU G O   1 
ATOM 11145 C CB  . LEU G 1 46  ? 70.264  128.956 69.291  1.00 16.92 ? 46  LEU G CB  1 
ATOM 11146 C CG  . LEU G 1 46  ? 69.013  129.479 69.985  1.00 18.95 ? 46  LEU G CG  1 
ATOM 11147 C CD1 . LEU G 1 46  ? 69.194  129.482 71.486  1.00 20.12 ? 46  LEU G CD1 1 
ATOM 11148 C CD2 . LEU G 1 46  ? 68.721  130.869 69.469  1.00 18.60 ? 46  LEU G CD2 1 
ATOM 11149 N N   . ASN G 1 47  ? 72.271  128.075 67.005  1.00 22.23 ? 47  ASN G N   1 
ATOM 11150 C CA  . ASN G 1 47  ? 73.532  128.306 66.300  1.00 22.81 ? 47  ASN G CA  1 
ATOM 11151 C C   . ASN G 1 47  ? 73.449  128.275 64.777  1.00 22.40 ? 47  ASN G C   1 
ATOM 11152 O O   . ASN G 1 47  ? 74.440  128.001 64.099  1.00 24.20 ? 47  ASN G O   1 
ATOM 11153 C CB  . ASN G 1 47  ? 74.649  127.374 66.804  1.00 26.27 ? 47  ASN G CB  1 
ATOM 11154 C CG  . ASN G 1 47  ? 74.142  126.009 67.218  1.00 29.12 ? 47  ASN G CG  1 
ATOM 11155 O OD1 . ASN G 1 47  ? 74.116  125.690 68.405  1.00 26.95 ? 47  ASN G OD1 1 
ATOM 11156 N ND2 . ASN G 1 47  ? 73.769  125.186 66.246  1.00 29.70 ? 47  ASN G ND2 1 
ATOM 11157 N N   . GLU G 1 48  ? 72.280  128.595 64.239  1.00 21.06 ? 48  GLU G N   1 
ATOM 11158 C CA  . GLU G 1 48  ? 72.094  128.615 62.797  1.00 18.39 ? 48  GLU G CA  1 
ATOM 11159 C C   . GLU G 1 48  ? 71.010  129.626 62.443  1.00 18.22 ? 48  GLU G C   1 
ATOM 11160 O O   . GLU G 1 48  ? 71.025  130.218 61.364  1.00 19.30 ? 48  GLU G O   1 
ATOM 11161 C CB  . GLU G 1 48  ? 71.715  127.219 62.290  1.00 15.54 ? 48  GLU G CB  1 
ATOM 11162 C CG  . GLU G 1 48  ? 72.078  126.988 60.825  1.00 15.28 ? 48  GLU G CG  1 
ATOM 11163 C CD  . GLU G 1 48  ? 71.694  125.616 60.301  1.00 17.37 ? 48  GLU G CD  1 
ATOM 11164 O OE1 . GLU G 1 48  ? 71.237  124.762 61.090  1.00 12.35 ? 48  GLU G OE1 1 
ATOM 11165 O OE2 . GLU G 1 48  ? 71.858  125.398 59.081  1.00 15.74 ? 48  GLU G OE2 1 
ATOM 11166 N N   . LYS G 1 49  ? 70.092  129.847 63.383  1.00 15.52 ? 49  LYS G N   1 
ATOM 11167 C CA  . LYS G 1 49  ? 68.966  130.752 63.255  1.00 15.78 ? 49  LYS G CA  1 
ATOM 11168 C C   . LYS G 1 49  ? 69.261  132.009 62.438  1.00 14.95 ? 49  LYS G C   1 
ATOM 11169 O O   . LYS G 1 49  ? 68.509  132.363 61.532  1.00 14.95 ? 49  LYS G O   1 
ATOM 11170 C CB  . LYS G 1 49  ? 68.493  131.141 64.662  1.00 15.39 ? 49  LYS G CB  1 
ATOM 11171 C CG  . LYS G 1 49  ? 67.288  132.067 64.749  1.00 17.65 ? 49  LYS G CG  1 
ATOM 11172 C CD  . LYS G 1 49  ? 66.819  132.174 66.210  1.00 18.24 ? 49  LYS G CD  1 
ATOM 11173 C CE  . LYS G 1 49  ? 65.635  133.122 66.414  1.00 20.57 ? 49  LYS G CE  1 
ATOM 11174 N NZ  . LYS G 1 49  ? 66.010  134.560 66.344  1.00 20.57 ? 49  LYS G NZ  1 
ATOM 11175 N N   . PHE G 1 50  ? 70.397  132.634 62.714  1.00 12.51 ? 50  PHE G N   1 
ATOM 11176 C CA  . PHE G 1 50  ? 70.788  133.873 62.047  1.00 11.72 ? 50  PHE G CA  1 
ATOM 11177 C C   . PHE G 1 50  ? 71.609  133.712 60.768  1.00 13.26 ? 50  PHE G C   1 
ATOM 11178 O O   . PHE G 1 50  ? 71.800  134.670 60.016  1.00 13.81 ? 50  PHE G O   1 
ATOM 11179 C CB  . PHE G 1 50  ? 71.502  134.762 63.061  1.00 11.57 ? 50  PHE G CB  1 
ATOM 11180 C CG  . PHE G 1 50  ? 70.853  134.738 64.416  1.00 14.43 ? 50  PHE G CG  1 
ATOM 11181 C CD1 . PHE G 1 50  ? 69.677  135.438 64.644  1.00 12.21 ? 50  PHE G CD1 1 
ATOM 11182 C CD2 . PHE G 1 50  ? 71.362  133.939 65.433  1.00 10.51 ? 50  PHE G CD2 1 
ATOM 11183 C CE1 . PHE G 1 50  ? 69.015  135.339 65.858  1.00 10.49 ? 50  PHE G CE1 1 
ATOM 11184 C CE2 . PHE G 1 50  ? 70.704  133.835 66.650  1.00 10.85 ? 50  PHE G CE2 1 
ATOM 11185 C CZ  . PHE G 1 50  ? 69.527  134.536 66.862  1.00 8.71  ? 50  PHE G CZ  1 
ATOM 11186 N N   . LYS G 1 51  ? 72.089  132.500 60.524  1.00 14.04 ? 51  LYS G N   1 
ATOM 11187 C CA  . LYS G 1 51  ? 72.871  132.205 59.330  1.00 15.93 ? 51  LYS G CA  1 
ATOM 11188 C C   . LYS G 1 51  ? 71.970  132.051 58.096  1.00 15.46 ? 51  LYS G C   1 
ATOM 11189 O O   . LYS G 1 51  ? 72.310  132.513 57.002  1.00 14.92 ? 51  LYS G O   1 
ATOM 11190 C CB  . LYS G 1 51  ? 73.674  130.918 59.536  1.00 15.63 ? 51  LYS G CB  1 
ATOM 11191 C CG  . LYS G 1 51  ? 74.742  130.984 60.620  1.00 20.34 ? 51  LYS G CG  1 
ATOM 11192 C CD  . LYS G 1 51  ? 75.561  129.691 60.636  1.00 24.31 ? 51  LYS G CD  1 
ATOM 11193 C CE  . LYS G 1 51  ? 76.730  129.750 61.610  1.00 25.30 ? 51  LYS G CE  1 
ATOM 11194 N NZ  . LYS G 1 51  ? 77.557  128.521 61.513  1.00 25.51 ? 51  LYS G NZ  1 
ATOM 11195 N N   . LEU G 1 52  ? 70.803  131.443 58.299  1.00 12.87 ? 52  LEU G N   1 
ATOM 11196 C CA  . LEU G 1 52  ? 69.835  131.174 57.237  1.00 8.23  ? 52  LEU G CA  1 
ATOM 11197 C C   . LEU G 1 52  ? 69.342  132.293 56.313  1.00 6.61  ? 52  LEU G C   1 
ATOM 11198 O O   . LEU G 1 52  ? 68.578  132.028 55.387  1.00 4.37  ? 52  LEU G O   1 
ATOM 11199 C CB  . LEU G 1 52  ? 68.630  130.460 57.830  1.00 10.96 ? 52  LEU G CB  1 
ATOM 11200 C CG  . LEU G 1 52  ? 68.923  129.060 58.352  1.00 11.47 ? 52  LEU G CG  1 
ATOM 11201 C CD1 . LEU G 1 52  ? 67.829  128.636 59.311  1.00 9.51  ? 52  LEU G CD1 1 
ATOM 11202 C CD2 . LEU G 1 52  ? 69.064  128.091 57.182  1.00 8.35  ? 52  LEU G CD2 1 
ATOM 11203 N N   . GLY G 1 53  ? 69.740  133.535 56.562  1.00 9.55  ? 53  GLY G N   1 
ATOM 11204 C CA  . GLY G 1 53  ? 69.292  134.629 55.710  1.00 11.48 ? 53  GLY G CA  1 
ATOM 11205 C C   . GLY G 1 53  ? 67.786  134.875 55.716  1.00 6.94  ? 53  GLY G C   1 
ATOM 11206 O O   . GLY G 1 53  ? 67.254  135.531 54.817  1.00 5.29  ? 53  GLY G O   1 
ATOM 11207 N N   . LEU G 1 54  ? 67.100  134.347 56.728  1.00 5.02  ? 54  LEU G N   1 
ATOM 11208 C CA  . LEU G 1 54  ? 65.654  134.510 56.870  1.00 6.82  ? 54  LEU G CA  1 
ATOM 11209 C C   . LEU G 1 54  ? 65.342  135.971 57.175  1.00 5.52  ? 54  LEU G C   1 
ATOM 11210 O O   . LEU G 1 54  ? 66.117  136.652 57.843  1.00 7.41  ? 54  LEU G O   1 
ATOM 11211 C CB  . LEU G 1 54  ? 65.122  133.647 58.018  1.00 2.13  ? 54  LEU G CB  1 
ATOM 11212 C CG  . LEU G 1 54  ? 65.391  132.147 57.979  1.00 2.45  ? 54  LEU G CG  1 
ATOM 11213 C CD1 . LEU G 1 54  ? 64.791  131.503 59.214  1.00 2.52  ? 54  LEU G CD1 1 
ATOM 11214 C CD2 . LEU G 1 54  ? 64.803  131.536 56.721  1.00 7.38  ? 54  LEU G CD2 1 
ATOM 11215 N N   . ASP G 1 55  ? 64.192  136.440 56.716  1.00 6.16  ? 55  ASP G N   1 
ATOM 11216 C CA  . ASP G 1 55  ? 63.786  137.819 56.950  1.00 10.72 ? 55  ASP G CA  1 
ATOM 11217 C C   . ASP G 1 55  ? 63.430  138.000 58.424  1.00 11.79 ? 55  ASP G C   1 
ATOM 11218 O O   . ASP G 1 55  ? 63.811  138.995 59.050  1.00 12.82 ? 55  ASP G O   1 
ATOM 11219 C CB  . ASP G 1 55  ? 62.599  138.160 56.052  1.00 10.70 ? 55  ASP G CB  1 
ATOM 11220 C CG  . ASP G 1 55  ? 62.782  137.649 54.640  1.00 6.87  ? 55  ASP G CG  1 
ATOM 11221 O OD1 . ASP G 1 55  ? 63.679  138.163 53.938  1.00 8.19  ? 55  ASP G OD1 1 
ATOM 11222 O OD2 . ASP G 1 55  ? 62.048  136.714 54.246  1.00 2.00  ? 55  ASP G OD2 1 
ATOM 11223 N N   . PHE G 1 56  ? 62.703  137.026 58.968  1.00 10.54 ? 56  PHE G N   1 
ATOM 11224 C CA  . PHE G 1 56  ? 62.290  137.039 60.370  1.00 7.52  ? 56  PHE G CA  1 
ATOM 11225 C C   . PHE G 1 56  ? 62.601  135.662 60.944  1.00 5.79  ? 56  PHE G C   1 
ATOM 11226 O O   . PHE G 1 56  ? 61.685  134.869 61.171  1.00 5.78  ? 56  PHE G O   1 
ATOM 11227 C CB  . PHE G 1 56  ? 60.817  137.357 60.512  1.00 11.00 ? 56  PHE G CB  1 
ATOM 11228 C CG  . PHE G 1 56  ? 60.439  138.705 59.988  1.00 11.58 ? 56  PHE G CG  1 
ATOM 11229 C CD1 . PHE G 1 56  ? 60.776  139.854 60.694  1.00 11.86 ? 56  PHE G CD1 1 
ATOM 11230 C CD2 . PHE G 1 56  ? 59.780  138.832 58.773  1.00 7.01  ? 56  PHE G CD2 1 
ATOM 11231 C CE1 . PHE G 1 56  ? 60.466  141.109 60.198  1.00 11.22 ? 56  PHE G CE1 1 
ATOM 11232 C CE2 . PHE G 1 56  ? 59.463  140.083 58.265  1.00 8.53  ? 56  PHE G CE2 1 
ATOM 11233 C CZ  . PHE G 1 56  ? 59.809  141.226 58.980  1.00 6.35  ? 56  PHE G CZ  1 
ATOM 11234 N N   . PRO G 1 57  ? 63.889  135.374 61.212  1.00 6.96  ? 57  PRO G N   1 
ATOM 11235 C CA  . PRO G 1 57  ? 64.348  134.094 61.758  1.00 6.87  ? 57  PRO G CA  1 
ATOM 11236 C C   . PRO G 1 57  ? 63.375  133.528 62.785  1.00 7.02  ? 57  PRO G C   1 
ATOM 11237 O O   . PRO G 1 57  ? 63.078  134.169 63.796  1.00 5.91  ? 57  PRO G O   1 
ATOM 11238 C CB  . PRO G 1 57  ? 65.683  134.463 62.397  1.00 9.73  ? 57  PRO G CB  1 
ATOM 11239 C CG  . PRO G 1 57  ? 66.188  135.540 61.497  1.00 10.69 ? 57  PRO G CG  1 
ATOM 11240 C CD  . PRO G 1 57  ? 64.960  136.382 61.293  1.00 12.55 ? 57  PRO G CD  1 
ATOM 11241 N N   . ASN G 1 58  ? 62.846  132.345 62.490  1.00 7.77  ? 58  ASN G N   1 
ATOM 11242 C CA  . ASN G 1 58  ? 61.893  131.679 63.371  1.00 7.73  ? 58  ASN G CA  1 
ATOM 11243 C C   . ASN G 1 58  ? 61.543  130.301 62.814  1.00 3.71  ? 58  ASN G C   1 
ATOM 11244 O O   . ASN G 1 58  ? 61.851  129.982 61.665  1.00 2.00  ? 58  ASN G O   1 
ATOM 11245 C CB  . ASN G 1 58  ? 60.617  132.528 63.512  1.00 9.14  ? 58  ASN G CB  1 
ATOM 11246 C CG  . ASN G 1 58  ? 59.663  131.994 64.575  1.00 12.49 ? 58  ASN G CG  1 
ATOM 11247 O OD1 . ASN G 1 58  ? 60.085  131.534 65.637  1.00 14.39 ? 58  ASN G OD1 1 
ATOM 11248 N ND2 . ASN G 1 58  ? 58.370  132.055 64.289  1.00 16.60 ? 58  ASN G ND2 1 
ATOM 11249 N N   . LEU G 1 59  ? 60.965  129.469 63.646  1.00 8.00  ? 59  LEU G N   1 
ATOM 11250 C CA  . LEU G 1 59  ? 60.542  128.141 63.264  1.00 9.94  ? 59  LEU G CA  1 
ATOM 11251 C C   . LEU G 1 59  ? 59.021  128.118 63.244  1.00 11.40 ? 59  LEU G C   1 
ATOM 11252 O O   . LEU G 1 59  ? 58.374  128.632 64.157  1.00 14.82 ? 59  LEU G O   1 
ATOM 11253 C CB  . LEU G 1 59  ? 61.088  127.091 64.228  1.00 9.98  ? 59  LEU G CB  1 
ATOM 11254 C CG  . LEU G 1 59  ? 62.575  126.788 64.065  1.00 5.62  ? 59  LEU G CG  1 
ATOM 11255 C CD1 . LEU G 1 59  ? 62.980  125.656 64.990  1.00 10.58 ? 59  LEU G CD1 1 
ATOM 11256 C CD2 . LEU G 1 59  ? 62.852  126.414 62.618  1.00 6.33  ? 59  LEU G CD2 1 
ATOM 11257 N N   . PRO G 1 60  ? 58.429  127.516 62.204  1.00 10.40 ? 60  PRO G N   1 
ATOM 11258 C CA  . PRO G 1 60  ? 59.110  126.874 61.079  1.00 11.00 ? 60  PRO G CA  1 
ATOM 11259 C C   . PRO G 1 60  ? 59.434  127.858 59.953  1.00 8.98  ? 60  PRO G C   1 
ATOM 11260 O O   . PRO G 1 60  ? 58.999  129.016 59.976  1.00 6.81  ? 60  PRO G O   1 
ATOM 11261 C CB  . PRO G 1 60  ? 58.086  125.841 60.636  1.00 14.18 ? 60  PRO G CB  1 
ATOM 11262 C CG  . PRO G 1 60  ? 56.808  126.620 60.758  1.00 13.55 ? 60  PRO G CG  1 
ATOM 11263 C CD  . PRO G 1 60  ? 56.967  127.385 62.072  1.00 10.91 ? 60  PRO G CD  1 
ATOM 11264 N N   . TYR G 1 61  ? 60.177  127.378 58.962  1.00 6.44  ? 61  TYR G N   1 
ATOM 11265 C CA  . TYR G 1 61  ? 60.554  128.203 57.826  1.00 7.52  ? 61  TYR G CA  1 
ATOM 11266 C C   . TYR G 1 61  ? 60.785  127.282 56.631  1.00 7.71  ? 61  TYR G C   1 
ATOM 11267 O O   . TYR G 1 61  ? 61.196  126.128 56.821  1.00 10.86 ? 61  TYR G O   1 
ATOM 11268 C CB  . TYR G 1 61  ? 61.814  129.009 58.147  1.00 7.63  ? 61  TYR G CB  1 
ATOM 11269 C CG  . TYR G 1 61  ? 63.077  128.178 58.186  1.00 10.68 ? 61  TYR G CG  1 
ATOM 11270 C CD1 . TYR G 1 61  ? 63.462  127.499 59.343  1.00 11.18 ? 61  TYR G CD1 1 
ATOM 11271 C CD2 . TYR G 1 61  ? 63.877  128.051 57.052  1.00 15.39 ? 61  TYR G CD2 1 
ATOM 11272 C CE1 . TYR G 1 61  ? 64.612  126.715 59.365  1.00 9.88  ? 61  TYR G CE1 1 
ATOM 11273 C CE2 . TYR G 1 61  ? 65.020  127.274 57.064  1.00 14.83 ? 61  TYR G CE2 1 
ATOM 11274 C CZ  . TYR G 1 61  ? 65.384  126.610 58.217  1.00 13.37 ? 61  TYR G CZ  1 
ATOM 11275 O OH  . TYR G 1 61  ? 66.528  125.851 58.195  1.00 14.96 ? 61  TYR G OH  1 
ATOM 11276 N N   . LEU G 1 62  ? 60.533  127.795 55.428  1.00 8.63  ? 62  LEU G N   1 
ATOM 11277 C CA  . LEU G 1 62  ? 60.681  127.010 54.203  1.00 11.61 ? 62  LEU G CA  1 
ATOM 11278 C C   . LEU G 1 62  ? 61.604  127.627 53.158  1.00 12.29 ? 62  LEU G C   1 
ATOM 11279 O O   . LEU G 1 62  ? 61.420  128.772 52.744  1.00 12.58 ? 62  LEU G O   1 
ATOM 11280 C CB  . LEU G 1 62  ? 59.306  126.761 53.571  1.00 9.31  ? 62  LEU G CB  1 
ATOM 11281 C CG  . LEU G 1 62  ? 59.281  125.922 52.291  1.00 4.18  ? 62  LEU G CG  1 
ATOM 11282 C CD1 . LEU G 1 62  ? 59.739  124.506 52.597  1.00 3.41  ? 62  LEU G CD1 1 
ATOM 11283 C CD2 . LEU G 1 62  ? 57.882  125.914 51.693  1.00 8.25  ? 62  LEU G CD2 1 
ATOM 11284 N N   . ILE G 1 63  ? 62.568  126.834 52.706  1.00 17.39 ? 63  ILE G N   1 
ATOM 11285 C CA  . ILE G 1 63  ? 63.523  127.262 51.695  1.00 16.25 ? 63  ILE G CA  1 
ATOM 11286 C C   . ILE G 1 63  ? 63.209  126.575 50.364  1.00 15.69 ? 63  ILE G C   1 
ATOM 11287 O O   . ILE G 1 63  ? 63.628  125.434 50.129  1.00 17.25 ? 63  ILE G O   1 
ATOM 11288 C CB  . ILE G 1 63  ? 64.990  126.935 52.091  1.00 14.90 ? 63  ILE G CB  1 
ATOM 11289 C CG1 . ILE G 1 63  ? 65.349  127.595 53.426  1.00 16.21 ? 63  ILE G CG1 1 
ATOM 11290 C CG2 . ILE G 1 63  ? 65.951  127.413 50.997  1.00 17.18 ? 63  ILE G CG2 1 
ATOM 11291 C CD1 . ILE G 1 63  ? 66.738  127.229 53.944  1.00 7.90  ? 63  ILE G CD1 1 
ATOM 11292 N N   . ASP G 1 64  ? 62.456  127.227 49.522  1.00 16.76 ? 64  ASP G N   1 
ATOM 11293 C CA  . ASP G 1 64  ? 62.146  126.718 48.206  1.00 17.99 ? 64  ASP G CA  1 
ATOM 11294 C C   . ASP G 1 64  ? 63.296  127.159 47.322  1.00 17.75 ? 64  ASP G C   1 
ATOM 11295 O O   . ASP G 1 64  ? 63.151  128.100 46.526  1.00 20.88 ? 64  ASP G O   1 
ATOM 11296 C CB  . ASP G 1 64  ? 60.819  127.299 47.709  1.00 20.14 ? 64  ASP G CB  1 
ATOM 11297 C CG  . ASP G 1 64  ? 60.530  126.951 46.263  1.00 22.61 ? 64  ASP G CG  1 
ATOM 11298 O OD1 . ASP G 1 64  ? 60.080  125.821 46.000  1.00 24.20 ? 64  ASP G OD1 1 
ATOM 11299 O OD2 . ASP G 1 64  ? 60.745  127.815 45.390  1.00 20.49 ? 64  ASP G OD2 1 
ATOM 11300 N N   . GLY G 1 65  ? 64.466  126.589 47.537  1.00 15.68 ? 65  GLY G N   1 
ATOM 11301 C CA  . GLY G 1 65  ? 65.630  126.954 46.752  1.00 14.94 ? 65  GLY G CA  1 
ATOM 11302 C C   . GLY G 1 65  ? 66.029  128.395 46.992  1.00 17.30 ? 65  GLY G C   1 
ATOM 11303 O O   . GLY G 1 65  ? 66.897  128.646 47.815  1.00 18.66 ? 65  GLY G O   1 
ATOM 11304 N N   . ALA G 1 66  ? 65.372  129.320 46.293  1.00 16.30 ? 66  ALA G N   1 
ATOM 11305 C CA  . ALA G 1 66  ? 65.643  130.752 46.420  1.00 16.15 ? 66  ALA G CA  1 
ATOM 11306 C C   . ALA G 1 66  ? 64.612  131.490 47.284  1.00 18.64 ? 66  ALA G C   1 
ATOM 11307 O O   . ALA G 1 66  ? 64.672  132.706 47.421  1.00 19.95 ? 66  ALA G O   1 
ATOM 11308 C CB  . ALA G 1 66  ? 65.722  131.389 45.038  1.00 16.34 ? 66  ALA G CB  1 
ATOM 11309 N N   . HIS G 1 67  ? 63.655  130.761 47.842  1.00 16.99 ? 67  HIS G N   1 
ATOM 11310 C CA  . HIS G 1 67  ? 62.626  131.368 48.676  1.00 15.04 ? 67  HIS G CA  1 
ATOM 11311 C C   . HIS G 1 67  ? 62.721  130.867 50.103  1.00 17.70 ? 67  HIS G C   1 
ATOM 11312 O O   . HIS G 1 67  ? 62.815  129.690 50.335  1.00 19.89 ? 67  HIS G O   1 
ATOM 11313 C CB  . HIS G 1 67  ? 61.236  131.056 48.126  1.00 15.60 ? 67  HIS G CB  1 
ATOM 11314 C CG  . HIS G 1 67  ? 60.896  131.800 46.871  1.00 10.73 ? 67  HIS G CG  1 
ATOM 11315 N ND1 . HIS G 1 67  ? 61.199  131.323 45.614  1.00 9.25  ? 67  HIS G ND1 1 
ATOM 11316 C CD2 . HIS G 1 67  ? 60.259  132.979 46.682  1.00 5.58  ? 67  HIS G CD2 1 
ATOM 11317 C CE1 . HIS G 1 67  ? 60.766  132.177 44.705  1.00 8.41  ? 67  HIS G CE1 1 
ATOM 11318 N NE2 . HIS G 1 67  ? 60.192  133.190 45.326  1.00 6.25  ? 67  HIS G NE2 1 
ATOM 11319 N N   . LYS G 1 68  ? 62.673  131.783 51.055  1.00 16.64 ? 68  LYS G N   1 
ATOM 11320 C CA  . LYS G 1 68  ? 62.762  131.432 52.478  1.00 15.70 ? 68  LYS G CA  1 
ATOM 11321 C C   . LYS G 1 68  ? 61.559  131.990 53.236  1.00 14.49 ? 68  LYS G C   1 
ATOM 11322 O O   . LYS G 1 68  ? 61.646  133.019 53.912  1.00 14.97 ? 68  LYS G O   1 
ATOM 11323 C CB  . LYS G 1 68  ? 64.078  131.957 53.054  1.00 15.51 ? 68  LYS G CB  1 
ATOM 11324 C CG  . LYS G 1 68  ? 65.291  131.240 52.482  1.00 18.71 ? 68  LYS G CG  1 
ATOM 11325 C CD  . LYS G 1 68  ? 66.567  132.043 52.670  1.00 16.21 ? 68  LYS G CD  1 
ATOM 11326 C CE  . LYS G 1 68  ? 67.775  131.260 52.174  1.00 12.32 ? 68  LYS G CE  1 
ATOM 11327 N NZ  . LYS G 1 68  ? 67.594  130.775 50.781  1.00 10.52 ? 68  LYS G NZ  1 
ATOM 11328 N N   . ILE G 1 69  ? 60.442  131.278 53.154  1.00 15.45 ? 69  ILE G N   1 
ATOM 11329 C CA  . ILE G 1 69  ? 59.191  131.701 53.755  1.00 17.45 ? 69  ILE G CA  1 
ATOM 11330 C C   . ILE G 1 69  ? 59.158  131.557 55.281  1.00 16.57 ? 69  ILE G C   1 
ATOM 11331 O O   . ILE G 1 69  ? 59.465  130.472 55.822  1.00 16.28 ? 69  ILE G O   1 
ATOM 11332 C CB  . ILE G 1 69  ? 57.962  130.977 53.102  1.00 18.13 ? 69  ILE G CB  1 
ATOM 11333 C CG1 . ILE G 1 69  ? 57.948  131.183 51.581  1.00 18.39 ? 69  ILE G CG1 1 
ATOM 11334 C CG2 . ILE G 1 69  ? 56.659  131.552 53.637  1.00 20.40 ? 69  ILE G CG2 1 
ATOM 11335 C CD1 . ILE G 1 69  ? 58.917  130.319 50.805  1.00 12.89 ? 69  ILE G CD1 1 
ATOM 11336 N N   . THR G 1 70  ? 58.713  132.717 55.887  1.00 17.86 ? 70  THR G N   1 
ATOM 11337 C CA  . THR G 1 70  ? 58.657  132.677 57.340  1.00 15.64 ? 70  THR G CA  1 
ATOM 11338 C C   . THR G 1 70  ? 57.172  132.664 57.695  1.00 13.86 ? 70  THR G C   1 
ATOM 11339 O O   . THR G 1 70  ? 56.348  133.142 56.911  1.00 13.07 ? 70  THR G O   1 
ATOM 11340 C CB  . THR G 1 70  ? 59.326  133.923 57.979  1.00 12.89 ? 70  THR G CB  1 
ATOM 11341 O OG1 . THR G 1 70  ? 60.632  134.126 57.416  1.00 10.57 ? 70  THR G OG1 1 
ATOM 11342 C CG2 . THR G 1 70  ? 59.456  133.731 59.496  1.00 9.14  ? 70  THR G CG2 1 
ATOM 11343 N N   . GLN G 1 71  ? 56.843  132.087 58.850  1.00 12.57 ? 71  GLN G N   1 
ATOM 11344 C CA  . GLN G 1 71  ? 55.472  131.988 59.351  1.00 10.64 ? 71  GLN G CA  1 
ATOM 11345 C C   . GLN G 1 71  ? 54.662  130.840 58.765  1.00 10.68 ? 71  GLN G C   1 
ATOM 11346 O O   . GLN G 1 71  ? 54.411  130.786 57.560  1.00 11.09 ? 71  GLN G O   1 
ATOM 11347 C CB  . GLN G 1 71  ? 54.719  133.309 59.182  1.00 11.20 ? 71  GLN G CB  1 
ATOM 11348 C CG  . GLN G 1 71  ? 55.095  134.370 60.192  1.00 13.00 ? 71  GLN G CG  1 
ATOM 11349 C CD  . GLN G 1 71  ? 54.625  134.039 61.591  1.00 9.92  ? 71  GLN G CD  1 
ATOM 11350 O OE1 . GLN G 1 71  ? 54.070  132.967 61.844  1.00 11.18 ? 71  GLN G OE1 1 
ATOM 11351 N NE2 . GLN G 1 71  ? 54.852  134.957 62.512  1.00 6.38  ? 71  GLN G NE2 1 
ATOM 11352 N N   . SER G 1 72  ? 54.217  129.953 59.650  1.00 12.65 ? 72  SER G N   1 
ATOM 11353 C CA  . SER G 1 72  ? 53.435  128.769 59.304  1.00 13.12 ? 72  SER G CA  1 
ATOM 11354 C C   . SER G 1 72  ? 52.370  128.978 58.225  1.00 13.02 ? 72  SER G C   1 
ATOM 11355 O O   . SER G 1 72  ? 52.490  128.450 57.120  1.00 11.97 ? 72  SER G O   1 
ATOM 11356 C CB  . SER G 1 72  ? 52.810  128.182 60.576  1.00 7.62  ? 72  SER G CB  1 
ATOM 11357 O OG  . SER G 1 72  ? 52.416  129.208 61.477  1.00 12.84 ? 72  SER G OG  1 
ATOM 11358 N N   . ASN G 1 73  ? 51.387  129.643 58.592  1.00 12.84 ? 73  ASN G N   1 
ATOM 11359 C CA  . ASN G 1 73  ? 50.333  129.892 57.609  1.00 10.68 ? 73  ASN G CA  1 
ATOM 11360 C C   . ASN G 1 73  ? 50.875  130.461 56.303  1.00 11.77 ? 73  ASN G C   1 
ATOM 11361 O O   . ASN G 1 73  ? 50.472  130.025 55.227  1.00 9.65  ? 73  ASN G O   1 
ATOM 11362 C CB  . ASN G 1 73  ? 49.270  130.835 58.178  1.00 11.55 ? 73  ASN G CB  1 
ATOM 11363 C CG  . ASN G 1 73  ? 48.326  130.143 59.151  1.00 11.60 ? 73  ASN G CG  1 
ATOM 11364 O OD1 . ASN G 1 73  ? 48.491  128.965 59.478  1.00 3.03  ? 73  ASN G OD1 1 
ATOM 11365 N ND2 . ASN G 1 73  ? 47.331  130.882 59.623  1.00 9.03  ? 73  ASN G ND2 1 
ATOM 11366 N N   . ALA G 1 74  ? 51.794  131.422 56.399  1.00 12.25 ? 74  ALA G N   1 
ATOM 11367 C CA  . ALA G 1 74  ? 52.401  132.049 55.220  1.00 10.70 ? 74  ALA G CA  1 
ATOM 11368 C C   . ALA G 1 74  ? 53.044  130.999 54.312  1.00 12.37 ? 74  ALA G C   1 
ATOM 11369 O O   . ALA G 1 74  ? 52.983  131.121 53.088  1.00 12.16 ? 74  ALA G O   1 
ATOM 11370 C CB  . ALA G 1 74  ? 53.441  133.065 55.638  1.00 11.15 ? 74  ALA G CB  1 
ATOM 11371 N N   . ILE G 1 75  ? 53.626  129.979 54.920  1.00 13.22 ? 75  ILE G N   1 
ATOM 11372 C CA  . ILE G 1 75  ? 54.239  128.894 54.175  1.00 13.30 ? 75  ILE G CA  1 
ATOM 11373 C C   . ILE G 1 75  ? 53.109  128.112 53.520  1.00 13.30 ? 75  ILE G C   1 
ATOM 11374 O O   . ILE G 1 75  ? 53.214  127.714 52.359  1.00 15.10 ? 75  ILE G O   1 
ATOM 11375 C CB  . ILE G 1 75  ? 55.051  127.962 55.103  1.00 15.98 ? 75  ILE G CB  1 
ATOM 11376 C CG1 . ILE G 1 75  ? 56.182  128.741 55.782  1.00 15.30 ? 75  ILE G CG1 1 
ATOM 11377 C CG2 . ILE G 1 75  ? 55.625  126.799 54.306  1.00 17.91 ? 75  ILE G CG2 1 
ATOM 11378 C CD1 . ILE G 1 75  ? 56.839  127.999 56.925  1.00 11.07 ? 75  ILE G CD1 1 
ATOM 11379 N N   . LEU G 1 76  ? 52.010  127.941 54.255  1.00 13.63 ? 76  LEU G N   1 
ATOM 11380 C CA  . LEU G 1 76  ? 50.847  127.217 53.749  1.00 12.31 ? 76  LEU G CA  1 
ATOM 11381 C C   . LEU G 1 76  ? 50.312  127.891 52.493  1.00 12.99 ? 76  LEU G C   1 
ATOM 11382 O O   . LEU G 1 76  ? 50.239  127.273 51.433  1.00 13.79 ? 76  LEU G O   1 
ATOM 11383 C CB  . LEU G 1 76  ? 49.750  127.104 54.820  1.00 9.87  ? 76  LEU G CB  1 
ATOM 11384 C CG  . LEU G 1 76  ? 50.050  126.183 56.015  1.00 8.17  ? 76  LEU G CG  1 
ATOM 11385 C CD1 . LEU G 1 76  ? 48.887  126.164 56.996  1.00 6.45  ? 76  LEU G CD1 1 
ATOM 11386 C CD2 . LEU G 1 76  ? 50.340  124.774 55.524  1.00 12.04 ? 76  LEU G CD2 1 
ATOM 11387 N N   . CYS G 1 77  ? 49.981  129.171 52.601  1.00 12.36 ? 77  CYS G N   1 
ATOM 11388 C CA  . CYS G 1 77  ? 49.484  129.925 51.459  1.00 13.02 ? 77  CYS G CA  1 
ATOM 11389 C C   . CYS G 1 77  ? 50.392  129.714 50.249  1.00 11.89 ? 77  CYS G C   1 
ATOM 11390 O O   . CYS G 1 77  ? 49.932  129.350 49.174  1.00 10.15 ? 77  CYS G O   1 
ATOM 11391 C CB  . CYS G 1 77  ? 49.445  131.422 51.782  1.00 16.25 ? 77  CYS G CB  1 
ATOM 11392 S SG  . CYS G 1 77  ? 48.073  131.964 52.810  1.00 12.97 ? 77  CYS G SG  1 
ATOM 11393 N N   . TYR G 1 78  ? 51.686  129.925 50.455  1.00 10.16 ? 78  TYR G N   1 
ATOM 11394 C CA  . TYR G 1 78  ? 52.704  129.792 49.420  1.00 12.72 ? 78  TYR G CA  1 
ATOM 11395 C C   . TYR G 1 78  ? 52.679  128.477 48.633  1.00 11.74 ? 78  TYR G C   1 
ATOM 11396 O O   . TYR G 1 78  ? 52.814  128.489 47.407  1.00 8.25  ? 78  TYR G O   1 
ATOM 11397 C CB  . TYR G 1 78  ? 54.089  130.000 50.039  1.00 12.36 ? 78  TYR G CB  1 
ATOM 11398 C CG  . TYR G 1 78  ? 55.232  129.668 49.111  1.00 14.20 ? 78  TYR G CG  1 
ATOM 11399 C CD1 . TYR G 1 78  ? 55.544  130.498 48.038  1.00 14.30 ? 78  TYR G CD1 1 
ATOM 11400 C CD2 . TYR G 1 78  ? 55.992  128.511 49.295  1.00 15.61 ? 78  TYR G CD2 1 
ATOM 11401 C CE1 . TYR G 1 78  ? 56.580  130.180 47.167  1.00 14.95 ? 78  TYR G CE1 1 
ATOM 11402 C CE2 . TYR G 1 78  ? 57.028  128.187 48.431  1.00 15.83 ? 78  TYR G CE2 1 
ATOM 11403 C CZ  . TYR G 1 78  ? 57.316  129.025 47.371  1.00 14.33 ? 78  TYR G CZ  1 
ATOM 11404 O OH  . TYR G 1 78  ? 58.329  128.703 46.507  1.00 7.92  ? 78  TYR G OH  1 
ATOM 11405 N N   . ILE G 1 79  ? 52.571  127.350 49.331  1.00 11.14 ? 79  ILE G N   1 
ATOM 11406 C CA  . ILE G 1 79  ? 52.535  126.051 48.667  1.00 8.17  ? 79  ILE G CA  1 
ATOM 11407 C C   . ILE G 1 79  ? 51.204  125.961 47.940  1.00 7.88  ? 79  ILE G C   1 
ATOM 11408 O O   . ILE G 1 79  ? 51.140  125.551 46.779  1.00 6.73  ? 79  ILE G O   1 
ATOM 11409 C CB  . ILE G 1 79  ? 52.658  124.902 49.685  1.00 9.54  ? 79  ILE G CB  1 
ATOM 11410 C CG1 . ILE G 1 79  ? 53.981  125.034 50.442  1.00 11.46 ? 79  ILE G CG1 1 
ATOM 11411 C CG2 . ILE G 1 79  ? 52.584  123.546 48.981  1.00 9.58  ? 79  ILE G CG2 1 
ATOM 11412 C CD1 . ILE G 1 79  ? 54.043  124.242 51.741  1.00 14.45 ? 79  ILE G CD1 1 
ATOM 11413 N N   . ALA G 1 80  ? 50.151  126.411 48.617  1.00 11.07 ? 80  ALA G N   1 
ATOM 11414 C CA  . ALA G 1 80  ? 48.800  126.402 48.071  1.00 10.67 ? 80  ALA G CA  1 
ATOM 11415 C C   . ALA G 1 80  ? 48.729  127.033 46.682  1.00 10.64 ? 80  ALA G C   1 
ATOM 11416 O O   . ALA G 1 80  ? 48.152  126.448 45.772  1.00 9.45  ? 80  ALA G O   1 
ATOM 11417 C CB  . ALA G 1 80  ? 47.837  127.113 49.023  1.00 10.11 ? 80  ALA G CB  1 
ATOM 11418 N N   . ARG G 1 81  ? 49.309  128.218 46.517  1.00 8.86  ? 81  ARG G N   1 
ATOM 11419 C CA  . ARG G 1 81  ? 49.299  128.908 45.227  1.00 10.83 ? 81  ARG G CA  1 
ATOM 11420 C C   . ARG G 1 81  ? 49.835  128.021 44.098  1.00 10.07 ? 81  ARG G C   1 
ATOM 11421 O O   . ARG G 1 81  ? 49.253  128.009 43.003  1.00 8.55  ? 81  ARG G O   1 
ATOM 11422 C CB  . ARG G 1 81  ? 50.162  130.168 45.267  1.00 10.70 ? 81  ARG G CB  1 
ATOM 11423 C CG  . ARG G 1 81  ? 49.853  131.156 46.362  1.00 12.19 ? 81  ARG G CG  1 
ATOM 11424 C CD  . ARG G 1 81  ? 50.758  132.355 46.192  1.00 13.70 ? 81  ARG G CD  1 
ATOM 11425 N NE  . ARG G 1 81  ? 51.049  133.043 47.444  1.00 18.33 ? 81  ARG G NE  1 
ATOM 11426 C CZ  . ARG G 1 81  ? 52.279  133.290 47.886  1.00 22.52 ? 81  ARG G CZ  1 
ATOM 11427 N NH1 . ARG G 1 81  ? 53.339  132.901 47.190  1.00 21.13 ? 81  ARG G NH1 1 
ATOM 11428 N NH2 . ARG G 1 81  ? 52.456  133.965 49.009  1.00 25.92 ? 81  ARG G NH2 1 
ATOM 11429 N N   . LYS G 1 82  ? 50.885  127.275 44.380  1.00 9.52  ? 82  LYS G N   1 
ATOM 11430 C CA  . LYS G 1 82  ? 51.517  126.384 43.406  1.00 14.13 ? 82  LYS G CA  1 
ATOM 11431 C C   . LYS G 1 82  ? 50.712  125.115 43.066  1.00 16.45 ? 82  LYS G C   1 
ATOM 11432 O O   . LYS G 1 82  ? 51.096  124.313 42.197  1.00 15.63 ? 82  LYS G O   1 
ATOM 11433 C CB  . LYS G 1 82  ? 52.928  126.018 43.883  1.00 13.09 ? 82  LYS G CB  1 
ATOM 11434 C CG  . LYS G 1 82  ? 53.787  127.240 44.202  1.00 16.27 ? 82  LYS G CG  1 
ATOM 11435 C CD  . LYS G 1 82  ? 55.180  126.882 44.726  1.00 16.89 ? 82  LYS G CD  1 
ATOM 11436 C CE  . LYS G 1 82  ? 56.116  126.390 43.623  1.00 17.39 ? 82  LYS G CE  1 
ATOM 11437 N NZ  . LYS G 1 82  ? 57.540  126.312 44.069  1.00 14.33 ? 82  LYS G NZ  1 
ATOM 11438 N N   . HIS G 1 83  ? 49.609  124.888 43.771  1.00 18.45 ? 83  HIS G N   1 
ATOM 11439 C CA  . HIS G 1 83  ? 48.755  123.744 43.540  1.00 18.57 ? 83  HIS G CA  1 
ATOM 11440 C C   . HIS G 1 83  ? 47.286  124.190 43.572  1.00 19.46 ? 83  HIS G C   1 
ATOM 11441 O O   . HIS G 1 83  ? 46.369  123.372 43.586  1.00 19.78 ? 83  HIS G O   1 
ATOM 11442 C CB  . HIS G 1 83  ? 48.995  122.689 44.625  1.00 21.49 ? 83  HIS G CB  1 
ATOM 11443 C CG  . HIS G 1 83  ? 50.430  122.286 44.783  1.00 25.30 ? 83  HIS G CG  1 
ATOM 11444 N ND1 . HIS G 1 83  ? 51.186  121.790 43.744  1.00 28.44 ? 83  HIS G ND1 1 
ATOM 11445 C CD2 . HIS G 1 83  ? 51.237  122.275 45.872  1.00 24.13 ? 83  HIS G CD2 1 
ATOM 11446 C CE1 . HIS G 1 83  ? 52.394  121.486 44.183  1.00 27.76 ? 83  HIS G CE1 1 
ATOM 11447 N NE2 . HIS G 1 83  ? 52.452  121.770 45.471  1.00 24.45 ? 83  HIS G NE2 1 
ATOM 11448 N N   . ASN G 1 84  ? 47.074  125.501 43.611  1.00 19.11 ? 84  ASN G N   1 
ATOM 11449 C CA  . ASN G 1 84  ? 45.757  126.115 43.655  1.00 17.56 ? 84  ASN G CA  1 
ATOM 11450 C C   . ASN G 1 84  ? 44.763  125.551 44.661  1.00 17.54 ? 84  ASN G C   1 
ATOM 11451 O O   . ASN G 1 84  ? 43.561  125.517 44.427  1.00 22.18 ? 84  ASN G O   1 
ATOM 11452 C CB  . ASN G 1 84  ? 45.144  126.210 42.262  1.00 20.50 ? 84  ASN G CB  1 
ATOM 11453 C CG  . ASN G 1 84  ? 45.040  127.646 41.782  1.00 16.59 ? 84  ASN G CG  1 
ATOM 11454 O OD1 . ASN G 1 84  ? 43.950  128.200 41.681  1.00 12.94 ? 84  ASN G OD1 1 
ATOM 11455 N ND2 . ASN G 1 84  ? 46.181  128.273 41.531  1.00 17.32 ? 84  ASN G ND2 1 
ATOM 11456 N N   . LEU G 1 85  ? 45.284  125.189 45.825  1.00 13.68 ? 85  LEU G N   1 
ATOM 11457 C CA  . LEU G 1 85  ? 44.491  124.664 46.935  1.00 8.60  ? 85  LEU G CA  1 
ATOM 11458 C C   . LEU G 1 85  ? 43.892  125.851 47.694  1.00 5.57  ? 85  LEU G C   1 
ATOM 11459 O O   . LEU G 1 85  ? 43.602  125.746 48.881  1.00 4.62  ? 85  LEU G O   1 
ATOM 11460 C CB  . LEU G 1 85  ? 45.417  123.909 47.904  1.00 9.41  ? 85  LEU G CB  1 
ATOM 11461 C CG  . LEU G 1 85  ? 45.776  122.428 47.795  1.00 2.97  ? 85  LEU G CG  1 
ATOM 11462 C CD1 . LEU G 1 85  ? 44.711  121.604 48.476  1.00 3.48  ? 85  LEU G CD1 1 
ATOM 11463 C CD2 . LEU G 1 85  ? 45.981  122.008 46.362  1.00 2.00  ? 85  LEU G CD2 1 
ATOM 11464 N N   . CYS G 1 86  ? 43.703  126.973 47.029  1.00 4.58  ? 86  CYS G N   1 
ATOM 11465 C CA  . CYS G 1 86  ? 43.201  128.188 47.653  1.00 10.23 ? 86  CYS G CA  1 
ATOM 11466 C C   . CYS G 1 86  ? 41.803  128.587 47.170  1.00 13.36 ? 86  CYS G C   1 
ATOM 11467 O O   . CYS G 1 86  ? 41.210  127.914 46.329  1.00 13.60 ? 86  CYS G O   1 
ATOM 11468 C CB  . CYS G 1 86  ? 44.206  129.325 47.396  1.00 9.19  ? 86  CYS G CB  1 
ATOM 11469 S SG  . CYS G 1 86  ? 44.213  130.697 48.585  1.00 11.45 ? 86  CYS G SG  1 
ATOM 11470 N N   . GLY G 1 87  ? 41.274  129.676 47.722  1.00 14.87 ? 87  GLY G N   1 
ATOM 11471 C CA  . GLY G 1 87  ? 39.951  130.140 47.339  1.00 13.22 ? 87  GLY G CA  1 
ATOM 11472 C C   . GLY G 1 87  ? 39.870  130.508 45.872  1.00 13.24 ? 87  GLY G C   1 
ATOM 11473 O O   . GLY G 1 87  ? 40.799  131.115 45.337  1.00 14.89 ? 87  GLY G O   1 
ATOM 11474 N N   . GLU G 1 88  ? 38.775  130.112 45.226  1.00 14.57 ? 88  GLU G N   1 
ATOM 11475 C CA  . GLU G 1 88  ? 38.544  130.396 43.815  1.00 13.04 ? 88  GLU G CA  1 
ATOM 11476 C C   . GLU G 1 88  ? 37.589  131.563 43.656  1.00 12.71 ? 88  GLU G C   1 
ATOM 11477 O O   . GLU G 1 88  ? 37.870  132.521 42.936  1.00 11.50 ? 88  GLU G O   1 
ATOM 11478 C CB  . GLU G 1 88  ? 37.949  129.180 43.120  1.00 11.31 ? 88  GLU G CB  1 
ATOM 11479 C CG  . GLU G 1 88  ? 38.916  128.056 42.863  1.00 9.51  ? 88  GLU G CG  1 
ATOM 11480 C CD  . GLU G 1 88  ? 38.783  127.515 41.453  1.00 13.22 ? 88  GLU G CD  1 
ATOM 11481 O OE1 . GLU G 1 88  ? 37.637  127.378 40.970  1.00 13.08 ? 88  GLU G OE1 1 
ATOM 11482 O OE2 . GLU G 1 88  ? 39.823  127.243 40.815  1.00 12.78 ? 88  GLU G OE2 1 
ATOM 11483 N N   . THR G 1 89  ? 36.419  131.432 44.269  1.00 14.55 ? 89  THR G N   1 
ATOM 11484 C CA  . THR G 1 89  ? 35.406  132.478 44.222  1.00 16.72 ? 89  THR G CA  1 
ATOM 11485 C C   . THR G 1 89  ? 35.607  133.335 45.452  1.00 16.61 ? 89  THR G C   1 
ATOM 11486 O O   . THR G 1 89  ? 36.112  132.825 46.477  1.00 17.28 ? 89  THR G O   1 
ATOM 11487 C CB  . THR G 1 89  ? 33.973  131.875 44.224  1.00 15.83 ? 89  THR G CB  1 
ATOM 11488 O OG1 . THR G 1 89  ? 33.794  131.047 45.381  1.00 11.45 ? 89  THR G OG1 1 
ATOM 11489 C CG2 . THR G 1 89  ? 33.737  131.034 42.980  1.00 13.05 ? 89  THR G CG2 1 
ATOM 11490 N N   . GLU G 1 90  ? 35.231  134.614 45.410  1.00 16.86 ? 90  GLU G N   1 
ATOM 11491 C CA  . GLU G 1 90  ? 35.382  135.499 46.571  1.00 16.86 ? 90  GLU G CA  1 
ATOM 11492 C C   . GLU G 1 90  ? 34.634  134.891 47.751  1.00 16.69 ? 90  GLU G C   1 
ATOM 11493 O O   . GLU G 1 90  ? 34.993  135.103 48.905  1.00 17.76 ? 90  GLU G O   1 
ATOM 11494 C CB  . GLU G 1 90  ? 34.844  136.899 46.268  1.00 18.19 ? 90  GLU G CB  1 
ATOM 11495 C CG  . GLU G 1 90  ? 35.688  138.043 46.848  1.00 18.95 ? 90  GLU G CG  1 
ATOM 11496 C CD  . GLU G 1 90  ? 35.236  138.502 48.224  1.00 15.73 ? 90  GLU G CD  1 
ATOM 11497 O OE1 . GLU G 1 90  ? 35.471  137.797 49.212  1.00 14.32 ? 90  GLU G OE1 1 
ATOM 11498 O OE2 . GLU G 1 90  ? 34.658  139.600 48.320  1.00 15.30 ? 90  GLU G OE2 1 
ATOM 11499 N N   . GLU G 1 91  ? 33.589  134.130 47.440  1.00 16.76 ? 91  GLU G N   1 
ATOM 11500 C CA  . GLU G 1 91  ? 32.787  133.437 48.440  1.00 17.22 ? 91  GLU G CA  1 
ATOM 11501 C C   . GLU G 1 91  ? 33.728  132.469 49.153  1.00 15.35 ? 91  GLU G C   1 
ATOM 11502 O O   . GLU G 1 91  ? 33.946  132.572 50.363  1.00 17.20 ? 91  GLU G O   1 
ATOM 11503 C CB  . GLU G 1 91  ? 31.656  132.662 47.741  1.00 19.29 ? 91  GLU G CB  1 
ATOM 11504 C CG  . GLU G 1 91  ? 30.876  131.692 48.624  1.00 20.26 ? 91  GLU G CG  1 
ATOM 11505 C CD  . GLU G 1 91  ? 30.049  130.697 47.820  1.00 20.98 ? 91  GLU G CD  1 
ATOM 11506 O OE1 . GLU G 1 91  ? 30.515  130.245 46.752  1.00 27.63 ? 91  GLU G OE1 1 
ATOM 11507 O OE2 . GLU G 1 91  ? 28.933  130.354 48.265  1.00 24.50 ? 91  GLU G OE2 1 
ATOM 11508 N N   . GLU G 1 92  ? 34.331  131.577 48.374  1.00 16.94 ? 92  GLU G N   1 
ATOM 11509 C CA  . GLU G 1 92  ? 35.260  130.589 48.904  1.00 18.60 ? 92  GLU G CA  1 
ATOM 11510 C C   . GLU G 1 92  ? 36.457  131.243 49.595  1.00 17.52 ? 92  GLU G C   1 
ATOM 11511 O O   . GLU G 1 92  ? 36.942  130.744 50.613  1.00 18.63 ? 92  GLU G O   1 
ATOM 11512 C CB  . GLU G 1 92  ? 35.746  129.672 47.783  1.00 18.65 ? 92  GLU G CB  1 
ATOM 11513 C CG  . GLU G 1 92  ? 34.655  128.817 47.166  1.00 22.04 ? 92  GLU G CG  1 
ATOM 11514 C CD  . GLU G 1 92  ? 35.169  127.945 46.036  1.00 25.09 ? 92  GLU G CD  1 
ATOM 11515 O OE1 . GLU G 1 92  ? 35.598  128.506 45.001  1.00 26.09 ? 92  GLU G OE1 1 
ATOM 11516 O OE2 . GLU G 1 92  ? 35.144  126.701 46.185  1.00 26.72 ? 92  GLU G OE2 1 
ATOM 11517 N N   . LYS G 1 93  ? 36.918  132.370 49.056  1.00 16.08 ? 93  LYS G N   1 
ATOM 11518 C CA  . LYS G 1 93  ? 38.053  133.089 49.629  1.00 14.38 ? 93  LYS G CA  1 
ATOM 11519 C C   . LYS G 1 93  ? 37.782  133.474 51.075  1.00 12.65 ? 93  LYS G C   1 
ATOM 11520 O O   . LYS G 1 93  ? 38.655  133.323 51.927  1.00 15.01 ? 93  LYS G O   1 
ATOM 11521 C CB  . LYS G 1 93  ? 38.368  134.354 48.824  1.00 12.87 ? 93  LYS G CB  1 
ATOM 11522 C CG  . LYS G 1 93  ? 39.055  134.081 47.498  1.00 10.45 ? 93  LYS G CG  1 
ATOM 11523 C CD  . LYS G 1 93  ? 39.421  135.364 46.773  1.00 8.44  ? 93  LYS G CD  1 
ATOM 11524 C CE  . LYS G 1 93  ? 40.176  135.034 45.493  1.00 14.56 ? 93  LYS G CE  1 
ATOM 11525 N NZ  . LYS G 1 93  ? 40.371  136.217 44.615  1.00 11.12 ? 93  LYS G NZ  1 
ATOM 11526 N N   . ILE G 1 94  ? 36.556  133.887 51.349  1.00 11.55 ? 94  ILE G N   1 
ATOM 11527 C CA  . ILE G 1 94  ? 36.161  134.272 52.694  1.00 12.85 ? 94  ILE G CA  1 
ATOM 11528 C C   . ILE G 1 94  ? 36.118  133.074 53.650  1.00 13.21 ? 94  ILE G C   1 
ATOM 11529 O O   . ILE G 1 94  ? 36.357  133.220 54.849  1.00 12.03 ? 94  ILE G O   1 
ATOM 11530 C CB  . ILE G 1 94  ? 34.824  135.053 52.675  1.00 12.44 ? 94  ILE G CB  1 
ATOM 11531 C CG1 . ILE G 1 94  ? 35.046  136.439 52.051  1.00 12.26 ? 94  ILE G CG1 1 
ATOM 11532 C CG2 . ILE G 1 94  ? 34.250  135.186 54.080  1.00 14.83 ? 94  ILE G CG2 1 
ATOM 11533 C CD1 . ILE G 1 94  ? 33.780  137.255 51.873  1.00 13.97 ? 94  ILE G CD1 1 
ATOM 11534 N N   . ARG G 1 95  ? 35.858  131.883 53.122  1.00 13.86 ? 95  ARG G N   1 
ATOM 11535 C CA  . ARG G 1 95  ? 35.830  130.685 53.961  1.00 15.06 ? 95  ARG G CA  1 
ATOM 11536 C C   . ARG G 1 95  ? 37.256  130.242 54.235  1.00 13.33 ? 95  ARG G C   1 
ATOM 11537 O O   . ARG G 1 95  ? 37.535  129.606 55.248  1.00 12.91 ? 95  ARG G O   1 
ATOM 11538 C CB  . ARG G 1 95  ? 35.085  129.539 53.280  1.00 16.46 ? 95  ARG G CB  1 
ATOM 11539 C CG  . ARG G 1 95  ? 33.757  129.908 52.678  1.00 11.31 ? 95  ARG G CG  1 
ATOM 11540 C CD  . ARG G 1 95  ? 32.796  128.758 52.800  1.00 11.66 ? 95  ARG G CD  1 
ATOM 11541 N NE  . ARG G 1 95  ? 32.170  128.740 54.116  1.00 7.05  ? 95  ARG G NE  1 
ATOM 11542 C CZ  . ARG G 1 95  ? 31.557  127.685 54.631  1.00 7.44  ? 95  ARG G CZ  1 
ATOM 11543 N NH1 . ARG G 1 95  ? 31.505  126.558 53.941  1.00 8.93  ? 95  ARG G NH1 1 
ATOM 11544 N NH2 . ARG G 1 95  ? 30.945  127.775 55.803  1.00 10.64 ? 95  ARG G NH2 1 
ATOM 11545 N N   . VAL G 1 96  ? 38.142  130.534 53.292  1.00 12.65 ? 96  VAL G N   1 
ATOM 11546 C CA  . VAL G 1 96  ? 39.546  130.185 53.428  1.00 14.51 ? 96  VAL G CA  1 
ATOM 11547 C C   . VAL G 1 96  ? 40.158  131.060 54.516  1.00 14.04 ? 96  VAL G C   1 
ATOM 11548 O O   . VAL G 1 96  ? 40.978  130.599 55.307  1.00 17.09 ? 96  VAL G O   1 
ATOM 11549 C CB  . VAL G 1 96  ? 40.322  130.400 52.100  1.00 12.98 ? 96  VAL G CB  1 
ATOM 11550 C CG1 . VAL G 1 96  ? 41.812  130.136 52.298  1.00 11.92 ? 96  VAL G CG1 1 
ATOM 11551 C CG2 . VAL G 1 96  ? 39.781  129.487 51.024  1.00 10.60 ? 96  VAL G CG2 1 
ATOM 11552 N N   . ASP G 1 97  ? 39.763  132.328 54.544  1.00 9.67  ? 97  ASP G N   1 
ATOM 11553 C CA  . ASP G 1 97  ? 40.269  133.265 55.536  1.00 9.71  ? 97  ASP G CA  1 
ATOM 11554 C C   . ASP G 1 97  ? 39.863  132.878 56.942  1.00 12.28 ? 97  ASP G C   1 
ATOM 11555 O O   . ASP G 1 97  ? 40.709  132.563 57.778  1.00 12.23 ? 97  ASP G O   1 
ATOM 11556 C CB  . ASP G 1 97  ? 39.758  134.675 55.252  1.00 4.85  ? 97  ASP G CB  1 
ATOM 11557 C CG  . ASP G 1 97  ? 40.452  135.319 54.088  1.00 6.80  ? 97  ASP G CG  1 
ATOM 11558 O OD1 . ASP G 1 97  ? 41.065  134.595 53.266  1.00 8.69  ? 97  ASP G OD1 1 
ATOM 11559 O OD2 . ASP G 1 97  ? 40.383  136.562 54.016  1.00 7.20  ? 97  ASP G OD2 1 
ATOM 11560 N N   . ILE G 1 98  ? 38.560  132.906 57.197  1.00 12.10 ? 98  ILE G N   1 
ATOM 11561 C CA  . ILE G 1 98  ? 38.041  132.583 58.513  1.00 6.99  ? 98  ILE G CA  1 
ATOM 11562 C C   . ILE G 1 98  ? 38.609  131.284 59.064  1.00 9.31  ? 98  ILE G C   1 
ATOM 11563 O O   . ILE G 1 98  ? 39.228  131.288 60.125  1.00 8.21  ? 98  ILE G O   1 
ATOM 11564 C CB  . ILE G 1 98  ? 36.506  132.555 58.526  1.00 5.70  ? 98  ILE G CB  1 
ATOM 11565 C CG1 . ILE G 1 98  ? 35.982  133.976 58.320  1.00 6.53  ? 98  ILE G CG1 1 
ATOM 11566 C CG2 . ILE G 1 98  ? 35.990  131.969 59.840  1.00 5.27  ? 98  ILE G CG2 1 
ATOM 11567 C CD1 . ILE G 1 98  ? 34.531  134.168 58.702  1.00 2.12  ? 98  ILE G CD1 1 
ATOM 11568 N N   . LEU G 1 99  ? 38.471  130.187 58.325  1.00 12.23 ? 99  LEU G N   1 
ATOM 11569 C CA  . LEU G 1 99  ? 38.990  128.923 58.806  1.00 14.25 ? 99  LEU G CA  1 
ATOM 11570 C C   . LEU G 1 99  ? 40.491  128.926 59.017  1.00 14.65 ? 99  LEU G C   1 
ATOM 11571 O O   . LEU G 1 99  ? 41.015  128.133 59.780  1.00 15.35 ? 99  LEU G O   1 
ATOM 11572 C CB  . LEU G 1 99  ? 38.554  127.754 57.948  1.00 10.81 ? 99  LEU G CB  1 
ATOM 11573 C CG  . LEU G 1 99  ? 37.929  126.690 58.859  1.00 13.26 ? 99  LEU G CG  1 
ATOM 11574 C CD1 . LEU G 1 99  ? 38.985  125.844 59.562  1.00 13.58 ? 99  LEU G CD1 1 
ATOM 11575 C CD2 . LEU G 1 99  ? 37.033  127.368 59.889  1.00 12.41 ? 99  LEU G CD2 1 
ATOM 11576 N N   . GLU G 1 100 ? 41.189  129.858 58.409  1.00 15.75 ? 100 GLU G N   1 
ATOM 11577 C CA  . GLU G 1 100 ? 42.619  129.934 58.617  1.00 21.35 ? 100 GLU G CA  1 
ATOM 11578 C C   . GLU G 1 100 ? 42.848  130.618 59.972  1.00 21.21 ? 100 GLU G C   1 
ATOM 11579 O O   . GLU G 1 100 ? 43.328  129.999 60.932  1.00 22.08 ? 100 GLU G O   1 
ATOM 11580 C CB  . GLU G 1 100 ? 43.278  130.723 57.488  1.00 21.53 ? 100 GLU G CB  1 
ATOM 11581 C CG  . GLU G 1 100 ? 44.785  130.661 57.504  1.00 26.05 ? 100 GLU G CG  1 
ATOM 11582 C CD  . GLU G 1 100 ? 45.409  131.137 56.216  1.00 24.53 ? 100 GLU G CD  1 
ATOM 11583 O OE1 . GLU G 1 100 ? 44.650  131.434 55.272  1.00 24.57 ? 100 GLU G OE1 1 
ATOM 11584 O OE2 . GLU G 1 100 ? 46.653  131.203 56.137  1.00 18.49 ? 100 GLU G OE2 1 
ATOM 11585 N N   . ASN G 1 101 ? 42.427  131.876 60.056  1.00 19.99 ? 101 ASN G N   1 
ATOM 11586 C CA  . ASN G 1 101 ? 42.572  132.686 61.263  1.00 16.94 ? 101 ASN G CA  1 
ATOM 11587 C C   . ASN G 1 101 ? 41.854  132.125 62.494  1.00 19.14 ? 101 ASN G C   1 
ATOM 11588 O O   . ASN G 1 101 ? 42.162  132.499 63.622  1.00 19.67 ? 101 ASN G O   1 
ATOM 11589 C CB  . ASN G 1 101 ? 42.073  134.111 61.000  1.00 15.20 ? 101 ASN G CB  1 
ATOM 11590 C CG  . ASN G 1 101 ? 43.108  134.985 60.306  1.00 19.36 ? 101 ASN G CG  1 
ATOM 11591 O OD1 . ASN G 1 101 ? 43.591  135.963 60.881  1.00 19.93 ? 101 ASN G OD1 1 
ATOM 11592 N ND2 . ASN G 1 101 ? 43.428  134.661 59.059  1.00 17.73 ? 101 ASN G ND2 1 
ATOM 11593 N N   . GLN G 1 102 ? 40.886  131.244 62.301  1.00 18.77 ? 102 GLN G N   1 
ATOM 11594 C CA  . GLN G 1 102 ? 40.136  130.668 63.394  1.00 14.32 ? 102 GLN G CA  1 
ATOM 11595 C C   . GLN G 1 102 ? 40.766  129.379 63.905  1.00 16.23 ? 102 GLN G C   1 
ATOM 11596 O O   . GLN G 1 102 ? 40.848  129.167 65.113  1.00 19.16 ? 102 GLN G O   1 
ATOM 11597 C CB  . GLN G 1 102 ? 38.689  130.406 62.981  1.00 12.66 ? 102 GLN G CB  1 
A