data_4H3E
# 
_entry.id   4H3E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4H3E         
RCSB  RCSB074968   
WWPDB D_1000074968 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         4F2N                 'FeSOD from L. major' unspecified 
TargetTrack SSGCID-TrcrA.00198.b .                     unspecified 
# 
_pdbx_database_status.entry_id                        4H3E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Iron superoxide dismutases in eukaryotic pathogens: new insights from Apicomplexa and Trypanosoma structures.' 
_citation.journal_abbrev            'Acta Crystallogr F Struct Biol Commun' 
_citation.journal_volume            71 
_citation.page_first                615 
_citation.page_last                 621 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25961325 
_citation.pdbx_database_id_DOI      10.1107/S2053230X15004185 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Phan, I.Q.'    1  
primary 'Davies, D.R.'  2  
primary 'Moretti, N.S.' 3  
primary 'Shanmugam, D.' 4  
primary 'Cestari, I.'   5  
primary 'Anupama, A.'   6  
primary 'Fairman, J.W.' 7  
primary 'Edwards, T.E.' 8  
primary 'Stuart, K.'    9  
primary 'Schenkman, S.' 10 
primary 'Myler, P.J.'   11 
# 
_cell.length_a           47.650 
_cell.length_b           75.680 
_cell.length_c           117.450 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4H3E 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4H3E 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase' 27239.119 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'FE (II) ION'          55.845    2   ?        ? ? ? 
3 water       nat water                  18.015    348 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        FeSOD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHHHHHHMLRRAVNISIARGRMALMSYATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLN
ALAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSFESAVTAQFGSVEQFKDAFVQAGVN
NFGSGWTWLCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAI
K
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHHHHHHMLRRAVNISIARGRMALMSYATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLN
ALAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSFESAVTAQFGSVEQFKDAFVQAGVN
NFGSGWTWLCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAI
K
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         SSGCID-TrcrA.00198.b 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   MET n 
1 10  LEU n 
1 11  ARG n 
1 12  ARG n 
1 13  ALA n 
1 14  VAL n 
1 15  ASN n 
1 16  ILE n 
1 17  SER n 
1 18  ILE n 
1 19  ALA n 
1 20  ARG n 
1 21  GLY n 
1 22  ARG n 
1 23  MET n 
1 24  ALA n 
1 25  LEU n 
1 26  MET n 
1 27  SER n 
1 28  TYR n 
1 29  ALA n 
1 30  THR n 
1 31  LEU n 
1 32  PRO n 
1 33  ASP n 
1 34  LEU n 
1 35  LEU n 
1 36  LYS n 
1 37  PRO n 
1 38  SER n 
1 39  GLY n 
1 40  ALA n 
1 41  PRO n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  PRO n 
1 46  LYS n 
1 47  LEU n 
1 48  GLY n 
1 49  PHE n 
1 50  ASN n 
1 51  TRP n 
1 52  LYS n 
1 53  ASP n 
1 54  GLY n 
1 55  CYS n 
1 56  ALA n 
1 57  PRO n 
1 58  VAL n 
1 59  PHE n 
1 60  SER n 
1 61  PRO n 
1 62  ARG n 
1 63  GLN n 
1 64  MET n 
1 65  GLU n 
1 66  LEU n 
1 67  HIS n 
1 68  TYR n 
1 69  THR n 
1 70  LYS n 
1 71  HIS n 
1 72  HIS n 
1 73  LYS n 
1 74  ALA n 
1 75  TYR n 
1 76  VAL n 
1 77  ASP n 
1 78  LYS n 
1 79  LEU n 
1 80  ASN n 
1 81  ALA n 
1 82  LEU n 
1 83  ALA n 
1 84  GLY n 
1 85  THR n 
1 86  THR n 
1 87  TYR n 
1 88  ASP n 
1 89  GLY n 
1 90  LYS n 
1 91  SER n 
1 92  ILE n 
1 93  GLU n 
1 94  GLU n 
1 95  ILE n 
1 96  ILE n 
1 97  LEU n 
1 98  ALA n 
1 99  VAL n 
1 100 ALA n 
1 101 ASN n 
1 102 ASP n 
1 103 ALA n 
1 104 GLU n 
1 105 LYS n 
1 106 LYS n 
1 107 GLY n 
1 108 LEU n 
1 109 PHE n 
1 110 ASN n 
1 111 GLN n 
1 112 ALA n 
1 113 ALA n 
1 114 GLN n 
1 115 HIS n 
1 116 PHE n 
1 117 ASN n 
1 118 HIS n 
1 119 THR n 
1 120 PHE n 
1 121 TYR n 
1 122 PHE n 
1 123 ARG n 
1 124 CYS n 
1 125 ILE n 
1 126 THR n 
1 127 PRO n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 ALA n 
1 132 MET n 
1 133 PRO n 
1 134 LYS n 
1 135 SER n 
1 136 PHE n 
1 137 GLU n 
1 138 SER n 
1 139 ALA n 
1 140 VAL n 
1 141 THR n 
1 142 ALA n 
1 143 GLN n 
1 144 PHE n 
1 145 GLY n 
1 146 SER n 
1 147 VAL n 
1 148 GLU n 
1 149 GLN n 
1 150 PHE n 
1 151 LYS n 
1 152 ASP n 
1 153 ALA n 
1 154 PHE n 
1 155 VAL n 
1 156 GLN n 
1 157 ALA n 
1 158 GLY n 
1 159 VAL n 
1 160 ASN n 
1 161 ASN n 
1 162 PHE n 
1 163 GLY n 
1 164 SER n 
1 165 GLY n 
1 166 TRP n 
1 167 THR n 
1 168 TRP n 
1 169 LEU n 
1 170 CYS n 
1 171 VAL n 
1 172 ASP n 
1 173 PRO n 
1 174 SER n 
1 175 ASN n 
1 176 LYS n 
1 177 ASN n 
1 178 GLN n 
1 179 LEU n 
1 180 VAL n 
1 181 ILE n 
1 182 ASP n 
1 183 ASN n 
1 184 THR n 
1 185 SER n 
1 186 ASN n 
1 187 ALA n 
1 188 GLY n 
1 189 CYS n 
1 190 PRO n 
1 191 LEU n 
1 192 THR n 
1 193 LYS n 
1 194 GLY n 
1 195 LEU n 
1 196 ARG n 
1 197 PRO n 
1 198 VAL n 
1 199 LEU n 
1 200 ALA n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 TRP n 
1 205 GLU n 
1 206 HIS n 
1 207 ALA n 
1 208 TYR n 
1 209 TYR n 
1 210 LYS n 
1 211 ASP n 
1 212 PHE n 
1 213 GLU n 
1 214 ASN n 
1 215 ARG n 
1 216 ARG n 
1 217 PRO n 
1 218 ASP n 
1 219 TYR n 
1 220 LEU n 
1 221 LYS n 
1 222 GLU n 
1 223 ILE n 
1 224 TRP n 
1 225 SER n 
1 226 VAL n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLU n 
1 231 PHE n 
1 232 VAL n 
1 233 ALA n 
1 234 LYS n 
1 235 MET n 
1 236 HIS n 
1 237 ALA n 
1 238 GLN n 
1 239 ALA n 
1 240 ILE n 
1 241 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Tc00.1047053509775.40 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'CL Brener' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Trypanosoma cruzi' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     353153 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAVA0421 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q4DCQ3_TRYCC 
_struct_ref.pdbx_db_accession          Q4DCQ3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLRRAVNISIARGRMALMSYATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLNALAGTTYD
GKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSLESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTW
LCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAIK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4H3E A 9 ? 241 ? Q4DCQ3 1 ? 233 ? 1 233 
2 1 4H3E B 9 ? 241 ? Q4DCQ3 1 ? 233 ? 1 233 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4H3E MET A 1   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -7  1  
1 4H3E ALA A 2   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -6  2  
1 4H3E HIS A 3   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -5  3  
1 4H3E HIS A 4   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -4  4  
1 4H3E HIS A 5   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -3  5  
1 4H3E HIS A 6   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -2  6  
1 4H3E HIS A 7   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -1  7  
1 4H3E HIS A 8   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' 0   8  
1 4H3E PHE A 136 ? UNP Q4DCQ3 LEU 128 'SEE REMARK 999' 128 9  
2 4H3E MET B 1   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -7  10 
2 4H3E ALA B 2   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -6  11 
2 4H3E HIS B 3   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -5  12 
2 4H3E HIS B 4   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -4  13 
2 4H3E HIS B 5   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -3  14 
2 4H3E HIS B 6   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -2  15 
2 4H3E HIS B 7   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' -1  16 
2 4H3E HIS B 8   ? UNP Q4DCQ3 ?   ?   'EXPRESSION TAG' 0   17 
2 4H3E PHE B 136 ? UNP Q4DCQ3 LEU 128 'SEE REMARK 999' 128 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE2 non-polymer         . 'FE (II) ION'   ? 'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4H3E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.94 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   36.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;TrcrA.00198.b.B1 PS01521 at 23.05 mg/mL against JCSG+ screen condition G1: 0.1 M HEPES, pH 7.0, 30% Jeffamine ED-2001, crystal tracking ID 235439g1, unique puck ID gvr7-6, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 944+' 
_diffrn_detector.pdbx_collection_date   2012-09-11 
_diffrn_detector.details                VariMax 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4H3E 
_reflns.d_resolution_high            2.250 
_reflns.number_obs                   20226 
_reflns.pdbx_Rmerge_I_obs            0.137 
_reflns.pdbx_netI_over_sigmaI        13.4 
_reflns.percent_possible_obs         97.0 
_reflns.B_iso_Wilson_estimate        19.810 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.number_all                   20854 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.250  2.310  9504  ? 1430 0.370 5.990  ? ? ? ? ? 94.4 1  1 
2.310  2.370  10470 ? 1410 0.302 7.520  ? ? ? ? ? 94.8 2  1 
2.370  2.440  10342 ? 1386 0.290 7.630  ? ? ? ? ? 96.6 3  1 
2.440  2.520  9852  ? 1315 0.269 8.180  ? ? ? ? ? 94.8 4  1 
2.520  2.600  9819  ? 1321 0.267 8.190  ? ? ? ? ? 97.1 5  1 
2.600  2.690  9355  ? 1259 0.240 8.890  ? ? ? ? ? 96.5 6  1 
2.690  2.790  9204  ? 1233 0.208 10.000 ? ? ? ? ? 95.7 7  1 
2.790  2.900  8645  ? 1196 0.197 10.980 ? ? ? ? ? 99.0 8  1 
2.900  3.030  8478  ? 1132 0.162 11.670 ? ? ? ? ? 96.0 9  1 
3.030  3.180  8066  ? 1096 0.129 13.990 ? ? ? ? ? 96.6 10 1 
3.180  3.350  7679  ? 1048 0.107 16.460 ? ? ? ? ? 99.3 11 1 
3.350  3.560  7387  ? 1002 0.095 18.540 ? ? ? ? ? 97.9 12 1 
3.560  3.800  6894  ? 949  0.083 21.620 ? ? ? ? ? 97.9 13 1 
3.800  4.110  6377  ? 883  0.078 22.750 ? ? ? ? ? 98.3 14 1 
4.110  4.500  5928  ? 830  0.072 24.780 ? ? ? ? ? 98.8 15 1 
4.500  5.030  5296  ? 748  0.080 22.730 ? ? ? ? ? 99.1 16 1 
5.030  5.810  4792  ? 680  0.108 17.380 ? ? ? ? ? 99.1 17 1 
5.810  7.120  3993  ? 574  0.112 15.670 ? ? ? ? ? 99.0 18 1 
7.120  10.060 3084  ? 462  0.069 23.750 ? ? ? ? ? 99.1 19 1 
10.060 ?      1587  ? 272  0.043 32.360 ? ? ? ? ? 96.5 20 1 
# 
_refine.entry_id                                 4H3E 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             44.19 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.98 
_refine.ls_number_reflns_obs                     19189 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;U VALUES      : WITH TLS ADDED 
HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1730 
_refine.ls_R_factor_R_work                       0.1709 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2122 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1038 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               13.3107 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.5400 
_refine.aniso_B[2][2]                            0.1900 
_refine.aniso_B[3][3]                            0.3500 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9360 
_refine.correlation_coeff_Fo_to_Fc_free          0.9110 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.3640 
_refine.pdbx_overall_ESU_R_Free                  0.2160 
_refine.overall_SU_ML                            0.1320 
_refine.overall_SU_B                             9.6980 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4F2N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                44.540 
_refine.B_iso_min                                2.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3350 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             348 
_refine_hist.number_atoms_total               3700 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        44.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3456 0.012  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         3150 0.005  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    4712 1.407  1.927  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      7242 1.008  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 428  6.073  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 161  38.245 24.534 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 517  12.935 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 10   11.965 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         499  0.084  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   3993 0.007  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     841  0.004  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'INTERATOMIC DISTANCE' A 12529 0.070 0.050 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 'INTERATOMIC DISTANCE' B 12529 0.070 0.050 ? ? ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.250 
_refine_ls_shell.d_res_low                        2.308 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.38 
_refine_ls_shell.number_reflns_R_work             1368 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.170 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1427 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 0 0 A 20 A 233 ? . . . . . . . . 
1 2 0 0 B 20 B 233 ? . . . . . . . . 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4H3E 
_struct.title                     'Crystal structure of a putative iron superoxide dismutase from Trypanosoma cruzi bound to iron' 
_struct.pdbx_descriptor           'Superoxide dismutase (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4H3E 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, radical oxygen species, trypanosomiasis, parasitic euglenoid trypanosome, Chagas Disease, radical scavenger, hydrogen peroxide, antioxidant, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 50  ? GLY A 54  ? ASN A 42  GLY A 46  5 ? 5  
HELX_P HELX_P2  2  SER A 60  ? LYS A 70  ? SER A 52  LYS A 62  1 ? 11 
HELX_P HELX_P3  3  LYS A 70  ? GLY A 84  ? LYS A 62  GLY A 76  1 ? 15 
HELX_P HELX_P4  4  SER A 91  ? ALA A 100 ? SER A 83  ALA A 92  1 ? 10 
HELX_P HELX_P5  5  ASP A 102 ? GLU A 104 ? ASP A 94  GLU A 96  5 ? 3  
HELX_P HELX_P6  6  LYS A 105 ? CYS A 124 ? LYS A 97  CYS A 116 1 ? 20 
HELX_P HELX_P7  7  PRO A 133 ? GLY A 145 ? PRO A 125 GLY A 137 1 ? 13 
HELX_P HELX_P8  8  SER A 146 ? ASN A 160 ? SER A 138 ASN A 152 1 ? 15 
HELX_P HELX_P9  9  PRO A 173 ? LYS A 176 ? PRO A 165 LYS A 168 5 ? 4  
HELX_P HELX_P10 10 CYS A 189 ? GLY A 194 ? CYS A 181 GLY A 186 5 ? 6  
HELX_P HELX_P11 11 TRP A 204 ? ALA A 207 ? TRP A 196 ALA A 199 5 ? 4  
HELX_P HELX_P12 12 TYR A 208 ? GLU A 213 ? TYR A 200 GLU A 205 1 ? 6  
HELX_P HELX_P13 13 ARG A 215 ? ILE A 223 ? ARG A 207 ILE A 215 1 ? 9  
HELX_P HELX_P14 14 TRP A 224 ? ILE A 227 ? TRP A 216 ILE A 219 5 ? 4  
HELX_P HELX_P15 15 ASP A 228 ? LYS A 241 ? ASP A 220 LYS A 233 1 ? 14 
HELX_P HELX_P16 16 ASN B 50  ? GLY B 54  ? ASN B 42  GLY B 46  5 ? 5  
HELX_P HELX_P17 17 SER B 60  ? LYS B 70  ? SER B 52  LYS B 62  1 ? 11 
HELX_P HELX_P18 18 LYS B 70  ? GLY B 84  ? LYS B 62  GLY B 76  1 ? 15 
HELX_P HELX_P19 19 SER B 91  ? ALA B 100 ? SER B 83  ALA B 92  1 ? 10 
HELX_P HELX_P20 20 ASP B 102 ? GLU B 104 ? ASP B 94  GLU B 96  5 ? 3  
HELX_P HELX_P21 21 LYS B 105 ? CYS B 124 ? LYS B 97  CYS B 116 1 ? 20 
HELX_P HELX_P22 22 PRO B 133 ? GLY B 145 ? PRO B 125 GLY B 137 1 ? 13 
HELX_P HELX_P23 23 SER B 146 ? ASN B 160 ? SER B 138 ASN B 152 1 ? 15 
HELX_P HELX_P24 24 PRO B 173 ? LYS B 176 ? PRO B 165 LYS B 168 5 ? 4  
HELX_P HELX_P25 25 CYS B 189 ? GLY B 194 ? CYS B 181 GLY B 186 5 ? 6  
HELX_P HELX_P26 26 TRP B 204 ? ALA B 207 ? TRP B 196 ALA B 199 5 ? 4  
HELX_P HELX_P27 27 TYR B 208 ? GLU B 213 ? TYR B 200 GLU B 205 1 ? 6  
HELX_P HELX_P28 28 ARG B 215 ? ILE B 223 ? ARG B 207 ILE B 215 1 ? 9  
HELX_P HELX_P29 29 TRP B 224 ? ILE B 227 ? TRP B 216 ILE B 219 5 ? 4  
HELX_P HELX_P30 30 ASP B 228 ? LYS B 241 ? ASP B 220 LYS B 233 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 202 OD2 ? ? ? 1_555 D FE2 . FE ? ? B ASP 194 B FE2 301 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc2  metalc ? ? A ASP 202 OD2 ? ? ? 1_555 C FE2 . FE ? ? A ASP 194 A FE2 301 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc3  metalc ? ? B HIS 118 NE2 ? ? ? 1_555 D FE2 . FE ? ? B HIS 110 B FE2 301 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc4  metalc ? ? B HIS 206 NE2 ? ? ? 1_555 D FE2 . FE ? ? B HIS 198 B FE2 301 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc5  metalc ? ? A HIS 206 NE2 ? ? ? 1_555 C FE2 . FE ? ? A HIS 198 A FE2 301 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc6  metalc ? ? A HIS 118 NE2 ? ? ? 1_555 C FE2 . FE ? ? A HIS 110 A FE2 301 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc7  metalc ? ? A HIS 67  NE2 ? ? ? 1_555 C FE2 . FE ? ? A HIS 59  A FE2 301 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc8  metalc ? ? D FE2 .   FE  ? ? ? 1_555 F HOH . O  ? ? B FE2 301 B HOH 402 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc9  metalc ? ? C FE2 .   FE  ? ? ? 1_555 E HOH . O  ? ? A FE2 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc10 metalc ? ? B HIS 67  NE2 ? ? ? 1_555 D FE2 . FE ? ? B HIS 59  B FE2 301 1_555 ? ? ? ? ? ? ? 2.328 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 56 A . ? ALA 48 A PRO 57 A ? PRO 49 A 1 4.54 
2 ALA 56 B . ? ALA 48 B PRO 57 B ? PRO 49 B 1 2.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 179 ? SER A 185 ? LEU A 171 SER A 177 
A 2 GLY A 165 ? VAL A 171 ? GLY A 157 VAL A 163 
A 3 ARG A 196 ? ASP A 202 ? ARG A 188 ASP A 194 
B 1 LEU B 179 ? SER B 185 ? LEU B 171 SER B 177 
B 2 GLY B 165 ? VAL B 171 ? GLY B 157 VAL B 163 
B 3 ARG B 196 ? ASP B 202 ? ARG B 188 ASP B 194 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 180 ? O VAL A 172 N CYS A 170 ? N CYS A 162 
A 2 3 N LEU A 169 ? N LEU A 161 O VAL A 198 ? O VAL A 190 
B 1 2 O VAL B 180 ? O VAL B 172 N CYS B 170 ? N CYS B 162 
B 2 3 N LEU B 169 ? N LEU B 161 O VAL B 198 ? O VAL B 190 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE2 A 301' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE2 B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 67  ? HIS A 59  . ? 1_555 ? 
2  AC1 5 HIS A 118 ? HIS A 110 . ? 1_555 ? 
3  AC1 5 ASP A 202 ? ASP A 194 . ? 1_555 ? 
4  AC1 5 HIS A 206 ? HIS A 198 . ? 1_555 ? 
5  AC1 5 HOH E .   ? HOH A 402 . ? 1_555 ? 
6  AC2 5 HIS B 67  ? HIS B 59  . ? 1_555 ? 
7  AC2 5 HIS B 118 ? HIS B 110 . ? 1_555 ? 
8  AC2 5 ASP B 202 ? ASP B 194 . ? 1_555 ? 
9  AC2 5 HIS B 206 ? HIS B 198 . ? 1_555 ? 
10 AC2 5 HOH F .   ? HOH B 402 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4H3E 
_atom_sites.fract_transf_matrix[1][1]   0.020986 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013214 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008514 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 28  ? 8.392   -16.146 1.534  1.00 28.65 ? 20  TYR A N   1 
ATOM   2    C  CA  . TYR A 1 28  ? 7.838   -14.957 0.774  1.00 26.59 ? 20  TYR A CA  1 
ATOM   3    C  C   . TYR A 1 28  ? 8.893   -13.861 0.807  1.00 23.88 ? 20  TYR A C   1 
ATOM   4    O  O   . TYR A 1 28  ? 9.582   -13.707 1.806  1.00 25.82 ? 20  TYR A O   1 
ATOM   5    C  CB  . TYR A 1 28  ? 6.521   -14.487 1.426  1.00 26.38 ? 20  TYR A CB  1 
ATOM   6    C  CG  . TYR A 1 28  ? 5.941   -13.153 0.978  1.00 26.97 ? 20  TYR A CG  1 
ATOM   7    C  CD1 . TYR A 1 28  ? 5.124   -13.061 -0.154 1.00 28.41 ? 20  TYR A CD1 1 
ATOM   8    C  CD2 . TYR A 1 28  ? 6.148   -11.997 1.738  1.00 27.95 ? 20  TYR A CD2 1 
ATOM   9    C  CE1 . TYR A 1 28  ? 4.570   -11.837 -0.556 1.00 28.81 ? 20  TYR A CE1 1 
ATOM   10   C  CE2 . TYR A 1 28  ? 5.604   -10.784 1.357  1.00 29.05 ? 20  TYR A CE2 1 
ATOM   11   C  CZ  . TYR A 1 28  ? 4.811   -10.702 0.213  1.00 30.88 ? 20  TYR A CZ  1 
ATOM   12   O  OH  . TYR A 1 28  ? 4.273   -9.466  -0.133 1.00 36.63 ? 20  TYR A OH  1 
ATOM   13   N  N   . ALA A 1 29  ? 9.036   -13.097 -0.260 1.00 21.02 ? 21  ALA A N   1 
ATOM   14   C  CA  . ALA A 1 29  ? 9.876   -11.901 -0.188 1.00 18.97 ? 21  ALA A CA  1 
ATOM   15   C  C   . ALA A 1 29  ? 9.031   -10.650 -0.431 1.00 16.71 ? 21  ALA A C   1 
ATOM   16   O  O   . ALA A 1 29  ? 8.272   -10.599 -1.375 1.00 16.46 ? 21  ALA A O   1 
ATOM   17   C  CB  . ALA A 1 29  ? 10.989  -12.015 -1.203 1.00 19.19 ? 21  ALA A CB  1 
ATOM   18   N  N   . THR A 1 30  ? 9.159   -9.655  0.440  1.00 14.84 ? 22  THR A N   1 
ATOM   19   C  CA  . THR A 1 30  ? 8.478   -8.391  0.230  1.00 13.52 ? 22  THR A CA  1 
ATOM   20   C  C   . THR A 1 30  ? 9.078   -7.655  -0.960 1.00 13.00 ? 22  THR A C   1 
ATOM   21   O  O   . THR A 1 30  ? 8.340   -7.164  -1.813 1.00 12.95 ? 22  THR A O   1 
ATOM   22   C  CB  . THR A 1 30  ? 8.491   -7.497  1.480  1.00 13.03 ? 22  THR A CB  1 
ATOM   23   O  OG1 . THR A 1 30  ? 7.774   -8.140  2.545  1.00 12.63 ? 22  THR A OG1 1 
ATOM   24   C  CG2 . THR A 1 30  ? 7.834   -6.191  1.194  1.00 12.80 ? 22  THR A CG2 1 
ATOM   25   N  N   . LEU A 1 31  ? 10.407  -7.627  -1.047 1.00 12.68 ? 23  LEU A N   1 
ATOM   26   C  CA  . LEU A 1 31  ? 11.113  -6.880  -2.073 1.00 12.49 ? 23  LEU A CA  1 
ATOM   27   C  C   . LEU A 1 31  ? 12.083  -7.804  -2.819 1.00 12.30 ? 23  LEU A C   1 
ATOM   28   O  O   . LEU A 1 31  ? 13.298  -7.759  -2.589 1.00 11.57 ? 23  LEU A O   1 
ATOM   29   C  CB  . LEU A 1 31  ? 11.868  -5.705  -1.432 1.00 12.73 ? 23  LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 31  ? 11.035  -4.537  -0.883 1.00 12.80 ? 23  LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 31  ? 11.941  -3.459  -0.351 1.00 12.64 ? 23  LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 31  ? 10.114  -3.965  -1.956 1.00 13.25 ? 23  LEU A CD2 1 
ATOM   33   N  N   . PRO A 1 32  ? 11.539  -8.667  -3.701 1.00 12.23 ? 24  PRO A N   1 
ATOM   34   C  CA  . PRO A 1 32  ? 12.405  -9.654  -4.363 1.00 12.59 ? 24  PRO A CA  1 
ATOM   35   C  C   . PRO A 1 32  ? 13.521  -9.064  -5.243 1.00 12.83 ? 24  PRO A C   1 
ATOM   36   O  O   . PRO A 1 32  ? 14.477  -9.772  -5.586 1.00 12.74 ? 24  PRO A O   1 
ATOM   37   C  CB  . PRO A 1 32  ? 11.427  -10.489 -5.201 1.00 12.76 ? 24  PRO A CB  1 
ATOM   38   C  CG  . PRO A 1 32  ? 10.199  -9.641  -5.349 1.00 12.66 ? 24  PRO A CG  1 
ATOM   39   C  CD  . PRO A 1 32  ? 10.128  -8.802  -4.098 1.00 12.20 ? 24  PRO A CD  1 
ATOM   40   N  N   . ASP A 1 33  ? 13.394  -7.797  -5.615 1.00 12.88 ? 25  ASP A N   1 
ATOM   41   C  CA  . ASP A 1 33  ? 14.406  -7.162  -6.461 1.00 13.54 ? 25  ASP A CA  1 
ATOM   42   C  C   . ASP A 1 33  ? 15.435  -6.420  -5.663 1.00 13.52 ? 25  ASP A C   1 
ATOM   43   O  O   . ASP A 1 33  ? 16.247  -5.712  -6.242 1.00 14.23 ? 25  ASP A O   1 
ATOM   44   C  CB  . ASP A 1 33  ? 13.736  -6.190  -7.446 1.00 13.93 ? 25  ASP A CB  1 
ATOM   45   C  CG  . ASP A 1 33  ? 12.985  -5.050  -6.741 1.00 14.00 ? 25  ASP A CG  1 
ATOM   46   O  OD1 . ASP A 1 33  ? 12.673  -5.130  -5.540 1.00 14.05 ? 25  ASP A OD1 1 
ATOM   47   O  OD2 . ASP A 1 33  ? 12.667  -4.064  -7.403 1.00 15.18 ? 25  ASP A OD2 1 
ATOM   48   N  N   . LEU A 1 34  ? 15.389  -6.545  -4.342 1.00 13.58 ? 26  LEU A N   1 
ATOM   49   C  CA  . LEU A 1 34  ? 16.411  -5.949  -3.473 1.00 13.57 ? 26  LEU A CA  1 
ATOM   50   C  C   . LEU A 1 34  ? 17.391  -7.023  -3.041 1.00 14.30 ? 26  LEU A C   1 
ATOM   51   O  O   . LEU A 1 34  ? 17.079  -7.833  -2.163 1.00 14.13 ? 26  LEU A O   1 
ATOM   52   C  CB  . LEU A 1 34  ? 15.769  -5.291  -2.255 1.00 12.94 ? 26  LEU A CB  1 
ATOM   53   C  CG  . LEU A 1 34  ? 16.732  -4.403  -1.477 1.00 13.11 ? 26  LEU A CG  1 
ATOM   54   C  CD1 . LEU A 1 34  ? 17.020  -3.123  -2.279 1.00 13.35 ? 26  LEU A CD1 1 
ATOM   55   C  CD2 . LEU A 1 34  ? 16.182  -4.058  -0.096 1.00 12.76 ? 26  LEU A CD2 1 
ATOM   56   N  N   . LEU A 1 35  ? 18.561  -7.011  -3.681 1.00 15.36 ? 27  LEU A N   1 
ATOM   57   C  CA  . LEU A 1 35  ? 19.541  -8.086  -3.627 1.00 17.00 ? 27  LEU A CA  1 
ATOM   58   C  C   . LEU A 1 35  ? 20.930  -7.612  -3.259 1.00 16.49 ? 27  LEU A C   1 
ATOM   59   O  O   . LEU A 1 35  ? 21.263  -6.440  -3.450 1.00 17.41 ? 27  LEU A O   1 
ATOM   60   C  CB  . LEU A 1 35  ? 19.688  -8.722  -5.041 1.00 18.67 ? 27  LEU A CB  1 
ATOM   61   C  CG  . LEU A 1 35  ? 18.449  -9.063  -5.855 1.00 19.54 ? 27  LEU A CG  1 
ATOM   62   C  CD1 . LEU A 1 35  ? 18.836  -9.503  -7.267 1.00 20.68 ? 27  LEU A CD1 1 
ATOM   63   C  CD2 . LEU A 1 35  ? 17.715  -10.187 -5.164 1.00 19.98 ? 27  LEU A CD2 1 
ATOM   64   N  N   . LYS A 1 36  ? 21.761  -8.562  -2.843 1.00 16.25 ? 28  LYS A N   1 
ATOM   65   C  CA  . LYS A 1 36  ? 23.204  -8.419  -2.881 1.00 16.18 ? 28  LYS A CA  1 
ATOM   66   C  C   . LYS A 1 36  ? 23.737  -9.032  -4.184 1.00 16.82 ? 28  LYS A C   1 
ATOM   67   O  O   . LYS A 1 36  ? 23.735  -10.259 -4.346 1.00 15.71 ? 28  LYS A O   1 
ATOM   68   C  CB  . LYS A 1 36  ? 23.862  -9.118  -1.695 1.00 16.36 ? 28  LYS A CB  1 
ATOM   69   C  CG  . LYS A 1 36  ? 25.403  -9.131  -1.724 1.00 16.32 ? 28  LYS A CG  1 
ATOM   70   C  CD  . LYS A 1 36  ? 26.007  -7.728  -1.681 1.00 16.63 ? 28  LYS A CD  1 
ATOM   71   C  CE  . LYS A 1 36  ? 27.536  -7.750  -1.674 1.00 16.88 ? 28  LYS A CE  1 
ATOM   72   N  NZ  . LYS A 1 36  ? 28.099  -8.247  -2.975 1.00 17.40 ? 28  LYS A NZ  1 
ATOM   73   N  N   . PRO A 1 37  ? 24.220  -8.182  -5.110 1.00 17.67 ? 29  PRO A N   1 
ATOM   74   C  CA  . PRO A 1 37  ? 24.675  -8.749  -6.368 1.00 18.95 ? 29  PRO A CA  1 
ATOM   75   C  C   . PRO A 1 37  ? 25.900  -9.656  -6.199 1.00 19.81 ? 29  PRO A C   1 
ATOM   76   O  O   . PRO A 1 37  ? 26.650  -9.509  -5.230 1.00 20.84 ? 29  PRO A O   1 
ATOM   77   C  CB  . PRO A 1 37  ? 25.011  -7.520  -7.214 1.00 19.25 ? 29  PRO A CB  1 
ATOM   78   C  CG  . PRO A 1 37  ? 24.290  -6.385  -6.572 1.00 18.78 ? 29  PRO A CG  1 
ATOM   79   C  CD  . PRO A 1 37  ? 24.297  -6.713  -5.107 1.00 18.04 ? 29  PRO A CD  1 
ATOM   80   N  N   . SER A 1 38  ? 26.065  -10.593 -7.138 1.00 20.21 ? 30  SER A N   1 
ATOM   81   C  CA  . SER A 1 38  ? 27.280  -11.417 -7.227 1.00 20.56 ? 30  SER A CA  1 
ATOM   82   C  C   . SER A 1 38  ? 28.428  -10.597 -7.728 1.00 20.41 ? 30  SER A C   1 
ATOM   83   O  O   . SER A 1 38  ? 28.330  -10.033 -8.787 1.00 20.18 ? 30  SER A O   1 
ATOM   84   C  CB  . SER A 1 38  ? 27.094  -12.561 -8.221 1.00 20.85 ? 30  SER A CB  1 
ATOM   85   O  OG  . SER A 1 38  ? 26.197  -13.480 -7.692 1.00 21.70 ? 30  SER A OG  1 
ATOM   86   N  N   . GLY A 1 39  ? 29.516  -10.531 -6.986 1.00 20.98 ? 31  GLY A N   1 
ATOM   87   C  CA  . GLY A 1 39  ? 30.709  -9.869  -7.488 1.00 21.90 ? 31  GLY A CA  1 
ATOM   88   C  C   . GLY A 1 39  ? 30.659  -8.356  -7.532 1.00 22.49 ? 31  GLY A C   1 
ATOM   89   O  O   . GLY A 1 39  ? 31.598  -7.722  -7.985 1.00 24.96 ? 31  GLY A O   1 
ATOM   90   N  N   . ALA A 1 40  ? 29.583  -7.744  -7.057 1.00 22.13 ? 32  ALA A N   1 
ATOM   91   C  CA  . ALA A 1 40  ? 29.514  -6.287  -7.023 1.00 20.67 ? 32  ALA A CA  1 
ATOM   92   C  C   . ALA A 1 40  ? 28.726  -5.818  -5.789 1.00 20.02 ? 32  ALA A C   1 
ATOM   93   O  O   . ALA A 1 40  ? 27.912  -6.561  -5.255 1.00 18.80 ? 32  ALA A O   1 
ATOM   94   C  CB  . ALA A 1 40  ? 28.861  -5.779  -8.290 1.00 20.15 ? 32  ALA A CB  1 
ATOM   95   N  N   . PRO A 1 41  ? 28.975  -4.581  -5.352 1.00 20.32 ? 33  PRO A N   1 
ATOM   96   C  CA  . PRO A 1 41  ? 28.319  -4.080  -4.161 1.00 20.74 ? 33  PRO A CA  1 
ATOM   97   C  C   . PRO A 1 41  ? 26.829  -3.897  -4.351 1.00 20.62 ? 33  PRO A C   1 
ATOM   98   O  O   . PRO A 1 41  ? 26.385  -3.587  -5.463 1.00 22.32 ? 33  PRO A O   1 
ATOM   99   C  CB  . PRO A 1 41  ? 28.996  -2.727  -3.924 1.00 20.71 ? 33  PRO A CB  1 
ATOM   100  C  CG  . PRO A 1 41  ? 29.585  -2.345  -5.248 1.00 21.18 ? 33  PRO A CG  1 
ATOM   101  C  CD  . PRO A 1 41  ? 29.974  -3.631  -5.883 1.00 20.69 ? 33  PRO A CD  1 
ATOM   102  N  N   . ALA A 1 42  ? 26.062  -4.098  -3.283 1.00 19.99 ? 34  ALA A N   1 
ATOM   103  C  CA  . ALA A 1 42  ? 24.656  -3.690  -3.280 1.00 20.23 ? 34  ALA A CA  1 
ATOM   104  C  C   . ALA A 1 42  ? 24.617  -2.172  -3.434 1.00 21.16 ? 34  ALA A C   1 
ATOM   105  O  O   . ALA A 1 42  ? 25.435  -1.493  -2.828 1.00 19.57 ? 34  ALA A O   1 
ATOM   106  C  CB  . ALA A 1 42  ? 23.979  -4.110  -1.994 1.00 20.05 ? 34  ALA A CB  1 
ATOM   107  N  N   . GLU A 1 43  ? 23.739  -1.661  -4.307 1.00 23.03 ? 35  GLU A N   1 
ATOM   108  C  CA  . GLU A 1 43  ? 23.631  -0.216  -4.549 1.00 24.79 ? 35  GLU A CA  1 
ATOM   109  C  C   . GLU A 1 43  ? 22.584  0.389   -3.640 1.00 22.79 ? 35  GLU A C   1 
ATOM   110  O  O   . GLU A 1 43  ? 21.664  -0.275  -3.198 1.00 22.00 ? 35  GLU A O   1 
ATOM   111  C  CB  . GLU A 1 43  ? 23.237  0.146   -6.008 1.00 27.67 ? 35  GLU A CB  1 
ATOM   112  C  CG  . GLU A 1 43  ? 24.164  -0.347  -7.124 1.00 30.85 ? 35  GLU A CG  1 
ATOM   113  C  CD  . GLU A 1 43  ? 25.426  0.485   -7.324 1.00 33.94 ? 35  GLU A CD  1 
ATOM   114  O  OE1 . GLU A 1 43  ? 25.841  1.249   -6.416 1.00 37.00 ? 35  GLU A OE1 1 
ATOM   115  O  OE2 . GLU A 1 43  ? 26.036  0.351   -8.408 1.00 35.20 ? 35  GLU A OE2 1 
ATOM   116  N  N   . LEU A 1 44  ? 22.725  1.681   -3.407 1.00 22.21 ? 36  LEU A N   1 
ATOM   117  C  CA  . LEU A 1 44  ? 21.713  2.451   -2.715 1.00 21.81 ? 36  LEU A CA  1 
ATOM   118  C  C   . LEU A 1 44  ? 20.532  2.609   -3.685 1.00 21.78 ? 36  LEU A C   1 
ATOM   119  O  O   . LEU A 1 44  ? 20.678  3.242   -4.724 1.00 23.20 ? 36  LEU A O   1 
ATOM   120  C  CB  . LEU A 1 44  ? 22.306  3.803   -2.355 1.00 22.65 ? 36  LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 44  ? 21.420  4.761   -1.567 1.00 22.50 ? 36  LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 44  ? 21.016  4.197   -0.214 1.00 22.99 ? 36  LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 44  ? 22.134  6.094   -1.408 1.00 22.18 ? 36  LEU A CD2 1 
ATOM   124  N  N   . PRO A 1 45  ? 19.371  2.026   -3.385 1.00 20.23 ? 37  PRO A N   1 
ATOM   125  C  CA  . PRO A 1 45  ? 18.237  2.105   -4.314 1.00 19.85 ? 37  PRO A CA  1 
ATOM   126  C  C   . PRO A 1 45  ? 17.812  3.522   -4.665 1.00 18.85 ? 37  PRO A C   1 
ATOM   127  O  O   . PRO A 1 45  ? 17.856  4.389   -3.798 1.00 17.10 ? 37  PRO A O   1 
ATOM   128  C  CB  . PRO A 1 45  ? 17.096  1.443   -3.561 1.00 19.99 ? 37  PRO A CB  1 
ATOM   129  C  CG  . PRO A 1 45  ? 17.751  0.688   -2.461 1.00 20.94 ? 37  PRO A CG  1 
ATOM   130  C  CD  . PRO A 1 45  ? 18.974  1.465   -2.094 1.00 20.75 ? 37  PRO A CD  1 
ATOM   131  N  N   . LYS A 1 46  ? 17.461  3.723   -5.934 1.00 18.53 ? 38  LYS A N   1 
ATOM   132  C  CA  . LYS A 1 46  ? 17.002  5.007   -6.454 1.00 19.72 ? 38  LYS A CA  1 
ATOM   133  C  C   . LYS A 1 46  ? 15.581  5.305   -5.962 1.00 19.23 ? 38  LYS A C   1 
ATOM   134  O  O   . LYS A 1 46  ? 14.727  4.453   -6.007 1.00 17.96 ? 38  LYS A O   1 
ATOM   135  C  CB  . LYS A 1 46  ? 17.049  5.009   -7.999 1.00 19.81 ? 38  LYS A CB  1 
ATOM   136  N  N   . LEU A 1 47  ? 15.371  6.522   -5.463 1.00 19.65 ? 39  LEU A N   1 
ATOM   137  C  CA  . LEU A 1 47  ? 14.069  6.952   -4.939 1.00 19.07 ? 39  LEU A CA  1 
ATOM   138  C  C   . LEU A 1 47  ? 13.076  7.167   -6.062 1.00 18.83 ? 39  LEU A C   1 
ATOM   139  O  O   . LEU A 1 47  ? 13.471  7.437   -7.183 1.00 18.33 ? 39  LEU A O   1 
ATOM   140  C  CB  . LEU A 1 47  ? 14.243  8.257   -4.179 1.00 19.43 ? 39  LEU A CB  1 
ATOM   141  C  CG  . LEU A 1 47  ? 15.146  8.223   -2.953 1.00 20.11 ? 39  LEU A CG  1 
ATOM   142  C  CD1 . LEU A 1 47  ? 15.194  9.584   -2.284 1.00 20.72 ? 39  LEU A CD1 1 
ATOM   143  C  CD2 . LEU A 1 47  ? 14.666  7.174   -1.951 1.00 20.29 ? 39  LEU A CD2 1 
ATOM   144  N  N   . GLY A 1 48  ? 11.786  7.053   -5.753 1.00 18.53 ? 40  GLY A N   1 
ATOM   145  C  CA  . GLY A 1 48  ? 10.733  7.360   -6.713 1.00 18.96 ? 40  GLY A CA  1 
ATOM   146  C  C   . GLY A 1 48  ? 10.575  8.854   -6.940 1.00 19.29 ? 40  GLY A C   1 
ATOM   147  O  O   . GLY A 1 48  ? 9.869   9.292   -7.848 1.00 22.20 ? 40  GLY A O   1 
ATOM   148  N  N   . PHE A 1 49  ? 11.263  9.652   -6.154 1.00 17.46 ? 41  PHE A N   1 
ATOM   149  C  CA  . PHE A 1 49  ? 11.184  11.088  -6.290 1.00 16.57 ? 41  PHE A CA  1 
ATOM   150  C  C   . PHE A 1 49  ? 12.592  11.644  -6.118 1.00 16.10 ? 41  PHE A C   1 
ATOM   151  O  O   . PHE A 1 49  ? 13.482  10.948  -5.704 1.00 15.50 ? 41  PHE A O   1 
ATOM   152  C  CB  . PHE A 1 49  ? 10.246  11.620  -5.228 1.00 15.91 ? 41  PHE A CB  1 
ATOM   153  C  CG  . PHE A 1 49  ? 10.659  11.268  -3.845 1.00 15.38 ? 41  PHE A CG  1 
ATOM   154  C  CD1 . PHE A 1 49  ? 11.414  12.150  -3.096 1.00 15.00 ? 41  PHE A CD1 1 
ATOM   155  C  CD2 . PHE A 1 49  ? 10.267  10.044  -3.275 1.00 15.46 ? 41  PHE A CD2 1 
ATOM   156  C  CE1 . PHE A 1 49  ? 11.795  11.830  -1.806 1.00 15.29 ? 41  PHE A CE1 1 
ATOM   157  C  CE2 . PHE A 1 49  ? 10.655  9.709   -1.984 1.00 15.52 ? 41  PHE A CE2 1 
ATOM   158  C  CZ  . PHE A 1 49  ? 11.422  10.607  -1.243 1.00 15.34 ? 41  PHE A CZ  1 
ATOM   159  N  N   . ASN A 1 50  ? 12.771  12.900  -6.438 1.00 16.05 ? 42  ASN A N   1 
ATOM   160  C  CA  . ASN A 1 50  ? 14.052  13.556  -6.333 1.00 16.81 ? 42  ASN A CA  1 
ATOM   161  C  C   . ASN A 1 50  ? 14.225  14.184  -4.933 1.00 16.54 ? 42  ASN A C   1 
ATOM   162  O  O   . ASN A 1 50  ? 13.515  15.113  -4.571 1.00 17.14 ? 42  ASN A O   1 
ATOM   163  C  CB  . ASN A 1 50  ? 14.106  14.653  -7.396 1.00 17.59 ? 42  ASN A CB  1 
ATOM   164  C  CG  . ASN A 1 50  ? 15.417  15.401  -7.397 1.00 18.13 ? 42  ASN A CG  1 
ATOM   165  O  OD1 . ASN A 1 50  ? 16.226  15.254  -6.491 1.00 17.92 ? 42  ASN A OD1 1 
ATOM   166  N  ND2 . ASN A 1 50  ? 15.638  16.197  -8.432 1.00 18.84 ? 42  ASN A ND2 1 
ATOM   167  N  N   . TRP A 1 51  ? 15.179  13.700  -4.169 1.00 16.57 ? 43  TRP A N   1 
ATOM   168  C  CA  . TRP A 1 51  ? 15.372  14.171  -2.785 1.00 16.98 ? 43  TRP A CA  1 
ATOM   169  C  C   . TRP A 1 51  ? 15.800  15.638  -2.687 1.00 17.31 ? 43  TRP A C   1 
ATOM   170  O  O   . TRP A 1 51  ? 15.636  16.261  -1.636 1.00 16.95 ? 43  TRP A O   1 
ATOM   171  C  CB  . TRP A 1 51  ? 16.355  13.282  -2.008 1.00 17.15 ? 43  TRP A CB  1 
ATOM   172  C  CG  . TRP A 1 51  ? 17.717  13.193  -2.570 1.00 17.49 ? 43  TRP A CG  1 
ATOM   173  C  CD1 . TRP A 1 51  ? 18.200  12.187  -3.350 1.00 17.86 ? 43  TRP A CD1 1 
ATOM   174  C  CD2 . TRP A 1 51  ? 18.791  14.153  -2.430 1.00 18.21 ? 43  TRP A CD2 1 
ATOM   175  N  NE1 . TRP A 1 51  ? 19.510  12.463  -3.726 1.00 18.69 ? 43  TRP A NE1 1 
ATOM   176  C  CE2 . TRP A 1 51  ? 19.893  13.659  -3.177 1.00 18.56 ? 43  TRP A CE2 1 
ATOM   177  C  CE3 . TRP A 1 51  ? 18.912  15.397  -1.788 1.00 18.93 ? 43  TRP A CE3 1 
ATOM   178  C  CZ2 . TRP A 1 51  ? 21.106  14.338  -3.257 1.00 19.14 ? 43  TRP A CZ2 1 
ATOM   179  C  CZ3 . TRP A 1 51  ? 20.135  16.089  -1.874 1.00 19.14 ? 43  TRP A CZ3 1 
ATOM   180  C  CH2 . TRP A 1 51  ? 21.202  15.564  -2.605 1.00 19.66 ? 43  TRP A CH2 1 
ATOM   181  N  N   . LYS A 1 52  ? 16.293  16.199  -3.778 1.00 17.80 ? 44  LYS A N   1 
ATOM   182  C  CA  . LYS A 1 52  ? 16.685  17.608  -3.798 1.00 18.83 ? 44  LYS A CA  1 
ATOM   183  C  C   . LYS A 1 52  ? 15.482  18.497  -3.707 1.00 18.14 ? 44  LYS A C   1 
ATOM   184  O  O   . LYS A 1 52  ? 15.615  19.638  -3.357 1.00 18.10 ? 44  LYS A O   1 
ATOM   185  C  CB  . LYS A 1 52  ? 17.480  17.950  -5.087 1.00 21.35 ? 44  LYS A CB  1 
ATOM   186  C  CG  . LYS A 1 52  ? 18.760  17.155  -5.208 1.00 22.47 ? 44  LYS A CG  1 
ATOM   187  C  CD  . LYS A 1 52  ? 19.467  17.345  -6.534 1.00 24.90 ? 44  LYS A CD  1 
ATOM   188  C  CE  . LYS A 1 52  ? 20.967  17.135  -6.347 1.00 26.88 ? 44  LYS A CE  1 
ATOM   189  N  NZ  . LYS A 1 52  ? 21.656  16.763  -7.611 1.00 28.20 ? 44  LYS A NZ  1 
ATOM   190  N  N   . ASP A 1 53  ? 14.300  17.985  -4.048 1.00 18.38 ? 45  ASP A N   1 
ATOM   191  C  CA  . ASP A 1 53  ? 13.058  18.730  -3.844 1.00 18.55 ? 45  ASP A CA  1 
ATOM   192  C  C   . ASP A 1 53  ? 12.390  18.327  -2.538 1.00 17.74 ? 45  ASP A C   1 
ATOM   193  O  O   . ASP A 1 53  ? 11.222  18.671  -2.307 1.00 18.01 ? 45  ASP A O   1 
ATOM   194  C  CB  . ASP A 1 53  ? 12.102  18.500  -5.015 1.00 19.78 ? 45  ASP A CB  1 
ATOM   195  C  CG  . ASP A 1 53  ? 12.618  19.130  -6.320 1.00 20.94 ? 45  ASP A CG  1 
ATOM   196  O  OD1 . ASP A 1 53  ? 13.399  20.086  -6.236 1.00 20.55 ? 45  ASP A OD1 1 
ATOM   197  O  OD2 . ASP A 1 53  ? 12.240  18.652  -7.421 1.00 22.79 ? 45  ASP A OD2 1 
ATOM   198  N  N   . GLY A 1 54  ? 13.130  17.643  -1.661 1.00 16.67 ? 46  GLY A N   1 
ATOM   199  C  CA  . GLY A 1 54  ? 12.542  17.102  -0.422 1.00 15.77 ? 46  GLY A CA  1 
ATOM   200  C  C   . GLY A 1 54  ? 11.431  16.114  -0.737 1.00 14.80 ? 46  GLY A C   1 
ATOM   201  O  O   . GLY A 1 54  ? 11.475  15.451  -1.774 1.00 15.42 ? 46  GLY A O   1 
ATOM   202  N  N   . CYS A 1 55  ? 10.429  16.024  0.136  1.00 14.18 ? 47  CYS A N   1 
ATOM   203  C  CA  . CYS A 1 55  ? 9.201   15.253  -0.186 1.00 13.29 ? 47  CYS A CA  1 
ATOM   204  C  C   . CYS A 1 55  ? 7.999   16.025  0.359  1.00 13.12 ? 47  CYS A C   1 
ATOM   205  O  O   . CYS A 1 55  ? 7.555   15.834  1.501  1.00 12.30 ? 47  CYS A O   1 
ATOM   206  C  CB  . CYS A 1 55  ? 9.296   13.839  0.350  1.00 12.55 ? 47  CYS A CB  1 
ATOM   207  S  SG  . CYS A 1 55  ? 7.876   12.770  0.012  1.00 11.85 ? 47  CYS A SG  1 
ATOM   208  N  N   . ALA A 1 56  ? 7.532   16.953  -0.474 1.00 13.41 ? 48  ALA A N   1 
ATOM   209  C  CA  . ALA A 1 56  ? 6.573   17.955  -0.056 1.00 13.44 ? 48  ALA A CA  1 
ATOM   210  C  C   . ALA A 1 56  ? 5.194   17.320  0.145  1.00 13.58 ? 48  ALA A C   1 
ATOM   211  O  O   . ALA A 1 56  ? 4.863   16.350  -0.526 1.00 13.67 ? 48  ALA A O   1 
ATOM   212  C  CB  . ALA A 1 56  ? 6.517   19.101  -1.085 1.00 13.69 ? 48  ALA A CB  1 
ATOM   213  N  N   . PRO A 1 57  ? 4.355   17.891  1.044  1.00 13.83 ? 49  PRO A N   1 
ATOM   214  C  CA  . PRO A 1 57  ? 4.559   19.132  1.817  1.00 14.14 ? 49  PRO A CA  1 
ATOM   215  C  C   . PRO A 1 57  ? 5.189   18.878  3.180  1.00 14.30 ? 49  PRO A C   1 
ATOM   216  O  O   . PRO A 1 57  ? 5.200   19.764  3.991  1.00 14.78 ? 49  PRO A O   1 
ATOM   217  C  CB  . PRO A 1 57  ? 3.126   19.606  2.061  1.00 14.18 ? 49  PRO A CB  1 
ATOM   218  C  CG  . PRO A 1 57  ? 2.371   18.289  2.207  1.00 13.71 ? 49  PRO A CG  1 
ATOM   219  C  CD  . PRO A 1 57  ? 2.964   17.404  1.156  1.00 13.58 ? 49  PRO A CD  1 
ATOM   220  N  N   . VAL A 1 58  ? 5.678   17.673  3.434  1.00 14.02 ? 50  VAL A N   1 
ATOM   221  C  CA  . VAL A 1 58  ? 6.087   17.292  4.770  1.00 13.85 ? 50  VAL A CA  1 
ATOM   222  C  C   . VAL A 1 58  ? 7.587   17.417  5.074  1.00 13.16 ? 50  VAL A C   1 
ATOM   223  O  O   . VAL A 1 58  ? 7.932   17.797  6.167  1.00 13.16 ? 50  VAL A O   1 
ATOM   224  C  CB  . VAL A 1 58  ? 5.651   15.847  5.059  1.00 14.09 ? 50  VAL A CB  1 
ATOM   225  C  CG1 . VAL A 1 58  ? 6.151   15.391  6.427  1.00 14.26 ? 50  VAL A CG1 1 
ATOM   226  C  CG2 . VAL A 1 58  ? 4.119   15.730  4.959  1.00 14.36 ? 50  VAL A CG2 1 
ATOM   227  N  N   . PHE A 1 59  ? 8.450   17.085  4.123  1.00 12.64 ? 51  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 59  ? 9.887   17.015  4.353  1.00 12.35 ? 51  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 59  ? 10.694  17.988  3.496  1.00 11.98 ? 51  PHE A C   1 
ATOM   230  O  O   . PHE A 1 59  ? 10.455  18.117  2.301  1.00 12.12 ? 51  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 59  ? 10.418  15.606  4.042  1.00 12.41 ? 51  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 59  ? 9.830   14.522  4.905  1.00 12.78 ? 51  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 59  ? 10.144  14.447  6.249  1.00 13.08 ? 51  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 59  ? 8.971   13.585  4.361  1.00 13.11 ? 51  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 59  ? 9.605   13.458  7.053  1.00 13.28 ? 51  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 59  ? 8.452   12.559  5.136  1.00 13.44 ? 51  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 59  ? 8.771   12.496  6.497  1.00 13.46 ? 51  PHE A CZ  1 
ATOM   238  N  N   . SER A 1 60  ? 11.727  18.542  4.085  1.00 11.49 ? 52  SER A N   1 
ATOM   239  C  CA  . SER A 1 60  ? 12.605  19.467  3.393  1.00 11.72 ? 52  SER A CA  1 
ATOM   240  C  C   . SER A 1 60  ? 13.635  18.703  2.567  1.00 11.59 ? 52  SER A C   1 
ATOM   241  O  O   . SER A 1 60  ? 13.899  17.521  2.823  1.00 11.51 ? 52  SER A O   1 
ATOM   242  C  CB  . SER A 1 60  ? 13.339  20.340  4.417  1.00 11.75 ? 52  SER A CB  1 
ATOM   243  O  OG  . SER A 1 60  ? 14.229  19.536  5.183  1.00 11.69 ? 52  SER A OG  1 
ATOM   244  N  N   . PRO A 1 61  ? 14.273  19.387  1.625  1.00 11.39 ? 53  PRO A N   1 
ATOM   245  C  CA  . PRO A 1 61  ? 15.388  18.778  0.933  1.00 11.39 ? 53  PRO A CA  1 
ATOM   246  C  C   . PRO A 1 61  ? 16.438  18.216  1.877  1.00 10.95 ? 53  PRO A C   1 
ATOM   247  O  O   . PRO A 1 61  ? 16.926  17.119  1.665  1.00 10.73 ? 53  PRO A O   1 
ATOM   248  C  CB  . PRO A 1 61  ? 15.946  19.962  0.075  1.00 11.76 ? 53  PRO A CB  1 
ATOM   249  C  CG  . PRO A 1 61  ? 14.720  20.743  -0.268 1.00 12.01 ? 53  PRO A CG  1 
ATOM   250  C  CD  . PRO A 1 61  ? 13.908  20.691  1.026  1.00 11.89 ? 53  PRO A CD  1 
ATOM   251  N  N   . ARG A 1 62  ? 16.799  18.987  2.885  1.00 11.07 ? 54  ARG A N   1 
ATOM   252  C  CA  . ARG A 1 62  ? 17.899  18.626  3.790  1.00 11.13 ? 54  ARG A CA  1 
ATOM   253  C  C   . ARG A 1 62  ? 17.561  17.410  4.644  1.00 10.54 ? 54  ARG A C   1 
ATOM   254  O  O   . ARG A 1 62  ? 18.387  16.529  4.785  1.00 10.21 ? 54  ARG A O   1 
ATOM   255  C  CB  . ARG A 1 62  ? 18.303  19.825  4.667  1.00 11.58 ? 54  ARG A CB  1 
ATOM   256  C  CG  . ARG A 1 62  ? 19.512  19.584  5.558  1.00 12.07 ? 54  ARG A CG  1 
ATOM   257  C  CD  . ARG A 1 62  ? 20.734  19.137  4.747  1.00 12.35 ? 54  ARG A CD  1 
ATOM   258  N  NE  . ARG A 1 62  ? 21.937  19.045  5.568  1.00 12.69 ? 54  ARG A NE  1 
ATOM   259  C  CZ  . ARG A 1 62  ? 23.118  18.598  5.132  1.00 13.04 ? 54  ARG A CZ  1 
ATOM   260  N  NH1 . ARG A 1 62  ? 23.272  18.210  3.872  1.00 13.06 ? 54  ARG A NH1 1 
ATOM   261  N  NH2 . ARG A 1 62  ? 24.167  18.567  5.951  1.00 13.15 ? 54  ARG A NH2 1 
ATOM   262  N  N   . GLN A 1 63  ? 16.343  17.347  5.183  1.00 10.42 ? 55  GLN A N   1 
ATOM   263  C  CA  . GLN A 1 63  ? 15.866  16.142  5.888  1.00 10.28 ? 55  GLN A CA  1 
ATOM   264  C  C   . GLN A 1 63  ? 15.933  14.889  5.002  1.00 10.50 ? 55  GLN A C   1 
ATOM   265  O  O   . GLN A 1 63  ? 16.452  13.858  5.436  1.00 10.48 ? 55  GLN A O   1 
ATOM   266  C  CB  . GLN A 1 63  ? 14.439  16.329  6.407  1.00 10.06 ? 55  GLN A CB  1 
ATOM   267  C  CG  . GLN A 1 63  ? 13.795  15.159  7.146  1.00 9.50  ? 55  GLN A CG  1 
ATOM   268  C  CD  . GLN A 1 63  ? 14.475  14.874  8.464  1.00 9.39  ? 55  GLN A CD  1 
ATOM   269  O  OE1 . GLN A 1 63  ? 14.042  15.360  9.530  1.00 9.31  ? 55  GLN A OE1 1 
ATOM   270  N  NE2 . GLN A 1 63  ? 15.582  14.105  8.409  1.00 9.15  ? 55  GLN A NE2 1 
ATOM   271  N  N   . MET A 1 64  ? 15.476  14.974  3.749  1.00 11.04 ? 56  MET A N   1 
ATOM   272  C  CA  . MET A 1 64  ? 15.610  13.833  2.825  1.00 11.12 ? 56  MET A CA  1 
ATOM   273  C  C   . MET A 1 64  ? 17.085  13.538  2.457  1.00 11.01 ? 56  MET A C   1 
ATOM   274  O  O   . MET A 1 64  ? 17.486  12.376  2.390  1.00 10.80 ? 56  MET A O   1 
ATOM   275  C  CB  . MET A 1 64  ? 14.810  14.085  1.555  1.00 11.91 ? 56  MET A CB  1 
ATOM   276  C  CG  . MET A 1 64  ? 13.309  14.114  1.735  1.00 12.23 ? 56  MET A CG  1 
ATOM   277  S  SD  . MET A 1 64  ? 12.625  12.530  2.300  1.00 13.62 ? 56  MET A SD  1 
ATOM   278  C  CE  . MET A 1 64  ? 12.710  12.770  4.083  1.00 13.45 ? 56  MET A CE  1 
ATOM   279  N  N   . GLU A 1 65  ? 17.883  14.584  2.210  1.00 10.95 ? 57  GLU A N   1 
ATOM   280  C  CA  . GLU A 1 65  ? 19.299  14.437  1.883  1.00 10.91 ? 57  GLU A CA  1 
ATOM   281  C  C   . GLU A 1 65  ? 20.044  13.659  2.968  1.00 10.66 ? 57  GLU A C   1 
ATOM   282  O  O   . GLU A 1 65  ? 20.761  12.682  2.675  1.00 10.38 ? 57  GLU A O   1 
ATOM   283  C  CB  . GLU A 1 65  ? 19.986  15.806  1.709  1.00 11.23 ? 57  GLU A CB  1 
ATOM   284  C  CG  . GLU A 1 65  ? 21.466  15.662  1.372  1.00 11.49 ? 57  GLU A CG  1 
ATOM   285  C  CD  . GLU A 1 65  ? 22.183  16.976  1.079  1.00 11.99 ? 57  GLU A CD  1 
ATOM   286  O  OE1 . GLU A 1 65  ? 21.744  18.053  1.513  1.00 11.92 ? 57  GLU A OE1 1 
ATOM   287  O  OE2 . GLU A 1 65  ? 23.215  16.903  0.407  1.00 12.25 ? 57  GLU A OE2 1 
ATOM   288  N  N   . LEU A 1 66  ? 19.869  14.085  4.219  1.00 10.39 ? 58  LEU A N   1 
ATOM   289  C  CA  . LEU A 1 66  ? 20.504  13.405  5.342  1.00 9.99  ? 58  LEU A CA  1 
ATOM   290  C  C   . LEU A 1 66  ? 20.036  11.977  5.441  1.00 9.78  ? 58  LEU A C   1 
ATOM   291  O  O   . LEU A 1 66  ? 20.853  11.070  5.558  1.00 9.67  ? 58  LEU A O   1 
ATOM   292  C  CB  . LEU A 1 66  ? 20.206  14.106  6.653  1.00 9.95  ? 58  LEU A CB  1 
ATOM   293  C  CG  . LEU A 1 66  ? 20.810  15.494  6.821  1.00 10.28 ? 58  LEU A CG  1 
ATOM   294  C  CD1 . LEU A 1 66  ? 20.180  16.185  8.029  1.00 10.56 ? 58  LEU A CD1 1 
ATOM   295  C  CD2 . LEU A 1 66  ? 22.309  15.415  6.951  1.00 10.27 ? 58  LEU A CD2 1 
ATOM   296  N  N   . HIS A 1 67  ? 18.728  11.763  5.378  1.00 9.67  ? 59  HIS A N   1 
ATOM   297  C  CA  . HIS A 1 67  ? 18.182  10.438  5.688  1.00 9.52  ? 59  HIS A CA  1 
ATOM   298  C  C   . HIS A 1 67  ? 18.610  9.403   4.634  1.00 9.72  ? 59  HIS A C   1 
ATOM   299  O  O   . HIS A 1 67  ? 19.040  8.322   4.967  1.00 9.81  ? 59  HIS A O   1 
ATOM   300  C  CB  . HIS A 1 67  ? 16.675  10.511  5.780  1.00 9.05  ? 59  HIS A CB  1 
ATOM   301  C  CG  . HIS A 1 67  ? 16.066  9.404   6.563  1.00 8.63  ? 59  HIS A CG  1 
ATOM   302  N  ND1 . HIS A 1 67  ? 14.725  9.375   6.874  1.00 8.27  ? 59  HIS A ND1 1 
ATOM   303  C  CD2 . HIS A 1 67  ? 16.613  8.308   7.142  1.00 8.48  ? 59  HIS A CD2 1 
ATOM   304  C  CE1 . HIS A 1 67  ? 14.469  8.316   7.608  1.00 8.18  ? 59  HIS A CE1 1 
ATOM   305  N  NE2 . HIS A 1 67  ? 15.594  7.641   7.774  1.00 8.23  ? 59  HIS A NE2 1 
ATOM   306  N  N   . TYR A 1 68  ? 18.558  9.798   3.371  1.00 10.00 ? 60  TYR A N   1 
ATOM   307  C  CA  . TYR A 1 68  ? 18.937  8.952   2.249  1.00 10.20 ? 60  TYR A CA  1 
ATOM   308  C  C   . TYR A 1 68  ? 20.453  8.892   2.000  1.00 10.50 ? 60  TYR A C   1 
ATOM   309  O  O   . TYR A 1 68  ? 21.023  7.789   2.011  1.00 10.51 ? 60  TYR A O   1 
ATOM   310  C  CB  . TYR A 1 68  ? 18.268  9.479   0.984  1.00 10.53 ? 60  TYR A CB  1 
ATOM   311  C  CG  . TYR A 1 68  ? 18.513  8.684   -0.265 1.00 10.70 ? 60  TYR A CG  1 
ATOM   312  C  CD1 . TYR A 1 68  ? 18.190  7.327   -0.343 1.00 10.81 ? 60  TYR A CD1 1 
ATOM   313  C  CD2 . TYR A 1 68  ? 18.991  9.300   -1.388 1.00 11.20 ? 60  TYR A CD2 1 
ATOM   314  C  CE1 . TYR A 1 68  ? 18.345  6.619   -1.528 1.00 10.85 ? 60  TYR A CE1 1 
ATOM   315  C  CE2 . TYR A 1 68  ? 19.177  8.605   -2.575 1.00 11.43 ? 60  TYR A CE2 1 
ATOM   316  C  CZ  . TYR A 1 68  ? 18.882  7.266   -2.633 1.00 11.09 ? 60  TYR A CZ  1 
ATOM   317  O  OH  . TYR A 1 68  ? 19.080  6.664   -3.826 1.00 10.94 ? 60  TYR A OH  1 
ATOM   318  N  N   . THR A 1 69  ? 21.087  10.040  1.721  1.00 10.54 ? 61  THR A N   1 
ATOM   319  C  CA  . THR A 1 69  ? 22.480  10.040  1.275  1.00 10.83 ? 61  THR A CA  1 
ATOM   320  C  C   . THR A 1 69  ? 23.474  9.917   2.413  1.00 11.16 ? 61  THR A C   1 
ATOM   321  O  O   . THR A 1 69  ? 24.654  9.714   2.143  1.00 11.42 ? 61  THR A O   1 
ATOM   322  C  CB  . THR A 1 69  ? 22.883  11.295  0.455  1.00 11.13 ? 61  THR A CB  1 
ATOM   323  O  OG1 . THR A 1 69  ? 22.984  12.447  1.306  1.00 11.06 ? 61  THR A OG1 1 
ATOM   324  C  CG2 . THR A 1 69  ? 21.896  11.567  -0.656 1.00 11.22 ? 61  THR A CG2 1 
ATOM   325  N  N   . LYS A 1 70  ? 23.034  10.081  3.664  1.00 11.04 ? 62  LYS A N   1 
ATOM   326  C  CA  . LYS A 1 70  ? 23.910  9.793   4.789  1.00 11.12 ? 62  LYS A CA  1 
ATOM   327  C  C   . LYS A 1 70  ? 23.517  8.530   5.524  1.00 10.74 ? 62  LYS A C   1 
ATOM   328  O  O   . LYS A 1 70  ? 24.300  7.581   5.557  1.00 10.78 ? 62  LYS A O   1 
ATOM   329  C  CB  . LYS A 1 70  ? 23.997  10.978  5.764  1.00 11.61 ? 62  LYS A CB  1 
ATOM   330  C  CG  . LYS A 1 70  ? 24.312  12.306  5.095  1.00 12.38 ? 62  LYS A CG  1 
ATOM   331  C  CD  . LYS A 1 70  ? 25.698  12.331  4.448  1.00 12.93 ? 62  LYS A CD  1 
ATOM   332  C  CE  . LYS A 1 70  ? 25.842  13.533  3.516  1.00 13.65 ? 62  LYS A CE  1 
ATOM   333  N  NZ  . LYS A 1 70  ? 27.165  13.501  2.849  1.00 13.85 ? 62  LYS A NZ  1 
ATOM   334  N  N   . HIS A 1 71  ? 22.329  8.496   6.139  1.00 10.35 ? 63  HIS A N   1 
ATOM   335  C  CA  . HIS A 1 71  ? 21.974  7.334   6.967  1.00 10.22 ? 63  HIS A CA  1 
ATOM   336  C  C   . HIS A 1 71  ? 21.847  6.052   6.127  1.00 10.12 ? 63  HIS A C   1 
ATOM   337  O  O   . HIS A 1 71  ? 22.538  5.056   6.363  1.00 10.03 ? 63  HIS A O   1 
ATOM   338  C  CB  . HIS A 1 71  ? 20.717  7.593   7.800  1.00 10.00 ? 63  HIS A CB  1 
ATOM   339  C  CG  . HIS A 1 71  ? 20.891  8.683   8.798  1.00 9.92  ? 63  HIS A CG  1 
ATOM   340  N  ND1 . HIS A 1 71  ? 21.464  8.470   10.035 1.00 10.00 ? 63  HIS A ND1 1 
ATOM   341  C  CD2 . HIS A 1 71  ? 20.622  10.001  8.730  1.00 9.80  ? 63  HIS A CD2 1 
ATOM   342  C  CE1 . HIS A 1 71  ? 21.536  9.616   10.682 1.00 10.00 ? 63  HIS A CE1 1 
ATOM   343  N  NE2 . HIS A 1 71  ? 21.024  10.557  9.917  1.00 9.96  ? 63  HIS A NE2 1 
ATOM   344  N  N   . HIS A 1 72  ? 21.010  6.092   5.113  1.00 10.33 ? 64  HIS A N   1 
ATOM   345  C  CA  . HIS A 1 72  ? 20.767  4.890   4.308  1.00 10.33 ? 64  HIS A CA  1 
ATOM   346  C  C   . HIS A 1 72  ? 22.043  4.488   3.583  1.00 10.90 ? 64  HIS A C   1 
ATOM   347  O  O   . HIS A 1 72  ? 22.469  3.332   3.639  1.00 10.85 ? 64  HIS A O   1 
ATOM   348  C  CB  . HIS A 1 72  ? 19.626  5.118   3.316  1.00 10.11 ? 64  HIS A CB  1 
ATOM   349  C  CG  . HIS A 1 72  ? 19.105  3.862   2.715  1.00 9.78  ? 64  HIS A CG  1 
ATOM   350  N  ND1 . HIS A 1 72  ? 18.028  3.838   1.858  1.00 9.75  ? 64  HIS A ND1 1 
ATOM   351  C  CD2 . HIS A 1 72  ? 19.485  2.577   2.882  1.00 9.54  ? 64  HIS A CD2 1 
ATOM   352  C  CE1 . HIS A 1 72  ? 17.795  2.598   1.480  1.00 9.75  ? 64  HIS A CE1 1 
ATOM   353  N  NE2 . HIS A 1 72  ? 18.663  1.817   2.092  1.00 9.68  ? 64  HIS A NE2 1 
ATOM   354  N  N   . LYS A 1 73  ? 22.710  5.446   2.949  1.00 11.74 ? 65  LYS A N   1 
ATOM   355  C  CA  . LYS A 1 73  ? 24.001  5.149   2.316  1.00 12.42 ? 65  LYS A CA  1 
ATOM   356  C  C   . LYS A 1 73  ? 24.973  4.469   3.284  1.00 12.04 ? 65  LYS A C   1 
ATOM   357  O  O   . LYS A 1 73  ? 25.632  3.483   2.934  1.00 12.74 ? 65  LYS A O   1 
ATOM   358  C  CB  . LYS A 1 73  ? 24.610  6.428   1.733  1.00 13.29 ? 65  LYS A CB  1 
ATOM   359  C  CG  . LYS A 1 73  ? 26.040  6.299   1.225  1.00 13.83 ? 65  LYS A CG  1 
ATOM   360  C  CD  . LYS A 1 73  ? 26.252  7.169   0.011  1.00 14.83 ? 65  LYS A CD  1 
ATOM   361  C  CE  . LYS A 1 73  ? 27.690  7.612   -0.224 1.00 15.45 ? 65  LYS A CE  1 
ATOM   362  N  NZ  . LYS A 1 73  ? 28.739  6.701   0.306  1.00 15.84 ? 65  LYS A NZ  1 
ATOM   363  N  N   . ALA A 1 74  ? 25.056  4.950   4.514  1.00 11.61 ? 66  ALA A N   1 
ATOM   364  C  CA  . ALA A 1 74  ? 25.994  4.353   5.443  1.00 11.17 ? 66  ALA A CA  1 
ATOM   365  C  C   . ALA A 1 74  ? 25.617  2.906   5.738  1.00 10.81 ? 66  ALA A C   1 
ATOM   366  O  O   . ALA A 1 74  ? 26.501  2.047   5.820  1.00 10.51 ? 66  ALA A O   1 
ATOM   367  C  CB  . ALA A 1 74  ? 26.105  5.174   6.720  1.00 11.29 ? 66  ALA A CB  1 
ATOM   368  N  N   . TYR A 1 75  ? 24.315  2.612   5.852  1.00 10.36 ? 67  TYR A N   1 
ATOM   369  C  CA  . TYR A 1 75  ? 23.888  1.215   6.039  1.00 9.98  ? 67  TYR A CA  1 
ATOM   370  C  C   . TYR A 1 75  ? 24.295  0.349   4.844  1.00 10.06 ? 67  TYR A C   1 
ATOM   371  O  O   . TYR A 1 75  ? 24.779  -0.768  5.041  1.00 10.47 ? 67  TYR A O   1 
ATOM   372  C  CB  . TYR A 1 75  ? 22.384  1.090   6.298  1.00 9.76  ? 67  TYR A CB  1 
ATOM   373  C  CG  . TYR A 1 75  ? 21.921  1.663   7.647  1.00 9.84  ? 67  TYR A CG  1 
ATOM   374  C  CD1 . TYR A 1 75  ? 22.455  1.205   8.850  1.00 9.86  ? 67  TYR A CD1 1 
ATOM   375  C  CD2 . TYR A 1 75  ? 20.962  2.658   7.708  1.00 9.78  ? 67  TYR A CD2 1 
ATOM   376  C  CE1 . TYR A 1 75  ? 22.045  1.726   10.064 1.00 9.91  ? 67  TYR A CE1 1 
ATOM   377  C  CE2 . TYR A 1 75  ? 20.554  3.181   8.919  1.00 9.96  ? 67  TYR A CE2 1 
ATOM   378  C  CZ  . TYR A 1 75  ? 21.082  2.699   10.092 1.00 10.01 ? 67  TYR A CZ  1 
ATOM   379  O  OH  . TYR A 1 75  ? 20.632  3.243   11.304 1.00 10.75 ? 67  TYR A OH  1 
ATOM   380  N  N   . VAL A 1 76  ? 24.104  0.839   3.620  1.00 9.84  ? 68  VAL A N   1 
ATOM   381  C  CA  . VAL A 1 76  ? 24.522  0.095   2.413  1.00 10.09 ? 68  VAL A CA  1 
ATOM   382  C  C   . VAL A 1 76  ? 26.048  -0.141  2.364  1.00 10.27 ? 68  VAL A C   1 
ATOM   383  O  O   . VAL A 1 76  ? 26.504  -1.263  2.138  1.00 9.94  ? 68  VAL A O   1 
ATOM   384  C  CB  . VAL A 1 76  ? 24.066  0.799   1.125  1.00 10.16 ? 68  VAL A CB  1 
ATOM   385  C  CG1 . VAL A 1 76  ? 24.688  0.182   -0.126 1.00 10.30 ? 68  VAL A CG1 1 
ATOM   386  C  CG2 . VAL A 1 76  ? 22.544  0.796   1.042  1.00 10.09 ? 68  VAL A CG2 1 
ATOM   387  N  N   . ASP A 1 77  ? 26.819  0.912   2.606  1.00 10.64 ? 69  ASP A N   1 
ATOM   388  C  CA  . ASP A 1 77  ? 28.266  0.798   2.600  1.00 11.04 ? 69  ASP A CA  1 
ATOM   389  C  C   . ASP A 1 77  ? 28.758  -0.216  3.631  1.00 11.76 ? 69  ASP A C   1 
ATOM   390  O  O   . ASP A 1 77  ? 29.611  -1.067  3.334  1.00 11.21 ? 69  ASP A O   1 
ATOM   391  C  CB  . ASP A 1 77  ? 28.946  2.163   2.823  1.00 10.97 ? 69  ASP A CB  1 
ATOM   392  C  CG  . ASP A 1 77  ? 28.695  3.151   1.657  1.00 10.91 ? 69  ASP A CG  1 
ATOM   393  O  OD1 . ASP A 1 77  ? 28.288  2.726   0.566  1.00 10.55 ? 69  ASP A OD1 1 
ATOM   394  O  OD2 . ASP A 1 77  ? 28.871  4.358   1.873  1.00 10.68 ? 69  ASP A OD2 1 
ATOM   395  N  N   . LYS A 1 78  ? 28.209  -0.145  4.847  1.00 12.59 ? 70  LYS A N   1 
ATOM   396  C  CA  . LYS A 1 78  ? 28.674  -1.042  5.900  1.00 13.53 ? 70  LYS A CA  1 
ATOM   397  C  C   . LYS A 1 78  ? 28.189  -2.486  5.623  1.00 13.60 ? 70  LYS A C   1 
ATOM   398  O  O   . LYS A 1 78  ? 28.899  -3.470  5.917  1.00 13.08 ? 70  LYS A O   1 
ATOM   399  C  CB  . LYS A 1 78  ? 28.199  -0.523  7.269  1.00 14.26 ? 70  LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 78  ? 28.832  -1.194  8.450  1.00 15.81 ? 70  LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 78  ? 30.273  -0.703  8.658  1.00 17.58 ? 70  LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 78  ? 30.939  -1.371  9.855  1.00 18.69 ? 70  LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 78  ? 30.627  -0.635  11.127 1.00 19.75 ? 70  LYS A NZ  1 
ATOM   404  N  N   . LEU A 1 79  ? 26.986  -2.621  5.059  1.00 13.27 ? 71  LEU A N   1 
ATOM   405  C  CA  . LEU A 1 79  ? 26.507  -3.951  4.621  1.00 13.39 ? 71  LEU A CA  1 
ATOM   406  C  C   . LEU A 1 79  ? 27.500  -4.624  3.640  1.00 13.81 ? 71  LEU A C   1 
ATOM   407  O  O   . LEU A 1 79  ? 27.944  -5.745  3.852  1.00 13.58 ? 71  LEU A O   1 
ATOM   408  C  CB  . LEU A 1 79  ? 25.109  -3.851  4.006  1.00 13.15 ? 71  LEU A CB  1 
ATOM   409  C  CG  . LEU A 1 79  ? 24.577  -5.065  3.240  1.00 13.27 ? 71  LEU A CG  1 
ATOM   410  C  CD1 . LEU A 1 79  ? 24.486  -6.262  4.153  1.00 13.09 ? 71  LEU A CD1 1 
ATOM   411  C  CD2 . LEU A 1 79  ? 23.225  -4.760  2.590  1.00 13.18 ? 71  LEU A CD2 1 
ATOM   412  N  N   . ASN A 1 80  ? 27.862  -3.909  2.592  1.00 14.65 ? 72  ASN A N   1 
ATOM   413  C  CA  . ASN A 1 80  ? 28.844  -4.413  1.632  1.00 15.26 ? 72  ASN A CA  1 
ATOM   414  C  C   . ASN A 1 80  ? 30.183  -4.794  2.292  1.00 15.42 ? 72  ASN A C   1 
ATOM   415  O  O   . ASN A 1 80  ? 30.725  -5.862  2.029  1.00 15.18 ? 72  ASN A O   1 
ATOM   416  C  CB  . ASN A 1 80  ? 29.051  -3.396  0.497  1.00 15.36 ? 72  ASN A CB  1 
ATOM   417  C  CG  . ASN A 1 80  ? 27.857  -3.328  -0.437 1.00 15.96 ? 72  ASN A CG  1 
ATOM   418  O  OD1 . ASN A 1 80  ? 27.288  -4.376  -0.797 1.00 17.45 ? 72  ASN A OD1 1 
ATOM   419  N  ND2 . ASN A 1 80  ? 27.476  -2.120  -0.870 1.00 15.39 ? 72  ASN A ND2 1 
ATOM   420  N  N   . ALA A 1 81  ? 30.696  -3.944  3.177  1.00 15.51 ? 73  ALA A N   1 
ATOM   421  C  CA  . ALA A 1 81  ? 31.954  -4.247  3.850  1.00 15.75 ? 73  ALA A CA  1 
ATOM   422  C  C   . ALA A 1 81  ? 31.850  -5.505  4.732  1.00 15.79 ? 73  ALA A C   1 
ATOM   423  O  O   . ALA A 1 81  ? 32.741  -6.345  4.705  1.00 16.72 ? 73  ALA A O   1 
ATOM   424  C  CB  . ALA A 1 81  ? 32.419  -3.061  4.675  1.00 15.72 ? 73  ALA A CB  1 
ATOM   425  N  N   . LEU A 1 82  ? 30.772  -5.647  5.494  1.00 15.37 ? 74  LEU A N   1 
ATOM   426  C  CA  . LEU A 1 82  ? 30.594  -6.828  6.344  1.00 15.16 ? 74  LEU A CA  1 
ATOM   427  C  C   . LEU A 1 82  ? 30.223  -8.098  5.562  1.00 15.05 ? 74  LEU A C   1 
ATOM   428  O  O   . LEU A 1 82  ? 30.558  -9.194  5.983  1.00 14.86 ? 74  LEU A O   1 
ATOM   429  C  CB  . LEU A 1 82  ? 29.552  -6.569  7.442  1.00 15.40 ? 74  LEU A CB  1 
ATOM   430  C  CG  . LEU A 1 82  ? 29.932  -5.535  8.522  1.00 15.72 ? 74  LEU A CG  1 
ATOM   431  C  CD1 . LEU A 1 82  ? 28.749  -5.230  9.433  1.00 15.41 ? 74  LEU A CD1 1 
ATOM   432  C  CD2 . LEU A 1 82  ? 31.100  -6.017  9.381  1.00 16.35 ? 74  LEU A CD2 1 
ATOM   433  N  N   . ALA A 1 83  ? 29.512  -7.979  4.445  1.00 14.49 ? 75  ALA A N   1 
ATOM   434  C  CA  . ALA A 1 83  ? 29.057  -9.171  3.740  1.00 14.31 ? 75  ALA A CA  1 
ATOM   435  C  C   . ALA A 1 83  ? 30.176  -9.889  2.928  1.00 14.83 ? 75  ALA A C   1 
ATOM   436  O  O   . ALA A 1 83  ? 30.096  -11.063 2.666  1.00 13.91 ? 75  ALA A O   1 
ATOM   437  C  CB  . ALA A 1 83  ? 27.872  -8.817  2.836  1.00 13.87 ? 75  ALA A CB  1 
ATOM   438  N  N   . GLY A 1 84  ? 31.199  -9.163  2.492  1.00 15.67 ? 76  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 84  ? 32.156  -9.739  1.525  1.00 16.15 ? 76  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 84  ? 31.402  -10.366 0.365  1.00 16.96 ? 76  GLY A C   1 
ATOM   441  O  O   . GLY A 1 84  ? 30.410  -9.805  -0.135 1.00 16.92 ? 76  GLY A O   1 
ATOM   442  N  N   . THR A 1 85  ? 31.822  -11.555 -0.035 1.00 17.59 ? 77  THR A N   1 
ATOM   443  C  CA  . THR A 1 85  ? 31.127  -12.305 -1.092 1.00 18.07 ? 77  THR A CA  1 
ATOM   444  C  C   . THR A 1 85  ? 30.268  -13.427 -0.519 1.00 18.40 ? 77  THR A C   1 
ATOM   445  O  O   . THR A 1 85  ? 29.615  -14.140 -1.270 1.00 18.46 ? 77  THR A O   1 
ATOM   446  C  CB  . THR A 1 85  ? 32.132  -12.976 -2.024 1.00 17.96 ? 77  THR A CB  1 
ATOM   447  O  OG1 . THR A 1 85  ? 32.925  -13.847 -1.230 1.00 17.37 ? 77  THR A OG1 1 
ATOM   448  C  CG2 . THR A 1 85  ? 33.041  -11.945 -2.684 1.00 18.15 ? 77  THR A CG2 1 
ATOM   449  N  N   . THR A 1 86  ? 30.253  -13.570 0.805  1.00 18.49 ? 78  THR A N   1 
ATOM   450  C  CA  . THR A 1 86  ? 29.523  -14.656 1.454  1.00 19.55 ? 78  THR A CA  1 
ATOM   451  C  C   . THR A 1 86  ? 28.036  -14.736 1.099  1.00 19.45 ? 78  THR A C   1 
ATOM   452  O  O   . THR A 1 86  ? 27.456  -15.800 1.154  1.00 19.25 ? 78  THR A O   1 
ATOM   453  C  CB  . THR A 1 86  ? 29.623  -14.502 2.974  1.00 20.59 ? 78  THR A CB  1 
ATOM   454  O  OG1 . THR A 1 86  ? 31.002  -14.292 3.316  1.00 23.23 ? 78  THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 86  ? 29.114  -15.751 3.691  1.00 21.33 ? 78  THR A CG2 1 
ATOM   456  N  N   . TYR A 1 87  ? 27.406  -13.613 0.767  1.00 18.71 ? 79  TYR A N   1 
ATOM   457  C  CA  . TYR A 1 87  ? 25.948  -13.586 0.577  1.00 18.12 ? 79  TYR A CA  1 
ATOM   458  C  C   . TYR A 1 87  ? 25.552  -13.212 -0.858 1.00 17.94 ? 79  TYR A C   1 
ATOM   459  O  O   . TYR A 1 87  ? 24.424  -12.772 -1.104 1.00 17.70 ? 79  TYR A O   1 
ATOM   460  C  CB  . TYR A 1 87  ? 25.334  -12.604 1.602  1.00 17.95 ? 79  TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 87  ? 25.611  -13.032 3.037  1.00 17.67 ? 79  TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 87  ? 24.821  -14.020 3.649  1.00 17.66 ? 79  TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 87  ? 26.668  -12.471 3.774  1.00 17.49 ? 79  TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 87  ? 25.071  -14.451 4.930  1.00 17.25 ? 79  TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 87  ? 26.925  -12.903 5.077  1.00 17.51 ? 79  TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 87  ? 26.104  -13.884 5.638  1.00 17.45 ? 79  TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 87  ? 26.294  -14.342 6.907  1.00 18.80 ? 79  TYR A OH  1 
ATOM   468  N  N   . ASP A 1 88  ? 26.503  -13.356 -1.784 1.00 17.24 ? 80  ASP A N   1 
ATOM   469  C  CA  . ASP A 1 88  ? 26.319  -12.952 -3.163 1.00 17.25 ? 80  ASP A CA  1 
ATOM   470  C  C   . ASP A 1 88  ? 25.206  -13.742 -3.854 1.00 17.32 ? 80  ASP A C   1 
ATOM   471  O  O   . ASP A 1 88  ? 25.173  -14.948 -3.758 1.00 17.39 ? 80  ASP A O   1 
ATOM   472  C  CB  . ASP A 1 88  ? 27.641  -13.115 -3.907 1.00 17.26 ? 80  ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 88  ? 28.570  -11.946 -3.666 1.00 17.16 ? 80  ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 88  ? 28.351  -11.194 -2.676 1.00 16.06 ? 80  ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 88  ? 29.510  -11.770 -4.462 1.00 17.03 ? 80  ASP A OD2 1 
ATOM   476  N  N   . GLY A 1 89  ? 24.284  -13.040 -4.508 1.00 17.57 ? 81  GLY A N   1 
ATOM   477  C  CA  . GLY A 1 89  ? 23.154  -13.684 -5.187 1.00 18.35 ? 81  GLY A CA  1 
ATOM   478  C  C   . GLY A 1 89  ? 21.927  -13.793 -4.310 1.00 18.53 ? 81  GLY A C   1 
ATOM   479  O  O   . GLY A 1 89  ? 20.857  -14.053 -4.805 1.00 19.55 ? 81  GLY A O   1 
ATOM   480  N  N   . LYS A 1 90  ? 22.082  -13.585 -2.997 1.00 18.70 ? 82  LYS A N   1 
ATOM   481  C  CA  . LYS A 1 90  ? 20.958  -13.603 -2.048 1.00 17.73 ? 82  LYS A CA  1 
ATOM   482  C  C   . LYS A 1 90  ? 20.199  -12.287 -2.002 1.00 15.87 ? 82  LYS A C   1 
ATOM   483  O  O   . LYS A 1 90  ? 20.786  -11.201 -2.171 1.00 14.86 ? 82  LYS A O   1 
ATOM   484  C  CB  . LYS A 1 90  ? 21.480  -13.903 -0.652 1.00 19.04 ? 82  LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 90  ? 22.027  -15.313 -0.538 1.00 20.35 ? 82  LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 90  ? 20.951  -16.197 0.031  1.00 21.90 ? 82  LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 90  ? 20.956  -17.569 -0.590 1.00 23.90 ? 82  LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 90  ? 22.234  -18.220 -0.251 1.00 24.87 ? 82  LYS A NZ  1 
ATOM   489  N  N   . SER A 1 91  ? 18.895  -12.377 -1.771 1.00 14.64 ? 83  SER A N   1 
ATOM   490  C  CA  . SER A 1 91  ? 18.096  -11.178 -1.487 1.00 13.98 ? 83  SER A CA  1 
ATOM   491  C  C   . SER A 1 91  ? 18.494  -10.640 -0.111 1.00 13.09 ? 83  SER A C   1 
ATOM   492  O  O   . SER A 1 91  ? 18.950  -11.404 0.783  1.00 12.50 ? 83  SER A O   1 
ATOM   493  C  CB  . SER A 1 91  ? 16.607  -11.485 -1.500 1.00 13.80 ? 83  SER A CB  1 
ATOM   494  O  OG  . SER A 1 91  ? 16.278  -12.261 -0.355 1.00 13.72 ? 83  SER A OG  1 
ATOM   495  N  N   . ILE A 1 92  ? 18.283  -9.349  0.071  1.00 12.09 ? 84  ILE A N   1 
ATOM   496  C  CA  . ILE A 1 92  ? 18.580  -8.734  1.358  1.00 11.93 ? 84  ILE A CA  1 
ATOM   497  C  C   . ILE A 1 92  ? 17.744  -9.405  2.455  1.00 12.11 ? 84  ILE A C   1 
ATOM   498  O  O   . ILE A 1 92  ? 18.226  -9.651  3.583  1.00 11.40 ? 84  ILE A O   1 
ATOM   499  C  CB  . ILE A 1 92  ? 18.324  -7.220  1.337  1.00 11.41 ? 84  ILE A CB  1 
ATOM   500  C  CG1 . ILE A 1 92  ? 19.209  -6.541  0.274  1.00 11.51 ? 84  ILE A CG1 1 
ATOM   501  C  CG2 . ILE A 1 92  ? 18.513  -6.602  2.732  1.00 11.05 ? 84  ILE A CG2 1 
ATOM   502  C  CD1 . ILE A 1 92  ? 20.702  -6.741  0.400  1.00 11.60 ? 84  ILE A CD1 1 
ATOM   503  N  N   . GLU A 1 93  ? 16.494  -9.726  2.116  1.00 12.56 ? 85  GLU A N   1 
ATOM   504  C  CA  . GLU A 1 93  ? 15.624  -10.424 3.063  1.00 12.70 ? 85  GLU A CA  1 
ATOM   505  C  C   . GLU A 1 93  ? 16.136  -11.789 3.467  1.00 12.88 ? 85  GLU A C   1 
ATOM   506  O  O   . GLU A 1 93  ? 16.001  -12.168 4.637  1.00 12.14 ? 85  GLU A O   1 
ATOM   507  C  CB  . GLU A 1 93  ? 14.201  -10.526 2.548  1.00 12.96 ? 85  GLU A CB  1 
ATOM   508  C  CG  . GLU A 1 93  ? 13.523  -9.175  2.558  1.00 13.09 ? 85  GLU A CG  1 
ATOM   509  C  CD  . GLU A 1 93  ? 12.319  -9.132  1.657  1.00 13.42 ? 85  GLU A CD  1 
ATOM   510  O  OE1 . GLU A 1 93  ? 11.256  -9.568  2.122  1.00 14.27 ? 85  GLU A OE1 1 
ATOM   511  O  OE2 . GLU A 1 93  ? 12.424  -8.697  0.481  1.00 13.69 ? 85  GLU A OE2 1 
ATOM   512  N  N   . GLU A 1 94  ? 16.712  -12.515 2.514  1.00 13.45 ? 86  GLU A N   1 
ATOM   513  C  CA  . GLU A 1 94  ? 17.290  -13.816 2.805  1.00 13.94 ? 86  GLU A CA  1 
ATOM   514  C  C   . GLU A 1 94  ? 18.448  -13.652 3.775  1.00 13.48 ? 86  GLU A C   1 
ATOM   515  O  O   . GLU A 1 94  ? 18.614  -14.461 4.683  1.00 14.27 ? 86  GLU A O   1 
ATOM   516  C  CB  . GLU A 1 94  ? 17.768  -14.536 1.526  1.00 15.21 ? 86  GLU A CB  1 
ATOM   517  C  CG  . GLU A 1 94  ? 16.642  -15.143 0.688  1.00 16.31 ? 86  GLU A CG  1 
ATOM   518  C  CD  . GLU A 1 94  ? 17.073  -15.652 -0.709 1.00 17.32 ? 86  GLU A CD  1 
ATOM   519  O  OE1 . GLU A 1 94  ? 16.739  -16.773 -1.045 1.00 21.13 ? 86  GLU A OE1 1 
ATOM   520  O  OE2 . GLU A 1 94  ? 17.734  -14.987 -1.493 1.00 17.22 ? 86  GLU A OE2 1 
ATOM   521  N  N   . ILE A 1 95  ? 19.257  -12.614 3.598  1.00 12.43 ? 87  ILE A N   1 
ATOM   522  C  CA  . ILE A 1 95  ? 20.368  -12.354 4.528  1.00 12.03 ? 87  ILE A CA  1 
ATOM   523  C  C   . ILE A 1 95  ? 19.846  -12.098 5.932  1.00 11.51 ? 87  ILE A C   1 
ATOM   524  O  O   . ILE A 1 95  ? 20.328  -12.654 6.899  1.00 11.15 ? 87  ILE A O   1 
ATOM   525  C  CB  . ILE A 1 95  ? 21.225  -11.157 4.055  1.00 11.72 ? 87  ILE A CB  1 
ATOM   526  C  CG1 . ILE A 1 95  ? 21.886  -11.510 2.731  1.00 12.09 ? 87  ILE A CG1 1 
ATOM   527  C  CG2 . ILE A 1 95  ? 22.308  -10.790 5.055  1.00 11.44 ? 87  ILE A CG2 1 
ATOM   528  C  CD1 . ILE A 1 95  ? 22.460  -10.295 2.029  1.00 12.24 ? 87  ILE A CD1 1 
ATOM   529  N  N   . ILE A 1 96  ? 18.888  -11.191 6.023  1.00 11.53 ? 88  ILE A N   1 
ATOM   530  C  CA  . ILE A 1 96  ? 18.300  -10.794 7.287  1.00 11.50 ? 88  ILE A CA  1 
ATOM   531  C  C   . ILE A 1 96  ? 17.839  -12.021 8.073  1.00 12.27 ? 88  ILE A C   1 
ATOM   532  O  O   . ILE A 1 96  ? 18.192  -12.179 9.231  1.00 11.80 ? 88  ILE A O   1 
ATOM   533  C  CB  . ILE A 1 96  ? 17.119  -9.858  7.081  1.00 11.12 ? 88  ILE A CB  1 
ATOM   534  C  CG1 . ILE A 1 96  ? 17.619  -8.505  6.584  1.00 11.00 ? 88  ILE A CG1 1 
ATOM   535  C  CG2 . ILE A 1 96  ? 16.354  -9.654  8.384  1.00 11.03 ? 88  ILE A CG2 1 
ATOM   536  C  CD1 . ILE A 1 96  ? 16.534  -7.689  5.893  1.00 10.96 ? 88  ILE A CD1 1 
ATOM   537  N  N   . LEU A 1 97  ? 17.088  -12.883 7.413  1.00 13.17 ? 89  LEU A N   1 
ATOM   538  C  CA  . LEU A 1 97  ? 16.621  -14.129 8.019  1.00 14.91 ? 89  LEU A CA  1 
ATOM   539  C  C   . LEU A 1 97  ? 17.761  -15.078 8.381  1.00 14.58 ? 89  LEU A C   1 
ATOM   540  O  O   . LEU A 1 97  ? 17.816  -15.585 9.491  1.00 14.75 ? 89  LEU A O   1 
ATOM   541  C  CB  . LEU A 1 97  ? 15.636  -14.831 7.071  1.00 16.50 ? 89  LEU A CB  1 
ATOM   542  C  CG  . LEU A 1 97  ? 14.850  -15.958 7.701  1.00 18.42 ? 89  LEU A CG  1 
ATOM   543  C  CD1 . LEU A 1 97  ? 13.711  -15.377 8.547  1.00 19.15 ? 89  LEU A CD1 1 
ATOM   544  C  CD2 . LEU A 1 97  ? 14.336  -16.928 6.641  1.00 19.41 ? 89  LEU A CD2 1 
ATOM   545  N  N   . ALA A 1 98  ? 18.676  -15.297 7.452  1.00 14.30 ? 90  ALA A N   1 
ATOM   546  C  CA  . ALA A 1 98  ? 19.826  -16.121 7.733  1.00 14.91 ? 90  ALA A CA  1 
ATOM   547  C  C   . ALA A 1 98  ? 20.583  -15.663 8.979  1.00 15.27 ? 90  ALA A C   1 
ATOM   548  O  O   . ALA A 1 98  ? 21.028  -16.488 9.761  1.00 16.31 ? 90  ALA A O   1 
ATOM   549  C  CB  . ALA A 1 98  ? 20.757  -16.187 6.533  1.00 14.92 ? 90  ALA A CB  1 
ATOM   550  N  N   . VAL A 1 99  ? 20.685  -14.368 9.242  1.00 15.29 ? 91  VAL A N   1 
ATOM   551  C  CA  . VAL A 1 99  ? 21.501  -13.945 10.404 1.00 15.05 ? 91  VAL A CA  1 
ATOM   552  C  C   . VAL A 1 99  ? 20.741  -13.388 11.598 1.00 15.30 ? 91  VAL A C   1 
ATOM   553  O  O   . VAL A 1 99  ? 21.350  -12.875 12.551 1.00 15.88 ? 91  VAL A O   1 
ATOM   554  C  CB  . VAL A 1 99  ? 22.612  -12.971 9.985  1.00 14.71 ? 91  VAL A CB  1 
ATOM   555  C  CG1 . VAL A 1 99  ? 23.524  -13.610 8.956  1.00 14.65 ? 91  VAL A CG1 1 
ATOM   556  C  CG2 . VAL A 1 99  ? 22.038  -11.671 9.476  1.00 14.26 ? 91  VAL A CG2 1 
ATOM   557  N  N   . ALA A 1 100 ? 19.418  -13.515 11.582 1.00 15.72 ? 92  ALA A N   1 
ATOM   558  C  CA  . ALA A 1 100 ? 18.566  -12.885 12.607 1.00 15.71 ? 92  ALA A CA  1 
ATOM   559  C  C   . ALA A 1 100 ? 18.874  -13.291 14.055 1.00 16.63 ? 92  ALA A C   1 
ATOM   560  O  O   . ALA A 1 100 ? 18.753  -12.480 14.977 1.00 17.47 ? 92  ALA A O   1 
ATOM   561  C  CB  . ALA A 1 100 ? 17.121  -13.172 12.319 1.00 15.69 ? 92  ALA A CB  1 
ATOM   562  N  N   . ASN A 1 101 ? 19.278  -14.513 14.281 1.00 15.62 ? 93  ASN A N   1 
ATOM   563  C  CA  . ASN A 1 101 ? 19.552  -14.871 15.662 1.00 15.91 ? 93  ASN A CA  1 
ATOM   564  C  C   . ASN A 1 101 ? 20.972  -15.363 15.810 1.00 15.99 ? 93  ASN A C   1 
ATOM   565  O  O   . ASN A 1 101 ? 21.233  -16.265 16.592 1.00 16.57 ? 93  ASN A O   1 
ATOM   566  C  CB  . ASN A 1 101 ? 18.553  -15.931 16.117 1.00 16.17 ? 93  ASN A CB  1 
ATOM   567  C  CG  . ASN A 1 101 ? 17.142  -15.388 16.110 1.00 16.05 ? 93  ASN A CG  1 
ATOM   568  O  OD1 . ASN A 1 101 ? 16.778  -14.595 16.964 1.00 15.79 ? 93  ASN A OD1 1 
ATOM   569  N  ND2 . ASN A 1 101 ? 16.380  -15.719 15.063 1.00 15.95 ? 93  ASN A ND2 1 
ATOM   570  N  N   . ASP A 1 102 ? 21.877  -14.741 15.066 1.00 15.01 ? 94  ASP A N   1 
ATOM   571  C  CA  . ASP A 1 102 ? 23.239  -15.141 15.040 1.00 14.90 ? 94  ASP A CA  1 
ATOM   572  C  C   . ASP A 1 102 ? 24.051  -14.005 15.670 1.00 14.12 ? 94  ASP A C   1 
ATOM   573  O  O   . ASP A 1 102 ? 24.349  -13.012 14.996 1.00 13.17 ? 94  ASP A O   1 
ATOM   574  C  CB  . ASP A 1 102 ? 23.672  -15.420 13.596 1.00 15.21 ? 94  ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 102 ? 25.124  -15.825 13.486 1.00 15.44 ? 94  ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 102 ? 25.879  -15.698 14.470 1.00 15.69 ? 94  ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 102 ? 25.529  -16.240 12.386 1.00 16.30 ? 94  ASP A OD2 1 
ATOM   578  N  N   . ALA A 1 103 ? 24.419  -14.189 16.945 1.00 13.29 ? 95  ALA A N   1 
ATOM   579  C  CA  . ALA A 1 103 ? 25.195  -13.227 17.691 1.00 13.02 ? 95  ALA A CA  1 
ATOM   580  C  C   . ALA A 1 103 ? 26.581  -13.008 17.116 1.00 13.07 ? 95  ALA A C   1 
ATOM   581  O  O   . ALA A 1 103 ? 27.187  -12.012 17.385 1.00 13.25 ? 95  ALA A O   1 
ATOM   582  C  CB  . ALA A 1 103 ? 25.306  -13.633 19.157 1.00 13.23 ? 95  ALA A CB  1 
ATOM   583  N  N   . GLU A 1 104 ? 27.109  -13.935 16.337 1.00 13.59 ? 96  GLU A N   1 
ATOM   584  C  CA  . GLU A 1 104 ? 28.376  -13.667 15.620 1.00 13.98 ? 96  GLU A CA  1 
ATOM   585  C  C   . GLU A 1 104 ? 28.239  -12.597 14.519 1.00 13.51 ? 96  GLU A C   1 
ATOM   586  O  O   . GLU A 1 104 ? 29.210  -12.087 14.064 1.00 13.25 ? 96  GLU A O   1 
ATOM   587  C  CB  . GLU A 1 104 ? 28.934  -14.958 14.998 1.00 14.38 ? 96  GLU A CB  1 
ATOM   588  C  CG  . GLU A 1 104 ? 29.021  -16.178 15.955 1.00 14.84 ? 96  GLU A CG  1 
ATOM   589  C  CD  . GLU A 1 104 ? 29.840  -15.895 17.207 1.00 14.94 ? 96  GLU A CD  1 
ATOM   590  O  OE1 . GLU A 1 104 ? 30.845  -15.189 17.082 1.00 14.85 ? 96  GLU A OE1 1 
ATOM   591  O  OE2 . GLU A 1 104 ? 29.482  -16.372 18.309 1.00 15.36 ? 96  GLU A OE2 1 
ATOM   592  N  N   . LYS A 1 105 ? 27.022  -12.285 14.095 1.00 14.05 ? 97  LYS A N   1 
ATOM   593  C  CA  . LYS A 1 105 ? 26.774  -11.446 12.923 1.00 14.09 ? 97  LYS A CA  1 
ATOM   594  C  C   . LYS A 1 105 ? 25.705  -10.388 13.185 1.00 13.69 ? 97  LYS A C   1 
ATOM   595  O  O   . LYS A 1 105 ? 24.964  -9.982  12.274 1.00 12.82 ? 97  LYS A O   1 
ATOM   596  C  CB  . LYS A 1 105 ? 26.322  -12.350 11.762 1.00 14.42 ? 97  LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 105 ? 27.440  -13.126 11.076 1.00 15.40 ? 97  LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 105 ? 26.840  -14.158 10.126 1.00 16.77 ? 97  LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 105 ? 27.793  -15.333 9.853  1.00 18.12 ? 97  LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 105 ? 27.823  -16.353 10.968 1.00 19.08 ? 97  LYS A NZ  1 
ATOM   601  N  N   . LYS A 1 106 ? 25.619  -9.920  14.419 1.00 13.94 ? 98  LYS A N   1 
ATOM   602  C  CA  . LYS A 1 106 ? 24.645  -8.879  14.754 1.00 14.55 ? 98  LYS A CA  1 
ATOM   603  C  C   . LYS A 1 106 ? 24.887  -7.617  13.920 1.00 13.48 ? 98  LYS A C   1 
ATOM   604  O  O   . LYS A 1 106 ? 23.927  -6.992  13.413 1.00 12.76 ? 98  LYS A O   1 
ATOM   605  C  CB  . LYS A 1 106 ? 24.687  -8.546  16.246 1.00 16.43 ? 98  LYS A CB  1 
ATOM   606  C  CG  . LYS A 1 106 ? 23.489  -7.708  16.701 1.00 18.63 ? 98  LYS A CG  1 
ATOM   607  C  CD  . LYS A 1 106 ? 22.161  -8.442  16.425 1.00 19.96 ? 98  LYS A CD  1 
ATOM   608  C  CE  . LYS A 1 106 ? 20.968  -7.749  17.041 1.00 20.99 ? 98  LYS A CE  1 
ATOM   609  N  NZ  . LYS A 1 106 ? 20.832  -6.384  16.459 1.00 22.37 ? 98  LYS A NZ  1 
ATOM   610  N  N   . GLY A 1 107 ? 26.166  -7.268  13.752 1.00 12.98 ? 99  GLY A N   1 
ATOM   611  C  CA  . GLY A 1 107 ? 26.576  -6.099  12.949 1.00 12.76 ? 99  GLY A CA  1 
ATOM   612  C  C   . GLY A 1 107 ? 26.020  -6.185  11.537 1.00 12.54 ? 99  GLY A C   1 
ATOM   613  O  O   . GLY A 1 107 ? 25.378  -5.237  11.037 1.00 12.14 ? 99  GLY A O   1 
ATOM   614  N  N   . LEU A 1 108 ? 26.244  -7.334  10.895 1.00 12.48 ? 100 LEU A N   1 
ATOM   615  C  CA  . LEU A 1 108 ? 25.695  -7.578  9.575  1.00 12.51 ? 100 LEU A CA  1 
ATOM   616  C  C   . LEU A 1 108 ? 24.151  -7.554  9.562  1.00 12.25 ? 100 LEU A C   1 
ATOM   617  O  O   . LEU A 1 108 ? 23.546  -6.971  8.664  1.00 12.80 ? 100 LEU A O   1 
ATOM   618  C  CB  . LEU A 1 108 ? 26.217  -8.913  9.027  1.00 13.22 ? 100 LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 108 ? 25.642  -9.345  7.681  1.00 13.80 ? 100 LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 108 ? 25.951  -8.335  6.583  1.00 14.21 ? 100 LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 108 ? 26.182  -10.705 7.272  1.00 14.39 ? 100 LEU A CD2 1 
ATOM   622  N  N   . PHE A 1 109 ? 23.497  -8.194  10.525 1.00 11.96 ? 101 PHE A N   1 
ATOM   623  C  CA  . PHE A 1 109 ? 22.026  -8.109  10.648 1.00 11.47 ? 101 PHE A CA  1 
ATOM   624  C  C   . PHE A 1 109 ? 21.579  -6.656  10.685 1.00 10.85 ? 101 PHE A C   1 
ATOM   625  O  O   . PHE A 1 109 ? 20.663  -6.274  9.965  1.00 10.51 ? 101 PHE A O   1 
ATOM   626  C  CB  . PHE A 1 109 ? 21.509  -8.818  11.912 1.00 11.55 ? 101 PHE A CB  1 
ATOM   627  C  CG  . PHE A 1 109 ? 20.052  -8.632  12.150 1.00 11.68 ? 101 PHE A CG  1 
ATOM   628  C  CD1 . PHE A 1 109 ? 19.121  -9.461  11.534 1.00 12.12 ? 101 PHE A CD1 1 
ATOM   629  C  CD2 . PHE A 1 109 ? 19.602  -7.647  12.976 1.00 11.94 ? 101 PHE A CD2 1 
ATOM   630  C  CE1 . PHE A 1 109 ? 17.770  -9.293  11.739 1.00 12.12 ? 101 PHE A CE1 1 
ATOM   631  C  CE2 . PHE A 1 109 ? 18.241  -7.468  13.205 1.00 12.26 ? 101 PHE A CE2 1 
ATOM   632  C  CZ  . PHE A 1 109 ? 17.318  -8.288  12.578 1.00 12.18 ? 101 PHE A CZ  1 
ATOM   633  N  N   . ASN A 1 110 ? 22.191  -5.854  11.551 1.00 10.53 ? 102 ASN A N   1 
ATOM   634  C  CA  . ASN A 1 110 ? 21.762  -4.453  11.711 1.00 10.23 ? 102 ASN A CA  1 
ATOM   635  C  C   . ASN A 1 110 ? 21.789  -3.671  10.377 1.00 9.99  ? 102 ASN A C   1 
ATOM   636  O  O   . ASN A 1 110 ? 20.830  -2.980  10.079 1.00 9.47  ? 102 ASN A O   1 
ATOM   637  C  CB  . ASN A 1 110 ? 22.625  -3.740  12.750 1.00 10.30 ? 102 ASN A CB  1 
ATOM   638  C  CG  . ASN A 1 110 ? 22.277  -4.137  14.170 1.00 10.37 ? 102 ASN A CG  1 
ATOM   639  O  OD1 . ASN A 1 110 ? 21.240  -4.720  14.413 1.00 10.67 ? 102 ASN A OD1 1 
ATOM   640  N  ND2 . ASN A 1 110 ? 23.148  -3.815  15.110 1.00 10.32 ? 102 ASN A ND2 1 
ATOM   641  N  N   . GLN A 1 111 ? 22.860  -3.823  9.586  1.00 9.97  ? 103 GLN A N   1 
ATOM   642  C  CA  . GLN A 1 111 ? 22.994  -3.093  8.336  1.00 10.10 ? 103 GLN A CA  1 
ATOM   643  C  C   . GLN A 1 111 ? 22.002  -3.627  7.284  1.00 10.04 ? 103 GLN A C   1 
ATOM   644  O  O   . GLN A 1 111 ? 21.343  -2.855  6.611  1.00 9.96  ? 103 GLN A O   1 
ATOM   645  C  CB  . GLN A 1 111 ? 24.423  -3.161  7.759  1.00 10.53 ? 103 GLN A CB  1 
ATOM   646  C  CG  . GLN A 1 111 ? 25.576  -2.859  8.738  1.00 11.13 ? 103 GLN A CG  1 
ATOM   647  C  CD  . GLN A 1 111 ? 25.401  -1.542  9.417  1.00 11.11 ? 103 GLN A CD  1 
ATOM   648  O  OE1 . GLN A 1 111 ? 25.215  -0.527  8.756  1.00 12.16 ? 103 GLN A OE1 1 
ATOM   649  N  NE2 . GLN A 1 111 ? 25.396  -1.542  10.723 1.00 11.26 ? 103 GLN A NE2 1 
ATOM   650  N  N   . ALA A 1 112 ? 21.895  -4.949  7.179  1.00 9.55  ? 104 ALA A N   1 
ATOM   651  C  CA  . ALA A 1 112 ? 21.045  -5.557  6.211  1.00 9.24  ? 104 ALA A CA  1 
ATOM   652  C  C   . ALA A 1 112 ? 19.586  -5.233  6.522  1.00 8.90  ? 104 ALA A C   1 
ATOM   653  O  O   . ALA A 1 112 ? 18.829  -4.836  5.634  1.00 8.80  ? 104 ALA A O   1 
ATOM   654  C  CB  . ALA A 1 112 ? 21.263  -7.063  6.197  1.00 9.51  ? 104 ALA A CB  1 
ATOM   655  N  N   . ALA A 1 113 ? 19.190  -5.377  7.785  1.00 8.46  ? 105 ALA A N   1 
ATOM   656  C  CA  . ALA A 1 113 ? 17.819  -5.054  8.164  1.00 8.24  ? 105 ALA A CA  1 
ATOM   657  C  C   . ALA A 1 113 ? 17.519  -3.562  7.977  1.00 8.08  ? 105 ALA A C   1 
ATOM   658  O  O   . ALA A 1 113 ? 16.474  -3.197  7.423  1.00 7.71  ? 105 ALA A O   1 
ATOM   659  C  CB  . ALA A 1 113 ? 17.528  -5.498  9.583  1.00 8.18  ? 105 ALA A CB  1 
ATOM   660  N  N   . GLN A 1 114 ? 18.434  -2.698  8.397  1.00 8.07  ? 106 GLN A N   1 
ATOM   661  C  CA  . GLN A 1 114 ? 18.232  -1.232  8.167  1.00 8.11  ? 106 GLN A CA  1 
ATOM   662  C  C   . GLN A 1 114 ? 18.153  -0.861  6.638  1.00 8.08  ? 106 GLN A C   1 
ATOM   663  O  O   . GLN A 1 114 ? 17.386  0.010   6.239  1.00 7.97  ? 106 GLN A O   1 
ATOM   664  C  CB  . GLN A 1 114 ? 19.299  -0.424  8.917  1.00 8.15  ? 106 GLN A CB  1 
ATOM   665  C  CG  . GLN A 1 114 ? 19.052  -0.364  10.445 1.00 8.29  ? 106 GLN A CG  1 
ATOM   666  C  CD  . GLN A 1 114 ? 17.790  0.398   10.838 1.00 8.38  ? 106 GLN A CD  1 
ATOM   667  O  OE1 . GLN A 1 114 ? 16.673  -0.096  10.724 1.00 8.29  ? 106 GLN A OE1 1 
ATOM   668  N  NE2 . GLN A 1 114 ? 17.966  1.623   11.278 1.00 8.81  ? 106 GLN A NE2 1 
ATOM   669  N  N   . HIS A 1 115 ? 18.937  -1.525  5.805  1.00 8.10  ? 107 HIS A N   1 
ATOM   670  C  CA  . HIS A 1 115 ? 18.900  -1.315  4.349  1.00 8.22  ? 107 HIS A CA  1 
ATOM   671  C  C   . HIS A 1 115 ? 17.500  -1.611  3.812  1.00 8.25  ? 107 HIS A C   1 
ATOM   672  O  O   . HIS A 1 115 ? 16.883  -0.768  3.129  1.00 7.92  ? 107 HIS A O   1 
ATOM   673  C  CB  . HIS A 1 115 ? 19.963  -2.185  3.680  1.00 8.33  ? 107 HIS A CB  1 
ATOM   674  C  CG  . HIS A 1 115 ? 19.923  -2.177  2.182  1.00 8.60  ? 107 HIS A CG  1 
ATOM   675  N  ND1 . HIS A 1 115 ? 19.538  -1.087  1.437  1.00 8.71  ? 107 HIS A ND1 1 
ATOM   676  C  CD2 . HIS A 1 115 ? 20.255  -3.142  1.288  1.00 8.85  ? 107 HIS A CD2 1 
ATOM   677  C  CE1 . HIS A 1 115 ? 19.642  -1.371  0.150  1.00 9.03  ? 107 HIS A CE1 1 
ATOM   678  N  NE2 . HIS A 1 115 ? 20.065  -2.620  0.033  1.00 9.04  ? 107 HIS A NE2 1 
ATOM   679  N  N   . PHE A 1 116 ? 16.985  -2.788  4.182  1.00 8.46  ? 108 PHE A N   1 
ATOM   680  C  CA  . PHE A 1 116 ? 15.622  -3.165  3.834  1.00 8.60  ? 108 PHE A CA  1 
ATOM   681  C  C   . PHE A 1 116 ? 14.620  -2.179  4.391  1.00 8.28  ? 108 PHE A C   1 
ATOM   682  O  O   . PHE A 1 116 ? 13.784  -1.676  3.662  1.00 8.03  ? 108 PHE A O   1 
ATOM   683  C  CB  . PHE A 1 116 ? 15.267  -4.542  4.348  1.00 8.97  ? 108 PHE A CB  1 
ATOM   684  C  CG  . PHE A 1 116 ? 13.808  -4.885  4.149  1.00 9.37  ? 108 PHE A CG  1 
ATOM   685  C  CD1 . PHE A 1 116 ? 13.369  -5.472  2.970  1.00 9.71  ? 108 PHE A CD1 1 
ATOM   686  C  CD2 . PHE A 1 116 ? 12.884  -4.612  5.134  1.00 9.50  ? 108 PHE A CD2 1 
ATOM   687  C  CE1 . PHE A 1 116 ? 12.032  -5.778  2.772  1.00 10.00 ? 108 PHE A CE1 1 
ATOM   688  C  CE2 . PHE A 1 116 ? 11.534  -4.926  4.943  1.00 9.79  ? 108 PHE A CE2 1 
ATOM   689  C  CZ  . PHE A 1 116 ? 11.108  -5.502  3.753  1.00 9.78  ? 108 PHE A CZ  1 
ATOM   690  N  N   . ASN A 1 117 ? 14.710  -1.914  5.696  1.00 8.21  ? 109 ASN A N   1 
ATOM   691  C  CA  . ASN A 1 117 ? 13.754  -1.016  6.364  1.00 7.85  ? 109 ASN A CA  1 
ATOM   692  C  C   . ASN A 1 117 ? 13.668  0.349   5.671  1.00 7.86  ? 109 ASN A C   1 
ATOM   693  O  O   . ASN A 1 117 ? 12.570  0.852   5.408  1.00 7.62  ? 109 ASN A O   1 
ATOM   694  C  CB  . ASN A 1 117 ? 14.120  -0.839  7.823  1.00 7.77  ? 109 ASN A CB  1 
ATOM   695  C  CG  . ASN A 1 117 ? 13.984  -2.126  8.634  1.00 7.77  ? 109 ASN A CG  1 
ATOM   696  O  OD1 . ASN A 1 117 ? 13.311  -3.068  8.220  1.00 7.65  ? 109 ASN A OD1 1 
ATOM   697  N  ND2 . ASN A 1 117 ? 14.514  -2.110  9.843  1.00 7.61  ? 109 ASN A ND2 1 
ATOM   698  N  N   . HIS A 1 118 ? 14.829  0.910   5.339  1.00 7.78  ? 110 HIS A N   1 
ATOM   699  C  CA  . HIS A 1 118 ? 14.882  2.205   4.722  1.00 8.02  ? 110 HIS A CA  1 
ATOM   700  C  C   . HIS A 1 118 ? 14.364  2.171   3.282  1.00 8.35  ? 110 HIS A C   1 
ATOM   701  O  O   . HIS A 1 118 ? 13.665  3.086   2.844  1.00 8.25  ? 110 HIS A O   1 
ATOM   702  C  CB  . HIS A 1 118 ? 16.323  2.782   4.780  1.00 8.03  ? 110 HIS A CB  1 
ATOM   703  C  CG  . HIS A 1 118 ? 16.675  3.359   6.105  1.00 8.01  ? 110 HIS A CG  1 
ATOM   704  N  ND1 . HIS A 1 118 ? 17.197  2.602   7.121  1.00 7.96  ? 110 HIS A ND1 1 
ATOM   705  C  CD2 . HIS A 1 118 ? 16.501  4.603   6.610  1.00 8.02  ? 110 HIS A CD2 1 
ATOM   706  C  CE1 . HIS A 1 118 ? 17.364  3.357   8.187  1.00 8.07  ? 110 HIS A CE1 1 
ATOM   707  N  NE2 . HIS A 1 118 ? 16.956  4.576   7.899  1.00 8.07  ? 110 HIS A NE2 1 
ATOM   708  N  N   . THR A 1 119 ? 14.733  1.137   2.540  1.00 8.84  ? 111 THR A N   1 
ATOM   709  C  CA  . THR A 1 119 ? 14.306  1.010   1.144  1.00 9.19  ? 111 THR A CA  1 
ATOM   710  C  C   . THR A 1 119 ? 12.776  0.958   1.124  1.00 9.40  ? 111 THR A C   1 
ATOM   711  O  O   . THR A 1 119 ? 12.133  1.655   0.331  1.00 9.27  ? 111 THR A O   1 
ATOM   712  C  CB  . THR A 1 119 ? 14.860  -0.261  0.502  1.00 9.40  ? 111 THR A CB  1 
ATOM   713  O  OG1 . THR A 1 119 ? 16.292  -0.194  0.476  1.00 9.35  ? 111 THR A OG1 1 
ATOM   714  C  CG2 . THR A 1 119 ? 14.329  -0.437  -0.972 1.00 9.74  ? 111 THR A CG2 1 
ATOM   715  N  N   . PHE A 1 120 ? 12.216  0.179   2.044  1.00 9.45  ? 112 PHE A N   1 
ATOM   716  C  CA  . PHE A 1 120 ? 10.790  0.014   2.146  1.00 9.60  ? 112 PHE A CA  1 
ATOM   717  C  C   . PHE A 1 120 ? 10.099  1.326   2.538  1.00 9.82  ? 112 PHE A C   1 
ATOM   718  O  O   . PHE A 1 120 ? 9.118   1.729   1.875  1.00 9.64  ? 112 PHE A O   1 
ATOM   719  C  CB  . PHE A 1 120 ? 10.436  -1.090  3.155  1.00 9.48  ? 112 PHE A CB  1 
ATOM   720  C  CG  . PHE A 1 120 ? 8.994   -1.554  3.062  1.00 9.66  ? 112 PHE A CG  1 
ATOM   721  C  CD1 . PHE A 1 120 ? 8.624   -2.516  2.151  1.00 9.93  ? 112 PHE A CD1 1 
ATOM   722  C  CD2 . PHE A 1 120 ? 8.013   -1.013  3.885  1.00 9.78  ? 112 PHE A CD2 1 
ATOM   723  C  CE1 . PHE A 1 120 ? 7.314   -2.944  2.057  1.00 10.21 ? 112 PHE A CE1 1 
ATOM   724  C  CE2 . PHE A 1 120 ? 6.691   -1.431  3.797  1.00 9.99  ? 112 PHE A CE2 1 
ATOM   725  C  CZ  . PHE A 1 120 ? 6.339   -2.412  2.889  1.00 10.17 ? 112 PHE A CZ  1 
ATOM   726  N  N   . TYR A 1 121 ? 10.606  1.949   3.614  1.00 9.64  ? 113 TYR A N   1 
ATOM   727  C  CA  . TYR A 1 121 ? 10.122  3.221   4.089  1.00 9.81  ? 113 TYR A CA  1 
ATOM   728  C  C   . TYR A 1 121 ? 10.107  4.284   2.960  1.00 10.32 ? 113 TYR A C   1 
ATOM   729  O  O   . TYR A 1 121 ? 9.106   4.924   2.735  1.00 10.34 ? 113 TYR A O   1 
ATOM   730  C  CB  . TYR A 1 121 ? 10.980  3.678   5.298  1.00 9.72  ? 113 TYR A CB  1 
ATOM   731  C  CG  . TYR A 1 121 ? 10.762  5.115   5.776  1.00 9.84  ? 113 TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1 121 ? 9.611   5.470   6.478  1.00 9.80  ? 113 TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1 121 ? 11.709  6.120   5.520  1.00 9.91  ? 113 TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1 121 ? 9.401   6.776   6.905  1.00 9.80  ? 113 TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1 121 ? 11.507  7.427   5.960  1.00 9.97  ? 113 TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1 121 ? 10.344  7.744   6.668  1.00 9.98  ? 113 TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1 121 ? 10.119  9.033   7.118  1.00 9.87  ? 113 TYR A OH  1 
ATOM   738  N  N   . PHE A 1 122 ? 11.217  4.486   2.273  1.00 10.82 ? 114 PHE A N   1 
ATOM   739  C  CA  . PHE A 1 122 ? 11.264  5.499   1.215  1.00 11.63 ? 114 PHE A CA  1 
ATOM   740  C  C   . PHE A 1 122 ? 10.283  5.234   0.057  1.00 12.56 ? 114 PHE A C   1 
ATOM   741  O  O   . PHE A 1 122 ? 9.822   6.196   -0.601 1.00 12.91 ? 114 PHE A O   1 
ATOM   742  C  CB  . PHE A 1 122 ? 12.678  5.677   0.679  1.00 11.28 ? 114 PHE A CB  1 
ATOM   743  C  CG  . PHE A 1 122 ? 13.615  6.319   1.659  1.00 11.26 ? 114 PHE A CG  1 
ATOM   744  C  CD1 . PHE A 1 122 ? 13.307  7.555   2.245  1.00 11.18 ? 114 PHE A CD1 1 
ATOM   745  C  CD2 . PHE A 1 122 ? 14.832  5.738   1.962  1.00 11.18 ? 114 PHE A CD2 1 
ATOM   746  C  CE1 . PHE A 1 122 ? 14.185  8.153   3.133  1.00 11.11 ? 114 PHE A CE1 1 
ATOM   747  C  CE2 . PHE A 1 122 ? 15.710  6.337   2.862  1.00 11.19 ? 114 PHE A CE2 1 
ATOM   748  C  CZ  . PHE A 1 122 ? 15.388  7.551   3.445  1.00 10.98 ? 114 PHE A CZ  1 
ATOM   749  N  N   . ARG A 1 123 ? 9.919   3.966   -0.159 1.00 13.46 ? 115 ARG A N   1 
ATOM   750  C  CA  . ARG A 1 123 ? 8.835   3.622   -1.118 1.00 14.86 ? 115 ARG A CA  1 
ATOM   751  C  C   . ARG A 1 123 ? 7.431   3.848   -0.573 1.00 13.05 ? 115 ARG A C   1 
ATOM   752  O  O   . ARG A 1 123 ? 6.469   3.849   -1.318 1.00 13.16 ? 115 ARG A O   1 
ATOM   753  C  CB  . ARG A 1 123 ? 8.971   2.177   -1.618 1.00 17.66 ? 115 ARG A CB  1 
ATOM   754  C  CG  . ARG A 1 123 ? 10.009  2.079   -2.721 1.00 21.15 ? 115 ARG A CG  1 
ATOM   755  C  CD  . ARG A 1 123 ? 10.333  0.649   -3.149 1.00 24.93 ? 115 ARG A CD  1 
ATOM   756  N  NE  . ARG A 1 123 ? 11.706  0.593   -3.696 1.00 29.65 ? 115 ARG A NE  1 
ATOM   757  C  CZ  . ARG A 1 123 ? 12.372  -0.515  -4.034 1.00 32.59 ? 115 ARG A CZ  1 
ATOM   758  N  NH1 . ARG A 1 123 ? 11.792  -1.695  -3.945 1.00 36.21 ? 115 ARG A NH1 1 
ATOM   759  N  NH2 . ARG A 1 123 ? 13.628  -0.439  -4.485 1.00 34.48 ? 115 ARG A NH2 1 
ATOM   760  N  N   . CYS A 1 124 ? 7.319   3.974   0.745  1.00 11.85 ? 116 CYS A N   1 
ATOM   761  C  CA  . CYS A 1 124 ? 6.045   4.272   1.375  1.00 10.91 ? 116 CYS A CA  1 
ATOM   762  C  C   . CYS A 1 124 ? 5.737   5.753   1.300  1.00 10.45 ? 116 CYS A C   1 
ATOM   763  O  O   . CYS A 1 124 ? 4.643   6.146   1.719  1.00 10.16 ? 116 CYS A O   1 
ATOM   764  C  CB  . CYS A 1 124 ? 6.027   3.806   2.842  1.00 10.36 ? 116 CYS A CB  1 
ATOM   765  S  SG  . CYS A 1 124 ? 5.942   2.033   2.997  1.00 9.54  ? 116 CYS A SG  1 
ATOM   766  N  N   . ILE A 1 125 ? 6.683   6.576   0.831  1.00 10.29 ? 117 ILE A N   1 
ATOM   767  C  CA  . ILE A 1 125 ? 6.432   8.013   0.711  1.00 10.47 ? 117 ILE A CA  1 
ATOM   768  C  C   . ILE A 1 125 ? 6.684   8.557   -0.708 1.00 10.97 ? 117 ILE A C   1 
ATOM   769  O  O   . ILE A 1 125 ? 7.520   8.039   -1.445 1.00 10.21 ? 117 ILE A O   1 
ATOM   770  C  CB  . ILE A 1 125 ? 7.208   8.859   1.750  1.00 10.30 ? 117 ILE A CB  1 
ATOM   771  C  CG1 . ILE A 1 125 ? 8.718   8.824   1.497  1.00 10.30 ? 117 ILE A CG1 1 
ATOM   772  C  CG2 . ILE A 1 125 ? 6.857   8.420   3.180  1.00 10.00 ? 117 ILE A CG2 1 
ATOM   773  C  CD1 . ILE A 1 125 ? 9.521   9.760   2.384  1.00 10.18 ? 117 ILE A CD1 1 
ATOM   774  N  N   . THR A 1 126 ? 5.952   9.626   -1.044 1.00 11.37 ? 118 THR A N   1 
ATOM   775  C  CA  . THR A 1 126 ? 6.020   10.249  -2.355 1.00 12.04 ? 118 THR A CA  1 
ATOM   776  C  C   . THR A 1 126 ? 5.449   11.664  -2.242 1.00 12.34 ? 118 THR A C   1 
ATOM   777  O  O   . THR A 1 126 ? 4.492   11.876  -1.492 1.00 12.22 ? 118 THR A O   1 
ATOM   778  C  CB  . THR A 1 126 ? 5.229   9.404   -3.390 1.00 12.29 ? 118 THR A CB  1 
ATOM   779  O  OG1 . THR A 1 126 ? 5.575   9.800   -4.717 1.00 12.63 ? 118 THR A OG1 1 
ATOM   780  C  CG2 . THR A 1 126 ? 3.730   9.571   -3.214 1.00 12.27 ? 118 THR A CG2 1 
ATOM   781  N  N   . PRO A 1 127 ? 6.019   12.642  -2.984 1.00 13.05 ? 119 PRO A N   1 
ATOM   782  C  CA  . PRO A 1 127 ? 5.485   14.015  -2.874 1.00 13.03 ? 119 PRO A CA  1 
ATOM   783  C  C   . PRO A 1 127 ? 3.979   14.053  -3.000 1.00 13.08 ? 119 PRO A C   1 
ATOM   784  O  O   . PRO A 1 127 ? 3.438   13.499  -3.952 1.00 13.29 ? 119 PRO A O   1 
ATOM   785  C  CB  . PRO A 1 127 ? 6.132   14.757  -4.043 1.00 13.40 ? 119 PRO A CB  1 
ATOM   786  C  CG  . PRO A 1 127 ? 7.355   14.007  -4.326 1.00 13.57 ? 119 PRO A CG  1 
ATOM   787  C  CD  . PRO A 1 127 ? 7.073   12.548  -4.012 1.00 13.14 ? 119 PRO A CD  1 
ATOM   788  N  N   . ASN A 1 128 ? 3.308   14.688  -2.037 1.00 13.06 ? 120 ASN A N   1 
ATOM   789  C  CA  . ASN A 1 128 ? 1.839   14.840  -2.055 1.00 13.44 ? 120 ASN A CA  1 
ATOM   790  C  C   . ASN A 1 128 ? 1.018   13.556  -1.929 1.00 13.37 ? 120 ASN A C   1 
ATOM   791  O  O   . ASN A 1 128 ? -0.208  13.594  -2.019 1.00 13.15 ? 120 ASN A O   1 
ATOM   792  C  CB  . ASN A 1 128 ? 1.408   15.643  -3.284 1.00 13.74 ? 120 ASN A CB  1 
ATOM   793  C  CG  . ASN A 1 128 ? 2.034   16.997  -3.261 1.00 13.94 ? 120 ASN A CG  1 
ATOM   794  O  OD1 . ASN A 1 128 ? 1.804   17.756  -2.322 1.00 14.03 ? 120 ASN A OD1 1 
ATOM   795  N  ND2 . ASN A 1 128 ? 2.904   17.269  -4.205 1.00 13.98 ? 120 ASN A ND2 1 
ATOM   796  N  N   . GLY A 1 129 ? 1.686   12.454  -1.635 1.00 13.38 ? 121 GLY A N   1 
ATOM   797  C  CA  . GLY A 1 129 ? 1.012   11.175  -1.448 1.00 13.82 ? 121 GLY A CA  1 
ATOM   798  C  C   . GLY A 1 129 ? 0.291   10.608  -2.665 1.00 14.56 ? 121 GLY A C   1 
ATOM   799  O  O   . GLY A 1 129 ? 0.250   11.207  -3.724 1.00 14.85 ? 121 GLY A O   1 
ATOM   800  N  N   . LYS A 1 130 ? -0.313  9.443   -2.476 1.00 15.87 ? 122 LYS A N   1 
ATOM   801  C  CA  . LYS A 1 130 ? -1.285  8.898   -3.399 1.00 16.68 ? 122 LYS A CA  1 
ATOM   802  C  C   . LYS A 1 130 ? -2.432  8.293   -2.618 1.00 16.15 ? 122 LYS A C   1 
ATOM   803  O  O   . LYS A 1 130 ? -2.205  7.572   -1.648 1.00 16.01 ? 122 LYS A O   1 
ATOM   804  C  CB  . LYS A 1 130 ? -0.635  7.828   -4.250 1.00 18.40 ? 122 LYS A CB  1 
ATOM   805  C  CG  . LYS A 1 130 ? 0.361   8.393   -5.234 1.00 20.52 ? 122 LYS A CG  1 
ATOM   806  C  CD  . LYS A 1 130 ? 0.926   7.288   -6.100 1.00 22.96 ? 122 LYS A CD  1 
ATOM   807  C  CE  . LYS A 1 130 ? 2.181   7.739   -6.832 1.00 25.24 ? 122 LYS A CE  1 
ATOM   808  N  NZ  . LYS A 1 130 ? 1.898   9.042   -7.510 1.00 26.67 ? 122 LYS A NZ  1 
ATOM   809  N  N   . ALA A 1 131 ? -3.658  8.515   -3.090 1.00 16.17 ? 123 ALA A N   1 
ATOM   810  C  CA  . ALA A 1 131 ? -4.874  8.014   -2.443 1.00 16.29 ? 123 ALA A CA  1 
ATOM   811  C  C   . ALA A 1 131 ? -4.918  6.483   -2.279 1.00 16.13 ? 123 ALA A C   1 
ATOM   812  O  O   . ALA A 1 131 ? -4.382  5.718   -3.109 1.00 16.89 ? 123 ALA A O   1 
ATOM   813  C  CB  . ALA A 1 131 ? -6.102  8.477   -3.216 1.00 16.54 ? 123 ALA A CB  1 
ATOM   814  N  N   . MET A 1 132 ? -5.538  6.047   -1.183 1.00 16.29 ? 124 MET A N   1 
ATOM   815  C  CA  . MET A 1 132 ? -5.812  4.629   -0.948 1.00 16.08 ? 124 MET A CA  1 
ATOM   816  C  C   . MET A 1 132 ? -6.663  4.096   -2.054 1.00 16.49 ? 124 MET A C   1 
ATOM   817  O  O   . MET A 1 132 ? -7.746  4.621   -2.268 1.00 16.95 ? 124 MET A O   1 
ATOM   818  C  CB  . MET A 1 132 ? -6.632  4.432   0.331  1.00 15.84 ? 124 MET A CB  1 
ATOM   819  C  CG  . MET A 1 132 ? -5.823  4.390   1.588  1.00 15.88 ? 124 MET A CG  1 
ATOM   820  S  SD  . MET A 1 132 ? -6.772  3.767   2.991  1.00 15.15 ? 124 MET A SD  1 
ATOM   821  C  CE  . MET A 1 132 ? -5.655  4.380   4.241  1.00 15.33 ? 124 MET A CE  1 
ATOM   822  N  N   . PRO A 1 133 ? -6.221  3.036   -2.729 1.00 17.12 ? 125 PRO A N   1 
ATOM   823  C  CA  . PRO A 1 133 ? -7.209  2.394   -3.585 1.00 17.48 ? 125 PRO A CA  1 
ATOM   824  C  C   . PRO A 1 133 ? -8.351  1.851   -2.728 1.00 17.84 ? 125 PRO A C   1 
ATOM   825  O  O   . PRO A 1 133 ? -8.155  1.536   -1.541 1.00 17.21 ? 125 PRO A O   1 
ATOM   826  C  CB  . PRO A 1 133 ? -6.419  1.269   -4.262 1.00 17.49 ? 125 PRO A CB  1 
ATOM   827  C  CG  . PRO A 1 133 ? -4.979  1.602   -4.070 1.00 17.02 ? 125 PRO A CG  1 
ATOM   828  C  CD  . PRO A 1 133 ? -4.901  2.389   -2.805 1.00 16.85 ? 125 PRO A CD  1 
ATOM   829  N  N   . LYS A 1 134 ? -9.528  1.732   -3.334 1.00 18.46 ? 126 LYS A N   1 
ATOM   830  C  CA  . LYS A 1 134 ? -10.755 1.333   -2.609 1.00 18.88 ? 126 LYS A CA  1 
ATOM   831  C  C   . LYS A 1 134 ? -10.584 -0.030  -1.999 1.00 18.47 ? 126 LYS A C   1 
ATOM   832  O  O   . LYS A 1 134 ? -11.034 -0.304  -0.905 1.00 18.02 ? 126 LYS A O   1 
ATOM   833  C  CB  . LYS A 1 134 ? -11.998 1.360   -3.528 1.00 19.23 ? 126 LYS A CB  1 
ATOM   834  N  N   . SER A 1 135 ? -9.889  -0.898  -2.693 1.00 19.04 ? 127 SER A N   1 
ATOM   835  C  CA  . SER A 1 135 ? -9.739  -2.246  -2.203 1.00 19.93 ? 127 SER A CA  1 
ATOM   836  C  C   . SER A 1 135 ? -8.940  -2.286  -0.892 1.00 19.07 ? 127 SER A C   1 
ATOM   837  O  O   . SER A 1 135 ? -9.282  -3.044  0.025  1.00 18.61 ? 127 SER A O   1 
ATOM   838  C  CB  . SER A 1 135 ? -9.094  -3.100  -3.274 1.00 21.24 ? 127 SER A CB  1 
ATOM   839  O  OG  . SER A 1 135 ? -9.012  -4.440  -2.842 1.00 23.64 ? 127 SER A OG  1 
ATOM   840  N  N   . PHE A 1 136 ? -7.865  -1.490  -0.806 1.00 18.61 ? 128 PHE A N   1 
ATOM   841  C  CA  . PHE A 1 136 ? -7.040  -1.470  0.417  1.00 17.59 ? 128 PHE A CA  1 
ATOM   842  C  C   . PHE A 1 136 ? -7.797  -0.740  1.530  1.00 17.37 ? 128 PHE A C   1 
ATOM   843  O  O   . PHE A 1 136 ? -7.782  -1.176  2.673  1.00 16.19 ? 128 PHE A O   1 
ATOM   844  C  CB  . PHE A 1 136 ? -5.650  -0.859  0.195  1.00 17.05 ? 128 PHE A CB  1 
ATOM   845  C  CG  . PHE A 1 136 ? -4.824  -0.759  1.468  1.00 16.93 ? 128 PHE A CG  1 
ATOM   846  C  CD1 . PHE A 1 136 ? -4.253  -1.879  2.038  1.00 16.77 ? 128 PHE A CD1 1 
ATOM   847  C  CD2 . PHE A 1 136 ? -4.667  0.450   2.105  1.00 16.92 ? 128 PHE A CD2 1 
ATOM   848  C  CE1 . PHE A 1 136 ? -3.524  -1.802  3.228  1.00 17.09 ? 128 PHE A CE1 1 
ATOM   849  C  CE2 . PHE A 1 136 ? -3.930  0.543   3.287  1.00 17.48 ? 128 PHE A CE2 1 
ATOM   850  C  CZ  . PHE A 1 136 ? -3.358  -0.583  3.861  1.00 16.62 ? 128 PHE A CZ  1 
ATOM   851  N  N   . GLU A 1 137 ? -8.454  0.362   1.181  1.00 17.48 ? 129 GLU A N   1 
ATOM   852  C  CA  . GLU A 1 137 ? -9.247  1.100   2.151  1.00 18.72 ? 129 GLU A CA  1 
ATOM   853  C  C   . GLU A 1 137 ? -10.280 0.210   2.851  1.00 18.07 ? 129 GLU A C   1 
ATOM   854  O  O   . GLU A 1 137 ? -10.509 0.326   4.074  1.00 17.14 ? 129 GLU A O   1 
ATOM   855  C  CB  . GLU A 1 137 ? -9.987  2.245   1.476  1.00 20.39 ? 129 GLU A CB  1 
ATOM   856  C  CG  . GLU A 1 137 ? -10.743 3.096   2.444  1.00 22.16 ? 129 GLU A CG  1 
ATOM   857  C  CD  . GLU A 1 137 ? -11.491 4.174   1.744  1.00 26.49 ? 129 GLU A CD  1 
ATOM   858  O  OE1 . GLU A 1 137 ? -10.918 5.267   1.458  1.00 29.40 ? 129 GLU A OE1 1 
ATOM   859  O  OE2 . GLU A 1 137 ? -12.662 3.911   1.456  1.00 29.24 ? 129 GLU A OE2 1 
ATOM   860  N  N   . SER A 1 138 ? -10.893 -0.668  2.065  1.00 16.64 ? 130 SER A N   1 
ATOM   861  C  CA  . SER A 1 138 ? -11.876 -1.598  2.587  1.00 16.57 ? 130 SER A CA  1 
ATOM   862  C  C   . SER A 1 138 ? -11.265 -2.602  3.561  1.00 15.78 ? 130 SER A C   1 
ATOM   863  O  O   . SER A 1 138 ? -11.890 -2.984  4.545  1.00 16.70 ? 130 SER A O   1 
ATOM   864  C  CB  . SER A 1 138 ? -12.565 -2.318  1.432  1.00 17.24 ? 130 SER A CB  1 
ATOM   865  O  OG  . SER A 1 138 ? -13.489 -3.259  1.922  1.00 17.97 ? 130 SER A OG  1 
ATOM   866  N  N   . ALA A 1 139 ? -10.047 -3.043  3.303  1.00 15.05 ? 131 ALA A N   1 
ATOM   867  C  CA  . ALA A 1 139 ? -9.371  -3.965  4.223  1.00 14.46 ? 131 ALA A CA  1 
ATOM   868  C  C   . ALA A 1 139 ? -8.967  -3.316  5.554  1.00 14.32 ? 131 ALA A C   1 
ATOM   869  O  O   . ALA A 1 139 ? -9.060  -3.940  6.621  1.00 14.49 ? 131 ALA A O   1 
ATOM   870  C  CB  . ALA A 1 139 ? -8.182  -4.581  3.544  1.00 14.53 ? 131 ALA A CB  1 
ATOM   871  N  N   . VAL A 1 140 ? -8.557  -2.051  5.498  1.00 13.98 ? 132 VAL A N   1 
ATOM   872  C  CA  . VAL A 1 140 ? -8.314  -1.253  6.720  1.00 13.81 ? 132 VAL A CA  1 
ATOM   873  C  C   . VAL A 1 140 ? -9.604  -1.011  7.481  1.00 14.06 ? 132 VAL A C   1 
ATOM   874  O  O   . VAL A 1 140 ? -9.636  -1.142  8.716  1.00 13.80 ? 132 VAL A O   1 
ATOM   875  C  CB  . VAL A 1 140 ? -7.673  0.125   6.433  1.00 13.41 ? 132 VAL A CB  1 
ATOM   876  C  CG1 . VAL A 1 140 ? -7.511  0.923   7.717  1.00 13.35 ? 132 VAL A CG1 1 
ATOM   877  C  CG2 . VAL A 1 140 ? -6.329  -0.047  5.749  1.00 13.16 ? 132 VAL A CG2 1 
ATOM   878  N  N   . THR A 1 141 ? -10.670 -0.695  6.751  1.00 14.40 ? 133 THR A N   1 
ATOM   879  C  CA  . THR A 1 141 ? -11.935 -0.386  7.382  1.00 14.91 ? 133 THR A CA  1 
ATOM   880  C  C   . THR A 1 141 ? -12.469 -1.637  8.056  1.00 14.75 ? 133 THR A C   1 
ATOM   881  O  O   . THR A 1 141 ? -12.910 -1.573  9.200  1.00 14.20 ? 133 THR A O   1 
ATOM   882  C  CB  . THR A 1 141 ? -12.983 0.197   6.409  1.00 15.50 ? 133 THR A CB  1 
ATOM   883  O  OG1 . THR A 1 141 ? -12.452 1.382   5.822  1.00 16.29 ? 133 THR A OG1 1 
ATOM   884  C  CG2 . THR A 1 141 ? -14.221 0.602   7.132  1.00 16.19 ? 133 THR A CG2 1 
ATOM   885  N  N   . ALA A 1 142 ? -12.431 -2.760  7.353  1.00 14.83 ? 134 ALA A N   1 
ATOM   886  C  CA  . ALA A 1 142 ? -12.900 -4.025  7.937  1.00 15.11 ? 134 ALA A CA  1 
ATOM   887  C  C   . ALA A 1 142 ? -12.175 -4.349  9.228  1.00 15.04 ? 134 ALA A C   1 
ATOM   888  O  O   . ALA A 1 142 ? -12.784 -4.783  10.175 1.00 16.00 ? 134 ALA A O   1 
ATOM   889  C  CB  . ALA A 1 142 ? -12.747 -5.163  6.948  1.00 15.11 ? 134 ALA A CB  1 
ATOM   890  N  N   . GLN A 1 143 ? -10.872 -4.138  9.256  1.00 14.96 ? 135 GLN A N   1 
ATOM   891  C  CA  . GLN A 1 143 ? -10.029 -4.568  10.383 1.00 15.38 ? 135 GLN A CA  1 
ATOM   892  C  C   . GLN A 1 143 ? -10.022 -3.619  11.551 1.00 14.32 ? 135 GLN A C   1 
ATOM   893  O  O   . GLN A 1 143 ? -10.082 -4.064  12.687 1.00 14.29 ? 135 GLN A O   1 
ATOM   894  C  CB  . GLN A 1 143 ? -8.570  -4.696  9.914  1.00 16.36 ? 135 GLN A CB  1 
ATOM   895  C  CG  . GLN A 1 143 ? -7.583  -5.040  11.025 1.00 16.93 ? 135 GLN A CG  1 
ATOM   896  C  CD  . GLN A 1 143 ? -7.640  -6.510  11.377 1.00 18.37 ? 135 GLN A CD  1 
ATOM   897  O  OE1 . GLN A 1 143 ? -7.531  -7.364  10.483 1.00 21.41 ? 135 GLN A OE1 1 
ATOM   898  N  NE2 . GLN A 1 143 ? -7.800  -6.821  12.652 1.00 18.56 ? 135 GLN A NE2 1 
ATOM   899  N  N   . PHE A 1 144 ? -9.913  -2.319  11.269 1.00 13.60 ? 136 PHE A N   1 
ATOM   900  C  CA  . PHE A 1 144 ? -9.772  -1.295  12.308 1.00 13.33 ? 136 PHE A CA  1 
ATOM   901  C  C   . PHE A 1 144 ? -11.039 -0.478  12.524 1.00 13.52 ? 136 PHE A C   1 
ATOM   902  O  O   . PHE A 1 144 ? -11.063 0.392   13.397 1.00 13.35 ? 136 PHE A O   1 
ATOM   903  C  CB  . PHE A 1 144 ? -8.625  -0.353  11.963 1.00 13.05 ? 136 PHE A CB  1 
ATOM   904  C  CG  . PHE A 1 144 ? -7.297  -1.028  11.940 1.00 12.67 ? 136 PHE A CG  1 
ATOM   905  C  CD1 . PHE A 1 144 ? -6.573  -1.170  13.102 1.00 12.63 ? 136 PHE A CD1 1 
ATOM   906  C  CD2 . PHE A 1 144 ? -6.798  -1.568  10.767 1.00 12.45 ? 136 PHE A CD2 1 
ATOM   907  C  CE1 . PHE A 1 144 ? -5.364  -1.824  13.085 1.00 12.36 ? 136 PHE A CE1 1 
ATOM   908  C  CE2 . PHE A 1 144 ? -5.584  -2.223  10.747 1.00 12.18 ? 136 PHE A CE2 1 
ATOM   909  C  CZ  . PHE A 1 144 ? -4.867  -2.349  11.914 1.00 12.10 ? 136 PHE A CZ  1 
ATOM   910  N  N   . GLY A 1 145 ? -12.080 -0.718  11.723 1.00 13.74 ? 137 GLY A N   1 
ATOM   911  C  CA  . GLY A 1 145 ? -13.359 -0.019  11.914 1.00 14.15 ? 137 GLY A CA  1 
ATOM   912  C  C   . GLY A 1 145 ? -13.468 1.148   10.970 1.00 14.51 ? 137 GLY A C   1 
ATOM   913  O  O   . GLY A 1 145 ? -14.492 1.339   10.379 1.00 15.07 ? 137 GLY A O   1 
ATOM   914  N  N   . SER A 1 146 ? -12.415 1.958   10.876 1.00 14.56 ? 138 SER A N   1 
ATOM   915  C  CA  . SER A 1 146 ? -12.345 3.044   9.923  1.00 14.45 ? 138 SER A CA  1 
ATOM   916  C  C   . SER A 1 146 ? -10.887 3.392   9.687  1.00 14.35 ? 138 SER A C   1 
ATOM   917  O  O   . SER A 1 146 ? -10.005 3.044   10.481 1.00 14.45 ? 138 SER A O   1 
ATOM   918  C  CB  . SER A 1 146 ? -13.071 4.295   10.450 1.00 14.84 ? 138 SER A CB  1 
ATOM   919  O  OG  . SER A 1 146 ? -12.467 4.771   11.653 1.00 14.65 ? 138 SER A OG  1 
ATOM   920  N  N   . VAL A 1 147 ? -10.629 4.108   8.601  1.00 14.26 ? 139 VAL A N   1 
ATOM   921  C  CA  . VAL A 1 147 ? -9.281  4.602   8.324  1.00 13.94 ? 139 VAL A CA  1 
ATOM   922  C  C   . VAL A 1 147 ? -8.782  5.468   9.489  1.00 13.82 ? 139 VAL A C   1 
ATOM   923  O  O   . VAL A 1 147 ? -7.642  5.323   9.922  1.00 13.32 ? 139 VAL A O   1 
ATOM   924  C  CB  . VAL A 1 147 ? -9.213  5.391   6.996  1.00 14.22 ? 139 VAL A CB  1 
ATOM   925  C  CG1 . VAL A 1 147 ? -7.825  5.988   6.776  1.00 14.56 ? 139 VAL A CG1 1 
ATOM   926  C  CG2 . VAL A 1 147 ? -9.551  4.474   5.830  1.00 14.67 ? 139 VAL A CG2 1 
ATOM   927  N  N   . GLU A 1 148 ? -9.626  6.381   9.969  1.00 13.69 ? 140 GLU A N   1 
ATOM   928  C  CA  . GLU A 1 148 ? -9.231  7.260   11.042 1.00 14.37 ? 140 GLU A CA  1 
ATOM   929  C  C   . GLU A 1 148 ? -8.804  6.509   12.306 1.00 13.37 ? 140 GLU A C   1 
ATOM   930  O  O   . GLU A 1 148 ? -7.860  6.922   12.971 1.00 12.71 ? 140 GLU A O   1 
ATOM   931  C  CB  . GLU A 1 148 ? -10.361 8.244   11.377 1.00 15.89 ? 140 GLU A CB  1 
ATOM   932  C  CG  . GLU A 1 148 ? -9.900  9.448   12.197 1.00 18.05 ? 140 GLU A CG  1 
ATOM   933  C  CD  . GLU A 1 148 ? -11.046 10.425  12.545 1.00 19.96 ? 140 GLU A CD  1 
ATOM   934  O  OE1 . GLU A 1 148 ? -12.000 10.559  11.727 1.00 21.32 ? 140 GLU A OE1 1 
ATOM   935  O  OE2 . GLU A 1 148 ? -10.999 11.031  13.655 1.00 21.22 ? 140 GLU A OE2 1 
ATOM   936  N  N   . GLN A 1 149 ? -9.527  5.438   12.640 1.00 12.61 ? 141 GLN A N   1 
ATOM   937  C  CA  . GLN A 1 149 ? -9.204  4.615   13.804 1.00 12.30 ? 141 GLN A CA  1 
ATOM   938  C  C   . GLN A 1 149 ? -7.879  3.913   13.607 1.00 11.79 ? 141 GLN A C   1 
ATOM   939  O  O   . GLN A 1 149 ? -7.091  3.831   14.521 1.00 11.53 ? 141 GLN A O   1 
ATOM   940  C  CB  . GLN A 1 149 ? -10.322 3.600   14.099 1.00 12.63 ? 141 GLN A CB  1 
ATOM   941  C  CG  . GLN A 1 149 ? -11.583 4.242   14.687 1.00 13.12 ? 141 GLN A CG  1 
ATOM   942  C  CD  . GLN A 1 149 ? -12.771 3.298   14.688 1.00 13.40 ? 141 GLN A CD  1 
ATOM   943  O  OE1 . GLN A 1 149 ? -13.525 3.191   13.715 1.00 13.51 ? 141 GLN A OE1 1 
ATOM   944  N  NE2 . GLN A 1 149 ? -12.912 2.580   15.767 1.00 13.78 ? 141 GLN A NE2 1 
ATOM   945  N  N   . PHE A 1 150 ? -7.645  3.409   12.400 1.00 11.31 ? 142 PHE A N   1 
ATOM   946  C  CA  . PHE A 1 150 ? -6.375  2.865   12.090 1.00 10.90 ? 142 PHE A CA  1 
ATOM   947  C  C   . PHE A 1 150 ? -5.265  3.914   12.257 1.00 10.64 ? 142 PHE A C   1 
ATOM   948  O  O   . PHE A 1 150 ? -4.252  3.633   12.879 1.00 10.72 ? 142 PHE A O   1 
ATOM   949  C  CB  . PHE A 1 150 ? -6.310  2.291   10.652 1.00 10.70 ? 142 PHE A CB  1 
ATOM   950  C  CG  . PHE A 1 150 ? -4.936  2.244   10.150 1.00 10.46 ? 142 PHE A CG  1 
ATOM   951  C  CD1 . PHE A 1 150 ? -4.004  1.368   10.744 1.00 10.50 ? 142 PHE A CD1 1 
ATOM   952  C  CD2 . PHE A 1 150 ? -4.500  3.160   9.213  1.00 10.53 ? 142 PHE A CD2 1 
ATOM   953  C  CE1 . PHE A 1 150 ? -2.683  1.357   10.352 1.00 10.24 ? 142 PHE A CE1 1 
ATOM   954  C  CE2 . PHE A 1 150 ? -3.171  3.159   8.822  1.00 10.63 ? 142 PHE A CE2 1 
ATOM   955  C  CZ  . PHE A 1 150 ? -2.263  2.248   9.392  1.00 10.37 ? 142 PHE A CZ  1 
ATOM   956  N  N   . LYS A 1 151 ? -5.423  5.098   11.678 1.00 10.60 ? 143 LYS A N   1 
ATOM   957  C  CA  . LYS A 1 151 ? -4.371  6.127   11.775 1.00 10.54 ? 143 LYS A CA  1 
ATOM   958  C  C   . LYS A 1 151 ? -4.086  6.523   13.219 1.00 10.40 ? 143 LYS A C   1 
ATOM   959  O  O   . LYS A 1 151 ? -2.922  6.628   13.626 1.00 10.33 ? 143 LYS A O   1 
ATOM   960  C  CB  . LYS A 1 151 ? -4.724  7.369   10.968 1.00 10.98 ? 143 LYS A CB  1 
ATOM   961  C  CG  . LYS A 1 151 ? -4.617  7.151   9.465  1.00 11.42 ? 143 LYS A CG  1 
ATOM   962  C  CD  . LYS A 1 151 ? -4.906  8.412   8.659  1.00 12.32 ? 143 LYS A CD  1 
ATOM   963  C  CE  . LYS A 1 151 ? -4.685  8.115   7.189  1.00 13.19 ? 143 LYS A CE  1 
ATOM   964  N  NZ  . LYS A 1 151 ? -5.136  9.168   6.245  1.00 14.11 ? 143 LYS A NZ  1 
ATOM   965  N  N   . ASP A 1 152 ? -5.135  6.734   14.002 1.00 10.41 ? 144 ASP A N   1 
ATOM   966  C  CA  . ASP A 1 152 ? -4.956  7.118   15.420 1.00 10.47 ? 144 ASP A CA  1 
ATOM   967  C  C   . ASP A 1 152 ? -4.224  6.058   16.210 1.00 9.97  ? 144 ASP A C   1 
ATOM   968  O  O   . ASP A 1 152 ? -3.332  6.393   16.966 1.00 9.63  ? 144 ASP A O   1 
ATOM   969  C  CB  . ASP A 1 152 ? -6.283  7.450   16.075 1.00 11.05 ? 144 ASP A CB  1 
ATOM   970  C  CG  . ASP A 1 152 ? -6.899  8.716   15.527 1.00 11.09 ? 144 ASP A CG  1 
ATOM   971  O  OD1 . ASP A 1 152 ? -6.170  9.500   14.910 1.00 11.31 ? 144 ASP A OD1 1 
ATOM   972  O  OD2 . ASP A 1 152 ? -8.110  8.916   15.751 1.00 11.11 ? 144 ASP A OD2 1 
ATOM   973  N  N   . ALA A 1 153 ? -4.551  4.775   15.986 1.00 9.80  ? 145 ALA A N   1 
ATOM   974  C  CA  . ALA A 1 153 ? -3.838  3.684   16.659 1.00 9.71  ? 145 ALA A CA  1 
ATOM   975  C  C   . ALA A 1 153 ? -2.370  3.610   16.209 1.00 9.67  ? 145 ALA A C   1 
ATOM   976  O  O   . ALA A 1 153 ? -1.490  3.289   17.007 1.00 9.26  ? 145 ALA A O   1 
ATOM   977  C  CB  . ALA A 1 153 ? -4.531  2.345   16.424 1.00 9.84  ? 145 ALA A CB  1 
ATOM   978  N  N   . PHE A 1 154 ? -2.124  3.868   14.916 1.00 9.40  ? 146 PHE A N   1 
ATOM   979  C  CA  . PHE A 1 154 ? -0.778  3.761   14.364 1.00 9.33  ? 146 PHE A CA  1 
ATOM   980  C  C   . PHE A 1 154 ? 0.073   4.894   14.940 1.00 9.34  ? 146 PHE A C   1 
ATOM   981  O  O   . PHE A 1 154 ? 1.215   4.667   15.351 1.00 9.25  ? 146 PHE A O   1 
ATOM   982  C  CB  . PHE A 1 154 ? -0.817  3.810   12.823 1.00 9.29  ? 146 PHE A CB  1 
ATOM   983  C  CG  . PHE A 1 154 ? 0.515   3.591   12.149 1.00 9.23  ? 146 PHE A CG  1 
ATOM   984  C  CD1 . PHE A 1 154 ? 0.816   2.373   11.551 1.00 9.42  ? 146 PHE A CD1 1 
ATOM   985  C  CD2 . PHE A 1 154 ? 1.450   4.607   12.062 1.00 9.21  ? 146 PHE A CD2 1 
ATOM   986  C  CE1 . PHE A 1 154 ? 2.023   2.170   10.910 1.00 9.24  ? 146 PHE A CE1 1 
ATOM   987  C  CE2 . PHE A 1 154 ? 2.659   4.401   11.433 1.00 9.09  ? 146 PHE A CE2 1 
ATOM   988  C  CZ  . PHE A 1 154 ? 2.943   3.180   10.856 1.00 9.11  ? 146 PHE A CZ  1 
ATOM   989  N  N   . VAL A 1 155 ? -0.486  6.103   14.998 1.00 9.34  ? 147 VAL A N   1 
ATOM   990  C  CA  . VAL A 1 155 ? 0.202   7.215   15.630 1.00 9.47  ? 147 VAL A CA  1 
ATOM   991  C  C   . VAL A 1 155 ? 0.513   6.922   17.098 1.00 10.02 ? 147 VAL A C   1 
ATOM   992  O  O   . VAL A 1 155 ? 1.625   7.169   17.556 1.00 10.61 ? 147 VAL A O   1 
ATOM   993  C  CB  . VAL A 1 155 ? -0.618  8.494   15.517 1.00 9.45  ? 147 VAL A CB  1 
ATOM   994  C  CG1 . VAL A 1 155 ? -0.036  9.583   16.359 1.00 9.47  ? 147 VAL A CG1 1 
ATOM   995  C  CG2 . VAL A 1 155 ? -0.700  8.931   14.060 1.00 9.39  ? 147 VAL A CG2 1 
ATOM   996  N  N   . GLN A 1 156 ? -0.442  6.389   17.846 1.00 10.57 ? 148 GLN A N   1 
ATOM   997  C  CA  . GLN A 1 156 ? -0.170  6.031   19.251 1.00 10.79 ? 148 GLN A CA  1 
ATOM   998  C  C   . GLN A 1 156 ? 1.031   5.065   19.383 1.00 10.45 ? 148 GLN A C   1 
ATOM   999  O  O   . GLN A 1 156 ? 1.932   5.274   20.222 1.00 10.21 ? 148 GLN A O   1 
ATOM   1000 C  CB  . GLN A 1 156 ? -1.439  5.564   19.975 1.00 11.36 ? 148 GLN A CB  1 
ATOM   1001 C  CG  . GLN A 1 156 ? -2.407  6.721   20.215 1.00 12.00 ? 148 GLN A CG  1 
ATOM   1002 C  CD  . GLN A 1 156 ? -1.727  7.968   20.790 1.00 12.44 ? 148 GLN A CD  1 
ATOM   1003 O  OE1 . GLN A 1 156 ? -1.603  9.009   20.117 1.00 13.02 ? 148 GLN A OE1 1 
ATOM   1004 N  NE2 . GLN A 1 156 ? -1.251  7.861   21.998 1.00 12.61 ? 148 GLN A NE2 1 
ATOM   1005 N  N   . ALA A 1 157 ? 1.062   4.027   18.543 1.00 9.90  ? 149 ALA A N   1 
ATOM   1006 C  CA  . ALA A 1 157 ? 2.155   3.060   18.576 1.00 9.48  ? 149 ALA A CA  1 
ATOM   1007 C  C   . ALA A 1 157 ? 3.489   3.758   18.261 1.00 9.24  ? 149 ALA A C   1 
ATOM   1008 O  O   . ALA A 1 157 ? 4.529   3.467   18.881 1.00 9.05  ? 149 ALA A O   1 
ATOM   1009 C  CB  . ALA A 1 157 ? 1.895   1.941   17.581 1.00 9.45  ? 149 ALA A CB  1 
ATOM   1010 N  N   . GLY A 1 158 ? 3.471   4.639   17.264 1.00 8.85  ? 150 GLY A N   1 
ATOM   1011 C  CA  . GLY A 1 158 ? 4.693   5.332   16.858 1.00 8.88  ? 150 GLY A CA  1 
ATOM   1012 C  C   . GLY A 1 158 ? 5.211   6.247   17.956 1.00 8.94  ? 150 GLY A C   1 
ATOM   1013 O  O   . GLY A 1 158 ? 6.406   6.258   18.241 1.00 8.61  ? 150 GLY A O   1 
ATOM   1014 N  N   . VAL A 1 159 ? 4.298   7.007   18.565 1.00 9.11  ? 151 VAL A N   1 
ATOM   1015 C  CA  . VAL A 1 159 ? 4.666   7.892   19.667 1.00 9.51  ? 151 VAL A CA  1 
ATOM   1016 C  C   . VAL A 1 159 ? 5.295   7.140   20.818 1.00 9.65  ? 151 VAL A C   1 
ATOM   1017 O  O   . VAL A 1 159 ? 6.239   7.647   21.459 1.00 9.68  ? 151 VAL A O   1 
ATOM   1018 C  CB  . VAL A 1 159 ? 3.472   8.708   20.177 1.00 9.85  ? 151 VAL A CB  1 
ATOM   1019 C  CG1 . VAL A 1 159 ? 3.819   9.455   21.461 1.00 10.13 ? 151 VAL A CG1 1 
ATOM   1020 C  CG2 . VAL A 1 159 ? 3.000   9.698   19.102 1.00 10.04 ? 151 VAL A CG2 1 
ATOM   1021 N  N   . ASN A 1 160 ? 4.763   5.961   21.119 1.00 9.66  ? 152 ASN A N   1 
ATOM   1022 C  CA  . ASN A 1 160 ? 5.213   5.241   22.317 1.00 10.18 ? 152 ASN A CA  1 
ATOM   1023 C  C   . ASN A 1 160 ? 6.225   4.144   22.018 1.00 10.02 ? 152 ASN A C   1 
ATOM   1024 O  O   . ASN A 1 160 ? 6.494   3.305   22.873 1.00 10.22 ? 152 ASN A O   1 
ATOM   1025 C  CB  . ASN A 1 160 ? 4.001   4.728   23.073 1.00 10.51 ? 152 ASN A CB  1 
ATOM   1026 C  CG  . ASN A 1 160 ? 3.202   5.878   23.635 1.00 10.95 ? 152 ASN A CG  1 
ATOM   1027 O  OD1 . ASN A 1 160 ? 3.609   6.485   24.626 1.00 11.94 ? 152 ASN A OD1 1 
ATOM   1028 N  ND2 . ASN A 1 160 ? 2.122   6.242   22.973 1.00 10.78 ? 152 ASN A ND2 1 
ATOM   1029 N  N   . ASN A 1 161 ? 6.764   4.161   20.801 1.00 9.69  ? 153 ASN A N   1 
ATOM   1030 C  CA  . ASN A 1 161 ? 7.833   3.262   20.426 1.00 9.74  ? 153 ASN A CA  1 
ATOM   1031 C  C   . ASN A 1 161 ? 9.124   3.785   21.041 1.00 9.36  ? 153 ASN A C   1 
ATOM   1032 O  O   . ASN A 1 161 ? 9.782   4.681   20.470 1.00 9.14  ? 153 ASN A O   1 
ATOM   1033 C  CB  . ASN A 1 161 ? 7.961   3.150   18.897 1.00 9.92  ? 153 ASN A CB  1 
ATOM   1034 C  CG  . ASN A 1 161 ? 8.759   1.915   18.469 1.00 10.56 ? 153 ASN A CG  1 
ATOM   1035 O  OD1 . ASN A 1 161 ? 9.281   1.210   19.285 1.00 11.16 ? 153 ASN A OD1 1 
ATOM   1036 N  ND2 . ASN A 1 161 ? 8.786   1.632   17.192 1.00 11.27 ? 153 ASN A ND2 1 
ATOM   1037 N  N   . PHE A 1 162 ? 9.507   3.221   22.182 1.00 9.15  ? 154 PHE A N   1 
ATOM   1038 C  CA  . PHE A 1 162 ? 10.571  3.823   22.975 1.00 8.96  ? 154 PHE A CA  1 
ATOM   1039 C  C   . PHE A 1 162 ? 11.965  3.671   22.357 1.00 8.73  ? 154 PHE A C   1 
ATOM   1040 O  O   . PHE A 1 162 ? 12.382  2.576   21.961 1.00 8.58  ? 154 PHE A O   1 
ATOM   1041 C  CB  . PHE A 1 162 ? 10.556  3.303   24.417 1.00 9.22  ? 154 PHE A CB  1 
ATOM   1042 C  CG  . PHE A 1 162 ? 11.498  4.054   25.324 1.00 9.45  ? 154 PHE A CG  1 
ATOM   1043 C  CD1 . PHE A 1 162 ? 11.254  5.382   25.650 1.00 9.48  ? 154 PHE A CD1 1 
ATOM   1044 C  CD2 . PHE A 1 162 ? 12.668  3.463   25.794 1.00 9.55  ? 154 PHE A CD2 1 
ATOM   1045 C  CE1 . PHE A 1 162 ? 12.127  6.074   26.480 1.00 9.70  ? 154 PHE A CE1 1 
ATOM   1046 C  CE2 . PHE A 1 162 ? 13.568  4.175   26.610 1.00 9.72  ? 154 PHE A CE2 1 
ATOM   1047 C  CZ  . PHE A 1 162 ? 13.283  5.473   26.957 1.00 9.75  ? 154 PHE A CZ  1 
ATOM   1048 N  N   . GLY A 1 163 ? 12.686  4.791   22.265 1.00 8.77  ? 155 GLY A N   1 
ATOM   1049 C  CA  . GLY A 1 163 ? 14.006  4.832   21.650 1.00 8.68  ? 155 GLY A CA  1 
ATOM   1050 C  C   . GLY A 1 163 ? 13.923  4.833   20.126 1.00 8.50  ? 155 GLY A C   1 
ATOM   1051 O  O   . GLY A 1 163 ? 12.986  5.371   19.558 1.00 8.32  ? 155 GLY A O   1 
ATOM   1052 N  N   . SER A 1 164 ? 14.937  4.272   19.472 1.00 8.57  ? 156 SER A N   1 
ATOM   1053 C  CA  . SER A 1 164 ? 14.975  4.214   18.010 1.00 8.53  ? 156 SER A CA  1 
ATOM   1054 C  C   . SER A 1 164 ? 14.154  3.041   17.548 1.00 8.51  ? 156 SER A C   1 
ATOM   1055 O  O   . SER A 1 164 ? 14.093  1.994   18.230 1.00 8.59  ? 156 SER A O   1 
ATOM   1056 C  CB  . SER A 1 164 ? 16.421  4.070   17.508 1.00 8.62  ? 156 SER A CB  1 
ATOM   1057 O  OG  . SER A 1 164 ? 17.292  5.111   17.967 1.00 8.67  ? 156 SER A OG  1 
ATOM   1058 N  N   . GLY A 1 165 ? 13.526  3.163   16.392 1.00 8.26  ? 157 GLY A N   1 
ATOM   1059 C  CA  . GLY A 1 165 ? 12.799  2.008   15.860 1.00 8.31  ? 157 GLY A CA  1 
ATOM   1060 C  C   . GLY A 1 165 ? 11.908  2.321   14.672 1.00 8.34  ? 157 GLY A C   1 
ATOM   1061 O  O   . GLY A 1 165 ? 12.069  3.366   13.998 1.00 7.99  ? 157 GLY A O   1 
ATOM   1062 N  N   . TRP A 1 166 ? 10.952  1.416   14.444 1.00 8.26  ? 158 TRP A N   1 
ATOM   1063 C  CA  . TRP A 1 166 ? 10.062  1.484   13.281 1.00 8.29  ? 158 TRP A CA  1 
ATOM   1064 C  C   . TRP A 1 166 ? 8.674   1.104   13.763 1.00 8.57  ? 158 TRP A C   1 
ATOM   1065 O  O   . TRP A 1 166 ? 8.565   0.234   14.643 1.00 8.70  ? 158 TRP A O   1 
ATOM   1066 C  CB  . TRP A 1 166 ? 10.515  0.496   12.224 1.00 8.16  ? 158 TRP A CB  1 
ATOM   1067 C  CG  . TRP A 1 166 ? 11.901  0.709   11.778 1.00 7.87  ? 158 TRP A CG  1 
ATOM   1068 C  CD1 . TRP A 1 166 ? 13.027  0.282   12.388 1.00 7.93  ? 158 TRP A CD1 1 
ATOM   1069 C  CD2 . TRP A 1 166 ? 12.309  1.429   10.624 1.00 7.81  ? 158 TRP A CD2 1 
ATOM   1070 N  NE1 . TRP A 1 166 ? 14.135  0.711   11.685 1.00 7.98  ? 158 TRP A NE1 1 
ATOM   1071 C  CE2 . TRP A 1 166 ? 13.710  1.411   10.592 1.00 7.75  ? 158 TRP A CE2 1 
ATOM   1072 C  CE3 . TRP A 1 166 ? 11.618  2.097   9.609  1.00 7.73  ? 158 TRP A CE3 1 
ATOM   1073 C  CZ2 . TRP A 1 166 ? 14.424  2.011   9.601  1.00 7.76  ? 158 TRP A CZ2 1 
ATOM   1074 C  CZ3 . TRP A 1 166 ? 12.336  2.707   8.630  1.00 7.66  ? 158 TRP A CZ3 1 
ATOM   1075 C  CH2 . TRP A 1 166 ? 13.722  2.659   8.627  1.00 7.71  ? 158 TRP A CH2 1 
ATOM   1076 N  N   . THR A 1 167 ? 7.636   1.764   13.223 1.00 8.62  ? 159 THR A N   1 
ATOM   1077 C  CA  . THR A 1 167 ? 6.251   1.345   13.442 1.00 8.67  ? 159 THR A CA  1 
ATOM   1078 C  C   . THR A 1 167 ? 5.686   0.876   12.116 1.00 8.73  ? 159 THR A C   1 
ATOM   1079 O  O   . THR A 1 167 ? 5.859   1.544   11.058 1.00 8.60  ? 159 THR A O   1 
ATOM   1080 C  CB  . THR A 1 167 ? 5.430   2.492   14.071 1.00 8.91  ? 159 THR A CB  1 
ATOM   1081 O  OG1 . THR A 1 167 ? 5.944   2.776   15.391 1.00 9.19  ? 159 THR A OG1 1 
ATOM   1082 C  CG2 . THR A 1 167 ? 3.961   2.141   14.206 1.00 8.90  ? 159 THR A CG2 1 
ATOM   1083 N  N   . TRP A 1 168 ? 5.055   -0.305  12.142 1.00 8.80  ? 160 TRP A N   1 
ATOM   1084 C  CA  . TRP A 1 168 ? 4.647   -1.007  10.912 1.00 8.72  ? 160 TRP A CA  1 
ATOM   1085 C  C   . TRP A 1 168 ? 3.170   -1.373  10.908 1.00 9.15  ? 160 TRP A C   1 
ATOM   1086 O  O   . TRP A 1 168 ? 2.562   -1.584  11.965 1.00 9.01  ? 160 TRP A O   1 
ATOM   1087 C  CB  . TRP A 1 168 ? 5.395   -2.335  10.757 1.00 8.67  ? 160 TRP A CB  1 
ATOM   1088 C  CG  . TRP A 1 168 ? 6.874   -2.315  10.891 1.00 8.48  ? 160 TRP A CG  1 
ATOM   1089 C  CD1 . TRP A 1 168 ? 7.572   -2.335  12.038 1.00 8.54  ? 160 TRP A CD1 1 
ATOM   1090 C  CD2 . TRP A 1 168 ? 7.832   -2.394  9.839  1.00 8.40  ? 160 TRP A CD2 1 
ATOM   1091 N  NE1 . TRP A 1 168 ? 8.918   -2.365  11.784 1.00 8.53  ? 160 TRP A NE1 1 
ATOM   1092 C  CE2 . TRP A 1 168 ? 9.112   -2.394  10.439 1.00 8.46  ? 160 TRP A CE2 1 
ATOM   1093 C  CE3 . TRP A 1 168 ? 7.741   -2.421  8.448  1.00 8.55  ? 160 TRP A CE3 1 
ATOM   1094 C  CZ2 . TRP A 1 168 ? 10.300  -2.413  9.696  1.00 8.46  ? 160 TRP A CZ2 1 
ATOM   1095 C  CZ3 . TRP A 1 168 ? 8.919   -2.469  7.695  1.00 8.46  ? 160 TRP A CZ3 1 
ATOM   1096 C  CH2 . TRP A 1 168 ? 10.175  -2.463  8.315  1.00 8.48  ? 160 TRP A CH2 1 
ATOM   1097 N  N   . LEU A 1 169 ? 2.600   -1.450  9.695  1.00 9.43  ? 161 LEU A N   1 
ATOM   1098 C  CA  . LEU A 1 169 ? 1.352   -2.159  9.471  1.00 9.83  ? 161 LEU A CA  1 
ATOM   1099 C  C   . LEU A 1 169 ? 1.722   -3.401  8.669  1.00 10.24 ? 161 LEU A C   1 
ATOM   1100 O  O   . LEU A 1 169 ? 2.323   -3.283  7.608  1.00 10.91 ? 161 LEU A O   1 
ATOM   1101 C  CB  . LEU A 1 169 ? 0.372   -1.299  8.693  1.00 10.09 ? 161 LEU A CB  1 
ATOM   1102 C  CG  . LEU A 1 169 ? -0.949  -1.967  8.324  1.00 10.41 ? 161 LEU A CG  1 
ATOM   1103 C  CD1 . LEU A 1 169 ? -1.716  -2.383  9.559  1.00 10.68 ? 161 LEU A CD1 1 
ATOM   1104 C  CD2 . LEU A 1 169 ? -1.784  -1.032  7.507  1.00 10.75 ? 161 LEU A CD2 1 
ATOM   1105 N  N   . CYS A 1 170 ? 1.378   -4.577  9.167  1.00 10.59 ? 162 CYS A N   1 
ATOM   1106 C  CA  . CYS A 1 170 ? 1.761   -5.860  8.542  1.00 10.74 ? 162 CYS A CA  1 
ATOM   1107 C  C   . CYS A 1 170 ? 0.562   -6.743  8.357  1.00 11.27 ? 162 CYS A C   1 
ATOM   1108 O  O   . CYS A 1 170 ? -0.466  -6.596  9.047  1.00 11.69 ? 162 CYS A O   1 
ATOM   1109 C  CB  . CYS A 1 170 ? 2.739   -6.629  9.427  1.00 10.69 ? 162 CYS A CB  1 
ATOM   1110 S  SG  . CYS A 1 170 ? 4.275   -5.762  9.752  1.00 10.16 ? 162 CYS A SG  1 
ATOM   1111 N  N   . VAL A 1 171 ? 0.702   -7.669  7.423  1.00 11.57 ? 163 VAL A N   1 
ATOM   1112 C  CA  . VAL A 1 171 ? -0.186  -8.802  7.292  1.00 11.90 ? 163 VAL A CA  1 
ATOM   1113 C  C   . VAL A 1 171 ? 0.410   -9.916  8.115  1.00 12.32 ? 163 VAL A C   1 
ATOM   1114 O  O   . VAL A 1 171 ? 1.616   -10.140 8.081  1.00 12.01 ? 163 VAL A O   1 
ATOM   1115 C  CB  . VAL A 1 171 ? -0.254  -9.270  5.822  1.00 12.06 ? 163 VAL A CB  1 
ATOM   1116 C  CG1 . VAL A 1 171 ? -0.879  -10.666 5.690  1.00 12.25 ? 163 VAL A CG1 1 
ATOM   1117 C  CG2 . VAL A 1 171 ? -1.014  -8.246  5.000  1.00 12.07 ? 163 VAL A CG2 1 
ATOM   1118 N  N   . ASP A 1 172 ? -0.441  -10.633 8.838  1.00 13.51 ? 164 ASP A N   1 
ATOM   1119 C  CA  . ASP A 1 172 ? -0.005  -11.781 9.609  1.00 14.72 ? 164 ASP A CA  1 
ATOM   1120 C  C   . ASP A 1 172 ? -0.557  -13.064 9.033  1.00 15.91 ? 164 ASP A C   1 
ATOM   1121 O  O   . ASP A 1 172 ? -1.735  -13.388 9.279  1.00 16.87 ? 164 ASP A O   1 
ATOM   1122 C  CB  . ASP A 1 172 ? -0.471  -11.646 11.053 1.00 14.80 ? 164 ASP A CB  1 
ATOM   1123 C  CG  . ASP A 1 172 ? 0.077   -12.752 11.943 1.00 15.28 ? 164 ASP A CG  1 
ATOM   1124 O  OD1 . ASP A 1 172 ? 0.643   -13.755 11.479 1.00 15.91 ? 164 ASP A OD1 1 
ATOM   1125 O  OD2 . ASP A 1 172 ? -0.060  -12.627 13.142 1.00 16.55 ? 164 ASP A OD2 1 
ATOM   1126 N  N   . PRO A 1 173 ? 0.270   -13.811 8.285  1.00 17.13 ? 165 PRO A N   1 
ATOM   1127 C  CA  . PRO A 1 173 ? -0.220  -15.062 7.700  1.00 18.01 ? 165 PRO A CA  1 
ATOM   1128 C  C   . PRO A 1 173 ? -0.588  -16.116 8.727  1.00 18.87 ? 165 PRO A C   1 
ATOM   1129 O  O   . PRO A 1 173 ? -1.470  -16.918 8.483  1.00 19.70 ? 165 PRO A O   1 
ATOM   1130 C  CB  . PRO A 1 173 ? 0.927   -15.537 6.821  1.00 18.22 ? 165 PRO A CB  1 
ATOM   1131 C  CG  . PRO A 1 173 ? 2.118   -14.701 7.153  1.00 17.72 ? 165 PRO A CG  1 
ATOM   1132 C  CD  . PRO A 1 173 ? 1.627   -13.462 7.829  1.00 17.35 ? 165 PRO A CD  1 
ATOM   1133 N  N   . SER A 1 174 ? 0.021   -16.095 9.896  1.00 19.82 ? 166 SER A N   1 
ATOM   1134 C  CA  . SER A 1 174 ? -0.338  -17.077 10.922 1.00 20.91 ? 166 SER A CA  1 
ATOM   1135 C  C   . SER A 1 174 ? -1.684  -16.767 11.614 1.00 22.07 ? 166 SER A C   1 
ATOM   1136 O  O   . SER A 1 174 ? -2.117  -17.520 12.465 1.00 22.56 ? 166 SER A O   1 
ATOM   1137 C  CB  . SER A 1 174 ? 0.770   -17.171 11.962 1.00 21.07 ? 166 SER A CB  1 
ATOM   1138 O  OG  . SER A 1 174 ? 0.683   -16.070 12.866 1.00 21.22 ? 166 SER A OG  1 
ATOM   1139 N  N   . ASN A 1 175 ? -2.357  -15.688 11.213 1.00 22.74 ? 167 ASN A N   1 
ATOM   1140 C  CA  . ASN A 1 175 ? -3.605  -15.257 11.825 1.00 23.43 ? 167 ASN A CA  1 
ATOM   1141 C  C   . ASN A 1 175 ? -4.607  -14.791 10.781 1.00 23.04 ? 167 ASN A C   1 
ATOM   1142 O  O   . ASN A 1 175 ? -5.078  -13.644 10.792 1.00 22.75 ? 167 ASN A O   1 
ATOM   1143 C  CB  . ASN A 1 175 ? -3.330  -14.099 12.752 1.00 24.71 ? 167 ASN A CB  1 
ATOM   1144 C  CG  . ASN A 1 175 ? -4.372  -13.948 13.786 1.00 26.98 ? 167 ASN A CG  1 
ATOM   1145 O  OD1 . ASN A 1 175 ? -4.860  -14.937 14.356 1.00 31.77 ? 167 ASN A OD1 1 
ATOM   1146 N  ND2 . ASN A 1 175 ? -4.718  -12.697 14.072 1.00 27.93 ? 167 ASN A ND2 1 
ATOM   1147 N  N   . LYS A 1 176 ? -4.882  -15.676 9.840  1.00 22.98 ? 168 LYS A N   1 
ATOM   1148 C  CA  . LYS A 1 176 ? -5.833  -15.410 8.753  1.00 22.32 ? 168 LYS A CA  1 
ATOM   1149 C  C   . LYS A 1 176 ? -5.523  -14.100 8.019  1.00 20.16 ? 168 LYS A C   1 
ATOM   1150 O  O   . LYS A 1 176 ? -6.420  -13.375 7.641  1.00 19.64 ? 168 LYS A O   1 
ATOM   1151 C  CB  . LYS A 1 176 ? -7.282  -15.381 9.299  1.00 22.62 ? 168 LYS A CB  1 
ATOM   1152 C  CG  . LYS A 1 176 ? -7.775  -16.560 10.133 1.00 23.14 ? 168 LYS A CG  1 
ATOM   1153 C  CD  . LYS A 1 176 ? -7.069  -17.891 9.856  1.00 24.46 ? 168 LYS A CD  1 
ATOM   1154 C  CE  . LYS A 1 176 ? -7.196  -18.426 8.412  1.00 24.78 ? 168 LYS A CE  1 
ATOM   1155 N  NZ  . LYS A 1 176 ? -7.749  -19.817 8.424  1.00 25.62 ? 168 LYS A NZ  1 
ATOM   1156 N  N   . ASN A 1 177 ? -4.248  -13.792 7.831  1.00 19.38 ? 169 ASN A N   1 
ATOM   1157 C  CA  . ASN A 1 177 ? -3.838  -12.582 7.083  1.00 18.28 ? 169 ASN A CA  1 
ATOM   1158 C  C   . ASN A 1 177 ? -4.363  -11.253 7.651  1.00 17.15 ? 169 ASN A C   1 
ATOM   1159 O  O   . ASN A 1 177 ? -4.448  -10.270 6.918  1.00 17.39 ? 169 ASN A O   1 
ATOM   1160 C  CB  . ASN A 1 177 ? -4.259  -12.683 5.600  1.00 18.32 ? 169 ASN A CB  1 
ATOM   1161 C  CG  . ASN A 1 177 ? -3.584  -13.812 4.876  1.00 18.51 ? 169 ASN A CG  1 
ATOM   1162 O  OD1 . ASN A 1 177 ? -2.565  -14.294 5.294  1.00 19.79 ? 169 ASN A OD1 1 
ATOM   1163 N  ND2 . ASN A 1 177 ? -4.138  -14.200 3.756  1.00 19.10 ? 169 ASN A ND2 1 
ATOM   1164 N  N   . GLN A 1 178 ? -4.696  -11.214 8.939  1.00 16.36 ? 170 GLN A N   1 
ATOM   1165 C  CA  . GLN A 1 178 ? -5.134  -9.995  9.601  1.00 15.77 ? 170 GLN A CA  1 
ATOM   1166 C  C   . GLN A 1 178 ? -4.086  -8.906  9.462  1.00 15.51 ? 170 GLN A C   1 
ATOM   1167 O  O   . GLN A 1 178 ? -2.908  -9.182  9.548  1.00 16.00 ? 170 GLN A O   1 
ATOM   1168 C  CB  . GLN A 1 178 ? -5.375  -10.242 11.085 1.00 15.42 ? 170 GLN A CB  1 
ATOM   1169 N  N   . LEU A 1 179 ? -4.526  -7.676  9.270  1.00 15.19 ? 171 LEU A N   1 
ATOM   1170 C  CA  . LEU A 1 179 ? -3.642  -6.523  9.354  1.00 15.21 ? 171 LEU A CA  1 
ATOM   1171 C  C   . LEU A 1 179 ? -3.336  -6.233  10.807 1.00 15.08 ? 171 LEU A C   1 
ATOM   1172 O  O   . LEU A 1 179 ? -4.228  -6.215  11.616 1.00 15.53 ? 171 LEU A O   1 
ATOM   1173 C  CB  . LEU A 1 179 ? -4.298  -5.301  8.735  1.00 15.18 ? 171 LEU A CB  1 
ATOM   1174 C  CG  . LEU A 1 179 ? -4.380  -5.360  7.217  1.00 15.31 ? 171 LEU A CG  1 
ATOM   1175 C  CD1 . LEU A 1 179 ? -5.364  -4.326  6.718  1.00 15.47 ? 171 LEU A CD1 1 
ATOM   1176 C  CD2 . LEU A 1 179 ? -2.993  -5.099  6.640  1.00 15.65 ? 171 LEU A CD2 1 
ATOM   1177 N  N   . VAL A 1 180 ? -2.078  -5.973  11.122 1.00 14.63 ? 172 VAL A N   1 
ATOM   1178 C  CA  . VAL A 1 180 ? -1.684  -5.770  12.494 1.00 14.31 ? 172 VAL A CA  1 
ATOM   1179 C  C   . VAL A 1 180 ? -0.627  -4.663  12.585 1.00 13.77 ? 172 VAL A C   1 
ATOM   1180 O  O   . VAL A 1 180 ? 0.245   -4.550  11.721 1.00 13.39 ? 172 VAL A O   1 
ATOM   1181 C  CB  . VAL A 1 180 ? -1.213  -7.121  13.083 1.00 14.57 ? 172 VAL A CB  1 
ATOM   1182 C  CG1 . VAL A 1 180 ? 0.156   -7.534  12.551 1.00 14.44 ? 172 VAL A CG1 1 
ATOM   1183 C  CG2 . VAL A 1 180 ? -1.196  -7.063  14.596 1.00 15.11 ? 172 VAL A CG2 1 
ATOM   1184 N  N   . ILE A 1 181 ? -0.734  -3.823  13.603 1.00 14.00 ? 173 ILE A N   1 
ATOM   1185 C  CA  . ILE A 1 181 ? 0.267   -2.799  13.862 1.00 13.94 ? 173 ILE A CA  1 
ATOM   1186 C  C   . ILE A 1 181 ? 1.345   -3.450  14.726 1.00 14.44 ? 173 ILE A C   1 
ATOM   1187 O  O   . ILE A 1 181 ? 1.052   -4.152  15.688 1.00 15.18 ? 173 ILE A O   1 
ATOM   1188 C  CB  . ILE A 1 181 ? -0.326  -1.549  14.540 1.00 13.49 ? 173 ILE A CB  1 
ATOM   1189 C  CG1 . ILE A 1 181 ? -1.356  -0.884  13.619 1.00 13.36 ? 173 ILE A CG1 1 
ATOM   1190 C  CG2 . ILE A 1 181 ? 0.786   -0.573  14.911 1.00 13.37 ? 173 ILE A CG2 1 
ATOM   1191 C  CD1 . ILE A 1 181 ? -2.187  0.222   14.275 1.00 13.50 ? 173 ILE A CD1 1 
ATOM   1192 N  N   . ASP A 1 182 ? 2.601   -3.210  14.361 1.00 14.64 ? 174 ASP A N   1 
ATOM   1193 C  CA  . ASP A 1 182 ? 3.761   -3.847  15.020 1.00 14.55 ? 174 ASP A CA  1 
ATOM   1194 C  C   . ASP A 1 182 ? 4.872   -2.797  15.173 1.00 13.52 ? 174 ASP A C   1 
ATOM   1195 O  O   . ASP A 1 182 ? 5.208   -2.111  14.231 1.00 12.84 ? 174 ASP A O   1 
ATOM   1196 C  CB  . ASP A 1 182 ? 4.268   -5.019  14.179 1.00 14.75 ? 174 ASP A CB  1 
ATOM   1197 C  CG  . ASP A 1 182 ? 5.271   -5.886  14.910 1.00 14.96 ? 174 ASP A CG  1 
ATOM   1198 O  OD1 . ASP A 1 182 ? 4.923   -6.451  15.938 1.00 16.53 ? 174 ASP A OD1 1 
ATOM   1199 O  OD2 . ASP A 1 182 ? 6.410   -6.014  14.479 1.00 14.71 ? 174 ASP A OD2 1 
ATOM   1200 N  N   . ASN A 1 183 ? 5.421   -2.717  16.377 1.00 12.92 ? 175 ASN A N   1 
ATOM   1201 C  CA  . ASN A 1 183 ? 6.544   -1.898  16.681 1.00 12.48 ? 175 ASN A CA  1 
ATOM   1202 C  C   . ASN A 1 183 ? 7.800   -2.763  16.731 1.00 11.99 ? 175 ASN A C   1 
ATOM   1203 O  O   . ASN A 1 183 ? 7.789   -3.804  17.335 1.00 11.96 ? 175 ASN A O   1 
ATOM   1204 C  CB  . ASN A 1 183 ? 6.338   -1.241  18.048 1.00 13.08 ? 175 ASN A CB  1 
ATOM   1205 C  CG  . ASN A 1 183 ? 5.571   0.068   17.973 1.00 13.16 ? 175 ASN A CG  1 
ATOM   1206 O  OD1 . ASN A 1 183 ? 5.214   0.556   16.897 1.00 13.47 ? 175 ASN A OD1 1 
ATOM   1207 N  ND2 . ASN A 1 183 ? 5.351   0.660   19.109 1.00 13.22 ? 175 ASN A ND2 1 
ATOM   1208 N  N   . THR A 1 184 ? 8.880   -2.318  16.067 1.00 11.38 ? 176 THR A N   1 
ATOM   1209 C  CA  . THR A 1 184 ? 10.216  -2.898  16.253 1.00 10.49 ? 176 THR A CA  1 
ATOM   1210 C  C   . THR A 1 184 ? 11.197  -1.839  16.771 1.00 10.05 ? 176 THR A C   1 
ATOM   1211 O  O   . THR A 1 184 ? 11.000  -0.638  16.606 1.00 9.64  ? 176 THR A O   1 
ATOM   1212 C  CB  . THR A 1 184 ? 10.794  -3.531  14.959 1.00 10.21 ? 176 THR A CB  1 
ATOM   1213 O  OG1 . THR A 1 184 ? 10.906  -2.536  13.937 1.00 9.66  ? 176 THR A OG1 1 
ATOM   1214 C  CG2 . THR A 1 184 ? 9.899   -4.689  14.486 1.00 10.32 ? 176 THR A CG2 1 
ATOM   1215 N  N   . SER A 1 185 ? 12.239  -2.339  17.437 1.00 9.81  ? 177 SER A N   1 
ATOM   1216 C  CA  . SER A 1 185 ? 13.292  -1.538  18.046 1.00 9.31  ? 177 SER A CA  1 
ATOM   1217 C  C   . SER A 1 185 ? 14.534  -1.636  17.207 1.00 8.94  ? 177 SER A C   1 
ATOM   1218 O  O   . SER A 1 185 ? 14.896  -2.718  16.740 1.00 8.57  ? 177 SER A O   1 
ATOM   1219 C  CB  . SER A 1 185 ? 13.611  -2.063  19.450 1.00 9.64  ? 177 SER A CB  1 
ATOM   1220 O  OG  . SER A 1 185 ? 14.750  -1.390  19.996 1.00 9.63  ? 177 SER A OG  1 
ATOM   1221 N  N   . ASN A 1 186 ? 15.178  -0.491  17.005 1.00 8.87  ? 178 ASN A N   1 
ATOM   1222 C  CA  . ASN A 1 186 ? 16.469  -0.417  16.332 1.00 8.87  ? 178 ASN A CA  1 
ATOM   1223 C  C   . ASN A 1 186 ? 16.417  -0.890  14.880 1.00 8.98  ? 178 ASN A C   1 
ATOM   1224 O  O   . ASN A 1 186 ? 15.749  -0.233  14.069 1.00 8.98  ? 178 ASN A O   1 
ATOM   1225 C  CB  . ASN A 1 186 ? 17.545  -1.089  17.200 1.00 8.93  ? 178 ASN A CB  1 
ATOM   1226 C  CG  . ASN A 1 186 ? 17.829  -0.295  18.472 1.00 8.98  ? 178 ASN A CG  1 
ATOM   1227 O  OD1 . ASN A 1 186 ? 17.389  0.840   18.615 1.00 8.85  ? 178 ASN A OD1 1 
ATOM   1228 N  ND2 . ASN A 1 186 ? 18.594  -0.869  19.374 1.00 9.13  ? 178 ASN A ND2 1 
ATOM   1229 N  N   . ALA A 1 187 ? 17.059  -2.015  14.544 1.00 9.26  ? 179 ALA A N   1 
ATOM   1230 C  CA  . ALA A 1 187 ? 16.979  -2.577  13.181 1.00 9.14  ? 179 ALA A CA  1 
ATOM   1231 C  C   . ALA A 1 187 ? 15.908  -3.653  13.017 1.00 9.38  ? 179 ALA A C   1 
ATOM   1232 O  O   . ALA A 1 187 ? 15.785  -4.281  11.933 1.00 9.07  ? 179 ALA A O   1 
ATOM   1233 C  CB  . ALA A 1 187 ? 18.321  -3.132  12.753 1.00 8.97  ? 179 ALA A CB  1 
ATOM   1234 N  N   . GLY A 1 188 ? 15.155  -3.888  14.083 1.00 9.70  ? 180 GLY A N   1 
ATOM   1235 C  CA  . GLY A 1 188 ? 14.159  -4.958  14.115 1.00 9.87  ? 180 GLY A CA  1 
ATOM   1236 C  C   . GLY A 1 188 ? 13.249  -4.943  12.897 1.00 10.26 ? 180 GLY A C   1 
ATOM   1237 O  O   . GLY A 1 188 ? 12.744  -3.868  12.470 1.00 9.82  ? 180 GLY A O   1 
ATOM   1238 N  N   . CYS A 1 189 ? 13.035  -6.136  12.333 1.00 10.36 ? 181 CYS A N   1 
ATOM   1239 C  CA  . CYS A 1 189 ? 12.441  -6.262  11.034 1.00 10.58 ? 181 CYS A CA  1 
ATOM   1240 C  C   . CYS A 1 189 ? 11.387  -7.399  11.092 1.00 10.94 ? 181 CYS A C   1 
ATOM   1241 O  O   . CYS A 1 189 ? 11.727  -8.552  11.425 1.00 10.73 ? 181 CYS A O   1 
ATOM   1242 C  CB  . CYS A 1 189 ? 13.545  -6.533  10.013 1.00 10.78 ? 181 CYS A CB  1 
ATOM   1243 S  SG  . CYS A 1 189 ? 13.059  -6.518  8.273  1.00 11.33 ? 181 CYS A SG  1 
ATOM   1244 N  N   . PRO A 1 190 ? 10.106  -7.068  10.811 1.00 10.85 ? 182 PRO A N   1 
ATOM   1245 C  CA  . PRO A 1 190 ? 8.959   -7.956  10.997 1.00 11.25 ? 182 PRO A CA  1 
ATOM   1246 C  C   . PRO A 1 190 ? 9.073   -9.362  10.370 1.00 11.68 ? 182 PRO A C   1 
ATOM   1247 O  O   . PRO A 1 190 ? 8.527   -10.314 10.912 1.00 11.31 ? 182 PRO A O   1 
ATOM   1248 C  CB  . PRO A 1 190 ? 7.816   -7.197  10.322 1.00 11.42 ? 182 PRO A CB  1 
ATOM   1249 C  CG  . PRO A 1 190 ? 8.214   -5.761  10.376 1.00 11.35 ? 182 PRO A CG  1 
ATOM   1250 C  CD  . PRO A 1 190 ? 9.710   -5.744  10.284 1.00 10.90 ? 182 PRO A CD  1 
ATOM   1251 N  N   . LEU A 1 191 ? 9.787   -9.486  9.251  1.00 11.97 ? 183 LEU A N   1 
ATOM   1252 C  CA  . LEU A 1 191 ? 9.912   -10.768 8.614  1.00 12.81 ? 183 LEU A CA  1 
ATOM   1253 C  C   . LEU A 1 191 ? 10.542  -11.797 9.535  1.00 12.93 ? 183 LEU A C   1 
ATOM   1254 O  O   . LEU A 1 191 ? 10.239  -12.988 9.400  1.00 13.09 ? 183 LEU A O   1 
ATOM   1255 C  CB  . LEU A 1 191 ? 10.665  -10.688 7.296  1.00 13.15 ? 183 LEU A CB  1 
ATOM   1256 C  CG  . LEU A 1 191 ? 12.175  -10.506 7.401  1.00 13.96 ? 183 LEU A CG  1 
ATOM   1257 C  CD1 . LEU A 1 191 ? 12.913  -11.839 7.424  1.00 14.80 ? 183 LEU A CD1 1 
ATOM   1258 C  CD2 . LEU A 1 191 ? 12.692  -9.672  6.222  1.00 14.43 ? 183 LEU A CD2 1 
ATOM   1259 N  N   . THR A 1 192 ? 11.380  -11.380 10.475 1.00 12.86 ? 184 THR A N   1 
ATOM   1260 C  CA  . THR A 1 192 ? 11.957  -12.355 11.412 1.00 13.52 ? 184 THR A CA  1 
ATOM   1261 C  C   . THR A 1 192 ? 10.898  -12.965 12.315 1.00 14.97 ? 184 THR A C   1 
ATOM   1262 O  O   . THR A 1 192 ? 11.120  -14.027 12.883 1.00 15.50 ? 184 THR A O   1 
ATOM   1263 C  CB  . THR A 1 192 ? 13.088  -11.795 12.297 1.00 12.73 ? 184 THR A CB  1 
ATOM   1264 O  OG1 . THR A 1 192 ? 12.565  -10.853 13.227 1.00 12.16 ? 184 THR A OG1 1 
ATOM   1265 C  CG2 . THR A 1 192 ? 14.125  -11.163 11.451 1.00 12.45 ? 184 THR A CG2 1 
ATOM   1266 N  N   . LYS A 1 193 ? 9.736   -12.344 12.458 1.00 16.38 ? 185 LYS A N   1 
ATOM   1267 C  CA  . LYS A 1 193 ? 8.675   -13.115 13.122 1.00 17.60 ? 185 LYS A CA  1 
ATOM   1268 C  C   . LYS A 1 193 ? 7.528   -13.506 12.204 1.00 17.64 ? 185 LYS A C   1 
ATOM   1269 O  O   . LYS A 1 193 ? 6.436   -13.770 12.649 1.00 18.00 ? 185 LYS A O   1 
ATOM   1270 C  CB  . LYS A 1 193 ? 8.237   -12.522 14.469 1.00 19.45 ? 185 LYS A CB  1 
ATOM   1271 C  CG  . LYS A 1 193 ? 8.045   -11.048 14.508 1.00 21.87 ? 185 LYS A CG  1 
ATOM   1272 C  CD  . LYS A 1 193 ? 7.800   -10.600 15.944 1.00 23.57 ? 185 LYS A CD  1 
ATOM   1273 C  CE  . LYS A 1 193 ? 7.121   -9.220  15.965 1.00 25.65 ? 185 LYS A CE  1 
ATOM   1274 N  NZ  . LYS A 1 193 ? 7.987   -8.016  15.682 1.00 25.64 ? 185 LYS A NZ  1 
ATOM   1275 N  N   . GLY A 1 194 ? 7.822   -13.633 10.921 1.00 17.23 ? 186 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 194 ? 6.880   -14.185 9.982  1.00 17.48 ? 186 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 194 ? 5.889   -13.181 9.414  1.00 17.60 ? 186 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 194 ? 5.104   -13.551 8.543  1.00 19.50 ? 186 GLY A O   1 
ATOM   1279 N  N   . LEU A 1 195 ? 5.927   -11.919 9.872  1.00 16.00 ? 187 LEU A N   1 
ATOM   1280 C  CA  . LEU A 1 195 ? 4.982   -10.925 9.418  1.00 14.82 ? 187 LEU A CA  1 
ATOM   1281 C  C   . LEU A 1 195 ? 5.434   -10.354 8.078  1.00 14.09 ? 187 LEU A C   1 
ATOM   1282 O  O   . LEU A 1 195 ? 6.621   -10.216 7.856  1.00 14.63 ? 187 LEU A O   1 
ATOM   1283 C  CB  . LEU A 1 195 ? 4.835   -9.797  10.477 1.00 14.65 ? 187 LEU A CB  1 
ATOM   1284 C  CG  . LEU A 1 195 ? 4.243   -10.149 11.869 1.00 15.09 ? 187 LEU A CG  1 
ATOM   1285 C  CD1 . LEU A 1 195 ? 4.216   -8.941  12.801 1.00 15.03 ? 187 LEU A CD1 1 
ATOM   1286 C  CD2 . LEU A 1 195 ? 2.838   -10.712 11.749 1.00 15.14 ? 187 LEU A CD2 1 
ATOM   1287 N  N   . ARG A 1 196 ? 4.477   -9.906  7.268  1.00 13.19 ? 188 ARG A N   1 
ATOM   1288 C  CA  . ARG A 1 196 ? 4.686   -9.285  5.963  1.00 12.05 ? 188 ARG A CA  1 
ATOM   1289 C  C   . ARG A 1 196 ? 4.296   -7.793  5.951  1.00 11.12 ? 188 ARG A C   1 
ATOM   1290 O  O   . ARG A 1 196 ? 3.111   -7.417  5.930  1.00 10.67 ? 188 ARG A O   1 
ATOM   1291 C  CB  . ARG A 1 196 ? 3.834   -10.019 4.930  1.00 12.77 ? 188 ARG A CB  1 
ATOM   1292 C  CG  . ARG A 1 196 ? 4.158   -11.497 4.839  1.00 13.13 ? 188 ARG A CG  1 
ATOM   1293 C  CD  . ARG A 1 196 ? 3.144   -12.285 4.035  1.00 13.95 ? 188 ARG A CD  1 
ATOM   1294 N  NE  . ARG A 1 196 ? 3.682   -13.619 3.817  1.00 14.48 ? 188 ARG A NE  1 
ATOM   1295 C  CZ  . ARG A 1 196 ? 3.248   -14.483 2.913  1.00 15.13 ? 188 ARG A CZ  1 
ATOM   1296 N  NH1 . ARG A 1 196 ? 2.197   -14.231 2.122  1.00 14.94 ? 188 ARG A NH1 1 
ATOM   1297 N  NH2 . ARG A 1 196 ? 3.867   -15.635 2.824  1.00 15.76 ? 188 ARG A NH2 1 
ATOM   1298 N  N   . PRO A 1 197 ? 5.293   -6.919  5.954  1.00 10.44 ? 189 PRO A N   1 
ATOM   1299 C  CA  . PRO A 1 197 ? 5.002   -5.479  6.039  1.00 9.97  ? 189 PRO A CA  1 
ATOM   1300 C  C   . PRO A 1 197 ? 4.269   -4.926  4.829  1.00 9.56  ? 189 PRO A C   1 
ATOM   1301 O  O   . PRO A 1 197 ? 4.608   -5.291  3.720  1.00 9.20  ? 189 PRO A O   1 
ATOM   1302 C  CB  . PRO A 1 197 ? 6.399   -4.843  6.141  1.00 9.71  ? 189 PRO A CB  1 
ATOM   1303 C  CG  . PRO A 1 197 ? 7.290   -5.833  5.528  1.00 9.96  ? 189 PRO A CG  1 
ATOM   1304 C  CD  . PRO A 1 197 ? 6.735   -7.184  5.862  1.00 10.17 ? 189 PRO A CD  1 
ATOM   1305 N  N   . VAL A 1 198 ? 3.308   -4.032  5.058  1.00 9.24  ? 190 VAL A N   1 
ATOM   1306 C  CA  . VAL A 1 198 ? 2.700   -3.234  3.963  1.00 9.41  ? 190 VAL A CA  1 
ATOM   1307 C  C   . VAL A 1 198 ? 2.963   -1.737  4.097  1.00 9.37  ? 190 VAL A C   1 
ATOM   1308 O  O   . VAL A 1 198 ? 2.884   -0.984  3.099  1.00 10.07 ? 190 VAL A O   1 
ATOM   1309 C  CB  . VAL A 1 198 ? 1.184   -3.486  3.837  1.00 9.59  ? 190 VAL A CB  1 
ATOM   1310 C  CG1 . VAL A 1 198 ? 0.910   -4.988  3.736  1.00 9.72  ? 190 VAL A CG1 1 
ATOM   1311 C  CG2 . VAL A 1 198 ? 0.410   -2.902  5.007  1.00 9.41  ? 190 VAL A CG2 1 
ATOM   1312 N  N   . LEU A 1 199 ? 3.312   -1.302  5.303  1.00 9.10  ? 191 LEU A N   1 
ATOM   1313 C  CA  . LEU A 1 199 ? 3.691   0.095   5.579  1.00 8.92  ? 191 LEU A CA  1 
ATOM   1314 C  C   . LEU A 1 199 ? 4.757   0.177   6.697  1.00 8.68  ? 191 LEU A C   1 
ATOM   1315 O  O   . LEU A 1 199 ? 4.656   -0.522  7.709  1.00 8.58  ? 191 LEU A O   1 
ATOM   1316 C  CB  . LEU A 1 199 ? 2.444   0.886   5.989  1.00 8.84  ? 191 LEU A CB  1 
ATOM   1317 C  CG  . LEU A 1 199 ? 2.630   2.292   6.533  1.00 8.84  ? 191 LEU A CG  1 
ATOM   1318 C  CD1 . LEU A 1 199 ? 3.218   3.275   5.512  1.00 8.87  ? 191 LEU A CD1 1 
ATOM   1319 C  CD2 . LEU A 1 199 ? 1.304   2.797   7.057  1.00 8.94  ? 191 LEU A CD2 1 
ATOM   1320 N  N   . ALA A 1 200 ? 5.762   1.031   6.502  1.00 8.57  ? 192 ALA A N   1 
ATOM   1321 C  CA  . ALA A 1 200 ? 6.736   1.352   7.548  1.00 8.43  ? 192 ALA A CA  1 
ATOM   1322 C  C   . ALA A 1 200 ? 6.852   2.857   7.781  1.00 8.27  ? 192 ALA A C   1 
ATOM   1323 O  O   . ALA A 1 200 ? 6.878   3.645   6.827  1.00 8.47  ? 192 ALA A O   1 
ATOM   1324 C  CB  . ALA A 1 200 ? 8.086   0.809   7.191  1.00 8.44  ? 192 ALA A CB  1 
ATOM   1325 N  N   . VAL A 1 201 ? 6.946   3.242   9.057  1.00 8.12  ? 193 VAL A N   1 
ATOM   1326 C  CA  . VAL A 1 201 ? 7.311   4.600   9.419  1.00 8.01  ? 193 VAL A CA  1 
ATOM   1327 C  C   . VAL A 1 201 ? 8.497   4.547   10.401 1.00 7.83  ? 193 VAL A C   1 
ATOM   1328 O  O   . VAL A 1 201 ? 8.425   3.926   11.451 1.00 7.82  ? 193 VAL A O   1 
ATOM   1329 C  CB  . VAL A 1 201 ? 6.099   5.379   9.963  1.00 8.16  ? 193 VAL A CB  1 
ATOM   1330 C  CG1 . VAL A 1 201 ? 6.485   6.791   10.439 1.00 8.14  ? 193 VAL A CG1 1 
ATOM   1331 C  CG2 . VAL A 1 201 ? 5.038   5.460   8.869  1.00 8.26  ? 193 VAL A CG2 1 
ATOM   1332 N  N   . ASP A 1 202 ? 9.597   5.161   9.978  1.00 7.67  ? 194 ASP A N   1 
ATOM   1333 C  CA  . ASP A 1 202 ? 10.825  5.238   10.740 1.00 7.64  ? 194 ASP A CA  1 
ATOM   1334 C  C   . ASP A 1 202 ? 10.585  6.153   11.937 1.00 7.83  ? 194 ASP A C   1 
ATOM   1335 O  O   . ASP A 1 202 ? 10.099  7.266   11.753 1.00 8.01  ? 194 ASP A O   1 
ATOM   1336 C  CB  . ASP A 1 202 ? 11.881  5.822   9.826  1.00 7.51  ? 194 ASP A CB  1 
ATOM   1337 C  CG  . ASP A 1 202 ? 13.287  5.640   10.316 1.00 7.60  ? 194 ASP A CG  1 
ATOM   1338 O  OD1 . ASP A 1 202 ? 13.539  5.178   11.470 1.00 7.56  ? 194 ASP A OD1 1 
ATOM   1339 O  OD2 . ASP A 1 202 ? 14.182  6.062   9.531  1.00 7.54  ? 194 ASP A OD2 1 
ATOM   1340 N  N   . VAL A 1 203 ? 10.859  5.687   13.148 1.00 7.83  ? 195 VAL A N   1 
ATOM   1341 C  CA  . VAL A 1 203 ? 10.839  6.587   14.311 1.00 8.10  ? 195 VAL A CA  1 
ATOM   1342 C  C   . VAL A 1 203 ? 12.205  6.745   14.981 1.00 8.17  ? 195 VAL A C   1 
ATOM   1343 O  O   . VAL A 1 203 ? 12.320  7.333   16.079 1.00 8.57  ? 195 VAL A O   1 
ATOM   1344 C  CB  . VAL A 1 203 ? 9.721   6.240   15.311 1.00 8.30  ? 195 VAL A CB  1 
ATOM   1345 C  CG1 . VAL A 1 203 ? 8.353   6.464   14.634 1.00 8.39  ? 195 VAL A CG1 1 
ATOM   1346 C  CG2 . VAL A 1 203 ? 9.829   4.806   15.841 1.00 8.32  ? 195 VAL A CG2 1 
ATOM   1347 N  N   . TRP A 1 204 ? 13.266  6.328   14.289 1.00 8.06  ? 196 TRP A N   1 
ATOM   1348 C  CA  . TRP A 1 204 ? 14.585  6.826   14.665 1.00 8.20  ? 196 TRP A CA  1 
ATOM   1349 C  C   . TRP A 1 204 ? 14.502  8.333   14.608 1.00 8.24  ? 196 TRP A C   1 
ATOM   1350 O  O   . TRP A 1 204 ? 13.912  8.889   13.697 1.00 8.40  ? 196 TRP A O   1 
ATOM   1351 C  CB  . TRP A 1 204 ? 15.666  6.357   13.705 1.00 8.30  ? 196 TRP A CB  1 
ATOM   1352 C  CG  . TRP A 1 204 ? 16.121  4.898   13.886 1.00 8.17  ? 196 TRP A CG  1 
ATOM   1353 C  CD1 . TRP A 1 204 ? 15.369  3.775   13.720 1.00 8.06  ? 196 TRP A CD1 1 
ATOM   1354 C  CD2 . TRP A 1 204 ? 17.451  4.461   14.175 1.00 8.14  ? 196 TRP A CD2 1 
ATOM   1355 N  NE1 . TRP A 1 204 ? 16.144  2.653   13.932 1.00 8.28  ? 196 TRP A NE1 1 
ATOM   1356 C  CE2 . TRP A 1 204 ? 17.430  3.051   14.209 1.00 8.24  ? 196 TRP A CE2 1 
ATOM   1357 C  CE3 . TRP A 1 204 ? 18.647  5.124   14.429 1.00 8.19  ? 196 TRP A CE3 1 
ATOM   1358 C  CZ2 . TRP A 1 204 ? 18.547  2.307   14.502 1.00 8.24  ? 196 TRP A CZ2 1 
ATOM   1359 C  CZ3 . TRP A 1 204 ? 19.778  4.370   14.709 1.00 8.32  ? 196 TRP A CZ3 1 
ATOM   1360 C  CH2 . TRP A 1 204 ? 19.720  2.983   14.739 1.00 8.34  ? 196 TRP A CH2 1 
ATOM   1361 N  N   . GLU A 1 205 ? 15.102  9.000   15.571 1.00 8.57  ? 197 GLU A N   1 
ATOM   1362 C  CA  . GLU A 1 205 ? 14.992  10.478  15.682 1.00 8.69  ? 197 GLU A CA  1 
ATOM   1363 C  C   . GLU A 1 205 ? 15.507  11.190  14.443 1.00 8.55  ? 197 GLU A C   1 
ATOM   1364 O  O   . GLU A 1 205 ? 14.972  12.197  14.047 1.00 8.44  ? 197 GLU A O   1 
ATOM   1365 C  CB  . GLU A 1 205 ? 15.697  10.979  16.944 1.00 8.86  ? 197 GLU A CB  1 
ATOM   1366 C  CG  . GLU A 1 205 ? 15.058  10.426  18.209 1.00 8.97  ? 197 GLU A CG  1 
ATOM   1367 C  CD  . GLU A 1 205 ? 15.642  10.991  19.498 1.00 9.25  ? 197 GLU A CD  1 
ATOM   1368 O  OE1 . GLU A 1 205 ? 16.845  10.783  19.748 1.00 9.41  ? 197 GLU A OE1 1 
ATOM   1369 O  OE2 . GLU A 1 205 ? 14.897  11.604  20.289 1.00 9.28  ? 197 GLU A OE2 1 
ATOM   1370 N  N   . HIS A 1 206 ? 16.494  10.609  13.777 1.00 8.72  ? 198 HIS A N   1 
ATOM   1371 C  CA  . HIS A 1 206 ? 17.009  11.188  12.519 1.00 8.80  ? 198 HIS A CA  1 
ATOM   1372 C  C   . HIS A 1 206 ? 16.013  11.262  11.399 1.00 8.54  ? 198 HIS A C   1 
ATOM   1373 O  O   . HIS A 1 206 ? 16.243  11.961  10.461 1.00 8.78  ? 198 HIS A O   1 
ATOM   1374 C  CB  . HIS A 1 206 ? 18.271  10.471  12.018 1.00 9.03  ? 198 HIS A CB  1 
ATOM   1375 C  CG  . HIS A 1 206 ? 18.057  9.068   11.538 1.00 9.11  ? 198 HIS A CG  1 
ATOM   1376 N  ND1 . HIS A 1 206 ? 18.751  7.999   12.062 1.00 9.26  ? 198 HIS A ND1 1 
ATOM   1377 C  CD2 . HIS A 1 206 ? 17.294  8.564   10.541 1.00 9.14  ? 198 HIS A CD2 1 
ATOM   1378 C  CE1 . HIS A 1 206 ? 18.411  6.891   11.426 1.00 9.18  ? 198 HIS A CE1 1 
ATOM   1379 N  NE2 . HIS A 1 206 ? 17.525  7.207   10.502 1.00 9.39  ? 198 HIS A NE2 1 
ATOM   1380 N  N   . ALA A 1 207 ? 14.914  10.533  11.475 1.00 8.47  ? 199 ALA A N   1 
ATOM   1381 C  CA  . ALA A 1 207 ? 13.928  10.579  10.381 1.00 8.47  ? 199 ALA A CA  1 
ATOM   1382 C  C   . ALA A 1 207 ? 13.164  11.891  10.366 1.00 8.56  ? 199 ALA A C   1 
ATOM   1383 O  O   . ALA A 1 207 ? 12.667  12.307  9.323  1.00 8.62  ? 199 ALA A O   1 
ATOM   1384 C  CB  . ALA A 1 207 ? 12.958  9.399   10.459 1.00 8.47  ? 199 ALA A CB  1 
ATOM   1385 N  N   . TYR A 1 208 ? 13.043  12.514  11.534 1.00 8.56  ? 200 TYR A N   1 
ATOM   1386 C  CA  . TYR A 1 208 ? 12.225  13.683  11.683 1.00 8.66  ? 200 TYR A CA  1 
ATOM   1387 C  C   . TYR A 1 208 ? 12.862  14.886  12.368 1.00 8.94  ? 200 TYR A C   1 
ATOM   1388 O  O   . TYR A 1 208 ? 12.224  15.964  12.403 1.00 8.84  ? 200 TYR A O   1 
ATOM   1389 C  CB  . TYR A 1 208 ? 10.958  13.327  12.468 1.00 8.69  ? 200 TYR A CB  1 
ATOM   1390 C  CG  . TYR A 1 208 ? 11.172  12.761  13.852 1.00 8.73  ? 200 TYR A CG  1 
ATOM   1391 C  CD1 . TYR A 1 208 ? 11.390  13.581  14.937 1.00 8.97  ? 200 TYR A CD1 1 
ATOM   1392 C  CD2 . TYR A 1 208 ? 11.123  11.375  14.067 1.00 8.69  ? 200 TYR A CD2 1 
ATOM   1393 C  CE1 . TYR A 1 208 ? 11.529  13.064  16.224 1.00 9.00  ? 200 TYR A CE1 1 
ATOM   1394 C  CE2 . TYR A 1 208 ? 11.298  10.838  15.321 1.00 8.71  ? 200 TYR A CE2 1 
ATOM   1395 C  CZ  . TYR A 1 208 ? 11.490  11.673  16.408 1.00 8.93  ? 200 TYR A CZ  1 
ATOM   1396 O  OH  . TYR A 1 208 ? 11.644  11.117  17.659 1.00 8.77  ? 200 TYR A OH  1 
ATOM   1397 N  N   . TYR A 1 209 ? 14.079  14.723  12.926 1.00 8.93  ? 201 TYR A N   1 
ATOM   1398 C  CA  . TYR A 1 209 ? 14.612  15.730  13.828 1.00 9.15  ? 201 TYR A CA  1 
ATOM   1399 C  C   . TYR A 1 209 ? 14.961  17.010  13.102 1.00 9.61  ? 201 TYR A C   1 
ATOM   1400 O  O   . TYR A 1 209 ? 14.875  18.087  13.705 1.00 9.92  ? 201 TYR A O   1 
ATOM   1401 C  CB  . TYR A 1 209 ? 15.803  15.226  14.670 1.00 8.99  ? 201 TYR A CB  1 
ATOM   1402 C  CG  . TYR A 1 209 ? 15.794  15.823  16.080 1.00 8.96  ? 201 TYR A CG  1 
ATOM   1403 C  CD1 . TYR A 1 209 ? 15.104  15.204  17.116 1.00 8.70  ? 201 TYR A CD1 1 
ATOM   1404 C  CD2 . TYR A 1 209 ? 16.442  17.042  16.360 1.00 9.12  ? 201 TYR A CD2 1 
ATOM   1405 C  CE1 . TYR A 1 209 ? 15.101  15.731  18.408 1.00 8.87  ? 201 TYR A CE1 1 
ATOM   1406 C  CE2 . TYR A 1 209 ? 16.427  17.591  17.643 1.00 9.18  ? 201 TYR A CE2 1 
ATOM   1407 C  CZ  . TYR A 1 209 ? 15.754  16.941  18.665 1.00 9.10  ? 201 TYR A CZ  1 
ATOM   1408 O  OH  . TYR A 1 209 ? 15.726  17.489  19.923 1.00 9.17  ? 201 TYR A OH  1 
ATOM   1409 N  N   . LYS A 1 210 ? 15.320  16.909  11.811 1.00 9.82  ? 202 LYS A N   1 
ATOM   1410 C  CA  . LYS A 1 210 ? 15.676  18.100  11.035 1.00 10.39 ? 202 LYS A CA  1 
ATOM   1411 C  C   . LYS A 1 210 ? 14.447  18.998  10.849 1.00 10.46 ? 202 LYS A C   1 
ATOM   1412 O  O   . LYS A 1 210 ? 14.517  20.191  11.111 1.00 10.70 ? 202 LYS A O   1 
ATOM   1413 C  CB  . LYS A 1 210 ? 16.333  17.744  9.675  1.00 10.60 ? 202 LYS A CB  1 
ATOM   1414 C  CG  . LYS A 1 210 ? 16.506  18.912  8.693  1.00 10.94 ? 202 LYS A CG  1 
ATOM   1415 C  CD  . LYS A 1 210 ? 17.285  20.093  9.244  1.00 11.44 ? 202 LYS A CD  1 
ATOM   1416 C  CE  . LYS A 1 210 ? 18.749  19.782  9.341  1.00 11.89 ? 202 LYS A CE  1 
ATOM   1417 N  NZ  . LYS A 1 210 ? 19.570  21.015  9.518  1.00 12.56 ? 202 LYS A NZ  1 
ATOM   1418 N  N   . ASP A 1 211 ? 13.323  18.401  10.458 1.00 10.07 ? 203 ASP A N   1 
ATOM   1419 C  CA  . ASP A 1 211 ? 12.113  19.147  10.164 1.00 10.13 ? 203 ASP A CA  1 
ATOM   1420 C  C   . ASP A 1 211 ? 11.182  19.293  11.376 1.00 10.36 ? 203 ASP A C   1 
ATOM   1421 O  O   . ASP A 1 211 ? 10.439  20.259  11.472 1.00 10.79 ? 203 ASP A O   1 
ATOM   1422 C  CB  . ASP A 1 211 ? 11.353  18.471  9.020  1.00 9.94  ? 203 ASP A CB  1 
ATOM   1423 C  CG  . ASP A 1 211 ? 12.087  18.556  7.662  1.00 9.89  ? 203 ASP A CG  1 
ATOM   1424 O  OD1 . ASP A 1 211 ? 12.993  19.383  7.499  1.00 10.11 ? 203 ASP A OD1 1 
ATOM   1425 O  OD2 . ASP A 1 211 ? 11.731  17.805  6.741  1.00 9.65  ? 203 ASP A OD2 1 
ATOM   1426 N  N   . PHE A 1 212 ? 11.244  18.376  12.337 1.00 10.30 ? 204 PHE A N   1 
ATOM   1427 C  CA  . PHE A 1 212 ? 10.344  18.419  13.466 1.00 10.48 ? 204 PHE A CA  1 
ATOM   1428 C  C   . PHE A 1 212 ? 10.980  18.588  14.845 1.00 10.52 ? 204 PHE A C   1 
ATOM   1429 O  O   . PHE A 1 212 ? 10.252  18.749  15.840 1.00 10.56 ? 204 PHE A O   1 
ATOM   1430 C  CB  . PHE A 1 212 ? 9.494   17.159  13.452 1.00 10.54 ? 204 PHE A CB  1 
ATOM   1431 C  CG  . PHE A 1 212 ? 8.614   17.065  12.251 1.00 10.85 ? 204 PHE A CG  1 
ATOM   1432 C  CD1 . PHE A 1 212 ? 7.316   17.560  12.298 1.00 11.41 ? 204 PHE A CD1 1 
ATOM   1433 C  CD2 . PHE A 1 212 ? 9.075   16.470  11.079 1.00 10.81 ? 204 PHE A CD2 1 
ATOM   1434 C  CE1 . PHE A 1 212 ? 6.487   17.504  11.191 1.00 11.55 ? 204 PHE A CE1 1 
ATOM   1435 C  CE2 . PHE A 1 212 ? 8.259   16.404  9.965  1.00 11.13 ? 204 PHE A CE2 1 
ATOM   1436 C  CZ  . PHE A 1 212 ? 6.959   16.918  10.020 1.00 11.52 ? 204 PHE A CZ  1 
ATOM   1437 N  N   . GLU A 1 213 ? 12.302  18.534  14.923 1.00 10.23 ? 205 GLU A N   1 
ATOM   1438 C  CA  . GLU A 1 213 ? 12.999  18.526  16.193 1.00 10.53 ? 205 GLU A CA  1 
ATOM   1439 C  C   . GLU A 1 213 ? 12.390  17.409  17.086 1.00 10.69 ? 205 GLU A C   1 
ATOM   1440 O  O   . GLU A 1 213 ? 12.215  16.283  16.602 1.00 10.54 ? 205 GLU A O   1 
ATOM   1441 C  CB  . GLU A 1 213 ? 13.006  19.928  16.823 1.00 10.76 ? 205 GLU A CB  1 
ATOM   1442 C  CG  . GLU A 1 213 ? 13.766  20.969  15.990 1.00 10.84 ? 205 GLU A CG  1 
ATOM   1443 C  CD  . GLU A 1 213 ? 13.511  22.428  16.439 1.00 11.34 ? 205 GLU A CD  1 
ATOM   1444 O  OE1 . GLU A 1 213 ? 12.342  22.785  16.663 1.00 11.13 ? 205 GLU A OE1 1 
ATOM   1445 O  OE2 . GLU A 1 213 ? 14.484  23.218  16.595 1.00 11.36 ? 205 GLU A OE2 1 
ATOM   1446 N  N   . ASN A 1 214 ? 12.042  17.709  18.335 1.00 11.01 ? 206 ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 214 ? 11.496  16.705  19.248 1.00 11.20 ? 206 ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 214 ? 10.059  16.249  18.979 1.00 11.00 ? 206 ASN A C   1 
ATOM   1449 O  O   . ASN A 1 214 ? 9.572   15.328  19.631 1.00 10.85 ? 206 ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 214 ? 11.534  17.235  20.679 1.00 11.67 ? 206 ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 214 ? 10.651  18.459  20.848 1.00 12.39 ? 206 ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 214 ? 10.930  19.517  20.275 1.00 13.07 ? 206 ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 214 ? 9.559   18.320  21.615 1.00 12.49 ? 206 ASN A ND2 1 
ATOM   1454 N  N   . ARG A 1 215 ? 9.381   16.867  18.006 1.00 10.98 ? 207 ARG A N   1 
ATOM   1455 C  CA  . ARG A 1 215 ? 7.944   16.704  17.888 1.00 10.48 ? 207 ARG A CA  1 
ATOM   1456 C  C   . ARG A 1 215 ? 7.616   15.476  17.044 1.00 9.87  ? 207 ARG A C   1 
ATOM   1457 O  O   . ARG A 1 215 ? 7.031   15.582  15.960 1.00 9.89  ? 207 ARG A O   1 
ATOM   1458 C  CB  . ARG A 1 215 ? 7.315   17.995  17.363 1.00 10.71 ? 207 ARG A CB  1 
ATOM   1459 C  CG  . ARG A 1 215 ? 7.579   19.212  18.268 1.00 11.13 ? 207 ARG A CG  1 
ATOM   1460 C  CD  . ARG A 1 215 ? 7.050   20.515  17.660 1.00 11.33 ? 207 ARG A CD  1 
ATOM   1461 N  NE  . ARG A 1 215 ? 7.734   20.877  16.426 1.00 11.39 ? 207 ARG A NE  1 
ATOM   1462 C  CZ  . ARG A 1 215 ? 7.236   20.803  15.183 1.00 11.48 ? 207 ARG A CZ  1 
ATOM   1463 N  NH1 . ARG A 1 215 ? 5.994   20.370  14.910 1.00 11.34 ? 207 ARG A NH1 1 
ATOM   1464 N  NH2 . ARG A 1 215 ? 8.010   21.170  14.164 1.00 11.70 ? 207 ARG A NH2 1 
ATOM   1465 N  N   . ARG A 1 216 ? 7.964   14.284  17.558 1.00 9.29  ? 208 ARG A N   1 
ATOM   1466 C  CA  . ARG A 1 216 ? 7.616   13.040  16.887 1.00 8.69  ? 208 ARG A CA  1 
ATOM   1467 C  C   . ARG A 1 216 ? 6.130   12.907  16.609 1.00 8.66  ? 208 ARG A C   1 
ATOM   1468 O  O   . ARG A 1 216 ? 5.741   12.391  15.539 1.00 8.42  ? 208 ARG A O   1 
ATOM   1469 C  CB  . ARG A 1 216 ? 8.080   11.822  17.674 1.00 8.57  ? 208 ARG A CB  1 
ATOM   1470 C  CG  . ARG A 1 216 ? 7.948   10.503  16.904 1.00 8.33  ? 208 ARG A CG  1 
ATOM   1471 C  CD  . ARG A 1 216 ? 8.140   9.273   17.796 1.00 8.28  ? 208 ARG A CD  1 
ATOM   1472 N  NE  . ARG A 1 216 ? 9.533   9.003   18.115 1.00 8.27  ? 208 ARG A NE  1 
ATOM   1473 C  CZ  . ARG A 1 216 ? 9.961   7.898   18.721 1.00 8.28  ? 208 ARG A CZ  1 
ATOM   1474 N  NH1 . ARG A 1 216 ? 9.101   6.939   19.089 1.00 8.38  ? 208 ARG A NH1 1 
ATOM   1475 N  NH2 . ARG A 1 216 ? 11.245  7.724   18.945 1.00 8.35  ? 208 ARG A NH2 1 
ATOM   1476 N  N   . PRO A 1 217 ? 5.274   13.299  17.563 1.00 8.82  ? 209 PRO A N   1 
ATOM   1477 C  CA  . PRO A 1 217 ? 3.850   13.177  17.257 1.00 8.85  ? 209 PRO A CA  1 
ATOM   1478 C  C   . PRO A 1 217 ? 3.384   13.998  16.050 1.00 8.93  ? 209 PRO A C   1 
ATOM   1479 O  O   . PRO A 1 217 ? 2.532   13.525  15.313 1.00 8.71  ? 209 PRO A O   1 
ATOM   1480 C  CB  . PRO A 1 217 ? 3.159   13.618  18.546 1.00 9.24  ? 209 PRO A CB  1 
ATOM   1481 C  CG  . PRO A 1 217 ? 4.184   13.419  19.633 1.00 9.27  ? 209 PRO A CG  1 
ATOM   1482 C  CD  . PRO A 1 217 ? 5.503   13.734  18.944 1.00 9.18  ? 209 PRO A CD  1 
ATOM   1483 N  N   . ASP A 1 218 ? 3.943   15.194  15.822 1.00 9.24  ? 210 ASP A N   1 
ATOM   1484 C  CA  . ASP A 1 218 ? 3.556   16.013  14.665 1.00 9.39  ? 210 ASP A CA  1 
ATOM   1485 C  C   . ASP A 1 218 ? 4.039   15.337  13.385 1.00 9.23  ? 210 ASP A C   1 
ATOM   1486 O  O   . ASP A 1 218 ? 3.339   15.340  12.368 1.00 9.25  ? 210 ASP A O   1 
ATOM   1487 C  CB  . ASP A 1 218 ? 4.130   17.419  14.768 1.00 9.80  ? 210 ASP A CB  1 
ATOM   1488 C  CG  . ASP A 1 218 ? 3.453   18.266  15.842 1.00 10.38 ? 210 ASP A CG  1 
ATOM   1489 O  OD1 . ASP A 1 218 ? 2.240   18.086  16.049 1.00 10.64 ? 210 ASP A OD1 1 
ATOM   1490 O  OD2 . ASP A 1 218 ? 4.109   19.149  16.458 1.00 10.69 ? 210 ASP A OD2 1 
ATOM   1491 N  N   . TYR A 1 219 ? 5.242   14.765  13.438 1.00 9.07  ? 211 TYR A N   1 
ATOM   1492 C  CA  . TYR A 1 219 ? 5.818   14.007  12.312 1.00 8.95  ? 211 TYR A CA  1 
ATOM   1493 C  C   . TYR A 1 219 ? 4.898   12.867  11.934 1.00 9.01  ? 211 TYR A C   1 
ATOM   1494 O  O   . TYR A 1 219 ? 4.535   12.730  10.775 1.00 8.76  ? 211 TYR A O   1 
ATOM   1495 C  CB  . TYR A 1 219 ? 7.187   13.478  12.662 1.00 8.75  ? 211 TYR A CB  1 
ATOM   1496 C  CG  . TYR A 1 219 ? 7.703   12.257  11.880 1.00 8.45  ? 211 TYR A CG  1 
ATOM   1497 C  CD1 . TYR A 1 219 ? 8.070   12.358  10.546 1.00 8.54  ? 211 TYR A CD1 1 
ATOM   1498 C  CD2 . TYR A 1 219 ? 7.946   11.038  12.532 1.00 8.36  ? 211 TYR A CD2 1 
ATOM   1499 C  CE1 . TYR A 1 219 ? 8.579   11.276  9.850  1.00 8.51  ? 211 TYR A CE1 1 
ATOM   1500 C  CE2 . TYR A 1 219 ? 8.448   9.944   11.862 1.00 8.26  ? 211 TYR A CE2 1 
ATOM   1501 C  CZ  . TYR A 1 219 ? 8.745   10.061  10.507 1.00 8.50  ? 211 TYR A CZ  1 
ATOM   1502 O  OH  . TYR A 1 219 ? 9.259   8.994   9.811  1.00 8.84  ? 211 TYR A OH  1 
ATOM   1503 N  N   . LEU A 1 220 ? 4.467   12.098  12.926 1.00 9.28  ? 212 LEU A N   1 
ATOM   1504 C  CA  . LEU A 1 220 ? 3.539   10.985  12.670 1.00 9.61  ? 212 LEU A CA  1 
ATOM   1505 C  C   . LEU A 1 220 ? 2.193   11.411  12.097 1.00 9.88  ? 212 LEU A C   1 
ATOM   1506 O  O   . LEU A 1 220 ? 1.673   10.719  11.218 1.00 9.74  ? 212 LEU A O   1 
ATOM   1507 C  CB  . LEU A 1 220 ? 3.336   10.126  13.913 1.00 9.55  ? 212 LEU A CB  1 
ATOM   1508 C  CG  . LEU A 1 220 ? 4.602   9.391   14.339 1.00 9.52  ? 212 LEU A CG  1 
ATOM   1509 C  CD1 . LEU A 1 220 ? 4.471   8.873   15.757 1.00 9.50  ? 212 LEU A CD1 1 
ATOM   1510 C  CD2 . LEU A 1 220 ? 4.913   8.255   13.377 1.00 9.57  ? 212 LEU A CD2 1 
ATOM   1511 N  N   . LYS A 1 221 ? 1.661   12.546  12.553 1.00 10.54 ? 213 LYS A N   1 
ATOM   1512 C  CA  . LYS A 1 221 ? 0.379   13.079  12.072 1.00 11.15 ? 213 LYS A CA  1 
ATOM   1513 C  C   . LYS A 1 221 ? 0.471   13.642  10.671 1.00 11.05 ? 213 LYS A C   1 
ATOM   1514 O  O   . LYS A 1 221 ? -0.485  13.531  9.899  1.00 11.20 ? 213 LYS A O   1 
ATOM   1515 C  CB  . LYS A 1 221 ? -0.183  14.160  13.040 1.00 11.85 ? 213 LYS A CB  1 
ATOM   1516 C  CG  . LYS A 1 221 ? -0.664  13.549  14.359 1.00 12.68 ? 213 LYS A CG  1 
ATOM   1517 C  CD  . LYS A 1 221 ? -0.735  14.507  15.542 1.00 13.44 ? 213 LYS A CD  1 
ATOM   1518 C  CE  . LYS A 1 221 ? -0.815  13.643  16.771 1.00 14.11 ? 213 LYS A CE  1 
ATOM   1519 N  NZ  . LYS A 1 221 ? -1.002  14.423  18.023 1.00 15.00 ? 213 LYS A NZ  1 
ATOM   1520 N  N   . GLU A 1 222 ? 1.614   14.239  10.352 1.00 11.25 ? 214 GLU A N   1 
ATOM   1521 C  CA  . GLU A 1 222 ? 1.800   14.925  9.079  1.00 11.50 ? 214 GLU A CA  1 
ATOM   1522 C  C   . GLU A 1 222 ? 2.163   13.965  7.966  1.00 11.08 ? 214 GLU A C   1 
ATOM   1523 O  O   . GLU A 1 222 ? 1.777   14.195  6.815  1.00 10.61 ? 214 GLU A O   1 
ATOM   1524 C  CB  . GLU A 1 222 ? 2.842   16.035  9.207  1.00 12.35 ? 214 GLU A CB  1 
ATOM   1525 C  CG  . GLU A 1 222 ? 2.288   17.266  9.935  1.00 13.62 ? 214 GLU A CG  1 
ATOM   1526 C  CD  . GLU A 1 222 ? 3.266   18.425  10.009 1.00 15.05 ? 214 GLU A CD  1 
ATOM   1527 O  OE1 . GLU A 1 222 ? 4.119   18.601  9.094  1.00 16.16 ? 214 GLU A OE1 1 
ATOM   1528 O  OE2 . GLU A 1 222 ? 3.165   19.195  10.997 1.00 16.99 ? 214 GLU A OE2 1 
ATOM   1529 N  N   . ILE A 1 223 ? 2.890   12.891  8.298  1.00 10.66 ? 215 ILE A N   1 
ATOM   1530 C  CA  . ILE A 1 223 ? 3.395   11.955  7.262  1.00 10.68 ? 215 ILE A CA  1 
ATOM   1531 C  C   . ILE A 1 223 ? 2.296   11.294  6.413  1.00 10.43 ? 215 ILE A C   1 
ATOM   1532 O  O   . ILE A 1 223 ? 2.545   10.932  5.275  1.00 10.63 ? 215 ILE A O   1 
ATOM   1533 C  CB  . ILE A 1 223 ? 4.392   10.927  7.827  1.00 10.42 ? 215 ILE A CB  1 
ATOM   1534 C  CG1 . ILE A 1 223 ? 5.196   10.268  6.700  1.00 10.49 ? 215 ILE A CG1 1 
ATOM   1535 C  CG2 . ILE A 1 223 ? 3.678   9.891   8.660  1.00 10.54 ? 215 ILE A CG2 1 
ATOM   1536 C  CD1 . ILE A 1 223 ? 6.387   9.448   7.205  1.00 10.57 ? 215 ILE A CD1 1 
ATOM   1537 N  N   . TRP A 1 224 ? 1.094   11.170  6.959  1.00 10.42 ? 216 TRP A N   1 
ATOM   1538 C  CA  . TRP A 1 224 ? -0.054  10.645  6.222  1.00 10.47 ? 216 TRP A CA  1 
ATOM   1539 C  C   . TRP A 1 224 ? -0.217  11.324  4.861  1.00 10.91 ? 216 TRP A C   1 
ATOM   1540 O  O   . TRP A 1 224 ? -0.628  10.711  3.895  1.00 11.10 ? 216 TRP A O   1 
ATOM   1541 C  CB  . TRP A 1 224 ? -1.367  10.802  7.021  1.00 10.39 ? 216 TRP A CB  1 
ATOM   1542 C  CG  . TRP A 1 224 ? -1.394  10.029  8.305  1.00 10.09 ? 216 TRP A CG  1 
ATOM   1543 C  CD1 . TRP A 1 224 ? -1.655  10.524  9.541  1.00 10.09 ? 216 TRP A CD1 1 
ATOM   1544 C  CD2 . TRP A 1 224 ? -1.123  8.629   8.483  1.00 9.66  ? 216 TRP A CD2 1 
ATOM   1545 N  NE1 . TRP A 1 224 ? -1.564  9.526   10.479 1.00 10.00 ? 216 TRP A NE1 1 
ATOM   1546 C  CE2 . TRP A 1 224 ? -1.246  8.356   9.853  1.00 9.76  ? 216 TRP A CE2 1 
ATOM   1547 C  CE3 . TRP A 1 224 ? -0.769  7.589   7.618  1.00 9.52  ? 216 TRP A CE3 1 
ATOM   1548 C  CZ2 . TRP A 1 224 ? -1.040  7.083   10.388 1.00 9.74  ? 216 TRP A CZ2 1 
ATOM   1549 C  CZ3 . TRP A 1 224 ? -0.575  6.322   8.141  1.00 9.47  ? 216 TRP A CZ3 1 
ATOM   1550 C  CH2 . TRP A 1 224 ? -0.705  6.077   9.516  1.00 9.52  ? 216 TRP A CH2 1 
ATOM   1551 N  N   . SER A 1 225 ? 0.068   12.603  4.787  1.00 11.10 ? 217 SER A N   1 
ATOM   1552 C  CA  . SER A 1 225 ? -0.190  13.291  3.548  1.00 11.44 ? 217 SER A CA  1 
ATOM   1553 C  C   . SER A 1 225 ? 0.876   13.041  2.495  1.00 11.37 ? 217 SER A C   1 
ATOM   1554 O  O   . SER A 1 225 ? 0.686   13.448  1.365  1.00 11.40 ? 217 SER A O   1 
ATOM   1555 C  CB  . SER A 1 225 ? -0.433  14.779  3.789  1.00 11.87 ? 217 SER A CB  1 
ATOM   1556 O  OG  . SER A 1 225 ? 0.501   15.266  4.658  1.00 12.38 ? 217 SER A OG  1 
ATOM   1557 N  N   . VAL A 1 226 ? 1.967   12.331  2.826  1.00 10.80 ? 218 VAL A N   1 
ATOM   1558 C  CA  . VAL A 1 226 ? 2.876   11.885  1.786  1.00 10.66 ? 218 VAL A CA  1 
ATOM   1559 C  C   . VAL A 1 226 ? 2.952   10.358  1.626  1.00 10.58 ? 218 VAL A C   1 
ATOM   1560 O  O   . VAL A 1 226 ? 3.842   9.861   0.926  1.00 10.56 ? 218 VAL A O   1 
ATOM   1561 C  CB  . VAL A 1 226 ? 4.285   12.491  1.928  1.00 10.79 ? 218 VAL A CB  1 
ATOM   1562 C  CG1 . VAL A 1 226 ? 4.218   14.011  1.805  1.00 11.07 ? 218 VAL A CG1 1 
ATOM   1563 C  CG2 . VAL A 1 226 ? 4.959   12.071  3.240  1.00 10.69 ? 218 VAL A CG2 1 
ATOM   1564 N  N   . ILE A 1 227 ? 2.037   9.605   2.249  1.00 10.25 ? 219 ILE A N   1 
ATOM   1565 C  CA  . ILE A 1 227 ? 2.110   8.163   2.126  1.00 10.07 ? 219 ILE A CA  1 
ATOM   1566 C  C   . ILE A 1 227 ? 1.661   7.793   0.720  1.00 10.28 ? 219 ILE A C   1 
ATOM   1567 O  O   . ILE A 1 227 ? 0.649   8.304   0.218  1.00 10.55 ? 219 ILE A O   1 
ATOM   1568 C  CB  . ILE A 1 227 ? 1.271   7.384   3.166  1.00 9.91  ? 219 ILE A CB  1 
ATOM   1569 C  CG1 . ILE A 1 227 ? 1.768   7.636   4.599  1.00 9.85  ? 219 ILE A CG1 1 
ATOM   1570 C  CG2 . ILE A 1 227 ? 1.244   5.895   2.840  1.00 9.80  ? 219 ILE A CG2 1 
ATOM   1571 C  CD1 . ILE A 1 227 ? 3.167   7.147   4.918  1.00 9.55  ? 219 ILE A CD1 1 
ATOM   1572 N  N   . ASP A 1 228 ? 2.433   6.915   0.098  1.00 10.22 ? 220 ASP A N   1 
ATOM   1573 C  CA  . ASP A 1 228 ? 2.080   6.337   -1.164 1.00 10.70 ? 220 ASP A CA  1 
ATOM   1574 C  C   . ASP A 1 228 ? 1.231   5.091   -0.918 1.00 10.90 ? 220 ASP A C   1 
ATOM   1575 O  O   . ASP A 1 228 ? 1.736   3.966   -0.782 1.00 10.59 ? 220 ASP A O   1 
ATOM   1576 C  CB  . ASP A 1 228 ? 3.327   6.005   -1.962 1.00 10.77 ? 220 ASP A CB  1 
ATOM   1577 C  CG  . ASP A 1 228 ? 2.991   5.400   -3.307 1.00 10.99 ? 220 ASP A CG  1 
ATOM   1578 O  OD1 . ASP A 1 228 ? 1.803   5.039   -3.520 1.00 10.85 ? 220 ASP A OD1 1 
ATOM   1579 O  OD2 . ASP A 1 228 ? 3.926   5.256   -4.111 1.00 11.15 ? 220 ASP A OD2 1 
ATOM   1580 N  N   . TRP A 1 229 ? -0.078  5.301   -0.831 1.00 11.40 ? 221 TRP A N   1 
ATOM   1581 C  CA  . TRP A 1 229 ? -1.009  4.202   -0.512 1.00 11.66 ? 221 TRP A CA  1 
ATOM   1582 C  C   . TRP A 1 229 ? -1.123  3.189   -1.651 1.00 12.36 ? 221 TRP A C   1 
ATOM   1583 O  O   . TRP A 1 229 ? -1.601  2.061   -1.438 1.00 12.34 ? 221 TRP A O   1 
ATOM   1584 C  CB  . TRP A 1 229 ? -2.392  4.741   -0.162 1.00 11.57 ? 221 TRP A CB  1 
ATOM   1585 C  CG  . TRP A 1 229 ? -2.425  5.508   1.151  1.00 11.45 ? 221 TRP A CG  1 
ATOM   1586 C  CD1 . TRP A 1 229 ? -2.705  6.843   1.332  1.00 11.25 ? 221 TRP A CD1 1 
ATOM   1587 C  CD2 . TRP A 1 229 ? -2.209  4.968   2.442  1.00 11.11 ? 221 TRP A CD2 1 
ATOM   1588 N  NE1 . TRP A 1 229 ? -2.665  7.152   2.653  1.00 11.29 ? 221 TRP A NE1 1 
ATOM   1589 C  CE2 . TRP A 1 229 ? -2.353  6.022   3.362  1.00 11.19 ? 221 TRP A CE2 1 
ATOM   1590 C  CE3 . TRP A 1 229 ? -1.909  3.693   2.917  1.00 11.41 ? 221 TRP A CE3 1 
ATOM   1591 C  CZ2 . TRP A 1 229 ? -2.199  5.842   4.741  1.00 11.22 ? 221 TRP A CZ2 1 
ATOM   1592 C  CZ3 . TRP A 1 229 ? -1.761  3.494   4.338  1.00 11.27 ? 221 TRP A CZ3 1 
ATOM   1593 C  CH2 . TRP A 1 229 ? -1.893  4.565   5.206  1.00 11.23 ? 221 TRP A CH2 1 
ATOM   1594 N  N   . GLU A 1 230 ? -0.667  3.566   -2.845 1.00 13.21 ? 222 GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 230 ? -0.655  2.606   -3.967 1.00 13.99 ? 222 GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 230 ? 0.405   1.547   -3.761 1.00 13.13 ? 222 GLU A C   1 
ATOM   1597 O  O   . GLU A 1 230 ? 0.159   0.376   -3.974 1.00 13.25 ? 222 GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 230 ? -0.493  3.309   -5.309 1.00 15.19 ? 222 GLU A CB  1 
ATOM   1599 C  CG  . GLU A 1 230 ? -1.734  4.096   -5.664 1.00 16.54 ? 222 GLU A CG  1 
ATOM   1600 C  CD  . GLU A 1 230 ? -1.594  4.903   -6.947 1.00 18.79 ? 222 GLU A CD  1 
ATOM   1601 O  OE1 . GLU A 1 230 ? -0.569  4.753   -7.651 1.00 19.92 ? 222 GLU A OE1 1 
ATOM   1602 O  OE2 . GLU A 1 230 ? -2.516  5.710   -7.237 1.00 20.06 ? 222 GLU A OE2 1 
ATOM   1603 N  N   . PHE A 1 231 ? 1.582   1.967   -3.335 1.00 12.68 ? 223 PHE A N   1 
ATOM   1604 C  CA  . PHE A 1 231 ? 2.621   1.020   -2.958 1.00 11.96 ? 223 PHE A CA  1 
ATOM   1605 C  C   . PHE A 1 231 ? 2.137   0.169   -1.779 1.00 11.42 ? 223 PHE A C   1 
ATOM   1606 O  O   . PHE A 1 231 ? 2.294   -1.036  -1.785 1.00 11.12 ? 223 PHE A O   1 
ATOM   1607 C  CB  . PHE A 1 231 ? 3.922   1.735   -2.589 1.00 11.57 ? 223 PHE A CB  1 
ATOM   1608 C  CG  . PHE A 1 231 ? 4.988   0.810   -2.090 1.00 11.30 ? 223 PHE A CG  1 
ATOM   1609 C  CD1 . PHE A 1 231 ? 5.670   0.004   -2.964 1.00 11.46 ? 223 PHE A CD1 1 
ATOM   1610 C  CD2 . PHE A 1 231 ? 5.301   0.735   -0.715 1.00 11.02 ? 223 PHE A CD2 1 
ATOM   1611 C  CE1 . PHE A 1 231 ? 6.655   -0.863  -2.509 1.00 11.19 ? 223 PHE A CE1 1 
ATOM   1612 C  CE2 . PHE A 1 231 ? 6.273   -0.129  -0.252 1.00 10.61 ? 223 PHE A CE2 1 
ATOM   1613 C  CZ  . PHE A 1 231 ? 6.962   -0.920  -1.159 1.00 10.92 ? 223 PHE A CZ  1 
ATOM   1614 N  N   . VAL A 1 232 ? 1.586   0.797   -0.755 1.00 11.09 ? 224 VAL A N   1 
ATOM   1615 C  CA  . VAL A 1 232 ? 1.081   0.043   0.382  1.00 10.99 ? 224 VAL A CA  1 
ATOM   1616 C  C   . VAL A 1 232 ? 0.041   -0.998  -0.063 1.00 11.59 ? 224 VAL A C   1 
ATOM   1617 O  O   . VAL A 1 232 ? 0.156   -2.171  0.307  1.00 11.47 ? 224 VAL A O   1 
ATOM   1618 C  CB  . VAL A 1 232 ? 0.489   0.952   1.461  1.00 10.82 ? 224 VAL A CB  1 
ATOM   1619 C  CG1 . VAL A 1 232 ? -0.124  0.131   2.595  1.00 10.75 ? 224 VAL A CG1 1 
ATOM   1620 C  CG2 . VAL A 1 232 ? 1.540   1.915   2.022  1.00 10.79 ? 224 VAL A CG2 1 
ATOM   1621 N  N   . ALA A 1 233 ? -0.927  -0.583  -0.891 1.00 12.18 ? 225 ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 233 ? -1.949  -1.495  -1.413 1.00 12.64 ? 225 ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 233 ? -1.362  -2.663  -2.195 1.00 13.23 ? 225 ALA A C   1 
ATOM   1624 O  O   . ALA A 1 233 ? -1.765  -3.786  -1.979 1.00 13.98 ? 225 ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 233 ? -2.951  -0.754  -2.275 1.00 12.78 ? 225 ALA A CB  1 
ATOM   1626 N  N   . LYS A 1 234 ? -0.402  -2.406  -3.072 1.00 13.54 ? 226 LYS A N   1 
ATOM   1627 C  CA  . LYS A 1 234 ? 0.297   -3.481  -3.781 1.00 14.76 ? 226 LYS A CA  1 
ATOM   1628 C  C   . LYS A 1 234 ? 0.997   -4.466  -2.821 1.00 14.25 ? 226 LYS A C   1 
ATOM   1629 O  O   . LYS A 1 234 ? 0.912   -5.673  -3.018 1.00 14.74 ? 226 LYS A O   1 
ATOM   1630 C  CB  . LYS A 1 234 ? 1.358   -2.883  -4.706 1.00 15.65 ? 226 LYS A CB  1 
ATOM   1631 C  CG  . LYS A 1 234 ? 2.058   -3.864  -5.615 1.00 16.95 ? 226 LYS A CG  1 
ATOM   1632 C  CD  . LYS A 1 234 ? 2.961   -3.080  -6.563 1.00 18.39 ? 226 LYS A CD  1 
ATOM   1633 C  CE  . LYS A 1 234 ? 3.590   -3.953  -7.648 1.00 20.22 ? 226 LYS A CE  1 
ATOM   1634 N  NZ  . LYS A 1 234 ? 5.063   -4.096  -7.427 1.00 21.31 ? 226 LYS A NZ  1 
ATOM   1635 N  N   . MET A 1 235 ? 1.690   -3.943  -1.805 1.00 13.75 ? 227 MET A N   1 
ATOM   1636 C  CA  . MET A 1 235 ? 2.330   -4.797  -0.806 1.00 13.45 ? 227 MET A CA  1 
ATOM   1637 C  C   . MET A 1 235 ? 1.241   -5.652  -0.139 1.00 13.53 ? 227 MET A C   1 
ATOM   1638 O  O   . MET A 1 235 ? 1.434   -6.846  0.097  1.00 14.37 ? 227 MET A O   1 
ATOM   1639 C  CB  . MET A 1 235 ? 3.130   -3.980  0.226  1.00 13.02 ? 227 MET A CB  1 
ATOM   1640 C  CG  . MET A 1 235 ? 4.410   -3.314  -0.281 1.00 13.40 ? 227 MET A CG  1 
ATOM   1641 S  SD  . MET A 1 235 ? 5.612   -4.425  -1.074 1.00 14.18 ? 227 MET A SD  1 
ATOM   1642 C  CE  . MET A 1 235 ? 5.122   -4.286  -2.790 1.00 14.39 ? 227 MET A CE  1 
ATOM   1643 N  N   . HIS A 1 236 ? 0.095   -5.054  0.154  1.00 13.05 ? 228 HIS A N   1 
ATOM   1644 C  CA  . HIS A 1 236 ? -0.992  -5.771  0.794  1.00 13.18 ? 228 HIS A CA  1 
ATOM   1645 C  C   . HIS A 1 236 ? -1.541  -6.875  -0.079 1.00 13.72 ? 228 HIS A C   1 
ATOM   1646 O  O   . HIS A 1 236 ? -1.726  -7.997  0.405  1.00 13.25 ? 228 HIS A O   1 
ATOM   1647 C  CB  . HIS A 1 236 ? -2.139  -4.822  1.137  1.00 12.97 ? 228 HIS A CB  1 
ATOM   1648 C  CG  . HIS A 1 236 ? -3.349  -5.495  1.697  1.00 13.11 ? 228 HIS A CG  1 
ATOM   1649 N  ND1 . HIS A 1 236 ? -3.395  -5.997  2.982  1.00 13.48 ? 228 HIS A ND1 1 
ATOM   1650 C  CD2 . HIS A 1 236 ? -4.584  -5.677  1.181  1.00 13.43 ? 228 HIS A CD2 1 
ATOM   1651 C  CE1 . HIS A 1 236 ? -4.596  -6.493  3.223  1.00 13.56 ? 228 HIS A CE1 1 
ATOM   1652 N  NE2 . HIS A 1 236 ? -5.337  -6.307  2.146  1.00 13.93 ? 228 HIS A NE2 1 
ATOM   1653 N  N   . ALA A 1 237 ? -1.836  -6.526  -1.341 1.00 14.31 ? 229 ALA A N   1 
ATOM   1654 C  CA  . ALA A 1 237 ? -2.381  -7.480  -2.315 1.00 15.20 ? 229 ALA A CA  1 
ATOM   1655 C  C   . ALA A 1 237 ? -1.463  -8.674  -2.484 1.00 15.71 ? 229 ALA A C   1 
ATOM   1656 O  O   . ALA A 1 237 ? -1.917  -9.809  -2.471 1.00 15.63 ? 229 ALA A O   1 
ATOM   1657 C  CB  . ALA A 1 237 ? -2.604  -6.808  -3.686 1.00 15.29 ? 229 ALA A CB  1 
ATOM   1658 N  N   . GLN A 1 238 ? -0.166  -8.422  -2.614 1.00 16.49 ? 230 GLN A N   1 
ATOM   1659 C  CA  . GLN A 1 238 ? 0.764   -9.522  -2.766 1.00 17.70 ? 230 GLN A CA  1 
ATOM   1660 C  C   . GLN A 1 238 ? 0.916   -10.332 -1.486 1.00 17.53 ? 230 GLN A C   1 
ATOM   1661 O  O   . GLN A 1 238 ? 1.075   -11.550 -1.555 1.00 17.91 ? 230 GLN A O   1 
ATOM   1662 C  CB  . GLN A 1 238 ? 2.127   -9.026  -3.244 1.00 19.63 ? 230 GLN A CB  1 
ATOM   1663 C  CG  . GLN A 1 238 ? 2.027   -8.427  -4.642 1.00 21.61 ? 230 GLN A CG  1 
ATOM   1664 C  CD  . GLN A 1 238 ? 3.342   -7.837  -5.101 1.00 23.26 ? 230 GLN A CD  1 
ATOM   1665 O  OE1 . GLN A 1 238 ? 4.263   -7.591  -4.287 1.00 25.52 ? 230 GLN A OE1 1 
ATOM   1666 N  NE2 . GLN A 1 238 ? 3.455   -7.629  -6.396 1.00 23.09 ? 230 GLN A NE2 1 
ATOM   1667 N  N   . ALA A 1 239 ? 0.867   -9.669  -0.323 1.00 16.74 ? 231 ALA A N   1 
ATOM   1668 C  CA  . ALA A 1 239 ? 1.072   -10.352 0.961  1.00 16.84 ? 231 ALA A CA  1 
ATOM   1669 C  C   . ALA A 1 239 ? -0.054  -11.361 1.288  1.00 17.38 ? 231 ALA A C   1 
ATOM   1670 O  O   . ALA A 1 239 ? 0.193   -12.327 1.979  1.00 16.19 ? 231 ALA A O   1 
ATOM   1671 C  CB  . ALA A 1 239 ? 1.214   -9.344  2.100  1.00 15.84 ? 231 ALA A CB  1 
ATOM   1672 N  N   . ILE A 1 240 ? -1.282  -11.100 0.812  1.00 18.55 ? 232 ILE A N   1 
ATOM   1673 C  CA  . ILE A 1 240 ? -2.426  -11.995 1.043  1.00 19.70 ? 232 ILE A CA  1 
ATOM   1674 C  C   . ILE A 1 240 ? -2.722  -13.013 -0.069 1.00 21.74 ? 232 ILE A C   1 
ATOM   1675 O  O   . ILE A 1 240 ? -3.581  -13.872 0.127  1.00 23.06 ? 232 ILE A O   1 
ATOM   1676 C  CB  . ILE A 1 240 ? -3.733  -11.211 1.277  1.00 19.41 ? 232 ILE A CB  1 
ATOM   1677 C  CG1 . ILE A 1 240 ? -4.192  -10.489 0.002  1.00 19.05 ? 232 ILE A CG1 1 
ATOM   1678 C  CG2 . ILE A 1 240 ? -3.566  -10.218 2.401  1.00 19.54 ? 232 ILE A CG2 1 
ATOM   1679 C  CD1 . ILE A 1 240 ? -5.580  -9.912  0.106  1.00 18.46 ? 232 ILE A CD1 1 
ATOM   1680 N  N   . LYS A 1 241 ? -2.057  -12.913 -1.226 1.00 23.60 ? 233 LYS A N   1 
ATOM   1681 C  CA  . LYS A 1 241 ? -2.391  -13.754 -2.383 1.00 25.12 ? 233 LYS A CA  1 
ATOM   1682 C  C   . LYS A 1 241 ? -2.268  -15.216 -1.993 1.00 26.58 ? 233 LYS A C   1 
ATOM   1683 O  O   . LYS A 1 241 ? -3.033  -16.015 -2.543 1.00 29.58 ? 233 LYS A O   1 
ATOM   1684 C  CB  . LYS A 1 241 ? -1.527  -13.448 -3.632 1.00 24.77 ? 233 LYS A CB  1 
ATOM   1685 O  OXT . LYS A 1 241 ? -1.447  -15.622 -1.157 1.00 25.78 ? 233 LYS A OXT 1 
ATOM   1686 N  N   . TYR B 1 28  ? 24.455  1.630   46.463 1.00 24.09 ? 20  TYR B N   1 
ATOM   1687 C  CA  . TYR B 1 28  ? 25.261  2.907   46.468 1.00 23.39 ? 20  TYR B CA  1 
ATOM   1688 C  C   . TYR B 1 28  ? 24.497  3.935   45.639 1.00 21.88 ? 20  TYR B C   1 
ATOM   1689 O  O   . TYR B 1 28  ? 23.996  3.593   44.601 1.00 20.75 ? 20  TYR B O   1 
ATOM   1690 C  CB  . TYR B 1 28  ? 26.659  2.658   45.858 1.00 22.65 ? 20  TYR B CB  1 
ATOM   1691 C  CG  . TYR B 1 28  ? 27.462  3.911   45.511 1.00 21.63 ? 20  TYR B CG  1 
ATOM   1692 C  CD1 . TYR B 1 28  ? 28.303  4.524   46.451 1.00 20.51 ? 20  TYR B CD1 1 
ATOM   1693 C  CD2 . TYR B 1 28  ? 27.386  4.462   44.228 1.00 20.83 ? 20  TYR B CD2 1 
ATOM   1694 C  CE1 . TYR B 1 28  ? 29.036  5.648   46.111 1.00 20.60 ? 20  TYR B CE1 1 
ATOM   1695 C  CE2 . TYR B 1 28  ? 28.106  5.593   43.867 1.00 20.56 ? 20  TYR B CE2 1 
ATOM   1696 C  CZ  . TYR B 1 28  ? 28.921  6.188   44.815 1.00 21.04 ? 20  TYR B CZ  1 
ATOM   1697 O  OH  . TYR B 1 28  ? 29.639  7.289   44.457 1.00 20.26 ? 20  TYR B OH  1 
ATOM   1698 N  N   . ALA B 1 29  ? 24.442  5.189   46.075 1.00 21.08 ? 21  ALA B N   1 
ATOM   1699 C  CA  . ALA B 1 29  ? 23.726  6.187   45.309 1.00 20.17 ? 21  ALA B CA  1 
ATOM   1700 C  C   . ALA B 1 29  ? 24.683  7.234   44.761 1.00 18.57 ? 21  ALA B C   1 
ATOM   1701 O  O   . ALA B 1 29  ? 25.431  7.835   45.508 1.00 17.87 ? 21  ALA B O   1 
ATOM   1702 C  CB  . ALA B 1 29  ? 22.658  6.845   46.156 1.00 21.41 ? 21  ALA B CB  1 
ATOM   1703 N  N   . THR B 1 30  ? 24.681  7.419   43.438 1.00 17.16 ? 22  THR B N   1 
ATOM   1704 C  CA  . THR B 1 30  ? 25.507  8.454   42.793 1.00 15.79 ? 22  THR B CA  1 
ATOM   1705 C  C   . THR B 1 30  ? 24.982  9.867   43.119 1.00 15.51 ? 22  THR B C   1 
ATOM   1706 O  O   . THR B 1 30  ? 25.750  10.752  43.404 1.00 15.07 ? 22  THR B O   1 
ATOM   1707 C  CB  . THR B 1 30  ? 25.592  8.265   41.266 1.00 14.92 ? 22  THR B CB  1 
ATOM   1708 O  OG1 . THR B 1 30  ? 26.227  7.015   40.978 1.00 14.75 ? 22  THR B OG1 1 
ATOM   1709 C  CG2 . THR B 1 30  ? 26.400  9.363   40.602 1.00 14.10 ? 22  THR B CG2 1 
ATOM   1710 N  N   . LEU B 1 31  ? 23.676  10.053  43.066 1.00 15.11 ? 23  LEU B N   1 
ATOM   1711 C  CA  . LEU B 1 31  ? 23.088  11.365  43.254 1.00 15.32 ? 23  LEU B CA  1 
ATOM   1712 C  C   . LEU B 1 31  ? 22.028  11.237  44.349 1.00 16.03 ? 23  LEU B C   1 
ATOM   1713 O  O   . LEU B 1 31  ? 20.827  11.239  44.052 1.00 15.78 ? 23  LEU B O   1 
ATOM   1714 C  CB  . LEU B 1 31  ? 22.468  11.842  41.940 1.00 15.13 ? 23  LEU B CB  1 
ATOM   1715 C  CG  . LEU B 1 31  ? 23.396  12.210  40.759 1.00 15.09 ? 23  LEU B CG  1 
ATOM   1716 C  CD1 . LEU B 1 31  ? 22.585  12.671  39.554 1.00 14.34 ? 23  LEU B CD1 1 
ATOM   1717 C  CD2 . LEU B 1 31  ? 24.399  13.295  41.157 1.00 15.24 ? 23  LEU B CD2 1 
ATOM   1718 N  N   . PRO B 1 32  ? 22.454  11.088  45.621 1.00 16.50 ? 24  PRO B N   1 
ATOM   1719 C  CA  . PRO B 1 32  ? 21.494  10.872  46.710 1.00 17.11 ? 24  PRO B CA  1 
ATOM   1720 C  C   . PRO B 1 32  ? 20.480  11.996  46.921 1.00 17.90 ? 24  PRO B C   1 
ATOM   1721 O  O   . PRO B 1 32  ? 19.425  11.764  47.504 1.00 17.95 ? 24  PRO B O   1 
ATOM   1722 C  CB  . PRO B 1 32  ? 22.373  10.751  47.948 1.00 17.55 ? 24  PRO B CB  1 
ATOM   1723 C  CG  . PRO B 1 32  ? 23.686  11.380  47.575 1.00 17.46 ? 24  PRO B CG  1 
ATOM   1724 C  CD  . PRO B 1 32  ? 23.840  11.180  46.101 1.00 17.12 ? 24  PRO B CD  1 
ATOM   1725 N  N   . ASP B 1 33  ? 20.770  13.197  46.431 1.00 18.60 ? 25  ASP B N   1 
ATOM   1726 C  CA  . ASP B 1 33  ? 19.849  14.313  46.592 1.00 19.17 ? 25  ASP B CA  1 
ATOM   1727 C  C   . ASP B 1 33  ? 18.822  14.389  45.466 1.00 16.55 ? 25  ASP B C   1 
ATOM   1728 O  O   . ASP B 1 33  ? 17.915  15.225  45.498 1.00 15.08 ? 25  ASP B O   1 
ATOM   1729 C  CB  . ASP B 1 33  ? 20.633  15.632  46.683 1.00 22.82 ? 25  ASP B CB  1 
ATOM   1730 C  CG  . ASP B 1 33  ? 21.541  15.705  47.939 1.00 26.61 ? 25  ASP B CG  1 
ATOM   1731 O  OD1 . ASP B 1 33  ? 21.253  15.033  48.961 1.00 30.24 ? 25  ASP B OD1 1 
ATOM   1732 O  OD2 . ASP B 1 33  ? 22.536  16.468  47.910 1.00 31.55 ? 25  ASP B OD2 1 
ATOM   1733 N  N   . LEU B 1 34  ? 18.957  13.523  44.463 1.00 14.65 ? 26  LEU B N   1 
ATOM   1734 C  CA  . LEU B 1 34  ? 18.016  13.488  43.354 1.00 13.63 ? 26  LEU B CA  1 
ATOM   1735 C  C   . LEU B 1 34  ? 16.892  12.522  43.776 1.00 14.09 ? 26  LEU B C   1 
ATOM   1736 O  O   . LEU B 1 34  ? 17.081  11.289  43.733 1.00 13.21 ? 26  LEU B O   1 
ATOM   1737 C  CB  . LEU B 1 34  ? 18.681  13.047  42.054 1.00 13.16 ? 26  LEU B CB  1 
ATOM   1738 C  CG  . LEU B 1 34  ? 17.780  13.218  40.821 1.00 13.10 ? 26  LEU B CG  1 
ATOM   1739 C  CD1 . LEU B 1 34  ? 17.637  14.704  40.484 1.00 13.24 ? 26  LEU B CD1 1 
ATOM   1740 C  CD2 . LEU B 1 34  ? 18.306  12.445  39.613 1.00 12.82 ? 26  LEU B CD2 1 
ATOM   1741 N  N   . LEU B 1 35  ? 15.757  13.112  44.197 1.00 14.28 ? 27  LEU B N   1 
ATOM   1742 C  CA  . LEU B 1 35  ? 14.647  12.429  44.858 1.00 15.32 ? 27  LEU B CA  1 
ATOM   1743 C  C   . LEU B 1 35  ? 13.296  12.663  44.201 1.00 14.73 ? 27  LEU B C   1 
ATOM   1744 O  O   . LEU B 1 35  ? 13.117  13.623  43.433 1.00 14.06 ? 27  LEU B O   1 
ATOM   1745 C  CB  . LEU B 1 35  ? 14.455  12.982  46.273 1.00 16.14 ? 27  LEU B CB  1 
ATOM   1746 C  CG  . LEU B 1 35  ? 15.646  13.174  47.192 1.00 16.81 ? 27  LEU B CG  1 
ATOM   1747 C  CD1 . LEU B 1 35  ? 15.236  13.904  48.456 1.00 16.61 ? 27  LEU B CD1 1 
ATOM   1748 C  CD2 . LEU B 1 35  ? 16.203  11.803  47.535 1.00 17.55 ? 27  LEU B CD2 1 
ATOM   1749 N  N   . LYS B 1 36  ? 12.356  11.765  44.511 1.00 14.17 ? 28  LYS B N   1 
ATOM   1750 C  CA  . LYS B 1 36  ? 10.938  12.022  44.296 1.00 13.93 ? 28  LYS B CA  1 
ATOM   1751 C  C   . LYS B 1 36  ? 10.354  12.574  45.586 1.00 13.98 ? 28  LYS B C   1 
ATOM   1752 O  O   . LYS B 1 36  ? 10.241  11.843  46.578 1.00 14.58 ? 28  LYS B O   1 
ATOM   1753 C  CB  . LYS B 1 36  ? 10.186  10.750  43.909 1.00 13.72 ? 28  LYS B CB  1 
ATOM   1754 C  CG  . LYS B 1 36  ? 8.668   10.928  43.851 1.00 13.75 ? 28  LYS B CG  1 
ATOM   1755 C  CD  . LYS B 1 36  ? 8.234   11.948  42.795 1.00 13.73 ? 28  LYS B CD  1 
ATOM   1756 C  CE  . LYS B 1 36  ? 6.717   12.082  42.702 1.00 13.52 ? 28  LYS B CE  1 
ATOM   1757 N  NZ  . LYS B 1 36  ? 6.132   12.725  43.905 1.00 13.81 ? 28  LYS B NZ  1 
ATOM   1758 N  N   . PRO B 1 37  ? 10.001  13.861  45.599 1.00 14.15 ? 29  PRO B N   1 
ATOM   1759 C  CA  . PRO B 1 37  ? 9.551   14.408  46.881 1.00 14.66 ? 29  PRO B CA  1 
ATOM   1760 C  C   . PRO B 1 37  ? 8.227   13.813  47.310 1.00 15.45 ? 29  PRO B C   1 
ATOM   1761 O  O   . PRO B 1 37  ? 7.462   13.322  46.469 1.00 15.42 ? 29  PRO B O   1 
ATOM   1762 C  CB  . PRO B 1 37  ? 9.402   15.908  46.597 1.00 14.40 ? 29  PRO B CB  1 
ATOM   1763 C  CG  . PRO B 1 37  ? 10.239  16.155  45.374 1.00 14.06 ? 29  PRO B CG  1 
ATOM   1764 C  CD  . PRO B 1 37  ? 10.133  14.908  44.571 1.00 13.86 ? 29  PRO B CD  1 
ATOM   1765 N  N   . SER B 1 38  ? 7.980   13.853  48.616 1.00 15.92 ? 30  SER B N   1 
ATOM   1766 C  CA  A SER B 1 38  ? 6.712   13.477  49.180 0.70 16.45 ? 30  SER B CA  1 
ATOM   1767 C  CA  B SER B 1 38  ? 6.694   13.452  49.161 0.30 16.22 ? 30  SER B CA  1 
ATOM   1768 C  C   . SER B 1 38  ? 5.685   14.561  48.926 1.00 16.44 ? 30  SER B C   1 
ATOM   1769 O  O   . SER B 1 38  ? 5.907   15.693  49.275 1.00 16.16 ? 30  SER B O   1 
ATOM   1770 C  CB  A SER B 1 38  ? 6.862   13.294  50.680 0.70 16.83 ? 30  SER B CB  1 
ATOM   1771 C  CB  B SER B 1 38  ? 6.795   13.111  50.655 0.30 16.45 ? 30  SER B CB  1 
ATOM   1772 O  OG  A SER B 1 38  ? 5.724   12.624  51.142 0.70 17.51 ? 30  SER B OG  1 
ATOM   1773 O  OG  B SER B 1 38  ? 7.539   14.073  51.376 0.30 16.38 ? 30  SER B OG  1 
ATOM   1774 N  N   . GLY B 1 39  ? 4.578   14.213  48.296 1.00 16.89 ? 31  GLY B N   1 
ATOM   1775 C  CA  . GLY B 1 39  ? 3.513   15.185  48.105 1.00 17.70 ? 31  GLY B CA  1 
ATOM   1776 C  C   . GLY B 1 39  ? 3.784   16.309  47.119 1.00 17.29 ? 31  GLY B C   1 
ATOM   1777 O  O   . GLY B 1 39  ? 2.969   17.203  46.974 1.00 18.56 ? 31  GLY B O   1 
ATOM   1778 N  N   . ALA B 1 40  ? 4.888   16.256  46.404 1.00 16.62 ? 32  ALA B N   1 
ATOM   1779 C  CA  . ALA B 1 40  ? 5.123   17.209  45.343 1.00 16.08 ? 32  ALA B CA  1 
ATOM   1780 C  C   . ALA B 1 40  ? 5.874   16.524  44.197 1.00 15.27 ? 32  ALA B C   1 
ATOM   1781 O  O   . ALA B 1 40  ? 6.562   15.531  44.391 1.00 14.62 ? 32  ALA B O   1 
ATOM   1782 C  CB  . ALA B 1 40  ? 5.901   18.385  45.865 1.00 16.34 ? 32  ALA B CB  1 
ATOM   1783 N  N   . PRO B 1 41  ? 5.725   17.058  42.980 1.00 14.94 ? 33  PRO B N   1 
ATOM   1784 C  CA  . PRO B 1 41  ? 6.387   16.475  41.825 1.00 14.34 ? 33  PRO B CA  1 
ATOM   1785 C  C   . PRO B 1 41  ? 7.902   16.588  41.903 1.00 14.11 ? 33  PRO B C   1 
ATOM   1786 O  O   . PRO B 1 41  ? 8.420   17.541  42.459 1.00 14.00 ? 33  PRO B O   1 
ATOM   1787 C  CB  . PRO B 1 41  ? 5.846   17.300  40.647 1.00 14.78 ? 33  PRO B CB  1 
ATOM   1788 C  CG  . PRO B 1 41  ? 5.352   18.575  41.249 1.00 15.14 ? 33  PRO B CG  1 
ATOM   1789 C  CD  . PRO B 1 41  ? 4.874   18.210  42.626 1.00 15.16 ? 33  PRO B CD  1 
ATOM   1790 N  N   . ALA B 1 42  ? 8.615   15.602  41.374 1.00 13.83 ? 34  ALA B N   1 
ATOM   1791 C  CA  . ALA B 1 42  ? 10.058  15.759  41.155 1.00 13.97 ? 34  ALA B CA  1 
ATOM   1792 C  C   . ALA B 1 42  ? 10.224  16.935  40.206 1.00 13.73 ? 34  ALA B C   1 
ATOM   1793 O  O   . ALA B 1 42  ? 9.470   17.036  39.243 1.00 12.90 ? 34  ALA B O   1 
ATOM   1794 C  CB  . ALA B 1 42  ? 10.672  14.491  40.557 1.00 13.67 ? 34  ALA B CB  1 
ATOM   1795 N  N   . GLU B 1 43  ? 11.173  17.826  40.494 1.00 14.85 ? 35  GLU B N   1 
ATOM   1796 C  CA  . GLU B 1 43  ? 11.417  19.001  39.600 1.00 15.90 ? 35  GLU B CA  1 
ATOM   1797 C  C   . GLU B 1 43  ? 12.486  18.695  38.568 1.00 13.54 ? 35  GLU B C   1 
ATOM   1798 O  O   . GLU B 1 43  ? 13.336  17.821  38.778 1.00 13.27 ? 35  GLU B O   1 
ATOM   1799 C  CB  . GLU B 1 43  ? 11.869  20.257  40.375 1.00 18.25 ? 35  GLU B CB  1 
ATOM   1800 C  CG  . GLU B 1 43  ? 10.923  20.763  41.466 1.00 21.13 ? 35  GLU B CG  1 
ATOM   1801 C  CD  . GLU B 1 43  ? 9.718   21.543  40.955 1.00 24.31 ? 35  GLU B CD  1 
ATOM   1802 O  OE1 . GLU B 1 43  ? 9.374   21.507  39.753 1.00 28.33 ? 35  GLU B OE1 1 
ATOM   1803 O  OE2 . GLU B 1 43  ? 9.082   22.222  41.787 1.00 29.24 ? 35  GLU B OE2 1 
ATOM   1804 N  N   . LEU B 1 44  ? 12.459  19.448  37.484 1.00 12.03 ? 36  LEU B N   1 
ATOM   1805 C  CA  . LEU B 1 44  ? 13.502  19.420  36.487 1.00 11.21 ? 36  LEU B CA  1 
ATOM   1806 C  C   . LEU B 1 44  ? 14.723  20.091  37.085 1.00 10.84 ? 36  LEU B C   1 
ATOM   1807 O  O   . LEU B 1 44  ? 14.654  21.274  37.373 1.00 11.08 ? 36  LEU B O   1 
ATOM   1808 C  CB  . LEU B 1 44  ? 13.058  20.191  35.231 1.00 10.84 ? 36  LEU B CB  1 
ATOM   1809 C  CG  . LEU B 1 44  ? 14.058  20.207  34.060 1.00 10.69 ? 36  LEU B CG  1 
ATOM   1810 C  CD1 . LEU B 1 44  ? 14.389  18.796  33.545 1.00 10.31 ? 36  LEU B CD1 1 
ATOM   1811 C  CD2 . LEU B 1 44  ? 13.512  21.085  32.948 1.00 10.56 ? 36  LEU B CD2 1 
ATOM   1812 N  N   . PRO B 1 45  ? 15.835  19.350  37.285 1.00 10.07 ? 37  PRO B N   1 
ATOM   1813 C  CA  . PRO B 1 45  ? 16.984  19.956  37.950 1.00 10.11 ? 37  PRO B CA  1 
ATOM   1814 C  C   . PRO B 1 45  ? 17.548  21.128  37.150 1.00 9.98  ? 37  PRO B C   1 
ATOM   1815 O  O   . PRO B 1 45  ? 17.633  21.077  35.938 1.00 9.26  ? 37  PRO B O   1 
ATOM   1816 C  CB  . PRO B 1 45  ? 18.023  18.822  38.021 1.00 9.90  ? 37  PRO B CB  1 
ATOM   1817 C  CG  . PRO B 1 45  ? 17.272  17.573  37.796 1.00 9.90  ? 37  PRO B CG  1 
ATOM   1818 C  CD  . PRO B 1 45  ? 16.124  17.968  36.892 1.00 10.00 ? 37  PRO B CD  1 
ATOM   1819 N  N   . LYS B 1 46  ? 17.946  22.154  37.860 1.00 10.43 ? 38  LYS B N   1 
ATOM   1820 C  CA  . LYS B 1 46  ? 18.588  23.286  37.267 1.00 11.06 ? 38  LYS B CA  1 
ATOM   1821 C  C   . LYS B 1 46  ? 19.975  22.921  36.813 1.00 10.89 ? 38  LYS B C   1 
ATOM   1822 O  O   . LYS B 1 46  ? 20.601  22.031  37.370 1.00 10.17 ? 38  LYS B O   1 
ATOM   1823 C  CB  . LYS B 1 46  ? 18.613  24.440  38.251 1.00 11.98 ? 38  LYS B CB  1 
ATOM   1824 C  CG  . LYS B 1 46  ? 17.259  25.100  38.221 1.00 12.98 ? 38  LYS B CG  1 
ATOM   1825 C  CD  . LYS B 1 46  ? 16.890  25.591  39.585 1.00 14.04 ? 38  LYS B CD  1 
ATOM   1826 C  CE  . LYS B 1 46  ? 15.468  26.111  39.570 1.00 14.65 ? 38  LYS B CE  1 
ATOM   1827 N  NZ  . LYS B 1 46  ? 15.513  27.249  40.514 1.00 15.67 ? 38  LYS B NZ  1 
ATOM   1828 N  N   . LEU B 1 47  ? 20.374  23.563  35.713 1.00 11.28 ? 39  LEU B N   1 
ATOM   1829 C  CA  . LEU B 1 47  ? 21.724  23.489  35.162 1.00 11.61 ? 39  LEU B CA  1 
ATOM   1830 C  C   . LEU B 1 47  ? 22.636  24.471  35.903 1.00 11.96 ? 39  LEU B C   1 
ATOM   1831 O  O   . LEU B 1 47  ? 22.211  25.523  36.350 1.00 11.76 ? 39  LEU B O   1 
ATOM   1832 C  CB  . LEU B 1 47  ? 21.708  23.855  33.673 1.00 11.62 ? 39  LEU B CB  1 
ATOM   1833 C  CG  . LEU B 1 47  ? 20.759  23.018  32.799 1.00 11.97 ? 39  LEU B CG  1 
ATOM   1834 C  CD1 . LEU B 1 47  ? 20.826  23.439  31.344 1.00 12.05 ? 39  LEU B CD1 1 
ATOM   1835 C  CD2 . LEU B 1 47  ? 21.088  21.523  32.894 1.00 11.91 ? 39  LEU B CD2 1 
ATOM   1836 N  N   . GLY B 1 48  ? 23.900  24.116  35.984 1.00 12.39 ? 40  GLY B N   1 
ATOM   1837 C  CA  . GLY B 1 48  ? 24.946  24.994  36.494 1.00 12.86 ? 40  GLY B CA  1 
ATOM   1838 C  C   . GLY B 1 48  ? 25.421  26.039  35.491 1.00 13.26 ? 40  GLY B C   1 
ATOM   1839 O  O   . GLY B 1 48  ? 26.197  26.921  35.831 1.00 13.46 ? 40  GLY B O   1 
ATOM   1840 N  N   . PHE B 1 49  ? 24.943  25.950  34.257 1.00 13.18 ? 41  PHE B N   1 
ATOM   1841 C  CA  . PHE B 1 49  ? 25.223  26.974  33.238 1.00 13.08 ? 41  PHE B CA  1 
ATOM   1842 C  C   . PHE B 1 49  ? 23.925  27.359  32.630 1.00 12.54 ? 41  PHE B C   1 
ATOM   1843 O  O   . PHE B 1 49  ? 22.908  26.676  32.815 1.00 12.57 ? 41  PHE B O   1 
ATOM   1844 C  CB  . PHE B 1 49  ? 26.138  26.450  32.140 1.00 13.51 ? 41  PHE B CB  1 
ATOM   1845 C  CG  . PHE B 1 49  ? 25.589  25.238  31.396 1.00 13.06 ? 41  PHE B CG  1 
ATOM   1846 C  CD1 . PHE B 1 49  ? 24.902  25.386  30.198 1.00 13.15 ? 41  PHE B CD1 1 
ATOM   1847 C  CD2 . PHE B 1 49  ? 25.777  23.972  31.891 1.00 13.03 ? 41  PHE B CD2 1 
ATOM   1848 C  CE1 . PHE B 1 49  ? 24.411  24.280  29.508 1.00 12.71 ? 41  PHE B CE1 1 
ATOM   1849 C  CE2 . PHE B 1 49  ? 25.298  22.860  31.206 1.00 12.88 ? 41  PHE B CE2 1 
ATOM   1850 C  CZ  . PHE B 1 49  ? 24.612  23.018  30.009 1.00 12.75 ? 41  PHE B CZ  1 
ATOM   1851 N  N   . ASN B 1 50  ? 23.942  28.455  31.908 1.00 12.25 ? 42  ASN B N   1 
ATOM   1852 C  CA  . ASN B 1 50  ? 22.728  28.966  31.330 1.00 12.16 ? 42  ASN B CA  1 
ATOM   1853 C  C   . ASN B 1 50  ? 22.520  28.398  29.925 1.00 11.59 ? 42  ASN B C   1 
ATOM   1854 O  O   . ASN B 1 50  ? 23.265  28.732  29.022 1.00 11.40 ? 42  ASN B O   1 
ATOM   1855 C  CB  . ASN B 1 50  ? 22.838  30.490  31.274 1.00 12.60 ? 42  ASN B CB  1 
ATOM   1856 C  CG  . ASN B 1 50  ? 21.616  31.124  30.731 1.00 12.82 ? 42  ASN B CG  1 
ATOM   1857 O  OD1 . ASN B 1 50  ? 20.746  30.456  30.193 1.00 13.15 ? 42  ASN B OD1 1 
ATOM   1858 N  ND2 . ASN B 1 50  ? 21.517  32.429  30.884 1.00 13.63 ? 42  ASN B ND2 1 
ATOM   1859 N  N   . TRP B 1 51  ? 21.452  27.621  29.722 1.00 11.38 ? 43  TRP B N   1 
ATOM   1860 C  CA  . TRP B 1 51  ? 21.196  26.976  28.403 1.00 10.92 ? 43  TRP B CA  1 
ATOM   1861 C  C   . TRP B 1 51  ? 20.915  27.971  27.283 1.00 11.18 ? 43  TRP B C   1 
ATOM   1862 O  O   . TRP B 1 51  ? 21.046  27.633  26.095 1.00 10.69 ? 43  TRP B O   1 
ATOM   1863 C  CB  . TRP B 1 51  ? 20.080  25.922  28.468 1.00 10.73 ? 43  TRP B CB  1 
ATOM   1864 C  CG  . TRP B 1 51  ? 18.750  26.422  28.872 1.00 10.87 ? 43  TRP B CG  1 
ATOM   1865 C  CD1 . TRP B 1 51  ? 18.205  26.341  30.113 1.00 10.71 ? 43  TRP B CD1 1 
ATOM   1866 C  CD2 . TRP B 1 51  ? 17.771  27.088  28.045 1.00 11.19 ? 43  TRP B CD2 1 
ATOM   1867 N  NE1 . TRP B 1 51  ? 16.984  26.911  30.119 1.00 10.82 ? 43  TRP B NE1 1 
ATOM   1868 C  CE2 . TRP B 1 51  ? 16.675  27.377  28.871 1.00 11.12 ? 43  TRP B CE2 1 
ATOM   1869 C  CE3 . TRP B 1 51  ? 17.723  27.471  26.698 1.00 11.40 ? 43  TRP B CE3 1 
ATOM   1870 C  CZ2 . TRP B 1 51  ? 15.522  28.040  28.407 1.00 11.44 ? 43  TRP B CZ2 1 
ATOM   1871 C  CZ3 . TRP B 1 51  ? 16.569  28.118  26.220 1.00 11.69 ? 43  TRP B CZ3 1 
ATOM   1872 C  CH2 . TRP B 1 51  ? 15.482  28.404  27.084 1.00 11.54 ? 43  TRP B CH2 1 
ATOM   1873 N  N   . LYS B 1 52  ? 20.557  29.207  27.649 1.00 11.45 ? 44  LYS B N   1 
ATOM   1874 C  CA  . LYS B 1 52  ? 20.286  30.218  26.646 1.00 11.85 ? 44  LYS B CA  1 
ATOM   1875 C  C   . LYS B 1 52  ? 21.550  30.649  25.954 1.00 11.67 ? 44  LYS B C   1 
ATOM   1876 O  O   . LYS B 1 52  ? 21.471  31.183  24.872 1.00 12.06 ? 44  LYS B O   1 
ATOM   1877 C  CB  . LYS B 1 52  ? 19.593  31.442  27.260 1.00 12.35 ? 44  LYS B CB  1 
ATOM   1878 C  CG  . LYS B 1 52  ? 18.276  31.088  27.902 1.00 12.63 ? 44  LYS B CG  1 
ATOM   1879 C  CD  . LYS B 1 52  ? 17.675  32.246  28.674 1.00 13.06 ? 44  LYS B CD  1 
ATOM   1880 C  CE  . LYS B 1 52  ? 16.173  32.135  28.635 1.00 13.38 ? 44  LYS B CE  1 
ATOM   1881 N  NZ  . LYS B 1 52  ? 15.549  32.923  29.733 1.00 13.98 ? 44  LYS B NZ  1 
ATOM   1882 N  N   . ASP B 1 53  ? 22.706  30.451  26.586 1.00 11.65 ? 45  ASP B N   1 
ATOM   1883 C  CA  . ASP B 1 53  ? 23.996  30.673  25.940 1.00 11.58 ? 45  ASP B CA  1 
ATOM   1884 C  C   . ASP B 1 53  ? 24.504  29.390  25.282 1.00 11.37 ? 45  ASP B C   1 
ATOM   1885 O  O   . ASP B 1 53  ? 25.658  29.330  24.904 1.00 11.06 ? 45  ASP B O   1 
ATOM   1886 C  CB  . ASP B 1 53  ? 25.022  31.187  26.933 1.00 11.89 ? 45  ASP B CB  1 
ATOM   1887 C  CG  . ASP B 1 53  ? 24.700  32.576  27.463 1.00 12.56 ? 45  ASP B CG  1 
ATOM   1888 O  OD1 . ASP B 1 53  ? 24.395  32.650  28.671 1.00 12.64 ? 45  ASP B OD1 1 
ATOM   1889 O  OD2 . ASP B 1 53  ? 24.739  33.583  26.695 1.00 12.92 ? 45  ASP B OD2 1 
ATOM   1890 N  N   . GLY B 1 54  ? 23.643  28.371  25.125 1.00 10.92 ? 46  GLY B N   1 
ATOM   1891 C  CA  . GLY B 1 54  ? 24.087  27.049  24.701 1.00 10.65 ? 46  GLY B CA  1 
ATOM   1892 C  C   . GLY B 1 54  ? 25.075  26.469  25.687 1.00 10.74 ? 46  GLY B C   1 
ATOM   1893 O  O   . GLY B 1 54  ? 24.992  26.707  26.892 1.00 10.72 ? 46  GLY B O   1 
ATOM   1894 N  N   . CYS B 1 55  ? 26.040  25.700  25.182 1.00 10.76 ? 47  CYS B N   1 
ATOM   1895 C  CA  . CYS B 1 55  ? 27.181  25.324  26.014 1.00 10.53 ? 47  CYS B CA  1 
ATOM   1896 C  C   . CYS B 1 55  ? 28.422  25.388  25.140 1.00 10.67 ? 47  CYS B C   1 
ATOM   1897 O  O   . CYS B 1 55  ? 28.816  24.398  24.511 1.00 10.23 ? 47  CYS B O   1 
ATOM   1898 C  CB  . CYS B 1 55  ? 26.952  23.949  26.647 1.00 10.29 ? 47  CYS B CB  1 
ATOM   1899 S  SG  . CYS B 1 55  ? 28.289  23.352  27.706 1.00 9.42  ? 47  CYS B SG  1 
ATOM   1900 N  N   . ALA B 1 56  ? 29.023  26.585  25.114 1.00 11.13 ? 48  ALA B N   1 
ATOM   1901 C  CA  . ALA B 1 56  ? 30.076  26.921  24.168 1.00 11.50 ? 48  ALA B CA  1 
ATOM   1902 C  C   . ALA B 1 56  ? 31.380  26.221  24.513 1.00 11.87 ? 48  ALA B C   1 
ATOM   1903 O  O   . ALA B 1 56  ? 31.663  25.969  25.684 1.00 11.78 ? 48  ALA B O   1 
ATOM   1904 C  CB  . ALA B 1 56  ? 30.287  28.442  24.097 1.00 11.85 ? 48  ALA B CB  1 
ATOM   1905 N  N   . PRO B 1 57  ? 32.212  25.931  23.503 1.00 12.34 ? 49  PRO B N   1 
ATOM   1906 C  CA  . PRO B 1 57  ? 32.058  26.235  22.093 1.00 12.81 ? 49  PRO B CA  1 
ATOM   1907 C  C   . PRO B 1 57  ? 31.305  25.179  21.302 1.00 12.96 ? 49  PRO B C   1 
ATOM   1908 O  O   . PRO B 1 57  ? 31.313  25.244  20.090 1.00 13.99 ? 49  PRO B O   1 
ATOM   1909 C  CB  . PRO B 1 57  ? 33.516  26.230  21.584 1.00 13.02 ? 49  PRO B CB  1 
ATOM   1910 C  CG  . PRO B 1 57  ? 34.161  25.161  22.426 1.00 12.67 ? 49  PRO B CG  1 
ATOM   1911 C  CD  . PRO B 1 57  ? 33.552  25.368  23.797 1.00 12.48 ? 49  PRO B CD  1 
ATOM   1912 N  N   . VAL B 1 58  ? 30.737  24.178  21.954 1.00 12.56 ? 50  VAL B N   1 
ATOM   1913 C  CA  . VAL B 1 58  ? 30.275  22.975  21.247 1.00 11.99 ? 50  VAL B CA  1 
ATOM   1914 C  C   . VAL B 1 58  ? 28.809  22.979  20.876 1.00 11.80 ? 50  VAL B C   1 
ATOM   1915 O  O   . VAL B 1 58  ? 28.452  22.484  19.803 1.00 11.93 ? 50  VAL B O   1 
ATOM   1916 C  CB  . VAL B 1 58  ? 30.573  21.718  22.079 1.00 11.57 ? 50  VAL B CB  1 
ATOM   1917 C  CG1 . VAL B 1 58  ? 29.994  20.459  21.428 1.00 11.37 ? 50  VAL B CG1 1 
ATOM   1918 C  CG2 . VAL B 1 58  ? 32.075  21.580  22.268 1.00 11.74 ? 50  VAL B CG2 1 
ATOM   1919 N  N   . PHE B 1 59  ? 27.951  23.502  21.764 1.00 11.48 ? 51  PHE B N   1 
ATOM   1920 C  CA  . PHE B 1 59  ? 26.508  23.402  21.586 1.00 10.96 ? 51  PHE B CA  1 
ATOM   1921 C  C   . PHE B 1 59  ? 25.833  24.747  21.463 1.00 10.65 ? 51  PHE B C   1 
ATOM   1922 O  O   . PHE B 1 59  ? 26.171  25.660  22.153 1.00 10.63 ? 51  PHE B O   1 
ATOM   1923 C  CB  . PHE B 1 59  ? 25.870  22.684  22.768 1.00 10.97 ? 51  PHE B CB  1 
ATOM   1924 C  CG  . PHE B 1 59  ? 26.316  21.277  22.945 1.00 11.24 ? 51  PHE B CG  1 
ATOM   1925 C  CD1 . PHE B 1 59  ? 25.939  20.285  22.048 1.00 11.23 ? 51  PHE B CD1 1 
ATOM   1926 C  CD2 . PHE B 1 59  ? 27.119  20.924  24.032 1.00 11.44 ? 51  PHE B CD2 1 
ATOM   1927 C  CE1 . PHE B 1 59  ? 26.381  18.967  22.209 1.00 11.35 ? 51  PHE B CE1 1 
ATOM   1928 C  CE2 . PHE B 1 59  ? 27.544  19.613  24.210 1.00 11.39 ? 51  PHE B CE2 1 
ATOM   1929 C  CZ  . PHE B 1 59  ? 27.169  18.625  23.296 1.00 11.15 ? 51  PHE B CZ  1 
ATOM   1930 N  N   . SER B 1 60  ? 24.824  24.808  20.617 1.00 10.53 ? 52  SER B N   1 
ATOM   1931 C  CA  . SER B 1 60  ? 24.054  25.993  20.391 1.00 10.99 ? 52  SER B CA  1 
ATOM   1932 C  C   . SER B 1 60  ? 22.983  26.152  21.468 1.00 10.96 ? 52  SER B C   1 
ATOM   1933 O  O   . SER B 1 60  ? 22.596  25.181  22.111 1.00 11.17 ? 52  SER B O   1 
ATOM   1934 C  CB  . SER B 1 60  ? 23.350  25.940  19.022 1.00 11.02 ? 52  SER B CB  1 
ATOM   1935 O  OG  . SER B 1 60  ? 22.352  24.929  19.037 1.00 10.59 ? 52  SER B OG  1 
ATOM   1936 N  N   . PRO B 1 61  ? 22.487  27.374  21.646 1.00 10.90 ? 53  PRO B N   1 
ATOM   1937 C  CA  . PRO B 1 61  ? 21.338  27.566  22.499 1.00 10.94 ? 53  PRO B CA  1 
ATOM   1938 C  C   . PRO B 1 61  ? 20.183  26.634  22.199 1.00 10.81 ? 53  PRO B C   1 
ATOM   1939 O  O   . PRO B 1 61  ? 19.620  26.035  23.109 1.00 10.62 ? 53  PRO B O   1 
ATOM   1940 C  CB  . PRO B 1 61  ? 20.944  29.020  22.212 1.00 11.23 ? 53  PRO B CB  1 
ATOM   1941 C  CG  . PRO B 1 61  ? 22.274  29.669  21.921 1.00 11.27 ? 53  PRO B CG  1 
ATOM   1942 C  CD  . PRO B 1 61  ? 22.986  28.643  21.099 1.00 11.18 ? 53  PRO B CD  1 
ATOM   1943 N  N   . ARG B 1 62  ? 19.864  26.474  20.925 1.00 10.91 ? 54  ARG B N   1 
ATOM   1944 C  CA  . ARG B 1 62  ? 18.724  25.645  20.526 1.00 10.98 ? 54  ARG B CA  1 
ATOM   1945 C  C   . ARG B 1 62  ? 18.919  24.140  20.821 1.00 10.28 ? 54  ARG B C   1 
ATOM   1946 O  O   . ARG B 1 62  ? 18.016  23.499  21.317 1.00 10.15 ? 54  ARG B O   1 
ATOM   1947 C  CB  . ARG B 1 62  ? 18.399  25.874  19.034 1.00 11.65 ? 54  ARG B CB  1 
ATOM   1948 C  CG  . ARG B 1 62  ? 17.121  25.191  18.556 1.00 11.97 ? 54  ARG B CG  1 
ATOM   1949 C  CD  . ARG B 1 62  ? 15.929  25.608  19.376 1.00 12.25 ? 54  ARG B CD  1 
ATOM   1950 N  NE  . ARG B 1 62  ? 14.681  25.093  18.825 1.00 13.18 ? 54  ARG B NE  1 
ATOM   1951 C  CZ  . ARG B 1 62  ? 13.479  25.242  19.398 1.00 13.82 ? 54  ARG B CZ  1 
ATOM   1952 N  NH1 . ARG B 1 62  ? 13.356  25.898  20.559 1.00 14.58 ? 54  ARG B NH1 1 
ATOM   1953 N  NH2 . ARG B 1 62  ? 12.398  24.700  18.853 1.00 13.65 ? 54  ARG B NH2 1 
ATOM   1954 N  N   . GLN B 1 63  ? 20.082  23.593  20.513 1.00 9.76  ? 55  GLN B N   1 
ATOM   1955 C  CA  . GLN B 1 63  ? 20.420  22.215  20.894 1.00 9.28  ? 55  GLN B CA  1 
ATOM   1956 C  C   . GLN B 1 63  ? 20.235  21.999  22.411 1.00 9.23  ? 55  GLN B C   1 
ATOM   1957 O  O   . GLN B 1 63  ? 19.627  21.005  22.814 1.00 8.99  ? 55  GLN B O   1 
ATOM   1958 C  CB  . GLN B 1 63  ? 21.835  21.856  20.436 1.00 8.92  ? 55  GLN B CB  1 
ATOM   1959 C  CG  . GLN B 1 63  ? 22.333  20.476  20.766 1.00 8.57  ? 55  GLN B CG  1 
ATOM   1960 C  CD  . GLN B 1 63  ? 21.568  19.386  20.035 1.00 8.48  ? 55  GLN B CD  1 
ATOM   1961 O  OE1 . GLN B 1 63  ? 21.999  18.921  18.955 1.00 8.42  ? 55  GLN B OE1 1 
ATOM   1962 N  NE2 . GLN B 1 63  ? 20.433  18.975  20.603 1.00 8.23  ? 55  GLN B NE2 1 
ATOM   1963 N  N   . MET B 1 64  ? 20.726  22.917  23.241 1.00 9.53  ? 56  MET B N   1 
ATOM   1964 C  CA  . MET B 1 64  ? 20.558  22.785  24.697 1.00 9.59  ? 56  MET B CA  1 
ATOM   1965 C  C   . MET B 1 64  ? 19.103  22.976  25.116 1.00 9.40  ? 56  MET B C   1 
ATOM   1966 O  O   . MET B 1 64  ? 18.611  22.246  25.964 1.00 9.01  ? 56  MET B O   1 
ATOM   1967 C  CB  . MET B 1 64  ? 21.439  23.773  25.433 1.00 10.20 ? 56  MET B CB  1 
ATOM   1968 C  CG  . MET B 1 64  ? 22.926  23.492  25.326 1.00 10.71 ? 56  MET B CG  1 
ATOM   1969 S  SD  . MET B 1 64  ? 23.466  21.899  26.035 1.00 11.09 ? 56  MET B SD  1 
ATOM   1970 C  CE  . MET B 1 64  ? 23.311  20.851  24.634 1.00 11.50 ? 56  MET B CE  1 
ATOM   1971 N  N   . GLU B 1 65  ? 18.416  23.958  24.504 1.00 9.48  ? 57  GLU B N   1 
ATOM   1972 C  CA  . GLU B 1 65  ? 17.022  24.232  24.799 1.00 9.30  ? 57  GLU B CA  1 
ATOM   1973 C  C   . GLU B 1 65  ? 16.171  22.986  24.567 1.00 8.89  ? 57  GLU B C   1 
ATOM   1974 O  O   . GLU B 1 65  ? 15.382  22.603  25.426 1.00 8.48  ? 57  GLU B O   1 
ATOM   1975 C  CB  . GLU B 1 65  ? 16.492  25.381  23.919 1.00 9.92  ? 57  GLU B CB  1 
ATOM   1976 C  CG  . GLU B 1 65  ? 15.041  25.686  24.215 1.00 10.25 ? 57  GLU B CG  1 
ATOM   1977 C  CD  . GLU B 1 65  ? 14.497  26.879  23.488 1.00 11.01 ? 57  GLU B CD  1 
ATOM   1978 O  OE1 . GLU B 1 65  ? 14.983  27.258  22.397 1.00 11.50 ? 57  GLU B OE1 1 
ATOM   1979 O  OE2 . GLU B 1 65  ? 13.489  27.401  23.973 1.00 11.41 ? 57  GLU B OE2 1 
ATOM   1980 N  N   . LEU B 1 66  ? 16.318  22.383  23.387 1.00 8.51  ? 58  LEU B N   1 
ATOM   1981 C  CA  . LEU B 1 66  ? 15.569  21.176  23.060 1.00 8.38  ? 58  LEU B CA  1 
ATOM   1982 C  C   . LEU B 1 66  ? 15.886  20.053  24.054 1.00 8.12  ? 58  LEU B C   1 
ATOM   1983 O  O   . LEU B 1 66  ? 14.990  19.420  24.575 1.00 7.97  ? 58  LEU B O   1 
ATOM   1984 C  CB  . LEU B 1 66  ? 15.886  20.671  21.645 1.00 8.38  ? 58  LEU B CB  1 
ATOM   1985 C  CG  . LEU B 1 66  ? 15.423  21.568  20.523 1.00 8.71  ? 58  LEU B CG  1 
ATOM   1986 C  CD1 . LEU B 1 66  ? 16.040  21.119  19.205 1.00 8.85  ? 58  LEU B CD1 1 
ATOM   1987 C  CD2 . LEU B 1 66  ? 13.901  21.608  20.460 1.00 8.87  ? 58  LEU B CD2 1 
ATOM   1988 N  N   . HIS B 1 67  ? 17.159  19.810  24.299 1.00 8.00  ? 59  HIS B N   1 
ATOM   1989 C  CA  . HIS B 1 67  ? 17.556  18.627  25.043 1.00 7.96  ? 59  HIS B CA  1 
ATOM   1990 C  C   . HIS B 1 67  ? 17.085  18.714  26.492 1.00 7.93  ? 59  HIS B C   1 
ATOM   1991 O  O   . HIS B 1 67  ? 16.559  17.752  27.036 1.00 7.74  ? 59  HIS B O   1 
ATOM   1992 C  CB  . HIS B 1 67  ? 19.057  18.455  24.971 1.00 7.95  ? 59  HIS B CB  1 
ATOM   1993 C  CG  . HIS B 1 67  ? 19.520  17.064  25.225 1.00 7.89  ? 59  HIS B CG  1 
ATOM   1994 N  ND1 . HIS B 1 67  ? 20.835  16.708  25.093 1.00 7.78  ? 59  HIS B ND1 1 
ATOM   1995 C  CD2 . HIS B 1 67  ? 18.857  15.944  25.618 1.00 7.85  ? 59  HIS B CD2 1 
ATOM   1996 C  CE1 . HIS B 1 67  ? 20.968  15.423  25.370 1.00 7.88  ? 59  HIS B CE1 1 
ATOM   1997 N  NE2 . HIS B 1 67  ? 19.787  14.940  25.693 1.00 7.83  ? 59  HIS B NE2 1 
ATOM   1998 N  N   . TYR B 1 68  ? 17.200  19.908  27.076 1.00 8.20  ? 60  TYR B N   1 
ATOM   1999 C  CA  . TYR B 1 68  ? 16.824  20.164  28.465 1.00 8.31  ? 60  TYR B CA  1 
ATOM   2000 C  C   . TYR B 1 68  ? 15.349  20.451  28.644 1.00 8.63  ? 60  TYR B C   1 
ATOM   2001 O  O   . TYR B 1 68  ? 14.672  19.741  29.389 1.00 8.46  ? 60  TYR B O   1 
ATOM   2002 C  CB  . TYR B 1 68  ? 17.623  21.364  28.987 1.00 8.40  ? 60  TYR B CB  1 
ATOM   2003 C  CG  . TYR B 1 68  ? 17.369  21.732  30.427 1.00 8.20  ? 60  TYR B CG  1 
ATOM   2004 C  CD1 . TYR B 1 68  ? 17.541  20.820  31.447 1.00 8.08  ? 60  TYR B CD1 1 
ATOM   2005 C  CD2 . TYR B 1 68  ? 17.010  23.023  30.763 1.00 8.30  ? 60  TYR B CD2 1 
ATOM   2006 C  CE1 . TYR B 1 68  ? 17.320  21.178  32.771 1.00 8.19  ? 60  TYR B CE1 1 
ATOM   2007 C  CE2 . TYR B 1 68  ? 16.795  23.405  32.064 1.00 8.34  ? 60  TYR B CE2 1 
ATOM   2008 C  CZ  . TYR B 1 68  ? 16.949  22.501  33.068 1.00 8.31  ? 60  TYR B CZ  1 
ATOM   2009 O  OH  . TYR B 1 68  ? 16.715  22.921  34.343 1.00 8.53  ? 60  TYR B OH  1 
ATOM   2010 N  N   . THR B 1 69  ? 14.851  21.506  27.990 1.00 9.09  ? 61  THR B N   1 
ATOM   2011 C  CA  . THR B 1 69  ? 13.483  21.967  28.239 1.00 9.47  ? 61  THR B CA  1 
ATOM   2012 C  C   . THR B 1 69  ? 12.433  21.171  27.485 1.00 9.63  ? 61  THR B C   1 
ATOM   2013 O  O   . THR B 1 69  ? 11.247  21.344  27.767 1.00 9.82  ? 61  THR B O   1 
ATOM   2014 C  CB  . THR B 1 69  ? 13.261  23.457  27.894 1.00 9.73  ? 61  THR B CB  1 
ATOM   2015 O  OG1 . THR B 1 69  ? 13.246  23.633  26.473 1.00 9.99  ? 61  THR B OG1 1 
ATOM   2016 C  CG2 . THR B 1 69  ? 14.313  24.326  28.515 1.00 9.83  ? 61  THR B CG2 1 
ATOM   2017 N  N   . LYS B 1 70  ? 12.836  20.324  26.537 1.00 9.80  ? 62  LYS B N   1 
ATOM   2018 C  CA  . LYS B 1 70  ? 11.879  19.386  25.915 1.00 10.14 ? 62  LYS B CA  1 
ATOM   2019 C  C   . LYS B 1 70  ? 12.129  17.954  26.325 1.00 9.47  ? 62  LYS B C   1 
ATOM   2020 O  O   . LYS B 1 70  ? 11.258  17.348  26.940 1.00 9.46  ? 62  LYS B O   1 
ATOM   2021 C  CB  . LYS B 1 70  ? 11.855  19.494  24.386 1.00 11.00 ? 62  LYS B CB  1 
ATOM   2022 C  CG  . LYS B 1 70  ? 11.727  20.931  23.856 1.00 12.06 ? 62  LYS B CG  1 
ATOM   2023 C  CD  . LYS B 1 70  ? 10.366  21.535  24.177 1.00 13.14 ? 62  LYS B CD  1 
ATOM   2024 C  CE  . LYS B 1 70  ? 10.385  23.017  23.861 1.00 14.46 ? 62  LYS B CE  1 
ATOM   2025 N  NZ  . LYS B 1 70  ? 9.072   23.593  24.224 1.00 15.84 ? 62  LYS B NZ  1 
ATOM   2026 N  N   . HIS B 1 71  ? 13.281  17.383  25.988 1.00 9.17  ? 63  HIS B N   1 
ATOM   2027 C  CA  . HIS B 1 71  ? 13.492  15.946  26.254 1.00 9.06  ? 63  HIS B CA  1 
ATOM   2028 C  C   . HIS B 1 71  ? 13.535  15.661  27.769 1.00 8.89  ? 63  HIS B C   1 
ATOM   2029 O  O   . HIS B 1 71  ? 12.753  14.876  28.278 1.00 8.81  ? 63  HIS B O   1 
ATOM   2030 C  CB  . HIS B 1 71  ? 14.711  15.380  25.518 1.00 8.91  ? 63  HIS B CB  1 
ATOM   2031 C  CG  . HIS B 1 71  ? 14.580  15.433  24.031 1.00 9.02  ? 63  HIS B CG  1 
ATOM   2032 N  ND1 . HIS B 1 71  ? 13.923  14.465  23.306 1.00 8.88  ? 63  HIS B ND1 1 
ATOM   2033 C  CD2 . HIS B 1 71  ? 14.979  16.370  23.139 1.00 9.12  ? 63  HIS B CD2 1 
ATOM   2034 C  CE1 . HIS B 1 71  ? 13.961  14.777  22.029 1.00 9.05  ? 63  HIS B CE1 1 
ATOM   2035 N  NE2 . HIS B 1 71  ? 14.578  15.943  21.900 1.00 9.13  ? 63  HIS B NE2 1 
ATOM   2036 N  N   . HIS B 1 72  ? 14.394  16.359  28.476 1.00 8.82  ? 64  HIS B N   1 
ATOM   2037 C  CA  . HIS B 1 72  ? 14.536  16.076  29.886 1.00 8.97  ? 64  HIS B CA  1 
ATOM   2038 C  C   . HIS B 1 72  ? 13.232  16.404  30.619 1.00 9.06  ? 64  HIS B C   1 
ATOM   2039 O  O   . HIS B 1 72  ? 12.728  15.586  31.390 1.00 8.80  ? 64  HIS B O   1 
ATOM   2040 C  CB  . HIS B 1 72  ? 15.725  16.804  30.489 1.00 8.92  ? 64  HIS B CB  1 
ATOM   2041 C  CG  . HIS B 1 72  ? 16.141  16.266  31.833 1.00 8.98  ? 64  HIS B CG  1 
ATOM   2042 N  ND1 . HIS B 1 72  ? 17.219  16.768  32.528 1.00 8.97  ? 64  HIS B ND1 1 
ATOM   2043 C  CD2 . HIS B 1 72  ? 15.620  15.287  32.608 1.00 9.00  ? 64  HIS B CD2 1 
ATOM   2044 C  CE1 . HIS B 1 72  ? 17.364  16.094  33.657 1.00 8.96  ? 64  HIS B CE1 1 
ATOM   2045 N  NE2 . HIS B 1 72  ? 16.394  15.205  33.737 1.00 9.00  ? 64  HIS B NE2 1 
ATOM   2046 N  N   . LYS B 1 73  ? 12.701  17.592  30.379 1.00 9.12  ? 65  LYS B N   1 
ATOM   2047 C  CA  . LYS B 1 73  ? 11.440  17.968  30.965 1.00 9.42  ? 65  LYS B CA  1 
ATOM   2048 C  C   . LYS B 1 73  ? 10.370  16.896  30.745 1.00 9.15  ? 65  LYS B C   1 
ATOM   2049 O  O   . LYS B 1 73  ? 9.643   16.534  31.670 1.00 9.00  ? 65  LYS B O   1 
ATOM   2050 C  CB  . LYS B 1 73  ? 10.980  19.319  30.399 1.00 10.22 ? 65  LYS B CB  1 
ATOM   2051 C  CG  . LYS B 1 73  ? 9.560   19.719  30.774 1.00 10.97 ? 65  LYS B CG  1 
ATOM   2052 C  CD  . LYS B 1 73  ? 9.466   21.209  30.998 1.00 11.67 ? 65  LYS B CD  1 
ATOM   2053 C  CE  . LYS B 1 73  ? 8.066   21.803  30.815 1.00 12.29 ? 65  LYS B CE  1 
ATOM   2054 N  NZ  . LYS B 1 73  ? 6.927   20.883  31.140 1.00 12.86 ? 65  LYS B NZ  1 
ATOM   2055 N  N   . ALA B 1 74  ? 10.276  16.369  29.534 1.00 8.82  ? 66  ALA B N   1 
ATOM   2056 C  CA  . ALA B 1 74  ? 9.256   15.373  29.267 1.00 8.82  ? 66  ALA B CA  1 
ATOM   2057 C  C   . ALA B 1 74  ? 9.499   14.098  30.109 1.00 8.69  ? 66  ALA B C   1 
ATOM   2058 O  O   . ALA B 1 74  ? 8.550   13.485  30.564 1.00 8.71  ? 66  ALA B O   1 
ATOM   2059 C  CB  . ALA B 1 74  ? 9.170   15.055  27.755 1.00 8.82  ? 66  ALA B CB  1 
ATOM   2060 N  N   . TYR B 1 75  ? 10.753  13.690  30.279 1.00 8.69  ? 67  TYR B N   1 
ATOM   2061 C  CA  . TYR B 1 75  ? 11.054  12.509  31.117 1.00 9.04  ? 67  TYR B CA  1 
ATOM   2062 C  C   . TYR B 1 75  ? 10.612  12.769  32.542 1.00 9.29  ? 67  TYR B C   1 
ATOM   2063 O  O   . TYR B 1 75  ? 10.025  11.886  33.161 1.00 9.71  ? 67  TYR B O   1 
ATOM   2064 C  CB  . TYR B 1 75  ? 12.538  12.113  31.087 1.00 8.93  ? 67  TYR B CB  1 
ATOM   2065 C  CG  . TYR B 1 75  ? 13.016  11.531  29.763 1.00 8.88  ? 67  TYR B CG  1 
ATOM   2066 C  CD1 . TYR B 1 75  ? 12.387  10.409  29.186 1.00 9.23  ? 67  TYR B CD1 1 
ATOM   2067 C  CD2 . TYR B 1 75  ? 14.065  12.085  29.086 1.00 8.87  ? 67  TYR B CD2 1 
ATOM   2068 C  CE1 . TYR B 1 75  ? 12.808  9.863   27.971 1.00 9.13  ? 67  TYR B CE1 1 
ATOM   2069 C  CE2 . TYR B 1 75  ? 14.482  11.558  27.867 1.00 8.95  ? 67  TYR B CE2 1 
ATOM   2070 C  CZ  . TYR B 1 75  ? 13.868  10.450  27.322 1.00 9.03  ? 67  TYR B CZ  1 
ATOM   2071 O  OH  . TYR B 1 75  ? 14.318  9.944   26.133 1.00 9.17  ? 67  TYR B OH  1 
ATOM   2072 N  N   . VAL B 1 76  ? 10.846  13.974  33.053 1.00 9.47  ? 68  VAL B N   1 
ATOM   2073 C  CA  . VAL B 1 76  ? 10.416  14.320  34.440 1.00 9.84  ? 68  VAL B CA  1 
ATOM   2074 C  C   . VAL B 1 76  ? 8.889   14.298  34.539 1.00 10.01 ? 68  VAL B C   1 
ATOM   2075 O  O   . VAL B 1 76  ? 8.354   13.753  35.479 1.00 9.83  ? 68  VAL B O   1 
ATOM   2076 C  CB  . VAL B 1 76  ? 10.957  15.723  34.870 1.00 9.84  ? 68  VAL B CB  1 
ATOM   2077 C  CG1 . VAL B 1 76  ? 10.303  16.223  36.150 1.00 9.93  ? 68  VAL B CG1 1 
ATOM   2078 C  CG2 . VAL B 1 76  ? 12.471  15.662  35.011 1.00 9.89  ? 68  VAL B CG2 1 
ATOM   2079 N  N   . ASP B 1 77  ? 8.209   14.929  33.570 1.00 10.30 ? 69  ASP B N   1 
ATOM   2080 C  CA  . ASP B 1 77  ? 6.759   15.006  33.575 1.00 10.80 ? 69  ASP B CA  1 
ATOM   2081 C  C   . ASP B 1 77  ? 6.134   13.612  33.535 1.00 11.21 ? 69  ASP B C   1 
ATOM   2082 O  O   . ASP B 1 77  ? 5.228   13.321  34.338 1.00 11.34 ? 69  ASP B O   1 
ATOM   2083 C  CB  . ASP B 1 77  ? 6.227   15.878  32.439 1.00 11.03 ? 69  ASP B CB  1 
ATOM   2084 C  CG  . ASP B 1 77  ? 6.593   17.362  32.606 1.00 11.21 ? 69  ASP B CG  1 
ATOM   2085 O  OD1 . ASP B 1 77  ? 6.948   17.794  33.719 1.00 11.68 ? 69  ASP B OD1 1 
ATOM   2086 O  OD2 . ASP B 1 77  ? 6.540   18.115  31.625 1.00 11.49 ? 69  ASP B OD2 1 
ATOM   2087 N  N   . LYS B 1 78  ? 6.644   12.742  32.653 1.00 11.05 ? 70  LYS B N   1 
ATOM   2088 C  CA  . LYS B 1 78  ? 6.096   11.399  32.523 1.00 11.39 ? 70  LYS B CA  1 
ATOM   2089 C  C   . LYS B 1 78  ? 6.463   10.558  33.779 1.00 10.82 ? 70  LYS B C   1 
ATOM   2090 O  O   . LYS B 1 78  ? 5.675   9.731   34.238 1.00 10.60 ? 70  LYS B O   1 
ATOM   2091 C  CB  . LYS B 1 78  ? 6.583   10.750  31.227 1.00 11.94 ? 70  LYS B CB  1 
ATOM   2092 C  CG  . LYS B 1 78  ? 5.899   9.440   30.861 1.00 12.89 ? 70  LYS B CG  1 
ATOM   2093 C  CD  . LYS B 1 78  ? 4.540   9.634   30.223 1.00 13.68 ? 70  LYS B CD  1 
ATOM   2094 C  CE  . LYS B 1 78  ? 3.830   8.318   29.902 1.00 14.18 ? 70  LYS B CE  1 
ATOM   2095 N  NZ  . LYS B 1 78  ? 4.255   7.676   28.637 1.00 14.49 ? 70  LYS B NZ  1 
ATOM   2096 N  N   . LEU B 1 79  ? 7.658   10.763  34.324 1.00 10.41 ? 71  LEU B N   1 
ATOM   2097 C  CA  . LEU B 1 79  ? 8.019   10.108  35.597 1.00 10.56 ? 71  LEU B CA  1 
ATOM   2098 C  C   . LEU B 1 79  ? 6.993   10.430  36.701 1.00 10.36 ? 71  LEU B C   1 
ATOM   2099 O  O   . LEU B 1 79  ? 6.434   9.518   37.334 1.00 10.50 ? 71  LEU B O   1 
ATOM   2100 C  CB  . LEU B 1 79  ? 9.436   10.496  36.038 1.00 10.62 ? 71  LEU B CB  1 
ATOM   2101 C  CG  . LEU B 1 79  ? 9.836   10.161  37.479 1.00 11.16 ? 71  LEU B CG  1 
ATOM   2102 C  CD1 . LEU B 1 79  ? 9.765   8.660   37.720 1.00 11.53 ? 71  LEU B CD1 1 
ATOM   2103 C  CD2 . LEU B 1 79  ? 11.209  10.705  37.804 1.00 11.22 ? 71  LEU B CD2 1 
ATOM   2104 N  N   . ASN B 1 80  ? 6.712   11.714  36.905 1.00 9.97  ? 72  ASN B N   1 
ATOM   2105 C  CA  . ASN B 1 80  ? 5.713   12.104  37.898 1.00 10.23 ? 72  ASN B CA  1 
ATOM   2106 C  C   . ASN B 1 80  ? 4.362   11.456  37.619 1.00 10.31 ? 72  ASN B C   1 
ATOM   2107 O  O   . ASN B 1 80  ? 3.736   10.943  38.533 1.00 10.20 ? 72  ASN B O   1 
ATOM   2108 C  CB  . ASN B 1 80  ? 5.599   13.644  38.031 1.00 10.28 ? 72  ASN B CB  1 
ATOM   2109 C  CG  . ASN B 1 80  ? 6.814   14.265  38.726 1.00 10.44 ? 72  ASN B CG  1 
ATOM   2110 O  OD1 . ASN B 1 80  ? 7.294   13.748  39.732 1.00 10.19 ? 72  ASN B OD1 1 
ATOM   2111 N  ND2 . ASN B 1 80  ? 7.339   15.383  38.167 1.00 10.60 ? 72  ASN B ND2 1 
ATOM   2112 N  N   . ALA B 1 81  ? 3.910   11.457  36.365 1.00 10.43 ? 73  ALA B N   1 
ATOM   2113 C  CA  . ALA B 1 81  ? 2.607   10.876  36.049 1.00 10.73 ? 73  ALA B CA  1 
ATOM   2114 C  C   . ALA B 1 81  ? 2.573   9.366   36.343 1.00 11.12 ? 73  ALA B C   1 
ATOM   2115 O  O   . ALA B 1 81  ? 1.595   8.879   36.882 1.00 11.63 ? 73  ALA B O   1 
ATOM   2116 C  CB  . ALA B 1 81  ? 2.240   11.149  34.594 1.00 10.80 ? 73  ALA B CB  1 
ATOM   2117 N  N   . LEU B 1 82  ? 3.629   8.632   35.987 1.00 11.01 ? 74  LEU B N   1 
ATOM   2118 C  CA  . LEU B 1 82  ? 3.664   7.191   36.231 1.00 11.19 ? 74  LEU B CA  1 
ATOM   2119 C  C   . LEU B 1 82  ? 3.907   6.851   37.691 1.00 11.46 ? 74  LEU B C   1 
ATOM   2120 O  O   . LEU B 1 82  ? 3.433   5.847   38.155 1.00 11.23 ? 74  LEU B O   1 
ATOM   2121 C  CB  . LEU B 1 82  ? 4.706   6.482   35.349 1.00 11.04 ? 74  LEU B CB  1 
ATOM   2122 C  CG  . LEU B 1 82  ? 4.392   6.406   33.846 1.00 11.18 ? 74  LEU B CG  1 
ATOM   2123 C  CD1 . LEU B 1 82  ? 5.579   5.928   33.053 1.00 11.03 ? 74  LEU B CD1 1 
ATOM   2124 C  CD2 . LEU B 1 82  ? 3.195   5.495   33.547 1.00 11.60 ? 74  LEU B CD2 1 
ATOM   2125 N  N   . ALA B 1 83  ? 4.635   7.689   38.420 1.00 11.85 ? 75  ALA B N   1 
ATOM   2126 C  CA  . ALA B 1 83  ? 4.942   7.362   39.802 1.00 12.17 ? 75  ALA B CA  1 
ATOM   2127 C  C   . ALA B 1 83  ? 3.776   7.606   40.783 1.00 12.46 ? 75  ALA B C   1 
ATOM   2128 O  O   . ALA B 1 83  ? 3.677   6.954   41.807 1.00 12.12 ? 75  ALA B O   1 
ATOM   2129 C  CB  . ALA B 1 83  ? 6.176   8.117   40.254 1.00 12.23 ? 75  ALA B CB  1 
ATOM   2130 N  N   . GLY B 1 84  ? 2.882   8.541   40.473 1.00 12.95 ? 76  GLY B N   1 
ATOM   2131 C  CA  . GLY B 1 84  ? 1.877   8.950   41.442 1.00 13.47 ? 76  GLY B CA  1 
ATOM   2132 C  C   . GLY B 1 84  ? 2.570   9.223   42.772 1.00 13.88 ? 76  GLY B C   1 
ATOM   2133 O  O   . GLY B 1 84  ? 3.625   9.864   42.815 1.00 14.32 ? 76  GLY B O   1 
ATOM   2134 N  N   . THR B 1 85  ? 1.996   8.742   43.861 1.00 14.45 ? 77  THR B N   1 
ATOM   2135 C  CA  . THR B 1 85  ? 2.594   8.915   45.196 1.00 14.74 ? 77  THR B CA  1 
ATOM   2136 C  C   . THR B 1 85  ? 3.278   7.629   45.685 1.00 15.17 ? 77  THR B C   1 
ATOM   2137 O  O   . THR B 1 85  ? 3.832   7.585   46.779 1.00 14.26 ? 77  THR B O   1 
ATOM   2138 C  CB  . THR B 1 85  ? 1.522   9.251   46.219 1.00 14.93 ? 77  THR B CB  1 
ATOM   2139 O  OG1 . THR B 1 85  ? 0.611   8.169   46.251 1.00 15.35 ? 77  THR B OG1 1 
ATOM   2140 C  CG2 . THR B 1 85  ? 0.753   10.543  45.851 1.00 14.59 ? 77  THR B CG2 1 
ATOM   2141 N  N   . THR B 1 86  ? 3.216   6.579   44.867 1.00 15.82 ? 78  THR B N   1 
ATOM   2142 C  CA  . THR B 1 86  ? 3.771   5.261   45.231 1.00 15.96 ? 78  THR B CA  1 
ATOM   2143 C  C   . THR B 1 86  ? 5.253   5.280   45.620 1.00 15.70 ? 78  THR B C   1 
ATOM   2144 O  O   . THR B 1 86  ? 5.669   4.448   46.382 1.00 16.21 ? 78  THR B O   1 
ATOM   2145 C  CB  . THR B 1 86  ? 3.646   4.300   44.032 1.00 16.72 ? 78  THR B CB  1 
ATOM   2146 O  OG1 . THR B 1 86  ? 2.330   4.397   43.484 1.00 17.45 ? 78  THR B OG1 1 
ATOM   2147 C  CG2 . THR B 1 86  ? 3.928   2.852   44.455 1.00 17.12 ? 78  THR B CG2 1 
ATOM   2148 N  N   . TYR B 1 87  ? 6.051   6.214   45.074 1.00 15.14 ? 79  TYR B N   1 
ATOM   2149 C  CA  . TYR B 1 87  ? 7.504   6.248   45.300 1.00 14.53 ? 79  TYR B CA  1 
ATOM   2150 C  C   . TYR B 1 87  ? 7.970   7.507   46.065 1.00 14.17 ? 79  TYR B C   1 
ATOM   2151 O  O   . TYR B 1 87  ? 9.163   7.841   46.052 1.00 13.78 ? 79  TYR B O   1 
ATOM   2152 C  CB  . TYR B 1 87  ? 8.230   6.125   43.941 1.00 14.10 ? 79  TYR B CB  1 
ATOM   2153 C  CG  . TYR B 1 87  ? 7.854   4.828   43.225 1.00 14.47 ? 79  TYR B CG  1 
ATOM   2154 C  CD1 . TYR B 1 87  ? 8.469   3.627   43.565 1.00 14.50 ? 79  TYR B CD1 1 
ATOM   2155 C  CD2 . TYR B 1 87  ? 6.835   4.792   42.257 1.00 14.69 ? 79  TYR B CD2 1 
ATOM   2156 C  CE1 . TYR B 1 87  ? 8.120   2.436   42.947 1.00 14.55 ? 79  TYR B CE1 1 
ATOM   2157 C  CE2 . TYR B 1 87  ? 6.460   3.597   41.642 1.00 14.81 ? 79  TYR B CE2 1 
ATOM   2158 C  CZ  . TYR B 1 87  ? 7.108   2.423   42.002 1.00 15.06 ? 79  TYR B CZ  1 
ATOM   2159 O  OH  . TYR B 1 87  ? 6.813   1.231   41.371 1.00 15.56 ? 79  TYR B OH  1 
ATOM   2160 N  N   . ASP B 1 88  ? 7.037   8.178   46.739 1.00 14.14 ? 80  ASP B N   1 
ATOM   2161 C  CA  . ASP B 1 88  ? 7.321   9.411   47.473 1.00 14.34 ? 80  ASP B CA  1 
ATOM   2162 C  C   . ASP B 1 88  ? 8.333   9.195   48.588 1.00 14.56 ? 80  ASP B C   1 
ATOM   2163 O  O   . ASP B 1 88  ? 8.196   8.275   49.384 1.00 14.87 ? 80  ASP B O   1 
ATOM   2164 C  CB  . ASP B 1 88  ? 6.017   9.998   48.027 1.00 14.79 ? 80  ASP B CB  1 
ATOM   2165 C  CG  . ASP B 1 88  ? 5.211   10.736  46.961 1.00 15.02 ? 80  ASP B CG  1 
ATOM   2166 O  OD1 . ASP B 1 88  ? 5.499   10.522  45.759 1.00 15.43 ? 80  ASP B OD1 1 
ATOM   2167 O  OD2 . ASP B 1 88  ? 4.320   11.528  47.303 1.00 15.11 ? 80  ASP B OD2 1 
ATOM   2168 N  N   . GLY B 1 89  ? 9.352   10.047  48.628 1.00 14.35 ? 81  GLY B N   1 
ATOM   2169 C  CA  . GLY B 1 89  ? 10.415  9.952   49.625 1.00 14.77 ? 81  GLY B CA  1 
ATOM   2170 C  C   . GLY B 1 89  ? 11.607  9.116   49.175 1.00 15.01 ? 81  GLY B C   1 
ATOM   2171 O  O   . GLY B 1 89  ? 12.643  9.150   49.801 1.00 15.26 ? 81  GLY B O   1 
ATOM   2172 N  N   . LYS B 1 90  ? 11.453  8.361   48.092 1.00 14.59 ? 82  LYS B N   1 
ATOM   2173 C  CA  . LYS B 1 90  ? 12.551  7.585   47.512 1.00 14.46 ? 82  LYS B CA  1 
ATOM   2174 C  C   . LYS B 1 90  ? 13.451  8.406   46.590 1.00 13.46 ? 82  LYS B C   1 
ATOM   2175 O  O   . LYS B 1 90  ? 13.001  9.334   45.922 1.00 13.35 ? 82  LYS B O   1 
ATOM   2176 C  CB  . LYS B 1 90  ? 11.982  6.440   46.698 1.00 15.01 ? 82  LYS B CB  1 
ATOM   2177 C  CG  . LYS B 1 90  ? 11.173  5.446   47.514 1.00 16.35 ? 82  LYS B CG  1 
ATOM   2178 C  CD  . LYS B 1 90  ? 11.320  4.052   46.955 1.00 16.99 ? 82  LYS B CD  1 
ATOM   2179 C  CE  . LYS B 1 90  ? 11.261  3.024   48.061 1.00 18.04 ? 82  LYS B CE  1 
ATOM   2180 N  NZ  . LYS B 1 90  ? 9.913   3.057   48.645 1.00 18.20 ? 82  LYS B NZ  1 
ATOM   2181 N  N   . SER B 1 91  ? 14.720  8.039   46.543 1.00 12.61 ? 83  SER B N   1 
ATOM   2182 C  CA  . SER B 1 91  ? 15.621  8.573   45.559 1.00 12.17 ? 83  SER B CA  1 
ATOM   2183 C  C   . SER B 1 91  ? 15.267  8.012   44.188 1.00 11.81 ? 83  SER B C   1 
ATOM   2184 O  O   . SER B 1 91  ? 14.715  6.891   44.072 1.00 11.19 ? 83  SER B O   1 
ATOM   2185 C  CB  . SER B 1 91  ? 17.073  8.209   45.902 1.00 12.17 ? 83  SER B CB  1 
ATOM   2186 O  OG  . SER B 1 91  ? 17.304  6.840   45.653 1.00 12.26 ? 83  SER B OG  1 
ATOM   2187 N  N   . ILE B 1 92  ? 15.620  8.769   43.147 1.00 11.45 ? 84  ILE B N   1 
ATOM   2188 C  CA  . ILE B 1 92  ? 15.363  8.339   41.793 1.00 11.69 ? 84  ILE B CA  1 
ATOM   2189 C  C   . ILE B 1 92  ? 16.110  7.007   41.543 1.00 12.27 ? 84  ILE B C   1 
ATOM   2190 O  O   . ILE B 1 92  ? 15.574  6.071   40.902 1.00 11.85 ? 84  ILE B O   1 
ATOM   2191 C  CB  . ILE B 1 92  ? 15.810  9.391   40.755 1.00 11.67 ? 84  ILE B CB  1 
ATOM   2192 C  CG1 . ILE B 1 92  ? 15.054  10.713  40.978 1.00 11.65 ? 84  ILE B CG1 1 
ATOM   2193 C  CG2 . ILE B 1 92  ? 15.654  8.844   39.309 1.00 11.21 ? 84  ILE B CG2 1 
ATOM   2194 C  CD1 . ILE B 1 92  ? 13.541  10.621  40.942 1.00 11.83 ? 84  ILE B CD1 1 
ATOM   2195 N  N   . GLU B 1 93  ? 17.323  6.905   42.076 1.00 12.72 ? 85  GLU B N   1 
ATOM   2196 C  CA  . GLU B 1 93  ? 18.099  5.655   41.931 1.00 13.76 ? 85  GLU B CA  1 
ATOM   2197 C  C   . GLU B 1 93  ? 17.431  4.471   42.593 1.00 14.48 ? 85  GLU B C   1 
ATOM   2198 O  O   . GLU B 1 93  ? 17.503  3.363   42.050 1.00 15.12 ? 85  GLU B O   1 
ATOM   2199 C  CB  . GLU B 1 93  ? 19.520  5.821   42.455 1.00 13.84 ? 85  GLU B CB  1 
ATOM   2200 C  CG  . GLU B 1 93  ? 20.327  6.691   41.520 1.00 14.08 ? 85  GLU B CG  1 
ATOM   2201 C  CD  . GLU B 1 93  ? 21.591  7.235   42.147 1.00 14.51 ? 85  GLU B CD  1 
ATOM   2202 O  OE1 . GLU B 1 93  ? 22.614  6.503   42.093 1.00 13.88 ? 85  GLU B OE1 1 
ATOM   2203 O  OE2 . GLU B 1 93  ? 21.554  8.400   42.645 1.00 14.46 ? 85  GLU B OE2 1 
ATOM   2204 N  N   . GLU B 1 94  ? 16.792  4.690   43.748 1.00 15.28 ? 86  GLU B N   1 
ATOM   2205 C  CA  . GLU B 1 94  ? 16.024  3.618   44.424 1.00 16.17 ? 86  GLU B CA  1 
ATOM   2206 C  C   . GLU B 1 94  ? 14.886  3.155   43.540 1.00 15.34 ? 86  GLU B C   1 
ATOM   2207 O  O   . GLU B 1 94  ? 14.632  1.967   43.439 1.00 15.96 ? 86  GLU B O   1 
ATOM   2208 C  CB  . GLU B 1 94  ? 15.470  4.059   45.792 1.00 17.70 ? 86  GLU B CB  1 
ATOM   2209 C  CG  . GLU B 1 94  ? 16.511  4.103   46.899 1.00 19.88 ? 86  GLU B CG  1 
ATOM   2210 C  CD  . GLU B 1 94  ? 15.989  4.718   48.219 1.00 22.67 ? 86  GLU B CD  1 
ATOM   2211 O  OE1 . GLU B 1 94  ? 15.978  3.986   49.241 1.00 28.15 ? 86  GLU B OE1 1 
ATOM   2212 O  OE2 . GLU B 1 94  ? 15.601  5.905   48.278 1.00 21.63 ? 86  GLU B OE2 1 
ATOM   2213 N  N   . ILE B 1 95  ? 14.206  4.091   42.893 1.00 14.51 ? 87  ILE B N   1 
ATOM   2214 C  CA  . ILE B 1 95  ? 13.099  3.738   42.012 1.00 14.67 ? 87  ILE B CA  1 
ATOM   2215 C  C   . ILE B 1 95  ? 13.593  2.893   40.821 1.00 14.44 ? 87  ILE B C   1 
ATOM   2216 O  O   . ILE B 1 95  ? 13.039  1.852   40.533 1.00 13.83 ? 87  ILE B O   1 
ATOM   2217 C  CB  . ILE B 1 95  ? 12.389  4.988   41.474 1.00 14.46 ? 87  ILE B CB  1 
ATOM   2218 C  CG1 . ILE B 1 95  ? 11.737  5.742   42.615 1.00 15.03 ? 87  ILE B CG1 1 
ATOM   2219 C  CG2 . ILE B 1 95  ? 11.336  4.629   40.442 1.00 14.24 ? 87  ILE B CG2 1 
ATOM   2220 C  CD1 . ILE B 1 95  ? 11.323  7.151   42.205 1.00 15.31 ? 87  ILE B CD1 1 
ATOM   2221 N  N   . ILE B 1 96  ? 14.650  3.368   40.171 1.00 14.52 ? 88  ILE B N   1 
ATOM   2222 C  CA  . ILE B 1 96  ? 15.263  2.679   39.051 1.00 14.80 ? 88  ILE B CA  1 
ATOM   2223 C  C   . ILE B 1 96  ? 15.548  1.223   39.421 1.00 15.20 ? 88  ILE B C   1 
ATOM   2224 O  O   . ILE B 1 96  ? 15.148  0.320   38.702 1.00 14.94 ? 88  ILE B O   1 
ATOM   2225 C  CB  . ILE B 1 96  ? 16.565  3.370   38.617 1.00 14.43 ? 88  ILE B CB  1 
ATOM   2226 C  CG1 . ILE B 1 96  ? 16.244  4.713   37.999 1.00 14.39 ? 88  ILE B CG1 1 
ATOM   2227 C  CG2 . ILE B 1 96  ? 17.338  2.513   37.611 1.00 14.14 ? 88  ILE B CG2 1 
ATOM   2228 C  CD1 . ILE B 1 96  ? 17.408  5.682   37.974 1.00 14.48 ? 88  ILE B CD1 1 
ATOM   2229 N  N   . LEU B 1 97  ? 16.229  1.012   40.543 1.00 15.91 ? 89  LEU B N   1 
ATOM   2230 C  CA  . LEU B 1 97  ? 16.570  -0.345  41.002 1.00 16.47 ? 89  LEU B CA  1 
ATOM   2231 C  C   . LEU B 1 97  ? 15.314  -1.141  41.359 1.00 15.78 ? 89  LEU B C   1 
ATOM   2232 O  O   . LEU B 1 97  ? 15.160  -2.273  40.929 1.00 15.76 ? 89  LEU B O   1 
ATOM   2233 C  CB  . LEU B 1 97  ? 17.505  -0.268  42.210 1.00 17.93 ? 89  LEU B CB  1 
ATOM   2234 C  CG  . LEU B 1 97  ? 18.165  -1.586  42.584 1.00 19.77 ? 89  LEU B CG  1 
ATOM   2235 C  CD1 . LEU B 1 97  ? 19.323  -1.870  41.618 1.00 20.46 ? 89  LEU B CD1 1 
ATOM   2236 C  CD2 . LEU B 1 97  ? 18.649  -1.577  44.034 1.00 19.97 ? 89  LEU B CD2 1 
ATOM   2237 N  N   . ALA B 1 98  ? 14.402  -0.547  42.112 1.00 15.03 ? 90  ALA B N   1 
ATOM   2238 C  CA  . ALA B 1 98  ? 13.165  -1.222  42.453 1.00 15.29 ? 90  ALA B CA  1 
ATOM   2239 C  C   . ALA B 1 98  ? 12.403  -1.733  41.218 1.00 15.49 ? 90  ALA B C   1 
ATOM   2240 O  O   . ALA B 1 98  ? 11.868  -2.828  41.238 1.00 15.20 ? 90  ALA B O   1 
ATOM   2241 C  CB  . ALA B 1 98  ? 12.268  -0.338  43.293 1.00 15.37 ? 90  ALA B CB  1 
ATOM   2242 N  N   . VAL B 1 99  ? 12.389  -0.997  40.124 1.00 14.85 ? 91  VAL B N   1 
ATOM   2243 C  CA  . VAL B 1 99  ? 11.586  -1.448  39.008 1.00 14.88 ? 91  VAL B CA  1 
ATOM   2244 C  C   . VAL B 1 99  ? 12.343  -2.003  37.809 1.00 14.81 ? 91  VAL B C   1 
ATOM   2245 O  O   . VAL B 1 99  ? 11.731  -2.277  36.778 1.00 14.29 ? 91  VAL B O   1 
ATOM   2246 C  CB  . VAL B 1 99  ? 10.628  -0.353  38.540 1.00 14.90 ? 91  VAL B CB  1 
ATOM   2247 C  CG1 . VAL B 1 99  ? 9.700   0.036   39.678 1.00 15.24 ? 91  VAL B CG1 1 
ATOM   2248 C  CG2 . VAL B 1 99  ? 11.379  0.843   37.993 1.00 14.66 ? 91  VAL B CG2 1 
ATOM   2249 N  N   . ALA B 1 100 ? 13.649  -2.196  37.957 1.00 15.87 ? 92  ALA B N   1 
ATOM   2250 C  CA  . ALA B 1 100 ? 14.524  -2.618  36.844 1.00 16.39 ? 92  ALA B CA  1 
ATOM   2251 C  C   . ALA B 1 100 ? 14.064  -3.957  36.250 1.00 17.47 ? 92  ALA B C   1 
ATOM   2252 O  O   . ALA B 1 100 ? 14.114  -4.120  35.056 1.00 17.21 ? 92  ALA B O   1 
ATOM   2253 C  CB  . ALA B 1 100 ? 15.989  -2.681  37.291 1.00 16.22 ? 92  ALA B CB  1 
ATOM   2254 N  N   . ASN B 1 101 ? 13.544  -4.864  37.076 1.00 19.75 ? 93  ASN B N   1 
ATOM   2255 C  CA  . ASN B 1 101 ? 13.046  -6.189  36.605 1.00 21.77 ? 93  ASN B CA  1 
ATOM   2256 C  C   . ASN B 1 101 ? 11.553  -6.431  36.702 1.00 23.71 ? 93  ASN B C   1 
ATOM   2257 O  O   . ASN B 1 101 ? 11.098  -7.567  36.881 1.00 25.87 ? 93  ASN B O   1 
ATOM   2258 C  CB  . ASN B 1 101 ? 13.734  -7.317  37.372 1.00 21.98 ? 93  ASN B CB  1 
ATOM   2259 C  CG  . ASN B 1 101 ? 15.216  -7.341  37.143 1.00 22.72 ? 93  ASN B CG  1 
ATOM   2260 O  OD1 . ASN B 1 101 ? 15.703  -6.919  36.085 1.00 22.40 ? 93  ASN B OD1 1 
ATOM   2261 N  ND2 . ASN B 1 101 ? 15.944  -7.868  38.115 1.00 23.28 ? 93  ASN B ND2 1 
ATOM   2262 N  N   . ASP B 1 102 ? 10.791  -5.365  36.573 1.00 23.96 ? 94  ASP B N   1 
ATOM   2263 C  CA  . ASP B 1 102 ? 9.363   -5.432  36.704 1.00 24.07 ? 94  ASP B CA  1 
ATOM   2264 C  C   . ASP B 1 102 ? 8.833   -5.098  35.329 1.00 23.85 ? 94  ASP B C   1 
ATOM   2265 O  O   . ASP B 1 102 ? 8.779   -3.916  34.954 1.00 22.58 ? 94  ASP B O   1 
ATOM   2266 C  CB  . ASP B 1 102 ? 8.899   -4.433  37.783 1.00 24.42 ? 94  ASP B CB  1 
ATOM   2267 C  CG  . ASP B 1 102 ? 7.393   -4.453  37.993 1.00 25.42 ? 94  ASP B CG  1 
ATOM   2268 O  OD1 . ASP B 1 102 ? 6.682   -4.981  37.106 1.00 27.92 ? 94  ASP B OD1 1 
ATOM   2269 O  OD2 . ASP B 1 102 ? 6.916   -3.938  39.022 1.00 23.51 ? 94  ASP B OD2 1 
ATOM   2270 N  N   . ALA B 1 103 ? 8.435   -6.138  34.592 1.00 23.11 ? 95  ALA B N   1 
ATOM   2271 C  CA  . ALA B 1 103 ? 7.898   -5.978  33.251 1.00 23.49 ? 95  ALA B CA  1 
ATOM   2272 C  C   . ALA B 1 103 ? 6.592   -5.211  33.232 1.00 23.61 ? 95  ALA B C   1 
ATOM   2273 O  O   . ALA B 1 103 ? 6.239   -4.676  32.197 1.00 27.15 ? 95  ALA B O   1 
ATOM   2274 C  CB  . ALA B 1 103 ? 7.693   -7.330  32.586 1.00 24.94 ? 95  ALA B CB  1 
ATOM   2275 N  N   . GLU B 1 104 ? 5.875   -5.132  34.340 1.00 21.25 ? 96  GLU B N   1 
ATOM   2276 C  CA  . GLU B 1 104 ? 4.679   -4.303  34.382 1.00 21.20 ? 96  GLU B CA  1 
ATOM   2277 C  C   . GLU B 1 104 ? 5.020   -2.804  34.380 1.00 20.37 ? 96  GLU B C   1 
ATOM   2278 O  O   . GLU B 1 104 ? 4.158   -2.006  34.102 1.00 20.75 ? 96  GLU B O   1 
ATOM   2279 C  CB  . GLU B 1 104 ? 3.814   -4.631  35.616 1.00 21.30 ? 96  GLU B CB  1 
ATOM   2280 N  N   . LYS B 1 105 ? 6.276   -2.441  34.675 1.00 19.62 ? 97  LYS B N   1 
ATOM   2281 C  CA  . LYS B 1 105 ? 6.680   -1.052  34.956 1.00 18.59 ? 97  LYS B CA  1 
ATOM   2282 C  C   . LYS B 1 105 ? 7.912   -0.604  34.135 1.00 17.29 ? 97  LYS B C   1 
ATOM   2283 O  O   . LYS B 1 105 ? 8.696   0.239   34.579 1.00 16.98 ? 97  LYS B O   1 
ATOM   2284 C  CB  . LYS B 1 105 ? 6.949   -0.875  36.470 1.00 18.66 ? 97  LYS B CB  1 
ATOM   2285 N  N   . LYS B 1 106 ? 8.080   -1.165  32.945 1.00 15.98 ? 98  LYS B N   1 
ATOM   2286 C  CA  . LYS B 1 106 ? 9.178   -0.762  32.073 1.00 14.86 ? 98  LYS B CA  1 
ATOM   2287 C  C   . LYS B 1 106 ? 9.077   0.749   31.747 1.00 13.46 ? 98  LYS B C   1 
ATOM   2288 O  O   . LYS B 1 106 ? 10.074  1.458   31.770 1.00 13.15 ? 98  LYS B O   1 
ATOM   2289 C  CB  . LYS B 1 106 ? 9.223   -1.641  30.804 1.00 14.73 ? 98  LYS B CB  1 
ATOM   2290 N  N   . GLY B 1 107 ? 7.865   1.232   31.519 1.00 12.51 ? 99  GLY B N   1 
ATOM   2291 C  CA  . GLY B 1 107 ? 7.578   2.652   31.277 1.00 11.68 ? 99  GLY B CA  1 
ATOM   2292 C  C   . GLY B 1 107 ? 8.137   3.554   32.370 1.00 11.02 ? 99  GLY B C   1 
ATOM   2293 O  O   . GLY B 1 107 ? 8.872   4.517   32.103 1.00 10.38 ? 99  GLY B O   1 
ATOM   2294 N  N   . LEU B 1 108 ? 7.806   3.219   33.609 1.00 10.90 ? 100 LEU B N   1 
ATOM   2295 C  CA  . LEU B 1 108 ? 8.335   3.947   34.774 1.00 10.60 ? 100 LEU B CA  1 
ATOM   2296 C  C   . LEU B 1 108 ? 9.865   3.836   34.856 1.00 10.11 ? 100 LEU B C   1 
ATOM   2297 O  O   . LEU B 1 108 ? 10.526  4.828   35.099 1.00 10.11 ? 100 LEU B O   1 
ATOM   2298 C  CB  . LEU B 1 108 ? 7.671   3.450   36.068 1.00 10.92 ? 100 LEU B CB  1 
ATOM   2299 C  CG  . LEU B 1 108 ? 8.203   4.076   37.359 1.00 11.09 ? 100 LEU B CG  1 
ATOM   2300 C  CD1 . LEU B 1 108 ? 8.055   5.591   37.397 1.00 11.22 ? 100 LEU B CD1 1 
ATOM   2301 C  CD2 . LEU B 1 108 ? 7.487   3.500   38.564 1.00 11.61 ? 100 LEU B CD2 1 
ATOM   2302 N  N   . PHE B 1 109 ? 10.421  2.640   34.652 1.00 9.72  ? 101 PHE B N   1 
ATOM   2303 C  CA  . PHE B 1 109 ? 11.857  2.472   34.605 1.00 9.36  ? 101 PHE B CA  1 
ATOM   2304 C  C   . PHE B 1 109 ? 12.486  3.406   33.548 1.00 9.07  ? 101 PHE B C   1 
ATOM   2305 O  O   . PHE B 1 109 ? 13.420  4.099   33.841 1.00 9.11  ? 101 PHE B O   1 
ATOM   2306 C  CB  . PHE B 1 109 ? 12.260  1.012   34.318 1.00 9.55  ? 101 PHE B CB  1 
ATOM   2307 C  CG  . PHE B 1 109 ? 13.724  0.841   34.106 1.00 9.39  ? 101 PHE B CG  1 
ATOM   2308 C  CD1 . PHE B 1 109 ? 14.551  0.663   35.160 1.00 9.32  ? 101 PHE B CD1 1 
ATOM   2309 C  CD2 . PHE B 1 109 ? 14.256  0.875   32.827 1.00 9.25  ? 101 PHE B CD2 1 
ATOM   2310 C  CE1 . PHE B 1 109 ? 15.904  0.532   34.967 1.00 9.39  ? 101 PHE B CE1 1 
ATOM   2311 C  CE2 . PHE B 1 109 ? 15.609  0.761   32.628 1.00 9.12  ? 101 PHE B CE2 1 
ATOM   2312 C  CZ  . PHE B 1 109 ? 16.442  0.589   33.688 1.00 9.16  ? 101 PHE B CZ  1 
ATOM   2313 N  N   . ASN B 1 110 ? 11.953  3.418   32.341 1.00 8.96  ? 102 ASN B N   1 
ATOM   2314 C  CA  . ASN B 1 110 ? 12.477  4.249   31.259 1.00 8.92  ? 102 ASN B CA  1 
ATOM   2315 C  C   . ASN B 1 110 ? 12.532  5.748   31.612 1.00 8.87  ? 102 ASN B C   1 
ATOM   2316 O  O   . ASN B 1 110 ? 13.552  6.372   31.391 1.00 8.66  ? 102 ASN B O   1 
ATOM   2317 C  CB  . ASN B 1 110 ? 11.672  4.054   29.961 1.00 8.93  ? 102 ASN B CB  1 
ATOM   2318 C  CG  . ASN B 1 110 ? 11.912  2.696   29.328 1.00 9.16  ? 102 ASN B CG  1 
ATOM   2319 O  OD1 . ASN B 1 110 ? 12.912  2.042   29.609 1.00 9.31  ? 102 ASN B OD1 1 
ATOM   2320 N  ND2 . ASN B 1 110 ? 11.031  2.298   28.421 1.00 9.38  ? 102 ASN B ND2 1 
ATOM   2321 N  N   . GLN B 1 111 ? 11.472  6.305   32.208 1.00 8.94  ? 103 GLN B N   1 
ATOM   2322 C  CA  . GLN B 1 111 ? 11.462  7.745   32.542 1.00 8.90  ? 103 GLN B CA  1 
ATOM   2323 C  C   . GLN B 1 111 ? 12.409  8.008   33.716 1.00 8.50  ? 103 GLN B C   1 
ATOM   2324 O  O   . GLN B 1 111 ? 13.136  8.995   33.716 1.00 8.13  ? 103 GLN B O   1 
ATOM   2325 C  CB  . GLN B 1 111 ? 10.057  8.252   32.903 1.00 9.14  ? 103 GLN B CB  1 
ATOM   2326 C  CG  . GLN B 1 111 ? 8.956   7.844   31.935 1.00 9.42  ? 103 GLN B CG  1 
ATOM   2327 C  CD  . GLN B 1 111 ? 9.235   8.284   30.533 1.00 9.54  ? 103 GLN B CD  1 
ATOM   2328 O  OE1 . GLN B 1 111 ? 9.503   9.466   30.284 1.00 9.77  ? 103 GLN B OE1 1 
ATOM   2329 N  NE2 . GLN B 1 111 ? 9.236   7.344   29.616 1.00 9.56  ? 103 GLN B NE2 1 
ATOM   2330 N  N   . ALA B 1 112 ? 12.396  7.115   34.708 1.00 8.48  ? 104 ALA B N   1 
ATOM   2331 C  CA  . ALA B 1 112 ? 13.177  7.312   35.924 1.00 8.39  ? 104 ALA B CA  1 
ATOM   2332 C  C   . ALA B 1 112 ? 14.640  7.212   35.580 1.00 8.11  ? 104 ALA B C   1 
ATOM   2333 O  O   . ALA B 1 112 ? 15.443  8.073   35.985 1.00 8.42  ? 104 ALA B O   1 
ATOM   2334 C  CB  . ALA B 1 112 ? 12.790  6.307   36.999 1.00 8.56  ? 104 ALA B CB  1 
ATOM   2335 N  N   . ALA B 1 113 ? 14.991  6.195   34.815 1.00 7.81  ? 105 ALA B N   1 
ATOM   2336 C  CA  . ALA B 1 113 ? 16.360  6.043   34.403 1.00 7.64  ? 105 ALA B CA  1 
ATOM   2337 C  C   . ALA B 1 113 ? 16.797  7.218   33.491 1.00 7.43  ? 105 ALA B C   1 
ATOM   2338 O  O   . ALA B 1 113 ? 17.883  7.765   33.673 1.00 7.63  ? 105 ALA B O   1 
ATOM   2339 C  CB  . ALA B 1 113 ? 16.591  4.683   33.756 1.00 7.66  ? 105 ALA B CB  1 
ATOM   2340 N  N   . GLN B 1 114 ? 15.959  7.637   32.552 1.00 7.28  ? 106 GLN B N   1 
ATOM   2341 C  CA  . GLN B 1 114 ? 16.303  8.785   31.698 1.00 7.14  ? 106 GLN B CA  1 
ATOM   2342 C  C   . GLN B 1 114 ? 16.462  10.130  32.439 1.00 7.06  ? 106 GLN B C   1 
ATOM   2343 O  O   . GLN B 1 114 ? 17.319  10.929  32.123 1.00 6.99  ? 106 GLN B O   1 
ATOM   2344 C  CB  . GLN B 1 114 ? 15.323  8.878   30.533 1.00 7.14  ? 106 GLN B CB  1 
ATOM   2345 C  CG  . GLN B 1 114 ? 15.567  7.812   29.439 1.00 7.22  ? 106 GLN B CG  1 
ATOM   2346 C  CD  . GLN B 1 114 ? 16.879  7.994   28.682 1.00 7.12  ? 106 GLN B CD  1 
ATOM   2347 O  OE1 . GLN B 1 114 ? 17.921  7.595   29.161 1.00 7.04  ? 106 GLN B OE1 1 
ATOM   2348 N  NE2 . GLN B 1 114 ? 16.810  8.553   27.456 1.00 7.12  ? 106 GLN B NE2 1 
ATOM   2349 N  N   . HIS B 1 115 ? 15.668  10.322  33.481 1.00 7.12  ? 107 HIS B N   1 
ATOM   2350 C  CA  . HIS B 1 115 ? 15.770  11.472  34.367 1.00 7.03  ? 107 HIS B CA  1 
ATOM   2351 C  C   . HIS B 1 115 ? 17.147  11.495  35.040 1.00 7.01  ? 107 HIS B C   1 
ATOM   2352 O  O   . HIS B 1 115 ? 17.872  12.495  34.961 1.00 6.85  ? 107 HIS B O   1 
ATOM   2353 C  CB  . HIS B 1 115 ? 14.646  11.417  35.405 1.00 7.15  ? 107 HIS B CB  1 
ATOM   2354 C  CG  . HIS B 1 115 ? 14.736  12.456  36.473 1.00 7.23  ? 107 HIS B CG  1 
ATOM   2355 N  ND1 . HIS B 1 115 ? 15.215  13.726  36.241 1.00 7.15  ? 107 HIS B ND1 1 
ATOM   2356 C  CD2 . HIS B 1 115 ? 14.416  12.410  37.792 1.00 7.36  ? 107 HIS B CD2 1 
ATOM   2357 C  CE1 . HIS B 1 115 ? 15.188  14.415  37.365 1.00 7.36  ? 107 HIS B CE1 1 
ATOM   2358 N  NE2 . HIS B 1 115 ? 14.686  13.650  38.318 1.00 7.39  ? 107 HIS B NE2 1 
ATOM   2359 N  N   . PHE B 1 116 ? 17.516  10.374  35.645 1.00 7.20  ? 108 PHE B N   1 
ATOM   2360 C  CA  . PHE B 1 116 ? 18.842  10.231  36.207 1.00 7.26  ? 108 PHE B CA  1 
ATOM   2361 C  C   . PHE B 1 116 ? 19.910  10.436  35.149 1.00 7.33  ? 108 PHE B C   1 
ATOM   2362 O  O   . PHE B 1 116 ? 20.837  11.240  35.347 1.00 7.41  ? 108 PHE B O   1 
ATOM   2363 C  CB  . PHE B 1 116 ? 19.051  8.875   36.862 1.00 7.33  ? 108 PHE B CB  1 
ATOM   2364 C  CG  . PHE B 1 116 ? 20.455  8.657   37.321 1.00 7.25  ? 108 PHE B CG  1 
ATOM   2365 C  CD1 . PHE B 1 116 ? 20.844  9.030   38.596 1.00 7.32  ? 108 PHE B CD1 1 
ATOM   2366 C  CD2 . PHE B 1 116 ? 21.410  8.105   36.451 1.00 7.19  ? 108 PHE B CD2 1 
ATOM   2367 C  CE1 . PHE B 1 116 ? 22.155  8.838   39.002 1.00 7.45  ? 108 PHE B CE1 1 
ATOM   2368 C  CE2 . PHE B 1 116 ? 22.729  7.928   36.842 1.00 7.18  ? 108 PHE B CE2 1 
ATOM   2369 C  CZ  . PHE B 1 116 ? 23.105  8.274   38.125 1.00 7.37  ? 108 PHE B CZ  1 
ATOM   2370 N  N   . ASN B 1 117 ? 19.808  9.707   34.042 1.00 7.38  ? 109 ASN B N   1 
ATOM   2371 C  CA  . ASN B 1 117 ? 20.836  9.789   33.001 1.00 7.42  ? 109 ASN B CA  1 
ATOM   2372 C  C   . ASN B 1 117 ? 21.068  11.230  32.511 1.00 7.45  ? 109 ASN B C   1 
ATOM   2373 O  O   . ASN B 1 117 ? 22.230  11.657  32.361 1.00 7.55  ? 109 ASN B O   1 
ATOM   2374 C  CB  . ASN B 1 117 ? 20.504  8.899   31.819 1.00 7.33  ? 109 ASN B CB  1 
ATOM   2375 C  CG  . ASN B 1 117 ? 20.525  7.425   32.166 1.00 7.43  ? 109 ASN B CG  1 
ATOM   2376 O  OD1 . ASN B 1 117 ? 21.070  7.013   33.187 1.00 7.40  ? 109 ASN B OD1 1 
ATOM   2377 N  ND2 . ASN B 1 117 ? 19.915  6.614   31.303 1.00 7.48  ? 109 ASN B ND2 1 
ATOM   2378 N  N   . HIS B 1 118 ? 19.973  11.970  32.282 1.00 7.32  ? 110 HIS B N   1 
ATOM   2379 C  CA  . HIS B 1 118 ? 20.065  13.338  31.788 1.00 7.36  ? 110 HIS B CA  1 
ATOM   2380 C  C   . HIS B 1 118 ? 20.589  14.331  32.823 1.00 7.52  ? 110 HIS B C   1 
ATOM   2381 O  O   . HIS B 1 118 ? 21.427  15.186  32.506 1.00 7.42  ? 110 HIS B O   1 
ATOM   2382 C  CB  . HIS B 1 118 ? 18.729  13.796  31.231 1.00 7.45  ? 110 HIS B CB  1 
ATOM   2383 C  CG  . HIS B 1 118 ? 18.438  13.254  29.872 1.00 7.37  ? 110 HIS B CG  1 
ATOM   2384 N  ND1 . HIS B 1 118 ? 17.806  12.048  29.679 1.00 7.54  ? 110 HIS B ND1 1 
ATOM   2385 C  CD2 . HIS B 1 118 ? 18.699  13.742  28.641 1.00 7.31  ? 110 HIS B CD2 1 
ATOM   2386 C  CE1 . HIS B 1 118 ? 17.684  11.823  28.384 1.00 7.41  ? 110 HIS B CE1 1 
ATOM   2387 N  NE2 . HIS B 1 118 ? 18.232  12.832  27.736 1.00 7.29  ? 110 HIS B NE2 1 
ATOM   2388 N  N   . THR B 1 119 ? 20.166  14.152  34.073 1.00 7.79  ? 111 THR B N   1 
ATOM   2389 C  CA  . THR B 1 119 ? 20.625  14.973  35.183 1.00 7.99  ? 111 THR B CA  1 
ATOM   2390 C  C   . THR B 1 119 ? 22.110  14.812  35.279 1.00 8.11  ? 111 THR B C   1 
ATOM   2391 O  O   . THR B 1 119 ? 22.835  15.791  35.357 1.00 8.21  ? 111 THR B O   1 
ATOM   2392 C  CB  . THR B 1 119 ? 19.964  14.549  36.531 1.00 8.19  ? 111 THR B CB  1 
ATOM   2393 O  OG1 . THR B 1 119 ? 18.547  14.719  36.448 1.00 8.08  ? 111 THR B OG1 1 
ATOM   2394 C  CG2 . THR B 1 119 ? 20.499  15.391  37.711 1.00 8.25  ? 111 THR B CG2 1 
ATOM   2395 N  N   . PHE B 1 120 ? 22.575  13.559  35.203 1.00 8.32  ? 112 PHE B N   1 
ATOM   2396 C  CA  . PHE B 1 120 ? 24.010  13.257  35.274 1.00 8.47  ? 112 PHE B CA  1 
ATOM   2397 C  C   . PHE B 1 120 ? 24.786  13.858  34.089 1.00 8.31  ? 112 PHE B C   1 
ATOM   2398 O  O   . PHE B 1 120 ? 25.780  14.535  34.262 1.00 8.07  ? 112 PHE B O   1 
ATOM   2399 C  CB  . PHE B 1 120 ? 24.236  11.733  35.373 1.00 8.81  ? 112 PHE B CB  1 
ATOM   2400 C  CG  . PHE B 1 120 ? 25.610  11.364  35.846 1.00 9.13  ? 112 PHE B CG  1 
ATOM   2401 C  CD1 . PHE B 1 120 ? 25.893  11.306  37.194 1.00 9.53  ? 112 PHE B CD1 1 
ATOM   2402 C  CD2 . PHE B 1 120 ? 26.619  11.123  34.936 1.00 9.37  ? 112 PHE B CD2 1 
ATOM   2403 C  CE1 . PHE B 1 120 ? 27.167  10.993  37.628 1.00 9.88  ? 112 PHE B CE1 1 
ATOM   2404 C  CE2 . PHE B 1 120 ? 27.890  10.797  35.349 1.00 9.44  ? 112 PHE B CE2 1 
ATOM   2405 C  CZ  . PHE B 1 120 ? 28.167  10.746  36.696 1.00 9.74  ? 112 PHE B CZ  1 
ATOM   2406 N  N   . TYR B 1 121 ? 24.298  13.582  32.881 1.00 8.40  ? 113 TYR B N   1 
ATOM   2407 C  CA  . TYR B 1 121 ? 24.909  14.056  31.632 1.00 8.39  ? 113 TYR B CA  1 
ATOM   2408 C  C   . TYR B 1 121 ? 25.084  15.549  31.604 1.00 8.43  ? 113 TYR B C   1 
ATOM   2409 O  O   . TYR B 1 121 ? 26.147  16.039  31.296 1.00 8.55  ? 113 TYR B O   1 
ATOM   2410 C  CB  . TYR B 1 121 ? 24.057  13.571  30.438 1.00 8.41  ? 113 TYR B CB  1 
ATOM   2411 C  CG  . TYR B 1 121 ? 24.402  14.197  29.094 1.00 8.51  ? 113 TYR B CG  1 
ATOM   2412 C  CD1 . TYR B 1 121 ? 25.569  13.852  28.410 1.00 8.59  ? 113 TYR B CD1 1 
ATOM   2413 C  CD2 . TYR B 1 121 ? 23.579  15.151  28.512 1.00 8.59  ? 113 TYR B CD2 1 
ATOM   2414 C  CE1 . TYR B 1 121 ? 25.886  14.416  27.155 1.00 8.58  ? 113 TYR B CE1 1 
ATOM   2415 C  CE2 . TYR B 1 121 ? 23.902  15.726  27.272 1.00 8.69  ? 113 TYR B CE2 1 
ATOM   2416 C  CZ  . TYR B 1 121 ? 25.066  15.354  26.603 1.00 8.61  ? 113 TYR B CZ  1 
ATOM   2417 O  OH  . TYR B 1 121 ? 25.402  15.891  25.367 1.00 8.54  ? 113 TYR B OH  1 
ATOM   2418 N  N   . PHE B 1 122 ? 24.044  16.299  31.911 1.00 8.79  ? 114 PHE B N   1 
ATOM   2419 C  CA  . PHE B 1 122 ? 24.151  17.783  31.867 1.00 9.06  ? 114 PHE B CA  1 
ATOM   2420 C  C   . PHE B 1 122 ? 25.176  18.297  32.878 1.00 9.24  ? 114 PHE B C   1 
ATOM   2421 O  O   . PHE B 1 122 ? 25.736  19.383  32.682 1.00 9.72  ? 114 PHE B O   1 
ATOM   2422 C  CB  . PHE B 1 122 ? 22.788  18.462  32.105 1.00 9.05  ? 114 PHE B CB  1 
ATOM   2423 C  CG  . PHE B 1 122 ? 21.845  18.323  30.945 1.00 9.05  ? 114 PHE B CG  1 
ATOM   2424 C  CD1 . PHE B 1 122 ? 22.253  18.668  29.663 1.00 9.08  ? 114 PHE B CD1 1 
ATOM   2425 C  CD2 . PHE B 1 122 ? 20.571  17.802  31.121 1.00 8.89  ? 114 PHE B CD2 1 
ATOM   2426 C  CE1 . PHE B 1 122 ? 21.407  18.501  28.583 1.00 9.03  ? 114 PHE B CE1 1 
ATOM   2427 C  CE2 . PHE B 1 122 ? 19.732  17.617  30.034 1.00 8.86  ? 114 PHE B CE2 1 
ATOM   2428 C  CZ  . PHE B 1 122 ? 20.146  17.963  28.762 1.00 8.85  ? 114 PHE B CZ  1 
ATOM   2429 N  N   . ARG B 1 123 ? 25.398  17.536  33.948 1.00 9.02  ? 115 ARG B N   1 
ATOM   2430 C  CA  . ARG B 1 123 ? 26.406  17.893  34.937 1.00 9.30  ? 115 ARG B CA  1 
ATOM   2431 C  C   . ARG B 1 123 ? 27.822  17.536  34.471 1.00 9.28  ? 115 ARG B C   1 
ATOM   2432 O  O   . ARG B 1 123 ? 28.798  18.037  35.024 1.00 9.39  ? 115 ARG B O   1 
ATOM   2433 C  CB  . ARG B 1 123 ? 26.089  17.285  36.304 1.00 9.35  ? 115 ARG B CB  1 
ATOM   2434 C  CG  . ARG B 1 123 ? 24.995  18.046  37.062 1.00 9.51  ? 115 ARG B CG  1 
ATOM   2435 C  CD  . ARG B 1 123 ? 24.537  17.378  38.380 1.00 9.65  ? 115 ARG B CD  1 
ATOM   2436 N  NE  . ARG B 1 123 ? 23.191  17.836  38.790 1.00 9.66  ? 115 ARG B NE  1 
ATOM   2437 C  CZ  . ARG B 1 123 ? 22.512  17.409  39.853 1.00 9.87  ? 115 ARG B CZ  1 
ATOM   2438 N  NH1 . ARG B 1 123 ? 22.991  16.443  40.628 1.00 9.99  ? 115 ARG B NH1 1 
ATOM   2439 N  NH2 . ARG B 1 123 ? 21.298  17.916  40.123 1.00 10.05 ? 115 ARG B NH2 1 
ATOM   2440 N  N   . CYS B 1 124 ? 27.912  16.687  33.450 1.00 8.87  ? 116 CYS B N   1 
ATOM   2441 C  CA  . CYS B 1 124 ? 29.181  16.343  32.840 1.00 8.80  ? 116 CYS B CA  1 
ATOM   2442 C  C   . CYS B 1 124 ? 29.636  17.370  31.820 1.00 8.96  ? 116 CYS B C   1 
ATOM   2443 O  O   . CYS B 1 124 ? 30.745  17.264  31.318 1.00 8.81  ? 116 CYS B O   1 
ATOM   2444 C  CB  . CYS B 1 124 ? 29.117  14.956  32.181 1.00 8.57  ? 116 CYS B CB  1 
ATOM   2445 S  SG  . CYS B 1 124 ? 28.976  13.619  33.384 1.00 8.36  ? 116 CYS B SG  1 
ATOM   2446 N  N   . ILE B 1 125 ? 28.810  18.379  31.520 1.00 9.11  ? 117 ILE B N   1 
ATOM   2447 C  CA  . ILE B 1 125 ? 29.260  19.425  30.613 1.00 9.33  ? 117 ILE B CA  1 
ATOM   2448 C  C   . ILE B 1 125 ? 29.114  20.831  31.206 1.00 9.84  ? 117 ILE B C   1 
ATOM   2449 O  O   . ILE B 1 125 ? 28.247  21.071  32.058 1.00 10.21 ? 117 ILE B O   1 
ATOM   2450 C  CB  . ILE B 1 125 ? 28.521  19.334  29.261 1.00 9.38  ? 117 ILE B CB  1 
ATOM   2451 C  CG1 . ILE B 1 125 ? 27.004  19.612  29.416 1.00 9.47  ? 117 ILE B CG1 1 
ATOM   2452 C  CG2 . ILE B 1 125 ? 28.749  17.971  28.618 1.00 9.17  ? 117 ILE B CG2 1 
ATOM   2453 C  CD1 . ILE B 1 125 ? 26.247  19.709  28.100 1.00 9.36  ? 117 ILE B CD1 1 
ATOM   2454 N  N   . THR B 1 126 ? 29.938  21.761  30.723 1.00 10.21 ? 118 THR B N   1 
ATOM   2455 C  CA  . THR B 1 126 ? 29.973  23.130  31.203 1.00 10.65 ? 118 THR B CA  1 
ATOM   2456 C  C   . THR B 1 126 ? 30.705  24.002  30.152 1.00 10.90 ? 118 THR B C   1 
ATOM   2457 O  O   . THR B 1 126 ? 31.620  23.517  29.486 1.00 10.93 ? 118 THR B O   1 
ATOM   2458 C  CB  . THR B 1 126 ? 30.699  23.180  32.558 1.00 10.90 ? 118 THR B CB  1 
ATOM   2459 O  OG1 . THR B 1 126 ? 30.394  24.398  33.246 1.00 11.65 ? 118 THR B OG1 1 
ATOM   2460 C  CG2 . THR B 1 126 ? 32.171  23.076  32.365 1.00 11.14 ? 118 THR B CG2 1 
ATOM   2461 N  N   . PRO B 1 127 ? 30.304  25.281  29.978 1.00 11.25 ? 119 PRO B N   1 
ATOM   2462 C  CA  . PRO B 1 127 ? 30.936  26.105  28.928 1.00 11.42 ? 119 PRO B CA  1 
ATOM   2463 C  C   . PRO B 1 127 ? 32.453  26.093  29.042 1.00 11.66 ? 119 PRO B C   1 
ATOM   2464 O  O   . PRO B 1 127 ? 32.988  26.307  30.123 1.00 11.36 ? 119 PRO B O   1 
ATOM   2465 C  CB  . PRO B 1 127 ? 30.413  27.516  29.217 1.00 11.65 ? 119 PRO B CB  1 
ATOM   2466 C  CG  . PRO B 1 127 ? 29.153  27.301  29.914 1.00 11.48 ? 119 PRO B CG  1 
ATOM   2467 C  CD  . PRO B 1 127 ? 29.294  26.050  30.721 1.00 11.36 ? 119 PRO B CD  1 
ATOM   2468 N  N   . ASN B 1 128 ? 33.120  25.777  27.944 1.00 12.11 ? 120 ASN B N   1 
ATOM   2469 C  CA  . ASN B 1 128 ? 34.592  25.741  27.869 1.00 12.69 ? 120 ASN B CA  1 
ATOM   2470 C  C   . ASN B 1 128 ? 35.252  24.620  28.684 1.00 12.30 ? 120 ASN B C   1 
ATOM   2471 O  O   . ASN B 1 128 ? 36.468  24.541  28.765 1.00 12.01 ? 120 ASN B O   1 
ATOM   2472 C  CB  . ASN B 1 128 ? 35.210  27.146  28.202 1.00 13.38 ? 120 ASN B CB  1 
ATOM   2473 C  CG  . ASN B 1 128 ? 34.684  28.265  27.280 1.00 14.02 ? 120 ASN B CG  1 
ATOM   2474 O  OD1 . ASN B 1 128 ? 34.093  29.228  27.755 1.00 14.64 ? 120 ASN B OD1 1 
ATOM   2475 N  ND2 . ASN B 1 128 ? 34.869  28.129  25.971 1.00 13.90 ? 120 ASN B ND2 1 
ATOM   2476 N  N   . GLY B 1 129 ? 34.456  23.742  29.261 1.00 12.58 ? 121 GLY B N   1 
ATOM   2477 C  CA  . GLY B 1 129 ? 34.996  22.654  30.100 1.00 12.96 ? 121 GLY B CA  1 
ATOM   2478 C  C   . GLY B 1 129 ? 35.730  23.055  31.354 1.00 13.24 ? 121 GLY B C   1 
ATOM   2479 O  O   . GLY B 1 129 ? 35.894  24.204  31.649 1.00 13.58 ? 121 GLY B O   1 
ATOM   2480 N  N   . LYS B 1 130 ? 36.150  22.073  32.115 1.00 13.94 ? 122 LYS B N   1 
ATOM   2481 C  CA  . LYS B 1 130 ? 37.069  22.266  33.210 1.00 14.83 ? 122 LYS B CA  1 
ATOM   2482 C  C   . LYS B 1 130 ? 38.119  21.180  33.207 1.00 14.49 ? 122 LYS B C   1 
ATOM   2483 O  O   . LYS B 1 130 ? 37.793  20.025  33.006 1.00 13.42 ? 122 LYS B O   1 
ATOM   2484 C  CB  . LYS B 1 130 ? 36.320  22.215  34.526 1.00 16.70 ? 122 LYS B CB  1 
ATOM   2485 C  CG  . LYS B 1 130 ? 35.431  23.429  34.741 1.00 18.71 ? 122 LYS B CG  1 
ATOM   2486 C  CD  . LYS B 1 130 ? 34.798  23.360  36.101 1.00 21.13 ? 122 LYS B CD  1 
ATOM   2487 C  CE  . LYS B 1 130 ? 33.634  24.330  36.222 1.00 22.99 ? 122 LYS B CE  1 
ATOM   2488 N  NZ  . LYS B 1 130 ? 34.056  25.675  35.771 1.00 23.93 ? 122 LYS B NZ  1 
ATOM   2489 N  N   . ALA B 1 131 ? 39.374  21.570  33.439 1.00 14.98 ? 123 ALA B N   1 
ATOM   2490 C  CA  . ALA B 1 131 ? 40.508  20.656  33.412 1.00 15.52 ? 123 ALA B CA  1 
ATOM   2491 C  C   . ALA B 1 131 ? 40.370  19.477  34.367 1.00 15.36 ? 123 ALA B C   1 
ATOM   2492 O  O   . ALA B 1 131 ? 39.777  19.592  35.464 1.00 16.02 ? 123 ALA B O   1 
ATOM   2493 C  CB  . ALA B 1 131 ? 41.800  21.416  33.724 1.00 16.12 ? 123 ALA B CB  1 
ATOM   2494 N  N   . MET B 1 132 ? 40.907  18.337  33.948 1.00 14.98 ? 124 MET B N   1 
ATOM   2495 C  CA  . MET B 1 132 ? 41.018  17.196  34.837 1.00 14.80 ? 124 MET B CA  1 
ATOM   2496 C  C   . MET B 1 132 ? 41.839  17.538  36.061 1.00 14.86 ? 124 MET B C   1 
ATOM   2497 O  O   . MET B 1 132 ? 42.961  17.964  35.907 1.00 15.77 ? 124 MET B O   1 
ATOM   2498 C  CB  . MET B 1 132 ? 41.760  16.080  34.150 1.00 14.70 ? 124 MET B CB  1 
ATOM   2499 C  CG  . MET B 1 132 ? 40.914  15.221  33.262 1.00 14.44 ? 124 MET B CG  1 
ATOM   2500 S  SD  . MET B 1 132 ? 41.776  13.738  32.748 1.00 13.91 ? 124 MET B SD  1 
ATOM   2501 C  CE  . MET B 1 132 ? 40.713  13.339  31.369 1.00 13.55 ? 124 MET B CE  1 
ATOM   2502 N  N   . PRO B 1 133 ? 41.312  17.325  37.274 1.00 14.62 ? 125 PRO B N   1 
ATOM   2503 C  CA  . PRO B 1 133 ? 42.237  17.428  38.411 1.00 14.97 ? 125 PRO B CA  1 
ATOM   2504 C  C   . PRO B 1 133 ? 43.274  16.314  38.312 1.00 15.66 ? 125 PRO B C   1 
ATOM   2505 O  O   . PRO B 1 133 ? 43.016  15.277  37.665 1.00 15.44 ? 125 PRO B O   1 
ATOM   2506 C  CB  . PRO B 1 133 ? 41.343  17.217  39.639 1.00 15.05 ? 125 PRO B CB  1 
ATOM   2507 C  CG  . PRO B 1 133 ? 39.943  17.442  39.157 1.00 14.72 ? 125 PRO B CG  1 
ATOM   2508 C  CD  . PRO B 1 133 ? 39.932  17.063  37.700 1.00 14.36 ? 125 PRO B CD  1 
ATOM   2509 N  N   . LYS B 1 134 ? 44.429  16.531  38.924 1.00 16.04 ? 126 LYS B N   1 
ATOM   2510 C  CA  . LYS B 1 134 ? 45.567  15.625  38.805 1.00 16.61 ? 126 LYS B CA  1 
ATOM   2511 C  C   . LYS B 1 134 ? 45.202  14.222  39.267 1.00 16.46 ? 126 LYS B C   1 
ATOM   2512 O  O   . LYS B 1 134 ? 45.627  13.231  38.702 1.00 16.62 ? 126 LYS B O   1 
ATOM   2513 C  CB  . LYS B 1 134 ? 46.759  16.160  39.634 1.00 16.25 ? 126 LYS B CB  1 
ATOM   2514 N  N   . SER B 1 135 ? 44.433  14.144  40.318 1.00 16.76 ? 127 SER B N   1 
ATOM   2515 C  CA  . SER B 1 135 ? 44.168  12.868  40.915 1.00 16.95 ? 127 SER B CA  1 
ATOM   2516 C  C   . SER B 1 135 ? 43.334  11.992  39.996 1.00 16.33 ? 127 SER B C   1 
ATOM   2517 O  O   . SER B 1 135 ? 43.613  10.801  39.854 1.00 15.56 ? 127 SER B O   1 
ATOM   2518 C  CB  . SER B 1 135 ? 43.463  13.055  42.241 1.00 17.63 ? 127 SER B CB  1 
ATOM   2519 O  OG  . SER B 1 135 ? 43.272  11.781  42.814 1.00 17.70 ? 127 SER B OG  1 
ATOM   2520 N  N   . PHE B 1 136 ? 42.365  12.602  39.307 1.00 15.94 ? 128 PHE B N   1 
ATOM   2521 C  CA  . PHE B 1 136 ? 41.541  11.861  38.354 1.00 15.17 ? 128 PHE B CA  1 
ATOM   2522 C  C   . PHE B 1 136 ? 42.330  11.537  37.089 1.00 15.30 ? 128 PHE B C   1 
ATOM   2523 O  O   . PHE B 1 136 ? 42.219  10.423  36.570 1.00 14.69 ? 128 PHE B O   1 
ATOM   2524 C  CB  . PHE B 1 136 ? 40.236  12.605  37.998 1.00 14.78 ? 128 PHE B CB  1 
ATOM   2525 C  CG  . PHE B 1 136 ? 39.397  11.868  36.996 1.00 13.83 ? 128 PHE B CG  1 
ATOM   2526 C  CD1 . PHE B 1 136 ? 38.703  10.741  37.386 1.00 13.86 ? 128 PHE B CD1 1 
ATOM   2527 C  CD2 . PHE B 1 136 ? 39.359  12.257  35.665 1.00 13.40 ? 128 PHE B CD2 1 
ATOM   2528 C  CE1 . PHE B 1 136 ? 37.963  10.024  36.472 1.00 13.60 ? 128 PHE B CE1 1 
ATOM   2529 C  CE2 . PHE B 1 136 ? 38.630  11.547  34.721 1.00 13.52 ? 128 PHE B CE2 1 
ATOM   2530 C  CZ  . PHE B 1 136 ? 37.918  10.420  35.128 1.00 13.52 ? 128 PHE B CZ  1 
ATOM   2531 N  N   . GLU B 1 137 ? 43.112  12.500  36.591 1.00 15.72 ? 129 GLU B N   1 
ATOM   2532 C  CA  . GLU B 1 137 ? 43.954  12.286  35.431 1.00 16.61 ? 129 GLU B CA  1 
ATOM   2533 C  C   . GLU B 1 137 ? 44.869  11.073  35.629 1.00 16.85 ? 129 GLU B C   1 
ATOM   2534 O  O   . GLU B 1 137 ? 45.101  10.279  34.698 1.00 16.30 ? 129 GLU B O   1 
ATOM   2535 C  CB  . GLU B 1 137 ? 44.817  13.492  35.141 1.00 18.23 ? 129 GLU B CB  1 
ATOM   2536 C  CG  . GLU B 1 137 ? 45.611  13.362  33.872 1.00 20.14 ? 129 GLU B CG  1 
ATOM   2537 C  CD  . GLU B 1 137 ? 46.449  14.571  33.608 1.00 22.88 ? 129 GLU B CD  1 
ATOM   2538 O  OE1 . GLU B 1 137 ? 46.022  15.506  32.935 1.00 25.48 ? 129 GLU B OE1 1 
ATOM   2539 O  OE2 . GLU B 1 137 ? 47.566  14.609  34.103 1.00 28.82 ? 129 GLU B OE2 1 
ATOM   2540 N  N   . SER B 1 138 ? 45.396  10.950  36.832 1.00 16.62 ? 130 SER B N   1 
ATOM   2541 C  CA  . SER B 1 138 ? 46.297  9.857   37.145 1.00 16.98 ? 130 SER B CA  1 
ATOM   2542 C  C   . SER B 1 138 ? 45.587  8.503   37.120 1.00 16.86 ? 130 SER B C   1 
ATOM   2543 O  O   . SER B 1 138 ? 46.142  7.505   36.652 1.00 16.86 ? 130 SER B O   1 
ATOM   2544 C  CB  . SER B 1 138 ? 46.917  10.073  38.519 1.00 16.94 ? 130 SER B CB  1 
ATOM   2545 O  OG  . SER B 1 138 ? 47.650  8.944   38.868 1.00 17.60 ? 130 SER B OG  1 
ATOM   2546 N  N   . ALA B 1 139 ? 44.369  8.461   37.628 1.00 16.70 ? 131 ALA B N   1 
ATOM   2547 C  CA  . ALA B 1 139 ? 43.625  7.232   37.594 1.00 16.76 ? 131 ALA B CA  1 
ATOM   2548 C  C   . ALA B 1 139 ? 43.285  6.812   36.142 1.00 16.65 ? 131 ALA B C   1 
ATOM   2549 O  O   . ALA B 1 139 ? 43.316  5.614   35.827 1.00 17.07 ? 131 ALA B O   1 
ATOM   2550 C  CB  . ALA B 1 139 ? 42.371  7.370   38.416 1.00 16.98 ? 131 ALA B CB  1 
ATOM   2551 N  N   . VAL B 1 140 ? 42.976  7.770   35.261 1.00 16.42 ? 132 VAL B N   1 
ATOM   2552 C  CA  . VAL B 1 140 ? 42.810  7.470   33.812 1.00 16.23 ? 132 VAL B CA  1 
ATOM   2553 C  C   . VAL B 1 140 ? 44.115  6.976   33.185 1.00 16.22 ? 132 VAL B C   1 
ATOM   2554 O  O   . VAL B 1 140 ? 44.120  6.013   32.402 1.00 16.45 ? 132 VAL B O   1 
ATOM   2555 C  CB  . VAL B 1 140 ? 42.316  8.677   32.995 1.00 16.56 ? 132 VAL B CB  1 
ATOM   2556 C  CG1 . VAL B 1 140 ? 42.195  8.321   31.512 1.00 16.63 ? 132 VAL B CG1 1 
ATOM   2557 C  CG2 . VAL B 1 140 ? 40.956  9.158   33.496 1.00 16.62 ? 132 VAL B CG2 1 
ATOM   2558 N  N   . THR B 1 141 ? 45.212  7.636   33.522 1.00 16.10 ? 133 THR B N   1 
ATOM   2559 C  CA  . THR B 1 141 ? 46.482  7.361   32.880 1.00 16.68 ? 133 THR B CA  1 
ATOM   2560 C  C   . THR B 1 141 ? 46.976  6.012   33.273 1.00 16.60 ? 133 THR B C   1 
ATOM   2561 O  O   . THR B 1 141 ? 47.374  5.245   32.414 1.00 16.09 ? 133 THR B O   1 
ATOM   2562 C  CB  . THR B 1 141 ? 47.542  8.427   33.192 1.00 17.28 ? 133 THR B CB  1 
ATOM   2563 O  OG1 . THR B 1 141 ? 47.053  9.696   32.787 1.00 17.21 ? 133 THR B OG1 1 
ATOM   2564 C  CG2 . THR B 1 141 ? 48.805  8.171   32.408 1.00 17.70 ? 133 THR B CG2 1 
ATOM   2565 N  N   . ALA B 1 142 ? 46.878  5.702   34.564 1.00 17.18 ? 134 ALA B N   1 
ATOM   2566 C  CA  . ALA B 1 142 ? 47.210  4.367   35.090 1.00 17.30 ? 134 ALA B CA  1 
ATOM   2567 C  C   . ALA B 1 142 ? 46.385  3.251   34.443 1.00 17.52 ? 134 ALA B C   1 
ATOM   2568 O  O   . ALA B 1 142 ? 46.916  2.195   34.133 1.00 17.43 ? 134 ALA B O   1 
ATOM   2569 C  CB  . ALA B 1 142 ? 47.024  4.316   36.601 1.00 17.14 ? 134 ALA B CB  1 
ATOM   2570 N  N   . GLN B 1 143 ? 45.087  3.471   34.260 1.00 17.86 ? 135 GLN B N   1 
ATOM   2571 C  CA  . GLN B 1 143 ? 44.166  2.424   33.774 1.00 18.01 ? 135 GLN B CA  1 
ATOM   2572 C  C   . GLN B 1 143 ? 44.265  2.226   32.260 1.00 17.13 ? 135 GLN B C   1 
ATOM   2573 O  O   . GLN B 1 143 ? 44.192  1.106   31.788 1.00 17.25 ? 135 GLN B O   1 
ATOM   2574 C  CB  . GLN B 1 143 ? 42.732  2.812   34.114 1.00 19.54 ? 135 GLN B CB  1 
ATOM   2575 C  CG  . GLN B 1 143 ? 41.672  1.896   33.539 1.00 21.13 ? 135 GLN B CG  1 
ATOM   2576 C  CD  . GLN B 1 143 ? 41.545  0.654   34.339 1.00 23.61 ? 135 GLN B CD  1 
ATOM   2577 O  OE1 . GLN B 1 143 ? 41.334  0.729   35.561 1.00 27.77 ? 135 GLN B OE1 1 
ATOM   2578 N  NE2 . GLN B 1 143 ? 41.663  -0.501  33.688 1.00 24.00 ? 135 GLN B NE2 1 
ATOM   2579 N  N   . PHE B 1 144 ? 44.351  3.321   31.501 1.00 15.91 ? 136 PHE B N   1 
ATOM   2580 C  CA  . PHE B 1 144 ? 44.240  3.276   30.029 1.00 14.90 ? 136 PHE B CA  1 
ATOM   2581 C  C   . PHE B 1 144 ? 45.550  3.571   29.330 1.00 14.32 ? 136 PHE B C   1 
ATOM   2582 O  O   . PHE B 1 144 ? 45.621  3.497   28.104 1.00 14.14 ? 136 PHE B O   1 
ATOM   2583 C  CB  . PHE B 1 144 ? 43.158  4.276   29.536 1.00 14.46 ? 136 PHE B CB  1 
ATOM   2584 C  CG  . PHE B 1 144 ? 41.770  3.931   29.978 1.00 14.62 ? 136 PHE B CG  1 
ATOM   2585 C  CD1 . PHE B 1 144 ? 40.974  3.063   29.233 1.00 14.74 ? 136 PHE B CD1 1 
ATOM   2586 C  CD2 . PHE B 1 144 ? 41.253  4.452   31.162 1.00 14.53 ? 136 PHE B CD2 1 
ATOM   2587 C  CE1 . PHE B 1 144 ? 39.693  2.744   29.656 1.00 14.73 ? 136 PHE B CE1 1 
ATOM   2588 C  CE2 . PHE B 1 144 ? 39.973  4.139   31.580 1.00 14.34 ? 136 PHE B CE2 1 
ATOM   2589 C  CZ  . PHE B 1 144 ? 39.199  3.278   30.835 1.00 14.46 ? 136 PHE B CZ  1 
ATOM   2590 N  N   . GLY B 1 145 ? 46.575  3.957   30.079 1.00 14.01 ? 137 GLY B N   1 
ATOM   2591 C  CA  . GLY B 1 145 ? 47.918  4.198   29.480 1.00 13.79 ? 137 GLY B CA  1 
ATOM   2592 C  C   . GLY B 1 145 ? 48.161  5.672   29.220 1.00 13.69 ? 137 GLY B C   1 
ATOM   2593 O  O   . GLY B 1 145 ? 49.229  6.177   29.565 1.00 14.12 ? 137 GLY B O   1 
ATOM   2594 N  N   . SER B 1 146 ? 47.135  6.375   28.732 1.00 13.27 ? 138 SER B N   1 
ATOM   2595 C  CA  . SER B 1 146 ? 47.137  7.842   28.625 1.00 13.56 ? 138 SER B CA  1 
ATOM   2596 C  C   . SER B 1 146 ? 45.718  8.373   28.484 1.00 13.60 ? 138 SER B C   1 
ATOM   2597 O  O   . SER B 1 146 ? 44.792  7.607   28.159 1.00 13.20 ? 138 SER B O   1 
ATOM   2598 C  CB  . SER B 1 146 ? 47.944  8.290   27.395 1.00 13.82 ? 138 SER B CB  1 
ATOM   2599 O  OG  . SER B 1 146 ? 47.407  7.709   26.188 1.00 13.92 ? 138 SER B OG  1 
ATOM   2600 N  N   . VAL B 1 147 ? 45.547  9.674   28.719 1.00 13.45 ? 139 VAL B N   1 
ATOM   2601 C  CA  . VAL B 1 147 ? 44.250  10.309  28.533 1.00 13.70 ? 139 VAL B CA  1 
ATOM   2602 C  C   . VAL B 1 147 ? 43.790  10.129  27.061 1.00 13.51 ? 139 VAL B C   1 
ATOM   2603 O  O   . VAL B 1 147 ? 42.645  9.747   26.826 1.00 12.82 ? 139 VAL B O   1 
ATOM   2604 C  CB  . VAL B 1 147 ? 44.271  11.822  28.904 1.00 14.03 ? 139 VAL B CB  1 
ATOM   2605 C  CG1 . VAL B 1 147 ? 42.945  12.471  28.553 1.00 13.76 ? 139 VAL B CG1 1 
ATOM   2606 C  CG2 . VAL B 1 147 ? 44.567  12.000  30.393 1.00 14.44 ? 139 VAL B CG2 1 
ATOM   2607 N  N   . GLU B 1 148 ? 44.698  10.334  26.101 1.00 13.45 ? 140 GLU B N   1 
ATOM   2608 C  CA  . GLU B 1 148 ? 44.356  10.183  24.669 1.00 13.65 ? 140 GLU B CA  1 
ATOM   2609 C  C   . GLU B 1 148 ? 43.911  8.724   24.283 1.00 13.48 ? 140 GLU B C   1 
ATOM   2610 O  O   . GLU B 1 148 ? 42.976  8.571   23.490 1.00 12.99 ? 140 GLU B O   1 
ATOM   2611 C  CB  . GLU B 1 148 ? 45.441  10.778  23.750 1.00 13.94 ? 140 GLU B CB  1 
ATOM   2612 C  CG  . GLU B 1 148 ? 45.562  12.328  23.790 1.00 14.74 ? 140 GLU B CG  1 
ATOM   2613 C  CD  . GLU B 1 148 ? 44.267  13.126  23.448 1.00 15.66 ? 140 GLU B CD  1 
ATOM   2614 O  OE1 . GLU B 1 148 ? 43.521  12.766  22.515 1.00 16.46 ? 140 GLU B OE1 1 
ATOM   2615 O  OE2 . GLU B 1 148 ? 43.952  14.131  24.141 1.00 16.65 ? 140 GLU B OE2 1 
ATOM   2616 N  N   . GLN B 1 149 ? 44.520  7.692   24.887 1.00 13.18 ? 141 GLN B N   1 
ATOM   2617 C  CA  . GLN B 1 149 ? 44.082  6.294   24.700 1.00 13.19 ? 141 GLN B CA  1 
ATOM   2618 C  C   . GLN B 1 149 ? 42.713  6.047   25.305 1.00 12.60 ? 141 GLN B C   1 
ATOM   2619 O  O   . GLN B 1 149 ? 41.903  5.336   24.718 1.00 12.01 ? 141 GLN B O   1 
ATOM   2620 C  CB  . GLN B 1 149 ? 45.109  5.300   25.265 1.00 13.79 ? 141 GLN B CB  1 
ATOM   2621 C  CG  . GLN B 1 149 ? 46.372  5.242   24.398 1.00 14.94 ? 141 GLN B CG  1 
ATOM   2622 C  CD  . GLN B 1 149 ? 47.570  4.530   25.028 1.00 15.96 ? 141 GLN B CD  1 
ATOM   2623 O  OE1 . GLN B 1 149 ? 48.205  5.043   25.950 1.00 15.87 ? 141 GLN B OE1 1 
ATOM   2624 N  NE2 . GLN B 1 149 ? 47.896  3.352   24.504 1.00 16.69 ? 141 GLN B NE2 1 
ATOM   2625 N  N   . PHE B 1 150 ? 42.455  6.636   26.489 1.00 12.12 ? 142 PHE B N   1 
ATOM   2626 C  CA  . PHE B 1 150 ? 41.143  6.568   27.068 1.00 11.70 ? 142 PHE B CA  1 
ATOM   2627 C  C   . PHE B 1 150 ? 40.125  7.231   26.132 1.00 11.65 ? 142 PHE B C   1 
ATOM   2628 O  O   . PHE B 1 150 ? 39.081  6.670   25.869 1.00 11.22 ? 142 PHE B O   1 
ATOM   2629 C  CB  . PHE B 1 150 ? 41.052  7.206   28.454 1.00 11.61 ? 142 PHE B CB  1 
ATOM   2630 C  CG  . PHE B 1 150 ? 39.651  7.673   28.776 1.00 11.40 ? 142 PHE B CG  1 
ATOM   2631 C  CD1 . PHE B 1 150 ? 38.652  6.747   28.989 1.00 11.37 ? 142 PHE B CD1 1 
ATOM   2632 C  CD2 . PHE B 1 150 ? 39.329  9.009   28.761 1.00 11.34 ? 142 PHE B CD2 1 
ATOM   2633 C  CE1 . PHE B 1 150 ? 37.351  7.156   29.200 1.00 11.50 ? 142 PHE B CE1 1 
ATOM   2634 C  CE2 . PHE B 1 150 ? 38.040  9.431   28.988 1.00 11.44 ? 142 PHE B CE2 1 
ATOM   2635 C  CZ  . PHE B 1 150 ? 37.035  8.501   29.198 1.00 11.51 ? 142 PHE B CZ  1 
ATOM   2636 N  N   . LYS B 1 151 ? 40.413  8.437   25.653 1.00 12.33 ? 143 LYS B N   1 
ATOM   2637 C  CA  . LYS B 1 151 ? 39.446  9.157   24.812 1.00 12.56 ? 143 LYS B CA  1 
ATOM   2638 C  C   . LYS B 1 151 ? 39.137  8.378   23.556 1.00 11.97 ? 143 LYS B C   1 
ATOM   2639 O  O   . LYS B 1 151 ? 37.977  8.294   23.139 1.00 11.82 ? 143 LYS B O   1 
ATOM   2640 C  CB  . LYS B 1 151 ? 39.940  10.574  24.475 1.00 13.43 ? 143 LYS B CB  1 
ATOM   2641 C  CG  . LYS B 1 151 ? 39.866  11.528  25.675 1.00 14.27 ? 143 LYS B CG  1 
ATOM   2642 C  CD  . LYS B 1 151 ? 40.256  12.974  25.343 1.00 14.96 ? 143 LYS B CD  1 
ATOM   2643 C  CE  . LYS B 1 151 ? 40.007  13.841  26.560 1.00 15.81 ? 143 LYS B CE  1 
ATOM   2644 N  NZ  . LYS B 1 151 ? 40.560  15.227  26.469 1.00 17.15 ? 143 LYS B NZ  1 
ATOM   2645 N  N   . ASP B 1 152 ? 40.171  7.818   22.936 1.00 11.78 ? 144 ASP B N   1 
ATOM   2646 C  CA  . ASP B 1 152 ? 39.993  7.049   21.716 1.00 11.54 ? 144 ASP B CA  1 
ATOM   2647 C  C   . ASP B 1 152 ? 39.091  5.830   21.936 1.00 11.11 ? 144 ASP B C   1 
ATOM   2648 O  O   . ASP B 1 152 ? 38.200  5.570   21.162 1.00 10.46 ? 144 ASP B O   1 
ATOM   2649 C  CB  . ASP B 1 152 ? 41.351  6.598   21.212 1.00 12.28 ? 144 ASP B CB  1 
ATOM   2650 C  CG  . ASP B 1 152 ? 41.257  5.659   19.990 1.00 12.81 ? 144 ASP B CG  1 
ATOM   2651 O  OD1 . ASP B 1 152 ? 40.911  6.126   18.899 1.00 13.65 ? 144 ASP B OD1 1 
ATOM   2652 O  OD2 . ASP B 1 152 ? 41.569  4.479   20.094 1.00 13.25 ? 144 ASP B OD2 1 
ATOM   2653 N  N   . ALA B 1 153 ? 39.311  5.113   23.034 1.00 10.93 ? 145 ALA B N   1 
ATOM   2654 C  CA  . ALA B 1 153 ? 38.476  3.955   23.361 1.00 10.44 ? 145 ALA B CA  1 
ATOM   2655 C  C   . ALA B 1 153 ? 37.052  4.391   23.665 1.00 10.00 ? 145 ALA B C   1 
ATOM   2656 O  O   . ALA B 1 153 ? 36.119  3.710   23.285 1.00 10.03 ? 145 ALA B O   1 
ATOM   2657 C  CB  . ALA B 1 153 ? 39.067  3.166   24.509 1.00 10.34 ? 145 ALA B CB  1 
ATOM   2658 N  N   . PHE B 1 154 ? 36.877  5.562   24.273 1.00 9.73  ? 146 PHE B N   1 
ATOM   2659 C  CA  . PHE B 1 154 ? 35.528  6.036   24.642 1.00 9.51  ? 146 PHE B CA  1 
ATOM   2660 C  C   . PHE B 1 154 ? 34.751  6.459   23.372 1.00 9.52  ? 146 PHE B C   1 
ATOM   2661 O  O   . PHE B 1 154 ? 33.597  6.104   23.193 1.00 9.25  ? 146 PHE B O   1 
ATOM   2662 C  CB  . PHE B 1 154 ? 35.635  7.180   25.658 1.00 9.34  ? 146 PHE B CB  1 
ATOM   2663 C  CG  . PHE B 1 154 ? 34.315  7.659   26.222 1.00 9.04  ? 146 PHE B CG  1 
ATOM   2664 C  CD1 . PHE B 1 154 ? 33.917  7.294   27.499 1.00 8.87  ? 146 PHE B CD1 1 
ATOM   2665 C  CD2 . PHE B 1 154 ? 33.484  8.488   25.481 1.00 9.05  ? 146 PHE B CD2 1 
ATOM   2666 C  CE1 . PHE B 1 154 ? 32.731  7.725   28.017 1.00 8.71  ? 146 PHE B CE1 1 
ATOM   2667 C  CE2 . PHE B 1 154 ? 32.281  8.922   26.012 1.00 8.88  ? 146 PHE B CE2 1 
ATOM   2668 C  CZ  . PHE B 1 154 ? 31.916  8.543   27.284 1.00 8.67  ? 146 PHE B CZ  1 
ATOM   2669 N  N   . VAL B 1 155 ? 35.407  7.209   22.491 1.00 9.79  ? 147 VAL B N   1 
ATOM   2670 C  CA  . VAL B 1 155 ? 34.834  7.556   21.187 1.00 9.76  ? 147 VAL B CA  1 
ATOM   2671 C  C   . VAL B 1 155 ? 34.472  6.305   20.381 1.00 10.12 ? 147 VAL B C   1 
ATOM   2672 O  O   . VAL B 1 155 ? 33.374  6.246   19.801 1.00 10.36 ? 147 VAL B O   1 
ATOM   2673 C  CB  . VAL B 1 155 ? 35.798  8.401   20.378 1.00 9.93  ? 147 VAL B CB  1 
ATOM   2674 C  CG1 . VAL B 1 155 ? 35.310  8.598   18.942 1.00 10.03 ? 147 VAL B CG1 1 
ATOM   2675 C  CG2 . VAL B 1 155 ? 35.998  9.762   21.040 1.00 9.86  ? 147 VAL B CG2 1 
ATOM   2676 N  N   . GLN B 1 156 ? 35.344  5.292   20.356 1.00 10.08 ? 148 GLN B N   1 
ATOM   2677 C  CA  . GLN B 1 156 ? 35.018  4.018   19.672 1.00 10.17 ? 148 GLN B CA  1 
ATOM   2678 C  C   . GLN B 1 156 ? 33.710  3.394   20.188 1.00 10.09 ? 148 GLN B C   1 
ATOM   2679 O  O   . GLN B 1 156 ? 32.838  3.000   19.417 1.00 10.09 ? 148 GLN B O   1 
ATOM   2680 C  CB  . GLN B 1 156 ? 36.154  2.999   19.863 1.00 10.02 ? 148 GLN B CB  1 
ATOM   2681 N  N   . ALA B 1 157 ? 33.576  3.347   21.498 1.00 9.98  ? 149 ALA B N   1 
ATOM   2682 C  CA  . ALA B 1 157 ? 32.380  2.812   22.111 1.00 10.09 ? 149 ALA B CA  1 
ATOM   2683 C  C   . ALA B 1 157 ? 31.159  3.659   21.776 1.00 10.01 ? 149 ALA B C   1 
ATOM   2684 O  O   . ALA B 1 157 ? 30.081  3.125   21.482 1.00 9.95  ? 149 ALA B O   1 
ATOM   2685 C  CB  . ALA B 1 157 ? 32.574  2.733   23.629 1.00 10.18 ? 149 ALA B CB  1 
ATOM   2686 N  N   . GLY B 1 158 ? 31.312  4.982   21.814 1.00 9.91  ? 150 GLY B N   1 
ATOM   2687 C  CA  . GLY B 1 158 ? 30.175  5.871   21.495 1.00 9.79  ? 150 GLY B CA  1 
ATOM   2688 C  C   . GLY B 1 158 ? 29.711  5.729   20.047 1.00 9.94  ? 150 GLY B C   1 
ATOM   2689 O  O   . GLY B 1 158 ? 28.514  5.616   19.764 1.00 9.82  ? 150 GLY B O   1 
ATOM   2690 N  N   . VAL B 1 159 ? 30.669  5.677   19.125 1.00 10.18 ? 151 VAL B N   1 
ATOM   2691 C  CA  . VAL B 1 159 ? 30.369  5.505   17.698 1.00 10.25 ? 151 VAL B CA  1 
ATOM   2692 C  C   . VAL B 1 159 ? 29.691  4.159   17.417 1.00 10.51 ? 151 VAL B C   1 
ATOM   2693 O  O   . VAL B 1 159 ? 28.755  4.104   16.591 1.00 10.87 ? 151 VAL B O   1 
ATOM   2694 C  CB  . VAL B 1 159 ? 31.625  5.624   16.816 1.00 10.16 ? 151 VAL B CB  1 
ATOM   2695 C  CG1 . VAL B 1 159 ? 31.294  5.239   15.372 1.00 10.47 ? 151 VAL B CG1 1 
ATOM   2696 C  CG2 . VAL B 1 159 ? 32.169  7.053   16.858 1.00 9.93  ? 151 VAL B CG2 1 
ATOM   2697 N  N   . ASN B 1 160 ? 30.123  3.101   18.103 1.00 10.52 ? 152 ASN B N   1 
ATOM   2698 C  CA  . ASN B 1 160 ? 29.593  1.750   17.826 1.00 10.82 ? 152 ASN B CA  1 
ATOM   2699 C  C   . ASN B 1 160 ? 28.383  1.403   18.719 1.00 10.61 ? 152 ASN B C   1 
ATOM   2700 O  O   . ASN B 1 160 ? 27.901  0.266   18.695 1.00 10.29 ? 152 ASN B O   1 
ATOM   2701 C  CB  . ASN B 1 160 ? 30.672  0.684   18.031 1.00 11.34 ? 152 ASN B CB  1 
ATOM   2702 C  CG  . ASN B 1 160 ? 31.862  0.819   17.062 1.00 11.79 ? 152 ASN B CG  1 
ATOM   2703 O  OD1 . ASN B 1 160 ? 31.695  0.909   15.864 1.00 12.25 ? 152 ASN B OD1 1 
ATOM   2704 N  ND2 . ASN B 1 160 ? 33.054  0.797   17.600 1.00 11.99 ? 152 ASN B ND2 1 
ATOM   2705 N  N   . ASN B 1 161 ? 27.906  2.376   19.520 1.00 10.13 ? 153 ASN B N   1 
ATOM   2706 C  CA  . ASN B 1 161 ? 26.730  2.167   20.339 1.00 9.97  ? 153 ASN B CA  1 
ATOM   2707 C  C   . ASN B 1 161 ? 25.490  2.227   19.452 1.00 9.80  ? 153 ASN B C   1 
ATOM   2708 O  O   . ASN B 1 161 ? 24.992  3.320   19.136 1.00 9.70  ? 153 ASN B O   1 
ATOM   2709 C  CB  . ASN B 1 161 ? 26.652  3.194   21.481 1.00 10.13 ? 153 ASN B CB  1 
ATOM   2710 C  CG  . ASN B 1 161 ? 25.782  2.723   22.618 1.00 10.31 ? 153 ASN B CG  1 
ATOM   2711 O  OD1 . ASN B 1 161 ? 25.150  1.712   22.515 1.00 10.63 ? 153 ASN B OD1 1 
ATOM   2712 N  ND2 . ASN B 1 161 ? 25.787  3.447   23.729 1.00 10.75 ? 153 ASN B ND2 1 
ATOM   2713 N  N   . PHE B 1 162 ? 24.976  1.057   19.068 1.00 9.61  ? 154 PHE B N   1 
ATOM   2714 C  CA  . PHE B 1 162 ? 23.933  0.985   18.054 1.00 9.43  ? 154 PHE B CA  1 
ATOM   2715 C  C   . PHE B 1 162 ? 22.579  1.479   18.578 1.00 9.24  ? 154 PHE B C   1 
ATOM   2716 O  O   . PHE B 1 162 ? 22.115  1.062   19.631 1.00 8.99  ? 154 PHE B O   1 
ATOM   2717 C  CB  . PHE B 1 162 ? 23.781  -0.425  17.480 1.00 9.54  ? 154 PHE B CB  1 
ATOM   2718 C  CG  . PHE B 1 162 ? 22.882  -0.478  16.272 1.00 9.69  ? 154 PHE B CG  1 
ATOM   2719 C  CD1 . PHE B 1 162 ? 23.269  0.122   15.082 1.00 9.67  ? 154 PHE B CD1 1 
ATOM   2720 C  CD2 . PHE B 1 162 ? 21.667  -1.110  16.326 1.00 9.79  ? 154 PHE B CD2 1 
ATOM   2721 C  CE1 . PHE B 1 162 ? 22.444  0.075   13.965 1.00 10.04 ? 154 PHE B CE1 1 
ATOM   2722 C  CE2 . PHE B 1 162 ? 20.837  -1.144  15.229 1.00 10.13 ? 154 PHE B CE2 1 
ATOM   2723 C  CZ  . PHE B 1 162 ? 21.224  -0.560  14.036 1.00 10.20 ? 154 PHE B CZ  1 
ATOM   2724 N  N   . GLY B 1 163 ? 21.952  2.354   17.793 1.00 9.15  ? 155 GLY B N   1 
ATOM   2725 C  CA  . GLY B 1 163 ? 20.649  2.913   18.113 1.00 9.11  ? 155 GLY B CA  1 
ATOM   2726 C  C   . GLY B 1 163 ? 20.765  4.026   19.149 1.00 8.87  ? 155 GLY B C   1 
ATOM   2727 O  O   . GLY B 1 163 ? 21.788  4.721   19.205 1.00 8.81  ? 155 GLY B O   1 
ATOM   2728 N  N   . SER B 1 164 ? 19.725  4.183   19.970 1.00 8.63  ? 156 SER B N   1 
ATOM   2729 C  CA  . SER B 1 164 ? 19.736  5.175   21.050 1.00 8.38  ? 156 SER B CA  1 
ATOM   2730 C  C   . SER B 1 164 ? 20.456  4.574   22.284 1.00 8.31  ? 156 SER B C   1 
ATOM   2731 O  O   . SER B 1 164 ? 20.411  3.372   22.547 1.00 8.11  ? 156 SER B O   1 
ATOM   2732 C  CB  . SER B 1 164 ? 18.329  5.584   21.434 1.00 8.40  ? 156 SER B CB  1 
ATOM   2733 O  OG  . SER B 1 164 ? 17.562  6.049   20.331 1.00 8.51  ? 156 SER B OG  1 
ATOM   2734 N  N   . GLY B 1 165 ? 21.156  5.422   23.010 1.00 8.25  ? 157 GLY B N   1 
ATOM   2735 C  CA  . GLY B 1 165 ? 21.805  4.976   24.217 1.00 8.16  ? 157 GLY B CA  1 
ATOM   2736 C  C   . GLY B 1 165 ? 22.755  5.963   24.846 1.00 8.02  ? 157 GLY B C   1 
ATOM   2737 O  O   . GLY B 1 165 ? 22.713  7.195   24.588 1.00 7.95  ? 157 GLY B O   1 
ATOM   2738 N  N   . TRP B 1 166 ? 23.636  5.407   25.676 1.00 7.83  ? 158 TRP B N   1 
ATOM   2739 C  CA  . TRP B 1 166 ? 24.532  6.212   26.479 1.00 7.39  ? 158 TRP B CA  1 
ATOM   2740 C  C   . TRP B 1 166 ? 25.863  5.508   26.507 1.00 7.51  ? 158 TRP B C   1 
ATOM   2741 O  O   . TRP B 1 166 ? 25.883  4.275   26.517 1.00 7.53  ? 158 TRP B O   1 
ATOM   2742 C  CB  . TRP B 1 166 ? 24.012  6.302   27.904 1.00 7.18  ? 158 TRP B CB  1 
ATOM   2743 C  CG  . TRP B 1 166 ? 22.700  6.896   27.996 1.00 7.00  ? 158 TRP B CG  1 
ATOM   2744 C  CD1 . TRP B 1 166 ? 21.505  6.254   27.874 1.00 6.98  ? 158 TRP B CD1 1 
ATOM   2745 C  CD2 . TRP B 1 166 ? 22.399  8.272   28.264 1.00 6.82  ? 158 TRP B CD2 1 
ATOM   2746 N  NE1 . TRP B 1 166 ? 20.475  7.144   28.038 1.00 6.84  ? 158 TRP B NE1 1 
ATOM   2747 C  CE2 . TRP B 1 166 ? 21.000  8.388   28.288 1.00 6.82  ? 158 TRP B CE2 1 
ATOM   2748 C  CE3 . TRP B 1 166 ? 23.182  9.404   28.544 1.00 6.77  ? 158 TRP B CE3 1 
ATOM   2749 C  CZ2 . TRP B 1 166 ? 20.367  9.593   28.526 1.00 6.77  ? 158 TRP B CZ2 1 
ATOM   2750 C  CZ3 . TRP B 1 166 ? 22.566  10.585  28.780 1.00 6.80  ? 158 TRP B CZ3 1 
ATOM   2751 C  CH2 . TRP B 1 166 ? 21.168  10.684  28.768 1.00 6.89  ? 158 TRP B CH2 1 
ATOM   2752 N  N   . THR B 1 167 ? 26.969  6.278   26.468 1.00 7.43  ? 159 THR B N   1 
ATOM   2753 C  CA  . THR B 1 167 ? 28.301  5.708   26.673 1.00 7.57  ? 159 THR B CA  1 
ATOM   2754 C  C   . THR B 1 167 ? 28.864  6.284   27.984 1.00 7.52  ? 159 THR B C   1 
ATOM   2755 O  O   . THR B 1 167 ? 28.816  7.503   28.212 1.00 7.46  ? 159 THR B O   1 
ATOM   2756 C  CB  . THR B 1 167 ? 29.223  5.981   25.454 1.00 7.63  ? 159 THR B CB  1 
ATOM   2757 O  OG1 . THR B 1 167 ? 28.719  5.278   24.312 1.00 7.78  ? 159 THR B OG1 1 
ATOM   2758 C  CG2 . THR B 1 167 ? 30.668  5.517   25.704 1.00 7.60  ? 159 THR B CG2 1 
ATOM   2759 N  N   . TRP B 1 168 ? 29.395  5.409   28.822 1.00 7.51  ? 160 TRP B N   1 
ATOM   2760 C  CA  . TRP B 1 168 ? 29.779  5.772   30.188 1.00 7.61  ? 160 TRP B CA  1 
ATOM   2761 C  C   . TRP B 1 168 ? 31.215  5.413   30.529 1.00 7.72  ? 160 TRP B C   1 
ATOM   2762 O  O   . TRP B 1 168 ? 31.774  4.452   29.982 1.00 7.66  ? 160 TRP B O   1 
ATOM   2763 C  CB  . TRP B 1 168 ? 28.925  5.013   31.223 1.00 7.65  ? 160 TRP B CB  1 
ATOM   2764 C  CG  . TRP B 1 168 ? 27.438  5.061   31.049 1.00 7.56  ? 160 TRP B CG  1 
ATOM   2765 C  CD1 . TRP B 1 168 ? 26.697  4.302   30.211 1.00 7.58  ? 160 TRP B CD1 1 
ATOM   2766 C  CD2 . TRP B 1 168 ? 26.515  5.870   31.783 1.00 7.57  ? 160 TRP B CD2 1 
ATOM   2767 N  NE1 . TRP B 1 168 ? 25.377  4.585   30.349 1.00 7.52  ? 160 TRP B NE1 1 
ATOM   2768 C  CE2 . TRP B 1 168 ? 25.231  5.560   31.304 1.00 7.56  ? 160 TRP B CE2 1 
ATOM   2769 C  CE3 . TRP B 1 168 ? 26.649  6.831   32.785 1.00 7.48  ? 160 TRP B CE3 1 
ATOM   2770 C  CZ2 . TRP B 1 168 ? 24.083  6.169   31.801 1.00 7.50  ? 160 TRP B CZ2 1 
ATOM   2771 C  CZ3 . TRP B 1 168 ? 25.516  7.426   33.284 1.00 7.53  ? 160 TRP B CZ3 1 
ATOM   2772 C  CH2 . TRP B 1 168 ? 24.243  7.104   32.779 1.00 7.55  ? 160 TRP B CH2 1 
ATOM   2773 N  N   . LEU B 1 169 ? 31.778  6.153   31.481 1.00 7.76  ? 161 LEU B N   1 
ATOM   2774 C  CA  . LEU B 1 169 ? 32.982  5.734   32.184 1.00 8.12  ? 161 LEU B CA  1 
ATOM   2775 C  C   . LEU B 1 169 ? 32.556  5.514   33.615 1.00 8.44  ? 161 LEU B C   1 
ATOM   2776 O  O   . LEU B 1 169 ? 31.975  6.404   34.193 1.00 8.53  ? 161 LEU B O   1 
ATOM   2777 C  CB  . LEU B 1 169 ? 34.081  6.807   32.134 1.00 8.06  ? 161 LEU B CB  1 
ATOM   2778 C  CG  . LEU B 1 169 ? 35.347  6.519   32.913 1.00 8.11  ? 161 LEU B CG  1 
ATOM   2779 C  CD1 . LEU B 1 169 ? 36.058  5.298   32.396 1.00 8.39  ? 161 LEU B CD1 1 
ATOM   2780 C  CD2 . LEU B 1 169 ? 36.288  7.696   32.855 1.00 8.15  ? 161 LEU B CD2 1 
ATOM   2781 N  N   . CYS B 1 170 ? 32.825  4.320   34.160 1.00 8.89  ? 162 CYS B N   1 
ATOM   2782 C  CA  . CYS B 1 170 ? 32.350  3.915   35.475 1.00 9.17  ? 162 CYS B CA  1 
ATOM   2783 C  C   . CYS B 1 170 ? 33.487  3.371   36.313 1.00 9.43  ? 162 CYS B C   1 
ATOM   2784 O  O   . CYS B 1 170 ? 34.485  2.910   35.786 1.00 9.51  ? 162 CYS B O   1 
ATOM   2785 C  CB  . CYS B 1 170 ? 31.288  2.811   35.348 1.00 9.24  ? 162 CYS B CB  1 
ATOM   2786 S  SG  . CYS B 1 170 ? 29.811  3.287   34.419 1.00 9.62  ? 162 CYS B SG  1 
ATOM   2787 N  N   . VAL B 1 171 ? 33.296  3.430   37.620 1.00 9.78  ? 163 VAL B N   1 
ATOM   2788 C  CA  . VAL B 1 171 ? 34.076  2.700   38.585 1.00 10.31 ? 163 VAL B CA  1 
ATOM   2789 C  C   . VAL B 1 171 ? 33.391  1.350   38.787 1.00 10.76 ? 163 VAL B C   1 
ATOM   2790 O  O   . VAL B 1 171 ? 32.161  1.283   38.874 1.00 10.37 ? 163 VAL B O   1 
ATOM   2791 C  CB  . VAL B 1 171 ? 34.109  3.443   39.933 1.00 10.52 ? 163 VAL B CB  1 
ATOM   2792 C  CG1 . VAL B 1 171 ? 34.632  2.554   41.056 1.00 10.73 ? 163 VAL B CG1 1 
ATOM   2793 C  CG2 . VAL B 1 171 ? 34.952  4.705   39.812 1.00 10.62 ? 163 VAL B CG2 1 
ATOM   2794 N  N   . ASP B 1 172 ? 34.193  0.296   38.849 1.00 11.28 ? 164 ASP B N   1 
ATOM   2795 C  CA  . ASP B 1 172 ? 33.699  -1.009  39.129 1.00 12.38 ? 164 ASP B CA  1 
ATOM   2796 C  C   . ASP B 1 172 ? 34.209  -1.460  40.496 1.00 13.15 ? 164 ASP B C   1 
ATOM   2797 O  O   . ASP B 1 172 ? 35.371  -1.894  40.613 1.00 13.27 ? 164 ASP B O   1 
ATOM   2798 C  CB  . ASP B 1 172 ? 34.207  -1.976  38.080 1.00 13.15 ? 164 ASP B CB  1 
ATOM   2799 C  CG  . ASP B 1 172 ? 33.672  -3.382  38.285 1.00 13.67 ? 164 ASP B CG  1 
ATOM   2800 O  OD1 . ASP B 1 172 ? 32.968  -3.682  39.273 1.00 14.25 ? 164 ASP B OD1 1 
ATOM   2801 O  OD2 . ASP B 1 172 ? 33.923  -4.189  37.402 1.00 14.50 ? 164 ASP B OD2 1 
ATOM   2802 N  N   . PRO B 1 173 ? 33.360  -1.363  41.525 1.00 13.77 ? 165 PRO B N   1 
ATOM   2803 C  CA  . PRO B 1 173 ? 33.780  -1.743  42.884 1.00 14.75 ? 165 PRO B CA  1 
ATOM   2804 C  C   . PRO B 1 173 ? 34.124  -3.210  43.010 1.00 15.55 ? 165 PRO B C   1 
ATOM   2805 O  O   . PRO B 1 173 ? 34.956  -3.563  43.806 1.00 15.65 ? 165 PRO B O   1 
ATOM   2806 C  CB  . PRO B 1 173 ? 32.583  -1.408  43.759 1.00 14.71 ? 165 PRO B CB  1 
ATOM   2807 C  CG  . PRO B 1 173 ? 31.422  -1.145  42.822 1.00 14.49 ? 165 PRO B CG  1 
ATOM   2808 C  CD  . PRO B 1 173 ? 31.992  -0.807  41.472 1.00 13.96 ? 165 PRO B CD  1 
ATOM   2809 N  N   . SER B 1 174 ? 33.558  -4.061  42.172 1.00 16.92 ? 166 SER B N   1 
ATOM   2810 C  CA  . SER B 1 174 ? 33.906  -5.497  42.234 1.00 18.60 ? 166 SER B CA  1 
ATOM   2811 C  C   . SER B 1 174 ? 35.269  -5.814  41.618 1.00 19.74 ? 166 SER B C   1 
ATOM   2812 O  O   . SER B 1 174 ? 35.704  -6.963  41.629 1.00 20.55 ? 166 SER B O   1 
ATOM   2813 C  CB  . SER B 1 174 ? 32.822  -6.341  41.571 1.00 18.25 ? 166 SER B CB  1 
ATOM   2814 O  OG  . SER B 1 174 ? 32.966  -6.274  40.163 1.00 18.89 ? 166 SER B OG  1 
ATOM   2815 N  N   . ASN B 1 175 ? 35.956  -4.800  41.098 1.00 20.96 ? 167 ASN B N   1 
ATOM   2816 C  CA  . ASN B 1 175 ? 37.218  -4.994  40.365 1.00 21.63 ? 167 ASN B CA  1 
ATOM   2817 C  C   . ASN B 1 175 ? 38.250  -3.975  40.780 1.00 19.91 ? 167 ASN B C   1 
ATOM   2818 O  O   . ASN B 1 175 ? 38.781  -3.262  39.961 1.00 19.13 ? 167 ASN B O   1 
ATOM   2819 C  CB  . ASN B 1 175 ? 36.920  -4.856  38.878 1.00 23.48 ? 167 ASN B CB  1 
ATOM   2820 C  CG  . ASN B 1 175 ? 36.983  -6.158  38.174 1.00 27.12 ? 167 ASN B CG  1 
ATOM   2821 O  OD1 . ASN B 1 175 ? 38.043  -6.773  38.123 1.00 31.48 ? 167 ASN B OD1 1 
ATOM   2822 N  ND2 . ASN B 1 175 ? 35.829  -6.646  37.688 1.00 28.36 ? 167 ASN B ND2 1 
ATOM   2823 N  N   . LYS B 1 176 ? 38.483  -3.891  42.076 1.00 20.24 ? 168 LYS B N   1 
ATOM   2824 C  CA  . LYS B 1 176 ? 39.429  -2.943  42.668 1.00 20.02 ? 168 LYS B CA  1 
ATOM   2825 C  C   . LYS B 1 176 ? 39.192  -1.526  42.189 1.00 17.80 ? 168 LYS B C   1 
ATOM   2826 O  O   . LYS B 1 176 ? 40.124  -0.814  41.928 1.00 17.12 ? 168 LYS B O   1 
ATOM   2827 C  CB  . LYS B 1 176 ? 40.844  -3.396  42.358 1.00 22.14 ? 168 LYS B CB  1 
ATOM   2828 C  CG  . LYS B 1 176 ? 41.042  -4.868  42.717 1.00 24.50 ? 168 LYS B CG  1 
ATOM   2829 C  CD  . LYS B 1 176 ? 42.490  -5.249  42.952 1.00 26.39 ? 168 LYS B CD  1 
ATOM   2830 C  CE  . LYS B 1 176 ? 43.273  -5.087  41.679 1.00 27.84 ? 168 LYS B CE  1 
ATOM   2831 N  NZ  . LYS B 1 176 ? 43.127  -6.335  40.885 1.00 29.73 ? 168 LYS B NZ  1 
ATOM   2832 N  N   . ASN B 1 177 ? 37.928  -1.144  42.056 1.00 16.17 ? 169 ASN B N   1 
ATOM   2833 C  CA  . ASN B 1 177 ? 37.569  0.200   41.650 1.00 15.48 ? 169 ASN B CA  1 
ATOM   2834 C  C   . ASN B 1 177 ? 38.137  0.648   40.291 1.00 14.75 ? 169 ASN B C   1 
ATOM   2835 O  O   . ASN B 1 177 ? 38.262  1.847   40.051 1.00 13.45 ? 169 ASN B O   1 
ATOM   2836 C  CB  . ASN B 1 177 ? 37.992  1.199   42.725 1.00 15.45 ? 169 ASN B CB  1 
ATOM   2837 C  CG  . ASN B 1 177 ? 37.245  1.010   44.012 1.00 15.67 ? 169 ASN B CG  1 
ATOM   2838 O  OD1 . ASN B 1 177 ? 36.163  0.434   44.044 1.00 16.15 ? 169 ASN B OD1 1 
ATOM   2839 N  ND2 . ASN B 1 177 ? 37.813  1.478   45.077 1.00 15.61 ? 169 ASN B ND2 1 
ATOM   2840 N  N   . GLN B 1 178 ? 38.465  -0.308  39.418 1.00 14.03 ? 170 GLN B N   1 
ATOM   2841 C  CA  . GLN B 1 178 ? 38.978  0.013   38.090 1.00 13.62 ? 170 GLN B CA  1 
ATOM   2842 C  C   . GLN B 1 178 ? 37.958  0.825   37.317 1.00 13.17 ? 170 GLN B C   1 
ATOM   2843 O  O   . GLN B 1 178 ? 36.754  0.629   37.428 1.00 13.00 ? 170 GLN B O   1 
ATOM   2844 C  CB  . GLN B 1 178 ? 39.265  -1.240  37.288 1.00 13.43 ? 170 GLN B CB  1 
ATOM   2845 N  N   . LEU B 1 179 ? 38.463  1.733   36.517 1.00 12.93 ? 171 LEU B N   1 
ATOM   2846 C  CA  . LEU B 1 179 ? 37.650  2.518   35.607 1.00 12.64 ? 171 LEU B CA  1 
ATOM   2847 C  C   . LEU B 1 179 ? 37.348  1.677   34.408 1.00 12.67 ? 171 LEU B C   1 
ATOM   2848 O  O   . LEU B 1 179 ? 38.222  0.994   33.889 1.00 13.07 ? 171 LEU B O   1 
ATOM   2849 C  CB  . LEU B 1 179 ? 38.413  3.734   35.151 1.00 12.41 ? 171 LEU B CB  1 
ATOM   2850 C  CG  . LEU B 1 179 ? 38.505  4.767   36.245 1.00 12.75 ? 171 LEU B CG  1 
ATOM   2851 C  CD1 . LEU B 1 179 ? 39.600  5.748   35.882 1.00 12.86 ? 171 LEU B CD1 1 
ATOM   2852 C  CD2 . LEU B 1 179 ? 37.171  5.480   36.429 1.00 12.60 ? 171 LEU B CD2 1 
ATOM   2853 N  N   . VAL B 1 180 ? 36.106  1.711   33.957 1.00 12.59 ? 172 VAL B N   1 
ATOM   2854 C  CA  . VAL B 1 180 ? 35.693  0.859   32.855 1.00 12.27 ? 172 VAL B CA  1 
ATOM   2855 C  C   . VAL B 1 180 ? 34.711  1.638   31.954 1.00 11.50 ? 172 VAL B C   1 
ATOM   2856 O  O   . VAL B 1 180 ? 33.883  2.409   32.435 1.00 11.09 ? 172 VAL B O   1 
ATOM   2857 C  CB  . VAL B 1 180 ? 35.123  -0.472  33.417 1.00 12.78 ? 172 VAL B CB  1 
ATOM   2858 C  CG1 . VAL B 1 180 ? 33.737  -0.274  33.989 1.00 12.44 ? 172 VAL B CG1 1 
ATOM   2859 C  CG2 . VAL B 1 180 ? 35.092  -1.526  32.327 1.00 13.61 ? 172 VAL B CG2 1 
ATOM   2860 N  N   . ILE B 1 181 ? 34.827  1.459   30.648 1.00 10.85 ? 173 ILE B N   1 
ATOM   2861 C  CA  . ILE B 1 181 ? 33.879  2.049   29.689 1.00 10.34 ? 173 ILE B CA  1 
ATOM   2862 C  C   . ILE B 1 181 ? 32.717  1.082   29.504 1.00 10.09 ? 173 ILE B C   1 
ATOM   2863 O  O   . ILE B 1 181 ? 32.909  -0.128  29.400 1.00 9.88  ? 173 ILE B O   1 
ATOM   2864 C  CB  . ILE B 1 181 ? 34.543  2.354   28.339 1.00 10.43 ? 173 ILE B CB  1 
ATOM   2865 C  CG1 . ILE B 1 181 ? 35.654  3.400   28.519 1.00 10.63 ? 173 ILE B CG1 1 
ATOM   2866 C  CG2 . ILE B 1 181 ? 33.510  2.830   27.319 1.00 10.52 ? 173 ILE B CG2 1 
ATOM   2867 C  CD1 . ILE B 1 181 ? 36.563  3.605   27.323 1.00 10.68 ? 173 ILE B CD1 1 
ATOM   2868 N  N   . ASP B 1 182 ? 31.509  1.614   29.489 1.00 9.84  ? 174 ASP B N   1 
ATOM   2869 C  CA  . ASP B 1 182 ? 30.297  0.786   29.405 1.00 9.72  ? 174 ASP B CA  1 
ATOM   2870 C  C   . ASP B 1 182 ? 29.251  1.477   28.522 1.00 9.62  ? 174 ASP B C   1 
ATOM   2871 O  O   . ASP B 1 182 ? 28.980  2.663   28.685 1.00 9.69  ? 174 ASP B O   1 
ATOM   2872 C  CB  . ASP B 1 182 ? 29.702  0.579   30.790 1.00 9.59  ? 174 ASP B CB  1 
ATOM   2873 C  CG  . ASP B 1 182 ? 28.607  -0.460  30.797 1.00 9.73  ? 174 ASP B CG  1 
ATOM   2874 O  OD1 . ASP B 1 182 ? 28.917  -1.635  30.489 1.00 10.23 ? 174 ASP B OD1 1 
ATOM   2875 O  OD2 . ASP B 1 182 ? 27.457  -0.147  31.159 1.00 9.74  ? 174 ASP B OD2 1 
ATOM   2876 N  N   . ASN B 1 183 ? 28.689  0.721   27.589 1.00 9.46  ? 175 ASN B N   1 
ATOM   2877 C  CA  . ASN B 1 183 ? 27.617  1.176   26.720 1.00 9.08  ? 175 ASN B CA  1 
ATOM   2878 C  C   . ASN B 1 183 ? 26.303  0.648   27.245 1.00 8.94  ? 175 ASN B C   1 
ATOM   2879 O  O   . ASN B 1 183 ? 26.205  -0.543  27.562 1.00 9.07  ? 175 ASN B O   1 
ATOM   2880 C  CB  . ASN B 1 183 ? 27.831  0.634   25.312 1.00 9.03  ? 175 ASN B CB  1 
ATOM   2881 C  CG  . ASN B 1 183 ? 28.733  1.529   24.468 1.00 8.97  ? 175 ASN B CG  1 
ATOM   2882 O  OD1 . ASN B 1 183 ? 29.169  2.581   24.897 1.00 8.86  ? 175 ASN B OD1 1 
ATOM   2883 N  ND2 . ASN B 1 183 ? 28.989  1.098   23.236 1.00 9.05  ? 175 ASN B ND2 1 
ATOM   2884 N  N   . THR B 1 184 ? 25.298  1.513   27.309 1.00 8.62  ? 176 THR B N   1 
ATOM   2885 C  CA  . THR B 1 184 ? 23.926  1.079   27.545 1.00 8.69  ? 176 THR B CA  1 
ATOM   2886 C  C   . THR B 1 184 ? 23.025  1.484   26.382 1.00 8.84  ? 176 THR B C   1 
ATOM   2887 O  O   . THR B 1 184 ? 23.324  2.438   25.631 1.00 8.96  ? 176 THR B O   1 
ATOM   2888 C  CB  . THR B 1 184 ? 23.337  1.621   28.880 1.00 8.51  ? 176 THR B CB  1 
ATOM   2889 O  OG1 . THR B 1 184 ? 23.337  3.045   28.877 1.00 8.24  ? 176 THR B OG1 1 
ATOM   2890 C  CG2 . THR B 1 184 ? 24.117  1.094   30.078 1.00 8.53  ? 176 THR B CG2 1 
ATOM   2891 N  N   . SER B 1 185 ? 21.921  0.762   26.250 1.00 8.91  ? 177 SER B N   1 
ATOM   2892 C  CA  . SER B 1 185 ? 20.917  1.000   25.209 1.00 8.90  ? 177 SER B CA  1 
ATOM   2893 C  C   . SER B 1 185 ? 19.715  1.667   25.824 1.00 8.67  ? 177 SER B C   1 
ATOM   2894 O  O   . SER B 1 185 ? 19.271  1.285   26.905 1.00 8.67  ? 177 SER B O   1 
ATOM   2895 C  CB  . SER B 1 185 ? 20.470  -0.342  24.591 1.00 9.21  ? 177 SER B CB  1 
ATOM   2896 O  OG  . SER B 1 185 ? 19.356  -0.194  23.712 1.00 9.40  ? 177 SER B OG  1 
ATOM   2897 N  N   . ASN B 1 186 ? 19.156  2.630   25.099 1.00 8.61  ? 178 ASN B N   1 
ATOM   2898 C  CA  . ASN B 1 186 ? 17.903  3.288   25.465 1.00 8.49  ? 178 ASN B CA  1 
ATOM   2899 C  C   . ASN B 1 186 ? 17.992  3.980   26.841 1.00 8.49  ? 178 ASN B C   1 
ATOM   2900 O  O   . ASN B 1 186 ? 18.735  4.973   26.972 1.00 8.24  ? 178 ASN B O   1 
ATOM   2901 C  CB  . ASN B 1 186 ? 16.738  2.307   25.308 1.00 8.68  ? 178 ASN B CB  1 
ATOM   2902 C  CG  . ASN B 1 186 ? 16.439  2.006   23.840 1.00 8.79  ? 178 ASN B CG  1 
ATOM   2903 O  OD1 . ASN B 1 186 ? 16.999  2.633   22.944 1.00 8.82  ? 178 ASN B OD1 1 
ATOM   2904 N  ND2 . ASN B 1 186 ? 15.533  1.082   23.593 1.00 8.99  ? 178 ASN B ND2 1 
ATOM   2905 N  N   . ALA B 1 187 ? 17.283  3.487   27.854 1.00 8.62  ? 179 ALA B N   1 
ATOM   2906 C  CA  . ALA B 1 187 ? 17.348  4.094   29.200 1.00 8.75  ? 179 ALA B CA  1 
ATOM   2907 C  C   . ALA B 1 187 ? 18.294  3.367   30.141 1.00 8.92  ? 179 ALA B C   1 
ATOM   2908 O  O   . ALA B 1 187 ? 18.384  3.693   31.336 1.00 8.63  ? 179 ALA B O   1 
ATOM   2909 C  CB  . ALA B 1 187 ? 15.977  4.132   29.814 1.00 8.87  ? 179 ALA B CB  1 
ATOM   2910 N  N   . GLY B 1 188 ? 19.001  2.380   29.589 1.00 9.32  ? 180 GLY B N   1 
ATOM   2911 C  CA  . GLY B 1 188 ? 19.896  1.545   30.359 1.00 9.73  ? 180 GLY B CA  1 
ATOM   2912 C  C   . GLY B 1 188 ? 20.822  2.366   31.257 1.00 10.00 ? 180 GLY B C   1 
ATOM   2913 O  O   . GLY B 1 188 ? 21.443  3.355   30.813 1.00 10.01 ? 180 GLY B O   1 
ATOM   2914 N  N   . CYS B 1 189 ? 20.901  1.952   32.515 1.00 10.40 ? 181 CYS B N   1 
ATOM   2915 C  CA  . CYS B 1 189 ? 21.540  2.749   33.581 1.00 10.92 ? 181 CYS B CA  1 
ATOM   2916 C  C   . CYS B 1 189 ? 22.484  1.821   34.405 1.00 11.09 ? 181 CYS B C   1 
ATOM   2917 O  O   . CYS B 1 189 ? 22.044  0.828   34.959 1.00 10.73 ? 181 CYS B O   1 
ATOM   2918 C  CB  . CYS B 1 189 ? 20.433  3.350   34.453 1.00 11.16 ? 181 CYS B CB  1 
ATOM   2919 S  SG  . CYS B 1 189 ? 20.906  4.539   35.712 1.00 11.39 ? 181 CYS B SG  1 
ATOM   2920 N  N   . PRO B 1 190 ? 23.791  2.138   34.429 1.00 11.59 ? 182 PRO B N   1 
ATOM   2921 C  CA  . PRO B 1 190 ? 24.856  1.272   34.954 1.00 11.72 ? 182 PRO B CA  1 
ATOM   2922 C  C   . PRO B 1 190 ? 24.634  0.750   36.374 1.00 11.98 ? 182 PRO B C   1 
ATOM   2923 O  O   . PRO B 1 190 ? 25.112  -0.340  36.689 1.00 11.92 ? 182 PRO B O   1 
ATOM   2924 C  CB  . PRO B 1 190 ? 26.097  2.170   34.918 1.00 11.87 ? 182 PRO B CB  1 
ATOM   2925 C  CG  . PRO B 1 190 ? 25.824  3.170   33.846 1.00 11.71 ? 182 PRO B CG  1 
ATOM   2926 C  CD  . PRO B 1 190 ? 24.334  3.372   33.828 1.00 11.61 ? 182 PRO B CD  1 
ATOM   2927 N  N   . LEU B 1 191 ? 23.941  1.506   37.224 1.00 12.07 ? 183 LEU B N   1 
ATOM   2928 C  CA  . LEU B 1 191 ? 23.713  1.052   38.610 1.00 12.69 ? 183 LEU B CA  1 
ATOM   2929 C  C   . LEU B 1 191 ? 22.995  -0.286  38.658 1.00 12.77 ? 183 LEU B C   1 
ATOM   2930 O  O   . LEU B 1 191 ? 23.214  -1.043  39.585 1.00 12.38 ? 183 LEU B O   1 
ATOM   2931 C  CB  . LEU B 1 191 ? 22.955  2.082   39.466 1.00 13.02 ? 183 LEU B CB  1 
ATOM   2932 C  CG  . LEU B 1 191 ? 21.453  2.248   39.159 1.00 13.50 ? 183 LEU B CG  1 
ATOM   2933 C  CD1 . LEU B 1 191 ? 20.587  1.345   40.021 1.00 13.60 ? 183 LEU B CD1 1 
ATOM   2934 C  CD2 . LEU B 1 191 ? 21.030  3.680   39.383 1.00 13.48 ? 183 LEU B CD2 1 
ATOM   2935 N  N   . THR B 1 192 ? 22.182  -0.604  37.638 1.00 12.76 ? 184 THR B N   1 
ATOM   2936 C  CA  . THR B 1 192 ? 21.549  -1.905  37.609 1.00 13.13 ? 184 THR B CA  1 
ATOM   2937 C  C   . THR B 1 192 ? 22.607  -3.039  37.416 1.00 13.92 ? 184 THR B C   1 
ATOM   2938 O  O   . THR B 1 192 ? 22.321  -4.184  37.699 1.00 13.89 ? 184 THR B O   1 
ATOM   2939 C  CB  . THR B 1 192 ? 20.484  -2.024  36.516 1.00 13.13 ? 184 THR B CB  1 
ATOM   2940 O  OG1 . THR B 1 192 ? 21.114  -1.978  35.226 1.00 12.51 ? 184 THR B OG1 1 
ATOM   2941 C  CG2 . THR B 1 192 ? 19.432  -0.926  36.644 1.00 13.04 ? 184 THR B CG2 1 
ATOM   2942 N  N   . LYS B 1 193 ? 23.802  -2.705  36.912 1.00 14.03 ? 185 LYS B N   1 
ATOM   2943 C  CA  . LYS B 1 193 ? 24.936  -3.637  36.792 1.00 14.46 ? 185 LYS B CA  1 
ATOM   2944 C  C   . LYS B 1 193 ? 25.854  -3.617  37.998 1.00 14.13 ? 185 LYS B C   1 
ATOM   2945 O  O   . LYS B 1 193 ? 26.797  -4.386  38.026 1.00 14.49 ? 185 LYS B O   1 
ATOM   2946 C  CB  . LYS B 1 193 ? 25.871  -3.202  35.667 1.00 14.71 ? 185 LYS B CB  1 
ATOM   2947 C  CG  . LYS B 1 193 ? 25.523  -3.662  34.310 1.00 15.14 ? 185 LYS B CG  1 
ATOM   2948 C  CD  . LYS B 1 193 ? 26.697  -3.381  33.381 1.00 15.42 ? 185 LYS B CD  1 
ATOM   2949 C  CE  . LYS B 1 193 ? 26.232  -3.408  31.934 1.00 15.27 ? 185 LYS B CE  1 
ATOM   2950 N  NZ  . LYS B 1 193 ? 25.429  -2.202  31.610 1.00 15.37 ? 185 LYS B NZ  1 
ATOM   2951 N  N   . GLY B 1 194 ? 25.619  -2.724  38.954 1.00 13.51 ? 186 GLY B N   1 
ATOM   2952 C  CA  . GLY B 1 194 ? 26.540  -2.545  40.057 1.00 13.54 ? 186 GLY B CA  1 
ATOM   2953 C  C   . GLY B 1 194 ? 27.678  -1.580  39.787 1.00 13.31 ? 186 GLY B C   1 
ATOM   2954 O  O   . GLY B 1 194 ? 28.554  -1.404  40.645 1.00 14.36 ? 186 GLY B O   1 
ATOM   2955 N  N   . LEU B 1 195 ? 27.671  -0.942  38.619 1.00 12.16 ? 187 LEU B N   1 
ATOM   2956 C  CA  . LEU B 1 195 ? 28.715  0.002   38.263 1.00 11.65 ? 187 LEU B CA  1 
ATOM   2957 C  C   . LEU B 1 195 ? 28.324  1.404   38.713 1.00 11.36 ? 187 LEU B C   1 
ATOM   2958 O  O   . LEU B 1 195 ? 27.139  1.715   38.788 1.00 11.57 ? 187 LEU B O   1 
ATOM   2959 C  CB  . LEU B 1 195 ? 28.942  0.020   36.749 1.00 11.42 ? 187 LEU B CB  1 
ATOM   2960 C  CG  . LEU B 1 195 ? 29.494  -1.258  36.118 1.00 11.40 ? 187 LEU B CG  1 
ATOM   2961 C  CD1 . LEU B 1 195 ? 29.604  -1.091  34.610 1.00 11.11 ? 187 LEU B CD1 1 
ATOM   2962 C  CD2 . LEU B 1 195 ? 30.838  -1.648  36.717 1.00 11.42 ? 187 LEU B CD2 1 
ATOM   2963 N  N   . ARG B 1 196 ? 29.336  2.222   39.022 1.00 11.15 ? 188 ARG B N   1 
ATOM   2964 C  CA  . ARG B 1 196 ? 29.181  3.596   39.524 1.00 11.02 ? 188 ARG B CA  1 
ATOM   2965 C  C   . ARG B 1 196 ? 29.681  4.618   38.482 1.00 10.71 ? 188 ARG B C   1 
ATOM   2966 O  O   . ARG B 1 196 ? 30.894  4.780   38.299 1.00 10.43 ? 188 ARG B O   1 
ATOM   2967 C  CB  . ARG B 1 196 ? 29.980  3.762   40.825 1.00 11.40 ? 188 ARG B CB  1 
ATOM   2968 C  CG  . ARG B 1 196 ? 29.548  2.809   41.917 1.00 11.89 ? 188 ARG B CG  1 
ATOM   2969 C  CD  . ARG B 1 196 ? 30.489  2.780   43.095 1.00 12.70 ? 188 ARG B CD  1 
ATOM   2970 N  NE  . ARG B 1 196 ? 29.929  1.900   44.123 1.00 13.64 ? 188 ARG B NE  1 
ATOM   2971 C  CZ  . ARG B 1 196 ? 30.324  1.848   45.393 1.00 14.35 ? 188 ARG B CZ  1 
ATOM   2972 N  NH1 . ARG B 1 196 ? 31.333  2.600   45.844 1.00 14.07 ? 188 ARG B NH1 1 
ATOM   2973 N  NH2 . ARG B 1 196 ? 29.688  1.022   46.208 1.00 14.67 ? 188 ARG B NH2 1 
ATOM   2974 N  N   . PRO B 1 197 ? 28.759  5.332   37.814 1.00 10.24 ? 189 PRO B N   1 
ATOM   2975 C  CA  . PRO B 1 197 ? 29.149  6.244   36.735 1.00 10.04 ? 189 PRO B CA  1 
ATOM   2976 C  C   . PRO B 1 197 ? 29.931  7.441   37.199 1.00 9.90  ? 189 PRO B C   1 
ATOM   2977 O  O   . PRO B 1 197 ? 29.631  7.981   38.253 1.00 10.14 ? 189 PRO B O   1 
ATOM   2978 C  CB  . PRO B 1 197 ? 27.811  6.706   36.163 1.00 10.01 ? 189 PRO B CB  1 
ATOM   2979 C  CG  . PRO B 1 197 ? 26.840  6.519   37.282 1.00 10.16 ? 189 PRO B CG  1 
ATOM   2980 C  CD  . PRO B 1 197 ? 27.303  5.314   38.033 1.00 10.26 ? 189 PRO B CD  1 
ATOM   2981 N  N   . VAL B 1 198 ? 30.955  7.826   36.443 1.00 9.65  ? 190 VAL B N   1 
ATOM   2982 C  CA  . VAL B 1 198 ? 31.644  9.083   36.677 1.00 9.59  ? 190 VAL B CA  1 
ATOM   2983 C  C   . VAL B 1 198 ? 31.476  10.066  35.508 1.00 9.44  ? 190 VAL B C   1 
ATOM   2984 O  O   . VAL B 1 198 ? 31.680  11.303  35.673 1.00 9.31  ? 190 VAL B O   1 
ATOM   2985 C  CB  . VAL B 1 198 ? 33.141  8.871   37.019 1.00 10.04 ? 190 VAL B CB  1 
ATOM   2986 C  CG1 . VAL B 1 198 ? 33.293  7.899   38.182 1.00 10.33 ? 190 VAL B CG1 1 
ATOM   2987 C  CG2 . VAL B 1 198 ? 33.955  8.374   35.836 1.00 10.04 ? 190 VAL B CG2 1 
ATOM   2988 N  N   . LEU B 1 199 ? 31.171  9.512   34.327 1.00 8.84  ? 191 LEU B N   1 
ATOM   2989 C  CA  . LEU B 1 199 ? 30.961  10.289  33.099 1.00 8.51  ? 191 LEU B CA  1 
ATOM   2990 C  C   . LEU B 1 199 ? 29.907  9.628   32.212 1.00 8.17  ? 191 LEU B C   1 
ATOM   2991 O  O   . LEU B 1 199 ? 29.930  8.436   32.023 1.00 8.05  ? 191 LEU B O   1 
ATOM   2992 C  CB  . LEU B 1 199 ? 32.279  10.414  32.316 1.00 8.51  ? 191 LEU B CB  1 
ATOM   2993 C  CG  . LEU B 1 199 ? 32.235  11.008  30.912 1.00 8.48  ? 191 LEU B CG  1 
ATOM   2994 C  CD1 . LEU B 1 199 ? 31.752  12.448  30.874 1.00 8.35  ? 191 LEU B CD1 1 
ATOM   2995 C  CD2 . LEU B 1 199 ? 33.587  10.863  30.242 1.00 8.56  ? 191 LEU B CD2 1 
ATOM   2996 N  N   . ALA B 1 200 ? 28.985  10.419  31.673 1.00 7.98  ? 192 ALA B N   1 
ATOM   2997 C  CA  . ALA B 1 200 ? 28.035  9.949   30.685 1.00 7.84  ? 192 ALA B CA  1 
ATOM   2998 C  C   . ALA B 1 200 ? 28.049  10.834  29.441 1.00 8.12  ? 192 ALA B C   1 
ATOM   2999 O  O   . ALA B 1 200 ? 28.103  12.092  29.547 1.00 8.20  ? 192 ALA B O   1 
ATOM   3000 C  CB  . ALA B 1 200 ? 26.642  9.954   31.276 1.00 7.90  ? 192 ALA B CB  1 
ATOM   3001 N  N   . VAL B 1 201 ? 27.952  10.201  28.270 1.00 7.95  ? 193 VAL B N   1 
ATOM   3002 C  CA  . VAL B 1 201 ? 27.712  10.905  27.023 1.00 7.98  ? 193 VAL B CA  1 
ATOM   3003 C  C   . VAL B 1 201 ? 26.511  10.289  26.330 1.00 8.04  ? 193 VAL B C   1 
ATOM   3004 O  O   . VAL B 1 201 ? 26.459  9.057   26.074 1.00 7.74  ? 193 VAL B O   1 
ATOM   3005 C  CB  . VAL B 1 201 ? 28.984  10.922  26.138 1.00 8.15  ? 193 VAL B CB  1 
ATOM   3006 C  CG1 . VAL B 1 201 ? 28.717  11.592  24.788 1.00 8.20  ? 193 VAL B CG1 1 
ATOM   3007 C  CG2 . VAL B 1 201 ? 30.097  11.689  26.871 1.00 8.21  ? 193 VAL B CG2 1 
ATOM   3008 N  N   . ASP B 1 202 ? 25.492  11.131  26.133 1.00 7.98  ? 194 ASP B N   1 
ATOM   3009 C  CA  . ASP B 1 202 ? 24.231  10.727  25.527 1.00 7.75  ? 194 ASP B CA  1 
ATOM   3010 C  C   . ASP B 1 202 ? 24.519  10.491  24.054 1.00 7.74  ? 194 ASP B C   1 
ATOM   3011 O  O   . ASP B 1 202 ? 25.098  11.341  23.419 1.00 7.56  ? 194 ASP B O   1 
ATOM   3012 C  CB  . ASP B 1 202 ? 23.260  11.888  25.683 1.00 7.77  ? 194 ASP B CB  1 
ATOM   3013 C  CG  . ASP B 1 202 ? 21.802  11.523  25.372 1.00 7.88  ? 194 ASP B CG  1 
ATOM   3014 O  OD1 . ASP B 1 202 ? 21.464  10.397  24.954 1.00 7.67  ? 194 ASP B OD1 1 
ATOM   3015 O  OD2 . ASP B 1 202 ? 20.980  12.422  25.606 1.00 8.26  ? 194 ASP B OD2 1 
ATOM   3016 N  N   . VAL B 1 203 ? 24.150  9.323   23.519 1.00 7.83  ? 195 VAL B N   1 
ATOM   3017 C  CA  . VAL B 1 203 ? 24.227  9.109   22.063 1.00 8.00  ? 195 VAL B CA  1 
ATOM   3018 C  C   . VAL B 1 203 ? 22.848  8.903   21.407 1.00 8.08  ? 195 VAL B C   1 
ATOM   3019 O  O   . VAL B 1 203 ? 22.750  8.503   20.254 1.00 8.32  ? 195 VAL B O   1 
ATOM   3020 C  CB  . VAL B 1 203 ? 25.271  8.047   21.688 1.00 8.16  ? 195 VAL B CB  1 
ATOM   3021 C  CG1 . VAL B 1 203 ? 26.665  8.555   22.055 1.00 8.15  ? 195 VAL B CG1 1 
ATOM   3022 C  CG2 . VAL B 1 203 ? 24.997  6.674   22.338 1.00 8.23  ? 195 VAL B CG2 1 
ATOM   3023 N  N   . TRP B 1 204 ? 21.769  9.163   22.147 1.00 8.13  ? 196 TRP B N   1 
ATOM   3024 C  CA  . TRP B 1 204 ? 20.466  9.346   21.501 1.00 8.13  ? 196 TRP B CA  1 
ATOM   3025 C  C   . TRP B 1 204 ? 20.689  10.439  20.487 1.00 8.04  ? 196 TRP B C   1 
ATOM   3026 O  O   . TRP B 1 204 ? 21.383  11.428  20.772 1.00 7.91  ? 196 TRP B O   1 
ATOM   3027 C  CB  . TRP B 1 204 ? 19.390  9.803   22.470 1.00 8.13  ? 196 TRP B CB  1 
ATOM   3028 C  CG  . TRP B 1 204 ? 18.805  8.729   23.352 1.00 8.35  ? 196 TRP B CG  1 
ATOM   3029 C  CD1 . TRP B 1 204 ? 19.457  7.984   24.300 1.00 8.40  ? 196 TRP B CD1 1 
ATOM   3030 C  CD2 . TRP B 1 204 ? 17.438  8.327   23.408 1.00 8.58  ? 196 TRP B CD2 1 
ATOM   3031 N  NE1 . TRP B 1 204 ? 18.587  7.133   24.918 1.00 8.49  ? 196 TRP B NE1 1 
ATOM   3032 C  CE2 . TRP B 1 204 ? 17.335  7.337   24.405 1.00 8.71  ? 196 TRP B CE2 1 
ATOM   3033 C  CE3 . TRP B 1 204 ? 16.294  8.717   22.729 1.00 8.75  ? 196 TRP B CE3 1 
ATOM   3034 C  CZ2 . TRP B 1 204 ? 16.131  6.685   24.698 1.00 8.87  ? 196 TRP B CZ2 1 
ATOM   3035 C  CZ3 . TRP B 1 204 ? 15.087  8.083   23.041 1.00 9.10  ? 196 TRP B CZ3 1 
ATOM   3036 C  CH2 . TRP B 1 204 ? 15.021  7.086   24.025 1.00 8.91  ? 196 TRP B CH2 1 
ATOM   3037 N  N   . GLU B 1 205 ? 20.144  10.260  19.295 1.00 8.07  ? 197 GLU B N   1 
ATOM   3038 C  CA  . GLU B 1 205 ? 20.414  11.180  18.218 1.00 8.14  ? 197 GLU B CA  1 
ATOM   3039 C  C   . GLU B 1 205 ? 19.995  12.604  18.588 1.00 8.21  ? 197 GLU B C   1 
ATOM   3040 O  O   . GLU B 1 205 ? 20.630  13.569  18.147 1.00 8.29  ? 197 GLU B O   1 
ATOM   3041 C  CB  . GLU B 1 205 ? 19.717  10.718  16.933 1.00 8.45  ? 197 GLU B CB  1 
ATOM   3042 C  CG  . GLU B 1 205 ? 20.263  9.402   16.418 1.00 8.51  ? 197 GLU B CG  1 
ATOM   3043 C  CD  . GLU B 1 205 ? 19.655  8.960   15.107 1.00 8.74  ? 197 GLU B CD  1 
ATOM   3044 O  OE1 . GLU B 1 205 ? 18.413  8.792   15.073 1.00 8.78  ? 197 GLU B OE1 1 
ATOM   3045 O  OE2 . GLU B 1 205 ? 20.427  8.723   14.130 1.00 8.82  ? 197 GLU B OE2 1 
ATOM   3046 N  N   . HIS B 1 206 ? 18.955  12.752  19.396 1.00 8.21  ? 198 HIS B N   1 
ATOM   3047 C  CA  . HIS B 1 206 ? 18.536  14.089  19.827 1.00 8.49  ? 198 HIS B CA  1 
ATOM   3048 C  C   . HIS B 1 206 ? 19.577  14.867  20.589 1.00 8.31  ? 198 HIS B C   1 
ATOM   3049 O  O   . HIS B 1 206 ? 19.431  16.079  20.721 1.00 8.66  ? 198 HIS B O   1 
ATOM   3050 C  CB  . HIS B 1 206 ? 17.225  14.085  20.636 1.00 8.50  ? 198 HIS B CB  1 
ATOM   3051 C  CG  . HIS B 1 206 ? 17.334  13.465  21.986 1.00 8.41  ? 198 HIS B CG  1 
ATOM   3052 N  ND1 . HIS B 1 206 ? 16.523  12.436  22.376 1.00 8.49  ? 198 HIS B ND1 1 
ATOM   3053 C  CD2 . HIS B 1 206 ? 18.116  13.752  23.060 1.00 8.47  ? 198 HIS B CD2 1 
ATOM   3054 C  CE1 . HIS B 1 206 ? 16.814  12.086  23.614 1.00 8.34  ? 198 HIS B CE1 1 
ATOM   3055 N  NE2 . HIS B 1 206 ? 17.791  12.859  24.045 1.00 8.33  ? 198 HIS B NE2 1 
ATOM   3056 N  N   . ALA B 1 207 ? 20.611  14.208  21.086 1.00 8.06  ? 199 ALA B N   1 
ATOM   3057 C  CA  . ALA B 1 207 ? 21.655  14.946  21.853 1.00 7.95  ? 199 ALA B CA  1 
ATOM   3058 C  C   . ALA B 1 207 ? 22.557  15.780  20.954 1.00 8.00  ? 199 ALA B C   1 
ATOM   3059 O  O   . ALA B 1 207 ? 23.091  16.793  21.381 1.00 8.21  ? 199 ALA B O   1 
ATOM   3060 C  CB  . ALA B 1 207 ? 22.501  13.998  22.675 1.00 7.70  ? 199 ALA B CB  1 
ATOM   3061 N  N   . TYR B 1 208 ? 22.706  15.361  19.706 1.00 8.16  ? 200 TYR B N   1 
ATOM   3062 C  CA  . TYR B 1 208 ? 23.622  16.017  18.779 1.00 8.15  ? 200 TYR B CA  1 
ATOM   3063 C  C   . TYR B 1 208 ? 23.045  16.417  17.419 1.00 8.48  ? 200 TYR B C   1 
ATOM   3064 O  O   . TYR B 1 208 ? 23.747  17.084  16.640 1.00 8.73  ? 200 TYR B O   1 
ATOM   3065 C  CB  . TYR B 1 208 ? 24.803  15.118  18.541 1.00 8.01  ? 200 TYR B CB  1 
ATOM   3066 C  CG  . TYR B 1 208 ? 24.510  13.744  17.972 1.00 7.91  ? 200 TYR B CG  1 
ATOM   3067 C  CD1 . TYR B 1 208 ? 24.340  13.546  16.617 1.00 7.98  ? 200 TYR B CD1 1 
ATOM   3068 C  CD2 . TYR B 1 208 ? 24.431  12.617  18.819 1.00 7.86  ? 200 TYR B CD2 1 
ATOM   3069 C  CE1 . TYR B 1 208 ? 24.066  12.284  16.102 1.00 8.09  ? 200 TYR B CE1 1 
ATOM   3070 C  CE2 . TYR B 1 208 ? 24.156  11.347  18.325 1.00 7.72  ? 200 TYR B CE2 1 
ATOM   3071 C  CZ  . TYR B 1 208 ? 23.977  11.175  16.966 1.00 7.96  ? 200 TYR B CZ  1 
ATOM   3072 O  OH  . TYR B 1 208 ? 23.749  9.901   16.475 1.00 7.99  ? 200 TYR B OH  1 
ATOM   3073 N  N   . TYR B 1 209 ? 21.802  16.029  17.115 1.00 8.54  ? 201 TYR B N   1 
ATOM   3074 C  CA  . TYR B 1 209 ? 21.315  16.145  15.747 1.00 8.81  ? 201 TYR B CA  1 
ATOM   3075 C  C   . TYR B 1 209 ? 21.097  17.588  15.311 1.00 9.14  ? 201 TYR B C   1 
ATOM   3076 O  O   . TYR B 1 209 ? 21.241  17.902  14.119 1.00 9.33  ? 201 TYR B O   1 
ATOM   3077 C  CB  . TYR B 1 209 ? 20.048  15.304  15.498 1.00 8.85  ? 201 TYR B CB  1 
ATOM   3078 C  CG  . TYR B 1 209 ? 20.015  14.714  14.088 1.00 8.89  ? 201 TYR B CG  1 
ATOM   3079 C  CD1 . TYR B 1 209 ? 20.607  13.483  13.824 1.00 8.76  ? 201 TYR B CD1 1 
ATOM   3080 C  CD2 . TYR B 1 209 ? 19.436  15.413  13.010 1.00 9.08  ? 201 TYR B CD2 1 
ATOM   3081 C  CE1 . TYR B 1 209 ? 20.612  12.950  12.546 1.00 8.94  ? 201 TYR B CE1 1 
ATOM   3082 C  CE2 . TYR B 1 209 ? 19.459  14.885  11.710 1.00 9.27  ? 201 TYR B CE2 1 
ATOM   3083 C  CZ  . TYR B 1 209 ? 20.045  13.651  11.487 1.00 9.19  ? 201 TYR B CZ  1 
ATOM   3084 O  OH  . TYR B 1 209 ? 20.065  13.096  10.209 1.00 9.41  ? 201 TYR B OH  1 
ATOM   3085 N  N   . LYS B 1 210 ? 20.764  18.477  16.245 1.00 9.28  ? 202 LYS B N   1 
ATOM   3086 C  CA  . LYS B 1 210 ? 20.550  19.898  15.892 1.00 9.63  ? 202 LYS B CA  1 
ATOM   3087 C  C   . LYS B 1 210 ? 21.876  20.536  15.416 1.00 9.76  ? 202 LYS B C   1 
ATOM   3088 O  O   . LYS B 1 210 ? 21.915  21.209  14.393 1.00 10.44 ? 202 LYS B O   1 
ATOM   3089 C  CB  . LYS B 1 210 ? 19.923  20.684  17.059 1.00 9.56  ? 202 LYS B CB  1 
ATOM   3090 C  CG  . LYS B 1 210 ? 19.892  22.203  16.907 1.00 9.83  ? 202 LYS B CG  1 
ATOM   3091 C  CD  . LYS B 1 210 ? 19.191  22.713  15.656 1.00 10.22 ? 202 LYS B CD  1 
ATOM   3092 C  CE  . LYS B 1 210 ? 17.698  22.553  15.776 1.00 10.30 ? 202 LYS B CE  1 
ATOM   3093 N  NZ  . LYS B 1 210 ? 16.979  23.368  14.765 1.00 10.78 ? 202 LYS B NZ  1 
ATOM   3094 N  N   . ASP B 1 211 ? 22.949  20.293  16.147 1.00 9.45  ? 203 ASP B N   1 
ATOM   3095 C  CA  . ASP B 1 211 ? 24.238  20.913  15.885 1.00 9.52  ? 203 ASP B CA  1 
ATOM   3096 C  C   . ASP B 1 211 ? 25.101  20.043  14.970 1.00 9.57  ? 203 ASP B C   1 
ATOM   3097 O  O   . ASP B 1 211 ? 25.966  20.567  14.286 1.00 9.81  ? 203 ASP B O   1 
ATOM   3098 C  CB  . ASP B 1 211 ? 24.996  21.178  17.217 1.00 9.29  ? 203 ASP B CB  1 
ATOM   3099 C  CG  . ASP B 1 211 ? 24.358  22.296  18.057 1.00 9.32  ? 203 ASP B CG  1 
ATOM   3100 O  OD1 . ASP B 1 211 ? 23.511  23.061  17.535 1.00 9.54  ? 203 ASP B OD1 1 
ATOM   3101 O  OD2 . ASP B 1 211 ? 24.670  22.406  19.266 1.00 9.00  ? 203 ASP B OD2 1 
ATOM   3102 N  N   . PHE B 1 212 ? 24.891  18.721  14.960 1.00 9.37  ? 204 PHE B N   1 
ATOM   3103 C  CA  . PHE B 1 212 ? 25.776  17.833  14.220 1.00 9.35  ? 204 PHE B CA  1 
ATOM   3104 C  C   . PHE B 1 212 ? 25.115  17.007  13.138 1.00 9.51  ? 204 PHE B C   1 
ATOM   3105 O  O   . PHE B 1 212 ? 25.800  16.374  12.346 1.00 9.67  ? 204 PHE B O   1 
ATOM   3106 C  CB  . PHE B 1 212 ? 26.507  16.912  15.181 1.00 9.16  ? 204 PHE B CB  1 
ATOM   3107 C  CG  . PHE B 1 212 ? 27.414  17.619  16.104 1.00 9.07  ? 204 PHE B CG  1 
ATOM   3108 C  CD1 . PHE B 1 212 ? 28.753  17.819  15.763 1.00 9.28  ? 204 PHE B CD1 1 
ATOM   3109 C  CD2 . PHE B 1 212 ? 26.967  18.081  17.317 1.00 9.01  ? 204 PHE B CD2 1 
ATOM   3110 C  CE1 . PHE B 1 212 ? 29.624  18.492  16.620 1.00 9.17  ? 204 PHE B CE1 1 
ATOM   3111 C  CE2 . PHE B 1 212 ? 27.842  18.762  18.177 1.00 9.03  ? 204 PHE B CE2 1 
ATOM   3112 C  CZ  . PHE B 1 212 ? 29.159  18.972  17.824 1.00 8.99  ? 204 PHE B CZ  1 
ATOM   3113 N  N   . GLU B 1 213 ? 23.792  17.053  13.061 1.00 9.65  ? 205 GLU B N   1 
ATOM   3114 C  CA  . GLU B 1 213 ? 23.033  16.196  12.146 1.00 9.66  ? 205 GLU B CA  1 
ATOM   3115 C  C   . GLU B 1 213 ? 23.504  14.746  12.354 1.00 9.67  ? 205 GLU B C   1 
ATOM   3116 O  O   . GLU B 1 213 ? 23.621  14.310  13.506 1.00 9.06  ? 205 GLU B O   1 
ATOM   3117 C  CB  . GLU B 1 213 ? 23.157  16.712  10.709 1.00 9.98  ? 205 GLU B CB  1 
ATOM   3118 C  CG  . GLU B 1 213 ? 22.501  18.097  10.516 1.00 10.09 ? 205 GLU B CG  1 
ATOM   3119 C  CD  . GLU B 1 213 ? 22.860  18.762  9.198  1.00 10.42 ? 205 GLU B CD  1 
ATOM   3120 O  OE1 . GLU B 1 213 ? 24.050  18.757  8.819  1.00 10.70 ? 205 GLU B OE1 1 
ATOM   3121 O  OE2 . GLU B 1 213 ? 21.954  19.297  8.527  1.00 10.68 ? 205 GLU B OE2 1 
ATOM   3122 N  N   . ASN B 1 214 ? 23.820  14.028  11.274 1.00 9.90  ? 206 ASN B N   1 
ATOM   3123 C  CA  . ASN B 1 214 ? 24.259  12.639  11.372 1.00 10.12 ? 206 ASN B CA  1 
ATOM   3124 C  C   . ASN B 1 214 ? 25.657  12.387  11.973 1.00 9.96  ? 206 ASN B C   1 
ATOM   3125 O  O   . ASN B 1 214 ? 26.033  11.236  12.174 1.00 9.70  ? 206 ASN B O   1 
ATOM   3126 C  CB  . ASN B 1 214 ? 24.235  11.987  9.986  1.00 10.48 ? 206 ASN B CB  1 
ATOM   3127 C  CG  . ASN B 1 214 ? 25.227  12.644  9.032  1.00 11.01 ? 206 ASN B CG  1 
ATOM   3128 O  OD1 . ASN B 1 214 ? 25.056  13.802  8.643  1.00 10.99 ? 206 ASN B OD1 1 
ATOM   3129 N  ND2 . ASN B 1 214 ? 26.279  11.900  8.648  1.00 11.41 ? 206 ASN B ND2 1 
ATOM   3130 N  N   . ARG B 1 215 ? 26.434  13.437  12.219 1.00 10.02 ? 207 ARG B N   1 
ATOM   3131 C  CA  . ARG B 1 215 ? 27.850  13.269  12.458 1.00 10.14 ? 207 ARG B CA  1 
ATOM   3132 C  C   . ARG B 1 215 ? 28.111  12.991  13.959 1.00 9.87  ? 207 ARG B C   1 
ATOM   3133 O  O   . ARG B 1 215 ? 28.728  13.792  14.647 1.00 9.58  ? 207 ARG B O   1 
ATOM   3134 C  CB  . ARG B 1 215 ? 28.624  14.503  11.931 1.00 10.56 ? 207 ARG B CB  1 
ATOM   3135 C  CG  . ARG B 1 215 ? 28.461  14.737  10.426 1.00 11.00 ? 207 ARG B CG  1 
ATOM   3136 C  CD  . ARG B 1 215 ? 29.135  16.029  9.968  1.00 11.40 ? 207 ARG B CD  1 
ATOM   3137 N  NE  . ARG B 1 215 ? 28.507  17.228  10.536 1.00 11.35 ? 207 ARG B NE  1 
ATOM   3138 C  CZ  . ARG B 1 215 ? 29.034  18.027  11.469 1.00 11.51 ? 207 ARG B CZ  1 
ATOM   3139 N  NH1 . ARG B 1 215 ? 30.248  17.818  12.016 1.00 11.30 ? 207 ARG B NH1 1 
ATOM   3140 N  NH2 . ARG B 1 215 ? 28.319  19.074  11.867 1.00 11.63 ? 207 ARG B NH2 1 
ATOM   3141 N  N   . ARG B 1 216 ? 27.680  11.825  14.433 1.00 9.78  ? 208 ARG B N   1 
ATOM   3142 C  CA  . ARG B 1 216 ? 27.935  11.412  15.810 1.00 9.69  ? 208 ARG B CA  1 
ATOM   3143 C  C   . ARG B 1 216 ? 29.414  11.393  16.133 1.00 9.48  ? 208 ARG B C   1 
ATOM   3144 O  O   . ARG B 1 216 ? 29.806  11.755  17.242 1.00 9.36  ? 208 ARG B O   1 
ATOM   3145 C  CB  . ARG B 1 216 ? 27.366  10.001  16.093 1.00 9.84  ? 208 ARG B CB  1 
ATOM   3146 C  CG  . ARG B 1 216 ? 27.429  9.627   17.575 1.00 9.77  ? 208 ARG B CG  1 
ATOM   3147 C  CD  . ARG B 1 216 ? 27.098  8.168   17.836 1.00 9.92  ? 208 ARG B CD  1 
ATOM   3148 N  NE  . ARG B 1 216 ? 25.678  7.878   17.752 1.00 10.13 ? 208 ARG B NE  1 
ATOM   3149 C  CZ  . ARG B 1 216 ? 25.128  6.720   18.109 1.00 10.30 ? 208 ARG B CZ  1 
ATOM   3150 N  NH1 . ARG B 1 216 ? 25.887  5.719   18.543 1.00 10.35 ? 208 ARG B NH1 1 
ATOM   3151 N  NH2 . ARG B 1 216 ? 23.807  6.550   18.001 1.00 10.31 ? 208 ARG B NH2 1 
ATOM   3152 N  N   . PRO B 1 217 ? 30.240  10.915  15.192 1.00 9.56  ? 209 PRO B N   1 
ATOM   3153 C  CA  . PRO B 1 217 ? 31.668  10.907  15.555 1.00 9.71  ? 209 PRO B CA  1 
ATOM   3154 C  C   . PRO B 1 217 ? 32.267  12.309  15.805 1.00 9.78  ? 209 PRO B C   1 
ATOM   3155 O  O   . PRO B 1 217 ? 33.101  12.443  16.704 1.00 9.87  ? 209 PRO B O   1 
ATOM   3156 C  CB  . PRO B 1 217 ? 32.336  10.200  14.371 1.00 9.72  ? 209 PRO B CB  1 
ATOM   3157 C  CG  . PRO B 1 217 ? 31.243  9.396   13.740 1.00 9.73  ? 209 PRO B CG  1 
ATOM   3158 C  CD  . PRO B 1 217 ? 29.999  10.241  13.906 1.00 9.62  ? 209 PRO B CD  1 
ATOM   3159 N  N   . ASP B 1 218 ? 31.813  13.339  15.094 1.00 9.89  ? 210 ASP B N   1 
ATOM   3160 C  CA  . ASP B 1 218 ? 32.315  14.705  15.344 1.00 9.98  ? 210 ASP B CA  1 
ATOM   3161 C  C   . ASP B 1 218 ? 31.824  15.222  16.716 1.00 9.78  ? 210 ASP B C   1 
ATOM   3162 O  O   . ASP B 1 218 ? 32.571  15.883  17.449 1.00 9.48  ? 210 ASP B O   1 
ATOM   3163 C  CB  . ASP B 1 218 ? 31.855  15.672  14.256 1.00 10.40 ? 210 ASP B CB  1 
ATOM   3164 C  CG  . ASP B 1 218 ? 32.539  15.429  12.932 1.00 10.90 ? 210 ASP B CG  1 
ATOM   3165 O  OD1 . ASP B 1 218 ? 33.674  14.961  12.924 1.00 11.09 ? 210 ASP B OD1 1 
ATOM   3166 O  OD2 . ASP B 1 218 ? 31.954  15.721  11.881 1.00 11.49 ? 210 ASP B OD2 1 
ATOM   3167 N  N   . TYR B 1 219 ? 30.562  14.930  17.033 1.00 9.71  ? 211 TYR B N   1 
ATOM   3168 C  CA  . TYR B 1 219 ? 29.974  15.213  18.352 1.00 9.67  ? 211 TYR B CA  1 
ATOM   3169 C  C   . TYR B 1 219 ? 30.797  14.592  19.453 1.00 9.80  ? 211 TYR B C   1 
ATOM   3170 O  O   . TYR B 1 219 ? 31.166  15.285  20.382 1.00 9.69  ? 211 TYR B O   1 
ATOM   3171 C  CB  . TYR B 1 219 ? 28.544  14.672  18.416 1.00 9.52  ? 211 TYR B CB  1 
ATOM   3172 C  CG  . TYR B 1 219 ? 27.937  14.445  19.804 1.00 9.27  ? 211 TYR B CG  1 
ATOM   3173 C  CD1 . TYR B 1 219 ? 27.645  15.508  20.646 1.00 9.35  ? 211 TYR B CD1 1 
ATOM   3174 C  CD2 . TYR B 1 219 ? 27.598  13.166  20.237 1.00 9.17  ? 211 TYR B CD2 1 
ATOM   3175 C  CE1 . TYR B 1 219 ? 27.073  15.297  21.908 1.00 9.22  ? 211 TYR B CE1 1 
ATOM   3176 C  CE2 . TYR B 1 219 ? 27.024  12.935  21.486 1.00 9.05  ? 211 TYR B CE2 1 
ATOM   3177 C  CZ  . TYR B 1 219 ? 26.753  14.013  22.324 1.00 9.05  ? 211 TYR B CZ  1 
ATOM   3178 O  OH  . TYR B 1 219 ? 26.168  13.841  23.552 1.00 8.54  ? 211 TYR B OH  1 
ATOM   3179 N  N   . LEU B 1 220 ? 31.110  13.285  19.344 1.00 10.15 ? 212 LEU B N   1 
ATOM   3180 C  CA  . LEU B 1 220 ? 31.925  12.622  20.359 1.00 10.30 ? 212 LEU B CA  1 
ATOM   3181 C  C   . LEU B 1 220 ? 33.322  13.237  20.550 1.00 10.77 ? 212 LEU B C   1 
ATOM   3182 O  O   . LEU B 1 220 ? 33.828  13.268  21.662 1.00 10.79 ? 212 LEU B O   1 
ATOM   3183 C  CB  . LEU B 1 220 ? 32.048  11.118  20.077 1.00 10.42 ? 212 LEU B CB  1 
ATOM   3184 C  CG  . LEU B 1 220 ? 30.698  10.415  20.254 1.00 10.30 ? 212 LEU B CG  1 
ATOM   3185 C  CD1 . LEU B 1 220 ? 30.749  9.038   19.654 1.00 10.48 ? 212 LEU B CD1 1 
ATOM   3186 C  CD2 . LEU B 1 220 ? 30.344  10.331  21.742 1.00 10.30 ? 212 LEU B CD2 1 
ATOM   3187 N  N   . LYS B 1 221 ? 33.943  13.696  19.465 1.00 11.27 ? 213 LYS B N   1 
ATOM   3188 C  CA  . LYS B 1 221 ? 35.254  14.294  19.549 1.00 11.84 ? 213 LYS B CA  1 
ATOM   3189 C  C   . LYS B 1 221 ? 35.192  15.675  20.139 1.00 12.07 ? 213 LYS B C   1 
ATOM   3190 O  O   . LYS B 1 221 ? 36.028  16.019  20.980 1.00 12.47 ? 213 LYS B O   1 
ATOM   3191 C  CB  . LYS B 1 221 ? 35.941  14.319  18.175 1.00 12.47 ? 213 LYS B CB  1 
ATOM   3192 C  CG  . LYS B 1 221 ? 36.433  12.917  17.872 1.00 12.75 ? 213 LYS B CG  1 
ATOM   3193 C  CD  . LYS B 1 221 ? 37.265  12.800  16.618 1.00 13.68 ? 213 LYS B CD  1 
ATOM   3194 C  CE  . LYS B 1 221 ? 37.984  11.447  16.576 1.00 14.04 ? 213 LYS B CE  1 
ATOM   3195 N  NZ  . LYS B 1 221 ? 38.907  11.326  15.421 1.00 14.66 ? 213 LYS B NZ  1 
ATOM   3196 N  N   . GLU B 1 222 ? 34.189  16.450  19.736 1.00 12.10 ? 214 GLU B N   1 
ATOM   3197 C  CA  . GLU B 1 222 ? 34.117  17.873  20.083 1.00 12.25 ? 214 GLU B CA  1 
ATOM   3198 C  C   . GLU B 1 222 ? 33.690  18.040  21.530 1.00 11.68 ? 214 GLU B C   1 
ATOM   3199 O  O   . GLU B 1 222 ? 34.174  18.948  22.195 1.00 11.68 ? 214 GLU B O   1 
ATOM   3200 C  CB  . GLU B 1 222 ? 33.172  18.632  19.164 1.00 12.86 ? 214 GLU B CB  1 
ATOM   3201 C  CG  . GLU B 1 222 ? 33.798  18.911  17.797 1.00 13.82 ? 214 GLU B CG  1 
ATOM   3202 C  CD  . GLU B 1 222 ? 32.931  19.766  16.889 1.00 14.80 ? 214 GLU B CD  1 
ATOM   3203 O  OE1 . GLU B 1 222 ? 32.146  20.615  17.362 1.00 15.91 ? 214 GLU B OE1 1 
ATOM   3204 O  OE2 . GLU B 1 222 ? 33.035  19.595  15.663 1.00 16.70 ? 214 GLU B OE2 1 
ATOM   3205 N  N   . ILE B 1 223 ? 32.861  17.119  22.037 1.00 11.00 ? 215 ILE B N   1 
ATOM   3206 C  CA  . ILE B 1 223 ? 32.336  17.229  23.416 1.00 10.67 ? 215 ILE B CA  1 
ATOM   3207 C  C   . ILE B 1 223 ? 33.412  17.236  24.517 1.00 10.72 ? 215 ILE B C   1 
ATOM   3208 O  O   . ILE B 1 223 ? 33.180  17.819  25.568 1.00 10.47 ? 215 ILE B O   1 
ATOM   3209 C  CB  . ILE B 1 223 ? 31.232  16.178  23.724 1.00 10.43 ? 215 ILE B CB  1 
ATOM   3210 C  CG1 . ILE B 1 223 ? 30.424  16.589  24.951 1.00 10.13 ? 215 ILE B CG1 1 
ATOM   3211 C  CG2 . ILE B 1 223 ? 31.813  14.787  23.882 1.00 10.40 ? 215 ILE B CG2 1 
ATOM   3212 C  CD1 . ILE B 1 223 ? 29.157  15.765  25.141 1.00 10.00 ? 215 ILE B CD1 1 
ATOM   3213 N  N   . TRP B 1 224 ? 34.592  16.651  24.239 1.00 10.59 ? 216 TRP B N   1 
ATOM   3214 C  CA  . TRP B 1 224 ? 35.717  16.683  25.150 1.00 10.53 ? 216 TRP B CA  1 
ATOM   3215 C  C   . TRP B 1 224 ? 36.040  18.106  25.604 1.00 10.75 ? 216 TRP B C   1 
ATOM   3216 O  O   . TRP B 1 224 ? 36.402  18.332  26.748 1.00 10.38 ? 216 TRP B O   1 
ATOM   3217 C  CB  . TRP B 1 224 ? 36.981  16.077  24.528 1.00 10.34 ? 216 TRP B CB  1 
ATOM   3218 C  CG  . TRP B 1 224 ? 36.914  14.630  24.222 1.00 10.22 ? 216 TRP B CG  1 
ATOM   3219 C  CD1 . TRP B 1 224 ? 37.220  14.032  23.022 1.00 10.22 ? 216 TRP B CD1 1 
ATOM   3220 C  CD2 . TRP B 1 224 ? 36.517  13.572  25.099 1.00 10.07 ? 216 TRP B CD2 1 
ATOM   3221 N  NE1 . TRP B 1 224 ? 37.046  12.696  23.108 1.00 10.14 ? 216 TRP B NE1 1 
ATOM   3222 C  CE2 . TRP B 1 224 ? 36.619  12.374  24.371 1.00 9.99  ? 216 TRP B CE2 1 
ATOM   3223 C  CE3 . TRP B 1 224 ? 36.091  13.518  26.432 1.00 9.97  ? 216 TRP B CE3 1 
ATOM   3224 C  CZ2 . TRP B 1 224 ? 36.303  11.144  24.921 1.00 9.85  ? 216 TRP B CZ2 1 
ATOM   3225 C  CZ3 . TRP B 1 224 ? 35.786  12.277  26.981 1.00 9.83  ? 216 TRP B CZ3 1 
ATOM   3226 C  CH2 . TRP B 1 224 ? 35.886  11.120  26.231 1.00 9.73  ? 216 TRP B CH2 1 
ATOM   3227 N  N   . SER B 1 225 ? 35.874  19.072  24.734 1.00 11.23 ? 217 SER B N   1 
ATOM   3228 C  CA  . SER B 1 225 ? 36.229  20.420  25.140 1.00 12.05 ? 217 SER B CA  1 
ATOM   3229 C  C   . SER B 1 225 ? 35.176  21.107  26.015 1.00 11.65 ? 217 SER B C   1 
ATOM   3230 O  O   . SER B 1 225 ? 35.440  22.179  26.522 1.00 12.00 ? 217 SER B O   1 
ATOM   3231 C  CB  . SER B 1 225 ? 36.595  21.276  23.926 1.00 12.85 ? 217 SER B CB  1 
ATOM   3232 O  OG  . SER B 1 225 ? 35.643  21.102  22.931 1.00 13.83 ? 217 SER B OG  1 
ATOM   3233 N  N   . VAL B 1 226 ? 34.014  20.491  26.248 1.00 10.91 ? 218 VAL B N   1 
ATOM   3234 C  CA  . VAL B 1 226 ? 33.106  21.021  27.264 1.00 10.66 ? 218 VAL B CA  1 
ATOM   3235 C  C   . VAL B 1 226 ? 32.870  20.088  28.456 1.00 10.27 ? 218 VAL B C   1 
ATOM   3236 O  O   . VAL B 1 226 ? 31.962  20.339  29.265 1.00 9.94  ? 218 VAL B O   1 
ATOM   3237 C  CB  . VAL B 1 226 ? 31.765  21.481  26.686 1.00 10.46 ? 218 VAL B CB  1 
ATOM   3238 C  CG1 . VAL B 1 226 ? 32.003  22.619  25.708 1.00 10.83 ? 218 VAL B CG1 1 
ATOM   3239 C  CG2 . VAL B 1 226 ? 31.009  20.330  26.043 1.00 10.35 ? 218 VAL B CG2 1 
ATOM   3240 N  N   . ILE B 1 227 ? 33.697  19.049  28.609 1.00 9.74  ? 219 ILE B N   1 
ATOM   3241 C  CA  . ILE B 1 227 ? 33.455  18.150  29.729 1.00 9.61  ? 219 ILE B CA  1 
ATOM   3242 C  C   . ILE B 1 227 ? 33.902  18.850  30.988 1.00 9.73  ? 219 ILE B C   1 
ATOM   3243 O  O   . ILE B 1 227 ? 34.969  19.464  31.024 1.00 9.77  ? 219 ILE B O   1 
ATOM   3244 C  CB  . ILE B 1 227 ? 34.175  16.782  29.620 1.00 9.39  ? 219 ILE B CB  1 
ATOM   3245 C  CG1 . ILE B 1 227 ? 33.679  15.966  28.426 1.00 9.16  ? 219 ILE B CG1 1 
ATOM   3246 C  CG2 . ILE B 1 227 ? 34.054  16.019  30.937 1.00 9.27  ? 219 ILE B CG2 1 
ATOM   3247 C  CD1 . ILE B 1 227 ? 32.238  15.515  28.489 1.00 9.04  ? 219 ILE B CD1 1 
ATOM   3248 N  N   . ASP B 1 228 ? 33.075  18.742  32.026 1.00 9.98  ? 220 ASP B N   1 
ATOM   3249 C  CA  . ASP B 1 228 ? 33.408  19.252  33.350 1.00 10.31 ? 220 ASP B CA  1 
ATOM   3250 C  C   . ASP B 1 228 ? 34.087  18.126  34.114 1.00 10.59 ? 220 ASP B C   1 
ATOM   3251 O  O   . ASP B 1 228 ? 33.460  17.331  34.823 1.00 10.19 ? 220 ASP B O   1 
ATOM   3252 C  CB  . ASP B 1 228 ? 32.156  19.736  34.053 1.00 10.41 ? 220 ASP B CB  1 
ATOM   3253 C  CG  . ASP B 1 228 ? 32.428  20.271  35.431 1.00 10.54 ? 220 ASP B CG  1 
ATOM   3254 O  OD1 . ASP B 1 228 ? 33.576  20.064  35.918 1.00 10.96 ? 220 ASP B OD1 1 
ATOM   3255 O  OD2 . ASP B 1 228 ? 31.477  20.842  36.044 1.00 10.16 ? 220 ASP B OD2 1 
ATOM   3256 N  N   . TRP B 1 229 ? 35.404  18.078  33.959 1.00 11.23 ? 221 TRP B N   1 
ATOM   3257 C  CA  . TRP B 1 229 ? 36.197  17.061  34.589 1.00 11.49 ? 221 TRP B CA  1 
ATOM   3258 C  C   . TRP B 1 229 ? 36.232  17.198  36.120 1.00 12.08 ? 221 TRP B C   1 
ATOM   3259 O  O   . TRP B 1 229 ? 36.578  16.229  36.819 1.00 11.93 ? 221 TRP B O   1 
ATOM   3260 C  CB  . TRP B 1 229 ? 37.609  17.038  34.011 1.00 11.58 ? 221 TRP B CB  1 
ATOM   3261 C  CG  . TRP B 1 229 ? 37.683  16.616  32.549 1.00 11.41 ? 221 TRP B CG  1 
ATOM   3262 C  CD1 . TRP B 1 229 ? 38.083  17.380  31.482 1.00 11.52 ? 221 TRP B CD1 1 
ATOM   3263 C  CD2 . TRP B 1 229 ? 37.375  15.322  32.018 1.00 11.12 ? 221 TRP B CD2 1 
ATOM   3264 N  NE1 . TRP B 1 229 ? 38.022  16.643  30.311 1.00 11.59 ? 221 TRP B NE1 1 
ATOM   3265 C  CE2 . TRP B 1 229 ? 37.604  15.372  30.613 1.00 11.13 ? 221 TRP B CE2 1 
ATOM   3266 C  CE3 . TRP B 1 229 ? 36.927  14.129  32.594 1.00 11.07 ? 221 TRP B CE3 1 
ATOM   3267 C  CZ2 . TRP B 1 229 ? 37.414  14.273  29.774 1.00 10.95 ? 221 TRP B CZ2 1 
ATOM   3268 C  CZ3 . TRP B 1 229 ? 36.726  13.032  31.772 1.00 11.11 ? 221 TRP B CZ3 1 
ATOM   3269 C  CH2 . TRP B 1 229 ? 36.981  13.112  30.353 1.00 11.12 ? 221 TRP B CH2 1 
ATOM   3270 N  N   . GLU B 1 230 ? 35.842  18.356  36.648 1.00 12.78 ? 222 GLU B N   1 
ATOM   3271 C  CA  . GLU B 1 230 ? 35.774  18.499  38.106 1.00 13.65 ? 222 GLU B CA  1 
ATOM   3272 C  C   . GLU B 1 230 ? 34.586  17.738  38.670 1.00 13.01 ? 222 GLU B C   1 
ATOM   3273 O  O   . GLU B 1 230 ? 34.708  17.067  39.687 1.00 12.91 ? 222 GLU B O   1 
ATOM   3274 C  CB  . GLU B 1 230 ? 35.765  19.968  38.523 1.00 15.01 ? 222 GLU B CB  1 
ATOM   3275 C  CG  . GLU B 1 230 ? 37.101  20.613  38.245 1.00 16.19 ? 222 GLU B CG  1 
ATOM   3276 C  CD  . GLU B 1 230 ? 37.121  22.107  38.468 1.00 18.14 ? 222 GLU B CD  1 
ATOM   3277 O  OE1 . GLU B 1 230 ? 36.147  22.676  39.013 1.00 19.29 ? 222 GLU B OE1 1 
ATOM   3278 O  OE2 . GLU B 1 230 ? 38.157  22.728  38.121 1.00 19.93 ? 222 GLU B OE2 1 
ATOM   3279 N  N   . PHE B 1 231 ? 33.441  17.831  38.002 1.00 12.39 ? 223 PHE B N   1 
ATOM   3280 C  CA  . PHE B 1 231 ? 32.299  17.001  38.357 1.00 11.76 ? 223 PHE B CA  1 
ATOM   3281 C  C   . PHE B 1 231 ? 32.625  15.524  38.191 1.00 11.65 ? 223 PHE B C   1 
ATOM   3282 O  O   . PHE B 1 231 ? 32.371  14.731  39.096 1.00 11.34 ? 223 PHE B O   1 
ATOM   3283 C  CB  . PHE B 1 231 ? 31.067  17.338  37.532 1.00 11.36 ? 223 PHE B CB  1 
ATOM   3284 C  CG  . PHE B 1 231 ? 29.894  16.435  37.813 1.00 11.16 ? 223 PHE B CG  1 
ATOM   3285 C  CD1 . PHE B 1 231 ? 29.151  16.586  38.973 1.00 11.29 ? 223 PHE B CD1 1 
ATOM   3286 C  CD2 . PHE B 1 231 ? 29.553  15.406  36.934 1.00 10.95 ? 223 PHE B CD2 1 
ATOM   3287 C  CE1 . PHE B 1 231 ? 28.091  15.732  39.255 1.00 11.06 ? 223 PHE B CE1 1 
ATOM   3288 C  CE2 . PHE B 1 231 ? 28.498  14.555  37.206 1.00 10.73 ? 223 PHE B CE2 1 
ATOM   3289 C  CZ  . PHE B 1 231 ? 27.750  14.731  38.365 1.00 10.79 ? 223 PHE B CZ  1 
ATOM   3290 N  N   . VAL B 1 232 ? 33.206  15.157  37.050 1.00 11.42 ? 224 VAL B N   1 
ATOM   3291 C  CA  . VAL B 1 232 ? 33.614  13.776  36.852 1.00 11.33 ? 224 VAL B CA  1 
ATOM   3292 C  C   . VAL B 1 232 ? 34.532  13.309  37.997 1.00 11.73 ? 224 VAL B C   1 
ATOM   3293 O  O   . VAL B 1 232 ? 34.307  12.235  38.574 1.00 11.95 ? 224 VAL B O   1 
ATOM   3294 C  CB  . VAL B 1 232 ? 34.315  13.569  35.497 1.00 11.25 ? 224 VAL B CB  1 
ATOM   3295 C  CG1 . VAL B 1 232 ? 34.818  12.135  35.361 1.00 11.14 ? 224 VAL B CG1 1 
ATOM   3296 C  CG2 . VAL B 1 232 ? 33.386  13.927  34.337 1.00 11.08 ? 224 VAL B CG2 1 
ATOM   3297 N  N   . ALA B 1 233 ? 35.549  14.110  38.339 1.00 11.87 ? 225 ALA B N   1 
ATOM   3298 C  CA  . ALA B 1 233 ? 36.484  13.751  39.401 1.00 12.32 ? 225 ALA B CA  1 
ATOM   3299 C  C   . ALA B 1 233 ? 35.791  13.570  40.759 1.00 12.68 ? 225 ALA B C   1 
ATOM   3300 O  O   . ALA B 1 233 ? 36.116  12.621  41.479 1.00 13.22 ? 225 ALA B O   1 
ATOM   3301 C  CB  . ALA B 1 233 ? 37.629  14.762  39.506 1.00 12.44 ? 225 ALA B CB  1 
ATOM   3302 N  N   . LYS B 1 234 ? 34.873  14.473  41.119 1.00 12.83 ? 226 LYS B N   1 
ATOM   3303 C  CA  . LYS B 1 234 ? 34.092  14.348  42.352 1.00 12.99 ? 226 LYS B CA  1 
ATOM   3304 C  C   . LYS B 1 234 ? 33.308  13.040  42.362 1.00 12.99 ? 226 LYS B C   1 
ATOM   3305 O  O   . LYS B 1 234 ? 33.272  12.355  43.379 1.00 13.31 ? 226 LYS B O   1 
ATOM   3306 C  CB  . LYS B 1 234 ? 33.122  15.533  42.561 1.00 13.26 ? 226 LYS B CB  1 
ATOM   3307 N  N   . MET B 1 235 ? 32.664  12.695  41.245 1.00 12.51 ? 227 MET B N   1 
ATOM   3308 C  CA  . MET B 1 235 ? 31.931  11.440  41.148 1.00 12.53 ? 227 MET B CA  1 
ATOM   3309 C  C   . MET B 1 235 ? 32.911  10.269  41.325 1.00 12.93 ? 227 MET B C   1 
ATOM   3310 O  O   . MET B 1 235 ? 32.585  9.282   41.992 1.00 13.61 ? 227 MET B O   1 
ATOM   3311 C  CB  . MET B 1 235 ? 31.200  11.314  39.803 1.00 12.36 ? 227 MET B CB  1 
ATOM   3312 C  CG  . MET B 1 235 ? 30.003  12.245  39.621 1.00 12.45 ? 227 MET B CG  1 
ATOM   3313 S  SD  . MET B 1 235 ? 28.717  12.155  40.916 1.00 13.10 ? 227 MET B SD  1 
ATOM   3314 C  CE  . MET B 1 235 ? 29.257  13.447  42.034 1.00 13.09 ? 227 MET B CE  1 
ATOM   3315 N  N   . HIS B 1 236 ? 34.114  10.406  40.788 1.00 12.98 ? 228 HIS B N   1 
ATOM   3316 C  CA  . HIS B 1 236 ? 35.122  9.371   40.933 1.00 13.62 ? 228 HIS B CA  1 
ATOM   3317 C  C   . HIS B 1 236 ? 35.542  9.239   42.393 1.00 13.78 ? 228 HIS B C   1 
ATOM   3318 O  O   . HIS B 1 236 ? 35.602  8.126   42.902 1.00 12.89 ? 228 HIS B O   1 
ATOM   3319 C  CB  . HIS B 1 236 ? 36.360  9.645   40.074 1.00 14.03 ? 228 HIS B CB  1 
ATOM   3320 C  CG  . HIS B 1 236 ? 37.435  8.606   40.219 1.00 14.59 ? 228 HIS B CG  1 
ATOM   3321 N  ND1 . HIS B 1 236 ? 38.571  8.792   40.978 1.00 15.40 ? 228 HIS B ND1 1 
ATOM   3322 C  CD2 . HIS B 1 236 ? 37.514  7.342   39.742 1.00 14.79 ? 228 HIS B CD2 1 
ATOM   3323 C  CE1 . HIS B 1 236 ? 39.306  7.690   40.952 1.00 15.33 ? 228 HIS B CE1 1 
ATOM   3324 N  NE2 . HIS B 1 236 ? 38.693  6.801   40.197 1.00 14.95 ? 228 HIS B NE2 1 
ATOM   3325 N  N   . ALA B 1 237 ? 35.825  10.377  43.034 1.00 13.80 ? 229 ALA B N   1 
ATOM   3326 C  CA  . ALA B 1 237 ? 36.289  10.408  44.453 1.00 14.10 ? 229 ALA B CA  1 
ATOM   3327 C  C   . ALA B 1 237 ? 35.270  9.750   45.366 1.00 14.05 ? 229 ALA B C   1 
ATOM   3328 O  O   . ALA B 1 237 ? 35.619  8.925   46.200 1.00 14.15 ? 229 ALA B O   1 
ATOM   3329 C  CB  . ALA B 1 237 ? 36.585  11.851  44.918 1.00 13.94 ? 229 ALA B CB  1 
ATOM   3330 N  N   . GLN B 1 238 ? 34.000  10.086  45.170 1.00 13.96 ? 230 GLN B N   1 
ATOM   3331 C  CA  . GLN B 1 238 ? 32.931  9.484   45.974 1.00 14.04 ? 230 GLN B CA  1 
ATOM   3332 C  C   . GLN B 1 238 ? 32.754  7.980   45.664 1.00 13.76 ? 230 GLN B C   1 
ATOM   3333 O  O   . GLN B 1 238 ? 32.542  7.181   46.544 1.00 14.01 ? 230 GLN B O   1 
ATOM   3334 C  CB  . GLN B 1 238 ? 31.603  10.275  45.786 1.00 13.72 ? 230 GLN B CB  1 
ATOM   3335 N  N   . ALA B 1 239 ? 32.881  7.600   44.410 1.00 13.85 ? 231 ALA B N   1 
ATOM   3336 C  CA  . ALA B 1 239 ? 32.680  6.200   44.012 1.00 13.95 ? 231 ALA B CA  1 
ATOM   3337 C  C   . ALA B 1 239 ? 33.739  5.211   44.557 1.00 14.89 ? 231 ALA B C   1 
ATOM   3338 O  O   . ALA B 1 239 ? 33.436  4.040   44.744 1.00 14.28 ? 231 ALA B O   1 
ATOM   3339 C  CB  . ALA B 1 239 ? 32.612  6.101   42.502 1.00 13.35 ? 231 ALA B CB  1 
ATOM   3340 N  N   . ILE B 1 240 ? 34.961  5.695   44.780 1.00 16.14 ? 232 ILE B N   1 
ATOM   3341 C  CA  . ILE B 1 240 ? 36.033  4.879   45.320 1.00 18.03 ? 232 ILE B CA  1 
ATOM   3342 C  C   . ILE B 1 240 ? 36.171  4.952   46.868 1.00 19.08 ? 232 ILE B C   1 
ATOM   3343 O  O   . ILE B 1 240 ? 36.909  4.163   47.422 1.00 20.94 ? 232 ILE B O   1 
ATOM   3344 C  CB  . ILE B 1 240 ? 37.394  5.231   44.686 1.00 17.84 ? 232 ILE B CB  1 
ATOM   3345 C  CG1 . ILE B 1 240 ? 37.881  6.620   45.121 1.00 18.16 ? 232 ILE B CG1 1 
ATOM   3346 C  CG2 . ILE B 1 240 ? 37.308  5.152   43.174 1.00 17.82 ? 232 ILE B CG2 1 
ATOM   3347 C  CD1 . ILE B 1 240 ? 39.310  6.901   44.695 1.00 18.46 ? 232 ILE B CD1 1 
ATOM   3348 N  N   . LYS B 1 241 ? 35.500  5.892   47.529 1.00 20.26 ? 233 LYS B N   1 
ATOM   3349 C  CA  . LYS B 1 241 ? 35.625  6.083   48.974 1.00 22.05 ? 233 LYS B CA  1 
ATOM   3350 C  C   . LYS B 1 241 ? 35.225  4.811   49.713 1.00 22.79 ? 233 LYS B C   1 
ATOM   3351 O  O   . LYS B 1 241 ? 35.788  4.511   50.753 1.00 25.91 ? 233 LYS B O   1 
ATOM   3352 C  CB  . LYS B 1 241 ? 34.779  7.264   49.480 1.00 21.33 ? 233 LYS B CB  1 
ATOM   3353 O  OXT . LYS B 1 241 ? 34.388  4.018   49.302 1.00 23.65 ? 233 LYS B OXT 1 
HETATM 3354 FE FE  . FE2 C 2 .   ? 16.180  6.053   9.277  1.00 10.98 ? 301 FE2 A FE  1 
HETATM 3355 FE FE  . FE2 D 2 .   ? 19.075  12.725  25.768 1.00 9.77  ? 301 FE2 B FE  1 
HETATM 3356 O  O   . HOH E 3 .   ? 15.037  -8.322  -0.052 1.00 6.75  ? 401 HOH A O   1 
HETATM 3357 O  O   . HOH E 3 .   ? 16.237  4.467   10.975 1.00 11.70 ? 402 HOH A O   1 
HETATM 3358 O  O   . HOH E 3 .   ? 18.041  12.185  8.372  1.00 5.91  ? 403 HOH A O   1 
HETATM 3359 O  O   . HOH E 3 .   ? 28.185  -10.875 0.069  1.00 15.92 ? 404 HOH A O   1 
HETATM 3360 O  O   . HOH E 3 .   ? 2.065   7.988   11.207 1.00 6.32  ? 405 HOH A O   1 
HETATM 3361 O  O   . HOH E 3 .   ? 12.530  10.688  7.100  1.00 20.15 ? 406 HOH A O   1 
HETATM 3362 O  O   . HOH E 3 .   ? 19.760  -3.715  18.767 1.00 9.77  ? 407 HOH A O   1 
HETATM 3363 O  O   . HOH E 3 .   ? 5.397   -7.861  2.745  1.00 13.46 ? 408 HOH A O   1 
HETATM 3364 O  O   . HOH E 3 .   ? 15.994  -3.021  21.610 1.00 11.12 ? 409 HOH A O   1 
HETATM 3365 O  O   . HOH E 3 .   ? 18.636  -4.126  15.913 1.00 15.73 ? 410 HOH A O   1 
HETATM 3366 O  O   . HOH E 3 .   ? 19.132  -4.743  -5.534 1.00 12.27 ? 411 HOH A O   1 
HETATM 3367 O  O   . HOH E 3 .   ? 26.981  -17.045 19.016 1.00 8.63  ? 412 HOH A O   1 
HETATM 3368 O  O   . HOH E 3 .   ? -3.562  9.152   17.688 1.00 14.05 ? 413 HOH A O   1 
HETATM 3369 O  O   . HOH E 3 .   ? 11.478  7.667   22.731 1.00 7.16  ? 414 HOH A O   1 
HETATM 3370 O  O   . HOH E 3 .   ? 7.175   10.354  20.958 1.00 9.61  ? 415 HOH A O   1 
HETATM 3371 O  O   . HOH E 3 .   ? -9.102  -0.864  -5.389 1.00 20.59 ? 416 HOH A O   1 
HETATM 3372 O  O   . HOH E 3 .   ? 12.489  12.732  19.533 1.00 7.91  ? 417 HOH A O   1 
HETATM 3373 O  O   . HOH E 3 .   ? 20.144  -18.784 17.413 1.00 13.73 ? 418 HOH A O   1 
HETATM 3374 O  O   . HOH E 3 .   ? 7.901   -5.909  -4.204 1.00 14.61 ? 419 HOH A O   1 
HETATM 3375 O  O   . HOH E 3 .   ? 8.008   24.531  17.315 1.00 29.21 ? 420 HOH A O   1 
HETATM 3376 O  O   . HOH E 3 .   ? 24.406  -16.891 18.233 1.00 7.86  ? 421 HOH A O   1 
HETATM 3377 O  O   . HOH E 3 .   ? -3.954  -9.185  -6.523 1.00 28.82 ? 422 HOH A O   1 
HETATM 3378 O  O   . HOH E 3 .   ? -1.994  2.143   19.315 1.00 14.07 ? 423 HOH A O   1 
HETATM 3379 O  O   . HOH E 3 .   ? 25.632  17.502  1.632  1.00 27.92 ? 424 HOH A O   1 
HETATM 3380 O  O   . HOH E 3 .   ? 10.729  13.389  21.469 1.00 11.51 ? 425 HOH A O   1 
HETATM 3381 O  O   . HOH E 3 .   ? 13.979  -8.487  13.760 1.00 9.49  ? 426 HOH A O   1 
HETATM 3382 O  O   . HOH E 3 .   ? 0.836   8.593   23.908 1.00 11.87 ? 427 HOH A O   1 
HETATM 3383 O  O   . HOH E 3 .   ? 19.547  21.951  11.869 1.00 13.92 ? 428 HOH A O   1 
HETATM 3384 O  O   . HOH E 3 .   ? 4.557   -4.148  18.707 1.00 14.72 ? 429 HOH A O   1 
HETATM 3385 O  O   . HOH E 3 .   ? 30.802  -7.174  -0.444 1.00 12.40 ? 430 HOH A O   1 
HETATM 3386 O  O   . HOH E 3 .   ? -3.130  10.968  12.599 1.00 8.39  ? 431 HOH A O   1 
HETATM 3387 O  O   . HOH E 3 .   ? -12.001 7.216   8.650  1.00 8.34  ? 432 HOH A O   1 
HETATM 3388 O  O   . HOH E 3 .   ? -3.002  -3.849  15.533 1.00 18.31 ? 433 HOH A O   1 
HETATM 3389 O  O   . HOH E 3 .   ? -9.991  6.994   15.985 1.00 9.06  ? 434 HOH A O   1 
HETATM 3390 O  O   . HOH E 3 .   ? 9.069   16.074  23.367 1.00 10.75 ? 435 HOH A O   1 
HETATM 3391 O  O   . HOH E 3 .   ? 28.770  3.539   6.572  1.00 16.68 ? 436 HOH A O   1 
HETATM 3392 O  O   . HOH E 3 .   ? 16.461  22.054  3.092  1.00 12.68 ? 437 HOH A O   1 
HETATM 3393 O  O   . HOH E 3 .   ? 22.294  -11.129 14.507 1.00 12.59 ? 438 HOH A O   1 
HETATM 3394 O  O   . HOH E 3 .   ? 26.808  0.792   -2.773 1.00 15.64 ? 439 HOH A O   1 
HETATM 3395 O  O   . HOH E 3 .   ? 26.796  10.968  1.068  1.00 12.73 ? 440 HOH A O   1 
HETATM 3396 O  O   . HOH E 3 .   ? 6.986   15.075  21.839 1.00 13.18 ? 441 HOH A O   1 
HETATM 3397 O  O   . HOH E 3 .   ? -13.781 6.891   12.625 1.00 4.92  ? 442 HOH A O   1 
HETATM 3398 O  O   . HOH E 3 .   ? 9.771   -8.673  4.539  1.00 21.04 ? 443 HOH A O   1 
HETATM 3399 O  O   . HOH E 3 .   ? 10.222  -1.081  19.821 1.00 15.76 ? 444 HOH A O   1 
HETATM 3400 O  O   . HOH E 3 .   ? 3.077   5.152   26.983 1.00 24.55 ? 445 HOH A O   1 
HETATM 3401 O  O   . HOH E 3 .   ? 10.138  -7.547  7.111  1.00 22.62 ? 446 HOH A O   1 
HETATM 3402 O  O   . HOH E 3 .   ? 5.689   -14.300 5.733  1.00 24.00 ? 447 HOH A O   1 
HETATM 3403 O  O   . HOH E 3 .   ? 5.334   17.116  20.956 1.00 20.30 ? 448 HOH A O   1 
HETATM 3404 O  O   . HOH E 3 .   ? 7.864   -12.535 5.455  1.00 28.29 ? 449 HOH A O   1 
HETATM 3405 O  O   . HOH E 3 .   ? 9.569   -14.236 7.336  1.00 20.87 ? 450 HOH A O   1 
HETATM 3406 O  O   . HOH E 3 .   ? 10.912  -12.005 3.350  1.00 25.25 ? 451 HOH A O   1 
HETATM 3407 O  O   . HOH E 3 .   ? 8.794   17.272  -3.006 1.00 21.11 ? 452 HOH A O   1 
HETATM 3408 O  O   . HOH E 3 .   ? 10.569  15.236  -4.503 1.00 21.13 ? 453 HOH A O   1 
HETATM 3409 O  O   . HOH E 3 .   ? 16.211  22.288  5.968  1.00 31.47 ? 454 HOH A O   1 
HETATM 3410 O  O   . HOH E 3 .   ? 24.508  14.615  0.007  1.00 9.06  ? 455 HOH A O   1 
HETATM 3411 O  O   . HOH E 3 .   ? 25.024  13.948  -2.483 1.00 16.33 ? 456 HOH A O   1 
HETATM 3412 O  O   . HOH E 3 .   ? 26.876  7.713   4.418  1.00 14.52 ? 457 HOH A O   1 
HETATM 3413 O  O   . HOH E 3 .   ? 28.762  5.623   4.305  1.00 16.68 ? 458 HOH A O   1 
HETATM 3414 O  O   . HOH E 3 .   ? 21.712  5.964   11.439 1.00 20.54 ? 459 HOH A O   1 
HETATM 3415 O  O   . HOH E 3 .   ? 23.347  5.039   9.247  1.00 13.96 ? 460 HOH A O   1 
HETATM 3416 O  O   . HOH E 3 .   ? 22.595  3.462   12.800 1.00 16.45 ? 461 HOH A O   1 
HETATM 3417 O  O   . HOH E 3 .   ? 26.123  3.140   -1.056 1.00 32.35 ? 462 HOH A O   1 
HETATM 3418 O  O   . HOH E 3 .   ? 4.332   11.959  -6.020 1.00 13.84 ? 463 HOH A O   1 
HETATM 3419 O  O   . HOH E 3 .   ? 7.329   8.461   -5.572 1.00 22.81 ? 464 HOH A O   1 
HETATM 3420 O  O   . HOH E 3 .   ? 8.029   6.899   -3.881 1.00 14.89 ? 465 HOH A O   1 
HETATM 3421 O  O   . HOH E 3 .   ? 6.362   4.543   -3.663 1.00 14.43 ? 466 HOH A O   1 
HETATM 3422 O  O   . HOH E 3 .   ? -4.471  5.789   -5.805 1.00 19.50 ? 467 HOH A O   1 
HETATM 3423 O  O   . HOH E 3 .   ? -6.338  8.383   0.964  1.00 21.67 ? 468 HOH A O   1 
HETATM 3424 O  O   . HOH E 3 .   ? 8.865   6.982   22.945 1.00 11.33 ? 469 HOH A O   1 
HETATM 3425 O  O   . HOH E 3 .   ? 9.969   10.688  20.840 1.00 17.34 ? 470 HOH A O   1 
HETATM 3426 O  O   . HOH E 3 .   ? 12.517  9.614   21.176 1.00 19.73 ? 471 HOH A O   1 
HETATM 3427 O  O   . HOH E 3 .   ? 6.454   12.434  22.266 1.00 13.39 ? 472 HOH A O   1 
HETATM 3428 O  O   . HOH E 3 .   ? 4.291   16.857  18.650 1.00 20.98 ? 473 HOH A O   1 
HETATM 3429 O  O   . HOH E 3 .   ? 9.789   22.084  17.604 1.00 11.27 ? 474 HOH A O   1 
HETATM 3430 O  O   . HOH E 3 .   ? 10.708  21.783  14.430 1.00 18.34 ? 475 HOH A O   1 
HETATM 3431 O  O   . HOH E 3 .   ? 12.815  22.168  12.556 1.00 24.76 ? 476 HOH A O   1 
HETATM 3432 O  O   . HOH E 3 .   ? 4.836   20.419  12.401 1.00 20.66 ? 477 HOH A O   1 
HETATM 3433 O  O   . HOH E 3 .   ? -1.206  9.994   1.354  1.00 8.27  ? 478 HOH A O   1 
HETATM 3434 O  O   . HOH E 3 .   ? -3.396  9.439   4.186  1.00 20.08 ? 479 HOH A O   1 
HETATM 3435 O  O   . HOH E 3 .   ? 0.805   17.798  5.831  1.00 26.24 ? 480 HOH A O   1 
HETATM 3436 O  O   . HOH E 3 .   ? -1.320  14.085  7.114  1.00 28.75 ? 481 HOH A O   1 
HETATM 3437 O  O   . HOH E 3 .   ? -3.090  13.234  11.200 1.00 21.14 ? 482 HOH A O   1 
HETATM 3438 O  O   . HOH E 3 .   ? -4.696  11.801  7.390  1.00 27.52 ? 483 HOH A O   1 
HETATM 3439 O  O   . HOH E 3 .   ? -1.751  -0.030  -5.829 1.00 31.87 ? 484 HOH A O   1 
HETATM 3440 O  O   . HOH E 3 .   ? 14.221  1.073   20.795 1.00 8.53  ? 485 HOH A O   1 
HETATM 3441 O  O   . HOH E 3 .   ? 11.113  0.227   21.935 1.00 20.37 ? 486 HOH A O   1 
HETATM 3442 O  O   . HOH E 3 .   ? 8.416   0.977   23.379 1.00 14.45 ? 487 HOH A O   1 
HETATM 3443 O  O   . HOH E 3 .   ? 6.205   -10.684 -3.069 1.00 34.99 ? 488 HOH A O   1 
HETATM 3444 O  O   . HOH E 3 .   ? 14.638  -12.211 -5.606 1.00 15.97 ? 489 HOH A O   1 
HETATM 3445 O  O   . HOH E 3 .   ? 20.559  -3.830  -2.458 1.00 12.62 ? 490 HOH A O   1 
HETATM 3446 O  O   . HOH E 3 .   ? 30.696  -9.678  -4.244 1.00 36.07 ? 491 HOH A O   1 
HETATM 3447 O  O   . HOH E 3 .   ? 18.679  -1.565  -5.586 1.00 19.26 ? 492 HOH A O   1 
HETATM 3448 O  O   . HOH E 3 .   ? 17.304  8.526   -5.869 1.00 19.74 ? 493 HOH A O   1 
HETATM 3449 O  O   . HOH E 3 .   ? 10.290  14.210  -7.516 1.00 21.69 ? 494 HOH A O   1 
HETATM 3450 O  O   . HOH E 3 .   ? 19.262  19.323  0.832  1.00 16.91 ? 495 HOH A O   1 
HETATM 3451 O  O   . HOH E 3 .   ? 23.149  20.323  1.214  1.00 17.42 ? 496 HOH A O   1 
HETATM 3452 O  O   . HOH E 3 .   ? 18.771  22.018  1.547  1.00 18.72 ? 497 HOH A O   1 
HETATM 3453 O  O   . HOH E 3 .   ? 21.808  22.127  2.568  1.00 24.47 ? 498 HOH A O   1 
HETATM 3454 O  O   . HOH E 3 .   ? 22.079  22.404  5.353  1.00 26.43 ? 499 HOH A O   1 
HETATM 3455 O  O   . HOH E 3 .   ? 16.965  19.805  14.044 1.00 10.98 ? 500 HOH A O   1 
HETATM 3456 O  O   . HOH E 3 .   ? 28.581  0.550   -0.805 1.00 14.33 ? 501 HOH A O   1 
HETATM 3457 O  O   . HOH E 3 .   ? 17.969  -16.900 4.516  1.00 19.22 ? 502 HOH A O   1 
HETATM 3458 O  O   . HOH E 3 .   ? 15.560  -17.432 3.649  1.00 24.17 ? 503 HOH A O   1 
HETATM 3459 O  O   . HOH E 3 .   ? 19.866  -16.454 12.389 1.00 29.16 ? 504 HOH A O   1 
HETATM 3460 O  O   . HOH E 3 .   ? 17.843  -18.952 16.604 1.00 20.03 ? 505 HOH A O   1 
HETATM 3461 O  O   . HOH E 3 .   ? 19.976  -17.345 19.787 1.00 14.43 ? 506 HOH A O   1 
HETATM 3462 O  O   . HOH E 3 .   ? 22.602  -16.323 20.188 1.00 12.25 ? 507 HOH A O   1 
HETATM 3463 O  O   . HOH E 3 .   ? 21.078  -13.951 18.968 1.00 26.21 ? 508 HOH A O   1 
HETATM 3464 O  O   . HOH E 3 .   ? 18.289  -15.355 19.406 1.00 19.55 ? 509 HOH A O   1 
HETATM 3465 O  O   . HOH E 3 .   ? 21.947  -12.052 17.475 1.00 27.89 ? 510 HOH A O   1 
HETATM 3466 O  O   . HOH E 3 .   ? 22.178  -10.489 19.077 1.00 24.25 ? 511 HOH A O   1 
HETATM 3467 O  O   . HOH E 3 .   ? 28.848  -8.812  11.761 1.00 6.31  ? 512 HOH A O   1 
HETATM 3468 O  O   . HOH E 3 .   ? 32.155  -13.585 15.230 1.00 19.40 ? 513 HOH A O   1 
HETATM 3469 O  O   . HOH E 3 .   ? 32.945  -15.550 18.734 1.00 25.28 ? 514 HOH A O   1 
HETATM 3470 O  O   . HOH E 3 .   ? 18.637  -9.998  15.001 1.00 20.11 ? 515 HOH A O   1 
HETATM 3471 O  O   . HOH E 3 .   ? 16.014  -9.804  15.056 1.00 23.29 ? 516 HOH A O   1 
HETATM 3472 O  O   . HOH E 3 .   ? 12.291  -12.032 15.410 1.00 27.94 ? 517 HOH A O   1 
HETATM 3473 O  O   . HOH E 3 .   ? 12.175  -7.688  16.031 1.00 15.91 ? 518 HOH A O   1 
HETATM 3474 O  O   . HOH E 3 .   ? 12.330  -5.417  17.807 1.00 3.09  ? 519 HOH A O   1 
HETATM 3475 O  O   . HOH E 3 .   ? 15.184  -5.437  17.626 1.00 9.93  ? 520 HOH A O   1 
HETATM 3476 O  O   . HOH E 3 .   ? 17.045  -6.175  16.410 1.00 18.57 ? 521 HOH A O   1 
HETATM 3477 O  O   . HOH E 3 .   ? 25.883  -2.571  14.291 1.00 12.49 ? 522 HOH A O   1 
HETATM 3478 O  O   . HOH E 3 .   ? 27.937  -2.898  12.637 1.00 21.75 ? 523 HOH A O   1 
HETATM 3479 O  O   . HOH E 3 .   ? 13.454  2.867   -1.581 1.00 19.97 ? 524 HOH A O   1 
HETATM 3480 O  O   . HOH E 3 .   ? 2.667   15.470  -6.959 1.00 22.09 ? 525 HOH A O   1 
HETATM 3481 O  O   . HOH E 3 .   ? -3.387  10.765  -0.142 1.00 24.22 ? 526 HOH A O   1 
HETATM 3482 O  O   . HOH E 3 .   ? -15.793 1.769   13.370 1.00 13.40 ? 527 HOH A O   1 
HETATM 3483 O  O   . HOH E 3 .   ? -13.823 8.747   10.669 1.00 14.01 ? 528 HOH A O   1 
HETATM 3484 O  O   . HOH E 3 .   ? -16.146 5.991   12.085 1.00 15.20 ? 529 HOH A O   1 
HETATM 3485 O  O   . HOH E 3 .   ? -12.418 8.047   14.650 1.00 11.08 ? 530 HOH A O   1 
HETATM 3486 O  O   . HOH E 3 .   ? -1.926  -19.314 14.122 1.00 25.78 ? 531 HOH A O   1 
HETATM 3487 O  O   . HOH E 3 .   ? -3.441  -18.275 9.895  1.00 16.73 ? 532 HOH A O   1 
HETATM 3488 O  O   . HOH E 3 .   ? -4.453  -1.553  16.560 1.00 17.63 ? 533 HOH A O   1 
HETATM 3489 O  O   . HOH E 3 .   ? 9.843   21.993  19.929 1.00 13.25 ? 534 HOH A O   1 
HETATM 3490 O  O   . HOH E 3 .   ? 7.867   21.028  21.606 1.00 18.71 ? 535 HOH A O   1 
HETATM 3491 O  O   . HOH E 3 .   ? 1.081   -14.170 -0.573 1.00 17.36 ? 536 HOH A O   1 
HETATM 3492 O  O   . HOH E 3 .   ? -2.356  -16.979 5.760  1.00 44.54 ? 537 HOH A O   1 
HETATM 3493 O  O   . HOH E 3 .   ? 12.875  25.372  15.466 1.00 21.33 ? 538 HOH A O   1 
HETATM 3494 O  O   . HOH E 3 .   ? -4.650  -3.951  -1.765 1.00 25.26 ? 539 HOH A O   1 
HETATM 3495 O  O   . HOH E 3 .   ? -4.237  -10.154 -3.510 1.00 19.13 ? 540 HOH A O   1 
HETATM 3496 O  O   . HOH E 3 .   ? 5.513   -7.923  -2.150 1.00 16.75 ? 541 HOH A O   1 
HETATM 3497 O  O   . HOH E 3 .   ? 24.761  3.314   -4.748 1.00 25.32 ? 542 HOH A O   1 
HETATM 3498 O  O   . HOH E 3 .   ? 25.960  5.029   -3.075 1.00 27.45 ? 543 HOH A O   1 
HETATM 3499 O  O   . HOH E 3 .   ? 23.771  -17.123 10.379 1.00 20.37 ? 544 HOH A O   1 
HETATM 3500 O  O   . HOH E 3 .   ? -3.760  9.922   -5.255 1.00 26.63 ? 545 HOH A O   1 
HETATM 3501 O  O   . HOH E 3 .   ? -9.390  1.797   -6.376 1.00 23.43 ? 546 HOH A O   1 
HETATM 3502 O  O   . HOH E 3 .   ? -8.377  -6.575  6.750  1.00 17.94 ? 547 HOH A O   1 
HETATM 3503 O  O   . HOH E 3 .   ? -3.695  10.900  15.111 1.00 21.40 ? 548 HOH A O   1 
HETATM 3504 O  O   . HOH E 3 .   ? -4.943  -5.507  14.009 1.00 17.86 ? 549 HOH A O   1 
HETATM 3505 O  O   . HOH E 3 .   ? 7.207   20.909  11.345 1.00 18.59 ? 550 HOH A O   1 
HETATM 3506 O  O   . HOH E 3 .   ? 7.160   20.048  7.909  1.00 32.71 ? 551 HOH A O   1 
HETATM 3507 O  O   . HOH E 3 .   ? 3.181   18.664  6.563  1.00 23.98 ? 552 HOH A O   1 
HETATM 3508 O  O   . HOH E 3 .   ? 1.290   16.544  17.700 1.00 23.43 ? 553 HOH A O   1 
HETATM 3509 O  O   . HOH E 3 .   ? -3.453  13.826  5.735  1.00 29.91 ? 554 HOH A O   1 
HETATM 3510 O  O   . HOH E 3 .   ? 22.935  -4.489  18.089 1.00 24.65 ? 555 HOH A O   1 
HETATM 3511 O  O   . HOH E 3 .   ? 25.299  -3.902  18.773 1.00 29.27 ? 556 HOH A O   1 
HETATM 3512 O  O   . HOH E 3 .   ? 28.767  -8.319  14.380 1.00 30.73 ? 557 HOH A O   1 
HETATM 3513 O  O   . HOH E 3 .   ? 26.495  -10.254 19.076 1.00 32.25 ? 558 HOH A O   1 
HETATM 3514 O  O   . HOH E 3 .   ? -6.235  7.971   3.770  1.00 21.56 ? 559 HOH A O   1 
HETATM 3515 O  O   . HOH E 3 .   ? 2.043   -6.733  16.217 1.00 23.46 ? 560 HOH A O   1 
HETATM 3516 O  O   . HOH E 3 .   ? 5.011   -13.538 14.895 1.00 30.38 ? 561 HOH A O   1 
HETATM 3517 O  O   . HOH E 3 .   ? 3.371   3.688   -6.553 1.00 22.07 ? 562 HOH A O   1 
HETATM 3518 O  O   . HOH E 3 .   ? 25.902  16.674  4.904  1.00 13.70 ? 563 HOH A O   1 
HETATM 3519 O  O   . HOH E 3 .   ? 27.469  15.962  1.084  1.00 21.00 ? 564 HOH A O   1 
HETATM 3520 O  O   . HOH E 3 .   ? 18.679  19.735  -2.031 1.00 29.15 ? 565 HOH A O   1 
HETATM 3521 O  O   . HOH E 3 .   ? 17.280  -17.723 13.150 1.00 16.51 ? 566 HOH A O   1 
HETATM 3522 O  O   . HOH E 3 .   ? 21.522  -18.120 14.033 1.00 23.73 ? 567 HOH A O   1 
HETATM 3523 O  O   . HOH E 3 .   ? -1.679  15.021  0.882  1.00 21.99 ? 568 HOH A O   1 
HETATM 3524 O  O   . HOH F 3 .   ? 17.292  2.838   20.372 1.00 4.80  ? 401 HOH B O   1 
HETATM 3525 O  O   . HOH F 3 .   ? 18.698  10.459  25.740 1.00 3.32  ? 402 HOH B O   1 
HETATM 3526 O  O   . HOH F 3 .   ? 5.765   8.699   43.880 1.00 8.60  ? 403 HOH B O   1 
HETATM 3527 O  O   . HOH F 3 .   ? 17.881  8.383   19.372 1.00 2.00  ? 404 HOH B O   1 
HETATM 3528 O  O   . HOH F 3 .   ? 21.687  -1.487  28.319 1.00 2.01  ? 405 HOH B O   1 
HETATM 3529 O  O   . HOH F 3 .   ? 18.972  9.296   43.115 1.00 12.77 ? 406 HOH B O   1 
HETATM 3530 O  O   . HOH F 3 .   ? 23.009  17.624  24.086 1.00 15.74 ? 407 HOH B O   1 
HETATM 3531 O  O   . HOH F 3 .   ? 19.976  1.175   21.354 1.00 3.36  ? 408 HOH B O   1 
HETATM 3532 O  O   . HOH F 3 .   ? 26.465  28.336  28.848 1.00 12.52 ? 409 HOH B O   1 
HETATM 3533 O  O   . HOH F 3 .   ? 17.838  17.930  21.829 1.00 10.27 ? 410 HOH B O   1 
HETATM 3534 O  O   . HOH F 3 .   ? 3.499   14.864  35.137 1.00 9.49  ? 411 HOH B O   1 
HETATM 3535 O  O   . HOH F 3 .   ? 23.939  -0.198  23.761 1.00 14.78 ? 412 HOH B O   1 
HETATM 3536 O  O   . HOH F 3 .   ? 33.215  11.528  23.824 1.00 11.97 ? 413 HOH B O   1 
HETATM 3537 O  O   . HOH F 3 .   ? 26.526  8.924   9.019  1.00 13.70 ? 414 HOH B O   1 
HETATM 3538 O  O   . HOH F 3 .   ? 14.654  -0.420  25.904 1.00 10.58 ? 415 HOH B O   1 
HETATM 3539 O  O   . HOH F 3 .   ? 8.517   4.342   28.268 1.00 10.58 ? 416 HOH B O   1 
HETATM 3540 O  O   . HOH F 3 .   ? 12.086  26.200  25.769 1.00 16.65 ? 417 HOH B O   1 
HETATM 3541 O  O   . HOH F 3 .   ? 21.906  -2.176  31.041 1.00 9.88  ? 418 HOH B O   1 
HETATM 3542 O  O   . HOH F 3 .   ? 8.246   18.918  37.540 1.00 15.98 ? 419 HOH B O   1 
HETATM 3543 O  O   . HOH F 3 .   ? 21.719  18.255  35.328 1.00 7.17  ? 420 HOH B O   1 
HETATM 3544 O  O   . HOH F 3 .   ? 11.515  12.937  26.530 1.00 16.69 ? 421 HOH B O   1 
HETATM 3545 O  O   . HOH F 3 .   ? 15.255  1.310   28.107 1.00 6.34  ? 422 HOH B O   1 
HETATM 3546 O  O   . HOH F 3 .   ? 25.579  19.867  11.180 1.00 11.11 ? 423 HOH B O   1 
HETATM 3547 O  O   . HOH F 3 .   ? 17.233  7.538   16.944 1.00 2.13  ? 424 HOH B O   1 
HETATM 3548 O  O   . HOH F 3 .   ? 42.713  3.013   23.822 1.00 16.43 ? 425 HOH B O   1 
HETATM 3549 O  O   . HOH F 3 .   ? 20.012  34.808  30.014 1.00 13.36 ? 426 HOH B O   1 
HETATM 3550 O  O   . HOH F 3 .   ? 27.792  28.634  26.536 1.00 9.34  ? 427 HOH B O   1 
HETATM 3551 O  O   . HOH F 3 .   ? 29.385  30.930  26.838 1.00 12.04 ? 428 HOH B O   1 
HETATM 3552 O  O   . HOH F 3 .   ? 26.430  29.629  31.344 1.00 14.97 ? 429 HOH B O   1 
HETATM 3553 O  O   . HOH F 3 .   ? 9.725   24.969  20.435 1.00 23.34 ? 430 HOH B O   1 
HETATM 3554 O  O   . HOH F 3 .   ? 17.253  28.205  21.754 1.00 12.73 ? 431 HOH B O   1 
HETATM 3555 O  O   . HOH F 3 .   ? 22.738  14.203  44.715 1.00 13.29 ? 432 HOH B O   1 
HETATM 3556 O  O   . HOH F 3 .   ? 23.920  33.622  32.772 1.00 9.23  ? 433 HOH B O   1 
HETATM 3557 O  O   . HOH F 3 .   ? 47.189  11.472  26.359 1.00 7.88  ? 434 HOH B O   1 
HETATM 3558 O  O   . HOH F 3 .   ? 29.641  -1.907  26.824 1.00 22.37 ? 435 HOH B O   1 
HETATM 3559 O  O   . HOH F 3 .   ? 26.433  32.139  30.230 1.00 13.96 ? 436 HOH B O   1 
HETATM 3560 O  O   . HOH F 3 .   ? 24.642  8.807   12.421 1.00 13.48 ? 437 HOH B O   1 
HETATM 3561 O  O   . HOH F 3 .   ? 25.377  7.135   14.400 1.00 10.29 ? 438 HOH B O   1 
HETATM 3562 O  O   . HOH F 3 .   ? 42.324  10.449  21.650 1.00 14.34 ? 439 HOH B O   1 
HETATM 3563 O  O   . HOH F 3 .   ? 21.707  -4.262  34.472 1.00 10.16 ? 440 HOH B O   1 
HETATM 3564 O  O   . HOH F 3 .   ? 43.108  15.926  42.497 1.00 28.55 ? 441 HOH B O   1 
HETATM 3565 O  O   . HOH F 3 .   ? 37.535  -5.388  44.054 1.00 27.81 ? 442 HOH B O   1 
HETATM 3566 O  O   . HOH F 3 .   ? 38.732  16.922  27.507 1.00 12.61 ? 443 HOH B O   1 
HETATM 3567 O  O   . HOH F 3 .   ? 4.756   -6.559  38.118 1.00 37.18 ? 444 HOH B O   1 
HETATM 3568 O  O   . HOH F 3 .   ? 26.367  17.480  8.787  1.00 7.21  ? 445 HOH B O   1 
HETATM 3569 O  O   . HOH F 3 .   ? 36.783  19.850  29.181 1.00 8.35  ? 446 HOH B O   1 
HETATM 3570 O  O   . HOH F 3 .   ? 6.351   17.222  36.299 1.00 11.61 ? 447 HOH B O   1 
HETATM 3571 O  O   . HOH F 3 .   ? 23.240  -0.932  32.996 1.00 11.96 ? 448 HOH B O   1 
HETATM 3572 O  O   . HOH F 3 .   ? 11.097  -2.909  34.312 1.00 9.34  ? 449 HOH B O   1 
HETATM 3573 O  O   . HOH F 3 .   ? 28.950  20.177  36.148 1.00 11.23 ? 450 HOH B O   1 
HETATM 3574 O  O   . HOH F 3 .   ? 23.024  9.740   14.013 1.00 8.40  ? 451 HOH B O   1 
HETATM 3575 O  O   . HOH F 3 .   ? 6.899   17.644  28.881 1.00 17.44 ? 452 HOH B O   1 
HETATM 3576 O  O   . HOH F 3 .   ? 18.997  -4.830  33.678 1.00 15.48 ? 453 HOH B O   1 
HETATM 3577 O  O   . HOH F 3 .   ? 19.216  19.113  12.590 1.00 10.59 ? 454 HOH B O   1 
HETATM 3578 O  O   . HOH F 3 .   ? 20.773  23.883  13.053 1.00 29.44 ? 455 HOH B O   1 
HETATM 3579 O  O   . HOH F 3 .   ? 23.669  21.439  12.270 1.00 21.65 ? 456 HOH B O   1 
HETATM 3580 O  O   . HOH F 3 .   ? 26.262  33.985  32.376 1.00 15.76 ? 457 HOH B O   1 
HETATM 3581 O  O   . HOH F 3 .   ? 28.901  6.881   40.664 1.00 7.37  ? 458 HOH B O   1 
HETATM 3582 O  O   . HOH F 3 .   ? 21.134  15.549  42.566 1.00 16.62 ? 459 HOH B O   1 
HETATM 3583 O  O   . HOH F 3 .   ? 39.852  24.312  33.778 1.00 17.43 ? 460 HOH B O   1 
HETATM 3584 O  O   . HOH F 3 .   ? 28.772  26.871  34.558 1.00 24.42 ? 461 HOH B O   1 
HETATM 3585 O  O   . HOH F 3 .   ? 18.843  25.772  34.828 1.00 20.27 ? 462 HOH B O   1 
HETATM 3586 O  O   . HOH F 3 .   ? 12.114  9.036   24.883 1.00 11.20 ? 463 HOH B O   1 
HETATM 3587 O  O   . HOH F 3 .   ? 28.207  24.251  34.776 1.00 19.81 ? 464 HOH B O   1 
HETATM 3588 O  O   . HOH F 3 .   ? 21.643  -3.642  21.225 1.00 27.16 ? 465 HOH B O   1 
HETATM 3589 O  O   . HOH F 3 .   ? 19.615  -0.651  33.285 1.00 8.57  ? 466 HOH B O   1 
HETATM 3590 O  O   . HOH F 3 .   ? 17.821  -2.318  23.626 1.00 18.16 ? 467 HOH B O   1 
HETATM 3591 O  O   . HOH F 3 .   ? 31.278  12.823  11.699 1.00 15.08 ? 468 HOH B O   1 
HETATM 3592 O  O   . HOH F 3 .   ? 18.756  18.533  34.462 1.00 9.20  ? 469 HOH B O   1 
HETATM 3593 O  O   . HOH F 3 .   ? 30.301  27.142  37.124 1.00 37.25 ? 470 HOH B O   1 
HETATM 3594 O  O   . HOH F 3 .   ? 38.075  9.123   47.345 1.00 20.28 ? 471 HOH B O   1 
HETATM 3595 O  O   . HOH F 3 .   ? 26.077  3.100   15.857 1.00 12.90 ? 472 HOH B O   1 
HETATM 3596 O  O   . HOH F 3 .   ? 14.010  23.686  36.536 1.00 21.03 ? 473 HOH B O   1 
HETATM 3597 O  O   . HOH F 3 .   ? 23.485  3.759   15.407 1.00 8.03  ? 474 HOH B O   1 
HETATM 3598 O  O   . HOH F 3 .   ? 22.682  6.365   15.174 1.00 18.90 ? 475 HOH B O   1 
HETATM 3599 O  O   . HOH F 3 .   ? 13.144  12.072  24.503 1.00 28.63 ? 476 HOH B O   1 
HETATM 3600 O  O   . HOH F 3 .   ? 10.338  13.864  24.291 1.00 18.39 ? 477 HOH B O   1 
HETATM 3601 O  O   . HOH F 3 .   ? 10.837  26.007  22.526 1.00 26.58 ? 478 HOH B O   1 
HETATM 3602 O  O   . HOH F 3 .   ? 15.009  15.901  43.931 1.00 28.88 ? 479 HOH B O   1 
HETATM 3603 O  O   . HOH F 3 .   ? 14.328  14.491  41.019 1.00 7.08  ? 480 HOH B O   1 
HETATM 3604 O  O   . HOH F 3 .   ? 14.773  17.061  40.784 1.00 19.12 ? 481 HOH B O   1 
HETATM 3605 O  O   . HOH F 3 .   ? 23.011  28.454  35.897 1.00 21.18 ? 482 HOH B O   1 
HETATM 3606 O  O   . HOH F 3 .   ? 20.270  26.926  32.667 1.00 9.93  ? 483 HOH B O   1 
HETATM 3607 O  O   . HOH F 3 .   ? 9.331   11.382  28.029 1.00 16.08 ? 484 HOH B O   1 
HETATM 3608 O  O   . HOH F 3 .   ? 6.837   11.887  27.331 1.00 9.23  ? 485 HOH B O   1 
HETATM 3609 O  O   . HOH F 3 .   ? 6.245   13.504  29.209 1.00 19.42 ? 486 HOH B O   1 
HETATM 3610 O  O   . HOH F 3 .   ? 3.893   12.999  30.781 1.00 16.07 ? 487 HOH B O   1 
HETATM 3611 O  O   . HOH F 3 .   ? 3.558   13.132  45.428 1.00 19.19 ? 488 HOH B O   1 
HETATM 3612 O  O   . HOH F 3 .   ? 3.495   11.903  40.976 1.00 22.25 ? 489 HOH B O   1 
HETATM 3613 O  O   . HOH F 3 .   ? 0.846   12.393  40.975 1.00 24.77 ? 490 HOH B O   1 
HETATM 3614 O  O   . HOH F 3 .   ? 14.151  -7.266  33.893 1.00 30.15 ? 491 HOH B O   1 
HETATM 3615 O  O   . HOH F 3 .   ? 5.922   -2.510  30.922 1.00 41.81 ? 492 HOH B O   1 
HETATM 3616 O  O   . HOH F 3 .   ? 5.298   1.769   34.087 1.00 17.37 ? 493 HOH B O   1 
HETATM 3617 O  O   . HOH F 3 .   ? 27.200  21.750  34.542 1.00 11.07 ? 494 HOH B O   1 
HETATM 3618 O  O   . HOH F 3 .   ? 24.618  21.534  35.683 1.00 17.91 ? 495 HOH B O   1 
HETATM 3619 O  O   . HOH F 3 .   ? 22.533  20.200  36.985 1.00 13.85 ? 496 HOH B O   1 
HETATM 3620 O  O   . HOH F 3 .   ? 31.830  21.106  38.704 1.00 11.58 ? 497 HOH B O   1 
HETATM 3621 O  O   . HOH F 3 .   ? 36.111  17.897  41.586 1.00 17.39 ? 498 HOH B O   1 
HETATM 3622 O  O   . HOH F 3 .   ? 34.060  19.581  42.368 1.00 21.34 ? 499 HOH B O   1 
HETATM 3623 O  O   . HOH F 3 .   ? 31.718  19.140  40.885 1.00 13.55 ? 500 HOH B O   1 
HETATM 3624 O  O   . HOH F 3 .   ? 35.196  26.634  32.043 1.00 19.72 ? 501 HOH B O   1 
HETATM 3625 O  O   . HOH F 3 .   ? 40.162  21.550  37.370 1.00 15.20 ? 502 HOH B O   1 
HETATM 3626 O  O   . HOH F 3 .   ? 41.831  18.567  31.040 1.00 22.79 ? 503 HOH B O   1 
HETATM 3627 O  O   . HOH F 3 .   ? 36.890  -0.264  29.662 1.00 17.28 ? 504 HOH B O   1 
HETATM 3628 O  O   . HOH F 3 .   ? 37.923  0.228   27.317 1.00 20.34 ? 505 HOH B O   1 
HETATM 3629 O  O   . HOH F 3 .   ? 39.042  -0.422  31.612 1.00 22.13 ? 506 HOH B O   1 
HETATM 3630 O  O   . HOH F 3 .   ? 24.342  -2.719  29.192 1.00 13.17 ? 507 HOH B O   1 
HETATM 3631 O  O   . HOH F 3 .   ? 22.972  -0.933  21.512 1.00 13.16 ? 508 HOH B O   1 
HETATM 3632 O  O   . HOH F 3 .   ? 25.538  -1.454  20.480 1.00 11.85 ? 509 HOH B O   1 
HETATM 3633 O  O   . HOH F 3 .   ? 27.889  -1.521  22.234 1.00 13.33 ? 510 HOH B O   1 
HETATM 3634 O  O   . HOH F 3 .   ? 29.980  -2.188  20.535 1.00 36.35 ? 511 HOH B O   1 
HETATM 3635 O  O   . HOH F 3 .   ? 28.711  -6.159  38.234 1.00 34.96 ? 512 HOH B O   1 
HETATM 3636 O  O   . HOH F 3 .   ? 27.905  -0.166  43.345 1.00 15.17 ? 513 HOH B O   1 
HETATM 3637 O  O   . HOH F 3 .   ? 38.787  11.567  41.657 1.00 15.67 ? 514 HOH B O   1 
HETATM 3638 O  O   . HOH F 3 .   ? 40.477  13.464  41.114 1.00 16.18 ? 515 HOH B O   1 
HETATM 3639 O  O   . HOH F 3 .   ? 24.023  21.646  7.371  1.00 27.28 ? 516 HOH B O   1 
HETATM 3640 O  O   . HOH F 3 .   ? 26.528  15.235  7.318  1.00 15.38 ? 517 HOH B O   1 
HETATM 3641 O  O   . HOH F 3 .   ? 28.699  12.972  6.890  1.00 14.90 ? 518 HOH B O   1 
HETATM 3642 O  O   . HOH F 3 .   ? 24.908  7.127   10.010 1.00 15.67 ? 519 HOH B O   1 
HETATM 3643 O  O   . HOH F 3 .   ? 27.877  6.274   15.082 1.00 17.09 ? 520 HOH B O   1 
HETATM 3644 O  O   . HOH F 3 .   ? 17.396  17.367  47.116 1.00 14.15 ? 521 HOH B O   1 
HETATM 3645 O  O   . HOH F 3 .   ? 19.597  17.803  42.294 1.00 10.94 ? 522 HOH B O   1 
HETATM 3646 O  O   . HOH F 3 .   ? 12.704  17.360  42.772 1.00 22.69 ? 523 HOH B O   1 
HETATM 3647 O  O   . HOH F 3 .   ? 29.944  22.186  17.281 1.00 18.12 ? 524 HOH B O   1 
HETATM 3648 O  O   . HOH F 3 .   ? 30.898  23.937  15.861 1.00 29.35 ? 525 HOH B O   1 
HETATM 3649 O  O   . HOH F 3 .   ? 31.463  19.716  13.854 1.00 23.00 ? 526 HOH B O   1 
HETATM 3650 O  O   . HOH F 3 .   ? 20.512  28.168  18.485 1.00 6.31  ? 527 HOH B O   1 
HETATM 3651 O  O   . HOH F 3 .   ? 20.988  26.412  16.239 1.00 19.34 ? 528 HOH B O   1 
HETATM 3652 O  O   . HOH F 3 .   ? 22.763  24.461  15.361 1.00 26.46 ? 529 HOH B O   1 
HETATM 3653 O  O   . HOH F 3 .   ? 18.036  26.210  15.439 1.00 36.85 ? 530 HOH B O   1 
HETATM 3654 O  O   . HOH F 3 .   ? 13.957  29.394  20.825 1.00 17.08 ? 531 HOH B O   1 
HETATM 3655 O  O   . HOH F 3 .   ? 9.539   23.322  27.245 1.00 17.79 ? 532 HOH B O   1 
HETATM 3656 O  O   . HOH F 3 .   ? 7.844   21.742  27.368 1.00 31.47 ? 533 HOH B O   1 
HETATM 3657 O  O   . HOH F 3 .   ? 8.676   18.855  27.357 1.00 21.40 ? 534 HOH B O   1 
HETATM 3658 O  O   . HOH F 3 .   ? 6.692   6.039   49.685 1.00 14.50 ? 535 HOH B O   1 
HETATM 3659 O  O   . HOH F 3 .   ? 14.284  6.937   50.636 1.00 21.59 ? 536 HOH B O   1 
HETATM 3660 O  O   . HOH F 3 .   ? 19.735  2.072   43.403 1.00 28.75 ? 537 HOH B O   1 
HETATM 3661 O  O   . HOH F 3 .   ? 12.494  -4.937  39.717 1.00 22.87 ? 538 HOH B O   1 
HETATM 3662 O  O   . HOH F 3 .   ? 10.471  -7.196  39.633 1.00 28.16 ? 539 HOH B O   1 
HETATM 3663 O  O   . HOH F 3 .   ? 25.567  16.876  41.620 1.00 11.63 ? 540 HOH B O   1 
HETATM 3664 O  O   . HOH F 3 .   ? 32.208  26.434  32.700 1.00 26.86 ? 541 HOH B O   1 
HETATM 3665 O  O   . HOH F 3 .   ? 36.819  26.884  25.394 1.00 29.29 ? 542 HOH B O   1 
HETATM 3666 O  O   . HOH F 3 .   ? 41.896  9.959   19.088 1.00 18.22 ? 543 HOH B O   1 
HETATM 3667 O  O   . HOH F 3 .   ? 39.709  4.435   39.902 1.00 14.13 ? 544 HOH B O   1 
HETATM 3668 O  O   . HOH F 3 .   ? 31.367  -2.349  30.633 1.00 20.93 ? 545 HOH B O   1 
HETATM 3669 O  O   . HOH F 3 .   ? 23.689  4.575   37.209 1.00 13.38 ? 546 HOH B O   1 
HETATM 3670 O  O   . HOH F 3 .   ? 17.661  -2.318  32.913 1.00 13.01 ? 547 HOH B O   1 
HETATM 3671 O  O   . HOH F 3 .   ? 22.474  -6.300  36.191 1.00 15.07 ? 548 HOH B O   1 
HETATM 3672 O  O   . HOH F 3 .   ? 25.972  3.185   40.917 1.00 16.24 ? 549 HOH B O   1 
HETATM 3673 O  O   . HOH F 3 .   ? 29.936  8.523   42.549 1.00 24.07 ? 550 HOH B O   1 
HETATM 3674 O  O   . HOH F 3 .   ? 28.990  6.847   12.823 1.00 10.04 ? 551 HOH B O   1 
HETATM 3675 O  O   . HOH F 3 .   ? 27.376  5.722   10.422 1.00 20.69 ? 552 HOH B O   1 
HETATM 3676 O  O   . HOH F 3 .   ? 25.828  5.685   48.118 1.00 30.33 ? 553 HOH B O   1 
HETATM 3677 O  O   . HOH F 3 .   ? 19.228  31.970  23.310 1.00 21.83 ? 554 HOH B O   1 
HETATM 3678 O  O   . HOH F 3 .   ? 9.258   18.907  34.439 1.00 22.91 ? 555 HOH B O   1 
HETATM 3679 O  O   . HOH F 3 .   ? 6.482   5.607   29.408 1.00 26.99 ? 556 HOH B O   1 
HETATM 3680 O  O   . HOH F 3 .   ? 15.359  0.307   45.388 1.00 28.27 ? 557 HOH B O   1 
HETATM 3681 O  O   . HOH F 3 .   ? 39.485  20.962  29.932 1.00 25.48 ? 558 HOH B O   1 
HETATM 3682 O  O   . HOH F 3 .   ? 51.420  4.432   29.984 1.00 19.63 ? 559 HOH B O   1 
HETATM 3683 O  O   . HOH F 3 .   ? 43.877  4.062   21.805 1.00 23.68 ? 560 HOH B O   1 
HETATM 3684 O  O   . HOH F 3 .   ? 39.417  9.054   19.035 1.00 21.27 ? 561 HOH B O   1 
HETATM 3685 O  O   . HOH F 3 .   ? 35.909  1.091   23.098 1.00 17.02 ? 562 HOH B O   1 
HETATM 3686 O  O   . HOH F 3 .   ? 25.231  -2.024  25.505 1.00 16.76 ? 563 HOH B O   1 
HETATM 3687 O  O   . HOH F 3 .   ? 41.749  -0.554  30.696 1.00 26.85 ? 564 HOH B O   1 
HETATM 3688 O  O   . HOH F 3 .   ? 18.311  -1.164  28.232 1.00 15.98 ? 565 HOH B O   1 
HETATM 3689 O  O   . HOH F 3 .   ? 16.628  -2.123  26.195 1.00 22.70 ? 566 HOH B O   1 
HETATM 3690 O  O   . HOH F 3 .   ? 19.875  -4.000  24.012 1.00 17.01 ? 567 HOH B O   1 
HETATM 3691 O  O   . HOH F 3 .   ? 2.806   11.269  49.585 1.00 31.75 ? 568 HOH B O   1 
HETATM 3692 O  O   . HOH F 3 .   ? 4.808   22.707  31.462 1.00 29.10 ? 569 HOH B O   1 
HETATM 3693 O  O   . HOH F 3 .   ? 36.085  25.398  38.772 1.00 27.55 ? 570 HOH B O   1 
HETATM 3694 O  O   . HOH F 3 .   ? 33.607  22.643  39.829 1.00 25.12 ? 571 HOH B O   1 
HETATM 3695 O  O   . HOH F 3 .   ? 3.320   13.881  51.055 1.00 31.90 ? 572 HOH B O   1 
HETATM 3696 O  O   . HOH F 3 .   ? -0.091  10.876  49.356 1.00 24.39 ? 573 HOH B O   1 
HETATM 3697 O  O   . HOH F 3 .   ? -1.669  9.483   47.931 1.00 29.98 ? 574 HOH B O   1 
HETATM 3698 O  O   . HOH F 3 .   ? 16.976  -4.613  40.697 1.00 26.34 ? 575 HOH B O   1 
HETATM 3699 O  O   . HOH F 3 .   ? 18.637  -4.364  38.446 1.00 24.71 ? 576 HOH B O   1 
HETATM 3700 O  O   . HOH F 3 .   ? 18.177  -5.625  35.960 1.00 19.33 ? 577 HOH B O   1 
HETATM 3701 O  O   . HOH F 3 .   ? 14.957  -2.555  33.231 1.00 22.47 ? 578 HOH B O   1 
HETATM 3702 O  O   . HOH F 3 .   ? 13.736  -1.898  30.807 1.00 29.23 ? 579 HOH B O   1 
HETATM 3703 O  O   . HOH F 3 .   ? 8.610   -8.697  38.379 1.00 37.27 ? 580 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . TYR A 28  ? 0.3757 0.3280 0.3848 0.0034  -0.0257 -0.0233 20  TYR A N   
2    C  CA  . TYR A 28  ? 0.3517 0.3057 0.3527 0.0044  -0.0255 -0.0247 20  TYR A CA  
3    C  C   . TYR A 28  ? 0.3196 0.2745 0.3131 0.0050  -0.0231 -0.0227 20  TYR A C   
4    O  O   . TYR A 28  ? 0.3443 0.2987 0.3381 0.0039  -0.0216 -0.0191 20  TYR A O   
5    C  CB  . TYR A 28  ? 0.3487 0.3034 0.3503 0.0028  -0.0259 -0.0222 20  TYR A CB  
6    C  CG  . TYR A 28  ? 0.3581 0.3145 0.3522 0.0035  -0.0254 -0.0222 20  TYR A CG  
7    C  CD1 . TYR A 28  ? 0.3766 0.3340 0.3690 0.0048  -0.0272 -0.0259 20  TYR A CD1 
8    C  CD2 . TYR A 28  ? 0.3720 0.3289 0.3611 0.0028  -0.0233 -0.0183 20  TYR A CD2 
9    C  CE1 . TYR A 28  ? 0.3832 0.3422 0.3691 0.0054  -0.0268 -0.0255 20  TYR A CE1 
10   C  CE2 . TYR A 28  ? 0.3876 0.3457 0.3706 0.0034  -0.0229 -0.0182 20  TYR A CE2 
11   C  CZ  . TYR A 28  ? 0.4109 0.3700 0.3924 0.0047  -0.0246 -0.0215 20  TYR A CZ  
12   O  OH  . TYR A 28  ? 0.4852 0.4455 0.4609 0.0054  -0.0242 -0.0208 20  TYR A OH  
13   N  N   . ALA A 29  ? 0.2853 0.2416 0.2719 0.0066  -0.0227 -0.0250 21  ALA A N   
14   C  CA  . ALA A 29  ? 0.2613 0.2185 0.2411 0.0069  -0.0203 -0.0226 21  ALA A CA  
15   C  C   . ALA A 29  ? 0.2342 0.1924 0.2082 0.0070  -0.0201 -0.0216 21  ALA A C   
16   O  O   . ALA A 29  ? 0.2313 0.1905 0.2035 0.0081  -0.0215 -0.0243 21  ALA A O   
17   C  CB  . ALA A 29  ? 0.2648 0.2228 0.2417 0.0088  -0.0195 -0.0253 21  ALA A CB  
18   N  N   . THR A 30  ? 0.2114 0.1697 0.1828 0.0059  -0.0185 -0.0178 22  THR A N   
19   C  CA  . THR A 30  ? 0.1961 0.1552 0.1623 0.0061  -0.0181 -0.0167 22  THR A CA  
20   C  C   . THR A 30  ? 0.1912 0.1515 0.1512 0.0079  -0.0172 -0.0179 22  THR A C   
21   O  O   . THR A 30  ? 0.1913 0.1527 0.1479 0.0090  -0.0181 -0.0192 22  THR A O   
22   C  CB  . THR A 30  ? 0.1904 0.1491 0.1557 0.0045  -0.0167 -0.0128 22  THR A CB  
23   O  OG1 . THR A 30  ? 0.1836 0.1420 0.1543 0.0029  -0.0174 -0.0115 22  THR A OG1 
24   C  CG2 . THR A 30  ? 0.1888 0.1482 0.1494 0.0049  -0.0163 -0.0120 22  THR A CG2 
25   N  N   . LEU A 31  ? 0.1876 0.1480 0.1463 0.0083  -0.0156 -0.0175 23  LEU A N   
26   C  CA  . LEU A 31  ? 0.1866 0.1484 0.1395 0.0099  -0.0143 -0.0178 23  LEU A CA  
27   C  C   . LEU A 31  ? 0.1836 0.1462 0.1375 0.0113  -0.0140 -0.0206 23  LEU A C   
28   O  O   . LEU A 31  ? 0.1743 0.1370 0.1284 0.0111  -0.0123 -0.0195 23  LEU A O   
29   C  CB  . LEU A 31  ? 0.1906 0.1520 0.1410 0.0089  -0.0120 -0.0141 23  LEU A CB  
30   C  CG  . LEU A 31  ? 0.1923 0.1533 0.1408 0.0080  -0.0119 -0.0116 23  LEU A CG  
31   C  CD1 . LEU A 31  ? 0.1911 0.1516 0.1376 0.0072  -0.0098 -0.0086 23  LEU A CD1 
32   C  CD2 . LEU A 31  ? 0.1989 0.1610 0.1435 0.0095  -0.0128 -0.0126 23  LEU A CD2 
33   N  N   . PRO A 32  ? 0.1821 0.1456 0.1371 0.0126  -0.0159 -0.0247 24  PRO A N   
34   C  CA  . PRO A 32  ? 0.1859 0.1501 0.1425 0.0141  -0.0158 -0.0280 24  PRO A CA  
35   C  C   . PRO A 32  ? 0.1899 0.1565 0.1411 0.0157  -0.0136 -0.0280 24  PRO A C   
36   O  O   . PRO A 32  ? 0.1880 0.1553 0.1409 0.0168  -0.0129 -0.0301 24  PRO A O   
37   C  CB  . PRO A 32  ? 0.1872 0.1521 0.1454 0.0153  -0.0185 -0.0326 24  PRO A CB  
38   C  CG  . PRO A 32  ? 0.1869 0.1524 0.1417 0.0151  -0.0195 -0.0315 24  PRO A CG  
39   C  CD  . PRO A 32  ? 0.1815 0.1452 0.1367 0.0129  -0.0182 -0.0266 24  PRO A CD  
40   N  N   . ASP A 33  ? 0.1922 0.1600 0.1374 0.0160  -0.0124 -0.0256 25  ASP A N   
41   C  CA  . ASP A 33  ? 0.2013 0.1717 0.1415 0.0175  -0.0101 -0.0249 25  ASP A CA  
42   C  C   . ASP A 33  ? 0.2012 0.1707 0.1418 0.0161  -0.0076 -0.0208 25  ASP A C   
43   O  O   . ASP A 33  ? 0.2108 0.1823 0.1476 0.0169  -0.0055 -0.0194 25  ASP A O   
44   C  CB  . ASP A 33  ? 0.2077 0.1802 0.1412 0.0189  -0.0101 -0.0244 25  ASP A CB  
45   C  CG  . ASP A 33  ? 0.2095 0.1804 0.1421 0.0173  -0.0102 -0.0204 25  ASP A CG  
46   O  OD1 . ASP A 33  ? 0.2097 0.1778 0.1464 0.0153  -0.0107 -0.0190 25  ASP A OD1 
47   O  OD2 . ASP A 33  ? 0.2256 0.1980 0.1532 0.0182  -0.0097 -0.0188 25  ASP A OD2 
48   N  N   . LEU A 34  ? 0.2013 0.1682 0.1464 0.0140  -0.0080 -0.0189 26  LEU A N   
49   C  CA  . LEU A 34  ? 0.2010 0.1672 0.1472 0.0125  -0.0061 -0.0155 26  LEU A CA  
50   C  C   . LEU A 34  ? 0.2087 0.1746 0.1599 0.0124  -0.0059 -0.0166 26  LEU A C   
51   O  O   . LEU A 34  ? 0.2056 0.1697 0.1618 0.0113  -0.0073 -0.0168 26  LEU A O   
52   C  CB  . LEU A 34  ? 0.1935 0.1576 0.1408 0.0104  -0.0066 -0.0125 26  LEU A CB  
53   C  CG  . LEU A 34  ? 0.1957 0.1594 0.1431 0.0091  -0.0048 -0.0092 26  LEU A CG  
54   C  CD1 . LEU A 34  ? 0.1999 0.1649 0.1424 0.0098  -0.0030 -0.0074 26  LEU A CD1 
55   C  CD2 . LEU A 34  ? 0.1911 0.1529 0.1406 0.0070  -0.0055 -0.0071 26  LEU A CD2 
56   N  N   . LEU A 35  ? 0.2218 0.1897 0.1720 0.0136  -0.0040 -0.0170 27  LEU A N   
57   C  CA  . LEU A 35  ? 0.2409 0.2092 0.1956 0.0142  -0.0037 -0.0188 27  LEU A CA  
58   C  C   . LEU A 35  ? 0.2339 0.2031 0.1894 0.0136  -0.0014 -0.0163 27  LEU A C   
59   O  O   . LEU A 35  ? 0.2464 0.2168 0.1983 0.0133  0.0003  -0.0137 27  LEU A O   
60   C  CB  . LEU A 35  ? 0.2620 0.2328 0.2147 0.0168  -0.0035 -0.0231 27  LEU A CB  
61   C  CG  . LEU A 35  ? 0.2736 0.2448 0.2240 0.0181  -0.0056 -0.0265 27  LEU A CG  
62   C  CD1 . LEU A 35  ? 0.2879 0.2625 0.2354 0.0209  -0.0049 -0.0305 27  LEU A CD1 
63   C  CD2 . LEU A 35  ? 0.2780 0.2464 0.2346 0.0172  -0.0082 -0.0283 27  LEU A CD2 
64   N  N   . LYS A 36  ? 0.2292 0.1982 0.1900 0.0137  -0.0015 -0.0171 28  LYS A N   
65   C  CA  . LYS A 36  ? 0.2272 0.1981 0.1894 0.0140  0.0007  -0.0161 28  LYS A CA  
66   C  C   . LYS A 36  ? 0.2347 0.2084 0.1960 0.0166  0.0018  -0.0197 28  LYS A C   
67   O  O   . LYS A 36  ? 0.2194 0.1928 0.1847 0.0177  0.0006  -0.0232 28  LYS A O   
68   C  CB  . LYS A 36  ? 0.2278 0.1973 0.1966 0.0127  0.0000  -0.0149 28  LYS A CB  
69   C  CG  . LYS A 36  ? 0.2257 0.1974 0.1971 0.0132  0.0020  -0.0142 28  LYS A CG  
70   C  CD  . LYS A 36  ? 0.2302 0.2033 0.1983 0.0122  0.0041  -0.0109 28  LYS A CD  
71   C  CE  . LYS A 36  ? 0.2314 0.2070 0.2029 0.0125  0.0060  -0.0100 28  LYS A CE  
72   N  NZ  . LYS A 36  ? 0.2373 0.2158 0.2080 0.0151  0.0078  -0.0130 28  LYS A NZ  
73   N  N   . PRO A 37  ? 0.2461 0.2229 0.2026 0.0177  0.0042  -0.0190 29  PRO A N   
74   C  CA  . PRO A 37  ? 0.2616 0.2417 0.2166 0.0204  0.0054  -0.0226 29  PRO A CA  
75   C  C   . PRO A 37  ? 0.2703 0.2514 0.2311 0.0212  0.0063  -0.0241 29  PRO A C   
76   O  O   . PRO A 37  ? 0.2822 0.2624 0.2472 0.0196  0.0067  -0.0213 29  PRO A O   
77   C  CB  . PRO A 37  ? 0.2665 0.2498 0.2153 0.0211  0.0081  -0.0203 29  PRO A CB  
78   C  CG  . PRO A 37  ? 0.2620 0.2430 0.2085 0.0189  0.0075  -0.0163 29  PRO A CG  
79   C  CD  . PRO A 37  ? 0.2518 0.2293 0.2041 0.0167  0.0059  -0.0150 29  PRO A CD  
80   N  N   . SER A 38  ? 0.2744 0.2576 0.2358 0.0237  0.0064  -0.0288 30  SER A N   
81   C  CA  . SER A 38  ? 0.2766 0.2616 0.2431 0.0250  0.0076  -0.0307 30  SER A CA  
82   C  C   . SER A 38  ? 0.2741 0.2632 0.2382 0.0256  0.0111  -0.0285 30  SER A C   
83   O  O   . SER A 38  ? 0.2722 0.2645 0.2302 0.0271  0.0128  -0.0289 30  SER A O   
84   C  CB  . SER A 38  ? 0.2795 0.2659 0.2467 0.0278  0.0068  -0.0369 30  SER A CB  
85   O  OG  . SER A 38  ? 0.2902 0.2727 0.2617 0.0272  0.0035  -0.0391 30  SER A OG  
86   N  N   . GLY A 39  ? 0.2797 0.2688 0.2487 0.0245  0.0123  -0.0260 31  GLY A N   
87   C  CA  . GLY A 39  ? 0.2903 0.2837 0.2583 0.0252  0.0158  -0.0241 31  GLY A CA  
88   C  C   . GLY A 39  ? 0.2991 0.2933 0.2622 0.0236  0.0175  -0.0193 31  GLY A C   
89   O  O   . GLY A 39  ? 0.3293 0.3272 0.2917 0.0240  0.0205  -0.0173 31  GLY A O   
90   N  N   . ALA A 40  ? 0.2965 0.2875 0.2567 0.0219  0.0156  -0.0174 32  ALA A N   
91   C  CA  . ALA A 40  ? 0.2793 0.2706 0.2357 0.0204  0.0170  -0.0129 32  ALA A CA  
92   C  C   . ALA A 40  ? 0.2723 0.2589 0.2296 0.0177  0.0145  -0.0105 32  ALA A C   
93   O  O   . ALA A 40  ? 0.2572 0.2409 0.2160 0.0173  0.0118  -0.0124 32  ALA A O   
94   C  CB  . ALA A 40  ? 0.2743 0.2680 0.2233 0.0221  0.0180  -0.0134 32  ALA A CB  
95   N  N   . PRO A 41  ? 0.2764 0.2626 0.2331 0.0158  0.0156  -0.0063 33  PRO A N   
96   C  CA  . PRO A 41  ? 0.2827 0.2651 0.2404 0.0133  0.0135  -0.0043 33  PRO A CA  
97   C  C   . PRO A 41  ? 0.2834 0.2636 0.2365 0.0135  0.0117  -0.0050 33  PRO A C   
98   O  O   . PRO A 41  ? 0.3059 0.2879 0.2541 0.0150  0.0126  -0.0055 33  PRO A O   
99   C  CB  . PRO A 41  ? 0.2819 0.2650 0.2399 0.0117  0.0154  -0.0002 33  PRO A CB  
100  C  CG  . PRO A 41  ? 0.2874 0.2746 0.2425 0.0135  0.0185  0.0004  33  PRO A CG  
101  C  CD  . PRO A 41  ? 0.2801 0.2697 0.2363 0.0158  0.0188  -0.0034 33  PRO A CD  
102  N  N   . ALA A 42  ? 0.2760 0.2528 0.2309 0.0119  0.0092  -0.0050 34  ALA A N   
103  C  CA  . ALA A 42  ? 0.2809 0.2556 0.2321 0.0116  0.0076  -0.0049 34  ALA A CA  
104  C  C   . ALA A 42  ? 0.2937 0.2686 0.2418 0.0107  0.0090  -0.0015 34  ALA A C   
105  O  O   . ALA A 42  ? 0.2727 0.2476 0.2233 0.0093  0.0100  0.0010  34  ALA A O   
106  C  CB  . ALA A 42  ? 0.2787 0.2503 0.2329 0.0099  0.0051  -0.0050 34  ALA A CB  
107  N  N   . GLU A 43  ? 0.3188 0.2942 0.2619 0.0118  0.0090  -0.0015 35  GLU A N   
108  C  CA  . GLU A 43  ? 0.3420 0.3174 0.2824 0.0112  0.0103  0.0020  35  GLU A CA  
109  C  C   . GLU A 43  ? 0.3178 0.2898 0.2582 0.0096  0.0084  0.0030  35  GLU A C   
110  O  O   . GLU A 43  ? 0.3082 0.2785 0.2490 0.0095  0.0062  0.0010  35  GLU A O   
111  C  CB  . GLU A 43  ? 0.3795 0.3575 0.3142 0.0133  0.0114  0.0022  35  GLU A CB  
112  C  CG  . GLU A 43  ? 0.4188 0.4011 0.3521 0.0154  0.0137  0.0011  35  GLU A CG  
113  C  CD  . GLU A 43  ? 0.4568 0.4414 0.3915 0.0149  0.0168  0.0046  35  GLU A CD  
114  O  OE1 . GLU A 43  ? 0.4950 0.4775 0.4332 0.0127  0.0171  0.0074  35  GLU A OE1 
115  O  OE2 . GLU A 43  ? 0.4722 0.4608 0.4045 0.0168  0.0190  0.0045  35  GLU A OE2 
116  N  N   . LEU A 44  ? 0.3107 0.2819 0.2511 0.0084  0.0094  0.0062  36  LEU A N   
117  C  CA  . LEU A 44  ? 0.3068 0.2751 0.2468 0.0072  0.0079  0.0072  36  LEU A CA  
118  C  C   . LEU A 44  ? 0.3078 0.2765 0.2431 0.0088  0.0072  0.0068  36  LEU A C   
119  O  O   . LEU A 44  ? 0.3263 0.2968 0.2586 0.0100  0.0087  0.0086  36  LEU A O   
120  C  CB  . LEU A 44  ? 0.3171 0.2847 0.2589 0.0057  0.0093  0.0105  36  LEU A CB  
121  C  CG  . LEU A 44  ? 0.3160 0.2807 0.2582 0.0044  0.0080  0.0115  36  LEU A CG  
122  C  CD1 . LEU A 44  ? 0.3221 0.2849 0.2666 0.0031  0.0060  0.0096  36  LEU A CD1 
123  C  CD2 . LEU A 44  ? 0.3113 0.2754 0.2559 0.0032  0.0095  0.0145  36  LEU A CD2 
124  N  N   . PRO A 45  ? 0.2889 0.2562 0.2236 0.0090  0.0049  0.0046  37  PRO A N   
125  C  CA  . PRO A 45  ? 0.2853 0.2532 0.2158 0.0106  0.0040  0.0039  37  PRO A CA  
126  C  C   . PRO A 45  ? 0.2735 0.2409 0.2017 0.0107  0.0046  0.0071  37  PRO A C   
127  O  O   . PRO A 45  ? 0.2513 0.2165 0.1820 0.0090  0.0048  0.0090  37  PRO A O   
128  C  CB  . PRO A 45  ? 0.2872 0.2532 0.2192 0.0100  0.0014  0.0017  37  PRO A CB  
129  C  CG  . PRO A 45  ? 0.2981 0.2631 0.2345 0.0086  0.0012  0.0008  37  PRO A CG  
130  C  CD  . PRO A 45  ? 0.2951 0.2601 0.2331 0.0075  0.0031  0.0033  37  PRO A CD  
131  N  N   . LYS A 46  ? 0.2702 0.2399 0.1941 0.0126  0.0050  0.0076  38  LYS A N   
132  C  CA  . LYS A 46  ? 0.2861 0.2557 0.2076 0.0131  0.0055  0.0110  38  LYS A CA  
133  C  C   . LYS A 46  ? 0.2805 0.2478 0.2022 0.0128  0.0031  0.0104  38  LYS A C   
134  O  O   . LYS A 46  ? 0.2647 0.2322 0.1856 0.0134  0.0012  0.0075  38  LYS A O   
135  C  CB  . LYS A 46  ? 0.2876 0.2611 0.2039 0.0155  0.0064  0.0117  38  LYS A CB  
136  N  N   . LEU A 47  ? 0.2861 0.2511 0.2095 0.0117  0.0034  0.0132  39  LEU A N   
137  C  CA  . LEU A 47  ? 0.2792 0.2420 0.2032 0.0114  0.0015  0.0129  39  LEU A CA  
138  C  C   . LEU A 47  ? 0.2769 0.2414 0.1969 0.0135  0.0005  0.0135  39  LEU A C   
139  O  O   . LEU A 47  ? 0.2709 0.2378 0.1876 0.0150  0.0017  0.0154  39  LEU A O   
140  C  CB  . LEU A 47  ? 0.2836 0.2437 0.2109 0.0100  0.0023  0.0156  39  LEU A CB  
141  C  CG  . LEU A 47  ? 0.2914 0.2499 0.2229 0.0078  0.0030  0.0150  39  LEU A CG  
142  C  CD1 . LEU A 47  ? 0.2989 0.2547 0.2335 0.0066  0.0034  0.0172  39  LEU A CD1 
143  C  CD2 . LEU A 47  ? 0.2934 0.2513 0.2263 0.0070  0.0013  0.0117  39  LEU A CD2 
144  N  N   . GLY A 48  ? 0.2734 0.2369 0.1938 0.0137  -0.0017 0.0119  40  GLY A N   
145  C  CA  . GLY A 48  ? 0.2795 0.2444 0.1965 0.0156  -0.0031 0.0126  40  GLY A CA  
146  C  C   . GLY A 48  ? 0.2840 0.2478 0.2011 0.0159  -0.0023 0.0168  40  GLY A C   
147  O  O   . GLY A 48  ? 0.3213 0.2866 0.2355 0.0176  -0.0031 0.0184  40  GLY A O   
148  N  N   . PHE A 49  ? 0.2604 0.2218 0.1811 0.0142  -0.0008 0.0187  41  PHE A N   
149  C  CA  . PHE A 49  ? 0.2493 0.2090 0.1713 0.0143  0.0000  0.0227  41  PHE A CA  
150  C  C   . PHE A 49  ? 0.2428 0.2018 0.1670 0.0130  0.0025  0.0252  41  PHE A C   
151  O  O   . PHE A 49  ? 0.2347 0.1942 0.1599 0.0119  0.0034  0.0235  41  PHE A O   
152  C  CB  . PHE A 49  ? 0.2407 0.1974 0.1664 0.0134  -0.0014 0.0218  41  PHE A CB  
153  C  CG  . PHE A 49  ? 0.2334 0.1881 0.1628 0.0112  -0.0012 0.0193  41  PHE A CG  
154  C  CD1 . PHE A 49  ? 0.2282 0.1805 0.1614 0.0097  0.0001  0.0207  41  PHE A CD1 
155  C  CD2 . PHE A 49  ? 0.2343 0.1896 0.1635 0.0108  -0.0025 0.0156  41  PHE A CD2 
156  C  CE1 . PHE A 49  ? 0.2312 0.1823 0.1674 0.0078  0.0000  0.0183  41  PHE A CE1 
157  C  CE2 . PHE A 49  ? 0.2344 0.1884 0.1668 0.0089  -0.0024 0.0137  41  PHE A CE2 
158  C  CZ  . PHE A 49  ? 0.2317 0.1837 0.1673 0.0075  -0.0011 0.0150  41  PHE A CZ  
159  N  N   . ASN A 50  ? 0.2421 0.2001 0.1677 0.0131  0.0036  0.0293  42  ASN A N   
160  C  CA  . ASN A 50  ? 0.2509 0.2082 0.1795 0.0118  0.0060  0.0320  42  ASN A CA  
161  C  C   . ASN A 50  ? 0.2468 0.2002 0.1814 0.0095  0.0058  0.0311  42  ASN A C   
162  O  O   . ASN A 50  ? 0.2543 0.2052 0.1916 0.0094  0.0050  0.0320  42  ASN A O   
163  C  CB  . ASN A 50  ? 0.2608 0.2190 0.1887 0.0130  0.0072  0.0374  42  ASN A CB  
164  C  CG  . ASN A 50  ? 0.2665 0.2243 0.1981 0.0116  0.0098  0.0408  42  ASN A CG  
165  O  OD1 . ASN A 50  ? 0.2630 0.2194 0.1983 0.0097  0.0104  0.0391  42  ASN A OD1 
166  N  ND2 . ASN A 50  ? 0.2753 0.2346 0.2060 0.0127  0.0113  0.0459  42  ASN A ND2 
167  N  N   . TRP A 51  ? 0.2464 0.1997 0.1833 0.0079  0.0065  0.0292  43  TRP A N   
168  C  CA  . TRP A 51  ? 0.2510 0.2012 0.1930 0.0058  0.0061  0.0276  43  TRP A CA  
169  C  C   . TRP A 51  ? 0.2544 0.2022 0.2013 0.0049  0.0071  0.0309  43  TRP A C   
170  O  O   . TRP A 51  ? 0.2494 0.1943 0.2005 0.0037  0.0063  0.0295  43  TRP A O   
171  C  CB  . TRP A 51  ? 0.2524 0.2034 0.1957 0.0043  0.0064  0.0251  43  TRP A CB  
172  C  CG  . TRP A 51  ? 0.2560 0.2089 0.1998 0.0040  0.0085  0.0271  43  TRP A CG  
173  C  CD1 . TRP A 51  ? 0.2607 0.2169 0.2010 0.0050  0.0094  0.0268  43  TRP A CD1 
174  C  CD2 . TRP A 51  ? 0.2637 0.2158 0.2122 0.0026  0.0102  0.0297  43  TRP A CD2 
175  N  NE1 . TRP A 51  ? 0.2701 0.2278 0.2124 0.0044  0.0117  0.0292  43  TRP A NE1 
176  C  CE2 . TRP A 51  ? 0.2675 0.2227 0.2150 0.0029  0.0122  0.0312  43  TRP A CE2 
177  C  CE3 . TRP A 51  ? 0.2721 0.2211 0.2259 0.0012  0.0101  0.0309  43  TRP A CE3 
178  C  CZ2 . TRP A 51  ? 0.2733 0.2288 0.2250 0.0016  0.0142  0.0340  43  TRP A CZ2 
179  C  CZ3 . TRP A 51  ? 0.2733 0.2223 0.2317 -0.0001 0.0119  0.0336  43  TRP A CZ3 
180  C  CH2 . TRP A 51  ? 0.2791 0.2314 0.2364 0.0001  0.0140  0.0352  43  TRP A CH2 
181  N  N   . LYS A 52  ? 0.2604 0.2093 0.2067 0.0057  0.0088  0.0352  44  LYS A N   
182  C  CA  . LYS A 52  ? 0.2725 0.2190 0.2241 0.0048  0.0098  0.0388  44  LYS A CA  
183  C  C   . LYS A 52  ? 0.2641 0.2080 0.2172 0.0056  0.0084  0.0395  44  LYS A C   
184  O  O   . LYS A 52  ? 0.2628 0.2037 0.2214 0.0047  0.0086  0.0412  44  LYS A O   
185  C  CB  . LYS A 52  ? 0.3038 0.2529 0.2544 0.0056  0.0123  0.0440  44  LYS A CB  
186  C  CG  . LYS A 52  ? 0.3173 0.2694 0.2672 0.0048  0.0140  0.0435  44  LYS A CG  
187  C  CD  . LYS A 52  ? 0.3475 0.3030 0.2955 0.0059  0.0166  0.0483  44  LYS A CD  
188  C  CE  . LYS A 52  ? 0.3710 0.3281 0.3222 0.0043  0.0187  0.0487  44  LYS A CE  
189  N  NZ  . LYS A 52  ? 0.3874 0.3493 0.3348 0.0057  0.0213  0.0518  44  LYS A NZ  
190  N  N   . ASP A 53  ? 0.2683 0.2132 0.2169 0.0074  0.0068  0.0382  45  ASP A N   
191  C  CA  . ASP A 53  ? 0.2707 0.2131 0.2208 0.0082  0.0052  0.0382  45  ASP A CA  
192  C  C   . ASP A 53  ? 0.2605 0.2015 0.2120 0.0074  0.0035  0.0331  45  ASP A C   
193  O  O   . ASP A 53  ? 0.2642 0.2039 0.2163 0.0083  0.0020  0.0321  45  ASP A O   
194  C  CB  . ASP A 53  ? 0.2872 0.2321 0.2322 0.0107  0.0044  0.0401  45  ASP A CB  
195  C  CG  . ASP A 53  ? 0.3018 0.2483 0.2456 0.0118  0.0061  0.0459  45  ASP A CG  
196  O  OD1 . ASP A 53  ? 0.2958 0.2404 0.2445 0.0106  0.0076  0.0490  45  ASP A OD1 
197  O  OD2 . ASP A 53  ? 0.3259 0.2759 0.2639 0.0138  0.0059  0.0473  45  ASP A OD2 
198  N  N   . GLY A 54  ? 0.2466 0.1879 0.1988 0.0058  0.0037  0.0300  46  GLY A N   
199  C  CA  . GLY A 54  ? 0.2353 0.1760 0.1880 0.0051  0.0022  0.0254  46  GLY A CA  
200  C  C   . GLY A 54  ? 0.2239 0.1666 0.1719 0.0065  0.0008  0.0236  46  GLY A C   
201  O  O   . GLY A 54  ? 0.2323 0.1774 0.1761 0.0077  0.0011  0.0248  46  GLY A O   
202  N  N   . CYS A 55  ? 0.2160 0.1579 0.1650 0.0065  -0.0006 0.0207  47  CYS A N   
203  C  CA  . CYS A 55  ? 0.2052 0.1488 0.1509 0.0080  -0.0021 0.0193  47  CYS A CA  
204  C  C   . CYS A 55  ? 0.2026 0.1446 0.1511 0.0085  -0.0032 0.0184  47  CYS A C   
205  O  O   . CYS A 55  ? 0.1918 0.1335 0.1420 0.0078  -0.0038 0.0153  47  CYS A O   
206  C  CB  . CYS A 55  ? 0.1958 0.1414 0.1395 0.0072  -0.0025 0.0162  47  CYS A CB  
207  S  SG  . CYS A 55  ? 0.1873 0.1350 0.1280 0.0086  -0.0044 0.0142  47  CYS A SG  
208  N  N   . ALA A 56  ? 0.2064 0.1475 0.1555 0.0100  -0.0033 0.0213  48  ALA A N   
209  C  CA  . ALA A 56  ? 0.2062 0.1452 0.1591 0.0106  -0.0041 0.0211  48  ALA A CA  
210  C  C   . ALA A 56  ? 0.2080 0.1486 0.1595 0.0116  -0.0057 0.0187  48  ALA A C   
211  O  O   . ALA A 56  ? 0.2096 0.1528 0.1571 0.0124  -0.0065 0.0185  48  ALA A O   
212  C  CB  . ALA A 56  ? 0.2095 0.1471 0.1637 0.0119  -0.0039 0.0256  48  ALA A CB  
213  N  N   . PRO A 57  ? 0.2103 0.1497 0.1655 0.0117  -0.0063 0.0166  49  PRO A N   
214  C  CA  . PRO A 57  ? 0.2134 0.1498 0.1739 0.0112  -0.0058 0.0163  49  PRO A CA  
215  C  C   . PRO A 57  ? 0.2151 0.1513 0.1769 0.0093  -0.0052 0.0128  49  PRO A C   
216  O  O   . PRO A 57  ? 0.2205 0.1546 0.1865 0.0089  -0.0050 0.0113  49  PRO A O   
217  C  CB  . PRO A 57  ? 0.2133 0.1494 0.1761 0.0127  -0.0070 0.0151  49  PRO A CB  
218  C  CG  . PRO A 57  ? 0.2073 0.1468 0.1667 0.0128  -0.0078 0.0128  49  PRO A CG  
219  C  CD  . PRO A 57  ? 0.2067 0.1479 0.1614 0.0129  -0.0078 0.0148  49  PRO A CD  
220  N  N   . VAL A 58  ? 0.2120 0.1503 0.1705 0.0082  -0.0050 0.0114  50  VAL A N   
221  C  CA  . VAL A 58  ? 0.2093 0.1482 0.1686 0.0066  -0.0047 0.0082  50  VAL A CA  
222  C  C   . VAL A 58  ? 0.2007 0.1386 0.1608 0.0049  -0.0037 0.0085  50  VAL A C   
223  O  O   . VAL A 58  ? 0.2000 0.1374 0.1627 0.0039  -0.0036 0.0061  50  VAL A O   
224  C  CB  . VAL A 58  ? 0.2125 0.1544 0.1684 0.0064  -0.0052 0.0065  50  VAL A CB  
225  C  CG1 . VAL A 58  ? 0.2141 0.1570 0.1705 0.0048  -0.0048 0.0037  50  VAL A CG1 
226  C  CG2 . VAL A 58  ? 0.2155 0.1585 0.1715 0.0079  -0.0062 0.0057  50  VAL A CG2 
227  N  N   . PHE A 59  ? 0.1946 0.1329 0.1527 0.0048  -0.0030 0.0111  51  PHE A N   
228  C  CA  . PHE A 59  ? 0.1907 0.1288 0.1496 0.0032  -0.0021 0.0115  51  PHE A CA  
229  C  C   . PHE A 59  ? 0.1860 0.1221 0.1471 0.0031  -0.0011 0.0150  51  PHE A C   
230  O  O   . PHE A 59  ? 0.1883 0.1247 0.1477 0.0044  -0.0008 0.0181  51  PHE A O   
231  C  CB  . PHE A 59  ? 0.1921 0.1327 0.1469 0.0028  -0.0019 0.0115  51  PHE A CB  
232  C  CG  . PHE A 59  ? 0.1965 0.1392 0.1497 0.0026  -0.0027 0.0085  51  PHE A CG  
233  C  CD1 . PHE A 59  ? 0.1997 0.1427 0.1545 0.0012  -0.0028 0.0060  51  PHE A CD1 
234  C  CD2 . PHE A 59  ? 0.2012 0.1456 0.1513 0.0036  -0.0034 0.0084  51  PHE A CD2 
235  C  CE1 . PHE A 59  ? 0.2020 0.1472 0.1553 0.0010  -0.0034 0.0039  51  PHE A CE1 
236  C  CE2 . PHE A 59  ? 0.2051 0.1513 0.1543 0.0033  -0.0041 0.0061  51  PHE A CE2 
237  C  CZ  . PHE A 59  ? 0.2046 0.1513 0.1554 0.0019  -0.0040 0.0041  51  PHE A CZ  
238  N  N   . SER A 60  ? 0.1790 0.1139 0.1438 0.0016  -0.0005 0.0146  52  SER A N   
239  C  CA  . SER A 60  ? 0.1814 0.1145 0.1494 0.0012  0.0006  0.0180  52  SER A CA  
240  C  C   . SER A 60  ? 0.1799 0.1152 0.1450 0.0009  0.0019  0.0204  52  SER A C   
241  O  O   . SER A 60  ? 0.1793 0.1169 0.1410 0.0005  0.0018  0.0186  52  SER A O   
242  C  CB  . SER A 60  ? 0.1806 0.1116 0.1543 -0.0005 0.0006  0.0162  52  SER A CB  
243  O  OG  . SER A 60  ? 0.1795 0.1125 0.1524 -0.0020 0.0006  0.0139  52  SER A OG  
244  N  N   . PRO A 61  ? 0.1771 0.1117 0.1439 0.0010  0.0032  0.0245  53  PRO A N   
245  C  CA  . PRO A 61  ? 0.1770 0.1139 0.1419 0.0005  0.0047  0.0266  53  PRO A CA  
246  C  C   . PRO A 61  ? 0.1706 0.1084 0.1370 -0.0013 0.0048  0.0239  53  PRO A C   
247  O  O   . PRO A 61  ? 0.1681 0.1085 0.1311 -0.0013 0.0052  0.0235  53  PRO A O   
248  C  CB  . PRO A 61  ? 0.1809 0.1164 0.1496 0.0005  0.0061  0.0314  53  PRO A CB  
249  C  CG  . PRO A 61  ? 0.1845 0.1181 0.1537 0.0020  0.0052  0.0327  53  PRO A CG  
250  C  CD  . PRO A 61  ? 0.1832 0.1152 0.1535 0.0017  0.0034  0.0278  53  PRO A CD  
251  N  N   . ARG A 62  ? 0.1711 0.1069 0.1427 -0.0028 0.0043  0.0222  54  ARG A N   
252  C  CA  . ARG A 62  ? 0.1709 0.1075 0.1446 -0.0047 0.0043  0.0200  54  ARG A CA  
253  C  C   . ARG A 62  ? 0.1640 0.1027 0.1339 -0.0047 0.0031  0.0163  54  ARG A C   
254  O  O   . ARG A 62  ? 0.1594 0.1003 0.1282 -0.0053 0.0034  0.0158  54  ARG A O   
255  C  CB  . ARG A 62  ? 0.1751 0.1092 0.1557 -0.0062 0.0037  0.0186  54  ARG A CB  
256  C  CG  . ARG A 62  ? 0.1801 0.1153 0.1634 -0.0081 0.0035  0.0165  54  ARG A CG  
257  C  CD  . ARG A 62  ? 0.1829 0.1202 0.1663 -0.0086 0.0052  0.0197  54  ARG A CD  
258  N  NE  . ARG A 62  ? 0.1855 0.1238 0.1727 -0.0105 0.0049  0.0179  54  ARG A NE  
259  C  CZ  . ARG A 62  ? 0.1890 0.1295 0.1771 -0.0112 0.0062  0.0198  54  ARG A CZ  
260  N  NH1 . ARG A 62  ? 0.1896 0.1317 0.1749 -0.0101 0.0081  0.0234  54  ARG A NH1 
261  N  NH2 . ARG A 62  ? 0.1887 0.1303 0.1808 -0.0129 0.0056  0.0180  54  ARG A NH2 
262  N  N   . GLN A 63  ? 0.1632 0.1013 0.1314 -0.0039 0.0018  0.0139  55  GLN A N   
263  C  CA  . GLN A 63  ? 0.1619 0.1022 0.1264 -0.0037 0.0008  0.0111  55  GLN A CA  
264  C  C   . GLN A 63  ? 0.1655 0.1081 0.1255 -0.0029 0.0013  0.0124  55  GLN A C   
265  O  O   . GLN A 63  ? 0.1650 0.1096 0.1236 -0.0034 0.0012  0.0112  55  GLN A O   
266  C  CB  . GLN A 63  ? 0.1596 0.0993 0.1233 -0.0028 -0.0003 0.0090  55  GLN A CB  
267  C  CG  . GLN A 63  ? 0.1529 0.0949 0.1132 -0.0026 -0.0012 0.0065  55  GLN A CG  
268  C  CD  . GLN A 63  ? 0.1507 0.0940 0.1122 -0.0041 -0.0017 0.0040  55  GLN A CD  
269  O  OE1 . GLN A 63  ? 0.1493 0.0924 0.1121 -0.0044 -0.0025 0.0013  55  GLN A OE1 
270  N  NE2 . GLN A 63  ? 0.1472 0.0920 0.1082 -0.0050 -0.0014 0.0047  55  GLN A NE2 
271  N  N   . MET A 64  ? 0.1730 0.1156 0.1308 -0.0014 0.0019  0.0150  56  MET A N   
272  C  CA  . MET A 64  ? 0.1747 0.1196 0.1283 -0.0004 0.0024  0.0159  56  MET A CA  
273  C  C   . MET A 64  ? 0.1726 0.1189 0.1270 -0.0012 0.0039  0.0173  56  MET A C   
274  O  O   . MET A 64  ? 0.1698 0.1183 0.1222 -0.0011 0.0039  0.0163  56  MET A O   
275  C  CB  . MET A 64  ? 0.1856 0.1306 0.1365 0.0014  0.0026  0.0182  56  MET A CB  
276  C  CG  . MET A 64  ? 0.1903 0.1346 0.1399 0.0025  0.0011  0.0168  56  MET A CG  
277  S  SD  . MET A 64  ? 0.2081 0.1545 0.1548 0.0026  -0.0003 0.0133  56  MET A SD  
278  C  CE  . MET A 64  ? 0.2052 0.1507 0.1553 0.0009  -0.0008 0.0106  56  MET A CE  
279  N  N   . GLU A 65  ? 0.1709 0.1162 0.1289 -0.0019 0.0050  0.0196  57  GLU A N   
280  C  CA  . GLU A 65  ? 0.1694 0.1161 0.1291 -0.0028 0.0066  0.0212  57  GLU A CA  
281  C  C   . GLU A 65  ? 0.1653 0.1132 0.1264 -0.0041 0.0059  0.0185  57  GLU A C   
282  O  O   . GLU A 65  ? 0.1615 0.1117 0.1212 -0.0040 0.0066  0.0185  57  GLU A O   
283  C  CB  . GLU A 65  ? 0.1722 0.1173 0.1371 -0.0038 0.0077  0.0240  57  GLU A CB  
284  C  CG  . GLU A 65  ? 0.1741 0.1211 0.1413 -0.0047 0.0095  0.0258  57  GLU A CG  
285  C  CD  . GLU A 65  ? 0.1790 0.1246 0.1519 -0.0058 0.0108  0.0291  57  GLU A CD  
286  O  OE1 . GLU A 65  ? 0.1779 0.1205 0.1545 -0.0063 0.0100  0.0290  57  GLU A OE1 
287  O  OE2 . GLU A 65  ? 0.1813 0.1289 0.1553 -0.0060 0.0128  0.0317  57  GLU A OE2 
288  N  N   . LEU A 66  ? 0.1615 0.1080 0.1253 -0.0053 0.0046  0.0161  58  LEU A N   
289  C  CA  . LEU A 66  ? 0.1556 0.1034 0.1205 -0.0066 0.0037  0.0136  58  LEU A CA  
290  C  C   . LEU A 66  ? 0.1538 0.1034 0.1145 -0.0057 0.0030  0.0122  58  LEU A C   
291  O  O   . LEU A 66  ? 0.1517 0.1033 0.1125 -0.0061 0.0031  0.0119  58  LEU A O   
292  C  CB  . LEU A 66  ? 0.1548 0.1012 0.1223 -0.0076 0.0022  0.0111  58  LEU A CB  
293  C  CG  . LEU A 66  ? 0.1577 0.1021 0.1307 -0.0088 0.0025  0.0117  58  LEU A CG  
294  C  CD1 . LEU A 66  ? 0.1612 0.1042 0.1360 -0.0093 0.0009  0.0085  58  LEU A CD1 
295  C  CD2 . LEU A 66  ? 0.1559 0.1018 0.1324 -0.0103 0.0031  0.0123  58  LEU A CD2 
296  N  N   . HIS A 67  ? 0.1535 0.1026 0.1113 -0.0046 0.0022  0.0113  59  HIS A N   
297  C  CA  . HIS A 67  ? 0.1520 0.1026 0.1070 -0.0041 0.0012  0.0097  59  HIS A CA  
298  C  C   . HIS A 67  ? 0.1547 0.1070 0.1075 -0.0031 0.0020  0.0106  59  HIS A C   
299  O  O   . HIS A 67  ? 0.1554 0.1092 0.1081 -0.0033 0.0017  0.0097  59  HIS A O   
300  C  CB  . HIS A 67  ? 0.1471 0.0968 0.1000 -0.0032 0.0003  0.0087  59  HIS A CB  
301  C  CG  . HIS A 67  ? 0.1417 0.0928 0.0932 -0.0032 -0.0009 0.0068  59  HIS A CG  
302  N  ND1 . HIS A 67  ? 0.1377 0.0885 0.0880 -0.0026 -0.0018 0.0057  59  HIS A ND1 
303  C  CD2 . HIS A 67  ? 0.1393 0.0921 0.0910 -0.0038 -0.0013 0.0061  59  HIS A CD2 
304  C  CE1 . HIS A 67  ? 0.1362 0.0886 0.0860 -0.0030 -0.0026 0.0045  59  HIS A CE1 
305  N  NE2 . HIS A 67  ? 0.1362 0.0897 0.0868 -0.0037 -0.0023 0.0048  59  HIS A NE2 
306  N  N   . TYR A 68  ? 0.1588 0.1109 0.1101 -0.0020 0.0032  0.0126  60  TYR A N   
307  C  CA  . TYR A 68  ? 0.1615 0.1157 0.1105 -0.0008 0.0041  0.0133  60  TYR A CA  
308  C  C   . TYR A 68  ? 0.1641 0.1197 0.1152 -0.0014 0.0057  0.0146  60  TYR A C   
309  O  O   . TYR A 68  ? 0.1637 0.1211 0.1147 -0.0012 0.0057  0.0135  60  TYR A O   
310  C  CB  . TYR A 68  ? 0.1666 0.1206 0.1127 0.0008  0.0047  0.0152  60  TYR A CB  
311  C  CG  . TYR A 68  ? 0.1691 0.1255 0.1119 0.0024  0.0056  0.0156  60  TYR A CG  
312  C  CD1 . TYR A 68  ? 0.1707 0.1284 0.1116 0.0032  0.0046  0.0131  60  TYR A CD1 
313  C  CD2 . TYR A 68  ? 0.1755 0.1330 0.1172 0.0032  0.0074  0.0184  60  TYR A CD2 
314  C  CE1 . TYR A 68  ? 0.1714 0.1315 0.1093 0.0048  0.0053  0.0129  60  TYR A CE1 
315  C  CE2 . TYR A 68  ? 0.1785 0.1388 0.1168 0.0049  0.0083  0.0186  60  TYR A CE2 
316  C  CZ  . TYR A 68  ? 0.1745 0.1360 0.1108 0.0058  0.0072  0.0155  60  TYR A CZ  
317  O  OH  . TYR A 68  ? 0.1727 0.1372 0.1057 0.0076  0.0080  0.0153  60  TYR A OH  
318  N  N   . THR A 69  ? 0.1640 0.1190 0.1175 -0.0020 0.0070  0.0169  61  THR A N   
319  C  CA  . THR A 69  ? 0.1664 0.1232 0.1221 -0.0024 0.0088  0.0186  61  THR A CA  
320  C  C   . THR A 69  ? 0.1690 0.1261 0.1290 -0.0042 0.0084  0.0174  61  THR A C   
321  O  O   . THR A 69  ? 0.1709 0.1299 0.1331 -0.0046 0.0097  0.0184  61  THR A O   
322  C  CB  . THR A 69  ? 0.1697 0.1262 0.1271 -0.0025 0.0107  0.0221  61  THR A CB  
323  O  OG1 . THR A 69  ? 0.1682 0.1222 0.1301 -0.0042 0.0102  0.0224  61  THR A OG1 
324  C  CG2 . THR A 69  ? 0.1723 0.1287 0.1254 -0.0007 0.0111  0.0238  61  THR A CG2 
325  N  N   . LYS A 70  ? 0.1675 0.1231 0.1288 -0.0053 0.0065  0.0154  62  LYS A N   
326  C  CA  . LYS A 70  ? 0.1672 0.1236 0.1318 -0.0068 0.0057  0.0140  62  LYS A CA  
327  C  C   . LYS A 70  ? 0.1626 0.1200 0.1254 -0.0065 0.0041  0.0118  62  LYS A C   
328  O  O   . LYS A 70  ? 0.1623 0.1216 0.1258 -0.0065 0.0043  0.0116  62  LYS A O   
329  C  CB  . LYS A 70  ? 0.1727 0.1274 0.1410 -0.0084 0.0048  0.0134  62  LYS A CB  
330  C  CG  . LYS A 70  ? 0.1819 0.1352 0.1531 -0.0088 0.0062  0.0158  62  LYS A CG  
331  C  CD  . LYS A 70  ? 0.1873 0.1425 0.1616 -0.0093 0.0081  0.0181  62  LYS A CD  
332  C  CE  . LYS A 70  ? 0.1960 0.1500 0.1726 -0.0093 0.0099  0.0213  62  LYS A CE  
333  N  NZ  . LYS A 70  ? 0.1968 0.1532 0.1764 -0.0097 0.0120  0.0238  62  LYS A NZ  
334  N  N   . HIS A 71  ? 0.1588 0.1150 0.1195 -0.0064 0.0027  0.0103  63  HIS A N   
335  C  CA  . HIS A 71  ? 0.1571 0.1144 0.1167 -0.0064 0.0012  0.0087  63  HIS A CA  
336  C  C   . HIS A 71  ? 0.1562 0.1146 0.1137 -0.0050 0.0016  0.0087  63  HIS A C   
337  O  O   . HIS A 71  ? 0.1542 0.1141 0.1130 -0.0051 0.0014  0.0083  63  HIS A O   
338  C  CB  . HIS A 71  ? 0.1552 0.1114 0.1133 -0.0065 -0.0001 0.0073  63  HIS A CB  
339  C  CG  . HIS A 71  ? 0.1536 0.1092 0.1140 -0.0078 -0.0007 0.0064  63  HIS A CG  
340  N  ND1 . HIS A 71  ? 0.1536 0.1107 0.1157 -0.0089 -0.0018 0.0053  63  HIS A ND1 
341  C  CD2 . HIS A 71  ? 0.1523 0.1059 0.1139 -0.0080 -0.0005 0.0065  63  HIS A CD2 
342  C  CE1 . HIS A 71  ? 0.1533 0.1095 0.1173 -0.0098 -0.0023 0.0042  63  HIS A CE1 
343  N  NE2 . HIS A 71  ? 0.1535 0.1074 0.1175 -0.0093 -0.0015 0.0049  63  HIS A NE2 
344  N  N   . HIS A 72  ? 0.1601 0.1177 0.1147 -0.0037 0.0021  0.0090  64  HIS A N   
345  C  CA  . HIS A 72  ? 0.1604 0.1191 0.1131 -0.0022 0.0021  0.0084  64  HIS A CA  
346  C  C   . HIS A 72  ? 0.1666 0.1271 0.1205 -0.0018 0.0036  0.0091  64  HIS A C   
347  O  O   . HIS A 72  ? 0.1652 0.1269 0.1200 -0.0015 0.0033  0.0081  64  HIS A O   
348  C  CB  . HIS A 72  ? 0.1590 0.1169 0.1082 -0.0008 0.0021  0.0084  64  HIS A CB  
349  C  CG  . HIS A 72  ? 0.1551 0.1139 0.1025 0.0005  0.0015  0.0070  64  HIS A CG  
350  N  ND1 . HIS A 72  ? 0.1558 0.1144 0.1002 0.0019  0.0011  0.0065  64  HIS A ND1 
351  C  CD2 . HIS A 72  ? 0.1513 0.1112 0.1000 0.0007  0.0010  0.0057  64  HIS A CD2 
352  C  CE1 . HIS A 72  ? 0.1557 0.1152 0.0996 0.0028  0.0004  0.0048  64  HIS A CE1 
353  N  NE2 . HIS A 72  ? 0.1537 0.1138 0.1004 0.0021  0.0003  0.0043  64  HIS A NE2 
354  N  N   . LYS A 73  ? 0.1770 0.1377 0.1314 -0.0019 0.0052  0.0109  65  LYS A N   
355  C  CA  . LYS A 73  ? 0.1843 0.1471 0.1403 -0.0016 0.0069  0.0117  65  LYS A CA  
356  C  C   . LYS A 73  ? 0.1779 0.1418 0.1377 -0.0026 0.0063  0.0109  65  LYS A C   
357  O  O   . LYS A 73  ? 0.1859 0.1516 0.1466 -0.0018 0.0068  0.0103  65  LYS A O   
358  C  CB  . LYS A 73  ? 0.1949 0.1578 0.1521 -0.0020 0.0088  0.0143  65  LYS A CB  
359  C  CG  . LYS A 73  ? 0.2001 0.1656 0.1599 -0.0020 0.0108  0.0155  65  LYS A CG  
360  C  CD  . LYS A 73  ? 0.2128 0.1793 0.1716 -0.0013 0.0131  0.0183  65  LYS A CD  
361  C  CE  . LYS A 73  ? 0.2185 0.1870 0.1814 -0.0021 0.0153  0.0204  65  LYS A CE  
362  N  NZ  . LYS A 73  ? 0.2217 0.1922 0.1880 -0.0025 0.0151  0.0190  65  LYS A NZ  
363  N  N   . ALA A 74  ? 0.1721 0.1351 0.1341 -0.0043 0.0050  0.0108  66  ALA A N   
364  C  CA  . ALA A 74  ? 0.1649 0.1293 0.1304 -0.0052 0.0042  0.0102  66  ALA A CA  
365  C  C   . ALA A 74  ? 0.1603 0.1252 0.1251 -0.0044 0.0030  0.0089  66  ALA A C   
366  O  O   . ALA A 74  ? 0.1551 0.1217 0.1225 -0.0042 0.0030  0.0087  66  ALA A O   
367  C  CB  . ALA A 74  ? 0.1658 0.1296 0.1335 -0.0070 0.0029  0.0101  66  ALA A CB  
368  N  N   . TYR A 75  ? 0.1560 0.1196 0.1180 -0.0039 0.0019  0.0080  67  TYR A N   
369  C  CA  . TYR A 75  ? 0.1511 0.1149 0.1131 -0.0032 0.0007  0.0069  67  TYR A CA  
370  C  C   . TYR A 75  ? 0.1518 0.1166 0.1137 -0.0016 0.0018  0.0062  67  TYR A C   
371  O  O   . TYR A 75  ? 0.1559 0.1217 0.1203 -0.0012 0.0013  0.0056  67  TYR A O   
372  C  CB  . TYR A 75  ? 0.1497 0.1121 0.1091 -0.0031 -0.0005 0.0061  67  TYR A CB  
373  C  CG  . TYR A 75  ? 0.1507 0.1127 0.1103 -0.0045 -0.0017 0.0063  67  TYR A CG  
374  C  CD1 . TYR A 75  ? 0.1499 0.1131 0.1117 -0.0054 -0.0027 0.0066  67  TYR A CD1 
375  C  CD2 . TYR A 75  ? 0.1513 0.1119 0.1087 -0.0046 -0.0017 0.0062  67  TYR A CD2 
376  C  CE1 . TYR A 75  ? 0.1505 0.1140 0.1120 -0.0065 -0.0038 0.0065  67  TYR A CE1 
377  C  CE2 . TYR A 75  ? 0.1534 0.1140 0.1109 -0.0057 -0.0027 0.0059  67  TYR A CE2 
378  C  CZ  . TYR A 75  ? 0.1530 0.1151 0.1123 -0.0066 -0.0037 0.0060  67  TYR A CZ  
379  O  OH  . TYR A 75  ? 0.1623 0.1250 0.1212 -0.0075 -0.0046 0.0055  67  TYR A OH  
380  N  N   . VAL A 76  ? 0.1499 0.1148 0.1092 -0.0005 0.0032  0.0064  68  VAL A N   
381  C  CA  . VAL A 76  ? 0.1527 0.1192 0.1114 0.0013  0.0044  0.0055  68  VAL A CA  
382  C  C   . VAL A 76  ? 0.1531 0.1217 0.1154 0.0012  0.0057  0.0060  68  VAL A C   
383  O  O   . VAL A 76  ? 0.1479 0.1176 0.1120 0.0022  0.0057  0.0047  68  VAL A O   
384  C  CB  . VAL A 76  ? 0.1548 0.1216 0.1095 0.0025  0.0058  0.0059  68  VAL A CB  
385  C  CG1 . VAL A 76  ? 0.1562 0.1253 0.1099 0.0044  0.0074  0.0050  68  VAL A CG1 
386  C  CG2 . VAL A 76  ? 0.1556 0.1207 0.1071 0.0029  0.0043  0.0050  68  VAL A CG2 
387  N  N   . ASP A 77  ? 0.1571 0.1262 0.1210 0.0000  0.0068  0.0079  69  ASP A N   
388  C  CA  . ASP A 77  ? 0.1601 0.1315 0.1279 -0.0002 0.0080  0.0086  69  ASP A CA  
389  C  C   . ASP A 77  ? 0.1678 0.1396 0.1395 -0.0007 0.0064  0.0077  69  ASP A C   
390  O  O   . ASP A 77  ? 0.1593 0.1330 0.1337 0.0002  0.0070  0.0071  69  ASP A O   
391  C  CB  . ASP A 77  ? 0.1585 0.1301 0.1282 -0.0018 0.0091  0.0107  69  ASP A CB  
392  C  CG  . ASP A 77  ? 0.1587 0.1304 0.1255 -0.0011 0.0111  0.0123  69  ASP A CG  
393  O  OD1 . ASP A 77  ? 0.1550 0.1275 0.1183 0.0007  0.0121  0.0117  69  ASP A OD1 
394  O  OD2 . ASP A 77  ? 0.1556 0.1265 0.1237 -0.0025 0.0116  0.0140  69  ASP A OD2 
395  N  N   . LYS A 78  ? 0.1787 0.1490 0.1506 -0.0020 0.0043  0.0078  70  LYS A N   
396  C  CA  . LYS A 78  ? 0.1891 0.1602 0.1646 -0.0025 0.0026  0.0077  70  LYS A CA  
397  C  C   . LYS A 78  ? 0.1902 0.1609 0.1658 -0.0011 0.0019  0.0062  70  LYS A C   
398  O  O   . LYS A 78  ? 0.1819 0.1537 0.1613 -0.0007 0.0013  0.0060  70  LYS A O   
399  C  CB  . LYS A 78  ? 0.1989 0.1690 0.1741 -0.0042 0.0008  0.0082  70  LYS A CB  
400  C  CG  . LYS A 78  ? 0.2168 0.1884 0.1955 -0.0049 -0.0009 0.0087  70  LYS A CG  
401  C  CD  . LYS A 78  ? 0.2372 0.2109 0.2198 -0.0057 -0.0004 0.0095  70  LYS A CD  
402  C  CE  . LYS A 78  ? 0.2495 0.2250 0.2356 -0.0063 -0.0023 0.0101  70  LYS A CE  
403  N  NZ  . LYS A 78  ? 0.2632 0.2388 0.2482 -0.0079 -0.0041 0.0103  70  LYS A NZ  
404  N  N   . LEU A 79  ? 0.1877 0.1567 0.1597 -0.0003 0.0017  0.0052  71  LEU A N   
405  C  CA  . LEU A 79  ? 0.1892 0.1578 0.1618 0.0011  0.0010  0.0034  71  LEU A CA  
406  C  C   . LEU A 79  ? 0.1932 0.1636 0.1679 0.0028  0.0024  0.0022  71  LEU A C   
407  O  O   . LEU A 79  ? 0.1888 0.1597 0.1674 0.0034  0.0017  0.0014  71  LEU A O   
408  C  CB  . LEU A 79  ? 0.1880 0.1550 0.1565 0.0018  0.0006  0.0022  71  LEU A CB  
409  C  CG  . LEU A 79  ? 0.1896 0.1562 0.1584 0.0035  0.0001  -0.0002 71  LEU A CG  
410  C  CD1 . LEU A 79  ? 0.1861 0.1520 0.1593 0.0031  -0.0018 -0.0002 71  LEU A CD1 
411  C  CD2 . LEU A 79  ? 0.1903 0.1558 0.1548 0.0040  -0.0003 -0.0012 71  LEU A CD2 
412  N  N   . ASN A 80  ? 0.2042 0.1760 0.1766 0.0035  0.0045  0.0022  72  ASN A N   
413  C  CA  . ASN A 80  ? 0.2105 0.1847 0.1846 0.0052  0.0063  0.0011  72  ASN A CA  
414  C  C   . ASN A 80  ? 0.2101 0.1860 0.1899 0.0047  0.0064  0.0019  72  ASN A C   
415  O  O   . ASN A 80  ? 0.2056 0.1825 0.1887 0.0061  0.0065  0.0004  72  ASN A O   
416  C  CB  . ASN A 80  ? 0.2125 0.1883 0.1829 0.0059  0.0088  0.0018  72  ASN A CB  
417  C  CG  . ASN A 80  ? 0.2222 0.1972 0.1872 0.0071  0.0088  0.0004  72  ASN A CG  
418  O  OD1 . ASN A 80  ? 0.2413 0.2159 0.2060 0.0085  0.0077  -0.0022 72  ASN A OD1 
419  N  ND2 . ASN A 80  ? 0.2162 0.1911 0.1774 0.0067  0.0098  0.0022  72  ASN A ND2 
420  N  N   . ALA A 81  ? 0.2107 0.1867 0.1919 0.0029  0.0062  0.0041  73  ALA A N   
421  C  CA  . ALA A 81  ? 0.2113 0.1892 0.1981 0.0023  0.0060  0.0050  73  ALA A CA  
422  C  C   . ALA A 81  ? 0.2108 0.1879 0.2011 0.0025  0.0037  0.0045  73  ALA A C   
423  O  O   . ALA A 81  ? 0.2206 0.1993 0.2155 0.0034  0.0038  0.0041  73  ALA A O   
424  C  CB  . ALA A 81  ? 0.2104 0.1888 0.1981 0.0002  0.0058  0.0071  73  ALA A CB  
425  N  N   . LEU A 82  ? 0.2068 0.1817 0.1952 0.0016  0.0017  0.0048  74  LEU A N   
426  C  CA  . LEU A 82  ? 0.2033 0.1775 0.1951 0.0017  -0.0005 0.0050  74  LEU A CA  
427  C  C   . LEU A 82  ? 0.2018 0.1751 0.1951 0.0036  -0.0006 0.0027  74  LEU A C   
428  O  O   . LEU A 82  ? 0.1978 0.1711 0.1958 0.0041  -0.0018 0.0027  74  LEU A O   
429  C  CB  . LEU A 82  ? 0.2077 0.1803 0.1973 0.0002  -0.0024 0.0062  74  LEU A CB  
430  C  CG  . LEU A 82  ? 0.2115 0.1851 0.2006 -0.0017 -0.0030 0.0081  74  LEU A CG  
431  C  CD1 . LEU A 82  ? 0.2091 0.1814 0.1951 -0.0029 -0.0045 0.0088  74  LEU A CD1 
432  C  CD2 . LEU A 82  ? 0.2171 0.1929 0.2113 -0.0021 -0.0041 0.0095  74  LEU A CD2 
433  N  N   . ALA A 83  ? 0.1962 0.1687 0.1856 0.0047  0.0005  0.0007  75  ALA A N   
434  C  CA  . ALA A 83  ? 0.1938 0.1653 0.1846 0.0065  0.0000  -0.0020 75  ALA A CA  
435  C  C   . ALA A 83  ? 0.1985 0.1721 0.1931 0.0084  0.0014  -0.0039 75  ALA A C   
436  O  O   . ALA A 83  ? 0.1858 0.1588 0.1839 0.0098  0.0006  -0.0060 75  ALA A O   
437  C  CB  . ALA A 83  ? 0.1903 0.1608 0.1757 0.0071  0.0003  -0.0038 75  ALA A CB  
438  N  N   . GLY A 84  ? 0.2084 0.1846 0.2025 0.0086  0.0035  -0.0033 76  GLY A N   
439  C  CA  . GLY A 84  ? 0.2127 0.1915 0.2096 0.0107  0.0053  -0.0055 76  GLY A CA  
440  C  C   . GLY A 84  ? 0.2239 0.2022 0.2182 0.0128  0.0056  -0.0092 76  GLY A C   
441  O  O   . GLY A 84  ? 0.2256 0.2030 0.2142 0.0127  0.0057  -0.0097 76  GLY A O   
442  N  N   . THR A 85  ? 0.2302 0.2090 0.2290 0.0147  0.0055  -0.0120 77  THR A N   
443  C  CA  . THR A 85  ? 0.2370 0.2154 0.2343 0.0168  0.0053  -0.0163 77  THR A CA  
444  C  C   . THR A 85  ? 0.2410 0.2159 0.2422 0.0166  0.0023  -0.0175 77  THR A C   
445  O  O   . THR A 85  ? 0.2421 0.2163 0.2431 0.0182  0.0016  -0.0212 77  THR A O   
446  C  CB  . THR A 85  ? 0.2335 0.2149 0.2338 0.0194  0.0071  -0.0194 77  THR A CB  
447  O  OG1 . THR A 85  ? 0.2236 0.2046 0.2319 0.0194  0.0061  -0.0188 77  THR A OG1 
448  C  CG2 . THR A 85  ? 0.2357 0.2211 0.2328 0.0198  0.0104  -0.0181 77  THR A CG2 
449  N  N   . THR A 86  ? 0.2415 0.2146 0.2464 0.0147  0.0005  -0.0142 78  THR A N   
450  C  CA  . THR A 86  ? 0.2544 0.2245 0.2640 0.0144  -0.0021 -0.0145 78  THR A CA  
451  C  C   . THR A 86  ? 0.2550 0.2228 0.2611 0.0142  -0.0034 -0.0162 78  THR A C   
452  O  O   . THR A 86  ? 0.2517 0.2174 0.2621 0.0147  -0.0052 -0.0180 78  THR A O   
453  C  CB  . THR A 86  ? 0.2670 0.2361 0.2790 0.0121  -0.0036 -0.0099 78  THR A CB  
454  O  OG1 . THR A 86  ? 0.2988 0.2703 0.3137 0.0122  -0.0025 -0.0082 78  THR A OG1 
455  C  CG2 . THR A 86  ? 0.2753 0.2418 0.2935 0.0119  -0.0061 -0.0094 78  THR A CG2 
456  N  N   . TYR A 87  ? 0.2479 0.2162 0.2468 0.0135  -0.0026 -0.0156 79  TYR A N   
457  C  CA  . TYR A 87  ? 0.2421 0.2084 0.2378 0.0131  -0.0040 -0.0167 79  TYR A CA  
458  C  C   . TYR A 87  ? 0.2414 0.2092 0.2313 0.0149  -0.0028 -0.0202 79  TYR A C   
459  O  O   . TYR A 87  ? 0.2399 0.2069 0.2255 0.0144  -0.0036 -0.0205 79  TYR A O   
460  C  CB  . TYR A 87  ? 0.2414 0.2067 0.2338 0.0107  -0.0045 -0.0127 79  TYR A CB  
461  C  CG  . TYR A 87  ? 0.2366 0.2008 0.2341 0.0091  -0.0058 -0.0094 79  TYR A CG  
462  C  CD1 . TYR A 87  ? 0.2356 0.1977 0.2376 0.0086  -0.0079 -0.0091 79  TYR A CD1 
463  C  CD2 . TYR A 87  ? 0.2336 0.1994 0.2318 0.0082  -0.0050 -0.0065 79  TYR A CD2 
464  C  CE1 . TYR A 87  ? 0.2292 0.1907 0.2356 0.0073  -0.0091 -0.0057 79  TYR A CE1 
465  C  CE2 . TYR A 87  ? 0.2325 0.1979 0.2351 0.0069  -0.0064 -0.0034 79  TYR A CE2 
466  C  CZ  . TYR A 87  ? 0.2310 0.1944 0.2374 0.0065  -0.0084 -0.0029 79  TYR A CZ  
467  O  OH  . TYR A 87  ? 0.2468 0.2101 0.2573 0.0054  -0.0098 0.0005  79  TYR A OH  
468  N  N   . ASP A 88  ? 0.2315 0.2020 0.2214 0.0169  -0.0010 -0.0225 80  ASP A N   
469  C  CA  . ASP A 88  ? 0.2329 0.2058 0.2169 0.0187  0.0004  -0.0254 80  ASP A CA  
470  C  C   . ASP A 88  ? 0.2343 0.2060 0.2180 0.0200  -0.0015 -0.0298 80  ASP A C   
471  O  O   . ASP A 88  ? 0.2335 0.2038 0.2233 0.0207  -0.0031 -0.0324 80  ASP A O   
472  C  CB  . ASP A 88  ? 0.2314 0.2078 0.2164 0.0207  0.0029  -0.0270 80  ASP A CB  
473  C  CG  . ASP A 88  ? 0.2302 0.2087 0.2130 0.0197  0.0053  -0.0230 80  ASP A CG  
474  O  OD1 . ASP A 88  ? 0.2171 0.1939 0.1993 0.0173  0.0047  -0.0190 80  ASP A OD1 
475  O  OD2 . ASP A 88  ? 0.2277 0.2097 0.2095 0.0212  0.0078  -0.0239 80  ASP A OD2 
476  N  N   . GLY A 89  ? 0.2394 0.2117 0.2165 0.0202  -0.0016 -0.0303 81  GLY A N   
477  C  CA  . GLY A 89  ? 0.2497 0.2213 0.2262 0.0213  -0.0037 -0.0345 81  GLY A CA  
478  C  C   . GLY A 89  ? 0.2525 0.2207 0.2309 0.0192  -0.0062 -0.0329 81  GLY A C   
479  O  O   . GLY A 89  ? 0.2660 0.2336 0.2431 0.0197  -0.0080 -0.0356 81  GLY A O   
480  N  N   . LYS A 90  ? 0.2543 0.2205 0.2357 0.0170  -0.0064 -0.0286 82  LYS A N   
481  C  CA  . LYS A 90  ? 0.2423 0.2057 0.2254 0.0149  -0.0084 -0.0264 82  LYS A CA  
482  C  C   . LYS A 90  ? 0.2209 0.1846 0.1973 0.0138  -0.0080 -0.0239 82  LYS A C   
483  O  O   . LYS A 90  ? 0.2092 0.1745 0.1808 0.0138  -0.0059 -0.0219 82  LYS A O   
484  C  CB  . LYS A 90  ? 0.2577 0.2195 0.2462 0.0131  -0.0087 -0.0227 82  LYS A CB  
485  C  CG  . LYS A 90  ? 0.2719 0.2327 0.2684 0.0140  -0.0097 -0.0247 82  LYS A CG  
486  C  CD  . LYS A 90  ? 0.2908 0.2489 0.2925 0.0129  -0.0122 -0.0247 82  LYS A CD  
487  C  CE  . LYS A 90  ? 0.3142 0.2713 0.3224 0.0146  -0.0137 -0.0293 82  LYS A CE  
488  N  NZ  . LYS A 90  ? 0.3247 0.2818 0.3385 0.0152  -0.0130 -0.0287 82  LYS A NZ  
489  N  N   . SER A 91  ? 0.2058 0.1680 0.1824 0.0130  -0.0099 -0.0241 83  SER A N   
490  C  CA  . SER A 91  ? 0.1993 0.1613 0.1707 0.0117  -0.0097 -0.0214 83  SER A CA  
491  C  C   . SER A 91  ? 0.1878 0.1489 0.1605 0.0096  -0.0090 -0.0169 83  SER A C   
492  O  O   . SER A 91  ? 0.1789 0.1390 0.1571 0.0088  -0.0095 -0.0157 83  SER A O   
493  C  CB  . SER A 91  ? 0.1971 0.1579 0.1694 0.0113  -0.0119 -0.0227 83  SER A CB  
494  O  OG  . SER A 91  ? 0.1946 0.1533 0.1732 0.0097  -0.0132 -0.0211 83  SER A OG  
495  N  N   . ILE A 92  ? 0.1766 0.1382 0.1445 0.0088  -0.0080 -0.0144 84  ILE A N   
496  C  CA  . ILE A 92  ? 0.1746 0.1355 0.1431 0.0068  -0.0075 -0.0106 84  ILE A CA  
497  C  C   . ILE A 92  ? 0.1760 0.1354 0.1487 0.0054  -0.0093 -0.0095 84  ILE A C   
498  O  O   . ILE A 92  ? 0.1660 0.1251 0.1420 0.0042  -0.0094 -0.0071 84  ILE A O   
499  C  CB  . ILE A 92  ? 0.1697 0.1311 0.1328 0.0063  -0.0064 -0.0086 84  ILE A CB  
500  C  CG1 . ILE A 92  ? 0.1716 0.1348 0.1310 0.0076  -0.0044 -0.0090 84  ILE A CG1 
501  C  CG2 . ILE A 92  ? 0.1650 0.1259 0.1290 0.0043  -0.0062 -0.0054 84  ILE A CG2 
502  C  CD1 . ILE A 92  ? 0.1716 0.1358 0.1333 0.0077  -0.0030 -0.0084 84  ILE A CD1 
503  N  N   . GLU A 93  ? 0.1819 0.1405 0.1547 0.0056  -0.0107 -0.0111 85  GLU A N   
504  C  CA  . GLU A 93  ? 0.1826 0.1400 0.1599 0.0043  -0.0123 -0.0100 85  GLU A CA  
505  C  C   . GLU A 93  ? 0.1829 0.1395 0.1671 0.0042  -0.0131 -0.0101 85  GLU A C   
506  O  O   . GLU A 93  ? 0.1724 0.1286 0.1603 0.0028  -0.0137 -0.0073 85  GLU A O   
507  C  CB  . GLU A 93  ? 0.1862 0.1433 0.1631 0.0045  -0.0137 -0.0118 85  GLU A CB  
508  C  CG  . GLU A 93  ? 0.1895 0.1471 0.1608 0.0042  -0.0130 -0.0106 85  GLU A CG  
509  C  CD  . GLU A 93  ? 0.1941 0.1520 0.1638 0.0050  -0.0143 -0.0130 85  GLU A CD  
510  O  OE1 . GLU A 93  ? 0.2040 0.1613 0.1769 0.0042  -0.0156 -0.0128 85  GLU A OE1 
511  O  OE2 . GLU A 93  ? 0.1987 0.1575 0.1641 0.0066  -0.0139 -0.0150 85  GLU A OE2 
512  N  N   . GLU A 94  ? 0.1895 0.1462 0.1755 0.0059  -0.0133 -0.0134 86  GLU A N   
513  C  CA  . GLU A 94  ? 0.1936 0.1494 0.1867 0.0061  -0.0141 -0.0138 86  GLU A CA  
514  C  C   . GLU A 94  ? 0.1872 0.1435 0.1815 0.0053  -0.0130 -0.0104 86  GLU A C   
515  O  O   . GLU A 94  ? 0.1955 0.1510 0.1955 0.0045  -0.0139 -0.0083 86  GLU A O   
516  C  CB  . GLU A 94  ? 0.2091 0.1651 0.2036 0.0083  -0.0142 -0.0185 86  GLU A CB  
517  C  CG  . GLU A 94  ? 0.2229 0.1782 0.2187 0.0091  -0.0160 -0.0224 86  GLU A CG  
518  C  CD  . GLU A 94  ? 0.2355 0.1918 0.2309 0.0116  -0.0161 -0.0278 86  GLU A CD  
519  O  OE1 . GLU A 94  ? 0.2822 0.2373 0.2832 0.0123  -0.0178 -0.0311 86  GLU A OE1 
520  O  OE2 . GLU A 94  ? 0.2353 0.1937 0.2252 0.0130  -0.0144 -0.0289 86  GLU A OE2 
521  N  N   . ILE A 95  ? 0.1751 0.1329 0.1645 0.0055  -0.0113 -0.0096 87  ILE A N   
522  C  CA  . ILE A 95  ? 0.1693 0.1280 0.1598 0.0047  -0.0105 -0.0065 87  ILE A CA  
523  C  C   . ILE A 95  ? 0.1627 0.1211 0.1536 0.0027  -0.0111 -0.0027 87  ILE A C   
524  O  O   . ILE A 95  ? 0.1567 0.1154 0.1518 0.0019  -0.0117 -0.0003 87  ILE A O   
525  C  CB  . ILE A 95  ? 0.1665 0.1269 0.1518 0.0051  -0.0084 -0.0064 87  ILE A CB  
526  C  CG1 . ILE A 95  ? 0.1710 0.1322 0.1561 0.0072  -0.0075 -0.0098 87  ILE A CG1 
527  C  CG2 . ILE A 95  ? 0.1622 0.1237 0.1487 0.0040  -0.0078 -0.0033 87  ILE A CG2 
528  C  CD1 . ILE A 95  ? 0.1742 0.1373 0.1537 0.0077  -0.0054 -0.0097 87  ILE A CD1 
529  N  N   . ILE A 96  ? 0.1644 0.1229 0.1508 0.0019  -0.0110 -0.0022 88  ILE A N   
530  C  CA  . ILE A 96  ? 0.1641 0.1229 0.1499 0.0002  -0.0114 0.0009  88  ILE A CA  
531  C  C   . ILE A 96  ? 0.1721 0.1303 0.1640 -0.0005 -0.0128 0.0025  88  ILE A C   
532  O  O   . ILE A 96  ? 0.1651 0.1242 0.1589 -0.0015 -0.0130 0.0057  88  ILE A O   
533  C  CB  . ILE A 96  ? 0.1609 0.1195 0.1420 -0.0001 -0.0112 0.0004  88  ILE A CB  
534  C  CG1 . ILE A 96  ? 0.1610 0.1204 0.1366 0.0002  -0.0097 0.0000  88  ILE A CG1 
535  C  CG2 . ILE A 96  ? 0.1595 0.1187 0.1408 -0.0017 -0.0116 0.0033  88  ILE A CG2 
536  C  CD1 . ILE A 96  ? 0.1621 0.1211 0.1334 0.0006  -0.0096 -0.0013 88  ILE A CD1 
537  N  N   . LEU A 97  ? 0.1828 0.1396 0.1779 0.0001  -0.0138 0.0004  89  LEU A N   
538  C  CA  . LEU A 97  ? 0.2029 0.1588 0.2049 -0.0005 -0.0153 0.0018  89  LEU A CA  
539  C  C   . LEU A 97  ? 0.1969 0.1526 0.2045 -0.0001 -0.0156 0.0030  89  LEU A C   
540  O  O   . LEU A 97  ? 0.1976 0.1538 0.2090 -0.0012 -0.0162 0.0067  89  LEU A O   
541  C  CB  . LEU A 97  ? 0.2225 0.1769 0.2273 0.0002  -0.0164 -0.0015 89  LEU A CB  
542  C  CG  . LEU A 97  ? 0.2448 0.1982 0.2569 -0.0008 -0.0179 0.0002  89  LEU A CG  
543  C  CD1 . LEU A 97  ? 0.2544 0.2089 0.2643 -0.0023 -0.0177 0.0030  89  LEU A CD1 
544  C  CD2 . LEU A 97  ? 0.2564 0.2079 0.2733 0.0003  -0.0194 -0.0039 89  LEU A CD2 
545  N  N   . ALA A 98  ? 0.1932 0.1486 0.2014 0.0014  -0.0152 0.0001  90  ALA A N   
546  C  CA  . ALA A 98  ? 0.1992 0.1546 0.2128 0.0020  -0.0155 0.0010  90  ALA A CA  
547  C  C   . ALA A 98  ? 0.2034 0.1606 0.2160 0.0009  -0.0151 0.0054  90  ALA A C   
548  O  O   . ALA A 98  ? 0.2147 0.1720 0.2329 0.0006  -0.0159 0.0081  90  ALA A O   
549  C  CB  . ALA A 98  ? 0.1994 0.1549 0.2126 0.0039  -0.0146 -0.0029 90  ALA A CB  
550  N  N   . VAL A 99  ? 0.2053 0.1641 0.2113 0.0002  -0.0139 0.0062  91  VAL A N   
551  C  CA  . VAL A 99  ? 0.2019 0.1627 0.2072 -0.0008 -0.0138 0.0098  91  VAL A CA  
552  C  C   . VAL A 99  ? 0.2055 0.1676 0.2080 -0.0024 -0.0140 0.0130  91  VAL A C   
553  O  O   . VAL A 99  ? 0.2128 0.1770 0.2136 -0.0032 -0.0140 0.0154  91  VAL A O   
554  C  CB  . VAL A 99  ? 0.1984 0.1605 0.1999 -0.0003 -0.0124 0.0086  91  VAL A CB  
555  C  CG1 . VAL A 99  ? 0.1968 0.1584 0.2017 0.0014  -0.0120 0.0059  91  VAL A CG1 
556  C  CG2 . VAL A 99  ? 0.1950 0.1572 0.1897 -0.0005 -0.0113 0.0070  91  VAL A CG2 
557  N  N   . ALA A 100 ? 0.2113 0.1726 0.2135 -0.0029 -0.0144 0.0128  92  ALA A N   
558  C  CA  . ALA A 100 ? 0.2118 0.1746 0.2107 -0.0043 -0.0143 0.0153  92  ALA A CA  
559  C  C   . ALA A 100 ? 0.2219 0.1869 0.2231 -0.0052 -0.0149 0.0198  92  ALA A C   
560  O  O   . ALA A 100 ? 0.2331 0.2005 0.2302 -0.0061 -0.0146 0.0216  92  ALA A O   
561  C  CB  . ALA A 100 ? 0.2116 0.1732 0.2113 -0.0046 -0.0146 0.0146  92  ALA A CB  
562  N  N   . ASN A 101 ? 0.2071 0.1717 0.2148 -0.0050 -0.0159 0.0217  93  ASN A N   
563  C  CA  . ASN A 101 ? 0.2093 0.1764 0.2188 -0.0058 -0.0166 0.0264  93  ASN A CA  
564  C  C   . ASN A 101 ? 0.2090 0.1766 0.2220 -0.0051 -0.0172 0.0274  93  ASN A C   
565  O  O   . ASN A 101 ? 0.2144 0.1829 0.2323 -0.0053 -0.0182 0.0312  93  ASN A O   
566  C  CB  . ASN A 101 ? 0.2109 0.1776 0.2257 -0.0064 -0.0173 0.0293  93  ASN A CB  
567  C  CG  . ASN A 101 ? 0.2105 0.1774 0.2219 -0.0072 -0.0166 0.0286  93  ASN A CG  
568  O  OD1 . ASN A 101 ? 0.2080 0.1776 0.2145 -0.0080 -0.0160 0.0303  93  ASN A OD1 
569  N  ND2 . ASN A 101 ? 0.2095 0.1736 0.2231 -0.0068 -0.0167 0.0255  93  ASN A ND2 
570  N  N   . ASP A 102 ? 0.1974 0.1647 0.2081 -0.0043 -0.0165 0.0244  94  ASP A N   
571  C  CA  . ASP A 102 ? 0.1948 0.1625 0.2089 -0.0035 -0.0170 0.0247  94  ASP A CA  
572  C  C   . ASP A 102 ? 0.1855 0.1562 0.1947 -0.0041 -0.0166 0.0254  94  ASP A C   
573  O  O   . ASP A 102 ? 0.1749 0.1454 0.1800 -0.0039 -0.0155 0.0224  94  ASP A O   
574  C  CB  . ASP A 102 ? 0.1987 0.1641 0.2150 -0.0020 -0.0163 0.0205  94  ASP A CB  
575  C  CG  . ASP A 102 ? 0.2000 0.1661 0.2203 -0.0010 -0.0165 0.0205  94  ASP A CG  
576  O  OD1 . ASP A 102 ? 0.2023 0.1709 0.2231 -0.0015 -0.0172 0.0235  94  ASP A OD1 
577  O  OD2 . ASP A 102 ? 0.2107 0.1752 0.2336 0.0004  -0.0161 0.0172  94  ASP A OD2 
578  N  N   . ALA A 103 ? 0.1738 0.1473 0.1839 -0.0047 -0.0177 0.0293  95  ALA A N   
579  C  CA  . ALA A 103 ? 0.1706 0.1474 0.1768 -0.0052 -0.0179 0.0300  95  ALA A CA  
580  C  C   . ALA A 103 ? 0.1706 0.1476 0.1785 -0.0045 -0.0177 0.0281  95  ALA A C   
581  O  O   . ALA A 103 ? 0.1734 0.1522 0.1779 -0.0049 -0.0175 0.0274  95  ALA A O   
582  C  CB  . ALA A 103 ? 0.1717 0.1519 0.1789 -0.0058 -0.0193 0.0347  95  ALA A CB  
583  N  N   . GLU A 104 ? 0.1759 0.1510 0.1895 -0.0032 -0.0177 0.0272  96  GLU A N   
584  C  CA  . GLU A 104 ? 0.1803 0.1557 0.1953 -0.0024 -0.0170 0.0250  96  GLU A CA  
585  C  C   . GLU A 104 ? 0.1763 0.1504 0.1865 -0.0023 -0.0151 0.0211  96  GLU A C   
586  O  O   . GLU A 104 ? 0.1727 0.1478 0.1830 -0.0019 -0.0143 0.0196  96  GLU A O   
587  C  CB  . GLU A 104 ? 0.1833 0.1571 0.2058 -0.0008 -0.0173 0.0246  96  GLU A CB  
588  C  CG  . GLU A 104 ? 0.1869 0.1614 0.2156 -0.0007 -0.0192 0.0288  96  GLU A CG  
589  C  CD  . GLU A 104 ? 0.1870 0.1653 0.2153 -0.0013 -0.0206 0.0323  96  GLU A CD  
590  O  OE1 . GLU A 104 ? 0.1857 0.1659 0.2129 -0.0012 -0.0202 0.0310  96  GLU A OE1 
591  O  OE2 . GLU A 104 ? 0.1915 0.1714 0.2208 -0.0019 -0.0220 0.0365  96  GLU A OE2 
592  N  N   . LYS A 105 ? 0.1850 0.1572 0.1915 -0.0026 -0.0145 0.0196  97  LYS A N   
593  C  CA  . LYS A 105 ? 0.1874 0.1582 0.1898 -0.0022 -0.0128 0.0161  97  LYS A CA  
594  C  C   . LYS A 105 ? 0.1845 0.1550 0.1808 -0.0033 -0.0124 0.0159  97  LYS A C   
595  O  O   . LYS A 105 ? 0.1750 0.1438 0.1684 -0.0030 -0.0114 0.0136  97  LYS A O   
596  C  CB  . LYS A 105 ? 0.1916 0.1598 0.1967 -0.0008 -0.0124 0.0137  97  LYS A CB  
597  C  CG  . LYS A 105 ? 0.2022 0.1704 0.2126 0.0007  -0.0121 0.0124  97  LYS A CG  
598  C  CD  . LYS A 105 ? 0.2193 0.1850 0.2328 0.0020  -0.0122 0.0098  97  LYS A CD  
599  C  CE  . LYS A 105 ? 0.2341 0.1997 0.2549 0.0035  -0.0126 0.0093  97  LYS A CE  
600  N  NZ  . LYS A 105 ? 0.2443 0.2097 0.2711 0.0031  -0.0145 0.0129  97  LYS A NZ  
601  N  N   . LYS A 106 ? 0.1875 0.1602 0.1819 -0.0045 -0.0132 0.0182  98  LYS A N   
602  C  CA  . LYS A 106 ? 0.1971 0.1699 0.1860 -0.0055 -0.0128 0.0178  98  LYS A CA  
603  C  C   . LYS A 106 ? 0.1850 0.1569 0.1702 -0.0054 -0.0114 0.0152  98  LYS A C   
604  O  O   . LYS A 106 ? 0.1776 0.1480 0.1593 -0.0055 -0.0106 0.0137  98  LYS A O   
605  C  CB  . LYS A 106 ? 0.2204 0.1961 0.2077 -0.0066 -0.0139 0.0202  98  LYS A CB  
606  C  CG  . LYS A 106 ? 0.2499 0.2259 0.2322 -0.0074 -0.0136 0.0199  98  LYS A CG  
607  C  CD  . LYS A 106 ? 0.2671 0.2413 0.2501 -0.0072 -0.0134 0.0202  98  LYS A CD  
608  C  CE  . LYS A 106 ? 0.2812 0.2564 0.2601 -0.0079 -0.0131 0.0204  98  LYS A CE  
609  N  NZ  . LYS A 106 ? 0.3004 0.2744 0.2751 -0.0079 -0.0121 0.0175  98  LYS A NZ  
610  N  N   . GLY A 107 ? 0.1778 0.1509 0.1644 -0.0053 -0.0110 0.0148  99  GLY A N   
611  C  CA  . GLY A 107 ? 0.1759 0.1486 0.1602 -0.0054 -0.0096 0.0129  99  GLY A CA  
612  C  C   . GLY A 107 ? 0.1743 0.1447 0.1573 -0.0043 -0.0082 0.0108  99  GLY A C   
613  O  O   . GLY A 107 ? 0.1710 0.1402 0.1501 -0.0044 -0.0072 0.0097  99  GLY A O   
614  N  N   . LEU A 108 ? 0.1727 0.1424 0.1591 -0.0030 -0.0081 0.0103  100 LEU A N   
615  C  CA  . LEU A 108 ? 0.1740 0.1419 0.1593 -0.0018 -0.0071 0.0080  100 LEU A CA  
616  C  C   . LEU A 108 ? 0.1722 0.1385 0.1546 -0.0020 -0.0076 0.0076  100 LEU A C   
617  O  O   . LEU A 108 ? 0.1807 0.1459 0.1597 -0.0015 -0.0067 0.0059  100 LEU A O   
618  C  CB  . LEU A 108 ? 0.1815 0.1492 0.1717 -0.0003 -0.0073 0.0071  100 LEU A CB  
619  C  CG  . LEU A 108 ? 0.1896 0.1558 0.1790 0.0012  -0.0066 0.0042  100 LEU A CG  
620  C  CD1 . LEU A 108 ? 0.1959 0.1627 0.1813 0.0018  -0.0046 0.0027  100 LEU A CD1 
621  C  CD2 . LEU A 108 ? 0.1953 0.1613 0.1903 0.0026  -0.0070 0.0030  100 LEU A CD2 
622  N  N   . PHE A 109 ? 0.1681 0.1343 0.1521 -0.0027 -0.0090 0.0092  101 PHE A N   
623  C  CA  . PHE A 109 ? 0.1630 0.1281 0.1447 -0.0031 -0.0094 0.0091  101 PHE A CA  
624  C  C   . PHE A 109 ? 0.1569 0.1221 0.1334 -0.0037 -0.0086 0.0086  101 PHE A C   
625  O  O   . PHE A 109 ? 0.1538 0.1177 0.1276 -0.0033 -0.0082 0.0072  101 PHE A O   
626  C  CB  . PHE A 109 ? 0.1629 0.1288 0.1469 -0.0040 -0.0108 0.0117  101 PHE A CB  
627  C  CG  . PHE A 109 ? 0.1656 0.1309 0.1474 -0.0045 -0.0110 0.0118  101 PHE A CG  
628  C  CD1 . PHE A 109 ? 0.1709 0.1346 0.1549 -0.0040 -0.0114 0.0108  101 PHE A CD1 
629  C  CD2 . PHE A 109 ? 0.1697 0.1363 0.1478 -0.0055 -0.0108 0.0127  101 PHE A CD2 
630  C  CE1 . PHE A 109 ? 0.1716 0.1350 0.1541 -0.0045 -0.0116 0.0110  101 PHE A CE1 
631  C  CE2 . PHE A 109 ? 0.1743 0.1407 0.1507 -0.0059 -0.0109 0.0128  101 PHE A CE2 
632  C  CZ  . PHE A 109 ? 0.1731 0.1380 0.1518 -0.0054 -0.0112 0.0120  101 PHE A CZ  
633  N  N   . ASN A 110 ? 0.1526 0.1194 0.1280 -0.0047 -0.0086 0.0098  102 ASN A N   
634  C  CA  . ASN A 110 ? 0.1502 0.1169 0.1214 -0.0054 -0.0080 0.0093  102 ASN A CA  
635  C  C   . ASN A 110 ? 0.1485 0.1137 0.1174 -0.0046 -0.0066 0.0076  102 ASN A C   
636  O  O   . ASN A 110 ? 0.1433 0.1075 0.1092 -0.0046 -0.0063 0.0069  102 ASN A O   
637  C  CB  . ASN A 110 ? 0.1505 0.1192 0.1216 -0.0064 -0.0084 0.0103  102 ASN A CB  
638  C  CG  . ASN A 110 ? 0.1506 0.1212 0.1221 -0.0072 -0.0097 0.0121  102 ASN A CG  
639  O  OD1 . ASN A 110 ? 0.1546 0.1249 0.1259 -0.0072 -0.0101 0.0127  102 ASN A OD1 
640  N  ND2 . ASN A 110 ? 0.1491 0.1220 0.1210 -0.0080 -0.0104 0.0129  102 ASN A ND2 
641  N  N   . GLN A 111 ? 0.1476 0.1130 0.1180 -0.0039 -0.0058 0.0071  103 GLN A N   
642  C  CA  . GLN A 111 ? 0.1502 0.1150 0.1185 -0.0031 -0.0043 0.0060  103 GLN A CA  
643  C  C   . GLN A 111 ? 0.1504 0.1139 0.1171 -0.0018 -0.0042 0.0044  103 GLN A C   
644  O  O   . GLN A 111 ? 0.1508 0.1135 0.1143 -0.0014 -0.0036 0.0038  103 GLN A O   
645  C  CB  . GLN A 111 ? 0.1545 0.1205 0.1250 -0.0026 -0.0031 0.0059  103 GLN A CB  
646  C  CG  . GLN A 111 ? 0.1607 0.1283 0.1339 -0.0038 -0.0035 0.0073  103 GLN A CG  
647  C  CD  . GLN A 111 ? 0.1611 0.1287 0.1323 -0.0051 -0.0036 0.0078  103 GLN A CD  
648  O  OE1 . GLN A 111 ? 0.1754 0.1421 0.1445 -0.0051 -0.0024 0.0075  103 GLN A OE1 
649  N  NE2 . GLN A 111 ? 0.1624 0.1310 0.1343 -0.0062 -0.0050 0.0085  103 GLN A NE2 
650  N  N   . ALA A 112 ? 0.1433 0.1066 0.1128 -0.0011 -0.0050 0.0038  104 ALA A N   
651  C  CA  . ALA A 112 ? 0.1399 0.1023 0.1087 0.0001  -0.0053 0.0019  104 ALA A CA  
652  C  C   . ALA A 112 ? 0.1367 0.0981 0.1034 -0.0004 -0.0061 0.0020  104 ALA A C   
653  O  O   . ALA A 112 ? 0.1367 0.0974 0.1004 0.0003  -0.0058 0.0007  104 ALA A O   
654  C  CB  . ALA A 112 ? 0.1419 0.1041 0.1153 0.0008  -0.0062 0.0011  104 ALA A CB  
655  N  N   . ALA A 113 ? 0.1307 0.0922 0.0987 -0.0017 -0.0070 0.0036  105 ALA A N   
656  C  CA  . ALA A 113 ? 0.1285 0.0896 0.0948 -0.0022 -0.0076 0.0037  105 ALA A CA  
657  C  C   . ALA A 113 ? 0.1281 0.0889 0.0901 -0.0024 -0.0067 0.0036  105 ALA A C   
658  O  O   . ALA A 113 ? 0.1243 0.0844 0.0843 -0.0019 -0.0068 0.0028  105 ALA A O   
659  C  CB  . ALA A 113 ? 0.1268 0.0888 0.0953 -0.0034 -0.0085 0.0057  105 ALA A CB  
660  N  N   . GLN A 114 ? 0.1279 0.0893 0.0893 -0.0030 -0.0060 0.0045  106 GLN A N   
661  C  CA  . GLN A 114 ? 0.1297 0.0906 0.0879 -0.0032 -0.0052 0.0044  106 GLN A CA  
662  C  C   . GLN A 114 ? 0.1303 0.0904 0.0863 -0.0018 -0.0042 0.0035  106 GLN A C   
663  O  O   . GLN A 114 ? 0.1301 0.0893 0.0836 -0.0015 -0.0040 0.0034  106 GLN A O   
664  C  CB  . GLN A 114 ? 0.1297 0.0914 0.0885 -0.0042 -0.0047 0.0053  106 GLN A CB  
665  C  CG  . GLN A 114 ? 0.1310 0.0938 0.0903 -0.0054 -0.0057 0.0060  106 GLN A CG  
666  C  CD  . GLN A 114 ? 0.1330 0.0953 0.0901 -0.0056 -0.0059 0.0056  106 GLN A CD  
667  O  OE1 . GLN A 114 ? 0.1321 0.0941 0.0888 -0.0052 -0.0063 0.0054  106 GLN A OE1 
668  N  NE2 . GLN A 114 ? 0.1388 0.1011 0.0949 -0.0062 -0.0056 0.0053  106 GLN A NE2 
669  N  N   . HIS A 115 ? 0.1301 0.0907 0.0871 -0.0009 -0.0037 0.0029  107 HIS A N   
670  C  CA  . HIS A 115 ? 0.1324 0.0930 0.0870 0.0006  -0.0028 0.0020  107 HIS A CA  
671  C  C   . HIS A 115 ? 0.1336 0.0935 0.0864 0.0014  -0.0038 0.0007  107 HIS A C   
672  O  O   . HIS A 115 ? 0.1305 0.0901 0.0802 0.0021  -0.0034 0.0008  107 HIS A O   
673  C  CB  . HIS A 115 ? 0.1328 0.0945 0.0891 0.0015  -0.0021 0.0012  107 HIS A CB  
674  C  CG  . HIS A 115 ? 0.1370 0.0994 0.0905 0.0033  -0.0012 0.0000  107 HIS A CG  
675  N  ND1 . HIS A 115 ? 0.1395 0.1019 0.0893 0.0038  -0.0003 0.0007  107 HIS A ND1 
676  C  CD2 . HIS A 115 ? 0.1396 0.1031 0.0937 0.0048  -0.0010 -0.0020 107 HIS A CD2 
677  C  CE1 . HIS A 115 ? 0.1439 0.1077 0.0916 0.0056  0.0004  -0.0006 107 HIS A CE1 
678  N  NE2 . HIS A 115 ? 0.1430 0.1075 0.0931 0.0063  0.0000  -0.0025 107 HIS A NE2 
679  N  N   . PHE A 116 ? 0.1355 0.0952 0.0907 0.0014  -0.0051 -0.0002 108 PHE A N   
680  C  CA  . PHE A 116 ? 0.1376 0.0968 0.0924 0.0019  -0.0064 -0.0015 108 PHE A CA  
681  C  C   . PHE A 116 ? 0.1344 0.0930 0.0873 0.0012  -0.0066 -0.0005 108 PHE A C   
682  O  O   . PHE A 116 ? 0.1321 0.0905 0.0826 0.0020  -0.0068 -0.0011 108 PHE A O   
683  C  CB  . PHE A 116 ? 0.1410 0.1000 0.0998 0.0016  -0.0078 -0.0022 108 PHE A CB  
684  C  CG  . PHE A 116 ? 0.1461 0.1048 0.1053 0.0018  -0.0091 -0.0033 108 PHE A CG  
685  C  CD1 . PHE A 116 ? 0.1505 0.1091 0.1093 0.0032  -0.0099 -0.0059 108 PHE A CD1 
686  C  CD2 . PHE A 116 ? 0.1476 0.1061 0.1074 0.0006  -0.0096 -0.0020 108 PHE A CD2 
687  C  CE1 . PHE A 116 ? 0.1539 0.1124 0.1136 0.0034  -0.0114 -0.0070 108 PHE A CE1 
688  C  CE2 . PHE A 116 ? 0.1509 0.1093 0.1116 0.0008  -0.0108 -0.0030 108 PHE A CE2 
689  C  CZ  . PHE A 116 ? 0.1508 0.1091 0.1115 0.0021  -0.0118 -0.0055 108 PHE A CZ  
690  N  N   . ASN A 117 ? 0.1330 0.0917 0.0873 -0.0002 -0.0066 0.0009  109 ASN A N   
691  C  CA  . ASN A 117 ? 0.1289 0.0874 0.0820 -0.0009 -0.0067 0.0015  109 ASN A CA  
692  C  C   . ASN A 117 ? 0.1303 0.0881 0.0802 -0.0003 -0.0059 0.0017  109 ASN A C   
693  O  O   . ASN A 117 ? 0.1278 0.0852 0.0764 0.0002  -0.0063 0.0014  109 ASN A O   
694  C  CB  . ASN A 117 ? 0.1272 0.0864 0.0816 -0.0023 -0.0067 0.0028  109 ASN A CB  
695  C  CG  . ASN A 117 ? 0.1258 0.0859 0.0834 -0.0029 -0.0076 0.0033  109 ASN A CG  
696  O  OD1 . ASN A 117 ? 0.1238 0.0837 0.0831 -0.0025 -0.0084 0.0027  109 ASN A OD1 
697  N  ND2 . ASN A 117 ? 0.1230 0.0843 0.0816 -0.0040 -0.0076 0.0047  109 ASN A ND2 
698  N  N   . HIS A 118 ? 0.1295 0.0873 0.0789 -0.0003 -0.0047 0.0024  110 HIS A N   
699  C  CA  . HIS A 118 ? 0.1335 0.0906 0.0806 0.0002  -0.0038 0.0031  110 HIS A CA  
700  C  C   . HIS A 118 ? 0.1385 0.0957 0.0831 0.0018  -0.0038 0.0026  110 HIS A C   
701  O  O   . HIS A 118 ? 0.1380 0.0946 0.0808 0.0024  -0.0037 0.0031  110 HIS A O   
702  C  CB  . HIS A 118 ? 0.1334 0.0906 0.0812 -0.0004 -0.0025 0.0042  110 HIS A CB  
703  C  CG  . HIS A 118 ? 0.1325 0.0896 0.0822 -0.0020 -0.0026 0.0047  110 HIS A CG  
704  N  ND1 . HIS A 118 ? 0.1309 0.0890 0.0826 -0.0029 -0.0032 0.0045  110 HIS A ND1 
705  C  CD2 . HIS A 118 ? 0.1330 0.0892 0.0827 -0.0026 -0.0024 0.0050  110 HIS A CD2 
706  C  CE1 . HIS A 118 ? 0.1319 0.0901 0.0844 -0.0040 -0.0034 0.0047  110 HIS A CE1 
707  N  NE2 . HIS A 118 ? 0.1327 0.0897 0.0841 -0.0039 -0.0029 0.0048  110 HIS A NE2 
708  N  N   . THR A 119 ? 0.1444 0.1026 0.0890 0.0027  -0.0039 0.0015  111 THR A N   
709  C  CA  . THR A 119 ? 0.1495 0.1083 0.0913 0.0045  -0.0040 0.0006  111 THR A CA  
710  C  C   . THR A 119 ? 0.1524 0.1109 0.0937 0.0049  -0.0056 -0.0003 111 THR A C   
711  O  O   . THR A 119 ? 0.1516 0.1103 0.0903 0.0059  -0.0057 0.0000  111 THR A O   
712  C  CB  . THR A 119 ? 0.1516 0.1117 0.0941 0.0054  -0.0042 -0.0013 111 THR A CB  
713  O  OG1 . THR A 119 ? 0.1504 0.1112 0.0936 0.0052  -0.0026 -0.0004 111 THR A OG1 
714  C  CG2 . THR A 119 ? 0.1565 0.1179 0.0957 0.0075  -0.0046 -0.0028 111 THR A CG2 
715  N  N   . PHE A 120 ? 0.1523 0.1105 0.0964 0.0039  -0.0068 -0.0011 112 PHE A N   
716  C  CA  . PHE A 120 ? 0.1539 0.1121 0.0986 0.0041  -0.0082 -0.0020 112 PHE A CA  
717  C  C   . PHE A 120 ? 0.1573 0.1148 0.1008 0.0038  -0.0079 -0.0006 112 PHE A C   
718  O  O   . PHE A 120 ? 0.1556 0.1132 0.0976 0.0048  -0.0087 -0.0009 112 PHE A O   
719  C  CB  . PHE A 120 ? 0.1512 0.1093 0.0997 0.0030  -0.0092 -0.0025 112 PHE A CB  
720  C  CG  . PHE A 120 ? 0.1528 0.1114 0.1028 0.0032  -0.0108 -0.0037 112 PHE A CG  
721  C  CD1 . PHE A 120 ? 0.1559 0.1148 0.1066 0.0042  -0.0121 -0.0058 112 PHE A CD1 
722  C  CD2 . PHE A 120 ? 0.1540 0.1126 0.1048 0.0025  -0.0110 -0.0028 112 PHE A CD2 
723  C  CE1 . PHE A 120 ? 0.1586 0.1181 0.1114 0.0043  -0.0137 -0.0070 112 PHE A CE1 
724  C  CE2 . PHE A 120 ? 0.1560 0.1151 0.1086 0.0027  -0.0123 -0.0038 112 PHE A CE2 
725  C  CZ  . PHE A 120 ? 0.1577 0.1173 0.1115 0.0035  -0.0138 -0.0058 112 PHE A CZ  
726  N  N   . TYR A 121 ? 0.1549 0.1118 0.0994 0.0025  -0.0070 0.0006  113 TYR A N   
727  C  CA  . TYR A 121 ? 0.1575 0.1136 0.1015 0.0022  -0.0067 0.0015  113 TYR A CA  
728  C  C   . TYR A 121 ? 0.1650 0.1205 0.1065 0.0035  -0.0062 0.0025  113 TYR A C   
729  O  O   . TYR A 121 ? 0.1656 0.1209 0.1066 0.0042  -0.0067 0.0026  113 TYR A O   
730  C  CB  . TYR A 121 ? 0.1561 0.1118 0.1015 0.0008  -0.0058 0.0023  113 TYR A CB  
731  C  CG  . TYR A 121 ? 0.1580 0.1128 0.1033 0.0005  -0.0053 0.0029  113 TYR A CG  
732  C  CD1 . TYR A 121 ? 0.1571 0.1120 0.1031 0.0004  -0.0058 0.0023  113 TYR A CD1 
733  C  CD2 . TYR A 121 ? 0.1592 0.1130 0.1042 0.0003  -0.0042 0.0039  113 TYR A CD2 
734  C  CE1 . TYR A 121 ? 0.1574 0.1113 0.1037 0.0003  -0.0054 0.0024  113 TYR A CE1 
735  C  CE2 . TYR A 121 ? 0.1601 0.1127 0.1059 0.0001  -0.0039 0.0042  113 TYR A CE2 
736  C  CZ  . TYR A 121 ? 0.1600 0.1126 0.1064 0.0001  -0.0045 0.0032  113 TYR A CZ  
737  O  OH  . TYR A 121 ? 0.1587 0.1100 0.1062 0.0000  -0.0043 0.0031  113 TYR A OH  
738  N  N   . PHE A 122 ? 0.1718 0.1274 0.1120 0.0038  -0.0050 0.0034  114 PHE A N   
739  C  CA  . PHE A 122 ? 0.1829 0.1382 0.1208 0.0050  -0.0044 0.0049  114 PHE A CA  
740  C  C   . PHE A 122 ? 0.1951 0.1515 0.1305 0.0067  -0.0055 0.0043  114 PHE A C   
741  O  O   . PHE A 122 ? 0.2002 0.1563 0.1340 0.0077  -0.0054 0.0058  114 PHE A O   
742  C  CB  . PHE A 122 ? 0.1786 0.1343 0.1159 0.0050  -0.0027 0.0062  114 PHE A CB  
743  C  CG  . PHE A 122 ? 0.1778 0.1325 0.1176 0.0033  -0.0017 0.0072  114 PHE A CG  
744  C  CD1 . PHE A 122 ? 0.1768 0.1298 0.1180 0.0027  -0.0016 0.0081  114 PHE A CD1 
745  C  CD2 . PHE A 122 ? 0.1761 0.1315 0.1173 0.0025  -0.0010 0.0070  114 PHE A CD2 
746  C  CE1 . PHE A 122 ? 0.1754 0.1276 0.1192 0.0012  -0.0009 0.0085  114 PHE A CE1 
747  C  CE2 . PHE A 122 ? 0.1755 0.1302 0.1193 0.0010  -0.0003 0.0077  114 PHE A CE2 
748  C  CZ  . PHE A 122 ? 0.1730 0.1261 0.1179 0.0004  -0.0003 0.0084  114 PHE A CZ  
749  N  N   . ARG A 123 ? 0.2061 0.1637 0.1417 0.0071  -0.0066 0.0022  115 ARG A N   
750  C  CA  . ARG A 123 ? 0.2241 0.1828 0.1578 0.0087  -0.0082 0.0010  115 ARG A CA  
751  C  C   . ARG A 123 ? 0.2007 0.1590 0.1361 0.0085  -0.0096 0.0006  115 ARG A C   
752  O  O   . ARG A 123 ? 0.2022 0.1615 0.1364 0.0098  -0.0110 0.0000  115 ARG A O   
753  C  CB  . ARG A 123 ? 0.2590 0.2192 0.1929 0.0092  -0.0092 -0.0016 115 ARG A CB  
754  C  CG  . ARG A 123 ? 0.3037 0.2653 0.2346 0.0105  -0.0080 -0.0014 115 ARG A CG  
755  C  CD  . ARG A 123 ? 0.3510 0.3138 0.2825 0.0110  -0.0087 -0.0044 115 ARG A CD  
756  N  NE  . ARG A 123 ? 0.4109 0.3748 0.3408 0.0116  -0.0069 -0.0039 115 ARG A NE  
757  C  CZ  . ARG A 123 ? 0.4475 0.4125 0.3781 0.0121  -0.0068 -0.0062 115 ARG A CZ  
758  N  NH1 . ARG A 123 ? 0.4925 0.4575 0.4257 0.0122  -0.0087 -0.0092 115 ARG A NH1 
759  N  NH2 . ARG A 123 ? 0.4715 0.4378 0.4009 0.0126  -0.0049 -0.0055 115 ARG A NH2 
760  N  N   . CYS A 124 ? 0.1849 0.1422 0.1232 0.0070  -0.0093 0.0007  116 CYS A N   
761  C  CA  . CYS A 124 ? 0.1723 0.1295 0.1125 0.0068  -0.0102 0.0004  116 CYS A CA  
762  C  C   . CYS A 124 ? 0.1671 0.1233 0.1066 0.0073  -0.0097 0.0021  116 CYS A C   
763  O  O   . CYS A 124 ? 0.1630 0.1192 0.1040 0.0074  -0.0104 0.0018  116 CYS A O   
764  C  CB  . CYS A 124 ? 0.1645 0.1215 0.1078 0.0051  -0.0100 0.0000  116 CYS A CB  
765  S  SG  . CYS A 124 ? 0.1529 0.1112 0.0986 0.0045  -0.0110 -0.0017 116 CYS A SG  
766  N  N   . ILE A 125 ? 0.1660 0.1213 0.1038 0.0076  -0.0084 0.0038  117 ILE A N   
767  C  CA  . ILE A 125 ? 0.1686 0.1226 0.1064 0.0081  -0.0080 0.0057  117 ILE A CA  
768  C  C   . ILE A 125 ? 0.1759 0.1303 0.1107 0.0097  -0.0077 0.0077  117 ILE A C   
769  O  O   . ILE A 125 ? 0.1667 0.1221 0.0992 0.0100  -0.0071 0.0080  117 ILE A O   
770  C  CB  . ILE A 125 ? 0.1664 0.1186 0.1063 0.0067  -0.0066 0.0064  117 ILE A CB  
771  C  CG1 . ILE A 125 ? 0.1667 0.1186 0.1059 0.0061  -0.0052 0.0075  117 ILE A CG1 
772  C  CG2 . ILE A 125 ? 0.1617 0.1141 0.1041 0.0053  -0.0068 0.0045  117 ILE A CG2 
773  C  CD1 . ILE A 125 ? 0.1650 0.1152 0.1065 0.0047  -0.0040 0.0082  117 ILE A CD1 
774  N  N   . THR A 126 ? 0.1811 0.1348 0.1161 0.0107  -0.0081 0.0093  118 THR A N   
775  C  CA  . THR A 126 ? 0.1903 0.1446 0.1226 0.0124  -0.0080 0.0118  118 THR A CA  
776  C  C   . THR A 126 ? 0.1940 0.1464 0.1283 0.0129  -0.0080 0.0139  118 THR A C   
777  O  O   . THR A 126 ? 0.1919 0.1436 0.1289 0.0127  -0.0089 0.0126  118 THR A O   
778  C  CB  . THR A 126 ? 0.1935 0.1505 0.1228 0.0140  -0.0098 0.0106  118 THR A CB  
779  O  OG1 . THR A 126 ? 0.1986 0.1571 0.1241 0.0156  -0.0094 0.0130  118 THR A OG1 
780  C  CG2 . THR A 126 ? 0.1926 0.1499 0.1235 0.0147  -0.0116 0.0097  118 THR A CG2 
781  N  N   . PRO A 127 ? 0.2035 0.1553 0.1371 0.0135  -0.0069 0.0173  119 PRO A N   
782  C  CA  . PRO A 127 ? 0.2030 0.1527 0.1394 0.0140  -0.0070 0.0195  119 PRO A CA  
783  C  C   . PRO A 127 ? 0.2032 0.1537 0.1401 0.0154  -0.0090 0.0186  119 PRO A C   
784  O  O   . PRO A 127 ? 0.2061 0.1591 0.1397 0.0169  -0.0103 0.0186  119 PRO A O   
785  C  CB  . PRO A 127 ? 0.2082 0.1581 0.1428 0.0151  -0.0059 0.0237  119 PRO A CB  
786  C  CG  . PRO A 127 ? 0.2106 0.1621 0.1428 0.0143  -0.0045 0.0236  119 PRO A CG  
787  C  CD  . PRO A 127 ? 0.2052 0.1584 0.1356 0.0140  -0.0056 0.0195  119 PRO A CD  
788  N  N   . ASN A 128 ? 0.2022 0.1508 0.1432 0.0150  -0.0093 0.0176  120 ASN A N   
789  C  CA  . ASN A 128 ? 0.2063 0.1556 0.1487 0.0163  -0.0110 0.0168  120 ASN A CA  
790  C  C   . ASN A 128 ? 0.2049 0.1568 0.1461 0.0164  -0.0125 0.0137  120 ASN A C   
791  O  O   . ASN A 128 ? 0.2014 0.1544 0.1439 0.0175  -0.0141 0.0130  120 ASN A O   
792  C  CB  . ASN A 128 ? 0.2104 0.1601 0.1516 0.0185  -0.0118 0.0203  120 ASN A CB  
793  C  CG  . ASN A 128 ? 0.2129 0.1597 0.1569 0.0183  -0.0104 0.0235  120 ASN A CG  
794  O  OD1 . ASN A 128 ? 0.2134 0.1576 0.1620 0.0177  -0.0101 0.0226  120 ASN A OD1 
795  N  ND2 . ASN A 128 ? 0.2142 0.1612 0.1557 0.0187  -0.0095 0.0269  120 ASN A ND2 
796  N  N   . GLY A 129 ? 0.2053 0.1581 0.1449 0.0151  -0.0120 0.0118  121 GLY A N   
797  C  CA  . GLY A 129 ? 0.2102 0.1652 0.1497 0.0149  -0.0134 0.0090  121 GLY A CA  
798  C  C   . GLY A 129 ? 0.2196 0.1772 0.1565 0.0166  -0.0154 0.0088  121 GLY A C   
799  O  O   . GLY A 129 ? 0.2239 0.1820 0.1585 0.0182  -0.0158 0.0111  121 GLY A O   
800  N  N   . LYS A 130 ? 0.2353 0.1948 0.1730 0.0162  -0.0166 0.0060  122 LYS A N   
801  C  CA  . LYS A 130 ? 0.2450 0.2071 0.1816 0.0177  -0.0190 0.0050  122 LYS A CA  
802  C  C   . LYS A 130 ? 0.2367 0.1997 0.1774 0.0170  -0.0202 0.0026  122 LYS A C   
803  O  O   . LYS A 130 ? 0.2343 0.1970 0.1772 0.0153  -0.0194 0.0010  122 LYS A O   
804  C  CB  . LYS A 130 ? 0.2674 0.2311 0.2004 0.0179  -0.0195 0.0037  122 LYS A CB  
805  C  CG  . LYS A 130 ? 0.2958 0.2596 0.2243 0.0190  -0.0184 0.0062  122 LYS A CG  
806  C  CD  . LYS A 130 ? 0.3271 0.2931 0.2521 0.0195  -0.0189 0.0044  122 LYS A CD  
807  C  CE  . LYS A 130 ? 0.3573 0.3235 0.2782 0.0201  -0.0170 0.0069  122 LYS A CE  
808  N  NZ  . LYS A 130 ? 0.3759 0.3423 0.2952 0.0217  -0.0170 0.0107  122 LYS A NZ  
809  N  N   . ALA A 131 ? 0.2359 0.2006 0.1779 0.0184  -0.0222 0.0025  123 ALA A N   
810  C  CA  . ALA A 131 ? 0.2354 0.2016 0.1819 0.0179  -0.0234 0.0005  123 ALA A CA  
811  C  C   . ALA A 131 ? 0.2326 0.2002 0.1803 0.0167  -0.0242 -0.0023 123 ALA A C   
812  O  O   . ALA A 131 ? 0.2428 0.2112 0.1877 0.0171  -0.0251 -0.0033 123 ALA A O   
813  C  CB  . ALA A 131 ? 0.2376 0.2057 0.1850 0.0199  -0.0257 0.0009  123 ALA A CB  
814  N  N   . MET A 132 ? 0.2328 0.2009 0.1853 0.0154  -0.0239 -0.0034 124 MET A N   
815  C  CA  . MET A 132 ? 0.2288 0.1983 0.1840 0.0142  -0.0249 -0.0057 124 MET A CA  
816  C  C   . MET A 132 ? 0.2331 0.2049 0.1886 0.0155  -0.0278 -0.0073 124 MET A C   
817  O  O   . MET A 132 ? 0.2378 0.2112 0.1952 0.0165  -0.0292 -0.0071 124 MET A O   
818  C  CB  . MET A 132 ? 0.2236 0.1939 0.1842 0.0128  -0.0241 -0.0060 124 MET A CB  
819  C  CG  . MET A 132 ? 0.2246 0.1934 0.1855 0.0111  -0.0216 -0.0053 124 MET A CG  
820  S  SD  . MET A 132 ? 0.2126 0.1834 0.1796 0.0094  -0.0209 -0.0058 124 MET A SD  
821  C  CE  . MET A 132 ? 0.2161 0.1851 0.1812 0.0083  -0.0179 -0.0045 124 MET A CE  
822  N  N   . PRO A 133 ? 0.2413 0.2138 0.1955 0.0154  -0.0290 -0.0092 125 PRO A N   
823  C  CA  . PRO A 133 ? 0.2443 0.2195 0.2002 0.0164  -0.0322 -0.0115 125 PRO A CA  
824  C  C   . PRO A 133 ? 0.2461 0.2226 0.2090 0.0151  -0.0328 -0.0125 125 PRO A C   
825  O  O   . PRO A 133 ? 0.2375 0.2129 0.2035 0.0132  -0.0309 -0.0119 125 PRO A O   
826  C  CB  . PRO A 133 ? 0.2451 0.2205 0.1989 0.0163  -0.0330 -0.0138 125 PRO A CB  
827  C  CG  . PRO A 133 ? 0.2414 0.2144 0.1910 0.0159  -0.0303 -0.0122 125 PRO A CG  
828  C  CD  . PRO A 133 ? 0.2393 0.2104 0.1907 0.0147  -0.0279 -0.0097 125 PRO A CD  
829  N  N   . LYS A 134 ? 0.2523 0.2314 0.2178 0.0161  -0.0355 -0.0138 126 LYS A N   
830  C  CA  . LYS A 134 ? 0.2545 0.2355 0.2273 0.0150  -0.0362 -0.0145 126 LYS A CA  
831  C  C   . LYS A 134 ? 0.2480 0.2287 0.2253 0.0129  -0.0360 -0.0160 126 LYS A C   
832  O  O   . LYS A 134 ? 0.2404 0.2214 0.2228 0.0113  -0.0348 -0.0153 126 LYS A O   
833  C  CB  . LYS A 134 ? 0.2572 0.2413 0.2322 0.0166  -0.0397 -0.0160 126 LYS A CB  
834  N  N   . SER A 135 ? 0.2560 0.2362 0.2314 0.0129  -0.0372 -0.0180 127 SER A N   
835  C  CA  . SER A 135 ? 0.2657 0.2455 0.2461 0.0110  -0.0373 -0.0195 127 SER A CA  
836  C  C   . SER A 135 ? 0.2554 0.2330 0.2362 0.0092  -0.0339 -0.0172 127 SER A C   
837  O  O   . SER A 135 ? 0.2475 0.2254 0.2343 0.0074  -0.0333 -0.0168 127 SER A O   
838  C  CB  . SER A 135 ? 0.2831 0.2627 0.2611 0.0117  -0.0392 -0.0225 127 SER A CB  
839  O  OG  . SER A 135 ? 0.3117 0.2908 0.2956 0.0100  -0.0396 -0.0241 127 SER A OG  
840  N  N   . PHE A 136 ? 0.2522 0.2278 0.2270 0.0097  -0.0318 -0.0154 128 PHE A N   
841  C  CA  . PHE A 136 ? 0.2400 0.2137 0.2148 0.0081  -0.0288 -0.0134 128 PHE A CA  
842  C  C   . PHE A 136 ? 0.2359 0.2107 0.2134 0.0075  -0.0272 -0.0114 128 PHE A C   
843  O  O   . PHE A 136 ? 0.2199 0.1948 0.2007 0.0058  -0.0256 -0.0103 128 PHE A O   
844  C  CB  . PHE A 136 ? 0.2360 0.2076 0.2043 0.0087  -0.0272 -0.0123 128 PHE A CB  
845  C  CG  . PHE A 136 ? 0.2350 0.2050 0.2033 0.0071  -0.0244 -0.0103 128 PHE A CG  
846  C  CD1 . PHE A 136 ? 0.2323 0.2017 0.2032 0.0056  -0.0239 -0.0105 128 PHE A CD1 
847  C  CD2 . PHE A 136 ? 0.2359 0.2052 0.2019 0.0072  -0.0224 -0.0084 128 PHE A CD2 
848  C  CE1 . PHE A 136 ? 0.2366 0.2051 0.2075 0.0042  -0.0216 -0.0085 128 PHE A CE1 
849  C  CE2 . PHE A 136 ? 0.2433 0.2117 0.2093 0.0058  -0.0201 -0.0069 128 PHE A CE2 
850  C  CZ  . PHE A 136 ? 0.2317 0.1998 0.1998 0.0043  -0.0197 -0.0068 128 PHE A CZ  
851  N  N   . GLU A 137 ? 0.2375 0.2130 0.2135 0.0089  -0.0276 -0.0109 129 GLU A N   
852  C  CA  . GLU A 137 ? 0.2519 0.2286 0.2306 0.0087  -0.0262 -0.0095 129 GLU A CA  
853  C  C   . GLU A 137 ? 0.2405 0.2197 0.2265 0.0073  -0.0265 -0.0098 129 GLU A C   
854  O  O   . GLU A 137 ? 0.2275 0.2077 0.2160 0.0062  -0.0244 -0.0084 129 GLU A O   
855  C  CB  . GLU A 137 ? 0.2733 0.2507 0.2507 0.0107  -0.0273 -0.0093 129 GLU A CB  
856  C  CG  . GLU A 137 ? 0.2944 0.2729 0.2746 0.0107  -0.0257 -0.0082 129 GLU A CG  
857  C  CD  . GLU A 137 ? 0.3492 0.3285 0.3290 0.0128  -0.0270 -0.0080 129 GLU A CD  
858  O  OE1 . GLU A 137 ? 0.3882 0.3653 0.3636 0.0140  -0.0262 -0.0068 129 GLU A OE1 
859  O  OE2 . GLU A 137 ? 0.3817 0.3635 0.3657 0.0133  -0.0288 -0.0089 129 GLU A OE2 
860  N  N   . SER A 138 ? 0.2207 0.2013 0.2101 0.0074  -0.0292 -0.0117 130 SER A N   
861  C  CA  . SER A 138 ? 0.2165 0.1995 0.2136 0.0059  -0.0298 -0.0120 130 SER A CA  
862  C  C   . SER A 138 ? 0.2059 0.1881 0.2056 0.0038  -0.0281 -0.0109 130 SER A C   
863  O  O   . SER A 138 ? 0.2151 0.1993 0.2203 0.0024  -0.0269 -0.0096 130 SER A O   
864  C  CB  . SER A 138 ? 0.2235 0.2078 0.2237 0.0065  -0.0334 -0.0147 130 SER A CB  
865  O  OG  . SER A 138 ? 0.2292 0.2157 0.2377 0.0050  -0.0341 -0.0150 130 SER A OG  
866  N  N   . ALA A 139 ? 0.1987 0.1784 0.1948 0.0035  -0.0280 -0.0113 131 ALA A N   
867  C  CA  . ALA A 139 ? 0.1907 0.1695 0.1892 0.0016  -0.0264 -0.0100 131 ALA A CA  
868  C  C   . ALA A 139 ? 0.1896 0.1686 0.1861 0.0009  -0.0232 -0.0072 131 ALA A C   
869  O  O   . ALA A 139 ? 0.1900 0.1702 0.1905 -0.0007 -0.0217 -0.0053 131 ALA A O   
870  C  CB  . ALA A 139 ? 0.1935 0.1697 0.1889 0.0018  -0.0272 -0.0113 131 ALA A CB  
871  N  N   . VAL A 140 ? 0.1875 0.1655 0.1781 0.0021  -0.0221 -0.0069 132 VAL A N   
872  C  CA  . VAL A 140 ? 0.1858 0.1643 0.1746 0.0017  -0.0192 -0.0049 132 VAL A CA  
873  C  C   . VAL A 140 ? 0.1864 0.1682 0.1797 0.0015  -0.0184 -0.0042 132 VAL A C   
874  O  O   . VAL A 140 ? 0.1819 0.1656 0.1769 0.0004  -0.0163 -0.0024 132 VAL A O   
875  C  CB  . VAL A 140 ? 0.1836 0.1601 0.1660 0.0032  -0.0185 -0.0050 132 VAL A CB  
876  C  CG1 . VAL A 140 ? 0.1830 0.1602 0.1642 0.0028  -0.0158 -0.0037 132 VAL A CG1 
877  C  CG2 . VAL A 140 ? 0.1828 0.1564 0.1606 0.0034  -0.0188 -0.0054 132 VAL A CG2 
878  N  N   . THR A 141 ? 0.1895 0.1726 0.1851 0.0026  -0.0201 -0.0054 133 THR A N   
879  C  CA  . THR A 141 ? 0.1933 0.1798 0.1935 0.0026  -0.0194 -0.0048 133 THR A CA  
880  C  C   . THR A 141 ? 0.1881 0.1772 0.1951 0.0007  -0.0191 -0.0037 133 THR A C   
881  O  O   . THR A 141 ? 0.1793 0.1712 0.1889 -0.0001 -0.0168 -0.0020 133 THR A O   
882  C  CB  . THR A 141 ? 0.1998 0.1875 0.2016 0.0043  -0.0215 -0.0064 133 THR A CB  
883  O  OG1 . THR A 141 ? 0.2126 0.1979 0.2083 0.0061  -0.0217 -0.0068 133 THR A OG1 
884  C  CG2 . THR A 141 ? 0.2057 0.1970 0.2123 0.0045  -0.0204 -0.0058 133 THR A CG2 
885  N  N   . ALA A 142 ? 0.1884 0.1767 0.1985 0.0000  -0.0213 -0.0047 134 ALA A N   
886  C  CA  . ALA A 142 ? 0.1888 0.1790 0.2063 -0.0020 -0.0211 -0.0034 134 ALA A CA  
887  C  C   . ALA A 142 ? 0.1881 0.1786 0.2049 -0.0034 -0.0183 -0.0006 134 ALA A C   
888  O  O   . ALA A 142 ? 0.1975 0.1912 0.2194 -0.0047 -0.0168 0.0016  134 ALA A O   
889  C  CB  . ALA A 142 ? 0.1883 0.1768 0.2090 -0.0024 -0.0241 -0.0053 134 ALA A CB  
890  N  N   . GLN A 143 ? 0.1901 0.1777 0.2007 -0.0032 -0.0176 -0.0005 135 GLN A N   
891  C  CA  . GLN A 143 ? 0.1956 0.1833 0.2053 -0.0046 -0.0154 0.0021  135 GLN A CA  
892  C  C   . GLN A 143 ? 0.1826 0.1725 0.1891 -0.0043 -0.0126 0.0037  135 GLN A C   
893  O  O   . GLN A 143 ? 0.1805 0.1731 0.1892 -0.0056 -0.0107 0.0063  135 GLN A O   
894  C  CB  . GLN A 143 ? 0.2111 0.1948 0.2156 -0.0043 -0.0160 0.0014  135 GLN A CB  
895  C  CG  . GLN A 143 ? 0.2189 0.2027 0.2218 -0.0055 -0.0140 0.0040  135 GLN A CG  
896  C  CD  . GLN A 143 ? 0.2346 0.2190 0.2441 -0.0072 -0.0144 0.0059  135 GLN A CD  
897  O  OE1 . GLN A 143 ? 0.2728 0.2551 0.2855 -0.0073 -0.0166 0.0043  135 GLN A OE1 
898  N  NE2 . GLN A 143 ? 0.2354 0.2227 0.2472 -0.0084 -0.0123 0.0092  135 GLN A NE2 
899  N  N   . PHE A 144 ? 0.1755 0.1645 0.1768 -0.0027 -0.0123 0.0021  136 PHE A N   
900  C  CA  . PHE A 144 ? 0.1727 0.1633 0.1704 -0.0023 -0.0098 0.0027  136 PHE A CA  
901  C  C   . PHE A 144 ? 0.1733 0.1670 0.1733 -0.0013 -0.0091 0.0021  136 PHE A C   
902  O  O   . PHE A 144 ? 0.1714 0.1668 0.1689 -0.0007 -0.0070 0.0022  136 PHE A O   
903  C  CB  . PHE A 144 ? 0.1727 0.1598 0.1634 -0.0012 -0.0098 0.0015  136 PHE A CB  
904  C  CG  . PHE A 144 ? 0.1696 0.1541 0.1578 -0.0021 -0.0101 0.0022  136 PHE A CG  
905  C  CD1 . PHE A 144 ? 0.1692 0.1549 0.1557 -0.0031 -0.0082 0.0039  136 PHE A CD1 
906  C  CD2 . PHE A 144 ? 0.1679 0.1494 0.1557 -0.0020 -0.0122 0.0011  136 PHE A CD2 
907  C  CE1 . PHE A 144 ? 0.1671 0.1507 0.1519 -0.0039 -0.0085 0.0047  136 PHE A CE1 
908  C  CE2 . PHE A 144 ? 0.1657 0.1451 0.1518 -0.0027 -0.0123 0.0017  136 PHE A CE2 
909  C  CZ  . PHE A 144 ? 0.1649 0.1452 0.1497 -0.0037 -0.0105 0.0036  136 PHE A CZ  
910  N  N   . GLY A 145 ? 0.1743 0.1687 0.1789 -0.0009 -0.0109 0.0012  137 GLY A N   
911  C  CA  . GLY A 145 ? 0.1773 0.1751 0.1851 0.0001  -0.0103 0.0006  137 GLY A CA  
912  C  C   . GLY A 145 ? 0.1837 0.1792 0.1884 0.0022  -0.0117 -0.0016 137 GLY A C   
913  O  O   . GLY A 145 ? 0.1891 0.1860 0.1974 0.0031  -0.0131 -0.0025 137 GLY A O   
914  N  N   . SER A 146 ? 0.1875 0.1797 0.1858 0.0030  -0.0113 -0.0021 138 SER A N   
915  C  CA  . SER A 146 ? 0.1881 0.1777 0.1833 0.0049  -0.0127 -0.0037 138 SER A CA  
916  C  C   . SER A 146 ? 0.1903 0.1759 0.1791 0.0049  -0.0125 -0.0037 138 SER A C   
917  O  O   . SER A 146 ? 0.1923 0.1775 0.1791 0.0037  -0.0110 -0.0028 138 SER A O   
918  C  CB  . SER A 146 ? 0.1922 0.1836 0.1881 0.0063  -0.0112 -0.0043 138 SER A CB  
919  O  OG  . SER A 146 ? 0.1905 0.1825 0.1837 0.0060  -0.0086 -0.0041 138 SER A OG  
920  N  N   . VAL A 147 ? 0.1910 0.1738 0.1770 0.0063  -0.0140 -0.0045 139 VAL A N   
921  C  CA  . VAL A 147 ? 0.1900 0.1691 0.1703 0.0065  -0.0138 -0.0045 139 VAL A CA  
922  C  C   . VAL A 147 ? 0.1892 0.1682 0.1675 0.0064  -0.0113 -0.0044 139 VAL A C   
923  O  O   . VAL A 147 ? 0.1844 0.1620 0.1597 0.0055  -0.0104 -0.0039 139 VAL A O   
924  C  CB  . VAL A 147 ? 0.1953 0.1720 0.1731 0.0083  -0.0155 -0.0049 139 VAL A CB  
925  C  CG1 . VAL A 147 ? 0.2024 0.1757 0.1750 0.0084  -0.0149 -0.0045 139 VAL A CG1 
926  C  CG2 . VAL A 147 ? 0.2006 0.1776 0.1794 0.0085  -0.0181 -0.0054 139 VAL A CG2 
927  N  N   . GLU A 148 ? 0.1864 0.1671 0.1667 0.0075  -0.0104 -0.0050 140 GLU A N   
928  C  CA  . GLU A 148 ? 0.1954 0.1763 0.1741 0.0076  -0.0084 -0.0056 140 GLU A CA  
929  C  C   . GLU A 148 ? 0.1822 0.1655 0.1605 0.0059  -0.0066 -0.0050 140 GLU A C   
930  O  O   . GLU A 148 ? 0.1751 0.1574 0.1503 0.0055  -0.0054 -0.0053 140 GLU A O   
931  C  CB  . GLU A 148 ? 0.2130 0.1959 0.1948 0.0091  -0.0077 -0.0067 140 GLU A CB  
932  C  CG  . GLU A 148 ? 0.2412 0.2232 0.2212 0.0098  -0.0060 -0.0081 140 GLU A CG  
933  C  CD  . GLU A 148 ? 0.2635 0.2476 0.2471 0.0115  -0.0053 -0.0096 140 GLU A CD  
934  O  OE1 . GLU A 148 ? 0.2796 0.2641 0.2664 0.0127  -0.0067 -0.0094 140 GLU A OE1 
935  O  OE2 . GLU A 148 ? 0.2791 0.2648 0.2626 0.0117  -0.0034 -0.0111 140 GLU A OE2 
936  N  N   . GLN A 149 ? 0.1702 0.1568 0.1521 0.0049  -0.0064 -0.0040 141 GLN A N   
937  C  CA  . GLN A 149 ? 0.1653 0.1547 0.1473 0.0033  -0.0047 -0.0027 141 GLN A CA  
938  C  C   . GLN A 149 ? 0.1608 0.1474 0.1397 0.0021  -0.0053 -0.0017 141 GLN A C   
939  O  O   . GLN A 149 ? 0.1581 0.1454 0.1346 0.0013  -0.0040 -0.0011 141 GLN A O   
940  C  CB  . GLN A 149 ? 0.1663 0.1598 0.1537 0.0025  -0.0045 -0.0013 141 GLN A CB  
941  C  CG  . GLN A 149 ? 0.1701 0.1676 0.1608 0.0035  -0.0031 -0.0021 141 GLN A CG  
942  C  CD  . GLN A 149 ? 0.1704 0.1716 0.1674 0.0028  -0.0033 -0.0007 141 GLN A CD  
943  O  OE1 . GLN A 149 ? 0.1707 0.1714 0.1712 0.0034  -0.0052 -0.0013 141 GLN A OE1 
944  N  NE2 . GLN A 149 ? 0.1732 0.1784 0.1720 0.0015  -0.0013 0.0012  141 GLN A NE2 
945  N  N   . PHE A 150 ? 0.1556 0.1395 0.1346 0.0021  -0.0074 -0.0016 142 PHE A N   
946  C  CA  . PHE A 150 ? 0.1524 0.1335 0.1285 0.0013  -0.0080 -0.0011 142 PHE A CA  
947  C  C   . PHE A 150 ? 0.1515 0.1301 0.1228 0.0018  -0.0072 -0.0018 142 PHE A C   
948  O  O   . PHE A 150 ? 0.1532 0.1316 0.1224 0.0008  -0.0065 -0.0011 142 PHE A O   
949  C  CB  . PHE A 150 ? 0.1504 0.1290 0.1270 0.0016  -0.0103 -0.0015 142 PHE A CB  
950  C  CG  . PHE A 150 ? 0.1499 0.1252 0.1224 0.0015  -0.0107 -0.0016 142 PHE A CG  
951  C  CD1 . PHE A 150 ? 0.1505 0.1258 0.1227 0.0001  -0.0101 -0.0004 142 PHE A CD1 
952  C  CD2 . PHE A 150 ? 0.1528 0.1254 0.1220 0.0027  -0.0113 -0.0024 142 PHE A CD2 
953  C  CE1 . PHE A 150 ? 0.1493 0.1218 0.1180 0.0000  -0.0103 -0.0004 142 PHE A CE1 
954  C  CE2 . PHE A 150 ? 0.1561 0.1261 0.1218 0.0026  -0.0114 -0.0022 142 PHE A CE2 
955  C  CZ  . PHE A 150 ? 0.1528 0.1229 0.1184 0.0012  -0.0108 -0.0014 142 PHE A CZ  
956  N  N   . LYS A 151 ? 0.1519 0.1287 0.1220 0.0032  -0.0076 -0.0030 143 LYS A N   
957  C  CA  . LYS A 151 ? 0.1533 0.1274 0.1197 0.0036  -0.0070 -0.0036 143 LYS A CA  
958  C  C   . LYS A 151 ? 0.1511 0.1273 0.1167 0.0030  -0.0052 -0.0041 143 LYS A C   
959  O  O   . LYS A 151 ? 0.1515 0.1265 0.1144 0.0023  -0.0047 -0.0041 143 LYS A O   
960  C  CB  . LYS A 151 ? 0.1597 0.1317 0.1259 0.0052  -0.0076 -0.0045 143 LYS A CB  
961  C  CG  . LYS A 151 ? 0.1663 0.1359 0.1316 0.0059  -0.0095 -0.0040 143 LYS A CG  
962  C  CD  . LYS A 151 ? 0.1785 0.1461 0.1435 0.0077  -0.0101 -0.0042 143 LYS A CD  
963  C  CE  . LYS A 151 ? 0.1907 0.1566 0.1540 0.0083  -0.0118 -0.0034 143 LYS A CE  
964  N  NZ  . LYS A 151 ? 0.2028 0.1674 0.1660 0.0102  -0.0128 -0.0030 143 LYS A NZ  
965  N  N   . ASP A 152 ? 0.1494 0.1290 0.1172 0.0034  -0.0041 -0.0047 144 ASP A N   
966  C  CA  . ASP A 152 ? 0.1495 0.1319 0.1163 0.0032  -0.0023 -0.0055 144 ASP A CA  
967  C  C   . ASP A 152 ? 0.1429 0.1273 0.1084 0.0015  -0.0018 -0.0039 144 ASP A C   
968  O  O   . ASP A 152 ? 0.1395 0.1241 0.1023 0.0012  -0.0011 -0.0044 144 ASP A O   
969  C  CB  . ASP A 152 ? 0.1546 0.1410 0.1243 0.0040  -0.0012 -0.0064 144 ASP A CB  
970  C  CG  . ASP A 152 ? 0.1552 0.1399 0.1263 0.0058  -0.0015 -0.0083 144 ASP A CG  
971  O  OD1 . ASP A 152 ? 0.1599 0.1405 0.1292 0.0063  -0.0024 -0.0090 144 ASP A OD1 
972  O  OD2 . ASP A 152 ? 0.1534 0.1410 0.1277 0.0067  -0.0009 -0.0089 144 ASP A OD2 
973  N  N   . ALA A 153 ? 0.1397 0.1252 0.1075 0.0006  -0.0022 -0.0018 145 ALA A N   
974  C  CA  . ALA A 153 ? 0.1383 0.1253 0.1054 -0.0009 -0.0019 0.0003  145 ALA A CA  
975  C  C   . ALA A 153 ? 0.1400 0.1233 0.1041 -0.0014 -0.0028 0.0003  145 ALA A C   
976  O  O   . ALA A 153 ? 0.1350 0.1194 0.0973 -0.0023 -0.0023 0.0012  145 ALA A O   
977  C  CB  . ALA A 153 ? 0.1379 0.1265 0.1092 -0.0018 -0.0023 0.0024  145 ALA A CB  
978  N  N   . PHE A 154 ? 0.1380 0.1174 0.1018 -0.0008 -0.0042 -0.0004 146 PHE A N   
979  C  CA  . PHE A 154 ? 0.1391 0.1152 0.1004 -0.0012 -0.0049 -0.0002 146 PHE A CA  
980  C  C   . PHE A 154 ? 0.1404 0.1157 0.0988 -0.0010 -0.0042 -0.0015 146 PHE A C   
981  O  O   . PHE A 154 ? 0.1400 0.1150 0.0965 -0.0018 -0.0041 -0.0010 146 PHE A O   
982  C  CB  . PHE A 154 ? 0.1397 0.1124 0.1011 -0.0004 -0.0064 -0.0007 146 PHE A CB  
983  C  CG  . PHE A 154 ? 0.1406 0.1104 0.0998 -0.0006 -0.0070 -0.0004 146 PHE A CG  
984  C  CD1 . PHE A 154 ? 0.1428 0.1120 0.1031 -0.0011 -0.0079 0.0004  146 PHE A CD1 
985  C  CD2 . PHE A 154 ? 0.1419 0.1097 0.0985 -0.0003 -0.0066 -0.0010 146 PHE A CD2 
986  C  CE1 . PHE A 154 ? 0.1419 0.1088 0.1003 -0.0012 -0.0083 0.0005  146 PHE A CE1 
987  C  CE2 . PHE A 154 ? 0.1416 0.1072 0.0966 -0.0006 -0.0070 -0.0006 146 PHE A CE2 
988  C  CZ  . PHE A 154 ? 0.1417 0.1069 0.0974 -0.0010 -0.0078 0.0001  146 PHE A CZ  
989  N  N   . VAL A 155 ? 0.1405 0.1155 0.0987 0.0001  -0.0038 -0.0032 147 VAL A N   
990  C  CA  . VAL A 155 ? 0.1430 0.1175 0.0994 0.0003  -0.0032 -0.0049 147 VAL A CA  
991  C  C   . VAL A 155 ? 0.1491 0.1274 0.1043 -0.0005 -0.0022 -0.0049 147 VAL A C   
992  O  O   . VAL A 155 ? 0.1574 0.1353 0.1106 -0.0011 -0.0022 -0.0054 147 VAL A O   
993  C  CB  . VAL A 155 ? 0.1426 0.1164 0.1001 0.0017  -0.0029 -0.0069 147 VAL A CB  
994  C  CG1 . VAL A 155 ? 0.1432 0.1171 0.0996 0.0019  -0.0023 -0.0090 147 VAL A CG1 
995  C  CG2 . VAL A 155 ? 0.1429 0.1129 0.1010 0.0026  -0.0040 -0.0065 147 VAL A CG2 
996  N  N   . GLN A 156 ? 0.1542 0.1367 0.1107 -0.0006 -0.0013 -0.0043 148 GLN A N   
997  C  CA  . GLN A 156 ? 0.1560 0.1429 0.1110 -0.0013 -0.0003 -0.0038 148 GLN A CA  
998  C  C   . GLN A 156 ? 0.1523 0.1388 0.1059 -0.0026 -0.0009 -0.0017 148 GLN A C   
999  O  O   . GLN A 156 ? 0.1497 0.1375 0.1009 -0.0030 -0.0008 -0.0021 148 GLN A O   
1000 C  CB  . GLN A 156 ? 0.1610 0.1528 0.1178 -0.0011 0.0010  -0.0029 148 GLN A CB  
1001 C  CG  . GLN A 156 ? 0.1685 0.1615 0.1260 0.0003  0.0019  -0.0057 148 GLN A CG  
1002 C  CD  . GLN A 156 ? 0.1751 0.1675 0.1300 0.0010  0.0021  -0.0088 148 GLN A CD  
1003 O  OE1 . GLN A 156 ? 0.1835 0.1721 0.1390 0.0018  0.0014  -0.0109 148 GLN A OE1 
1004 N  NE2 . GLN A 156 ? 0.1767 0.1730 0.1292 0.0006  0.0029  -0.0091 148 GLN A NE2 
1005 N  N   . ALA A 157 ? 0.1454 0.1300 0.1009 -0.0031 -0.0017 0.0004  149 ALA A N   
1006 C  CA  . ALA A 157 ? 0.1404 0.1244 0.0954 -0.0042 -0.0024 0.0024  149 ALA A CA  
1007 C  C   . ALA A 157 ? 0.1392 0.1201 0.0919 -0.0042 -0.0030 0.0011  149 ALA A C   
1008 O  O   . ALA A 157 ? 0.1369 0.1188 0.0882 -0.0050 -0.0032 0.0018  149 ALA A O   
1009 C  CB  . ALA A 157 ? 0.1397 0.1218 0.0976 -0.0046 -0.0033 0.0041  149 ALA A CB  
1010 N  N   . GLY A 158 ? 0.1354 0.1127 0.0880 -0.0034 -0.0034 -0.0006 150 GLY A N   
1011 C  CA  . GLY A 158 ? 0.1373 0.1116 0.0883 -0.0035 -0.0039 -0.0016 150 GLY A CA  
1012 C  C   . GLY A 158 ? 0.1381 0.1140 0.0875 -0.0036 -0.0035 -0.0034 150 GLY A C   
1013 O  O   . GLY A 158 ? 0.1344 0.1100 0.0828 -0.0043 -0.0039 -0.0033 150 GLY A O   
1014 N  N   . VAL A 159 ? 0.1397 0.1175 0.0891 -0.0029 -0.0028 -0.0052 151 VAL A N   
1015 C  CA  . VAL A 159 ? 0.1445 0.1243 0.0924 -0.0028 -0.0025 -0.0076 151 VAL A CA  
1016 C  C   . VAL A 159 ? 0.1455 0.1294 0.0916 -0.0037 -0.0024 -0.0065 151 VAL A C   
1017 O  O   . VAL A 159 ? 0.1462 0.1307 0.0908 -0.0040 -0.0029 -0.0080 151 VAL A O   
1018 C  CB  . VAL A 159 ? 0.1480 0.1298 0.0965 -0.0017 -0.0015 -0.0098 151 VAL A CB  
1019 C  CG1 . VAL A 159 ? 0.1510 0.1359 0.0978 -0.0015 -0.0012 -0.0127 151 VAL A CG1 
1020 C  CG2 . VAL A 159 ? 0.1511 0.1288 0.1016 -0.0006 -0.0018 -0.0112 151 VAL A CG2 
1021 N  N   . ASN A 160 ? 0.1446 0.1314 0.0911 -0.0041 -0.0020 -0.0038 152 ASN A N   
1022 C  CA  . ASN A 160 ? 0.1502 0.1415 0.0950 -0.0048 -0.0018 -0.0022 152 ASN A CA  
1023 C  C   . ASN A 160 ? 0.1485 0.1386 0.0938 -0.0058 -0.0028 0.0007  152 ASN A C   
1024 O  O   . ASN A 160 ? 0.1500 0.1438 0.0946 -0.0064 -0.0027 0.0029  152 ASN A O   
1025 C  CB  . ASN A 160 ? 0.1527 0.1488 0.0978 -0.0045 -0.0005 -0.0009 152 ASN A CB  
1026 C  CG  . ASN A 160 ? 0.1579 0.1562 0.1021 -0.0034 0.0005  -0.0042 152 ASN A CG  
1027 O  OD1 . ASN A 160 ? 0.1703 0.1715 0.1119 -0.0031 0.0006  -0.0063 152 ASN A OD1 
1028 N  ND2 . ASN A 160 ? 0.1555 0.1522 0.1019 -0.0026 0.0010  -0.0051 152 ASN A ND2 
1029 N  N   . ASN A 161 ? 0.1454 0.1307 0.0920 -0.0059 -0.0036 0.0006  153 ASN A N   
1030 C  CA  . ASN A 161 ? 0.1463 0.1301 0.0936 -0.0067 -0.0044 0.0027  153 ASN A CA  
1031 C  C   . ASN A 161 ? 0.1419 0.1264 0.0875 -0.0071 -0.0051 0.0016  153 ASN A C   
1032 O  O   . ASN A 161 ? 0.1402 0.1216 0.0857 -0.0070 -0.0055 -0.0004 153 ASN A O   
1033 C  CB  . ASN A 161 ? 0.1496 0.1286 0.0986 -0.0064 -0.0049 0.0027  153 ASN A CB  
1034 C  CG  . ASN A 161 ? 0.1576 0.1357 0.1081 -0.0070 -0.0056 0.0051  153 ASN A CG  
1035 O  OD1 . ASN A 161 ? 0.1643 0.1448 0.1149 -0.0076 -0.0058 0.0068  153 ASN A OD1 
1036 N  ND2 . ASN A 161 ? 0.1672 0.1419 0.1191 -0.0067 -0.0059 0.0051  153 ASN A ND2 
1037 N  N   . PHE A 162 ? 0.1382 0.1269 0.0826 -0.0075 -0.0053 0.0030  154 PHE A N   
1038 C  CA  . PHE A 162 ? 0.1359 0.1263 0.0784 -0.0078 -0.0060 0.0015  154 PHE A CA  
1039 C  C   . PHE A 162 ? 0.1335 0.1210 0.0773 -0.0084 -0.0071 0.0019  154 PHE A C   
1040 O  O   . PHE A 162 ? 0.1313 0.1181 0.0767 -0.0088 -0.0074 0.0047  154 PHE A O   
1041 C  CB  . PHE A 162 ? 0.1379 0.1343 0.0783 -0.0080 -0.0060 0.0030  154 PHE A CB  
1042 C  CG  . PHE A 162 ? 0.1407 0.1396 0.0788 -0.0081 -0.0070 0.0006  154 PHE A CG  
1043 C  CD1 . PHE A 162 ? 0.1414 0.1406 0.0782 -0.0075 -0.0068 -0.0036 154 PHE A CD1 
1044 C  CD2 . PHE A 162 ? 0.1414 0.1421 0.0792 -0.0087 -0.0082 0.0024  154 PHE A CD2 
1045 C  CE1 . PHE A 162 ? 0.1440 0.1455 0.0790 -0.0077 -0.0079 -0.0062 154 PHE A CE1 
1046 C  CE2 . PHE A 162 ? 0.1434 0.1466 0.0794 -0.0088 -0.0094 -0.0001 154 PHE A CE2 
1047 C  CZ  . PHE A 162 ? 0.1440 0.1477 0.0786 -0.0083 -0.0093 -0.0045 154 PHE A CZ  
1048 N  N   . GLY A 163 ? 0.1346 0.1205 0.0781 -0.0085 -0.0076 -0.0009 155 GLY A N   
1049 C  CA  . GLY A 163 ? 0.1337 0.1170 0.0788 -0.0090 -0.0084 -0.0007 155 GLY A CA  
1050 C  C   . GLY A 163 ? 0.1325 0.1110 0.0795 -0.0088 -0.0079 -0.0003 155 GLY A C   
1051 O  O   . GLY A 163 ? 0.1309 0.1073 0.0779 -0.0081 -0.0071 -0.0013 155 GLY A O   
1052 N  N   . SER A 164 ? 0.1335 0.1103 0.0821 -0.0091 -0.0083 0.0012  156 SER A N   
1053 C  CA  . SER A 164 ? 0.1337 0.1065 0.0837 -0.0088 -0.0077 0.0016  156 SER A CA  
1054 C  C   . SER A 164 ? 0.1334 0.1061 0.0840 -0.0083 -0.0075 0.0035  156 SER A C   
1055 O  O   . SER A 164 ? 0.1335 0.1086 0.0844 -0.0086 -0.0078 0.0054  156 SER A O   
1056 C  CB  . SER A 164 ? 0.1347 0.1064 0.0865 -0.0092 -0.0081 0.0022  156 SER A CB  
1057 O  OG  . SER A 164 ? 0.1351 0.1071 0.0872 -0.0098 -0.0085 0.0005  156 SER A OG  
1058 N  N   . GLY A 165 ? 0.1310 0.1008 0.0819 -0.0077 -0.0069 0.0032  157 GLY A N   
1059 C  CA  . GLY A 165 ? 0.1315 0.1010 0.0834 -0.0073 -0.0070 0.0046  157 GLY A CA  
1060 C  C   . GLY A 165 ? 0.1327 0.0997 0.0845 -0.0064 -0.0066 0.0038  157 GLY A C   
1061 O  O   . GLY A 165 ? 0.1292 0.0941 0.0802 -0.0060 -0.0062 0.0027  157 GLY A O   
1062 N  N   . TRP A 166 ? 0.1312 0.0986 0.0841 -0.0062 -0.0068 0.0046  158 TRP A N   
1063 C  CA  . TRP A 166 ? 0.1321 0.0976 0.0851 -0.0053 -0.0068 0.0039  158 TRP A CA  
1064 C  C   . TRP A 166 ? 0.1349 0.1021 0.0889 -0.0053 -0.0068 0.0042  158 TRP A C   
1065 O  O   . TRP A 166 ? 0.1352 0.1047 0.0906 -0.0059 -0.0069 0.0056  158 TRP A O   
1066 C  CB  . TRP A 166 ? 0.1306 0.0945 0.0849 -0.0049 -0.0072 0.0042  158 TRP A CB  
1067 C  CG  . TRP A 166 ? 0.1275 0.0903 0.0813 -0.0049 -0.0070 0.0042  158 TRP A CG  
1068 C  CD1 . TRP A 166 ? 0.1276 0.0913 0.0823 -0.0056 -0.0071 0.0051  158 TRP A CD1 
1069 C  CD2 . TRP A 166 ? 0.1278 0.0886 0.0802 -0.0042 -0.0066 0.0035  158 TRP A CD2 
1070 N  NE1 . TRP A 166 ? 0.1288 0.0913 0.0831 -0.0054 -0.0067 0.0047  158 TRP A NE1 
1071 C  CE2 . TRP A 166 ? 0.1270 0.0877 0.0799 -0.0046 -0.0063 0.0039  158 TRP A CE2 
1072 C  CE3 . TRP A 166 ? 0.1278 0.0872 0.0788 -0.0032 -0.0064 0.0027  158 TRP A CE3 
1073 C  CZ2 . TRP A 166 ? 0.1279 0.0873 0.0799 -0.0040 -0.0056 0.0037  158 TRP A CZ2 
1074 C  CZ3 . TRP A 166 ? 0.1277 0.0857 0.0776 -0.0026 -0.0058 0.0027  158 TRP A CZ3 
1075 C  CH2 . TRP A 166 ? 0.1282 0.0863 0.0786 -0.0031 -0.0053 0.0032  158 TRP A CH2 
1076 N  N   . THR A 167 ? 0.1359 0.1022 0.0894 -0.0045 -0.0067 0.0031  159 THR A N   
1077 C  CA  . THR A 167 ? 0.1354 0.1034 0.0906 -0.0044 -0.0068 0.0033  159 THR A CA  
1078 C  C   . THR A 167 ? 0.1364 0.1026 0.0928 -0.0036 -0.0076 0.0028  159 THR A C   
1079 O  O   . THR A 167 ? 0.1360 0.1001 0.0908 -0.0027 -0.0078 0.0018  159 THR A O   
1080 C  CB  . THR A 167 ? 0.1384 0.1076 0.0926 -0.0040 -0.0060 0.0022  159 THR A CB  
1081 O  OG1 . THR A 167 ? 0.1416 0.1131 0.0946 -0.0046 -0.0054 0.0024  159 THR A OG1 
1082 C  CG2 . THR A 167 ? 0.1369 0.1080 0.0932 -0.0037 -0.0060 0.0024  159 THR A CG2 
1083 N  N   . TRP A 168 ? 0.1358 0.1032 0.0952 -0.0040 -0.0081 0.0036  160 TRP A N   
1084 C  CA  . TRP A 168 ? 0.1348 0.1007 0.0959 -0.0033 -0.0093 0.0029  160 TRP A CA  
1085 C  C   . TRP A 168 ? 0.1388 0.1061 0.1027 -0.0033 -0.0098 0.0028  160 TRP A C   
1086 O  O   . TRP A 168 ? 0.1356 0.1054 0.1014 -0.0040 -0.0091 0.0040  160 TRP A O   
1087 C  CB  . TRP A 168 ? 0.1335 0.0990 0.0969 -0.0039 -0.0099 0.0036  160 TRP A CB  
1088 C  CG  . TRP A 168 ? 0.1320 0.0965 0.0938 -0.0041 -0.0095 0.0040  160 TRP A CG  
1089 C  CD1 . TRP A 168 ? 0.1324 0.0983 0.0940 -0.0050 -0.0089 0.0055  160 TRP A CD1 
1090 C  CD2 . TRP A 168 ? 0.1320 0.0946 0.0926 -0.0034 -0.0097 0.0030  160 TRP A CD2 
1091 N  NE1 . TRP A 168 ? 0.1329 0.0977 0.0936 -0.0049 -0.0088 0.0055  160 TRP A NE1 
1092 C  CE2 . TRP A 168 ? 0.1328 0.0956 0.0929 -0.0040 -0.0092 0.0040  160 TRP A CE2 
1093 C  CE3 . TRP A 168 ? 0.1346 0.0958 0.0944 -0.0022 -0.0103 0.0014  160 TRP A CE3 
1094 C  CZ2 . TRP A 168 ? 0.1336 0.0951 0.0928 -0.0035 -0.0090 0.0035  160 TRP A CZ2 
1095 C  CZ3 . TRP A 168 ? 0.1343 0.0944 0.0927 -0.0017 -0.0101 0.0008  160 TRP A CZ3 
1096 C  CH2 . TRP A 168 ? 0.1346 0.0948 0.0929 -0.0023 -0.0094 0.0019  160 TRP A CH2 
1097 N  N   . LEU A 169 ? 0.1425 0.1087 0.1069 -0.0023 -0.0109 0.0013  161 LEU A N   
1098 C  CA  . LEU A 169 ? 0.1459 0.1133 0.1142 -0.0024 -0.0119 0.0010  161 LEU A CA  
1099 C  C   . LEU A 169 ? 0.1508 0.1169 0.1215 -0.0024 -0.0133 0.0003  161 LEU A C   
1100 O  O   . LEU A 169 ? 0.1606 0.1250 0.1289 -0.0015 -0.0139 -0.0011 161 LEU A O   
1101 C  CB  . LEU A 169 ? 0.1496 0.1169 0.1169 -0.0012 -0.0125 -0.0004 161 LEU A CB  
1102 C  CG  . LEU A 169 ? 0.1518 0.1204 0.1234 -0.0011 -0.0138 -0.0010 161 LEU A CG  
1103 C  CD1 . LEU A 169 ? 0.1529 0.1243 0.1284 -0.0023 -0.0129 0.0006  161 LEU A CD1 
1104 C  CD2 . LEU A 169 ? 0.1566 0.1252 0.1267 0.0003  -0.0145 -0.0023 161 LEU A CD2 
1105 N  N   . CYS A 170 ? 0.1532 0.1203 0.1288 -0.0035 -0.0137 0.0013  162 CYS A N   
1106 C  CA  . CYS A 170 ? 0.1544 0.1202 0.1334 -0.0036 -0.0150 0.0005  162 CYS A CA  
1107 C  C   . CYS A 170 ? 0.1589 0.1257 0.1437 -0.0040 -0.0164 0.0001  162 CYS A C   
1108 O  O   . CYS A 170 ? 0.1627 0.1316 0.1499 -0.0047 -0.0159 0.0014  162 CYS A O   
1109 C  CB  . CYS A 170 ? 0.1532 0.1190 0.1340 -0.0047 -0.0143 0.0027  162 CYS A CB  
1110 S  SG  . CYS A 170 ? 0.1487 0.1137 0.1238 -0.0044 -0.0130 0.0033  162 CYS A SG  
1111 N  N   . VAL A 171 ? 0.1622 0.1276 0.1497 -0.0036 -0.0181 -0.0020 163 VAL A N   
1112 C  CA  . VAL A 171 ? 0.1639 0.1297 0.1585 -0.0043 -0.0196 -0.0025 163 VAL A CA  
1113 C  C   . VAL A 171 ? 0.1678 0.1333 0.1671 -0.0056 -0.0192 -0.0002 163 VAL A C   
1114 O  O   . VAL A 171 ? 0.1649 0.1289 0.1625 -0.0054 -0.0189 -0.0001 163 VAL A O   
1115 C  CB  . VAL A 171 ? 0.1661 0.1306 0.1614 -0.0031 -0.0219 -0.0064 163 VAL A CB  
1116 C  CG1 . VAL A 171 ? 0.1658 0.1302 0.1695 -0.0039 -0.0237 -0.0073 163 VAL A CG1 
1117 C  CG2 . VAL A 171 ? 0.1673 0.1326 0.1585 -0.0018 -0.0225 -0.0083 163 VAL A CG2 
1118 N  N   . ASP A 172 ? 0.1802 0.1472 0.1860 -0.0070 -0.0193 0.0019  164 ASP A N   
1119 C  CA  . ASP A 172 ? 0.1937 0.1604 0.2050 -0.0083 -0.0191 0.0046  164 ASP A CA  
1120 C  C   . ASP A 172 ? 0.2064 0.1720 0.2261 -0.0088 -0.0212 0.0031  164 ASP A C   
1121 O  O   . ASP A 172 ? 0.2162 0.1835 0.2414 -0.0097 -0.0216 0.0040  164 ASP A O   
1122 C  CB  . ASP A 172 ? 0.1933 0.1630 0.2059 -0.0096 -0.0173 0.0090  164 ASP A CB  
1123 C  CG  . ASP A 172 ? 0.1977 0.1675 0.2155 -0.0109 -0.0169 0.0126  164 ASP A CG  
1124 O  OD1 . ASP A 172 ? 0.2050 0.1724 0.2271 -0.0109 -0.0182 0.0118  164 ASP A OD1 
1125 O  OD2 . ASP A 172 ? 0.2129 0.1855 0.2306 -0.0118 -0.0152 0.0164  164 ASP A OD2 
1126 N  N   . PRO A 173 ? 0.2222 0.1853 0.2435 -0.0081 -0.0226 0.0008  165 PRO A N   
1127 C  CA  . PRO A 173 ? 0.2309 0.1927 0.2608 -0.0085 -0.0248 -0.0013 165 PRO A CA  
1128 C  C   . PRO A 173 ? 0.2387 0.2010 0.2774 -0.0104 -0.0246 0.0028  165 PRO A C   
1129 O  O   . PRO A 173 ? 0.2465 0.2088 0.2932 -0.0112 -0.0262 0.0020  165 PRO A O   
1130 C  CB  . PRO A 173 ? 0.2348 0.1939 0.2636 -0.0072 -0.0259 -0.0045 165 PRO A CB  
1131 C  CG  . PRO A 173 ? 0.2311 0.1901 0.2520 -0.0065 -0.0239 -0.0031 165 PRO A CG  
1132 C  CD  . PRO A 173 ? 0.2275 0.1889 0.2429 -0.0069 -0.0222 -0.0007 165 PRO A CD  
1133 N  N   . SER A 174 ? 0.2507 0.2140 0.2885 -0.0112 -0.0227 0.0073  166 SER A N   
1134 C  CA  . SER A 174 ? 0.2613 0.2256 0.3074 -0.0130 -0.0223 0.0120  166 SER A CA  
1135 C  C   . SER A 174 ? 0.2742 0.2420 0.3225 -0.0142 -0.0212 0.0146  166 SER A C   
1136 O  O   . SER A 174 ? 0.2775 0.2467 0.3328 -0.0157 -0.0207 0.0188  166 SER A O   
1137 C  CB  . SER A 174 ? 0.2639 0.2286 0.3080 -0.0133 -0.0207 0.0162  166 SER A CB  
1138 O  OG  . SER A 174 ? 0.2671 0.2350 0.3042 -0.0135 -0.0184 0.0188  166 SER A OG  
1139 N  N   . ASN A 175 ? 0.2840 0.2531 0.3268 -0.0134 -0.0210 0.0123  167 ASN A N   
1140 C  CA  . ASN A 175 ? 0.2910 0.2638 0.3353 -0.0142 -0.0198 0.0144  167 ASN A CA  
1141 C  C   . ASN A 175 ? 0.2860 0.2589 0.3303 -0.0135 -0.0214 0.0101  167 ASN A C   
1142 O  O   . ASN A 175 ? 0.2837 0.2585 0.3222 -0.0127 -0.0205 0.0094  167 ASN A O   
1143 C  CB  . ASN A 175 ? 0.3092 0.2845 0.3453 -0.0139 -0.0173 0.0168  167 ASN A CB  
1144 C  CG  . ASN A 175 ? 0.3355 0.3152 0.3743 -0.0150 -0.0155 0.0204  167 ASN A CG  
1145 O  OD1 . ASN A 175 ? 0.3931 0.3741 0.4399 -0.0165 -0.0153 0.0238  167 ASN A OD1 
1146 N  ND2 . ASN A 175 ? 0.3491 0.3310 0.3813 -0.0143 -0.0140 0.0199  167 ASN A ND2 
1147 N  N   . LYS A 176 ? 0.2840 0.2548 0.3345 -0.0135 -0.0240 0.0070  168 LYS A N   
1148 C  CA  . LYS A 176 ? 0.2751 0.2462 0.3266 -0.0127 -0.0261 0.0027  168 LYS A CA  
1149 C  C   . LYS A 176 ? 0.2515 0.2222 0.2924 -0.0107 -0.0260 -0.0004 168 LYS A C   
1150 O  O   . LYS A 176 ? 0.2449 0.2174 0.2842 -0.0101 -0.0265 -0.0019 168 LYS A O   
1151 C  CB  . LYS A 176 ? 0.2759 0.2505 0.3332 -0.0139 -0.0256 0.0048  168 LYS A CB  
1152 C  CG  . LYS A 176 ? 0.2785 0.2542 0.3467 -0.0161 -0.0253 0.0088  168 LYS A CG  
1153 C  CD  . LYS A 176 ? 0.2941 0.2663 0.3690 -0.0167 -0.0270 0.0083  168 LYS A CD  
1154 C  CE  . LYS A 176 ? 0.2979 0.2673 0.3762 -0.0159 -0.0306 0.0021  168 LYS A CE  
1155 N  NZ  . LYS A 176 ? 0.3043 0.2729 0.3960 -0.0176 -0.0323 0.0026  168 LYS A NZ  
1156 N  N   . ASN A 177 ? 0.2444 0.2131 0.2788 -0.0097 -0.0254 -0.0011 169 ASN A N   
1157 C  CA  . ASN A 177 ? 0.2338 0.2021 0.2586 -0.0078 -0.0253 -0.0037 169 ASN A CA  
1158 C  C   . ASN A 177 ? 0.2205 0.1911 0.2400 -0.0075 -0.0234 -0.0020 169 ASN A C   
1159 O  O   . ASN A 177 ? 0.2255 0.1960 0.2391 -0.0060 -0.0238 -0.0042 169 ASN A O   
1160 C  CB  . ASN A 177 ? 0.2346 0.2020 0.2596 -0.0064 -0.0281 -0.0088 169 ASN A CB  
1161 C  CG  . ASN A 177 ? 0.2366 0.2016 0.2652 -0.0061 -0.0300 -0.0116 169 ASN A CG  
1162 O  OD1 . ASN A 177 ? 0.2532 0.2166 0.2821 -0.0065 -0.0290 -0.0102 169 ASN A OD1 
1163 N  ND2 . ASN A 177 ? 0.2433 0.2082 0.2744 -0.0053 -0.0327 -0.0159 169 ASN A ND2 
1164 N  N   . GLN A 178 ? 0.2090 0.1819 0.2306 -0.0088 -0.0214 0.0020  170 GLN A N   
1165 C  CA  . GLN A 178 ? 0.2024 0.1777 0.2193 -0.0085 -0.0194 0.0035  170 GLN A CA  
1166 C  C   . GLN A 178 ? 0.2026 0.1765 0.2104 -0.0073 -0.0184 0.0027  170 GLN A C   
1167 O  O   . GLN A 178 ? 0.2100 0.1821 0.2157 -0.0073 -0.0181 0.0032  170 GLN A O   
1168 C  CB  . GLN A 178 ? 0.1960 0.1742 0.2158 -0.0101 -0.0172 0.0080  170 GLN A CB  
1169 N  N   . LEU A 179 ? 0.1997 0.1745 0.2029 -0.0062 -0.0179 0.0017  171 LEU A N   
1170 C  CA  . LEU A 179 ? 0.2029 0.1767 0.1984 -0.0052 -0.0166 0.0016  171 LEU A CA  
1171 C  C   . LEU A 179 ? 0.2010 0.1767 0.1952 -0.0061 -0.0142 0.0047  171 LEU A C   
1172 O  O   . LEU A 179 ? 0.2047 0.1834 0.2018 -0.0068 -0.0132 0.0063  171 LEU A O   
1173 C  CB  . LEU A 179 ? 0.2036 0.1777 0.1955 -0.0038 -0.0169 -0.0002 171 LEU A CB  
1174 C  CG  . LEU A 179 ? 0.2061 0.1786 0.1971 -0.0025 -0.0192 -0.0033 171 LEU A CG  
1175 C  CD1 . LEU A 179 ? 0.2083 0.1818 0.1977 -0.0012 -0.0197 -0.0044 171 LEU A CD1 
1176 C  CD2 . LEU A 179 ? 0.2131 0.1829 0.1985 -0.0016 -0.0191 -0.0042 171 LEU A CD2 
1177 N  N   . VAL A 180 ? 0.1971 0.1715 0.1870 -0.0061 -0.0133 0.0053  172 VAL A N   
1178 C  CA  . VAL A 180 ? 0.1929 0.1694 0.1814 -0.0069 -0.0114 0.0080  172 VAL A CA  
1179 C  C   . VAL A 180 ? 0.1888 0.1640 0.1705 -0.0061 -0.0105 0.0072  172 VAL A C   
1180 O  O   . VAL A 180 ? 0.1857 0.1581 0.1648 -0.0054 -0.0113 0.0056  172 VAL A O   
1181 C  CB  . VAL A 180 ? 0.1946 0.1714 0.1875 -0.0082 -0.0114 0.0106  172 VAL A CB  
1182 C  CG1 . VAL A 180 ? 0.1945 0.1682 0.1858 -0.0079 -0.0123 0.0098  172 VAL A CG1 
1183 C  CG2 . VAL A 180 ? 0.2005 0.1807 0.1930 -0.0091 -0.0095 0.0140  172 VAL A CG2 
1184 N  N   . ILE A 181 ? 0.1918 0.1693 0.1709 -0.0062 -0.0089 0.0081  173 ILE A N   
1185 C  CA  . ILE A 181 ? 0.1932 0.1698 0.1668 -0.0057 -0.0081 0.0074  173 ILE A CA  
1186 C  C   . ILE A 181 ? 0.1993 0.1766 0.1726 -0.0067 -0.0076 0.0095  173 ILE A C   
1187 O  O   . ILE A 181 ? 0.2068 0.1870 0.1828 -0.0076 -0.0070 0.0121  173 ILE A O   
1188 C  CB  . ILE A 181 ? 0.1876 0.1663 0.1587 -0.0051 -0.0068 0.0067  173 ILE A CB  
1189 C  CG1 . ILE A 181 ? 0.1860 0.1639 0.1577 -0.0040 -0.0074 0.0047  173 ILE A CG1 
1190 C  CG2 . ILE A 181 ? 0.1880 0.1657 0.1543 -0.0048 -0.0061 0.0059  173 ILE A CG2 
1191 C  CD1 . ILE A 181 ? 0.1873 0.1675 0.1581 -0.0033 -0.0061 0.0040  173 ILE A CD1 
1192 N  N   . ASP A 182 ? 0.2037 0.1786 0.1741 -0.0064 -0.0079 0.0088  174 ASP A N   
1193 C  CA  . ASP A 182 ? 0.2024 0.1776 0.1727 -0.0072 -0.0078 0.0107  174 ASP A CA  
1194 C  C   . ASP A 182 ? 0.1913 0.1657 0.1569 -0.0068 -0.0074 0.0096  174 ASP A C   
1195 O  O   . ASP A 182 ? 0.1842 0.1561 0.1477 -0.0060 -0.0077 0.0075  174 ASP A O   
1196 C  CB  . ASP A 182 ? 0.2047 0.1776 0.1783 -0.0073 -0.0091 0.0107  174 ASP A CB  
1197 C  CG  . ASP A 182 ? 0.2065 0.1801 0.1817 -0.0081 -0.0091 0.0132  174 ASP A CG  
1198 O  OD1 . ASP A 182 ? 0.2248 0.2011 0.2022 -0.0089 -0.0087 0.0159  174 ASP A OD1 
1199 O  OD2 . ASP A 182 ? 0.2043 0.1759 0.1785 -0.0078 -0.0096 0.0126  174 ASP A OD2 
1200 N  N   . ASN A 183 ? 0.1833 0.1601 0.1475 -0.0074 -0.0067 0.0110  175 ASN A N   
1201 C  CA  . ASN A 183 ? 0.1790 0.1556 0.1397 -0.0073 -0.0065 0.0102  175 ASN A CA  
1202 C  C   . ASN A 183 ? 0.1727 0.1485 0.1344 -0.0078 -0.0072 0.0117  175 ASN A C   
1203 O  O   . ASN A 183 ? 0.1709 0.1485 0.1352 -0.0084 -0.0073 0.0142  175 ASN A O   
1204 C  CB  . ASN A 183 ? 0.1861 0.1664 0.1445 -0.0075 -0.0056 0.0105  175 ASN A CB  
1205 C  CG  . ASN A 183 ? 0.1878 0.1680 0.1442 -0.0067 -0.0049 0.0080  175 ASN A CG  
1206 O  OD1 . ASN A 183 ? 0.1926 0.1700 0.1492 -0.0060 -0.0052 0.0063  175 ASN A OD1 
1207 N  ND2 . ASN A 183 ? 0.1881 0.1717 0.1425 -0.0067 -0.0041 0.0077  175 ASN A ND2 
1208 N  N   . THR A 184 ? 0.1662 0.1396 0.1264 -0.0074 -0.0075 0.0103  176 THR A N   
1209 C  CA  . THR A 184 ? 0.1548 0.1281 0.1157 -0.0078 -0.0080 0.0115  176 THR A CA  
1210 C  C   . THR A 184 ? 0.1501 0.1240 0.1079 -0.0079 -0.0078 0.0105  176 THR A C   
1211 O  O   . THR A 184 ? 0.1459 0.1190 0.1013 -0.0076 -0.0073 0.0085  176 THR A O   
1212 C  CB  . THR A 184 ? 0.1517 0.1219 0.1145 -0.0073 -0.0086 0.0107  176 THR A CB  
1213 O  OG1 . THR A 184 ? 0.1462 0.1141 0.1067 -0.0066 -0.0083 0.0084  176 THR A OG1 
1214 C  CG2 . THR A 184 ? 0.1519 0.1215 0.1186 -0.0073 -0.0092 0.0113  176 THR A CG2 
1215 N  N   . SER A 185 ? 0.1463 0.1217 0.1048 -0.0084 -0.0082 0.0121  177 SER A N   
1216 C  CA  . SER A 185 ? 0.1403 0.1168 0.0966 -0.0087 -0.0084 0.0114  177 SER A CA  
1217 C  C   . SER A 185 ? 0.1360 0.1101 0.0934 -0.0086 -0.0087 0.0109  177 SER A C   
1218 O  O   . SER A 185 ? 0.1308 0.1040 0.0909 -0.0085 -0.0091 0.0121  177 SER A O   
1219 C  CB  . SER A 185 ? 0.1432 0.1237 0.0994 -0.0093 -0.0088 0.0137  177 SER A CB  
1220 O  OG  . SER A 185 ? 0.1432 0.1249 0.0978 -0.0096 -0.0093 0.0128  177 SER A OG  
1221 N  N   . ASN A 186 ? 0.1360 0.1092 0.0918 -0.0086 -0.0085 0.0091  178 ASN A N   
1222 C  CA  . ASN A 186 ? 0.1362 0.1078 0.0930 -0.0085 -0.0086 0.0087  178 ASN A CA  
1223 C  C   . ASN A 186 ? 0.1381 0.1068 0.0962 -0.0078 -0.0082 0.0084  178 ASN A C   
1224 O  O   . ASN A 186 ? 0.1392 0.1061 0.0960 -0.0072 -0.0077 0.0071  178 ASN A O   
1225 C  CB  . ASN A 186 ? 0.1357 0.1097 0.0940 -0.0091 -0.0095 0.0104  178 ASN A CB  
1226 C  CG  . ASN A 186 ? 0.1359 0.1129 0.0923 -0.0097 -0.0100 0.0099  178 ASN A CG  
1227 O  OD1 . ASN A 186 ? 0.1351 0.1119 0.0894 -0.0097 -0.0096 0.0079  178 ASN A OD1 
1228 N  ND2 . ASN A 186 ? 0.1366 0.1165 0.0939 -0.0101 -0.0110 0.0115  178 ASN A ND2 
1229 N  N   . ALA A 187 ? 0.1409 0.1094 0.1016 -0.0076 -0.0086 0.0094  179 ALA A N   
1230 C  CA  . ALA A 187 ? 0.1398 0.1060 0.1017 -0.0067 -0.0083 0.0087  179 ALA A CA  
1231 C  C   . ALA A 187 ? 0.1423 0.1082 0.1060 -0.0064 -0.0088 0.0091  179 ALA A C   
1232 O  O   . ALA A 187 ? 0.1384 0.1026 0.1035 -0.0056 -0.0089 0.0082  179 ALA A O   
1233 C  CB  . ALA A 187 ? 0.1368 0.1029 0.1010 -0.0064 -0.0084 0.0089  179 ALA A CB  
1234 N  N   . GLY A 188 ? 0.1456 0.1133 0.1096 -0.0070 -0.0092 0.0105  180 GLY A N   
1235 C  CA  . GLY A 188 ? 0.1468 0.1146 0.1135 -0.0070 -0.0096 0.0115  180 GLY A CA  
1236 C  C   . GLY A 188 ? 0.1525 0.1182 0.1191 -0.0062 -0.0096 0.0096  180 GLY A C   
1237 O  O   . GLY A 188 ? 0.1482 0.1131 0.1116 -0.0059 -0.0091 0.0081  180 GLY A O   
1238 N  N   . CYS A 189 ? 0.1530 0.1176 0.1232 -0.0059 -0.0103 0.0095  181 CYS A N   
1239 C  CA  . CYS A 189 ? 0.1563 0.1191 0.1267 -0.0050 -0.0106 0.0072  181 CYS A CA  
1240 C  C   . CYS A 189 ? 0.1593 0.1221 0.1341 -0.0052 -0.0115 0.0077  181 CYS A C   
1241 O  O   . CYS A 189 ? 0.1553 0.1181 0.1345 -0.0055 -0.0121 0.0090  181 CYS A O   
1242 C  CB  . CYS A 189 ? 0.1592 0.1206 0.1298 -0.0040 -0.0105 0.0057  181 CYS A CB  
1243 S  SG  . CYS A 189 ? 0.1672 0.1269 0.1365 -0.0025 -0.0108 0.0025  181 CYS A SG  
1244 N  N   . PRO A 190 ? 0.1585 0.1213 0.1326 -0.0051 -0.0116 0.0068  182 PRO A N   
1245 C  CA  . PRO A 190 ? 0.1619 0.1252 0.1404 -0.0056 -0.0124 0.0074  182 PRO A CA  
1246 C  C   . PRO A 190 ? 0.1660 0.1277 0.1499 -0.0053 -0.0137 0.0066  182 PRO A C   
1247 O  O   . PRO A 190 ? 0.1595 0.1218 0.1485 -0.0062 -0.0143 0.0083  182 PRO A O   
1248 C  CB  . PRO A 190 ? 0.1648 0.1279 0.1411 -0.0050 -0.0125 0.0055  182 PRO A CB  
1249 C  CG  . PRO A 190 ? 0.1658 0.1290 0.1365 -0.0047 -0.0114 0.0051  182 PRO A CG  
1250 C  CD  . PRO A 190 ? 0.1608 0.1233 0.1302 -0.0045 -0.0111 0.0052  182 PRO A CD  
1251 N  N   . LEU A 191 ? 0.1706 0.1307 0.1537 -0.0042 -0.0140 0.0041  183 LEU A N   
1252 C  CA  . LEU A 191 ? 0.1799 0.1386 0.1682 -0.0037 -0.0153 0.0026  183 LEU A CA  
1253 C  C   . LEU A 191 ? 0.1797 0.1385 0.1732 -0.0046 -0.0155 0.0054  183 LEU A C   
1254 O  O   . LEU A 191 ? 0.1799 0.1378 0.1797 -0.0047 -0.0167 0.0052  183 LEU A O   
1255 C  CB  . LEU A 191 ? 0.1854 0.1429 0.1715 -0.0022 -0.0154 -0.0007 183 LEU A CB  
1256 C  CG  . LEU A 191 ? 0.1962 0.1537 0.1807 -0.0018 -0.0144 -0.0001 183 LEU A CG  
1257 C  CD1 . LEU A 191 ? 0.2050 0.1617 0.1954 -0.0016 -0.0151 -0.0002 183 LEU A CD1 
1258 C  CD2 . LEU A 191 ? 0.2039 0.1613 0.1832 -0.0004 -0.0136 -0.0027 183 LEU A CD2 
1259 N  N   . THR A 192 ? 0.1791 0.1392 0.1705 -0.0051 -0.0146 0.0079  184 THR A N   
1260 C  CA  . THR A 192 ? 0.1855 0.1461 0.1819 -0.0058 -0.0149 0.0111  184 THR A CA  
1261 C  C   . THR A 192 ? 0.2022 0.1640 0.2027 -0.0071 -0.0152 0.0141  184 THR A C   
1262 O  O   . THR A 192 ? 0.2070 0.1688 0.2132 -0.0076 -0.0158 0.0167  184 THR A O   
1263 C  CB  . THR A 192 ? 0.1761 0.1383 0.1694 -0.0061 -0.0141 0.0133  184 THR A CB  
1264 O  OG1 . THR A 192 ? 0.1694 0.1339 0.1586 -0.0070 -0.0132 0.0151  184 THR A OG1 
1265 C  CG2 . THR A 192 ? 0.1739 0.1352 0.1637 -0.0051 -0.0136 0.0108  184 THR A CG2 
1266 N  N   . LYS A 193 ? 0.2204 0.1833 0.2188 -0.0075 -0.0148 0.0140  185 LYS A N   
1267 C  CA  . LYS A 193 ? 0.2337 0.1977 0.2374 -0.0086 -0.0152 0.0166  185 LYS A CA  
1268 C  C   . LYS A 193 ? 0.2334 0.1961 0.2406 -0.0085 -0.0162 0.0140  185 LYS A C   
1269 O  O   . LYS A 193 ? 0.2364 0.2004 0.2469 -0.0094 -0.0162 0.0157  185 LYS A O   
1270 C  CB  . LYS A 193 ? 0.2568 0.2243 0.2578 -0.0096 -0.0139 0.0202  185 LYS A CB  
1271 C  CG  . LYS A 193 ? 0.2895 0.2582 0.2832 -0.0093 -0.0128 0.0186  185 LYS A CG  
1272 C  CD  . LYS A 193 ? 0.3105 0.2830 0.3020 -0.0101 -0.0116 0.0219  185 LYS A CD  
1273 C  CE  . LYS A 193 ? 0.3383 0.3120 0.3242 -0.0098 -0.0106 0.0200  185 LYS A CE  
1274 N  NZ  . LYS A 193 ? 0.3405 0.3133 0.3203 -0.0090 -0.0102 0.0176  185 LYS A NZ  
1275 N  N   . GLY A 194 ? 0.2291 0.1894 0.2361 -0.0073 -0.0171 0.0100  186 GLY A N   
1276 C  CA  . GLY A 194 ? 0.2314 0.1904 0.2424 -0.0070 -0.0185 0.0071  186 GLY A CA  
1277 C  C   . GLY A 194 ? 0.2342 0.1939 0.2406 -0.0065 -0.0184 0.0048  186 GLY A C   
1278 O  O   . GLY A 194 ? 0.2576 0.2166 0.2668 -0.0061 -0.0199 0.0020  186 GLY A O   
1279 N  N   . LEU A 195 ? 0.2155 0.1768 0.2154 -0.0065 -0.0170 0.0059  187 LEU A N   
1280 C  CA  . LEU A 195 ? 0.2016 0.1637 0.1977 -0.0060 -0.0168 0.0042  187 LEU A CA  
1281 C  C   . LEU A 195 ? 0.1944 0.1550 0.1858 -0.0044 -0.0173 0.0004  187 LEU A C   
1282 O  O   . LEU A 195 ? 0.2024 0.1621 0.1912 -0.0038 -0.0168 0.0000  187 LEU A O   
1283 C  CB  . LEU A 195 ? 0.2003 0.1646 0.1918 -0.0066 -0.0151 0.0066  187 LEU A CB  
1284 C  CG  . LEU A 195 ? 0.2039 0.1707 0.1986 -0.0080 -0.0143 0.0105  187 LEU A CG  
1285 C  CD1 . LEU A 195 ? 0.2042 0.1734 0.1936 -0.0082 -0.0126 0.0119  187 LEU A CD1 
1286 C  CD2 . LEU A 195 ? 0.2024 0.1701 0.2026 -0.0086 -0.0151 0.0105  187 LEU A CD2 
1287 N  N   . ARG A 196 ? 0.1835 0.1442 0.1735 -0.0037 -0.0181 -0.0019 188 ARG A N   
1288 C  CA  . ARG A 196 ? 0.1709 0.1309 0.1561 -0.0021 -0.0185 -0.0050 188 ARG A CA  
1289 C  C   . ARG A 196 ? 0.1608 0.1217 0.1401 -0.0016 -0.0175 -0.0046 188 ARG A C   
1290 O  O   . ARG A 196 ? 0.1545 0.1164 0.1343 -0.0016 -0.0180 -0.0048 188 ARG A O   
1291 C  CB  . ARG A 196 ? 0.1789 0.1386 0.1676 -0.0014 -0.0207 -0.0082 188 ARG A CB  
1292 C  CG  . ARG A 196 ? 0.1816 0.1402 0.1770 -0.0017 -0.0219 -0.0092 188 ARG A CG  
1293 C  CD  . ARG A 196 ? 0.1904 0.1489 0.1907 -0.0014 -0.0243 -0.0124 188 ARG A CD  
1294 N  NE  . ARG A 196 ? 0.1957 0.1526 0.2020 -0.0014 -0.0254 -0.0139 188 ARG A NE  
1295 C  CZ  . ARG A 196 ? 0.2027 0.1589 0.2134 -0.0008 -0.0277 -0.0178 188 ARG A CZ  
1296 N  NH1 . ARG A 196 ? 0.2001 0.1575 0.2102 -0.0002 -0.0293 -0.0206 188 ARG A NH1 
1297 N  NH2 . ARG A 196 ? 0.2092 0.1639 0.2256 -0.0008 -0.0285 -0.0191 188 ARG A NH2 
1298 N  N   . PRO A 197 ? 0.1539 0.1144 0.1282 -0.0011 -0.0162 -0.0040 189 PRO A N   
1299 C  CA  . PRO A 197 ? 0.1495 0.1105 0.1190 -0.0008 -0.0152 -0.0034 189 PRO A CA  
1300 C  C   . PRO A 197 ? 0.1451 0.1061 0.1122 0.0006  -0.0161 -0.0055 189 PRO A C   
1301 O  O   . PRO A 197 ? 0.1411 0.1016 0.1071 0.0018  -0.0170 -0.0076 189 PRO A O   
1302 C  CB  . PRO A 197 ? 0.1477 0.1079 0.1134 -0.0006 -0.0138 -0.0027 189 PRO A CB  
1303 C  CG  . PRO A 197 ? 0.1506 0.1100 0.1178 -0.0002 -0.0143 -0.0039 189 PRO A CG  
1304 C  CD  . PRO A 197 ? 0.1512 0.1108 0.1245 -0.0009 -0.0155 -0.0040 189 PRO A CD  
1305 N  N   . VAL A 198 ? 0.1411 0.1029 0.1070 0.0007  -0.0160 -0.0050 190 VAL A N   
1306 C  CA  . VAL A 198 ? 0.1443 0.1063 0.1071 0.0022  -0.0167 -0.0064 190 VAL A CA  
1307 C  C   . VAL A 198 ? 0.1453 0.1069 0.1037 0.0026  -0.0153 -0.0051 190 VAL A C   
1308 O  O   . VAL A 198 ? 0.1553 0.1167 0.1104 0.0040  -0.0156 -0.0056 190 VAL A O   
1309 C  CB  . VAL A 198 ? 0.1450 0.1083 0.1111 0.0023  -0.0182 -0.0073 190 VAL A CB  
1310 C  CG1 . VAL A 198 ? 0.1448 0.1083 0.1164 0.0017  -0.0197 -0.0086 190 VAL A CG1 
1311 C  CG2 . VAL A 198 ? 0.1418 0.1063 0.1095 0.0013  -0.0172 -0.0054 190 VAL A CG2 
1312 N  N   . LEU A 199 ? 0.1419 0.1035 0.1004 0.0015  -0.0138 -0.0033 191 LEU A N   
1313 C  CA  . LEU A 199 ? 0.1409 0.1019 0.0962 0.0017  -0.0125 -0.0023 191 LEU A CA  
1314 C  C   . LEU A 199 ? 0.1380 0.0988 0.0931 0.0005  -0.0111 -0.0010 191 LEU A C   
1315 O  O   . LEU A 199 ? 0.1354 0.0973 0.0931 -0.0006 -0.0110 -0.0003 191 LEU A O   
1316 C  CB  . LEU A 199 ? 0.1393 0.1013 0.0954 0.0020  -0.0125 -0.0022 191 LEU A CB  
1317 C  CG  . LEU A 199 ? 0.1402 0.1016 0.0943 0.0020  -0.0112 -0.0014 191 LEU A CG  
1318 C  CD1 . LEU A 199 ? 0.1422 0.1018 0.0929 0.0032  -0.0110 -0.0012 191 LEU A CD1 
1319 C  CD2 . LEU A 199 ? 0.1403 0.1030 0.0962 0.0022  -0.0113 -0.0016 191 LEU A CD2 
1320 N  N   . ALA A 200 ? 0.1379 0.0976 0.0902 0.0008  -0.0102 -0.0006 192 ALA A N   
1321 C  CA  . ALA A 200 ? 0.1362 0.0959 0.0883 -0.0003 -0.0090 0.0004  192 ALA A CA  
1322 C  C   . ALA A 200 ? 0.1351 0.0940 0.0853 -0.0001 -0.0081 0.0006  192 ALA A C   
1323 O  O   . ALA A 200 ? 0.1386 0.0963 0.0871 0.0009  -0.0081 0.0006  192 ALA A O   
1324 C  CB  . ALA A 200 ? 0.1367 0.0957 0.0883 -0.0005 -0.0088 0.0006  192 ALA A CB  
1325 N  N   . VAL A 201 ? 0.1327 0.0924 0.0834 -0.0011 -0.0075 0.0009  193 VAL A N   
1326 C  CA  . VAL A 201 ? 0.1320 0.0909 0.0816 -0.0011 -0.0067 0.0007  193 VAL A CA  
1327 C  C   . VAL A 201 ? 0.1294 0.0889 0.0791 -0.0023 -0.0062 0.0010  193 VAL A C   
1328 O  O   . VAL A 201 ? 0.1283 0.0898 0.0789 -0.0031 -0.0063 0.0012  193 VAL A O   
1329 C  CB  . VAL A 201 ? 0.1333 0.0930 0.0836 -0.0007 -0.0067 0.0000  193 VAL A CB  
1330 C  CG1 . VAL A 201 ? 0.1336 0.0922 0.0834 -0.0008 -0.0060 -0.0006 193 VAL A CG1 
1331 C  CG2 . VAL A 201 ? 0.1349 0.0939 0.0852 0.0006  -0.0074 -0.0002 193 VAL A CG2 
1332 N  N   . ASP A 202 ? 0.1281 0.0861 0.0771 -0.0024 -0.0058 0.0013  194 ASP A N   
1333 C  CA  . ASP A 202 ? 0.1274 0.0859 0.0768 -0.0034 -0.0055 0.0014  194 ASP A CA  
1334 C  C   . ASP A 202 ? 0.1296 0.0889 0.0791 -0.0039 -0.0053 0.0004  194 ASP A C   
1335 O  O   . ASP A 202 ? 0.1323 0.0904 0.0818 -0.0033 -0.0051 -0.0004 194 ASP A O   
1336 C  CB  . ASP A 202 ? 0.1265 0.0832 0.0755 -0.0032 -0.0049 0.0019  194 ASP A CB  
1337 C  CG  . ASP A 202 ? 0.1272 0.0845 0.0771 -0.0042 -0.0048 0.0023  194 ASP A CG  
1338 O  OD1 . ASP A 202 ? 0.1258 0.0850 0.0764 -0.0051 -0.0052 0.0021  194 ASP A OD1 
1339 O  OD2 . ASP A 202 ? 0.1268 0.0829 0.0768 -0.0041 -0.0041 0.0029  194 ASP A OD2 
1340 N  N   . VAL A 203 ? 0.1287 0.0905 0.0785 -0.0048 -0.0055 0.0003  195 VAL A N   
1341 C  CA  . VAL A 203 ? 0.1318 0.0948 0.0813 -0.0052 -0.0054 -0.0011 195 VAL A CA  
1342 C  C   . VAL A 203 ? 0.1322 0.0960 0.0821 -0.0061 -0.0057 -0.0013 195 VAL A C   
1343 O  O   . VAL A 203 ? 0.1369 0.1024 0.0865 -0.0066 -0.0059 -0.0028 195 VAL A O   
1344 C  CB  . VAL A 203 ? 0.1335 0.0994 0.0827 -0.0051 -0.0054 -0.0015 195 VAL A CB  
1345 C  CG1 . VAL A 203 ? 0.1348 0.0997 0.0843 -0.0040 -0.0052 -0.0018 195 VAL A CG1 
1346 C  CG2 . VAL A 203 ? 0.1327 0.1011 0.0821 -0.0057 -0.0056 0.0003  195 VAL A CG2 
1347 N  N   . TRP A 204 ? 0.1310 0.0936 0.0815 -0.0064 -0.0057 -0.0002 196 TRP A N   
1348 C  CA  . TRP A 204 ? 0.1325 0.0952 0.0839 -0.0073 -0.0059 -0.0006 196 TRP A CA  
1349 C  C   . TRP A 204 ? 0.1333 0.0942 0.0855 -0.0072 -0.0057 -0.0022 196 TRP A C   
1350 O  O   . TRP A 204 ? 0.1361 0.0947 0.0884 -0.0064 -0.0052 -0.0020 196 TRP A O   
1351 C  CB  . TRP A 204 ? 0.1339 0.0954 0.0863 -0.0074 -0.0057 0.0008  196 TRP A CB  
1352 C  CG  . TRP A 204 ? 0.1315 0.0948 0.0843 -0.0076 -0.0061 0.0022  196 TRP A CG  
1353 C  CD1 . TRP A 204 ? 0.1300 0.0939 0.0825 -0.0071 -0.0062 0.0031  196 TRP A CD1 
1354 C  CD2 . TRP A 204 ? 0.1303 0.0947 0.0845 -0.0083 -0.0064 0.0029  196 TRP A CD2 
1355 N  NE1 . TRP A 204 ? 0.1319 0.0970 0.0857 -0.0075 -0.0067 0.0043  196 TRP A NE1 
1356 C  CE2 . TRP A 204 ? 0.1309 0.0965 0.0857 -0.0081 -0.0068 0.0043  196 TRP A CE2 
1357 C  CE3 . TRP A 204 ? 0.1303 0.0949 0.0860 -0.0090 -0.0066 0.0025  196 TRP A CE3 
1358 C  CZ2 . TRP A 204 ? 0.1299 0.0968 0.0863 -0.0085 -0.0073 0.0053  196 TRP A CZ2 
1359 C  CZ3 . TRP A 204 ? 0.1308 0.0971 0.0882 -0.0095 -0.0071 0.0035  196 TRP A CZ3 
1360 C  CH2 . TRP A 204 ? 0.1306 0.0980 0.0883 -0.0092 -0.0074 0.0049  196 TRP A CH2 
1361 N  N   . GLU A 205 ? 0.1369 0.0989 0.0898 -0.0079 -0.0062 -0.0038 197 GLU A N   
1362 C  CA  . GLU A 205 ? 0.1385 0.0988 0.0930 -0.0079 -0.0061 -0.0059 197 GLU A CA  
1363 C  C   . GLU A 205 ? 0.1372 0.0940 0.0938 -0.0078 -0.0055 -0.0047 197 GLU A C   
1364 O  O   . GLU A 205 ? 0.1361 0.0907 0.0938 -0.0073 -0.0052 -0.0053 197 GLU A O   
1365 C  CB  . GLU A 205 ? 0.1397 0.1021 0.0950 -0.0088 -0.0071 -0.0082 197 GLU A CB  
1366 C  CG  . GLU A 205 ? 0.1405 0.1068 0.0933 -0.0086 -0.0075 -0.0092 197 GLU A CG  
1367 C  CD  . GLU A 205 ? 0.1431 0.1121 0.0961 -0.0093 -0.0086 -0.0120 197 GLU A CD  
1368 O  OE1 . GLU A 205 ? 0.1445 0.1145 0.0985 -0.0102 -0.0094 -0.0117 197 GLU A OE1 
1369 O  OE2 . GLU A 205 ? 0.1433 0.1137 0.0955 -0.0087 -0.0087 -0.0146 197 GLU A OE2 
1370 N  N   . HIS A 206 ? 0.1392 0.0958 0.0962 -0.0082 -0.0052 -0.0028 198 HIS A N   
1371 C  CA  . HIS A 206 ? 0.1406 0.0945 0.0993 -0.0081 -0.0043 -0.0012 198 HIS A CA  
1372 C  C   . HIS A 206 ? 0.1383 0.0905 0.0956 -0.0068 -0.0036 0.0001  198 HIS A C   
1373 O  O   . HIS A 206 ? 0.1417 0.0918 0.1002 -0.0065 -0.0028 0.0014  198 HIS A O   
1374 C  CB  . HIS A 206 ? 0.1429 0.0976 0.1024 -0.0086 -0.0039 0.0005  198 HIS A CB  
1375 C  CG  . HIS A 206 ? 0.1443 0.1002 0.1015 -0.0079 -0.0037 0.0018  198 HIS A CG  
1376 N  ND1 . HIS A 206 ? 0.1455 0.1036 0.1027 -0.0084 -0.0042 0.0021  198 HIS A ND1 
1377 C  CD2 . HIS A 206 ? 0.1457 0.1008 0.1009 -0.0067 -0.0032 0.0028  198 HIS A CD2 
1378 C  CE1 . HIS A 206 ? 0.1449 0.1033 0.1007 -0.0076 -0.0040 0.0031  198 HIS A CE1 
1379 N  NE2 . HIS A 206 ? 0.1486 0.1053 0.1030 -0.0066 -0.0035 0.0034  198 HIS A NE2 
1380 N  N   . ALA A 207 ? 0.1379 0.0910 0.0928 -0.0060 -0.0039 -0.0001 199 ALA A N   
1381 C  CA  . ALA A 207 ? 0.1389 0.0905 0.0925 -0.0047 -0.0035 0.0009  199 ALA A CA  
1382 C  C   . ALA A 207 ? 0.1403 0.0900 0.0952 -0.0041 -0.0034 0.0002  199 ALA A C   
1383 O  O   . ALA A 207 ? 0.1416 0.0896 0.0962 -0.0031 -0.0031 0.0015  199 ALA A O   
1384 C  CB  . ALA A 207 ? 0.1390 0.0923 0.0905 -0.0041 -0.0039 0.0008  199 ALA A CB  
1385 N  N   . TYR A 208 ? 0.1396 0.0898 0.0958 -0.0046 -0.0039 -0.0021 200 TYR A N   
1386 C  CA  . TYR A 208 ? 0.1408 0.0894 0.0987 -0.0040 -0.0040 -0.0034 200 TYR A CA  
1387 C  C   . TYR A 208 ? 0.1437 0.0911 0.1050 -0.0048 -0.0042 -0.0052 200 TYR A C   
1388 O  O   . TYR A 208 ? 0.1423 0.0878 0.1058 -0.0041 -0.0042 -0.0064 200 TYR A O   
1389 C  CB  . TYR A 208 ? 0.1410 0.0916 0.0975 -0.0033 -0.0043 -0.0051 200 TYR A CB  
1390 C  CG  . TYR A 208 ? 0.1408 0.0946 0.0962 -0.0042 -0.0047 -0.0069 200 TYR A CG  
1391 C  CD1 . TYR A 208 ? 0.1432 0.0977 0.1000 -0.0046 -0.0051 -0.0097 200 TYR A CD1 
1392 C  CD2 . TYR A 208 ? 0.1402 0.0966 0.0934 -0.0044 -0.0048 -0.0059 200 TYR A CD2 
1393 C  CE1 . TYR A 208 ? 0.1428 0.1009 0.0981 -0.0052 -0.0055 -0.0113 200 TYR A CE1 
1394 C  CE2 . TYR A 208 ? 0.1397 0.0993 0.0918 -0.0051 -0.0052 -0.0070 200 TYR A CE2 
1395 C  CZ  . TYR A 208 ? 0.1419 0.1027 0.0948 -0.0054 -0.0055 -0.0096 200 TYR A CZ  
1396 O  OH  . TYR A 208 ? 0.1390 0.1037 0.0904 -0.0060 -0.0059 -0.0105 200 TYR A OH  
1397 N  N   . TYR A 209 ? 0.1429 0.0913 0.1051 -0.0061 -0.0045 -0.0058 201 TYR A N   
1398 C  CA  . TYR A 209 ? 0.1447 0.0928 0.1101 -0.0069 -0.0051 -0.0084 201 TYR A CA  
1399 C  C   . TYR A 209 ? 0.1503 0.0947 0.1200 -0.0070 -0.0047 -0.0076 201 TYR A C   
1400 O  O   . TYR A 209 ? 0.1536 0.0967 0.1267 -0.0072 -0.0053 -0.0102 201 TYR A O   
1401 C  CB  . TYR A 209 ? 0.1418 0.0924 0.1073 -0.0083 -0.0058 -0.0094 201 TYR A CB  
1402 C  CG  . TYR A 209 ? 0.1405 0.0928 0.1070 -0.0087 -0.0069 -0.0134 201 TYR A CG  
1403 C  CD1 . TYR A 209 ? 0.1372 0.0930 0.1004 -0.0083 -0.0073 -0.0151 201 TYR A CD1 
1404 C  CD2 . TYR A 209 ? 0.1417 0.0922 0.1127 -0.0095 -0.0075 -0.0155 201 TYR A CD2 
1405 C  CE1 . TYR A 209 ? 0.1386 0.0965 0.1020 -0.0085 -0.0083 -0.0189 201 TYR A CE1 
1406 C  CE2 . TYR A 209 ? 0.1416 0.0939 0.1135 -0.0097 -0.0087 -0.0197 201 TYR A CE2 
1407 C  CZ  . TYR A 209 ? 0.1406 0.0968 0.1083 -0.0091 -0.0090 -0.0215 201 TYR A CZ  
1408 O  OH  . TYR A 209 ? 0.1405 0.0991 0.1086 -0.0092 -0.0101 -0.0259 201 TYR A OH  
1409 N  N   . LYS A 210 ? 0.1534 0.0962 0.1233 -0.0069 -0.0038 -0.0041 202 LYS A N   
1410 C  CA  . LYS A 210 ? 0.1603 0.0998 0.1346 -0.0070 -0.0032 -0.0024 202 LYS A CA  
1411 C  C   . LYS A 210 ? 0.1616 0.0987 0.1371 -0.0056 -0.0033 -0.0029 202 LYS A C   
1412 O  O   . LYS A 210 ? 0.1638 0.0986 0.1440 -0.0059 -0.0036 -0.0041 202 LYS A O   
1413 C  CB  . LYS A 210 ? 0.1634 0.1025 0.1370 -0.0069 -0.0020 0.0019  202 LYS A CB  
1414 C  CG  . LYS A 210 ? 0.1675 0.1034 0.1449 -0.0067 -0.0011 0.0047  202 LYS A CG  
1415 C  CD  . LYS A 210 ? 0.1723 0.1063 0.1562 -0.0081 -0.0014 0.0034  202 LYS A CD  
1416 C  CE  . LYS A 210 ? 0.1768 0.1123 0.1626 -0.0097 -0.0011 0.0041  202 LYS A CE  
1417 N  NZ  . LYS A 210 ? 0.1836 0.1168 0.1767 -0.0111 -0.0012 0.0039  202 LYS A NZ  
1418 N  N   . ASP A 211 ? 0.1576 0.0956 0.1294 -0.0042 -0.0032 -0.0022 203 ASP A N   
1419 C  CA  . ASP A 211 ? 0.1586 0.0948 0.1315 -0.0028 -0.0033 -0.0022 203 ASP A CA  
1420 C  C   . ASP A 211 ? 0.1611 0.0985 0.1340 -0.0023 -0.0041 -0.0063 203 ASP A C   
1421 O  O   . ASP A 211 ? 0.1661 0.1017 0.1420 -0.0013 -0.0043 -0.0075 203 ASP A O   
1422 C  CB  . ASP A 211 ? 0.1572 0.0939 0.1264 -0.0014 -0.0029 0.0007  203 ASP A CB  
1423 C  CG  . ASP A 211 ? 0.1570 0.0925 0.1262 -0.0014 -0.0020 0.0049  203 ASP A CG  
1424 O  OD1 . ASP A 211 ? 0.1591 0.0928 0.1322 -0.0022 -0.0015 0.0061  203 ASP A OD1 
1425 O  OD2 . ASP A 211 ? 0.1549 0.0915 0.1204 -0.0004 -0.0018 0.0070  203 ASP A OD2 
1426 N  N   . PHE A 212 ? 0.1602 0.1010 0.1301 -0.0028 -0.0044 -0.0084 204 PHE A N   
1427 C  CA  . PHE A 212 ? 0.1620 0.1048 0.1313 -0.0023 -0.0048 -0.0119 204 PHE A CA  
1428 C  C   . PHE A 212 ? 0.1617 0.1064 0.1317 -0.0033 -0.0055 -0.0156 204 PHE A C   
1429 O  O   . PHE A 212 ? 0.1616 0.1084 0.1311 -0.0027 -0.0057 -0.0189 204 PHE A O   
1430 C  CB  . PHE A 212 ? 0.1633 0.1090 0.1282 -0.0017 -0.0046 -0.0111 204 PHE A CB  
1431 C  CG  . PHE A 212 ? 0.1679 0.1122 0.1322 -0.0003 -0.0044 -0.0084 204 PHE A CG  
1432 C  CD1 . PHE A 212 ? 0.1747 0.1188 0.1401 0.0011  -0.0044 -0.0095 204 PHE A CD1 
1433 C  CD2 . PHE A 212 ? 0.1682 0.1118 0.1308 -0.0004 -0.0041 -0.0051 204 PHE A CD2 
1434 C  CE1 . PHE A 212 ? 0.1769 0.1201 0.1419 0.0024  -0.0045 -0.0071 204 PHE A CE1 
1435 C  CE2 . PHE A 212 ? 0.1728 0.1155 0.1345 0.0009  -0.0041 -0.0029 204 PHE A CE2 
1436 C  CZ  . PHE A 212 ? 0.1774 0.1199 0.1403 0.0023  -0.0043 -0.0038 204 PHE A CZ  
1437 N  N   . GLU A 213 ? 0.1577 0.1023 0.1287 -0.0048 -0.0057 -0.0152 205 GLU A N   
1438 C  CA  . GLU A 213 ? 0.1605 0.1077 0.1317 -0.0058 -0.0066 -0.0184 205 GLU A CA  
1439 C  C   . GLU A 213 ? 0.1627 0.1145 0.1290 -0.0055 -0.0067 -0.0194 205 GLU A C   
1440 O  O   . GLU A 213 ? 0.1615 0.1144 0.1246 -0.0054 -0.0062 -0.0165 205 GLU A O   
1441 C  CB  . GLU A 213 ? 0.1624 0.1079 0.1383 -0.0058 -0.0073 -0.0223 205 GLU A CB  
1442 C  CG  . GLU A 213 ? 0.1631 0.1041 0.1446 -0.0065 -0.0073 -0.0209 205 GLU A CG  
1443 C  CD  . GLU A 213 ? 0.1683 0.1068 0.1556 -0.0061 -0.0080 -0.0246 205 GLU A CD  
1444 O  OE1 . GLU A 213 ? 0.1658 0.1042 0.1530 -0.0046 -0.0079 -0.0264 205 GLU A OE1 
1445 O  OE2 . GLU A 213 ? 0.1676 0.1042 0.1599 -0.0073 -0.0087 -0.0258 205 GLU A OE2 
1446 N  N   . ASN A 214 ? 0.1660 0.1204 0.1318 -0.0052 -0.0072 -0.0233 206 ASN A N   
1447 C  CA  . ASN A 214 ? 0.1683 0.1275 0.1297 -0.0049 -0.0071 -0.0239 206 ASN A CA  
1448 C  C   . ASN A 214 ? 0.1661 0.1262 0.1255 -0.0036 -0.0061 -0.0227 206 ASN A C   
1449 O  O   . ASN A 214 ? 0.1640 0.1281 0.1202 -0.0034 -0.0059 -0.0224 206 ASN A O   
1450 C  CB  . ASN A 214 ? 0.1733 0.1357 0.1345 -0.0048 -0.0079 -0.0285 206 ASN A CB  
1451 C  CG  . ASN A 214 ? 0.1819 0.1428 0.1461 -0.0036 -0.0077 -0.0320 206 ASN A CG  
1452 O  OD1 . ASN A 214 ? 0.1905 0.1470 0.1592 -0.0036 -0.0080 -0.0326 206 ASN A OD1 
1453 N  ND2 . ASN A 214 ? 0.1827 0.1471 0.1446 -0.0024 -0.0071 -0.0340 206 ASN A ND2 
1454 N  N   . ARG A 215 ? 0.1663 0.1228 0.1280 -0.0026 -0.0057 -0.0218 207 ARG A N   
1455 C  CA  . ARG A 215 ? 0.1600 0.1175 0.1209 -0.0012 -0.0050 -0.0216 207 ARG A CA  
1456 C  C   . ARG A 215 ? 0.1529 0.1108 0.1113 -0.0012 -0.0046 -0.0178 207 ARG A C   
1457 O  O   . ARG A 215 ? 0.1537 0.1092 0.1130 -0.0004 -0.0044 -0.0158 207 ARG A O   
1458 C  CB  . ARG A 215 ? 0.1627 0.1167 0.1276 0.0000  -0.0050 -0.0228 207 ARG A CB  
1459 C  CG  . ARG A 215 ? 0.1672 0.1207 0.1351 0.0001  -0.0055 -0.0273 207 ARG A CG  
1460 C  CD  . ARG A 215 ? 0.1694 0.1186 0.1423 0.0012  -0.0055 -0.0281 207 ARG A CD  
1461 N  NE  . ARG A 215 ? 0.1708 0.1156 0.1463 0.0007  -0.0056 -0.0246 207 ARG A NE  
1462 C  CZ  . ARG A 215 ? 0.1727 0.1151 0.1483 0.0014  -0.0053 -0.0209 207 ARG A CZ  
1463 N  NH1 . ARG A 215 ? 0.1710 0.1149 0.1449 0.0028  -0.0049 -0.0200 207 ARG A NH1 
1464 N  NH2 . ARG A 215 ? 0.1760 0.1149 0.1537 0.0009  -0.0053 -0.0178 207 ARG A NH2 
1465 N  N   . ARG A 216 ? 0.1454 0.1066 0.1009 -0.0021 -0.0046 -0.0167 208 ARG A N   
1466 C  CA  . ARG A 216 ? 0.1382 0.1000 0.0919 -0.0021 -0.0044 -0.0135 208 ARG A CA  
1467 C  C   . ARG A 216 ? 0.1376 0.1001 0.0914 -0.0009 -0.0039 -0.0133 208 ARG A C   
1468 O  O   . ARG A 216 ? 0.1350 0.0961 0.0888 -0.0005 -0.0040 -0.0109 208 ARG A O   
1469 C  CB  . ARG A 216 ? 0.1363 0.1018 0.0876 -0.0031 -0.0045 -0.0126 208 ARG A CB  
1470 C  CG  . ARG A 216 ? 0.1336 0.0991 0.0839 -0.0033 -0.0045 -0.0094 208 ARG A CG  
1471 C  CD  . ARG A 216 ? 0.1321 0.1016 0.0808 -0.0040 -0.0045 -0.0082 208 ARG A CD  
1472 N  NE  . ARG A 216 ? 0.1321 0.1018 0.0803 -0.0051 -0.0051 -0.0078 208 ARG A NE  
1473 C  CZ  . ARG A 216 ? 0.1316 0.1042 0.0788 -0.0058 -0.0053 -0.0062 208 ARG A CZ  
1474 N  NH1 . ARG A 216 ? 0.1321 0.1074 0.0787 -0.0057 -0.0050 -0.0047 208 ARG A NH1 
1475 N  NH2 . ARG A 216 ? 0.1324 0.1052 0.0795 -0.0066 -0.0060 -0.0058 208 ARG A NH2 
1476 N  N   . PRO A 217 ? 0.1386 0.1038 0.0927 -0.0002 -0.0035 -0.0157 209 PRO A N   
1477 C  CA  . PRO A 217 ? 0.1384 0.1044 0.0933 0.0010  -0.0030 -0.0153 209 PRO A CA  
1478 C  C   . PRO A 217 ? 0.1400 0.1019 0.0972 0.0021  -0.0033 -0.0148 209 PRO A C   
1479 O  O   . PRO A 217 ? 0.1372 0.0991 0.0947 0.0028  -0.0034 -0.0131 209 PRO A O   
1480 C  CB  . PRO A 217 ? 0.1422 0.1119 0.0971 0.0017  -0.0023 -0.0184 209 PRO A CB  
1481 C  CG  . PRO A 217 ? 0.1423 0.1146 0.0952 0.0006  -0.0025 -0.0195 209 PRO A CG  
1482 C  CD  . PRO A 217 ? 0.1424 0.1106 0.0959 -0.0003 -0.0034 -0.0188 209 PRO A CD  
1483 N  N   . ASP A 218 ? 0.1444 0.1030 0.1037 0.0023  -0.0036 -0.0160 210 ASP A N   
1484 C  CA  . ASP A 218 ? 0.1467 0.1016 0.1085 0.0034  -0.0039 -0.0149 210 ASP A CA  
1485 C  C   . ASP A 218 ? 0.1458 0.0988 0.1061 0.0030  -0.0042 -0.0113 210 ASP A C   
1486 O  O   . ASP A 218 ? 0.1463 0.0981 0.1070 0.0040  -0.0045 -0.0096 210 ASP A O   
1487 C  CB  . ASP A 218 ? 0.1518 0.1035 0.1168 0.0035  -0.0041 -0.0167 210 ASP A CB  
1488 C  CG  . ASP A 218 ? 0.1580 0.1111 0.1251 0.0044  -0.0038 -0.0207 210 ASP A CG  
1489 O  OD1 . ASP A 218 ? 0.1605 0.1159 0.1277 0.0056  -0.0034 -0.0213 210 ASP A OD1 
1490 O  OD2 . ASP A 218 ? 0.1617 0.1137 0.1309 0.0041  -0.0041 -0.0234 210 ASP A OD2 
1491 N  N   . TYR A 219 ? 0.1443 0.0973 0.1029 0.0016  -0.0043 -0.0104 211 TYR A N   
1492 C  CA  . TYR A 219 ? 0.1437 0.0956 0.1007 0.0013  -0.0045 -0.0074 211 TYR A CA  
1493 C  C   . TYR A 219 ? 0.1444 0.0983 0.0998 0.0017  -0.0047 -0.0063 211 TYR A C   
1494 O  O   . TYR A 219 ? 0.1417 0.0943 0.0967 0.0025  -0.0050 -0.0045 211 TYR A O   
1495 C  CB  . TYR A 219 ? 0.1414 0.0938 0.0972 -0.0002 -0.0044 -0.0071 211 TYR A CB  
1496 C  CG  . TYR A 219 ? 0.1382 0.0910 0.0919 -0.0007 -0.0045 -0.0047 211 TYR A CG  
1497 C  CD1 . TYR A 219 ? 0.1401 0.0907 0.0936 -0.0002 -0.0045 -0.0025 211 TYR A CD1 
1498 C  CD2 . TYR A 219 ? 0.1367 0.0922 0.0889 -0.0015 -0.0046 -0.0046 211 TYR A CD2 
1499 C  CE1 . TYR A 219 ? 0.1402 0.0914 0.0919 -0.0005 -0.0045 -0.0009 211 TYR A CE1 
1500 C  CE2 . TYR A 219 ? 0.1358 0.0915 0.0867 -0.0018 -0.0047 -0.0028 211 TYR A CE2 
1501 C  CZ  . TYR A 219 ? 0.1396 0.0932 0.0903 -0.0012 -0.0047 -0.0012 211 TYR A CZ  
1502 O  OH  . TYR A 219 ? 0.1441 0.0980 0.0936 -0.0014 -0.0048 0.0001  211 TYR A OH  
1503 N  N   . LEU A 220 ? 0.1469 0.1041 0.1015 0.0013  -0.0045 -0.0072 212 LEU A N   
1504 C  CA  . LEU A 220 ? 0.1505 0.1098 0.1046 0.0016  -0.0047 -0.0062 212 LEU A CA  
1505 C  C   . LEU A 220 ? 0.1536 0.1127 0.1093 0.0031  -0.0050 -0.0063 212 LEU A C   
1506 O  O   . LEU A 220 ? 0.1518 0.1110 0.1072 0.0035  -0.0056 -0.0050 212 LEU A O   
1507 C  CB  . LEU A 220 ? 0.1488 0.1119 0.1023 0.0008  -0.0043 -0.0068 212 LEU A CB  
1508 C  CG  . LEU A 220 ? 0.1486 0.1124 0.1006 -0.0006 -0.0043 -0.0060 212 LEU A CG  
1509 C  CD1 . LEU A 220 ? 0.1473 0.1151 0.0987 -0.0013 -0.0038 -0.0065 212 LEU A CD1 
1510 C  CD2 . LEU A 220 ? 0.1497 0.1127 0.1012 -0.0009 -0.0049 -0.0039 212 LEU A CD2 
1511 N  N   . LYS A 221 ? 0.1614 0.1201 0.1189 0.0039  -0.0046 -0.0081 213 LYS A N   
1512 C  CA  . LYS A 221 ? 0.1685 0.1271 0.1281 0.0055  -0.0049 -0.0083 213 LYS A CA  
1513 C  C   . LYS A 221 ? 0.1683 0.1235 0.1282 0.0064  -0.0057 -0.0065 213 LYS A C   
1514 O  O   . LYS A 221 ? 0.1698 0.1253 0.1304 0.0075  -0.0064 -0.0056 213 LYS A O   
1515 C  CB  . LYS A 221 ? 0.1764 0.1357 0.1382 0.0062  -0.0043 -0.0110 213 LYS A CB  
1516 C  CG  . LYS A 221 ? 0.1855 0.1493 0.1469 0.0058  -0.0034 -0.0125 213 LYS A CG  
1517 C  CD  . LYS A 221 ? 0.1943 0.1594 0.1569 0.0062  -0.0026 -0.0158 213 LYS A CD  
1518 C  CE  . LYS A 221 ? 0.2018 0.1718 0.1625 0.0054  -0.0017 -0.0164 213 LYS A CE  
1519 N  NZ  . LYS A 221 ? 0.2121 0.1846 0.1733 0.0059  -0.0008 -0.0199 213 LYS A NZ  
1520 N  N   . GLU A 222 ? 0.1718 0.1242 0.1313 0.0059  -0.0056 -0.0058 214 GLU A N   
1521 C  CA  . GLU A 222 ? 0.1758 0.1252 0.1357 0.0068  -0.0061 -0.0037 214 GLU A CA  
1522 C  C   . GLU A 222 ? 0.1714 0.1210 0.1285 0.0067  -0.0066 -0.0014 214 GLU A C   
1523 O  O   . GLU A 222 ? 0.1659 0.1145 0.1227 0.0079  -0.0072 0.0004  214 GLU A O   
1524 C  CB  . GLU A 222 ? 0.1870 0.1335 0.1485 0.0064  -0.0056 -0.0038 214 GLU A CB  
1525 C  CG  . GLU A 222 ? 0.2022 0.1477 0.1675 0.0071  -0.0054 -0.0060 214 GLU A CG  
1526 C  CD  . GLU A 222 ? 0.2205 0.1628 0.1885 0.0066  -0.0052 -0.0062 214 GLU A CD  
1527 O  OE1 . GLU A 222 ? 0.2355 0.1755 0.2031 0.0063  -0.0051 -0.0035 214 GLU A OE1 
1528 O  OE2 . GLU A 222 ? 0.2443 0.1863 0.2149 0.0067  -0.0050 -0.0092 214 GLU A OE2 
1529 N  N   . ILE A 223 ? 0.1664 0.1173 0.1214 0.0054  -0.0063 -0.0015 215 ILE A N   
1530 C  CA  . ILE A 223 ? 0.1674 0.1185 0.1200 0.0053  -0.0067 0.0002  215 ILE A CA  
1531 C  C   . ILE A 223 ? 0.1639 0.1164 0.1158 0.0064  -0.0078 0.0006  215 ILE A C   
1532 O  O   . ILE A 223 ? 0.1673 0.1195 0.1173 0.0070  -0.0083 0.0019  215 ILE A O   
1533 C  CB  . ILE A 223 ? 0.1642 0.1164 0.1154 0.0037  -0.0063 -0.0001 215 ILE A CB  
1534 C  CG1 . ILE A 223 ? 0.1660 0.1177 0.1150 0.0038  -0.0065 0.0014  215 ILE A CG1 
1535 C  CG2 . ILE A 223 ? 0.1646 0.1196 0.1162 0.0032  -0.0065 -0.0013 215 ILE A CG2 
1536 C  CD1 . ILE A 223 ? 0.1669 0.1193 0.1153 0.0024  -0.0060 0.0013  215 ILE A CD1 
1537 N  N   . TRP A 224 ? 0.1627 0.1168 0.1164 0.0068  -0.0082 -0.0006 216 TRP A N   
1538 C  CA  . TRP A 224 ? 0.1627 0.1184 0.1168 0.0079  -0.0094 -0.0004 216 TRP A CA  
1539 C  C   . TRP A 224 ? 0.1690 0.1232 0.1221 0.0095  -0.0103 0.0012  216 TRP A C   
1540 O  O   . TRP A 224 ? 0.1716 0.1268 0.1234 0.0103  -0.0115 0.0017  216 TRP A O   
1541 C  CB  . TRP A 224 ? 0.1601 0.1177 0.1171 0.0083  -0.0095 -0.0018 216 TRP A CB  
1542 C  CG  . TRP A 224 ? 0.1552 0.1152 0.1130 0.0069  -0.0086 -0.0030 216 TRP A CG  
1543 C  CD1 . TRP A 224 ? 0.1543 0.1154 0.1136 0.0066  -0.0076 -0.0044 216 TRP A CD1 
1544 C  CD2 . TRP A 224 ? 0.1495 0.1111 0.1067 0.0057  -0.0088 -0.0028 216 TRP A CD2 
1545 N  NE1 . TRP A 224 ? 0.1523 0.1161 0.1116 0.0053  -0.0070 -0.0047 216 TRP A NE1 
1546 C  CE2 . TRP A 224 ? 0.1496 0.1133 0.1078 0.0047  -0.0077 -0.0036 216 TRP A CE2 
1547 C  CE3 . TRP A 224 ? 0.1481 0.1095 0.1041 0.0054  -0.0097 -0.0021 216 TRP A CE3 
1548 C  CZ2 . TRP A 224 ? 0.1486 0.1143 0.1071 0.0034  -0.0076 -0.0031 216 TRP A CZ2 
1549 C  CZ3 . TRP A 224 ? 0.1468 0.1098 0.1033 0.0042  -0.0097 -0.0021 216 TRP A CZ3 
1550 C  CH2 . TRP A 224 ? 0.1463 0.1113 0.1042 0.0031  -0.0086 -0.0024 216 TRP A CH2 
1551 N  N   . SER A 225 ? 0.1719 0.1239 0.1258 0.0100  -0.0097 0.0021  217 SER A N   
1552 C  CA  . SER A 225 ? 0.1768 0.1277 0.1302 0.0117  -0.0105 0.0041  217 SER A CA  
1553 C  C   . SER A 225 ? 0.1773 0.1275 0.1272 0.0116  -0.0104 0.0061  217 SER A C   
1554 O  O   . SER A 225 ? 0.1781 0.1282 0.1268 0.0131  -0.0111 0.0081  217 SER A O   
1555 C  CB  . SER A 225 ? 0.1820 0.1307 0.1384 0.0125  -0.0102 0.0047  217 SER A CB  
1556 O  OG  . SER A 225 ? 0.1887 0.1357 0.1462 0.0112  -0.0088 0.0039  217 SER A OG  
1557 N  N   . VAL A 226 ? 0.1705 0.1209 0.1190 0.0102  -0.0095 0.0056  218 VAL A N   
1558 C  CA  . VAL A 226 ? 0.1698 0.1203 0.1150 0.0103  -0.0094 0.0072  218 VAL A CA  
1559 C  C   . VAL A 226 ? 0.1686 0.1212 0.1120 0.0099  -0.0100 0.0057  218 VAL A C   
1560 O  O   . VAL A 226 ? 0.1691 0.1221 0.1099 0.0099  -0.0096 0.0063  218 VAL A O   
1561 C  CB  . VAL A 226 ? 0.1721 0.1207 0.1173 0.0093  -0.0078 0.0085  218 VAL A CB  
1562 C  CG1 . VAL A 226 ? 0.1756 0.1219 0.1231 0.0100  -0.0074 0.0103  218 VAL A CG1 
1563 C  CG2 . VAL A 226 ? 0.1704 0.1189 0.1169 0.0074  -0.0070 0.0066  218 VAL A CG2 
1564 N  N   . ILE A 227 ? 0.1635 0.1176 0.1084 0.0095  -0.0108 0.0038  219 ILE A N   
1565 C  CA  . ILE A 227 ? 0.1609 0.1166 0.1051 0.0090  -0.0115 0.0024  219 ILE A CA  
1566 C  C   . ILE A 227 ? 0.1638 0.1209 0.1058 0.0106  -0.0130 0.0026  219 ILE A C   
1567 O  O   . ILE A 227 ? 0.1670 0.1246 0.1093 0.0119  -0.0141 0.0029  219 ILE A O   
1568 C  CB  . ILE A 227 ? 0.1574 0.1147 0.1045 0.0081  -0.0119 0.0007  219 ILE A CB  
1569 C  CG1 . ILE A 227 ? 0.1563 0.1130 0.1049 0.0066  -0.0105 0.0004  219 ILE A CG1 
1570 C  CG2 . ILE A 227 ? 0.1555 0.1143 0.1026 0.0077  -0.0129 -0.0005 219 ILE A CG2 
1571 C  CD1 . ILE A 227 ? 0.1530 0.1092 0.1005 0.0053  -0.0095 0.0007  219 ILE A CD1 
1572 N  N   . ASP A 228 ? 0.1636 0.1213 0.1034 0.0106  -0.0131 0.0021  220 ASP A N   
1573 C  CA  . ASP A 228 ? 0.1699 0.1293 0.1074 0.0120  -0.0146 0.0015  220 ASP A CA  
1574 C  C   . ASP A 228 ? 0.1711 0.1321 0.1111 0.0116  -0.0162 -0.0011 220 ASP A C   
1575 O  O   . ASP A 228 ? 0.1668 0.1281 0.1073 0.0108  -0.0163 -0.0025 220 ASP A O   
1576 C  CB  . ASP A 228 ? 0.1718 0.1315 0.1060 0.0123  -0.0137 0.0019  220 ASP A CB  
1577 C  CG  . ASP A 228 ? 0.1747 0.1367 0.1060 0.0141  -0.0154 0.0008  220 ASP A CG  
1578 O  OD1 . ASP A 228 ? 0.1721 0.1354 0.1045 0.0147  -0.0174 -0.0007 220 ASP A OD1 
1579 O  OD2 . ASP A 228 ? 0.1776 0.1404 0.1057 0.0148  -0.0146 0.0012  220 ASP A OD2 
1580 N  N   . TRP A 229 ? 0.1764 0.1383 0.1185 0.0121  -0.0175 -0.0015 221 TRP A N   
1581 C  CA  . TRP A 229 ? 0.1780 0.1414 0.1235 0.0116  -0.0191 -0.0037 221 TRP A CA  
1582 C  C   . TRP A 229 ? 0.1867 0.1519 0.1311 0.0125  -0.0210 -0.0056 221 TRP A C   
1583 O  O   . TRP A 229 ? 0.1850 0.1511 0.1326 0.0118  -0.0222 -0.0077 221 TRP A O   
1584 C  CB  . TRP A 229 ? 0.1756 0.1400 0.1241 0.0120  -0.0199 -0.0036 221 TRP A CB  
1585 C  CG  . TRP A 229 ? 0.1737 0.1369 0.1244 0.0109  -0.0181 -0.0025 221 TRP A CG  
1586 C  CD1 . TRP A 229 ? 0.1715 0.1338 0.1223 0.0117  -0.0174 -0.0012 221 TRP A CD1 
1587 C  CD2 . TRP A 229 ? 0.1686 0.1319 0.1218 0.0091  -0.0168 -0.0030 221 TRP A CD2 
1588 N  NE1 . TRP A 229 ? 0.1714 0.1332 0.1244 0.0105  -0.0158 -0.0013 221 TRP A NE1 
1589 C  CE2 . TRP A 229 ? 0.1695 0.1321 0.1237 0.0089  -0.0154 -0.0022 221 TRP A CE2 
1590 C  CE3 . TRP A 229 ? 0.1716 0.1355 0.1265 0.0077  -0.0168 -0.0038 221 TRP A CE3 
1591 C  CZ2 . TRP A 229 ? 0.1691 0.1321 0.1252 0.0074  -0.0140 -0.0023 221 TRP A CZ2 
1592 C  CZ3 . TRP A 229 ? 0.1689 0.1331 0.1261 0.0061  -0.0153 -0.0034 221 TRP A CZ3 
1593 C  CH2 . TRP A 229 ? 0.1685 0.1324 0.1258 0.0061  -0.0140 -0.0028 221 TRP A CH2 
1594 N  N   . GLU A 230 ? 0.1988 0.1644 0.1387 0.0141  -0.0213 -0.0051 222 GLU A N   
1595 C  CA  . GLU A 230 ? 0.2087 0.1763 0.1467 0.0152  -0.0231 -0.0075 222 GLU A CA  
1596 C  C   . GLU A 230 ? 0.1979 0.1649 0.1363 0.0142  -0.0223 -0.0089 222 GLU A C   
1597 O  O   . GLU A 230 ? 0.1983 0.1662 0.1388 0.0141  -0.0238 -0.0117 222 GLU A O   
1598 C  CB  . GLU A 230 ? 0.2251 0.1941 0.1579 0.0174  -0.0236 -0.0063 222 GLU A CB  
1599 C  CG  . GLU A 230 ? 0.2417 0.2119 0.1748 0.0187  -0.0252 -0.0054 222 GLU A CG  
1600 C  CD  . GLU A 230 ? 0.2714 0.2432 0.1992 0.0209  -0.0256 -0.0034 222 GLU A CD  
1601 O  OE1 . GLU A 230 ? 0.2869 0.2593 0.2105 0.0216  -0.0247 -0.0032 222 GLU A OE1 
1602 O  OE2 . GLU A 230 ? 0.2872 0.2598 0.2153 0.0221  -0.0268 -0.0020 222 GLU A OE2 
1603 N  N   . PHE A 231 ? 0.1932 0.1585 0.1301 0.0135  -0.0199 -0.0071 223 PHE A N   
1604 C  CA  . PHE A 231 ? 0.1840 0.1486 0.1219 0.0124  -0.0189 -0.0082 223 PHE A CA  
1605 C  C   . PHE A 231 ? 0.1756 0.1395 0.1189 0.0106  -0.0194 -0.0091 223 PHE A C   
1606 O  O   . PHE A 231 ? 0.1709 0.1351 0.1167 0.0101  -0.0202 -0.0111 223 PHE A O   
1607 C  CB  . PHE A 231 ? 0.1802 0.1432 0.1161 0.0118  -0.0164 -0.0058 223 PHE A CB  
1608 C  CG  . PHE A 231 ? 0.1765 0.1388 0.1140 0.0106  -0.0154 -0.0066 223 PHE A CG  
1609 C  CD1 . PHE A 231 ? 0.1787 0.1422 0.1147 0.0116  -0.0156 -0.0084 223 PHE A CD1 
1610 C  CD2 . PHE A 231 ? 0.1724 0.1333 0.1131 0.0087  -0.0143 -0.0057 223 PHE A CD2 
1611 C  CE1 . PHE A 231 ? 0.1749 0.1377 0.1128 0.0106  -0.0148 -0.0092 223 PHE A CE1 
1612 C  CE2 . PHE A 231 ? 0.1667 0.1272 0.1091 0.0078  -0.0137 -0.0062 223 PHE A CE2 
1613 C  CZ  . PHE A 231 ? 0.1708 0.1320 0.1120 0.0087  -0.0139 -0.0078 223 PHE A CZ  
1614 N  N   . VAL A 232 ? 0.1709 0.1341 0.1164 0.0096  -0.0187 -0.0075 224 VAL A N   
1615 C  CA  . VAL A 232 ? 0.1679 0.1311 0.1184 0.0079  -0.0189 -0.0079 224 VAL A CA  
1616 C  C   . VAL A 232 ? 0.1739 0.1386 0.1278 0.0082  -0.0212 -0.0103 224 VAL A C   
1617 O  O   . VAL A 232 ? 0.1712 0.1358 0.1288 0.0071  -0.0217 -0.0114 224 VAL A O   
1618 C  CB  . VAL A 232 ? 0.1654 0.1284 0.1173 0.0072  -0.0178 -0.0062 224 VAL A CB  
1619 C  CG1 . VAL A 232 ? 0.1625 0.1263 0.1195 0.0056  -0.0179 -0.0064 224 VAL A CG1 
1620 C  CG2 . VAL A 232 ? 0.1663 0.1277 0.1158 0.0067  -0.0157 -0.0043 224 VAL A CG2 
1621 N  N   . ALA A 233 ? 0.1812 0.1473 0.1342 0.0096  -0.0229 -0.0110 225 ALA A N   
1622 C  CA  . ALA A 233 ? 0.1853 0.1531 0.1417 0.0099  -0.0255 -0.0136 225 ALA A CA  
1623 C  C   . ALA A 233 ? 0.1929 0.1608 0.1492 0.0103  -0.0267 -0.0163 225 ALA A C   
1624 O  O   . ALA A 233 ? 0.2005 0.1687 0.1619 0.0094  -0.0280 -0.0182 225 ALA A O   
1625 C  CB  . ALA A 233 ? 0.1872 0.1566 0.1418 0.0116  -0.0272 -0.0139 225 ALA A CB  
1626 N  N   . LYS A 234 ? 0.1985 0.1664 0.1496 0.0116  -0.0262 -0.0166 226 LYS A N   
1627 C  CA  . LYS A 234 ? 0.2139 0.1821 0.1647 0.0122  -0.0269 -0.0195 226 LYS A CA  
1628 C  C   . LYS A 234 ? 0.2066 0.1730 0.1618 0.0104  -0.0259 -0.0195 226 LYS A C   
1629 O  O   . LYS A 234 ? 0.2115 0.1780 0.1706 0.0102  -0.0274 -0.0223 226 LYS A O   
1630 C  CB  . LYS A 234 ? 0.2273 0.1960 0.1714 0.0138  -0.0257 -0.0190 226 LYS A CB  
1631 C  CG  . LYS A 234 ? 0.2438 0.2135 0.1868 0.0149  -0.0264 -0.0223 226 LYS A CG  
1632 C  CD  . LYS A 234 ? 0.2640 0.2349 0.1999 0.0166  -0.0250 -0.0212 226 LYS A CD  
1633 C  CE  . LYS A 234 ? 0.2873 0.2601 0.2211 0.0183  -0.0257 -0.0248 226 LYS A CE  
1634 N  NZ  . LYS A 234 ? 0.3017 0.2735 0.2346 0.0179  -0.0231 -0.0239 226 LYS A NZ  
1635 N  N   . MET A 235 ? 0.2009 0.1659 0.1558 0.0091  -0.0235 -0.0165 227 MET A N   
1636 C  CA  . MET A 235 ? 0.1961 0.1597 0.1551 0.0075  -0.0226 -0.0160 227 MET A CA  
1637 C  C   . MET A 235 ? 0.1948 0.1586 0.1605 0.0062  -0.0240 -0.0165 227 MET A C   
1638 O  O   . MET A 235 ? 0.2040 0.1673 0.1745 0.0054  -0.0247 -0.0176 227 MET A O   
1639 C  CB  . MET A 235 ? 0.1917 0.1540 0.1489 0.0064  -0.0200 -0.0127 227 MET A CB  
1640 C  CG  . MET A 235 ? 0.1984 0.1603 0.1505 0.0073  -0.0184 -0.0119 227 MET A CG  
1641 S  SD  . MET A 235 ? 0.2083 0.1702 0.1603 0.0081  -0.0185 -0.0143 227 MET A SD  
1642 C  CE  . MET A 235 ? 0.2117 0.1756 0.1595 0.0105  -0.0201 -0.0170 227 MET A CE  
1643 N  N   . HIS A 236 ? 0.1881 0.1529 0.1547 0.0059  -0.0244 -0.0155 228 HIS A N   
1644 C  CA  . HIS A 236 ? 0.1873 0.1529 0.1605 0.0047  -0.0255 -0.0156 228 HIS A CA  
1645 C  C   . HIS A 236 ? 0.1927 0.1589 0.1698 0.0051  -0.0283 -0.0191 228 HIS A C   
1646 O  O   . HIS A 236 ? 0.1846 0.1505 0.1682 0.0038  -0.0290 -0.0196 228 HIS A O   
1647 C  CB  . HIS A 236 ? 0.1842 0.1511 0.1574 0.0047  -0.0255 -0.0143 228 HIS A CB  
1648 C  CG  . HIS A 236 ? 0.1833 0.1515 0.1634 0.0035  -0.0265 -0.0143 228 HIS A CG  
1649 N  ND1 . HIS A 236 ? 0.1864 0.1547 0.1711 0.0016  -0.0252 -0.0121 228 HIS A ND1 
1650 C  CD2 . HIS A 236 ? 0.1856 0.1555 0.1691 0.0039  -0.0287 -0.0160 228 HIS A CD2 
1651 C  CE1 . HIS A 236 ? 0.1848 0.1547 0.1755 0.0008  -0.0263 -0.0123 228 HIS A CE1 
1652 N  NE2 . HIS A 236 ? 0.1894 0.1603 0.1797 0.0022  -0.0285 -0.0148 228 HIS A NE2 
1653 N  N   . ALA A 237 ? 0.2009 0.1683 0.1743 0.0070  -0.0299 -0.0215 229 ALA A N   
1654 C  CA  . ALA A 237 ? 0.2108 0.1793 0.1872 0.0078  -0.0329 -0.0256 229 ALA A CA  
1655 C  C   . ALA A 237 ? 0.2170 0.1841 0.1958 0.0076  -0.0332 -0.0278 229 ALA A C   
1656 O  O   . ALA A 237 ? 0.2138 0.1808 0.1993 0.0069  -0.0350 -0.0300 229 ALA A O   
1657 C  CB  . ALA A 237 ? 0.2134 0.1838 0.1837 0.0102  -0.0344 -0.0276 229 ALA A CB  
1658 N  N   . GLN A 238 ? 0.2287 0.1949 0.2028 0.0082  -0.0313 -0.0271 230 GLN A N   
1659 C  CA  . GLN A 238 ? 0.2436 0.2086 0.2201 0.0082  -0.0314 -0.0292 230 GLN A CA  
1660 C  C   . GLN A 238 ? 0.2398 0.2030 0.2233 0.0060  -0.0306 -0.0271 230 GLN A C   
1661 O  O   . GLN A 238 ? 0.2430 0.2052 0.2322 0.0057  -0.0319 -0.0293 230 GLN A O   
1662 C  CB  . GLN A 238 ? 0.2704 0.2352 0.2403 0.0095  -0.0295 -0.0289 230 GLN A CB  
1663 C  CG  . GLN A 238 ? 0.2969 0.2639 0.2602 0.0119  -0.0304 -0.0311 230 GLN A CG  
1664 C  CD  . GLN A 238 ? 0.3200 0.2872 0.2767 0.0131  -0.0282 -0.0302 230 GLN A CD  
1665 O  OE1 . GLN A 238 ? 0.3492 0.3148 0.3058 0.0120  -0.0258 -0.0273 230 GLN A OE1 
1666 N  NE2 . GLN A 238 ? 0.3188 0.2883 0.2703 0.0153  -0.0289 -0.0325 230 GLN A NE2 
1667 N  N   . ALA A 239 ? 0.2300 0.1928 0.2132 0.0046  -0.0286 -0.0228 231 ALA A N   
1668 C  CA  . ALA A 239 ? 0.2297 0.1913 0.2187 0.0026  -0.0276 -0.0202 231 ALA A CA  
1669 C  C   . ALA A 239 ? 0.2336 0.1955 0.2312 0.0013  -0.0295 -0.0207 231 ALA A C   
1670 O  O   . ALA A 239 ? 0.2168 0.1777 0.2205 0.0000  -0.0293 -0.0196 231 ALA A O   
1671 C  CB  . ALA A 239 ? 0.2179 0.1798 0.2040 0.0016  -0.0251 -0.0159 231 ALA A CB  
1672 N  N   . ILE A 240 ? 0.2476 0.2111 0.2461 0.0017  -0.0311 -0.0222 232 ILE A N   
1673 C  CA  . ILE A 240 ? 0.2590 0.2232 0.2662 0.0004  -0.0330 -0.0229 232 ILE A CA  
1674 C  C   . ILE A 240 ? 0.2835 0.2475 0.2950 0.0012  -0.0361 -0.0279 232 ILE A C   
1675 O  O   . ILE A 240 ? 0.2974 0.2616 0.3173 0.0000  -0.0378 -0.0286 232 ILE A O   
1676 C  CB  . ILE A 240 ? 0.2545 0.2209 0.2619 0.0001  -0.0332 -0.0216 232 ILE A CB  
1677 C  CG1 . ILE A 240 ? 0.2513 0.2190 0.2534 0.0022  -0.0349 -0.0247 232 ILE A CG1 
1678 C  CG2 . ILE A 240 ? 0.2574 0.2241 0.2611 -0.0006 -0.0302 -0.0172 232 ILE A CG2 
1679 C  CD1 . ILE A 240 ? 0.2425 0.2125 0.2464 0.0021  -0.0357 -0.0241 232 ILE A CD1 
1680 N  N   . LYS A 241 ? 0.3089 0.2728 0.3149 0.0033  -0.0370 -0.0315 233 LYS A N   
1681 C  CA  . LYS A 241 ? 0.3270 0.2914 0.3361 0.0044  -0.0402 -0.0370 233 LYS A CA  
1682 C  C   . LYS A 241 ? 0.3429 0.3053 0.3618 0.0031  -0.0412 -0.0381 233 LYS A C   
1683 O  O   . LYS A 241 ? 0.3786 0.3415 0.4038 0.0030  -0.0442 -0.0419 233 LYS A O   
1684 C  CB  . LYS A 241 ? 0.3250 0.2901 0.3261 0.0070  -0.0405 -0.0405 233 LYS A CB  
1685 O  OXT . LYS A 241 ? 0.3325 0.2931 0.3538 0.0020  -0.0394 -0.0353 233 LYS A OXT 
1686 N  N   . TYR B 28  ? 0.3079 0.3144 0.2931 0.0268  -0.0119 0.0129  20  TYR B N   
1687 C  CA  . TYR B 28  ? 0.2990 0.3072 0.2827 0.0267  -0.0146 0.0086  20  TYR B CA  
1688 C  C   . TYR B 28  ? 0.2806 0.2864 0.2645 0.0240  -0.0149 0.0060  20  TYR B C   
1689 O  O   . TYR B 28  ? 0.2667 0.2690 0.2529 0.0215  -0.0137 0.0064  20  TYR B O   
1690 C  CB  . TYR B 28  ? 0.2891 0.2965 0.2752 0.0258  -0.0156 0.0071  20  TYR B CB  
1691 C  CG  . TYR B 28  ? 0.2759 0.2839 0.2621 0.0246  -0.0179 0.0026  20  TYR B CG  
1692 C  CD1 . TYR B 28  ? 0.2607 0.2732 0.2453 0.0268  -0.0201 0.0006  20  TYR B CD1 
1693 C  CD2 . TYR B 28  ? 0.2662 0.2706 0.2545 0.0214  -0.0179 0.0003  20  TYR B CD2 
1694 C  CE1 . TYR B 28  ? 0.2615 0.2742 0.2470 0.0254  -0.0221 -0.0036 20  TYR B CE1 
1695 C  CE2 . TYR B 28  ? 0.2625 0.2671 0.2516 0.0203  -0.0197 -0.0035 20  TYR B CE2 
1696 C  CZ  . TYR B 28  ? 0.2676 0.2762 0.2555 0.0222  -0.0217 -0.0055 20  TYR B CZ  
1697 O  OH  . TYR B 28  ? 0.2572 0.2659 0.2466 0.0208  -0.0232 -0.0092 20  TYR B OH  
1698 N  N   . ALA B 29  ? 0.2706 0.2784 0.2522 0.0246  -0.0164 0.0031  21  ALA B N   
1699 C  CA  . ALA B 29  ? 0.2596 0.2652 0.2416 0.0223  -0.0165 0.0010  21  ALA B CA  
1700 C  C   . ALA B 29  ? 0.2393 0.2442 0.2223 0.0209  -0.0183 -0.0031 21  ALA B C   
1701 O  O   . ALA B 29  ? 0.2299 0.2376 0.2116 0.0224  -0.0200 -0.0052 21  ALA B O   
1702 C  CB  . ALA B 29  ? 0.2757 0.2833 0.2547 0.0239  -0.0162 0.0012  21  ALA B CB  
1703 N  N   . THR B 30  ? 0.2217 0.2231 0.2072 0.0181  -0.0179 -0.0040 22  THR B N   
1704 C  CA  . THR B 30  ? 0.2042 0.2045 0.1912 0.0166  -0.0192 -0.0075 22  THR B CA  
1705 C  C   . THR B 30  ? 0.2009 0.2018 0.1865 0.0168  -0.0198 -0.0099 22  THR B C   
1706 O  O   . THR B 30  ? 0.1949 0.1968 0.1809 0.0171  -0.0212 -0.0129 22  THR B O   
1707 C  CB  . THR B 30  ? 0.1935 0.1901 0.1832 0.0139  -0.0183 -0.0075 22  THR B CB  
1708 O  OG1 . THR B 30  ? 0.1911 0.1870 0.1823 0.0138  -0.0178 -0.0058 22  THR B OG1 
1709 C  CG2 . THR B 30  ? 0.1829 0.1785 0.1744 0.0125  -0.0192 -0.0105 22  THR B CG2 
1710 N  N   . LEU B 31  ? 0.1965 0.1967 0.1808 0.0168  -0.0187 -0.0086 23  LEU B N   
1711 C  CA  . LEU B 31  ? 0.1996 0.1997 0.1827 0.0169  -0.0189 -0.0106 23  LEU B CA  
1712 C  C   . LEU B 31  ? 0.2088 0.2113 0.1889 0.0192  -0.0183 -0.0089 23  LEU B C   
1713 O  O   . LEU B 31  ? 0.2060 0.2076 0.1858 0.0188  -0.0170 -0.0072 23  LEU B O   
1714 C  CB  . LEU B 31  ? 0.1977 0.1946 0.1826 0.0147  -0.0179 -0.0106 23  LEU B CB  
1715 C  CG  . LEU B 31  ? 0.1971 0.1915 0.1849 0.0125  -0.0182 -0.0122 23  LEU B CG  
1716 C  CD1 . LEU B 31  ? 0.1880 0.1800 0.1768 0.0109  -0.0170 -0.0116 23  LEU B CD1 
1717 C  CD2 . LEU B 31  ? 0.1984 0.1934 0.1872 0.0128  -0.0195 -0.0157 23  LEU B CD2 
1718 N  N   . PRO B 32  ? 0.2144 0.2204 0.1921 0.0218  -0.0192 -0.0093 24  PRO B N   
1719 C  CA  . PRO B 32  ? 0.2223 0.2309 0.1968 0.0243  -0.0184 -0.0073 24  PRO B CA  
1720 C  C   . PRO B 32  ? 0.2329 0.2414 0.2059 0.0247  -0.0180 -0.0085 24  PRO B C   
1721 O  O   . PRO B 32  ? 0.2337 0.2436 0.2046 0.0263  -0.0167 -0.0062 24  PRO B O   
1722 C  CB  . PRO B 32  ? 0.2274 0.2400 0.1995 0.0270  -0.0199 -0.0083 24  PRO B CB  
1723 C  CG  . PRO B 32  ? 0.2256 0.2378 0.1998 0.0258  -0.0218 -0.0121 24  PRO B CG  
1724 C  CD  . PRO B 32  ? 0.2214 0.2295 0.1994 0.0226  -0.0211 -0.0116 24  PRO B CD  
1725 N  N   . ASP B 33  ? 0.2420 0.2486 0.2161 0.0235  -0.0188 -0.0120 25  ASP B N   
1726 C  CA  . ASP B 33  ? 0.2498 0.2559 0.2228 0.0240  -0.0182 -0.0133 25  ASP B CA  
1727 C  C   . ASP B 33  ? 0.2168 0.2201 0.1917 0.0220  -0.0166 -0.0113 25  ASP B C   
1728 O  O   . ASP B 33  ? 0.1986 0.2015 0.1729 0.0225  -0.0158 -0.0117 25  ASP B O   
1729 C  CB  . ASP B 33  ? 0.2959 0.3014 0.2697 0.0237  -0.0196 -0.0180 25  ASP B CB  
1730 C  CG  . ASP B 33  ? 0.3434 0.3526 0.3150 0.0259  -0.0215 -0.0206 25  ASP B CG  
1731 O  OD1 . ASP B 33  ? 0.3893 0.4019 0.3576 0.0285  -0.0214 -0.0188 25  ASP B OD1 
1732 O  OD2 . ASP B 33  ? 0.4055 0.4144 0.3789 0.0252  -0.0231 -0.0245 25  ASP B OD2 
1733 N  N   . LEU B 34  ? 0.1926 0.1943 0.1699 0.0200  -0.0161 -0.0093 26  LEU B N   
1734 C  CA  . LEU B 34  ? 0.1797 0.1793 0.1588 0.0182  -0.0149 -0.0076 26  LEU B CA  
1735 C  C   . LEU B 34  ? 0.1853 0.1866 0.1635 0.0191  -0.0135 -0.0040 26  LEU B C   
1736 O  O   . LEU B 34  ? 0.1737 0.1753 0.1528 0.0187  -0.0132 -0.0019 26  LEU B O   
1737 C  CB  . LEU B 34  ? 0.1737 0.1708 0.1555 0.0157  -0.0151 -0.0075 26  LEU B CB  
1738 C  CG  . LEU B 34  ? 0.1730 0.1684 0.1564 0.0139  -0.0141 -0.0064 26  LEU B CG  
1739 C  CD1 . LEU B 34  ? 0.1751 0.1692 0.1588 0.0139  -0.0140 -0.0084 26  LEU B CD1 
1740 C  CD2 . LEU B 34  ? 0.1693 0.1629 0.1549 0.0117  -0.0141 -0.0059 26  LEU B CD2 
1741 N  N   . LEU B 35  ? 0.1878 0.1902 0.1647 0.0203  -0.0126 -0.0033 27  LEU B N   
1742 C  CA  . LEU B 35  ? 0.2005 0.2052 0.1765 0.0217  -0.0112 -0.0001 27  LEU B CA  
1743 C  C   . LEU B 35  ? 0.1925 0.1970 0.1701 0.0207  -0.0099 0.0015  27  LEU B C   
1744 O  O   . LEU B 35  ? 0.1843 0.1871 0.1627 0.0198  -0.0102 0.0000  27  LEU B O   
1745 C  CB  . LEU B 35  ? 0.2112 0.2185 0.1836 0.0248  -0.0111 -0.0008 27  LEU B CB  
1746 C  CG  . LEU B 35  ? 0.2200 0.2287 0.1900 0.0266  -0.0126 -0.0033 27  LEU B CG  
1747 C  CD1 . LEU B 35  ? 0.2178 0.2292 0.1841 0.0297  -0.0125 -0.0044 27  LEU B CD1 
1748 C  CD2 . LEU B 35  ? 0.2289 0.2390 0.1990 0.0270  -0.0126 -0.0009 27  LEU B CD2 
1749 N  N   . LYS B 36  ? 0.1847 0.1909 0.1629 0.0211  -0.0086 0.0048  28  LYS B N   
1750 C  CA  . LYS B 36  ? 0.1809 0.1882 0.1602 0.0211  -0.0073 0.0065  28  LYS B CA  
1751 C  C   . LYS B 36  ? 0.1817 0.1915 0.1579 0.0242  -0.0063 0.0070  28  LYS B C   
1752 O  O   . LYS B 36  ? 0.1890 0.2009 0.1640 0.0260  -0.0055 0.0091  28  LYS B O   
1753 C  CB  . LYS B 36  ? 0.1770 0.1851 0.1594 0.0196  -0.0061 0.0098  28  LYS B CB  
1754 C  CG  . LYS B 36  ? 0.1762 0.1863 0.1600 0.0198  -0.0047 0.0119  28  LYS B CG  
1755 C  CD  . LYS B 36  ? 0.1758 0.1851 0.1607 0.0186  -0.0053 0.0103  28  LYS B CD  
1756 C  CE  . LYS B 36  ? 0.1717 0.1835 0.1584 0.0188  -0.0040 0.0126  28  LYS B CE  
1757 N  NZ  . LYS B 36  ? 0.1755 0.1893 0.1598 0.0219  -0.0028 0.0133  28  LYS B NZ  
1758 N  N   . PRO B 37  ? 0.1843 0.1938 0.1594 0.0251  -0.0064 0.0051  29  PRO B N   
1759 C  CA  . PRO B 37  ? 0.1912 0.2030 0.1630 0.0283  -0.0055 0.0050  29  PRO B CA  
1760 C  C   . PRO B 37  ? 0.1999 0.2145 0.1725 0.0294  -0.0035 0.0089  29  PRO B C   
1761 O  O   . PRO B 37  ? 0.1984 0.2130 0.1745 0.0274  -0.0028 0.0110  29  PRO B O   
1762 C  CB  . PRO B 37  ? 0.1885 0.1988 0.1599 0.0287  -0.0058 0.0022  29  PRO B CB  
1763 C  CG  . PRO B 37  ? 0.1845 0.1915 0.1581 0.0259  -0.0071 0.0003  29  PRO B CG  
1764 C  CD  . PRO B 37  ? 0.1810 0.1881 0.1574 0.0236  -0.0071 0.0028  29  PRO B CD  
1765 N  N   . SER B 38  ? 0.2062 0.2234 0.1755 0.0325  -0.0025 0.0096  30  SER B N   
1766 C  CA  A SER B 38  ? 0.2118 0.2319 0.1815 0.0341  -0.0003 0.0132  30  SER B CA  
1767 C  CA  B SER B 38  ? 0.2088 0.2289 0.1786 0.0340  -0.0003 0.0133  30  SER B CA  
1768 C  C   . SER B 38  ? 0.2114 0.2317 0.1815 0.0346  0.0005  0.0128  30  SER B C   
1769 O  O   . SER B 38  ? 0.2090 0.2286 0.1765 0.0362  0.0001  0.0098  30  SER B O   
1770 C  CB  A SER B 38  ? 0.2171 0.2400 0.1825 0.0378  0.0005  0.0140  30  SER B CB  
1771 C  CB  B SER B 38  ? 0.2121 0.2352 0.1779 0.0376  0.0007  0.0146  30  SER B CB  
1772 O  OG  A SER B 38  ? 0.2243 0.2500 0.1909 0.0389  0.0030  0.0183  30  SER B OG  
1773 O  OG  B SER B 38  ? 0.2126 0.2357 0.1739 0.0398  -0.0006 0.0108  30  SER B OG  
1774 N  N   . GLY B 39  ? 0.2155 0.2368 0.1894 0.0332  0.0017  0.0156  31  GLY B N   
1775 C  CA  . GLY B 39  ? 0.2252 0.2473 0.1998 0.0341  0.0027  0.0157  31  GLY B CA  
1776 C  C   . GLY B 39  ? 0.2207 0.2400 0.1960 0.0328  0.0014  0.0127  31  GLY B C   
1777 O  O   . GLY B 39  ? 0.2366 0.2564 0.2123 0.0337  0.0023  0.0127  31  GLY B O   
1778 N  N   . ALA B 40  ? 0.2131 0.2295 0.1887 0.0306  -0.0004 0.0104  32  ALA B N   
1779 C  CA  . ALA B 40  ? 0.2067 0.2205 0.1836 0.0292  -0.0013 0.0083  32  ALA B CA  
1780 C  C   . ALA B 40  ? 0.1964 0.2083 0.1757 0.0260  -0.0028 0.0080  32  ALA B C   
1781 O  O   . ALA B 40  ? 0.1882 0.1999 0.1673 0.0252  -0.0034 0.0083  32  ALA B O   
1782 C  CB  . ALA B 40  ? 0.2117 0.2233 0.1857 0.0309  -0.0019 0.0045  32  ALA B CB  
1783 N  N   . PRO B 41  ? 0.1919 0.2025 0.1733 0.0244  -0.0032 0.0075  33  PRO B N   
1784 C  CA  . PRO B 41  ? 0.1842 0.1931 0.1675 0.0216  -0.0045 0.0071  33  PRO B CA  
1785 C  C   . PRO B 41  ? 0.1828 0.1888 0.1646 0.0211  -0.0058 0.0043  33  PRO B C   
1786 O  O   . PRO B 41  ? 0.1824 0.1871 0.1624 0.0226  -0.0059 0.0020  33  PRO B O   
1787 C  CB  . PRO B 41  ? 0.1893 0.1979 0.1745 0.0209  -0.0045 0.0072  33  PRO B CB  
1788 C  CG  . PRO B 41  ? 0.1944 0.2029 0.1782 0.0234  -0.0033 0.0066  33  PRO B CG  
1789 C  CD  . PRO B 41  ? 0.1944 0.2052 0.1764 0.0255  -0.0024 0.0076  33  PRO B CD  
1790 N  N   . ALA B 42  ? 0.1791 0.1843 0.1620 0.0191  -0.0067 0.0044  34  ALA B N   
1791 C  CA  . ALA B 42  ? 0.1820 0.1845 0.1643 0.0183  -0.0080 0.0018  34  ALA B CA  
1792 C  C   . ALA B 42  ? 0.1794 0.1798 0.1626 0.0178  -0.0081 0.0003  34  ALA B C   
1793 O  O   . ALA B 42  ? 0.1681 0.1690 0.1529 0.0169  -0.0077 0.0016  34  ALA B O   
1794 C  CB  . ALA B 42  ? 0.1779 0.1798 0.1617 0.0162  -0.0087 0.0024  34  ALA B CB  
1795 N  N   . GLU B 43  ? 0.1946 0.1928 0.1768 0.0184  -0.0086 -0.0025 35  GLU B N   
1796 C  CA  . GLU B 43  ? 0.2082 0.2040 0.1918 0.0179  -0.0084 -0.0038 35  GLU B CA  
1797 C  C   . GLU B 43  ? 0.1786 0.1723 0.1636 0.0158  -0.0092 -0.0046 35  GLU B C   
1798 O  O   . GLU B 43  ? 0.1752 0.1689 0.1600 0.0150  -0.0101 -0.0051 35  GLU B O   
1799 C  CB  . GLU B 43  ? 0.2389 0.2330 0.2216 0.0195  -0.0082 -0.0066 35  GLU B CB  
1800 C  CG  . GLU B 43  ? 0.2754 0.2712 0.2562 0.0220  -0.0072 -0.0065 35  GLU B CG  
1801 C  CD  . GLU B 43  ? 0.3153 0.3113 0.2972 0.0228  -0.0057 -0.0048 35  GLU B CD  
1802 O  OE1 . GLU B 43  ? 0.3657 0.3614 0.3494 0.0216  -0.0055 -0.0030 35  GLU B OE1 
1803 O  OE2 . GLU B 43  ? 0.3780 0.3745 0.3585 0.0250  -0.0048 -0.0053 35  GLU B OE2 
1804 N  N   . LEU B 44  ? 0.1594 0.1516 0.1459 0.0152  -0.0087 -0.0044 36  LEU B N   
1805 C  CA  . LEU B 44  ? 0.1493 0.1394 0.1372 0.0136  -0.0091 -0.0053 36  LEU B CA  
1806 C  C   . LEU B 44  ? 0.1452 0.1331 0.1334 0.0139  -0.0095 -0.0082 36  LEU B C   
1807 O  O   . LEU B 44  ? 0.1486 0.1351 0.1373 0.0149  -0.0088 -0.0095 36  LEU B O   
1808 C  CB  . LEU B 44  ? 0.1444 0.1338 0.1336 0.0135  -0.0082 -0.0040 36  LEU B CB  
1809 C  CG  . LEU B 44  ? 0.1427 0.1302 0.1333 0.0120  -0.0083 -0.0044 36  LEU B CG  
1810 C  CD1 . LEU B 44  ? 0.1376 0.1262 0.1279 0.0103  -0.0093 -0.0038 36  LEU B CD1 
1811 C  CD2 . LEU B 44  ? 0.1408 0.1280 0.1323 0.0125  -0.0070 -0.0028 36  LEU B CD2 
1812 N  N   . PRO B 45  ? 0.1356 0.1233 0.1239 0.0129  -0.0106 -0.0094 37  PRO B N   
1813 C  CA  . PRO B 45  ? 0.1363 0.1226 0.1252 0.0131  -0.0113 -0.0125 37  PRO B CA  
1814 C  C   . PRO B 45  ? 0.1348 0.1182 0.1263 0.0125  -0.0104 -0.0137 37  PRO B C   
1815 O  O   . PRO B 45  ? 0.1255 0.1079 0.1183 0.0115  -0.0098 -0.0122 37  PRO B O   
1816 C  CB  . PRO B 45  ? 0.1334 0.1203 0.1224 0.0121  -0.0125 -0.0128 37  PRO B CB  
1817 C  CG  . PRO B 45  ? 0.1332 0.1219 0.1210 0.0117  -0.0124 -0.0101 37  PRO B CG  
1818 C  CD  . PRO B 45  ? 0.1344 0.1230 0.1226 0.0116  -0.0113 -0.0082 37  PRO B CD  
1819 N  N   . LYS B 46  ? 0.1406 0.1228 0.1330 0.0133  -0.0104 -0.0164 38  LYS B N   
1820 C  CA  . LYS B 46  ? 0.1485 0.1277 0.1441 0.0127  -0.0095 -0.0177 38  LYS B CA  
1821 C  C   . LYS B 46  ? 0.1458 0.1242 0.1436 0.0111  -0.0102 -0.0188 38  LYS B C   
1822 O  O   . LYS B 46  ? 0.1365 0.1166 0.1334 0.0107  -0.0117 -0.0197 38  LYS B O   
1823 C  CB  . LYS B 46  ? 0.1602 0.1383 0.1565 0.0139  -0.0092 -0.0208 38  LYS B CB  
1824 C  CG  . LYS B 46  ? 0.1733 0.1512 0.1687 0.0155  -0.0077 -0.0191 38  LYS B CG  
1825 C  CD  . LYS B 46  ? 0.1871 0.1657 0.1807 0.0172  -0.0080 -0.0216 38  LYS B CD  
1826 C  CE  . LYS B 46  ? 0.1951 0.1739 0.1876 0.0190  -0.0064 -0.0196 38  LYS B CE  
1827 N  NZ  . LYS B 46  ? 0.2085 0.1856 0.2014 0.0203  -0.0059 -0.0231 38  LYS B NZ  
1828 N  N   . LEU B 47  ? 0.1506 0.1266 0.1513 0.0102  -0.0089 -0.0182 39  LEU B N   
1829 C  CA  . LEU B 47  ? 0.1542 0.1290 0.1578 0.0087  -0.0090 -0.0192 39  LEU B CA  
1830 C  C   . LEU B 47  ? 0.1580 0.1314 0.1649 0.0085  -0.0093 -0.0230 39  LEU B C   
1831 O  O   . LEU B 47  ? 0.1557 0.1277 0.1635 0.0094  -0.0085 -0.0243 39  LEU B O   
1832 C  CB  . LEU B 47  ? 0.1543 0.1273 0.1598 0.0081  -0.0072 -0.0167 39  LEU B CB  
1833 C  CG  . LEU B 47  ? 0.1592 0.1338 0.1618 0.0083  -0.0069 -0.0133 39  LEU B CG  
1834 C  CD1 . LEU B 47  ? 0.1602 0.1335 0.1643 0.0081  -0.0051 -0.0110 39  LEU B CD1 
1835 C  CD2 . LEU B 47  ? 0.1583 0.1350 0.1590 0.0075  -0.0085 -0.0131 39  LEU B CD2 
1836 N  N   . GLY B 48  ? 0.1626 0.1364 0.1716 0.0073  -0.0104 -0.0247 40  GLY B N   
1837 C  CA  . GLY B 48  ? 0.1676 0.1403 0.1808 0.0067  -0.0107 -0.0284 40  GLY B CA  
1838 C  C   . GLY B 48  ? 0.1721 0.1413 0.1903 0.0057  -0.0085 -0.0281 40  GLY B C   
1839 O  O   . GLY B 48  ? 0.1737 0.1415 0.1963 0.0050  -0.0084 -0.0311 40  GLY B O   
1840 N  N   . PHE B 49  ? 0.1716 0.1397 0.1893 0.0057  -0.0067 -0.0243 41  PHE B N   
1841 C  CA  . PHE B 49  ? 0.1700 0.1349 0.1920 0.0053  -0.0041 -0.0231 41  PHE B CA  
1842 C  C   . PHE B 49  ? 0.1641 0.1282 0.1840 0.0067  -0.0023 -0.0199 41  PHE B C   
1843 O  O   . PHE B 49  ? 0.1654 0.1316 0.1807 0.0076  -0.0032 -0.0184 41  PHE B O   
1844 C  CB  . PHE B 49  ? 0.1748 0.1398 0.1987 0.0041  -0.0034 -0.0213 41  PHE B CB  
1845 C  CG  . PHE B 49  ? 0.1700 0.1369 0.1892 0.0045  -0.0038 -0.0181 41  PHE B CG  
1846 C  CD1 . PHE B 49  ? 0.1717 0.1380 0.1898 0.0051  -0.0019 -0.0146 41  PHE B CD1 
1847 C  CD2 . PHE B 49  ? 0.1698 0.1393 0.1861 0.0041  -0.0060 -0.0188 41  PHE B CD2 
1848 C  CE1 . PHE B 49  ? 0.1669 0.1352 0.1809 0.0053  -0.0024 -0.0122 41  PHE B CE1 
1849 C  CE2 . PHE B 49  ? 0.1686 0.1396 0.1813 0.0042  -0.0062 -0.0162 41  PHE B CE2 
1850 C  CZ  . PHE B 49  ? 0.1675 0.1380 0.1790 0.0047  -0.0046 -0.0132 41  PHE B CZ  
1851 N  N   . ASN B 50  ? 0.1603 0.1214 0.1837 0.0069  0.0003  -0.0187 42  ASN B N   
1852 C  CA  . ASN B 50  ? 0.1599 0.1204 0.1818 0.0085  0.0021  -0.0155 42  ASN B CA  
1853 C  C   . ASN B 50  ? 0.1529 0.1145 0.1730 0.0087  0.0031  -0.0114 42  ASN B C   
1854 O  O   . ASN B 50  ? 0.1499 0.1100 0.1731 0.0083  0.0049  -0.0101 42  ASN B O   
1855 C  CB  . ASN B 50  ? 0.1651 0.1217 0.1921 0.0090  0.0047  -0.0161 42  ASN B CB  
1856 C  CG  . ASN B 50  ? 0.1684 0.1243 0.1942 0.0109  0.0068  -0.0128 42  ASN B CG  
1857 O  OD1 . ASN B 50  ? 0.1733 0.1317 0.1948 0.0118  0.0065  -0.0098 42  ASN B OD1 
1858 N  ND2 . ASN B 50  ? 0.1785 0.1309 0.2083 0.0116  0.0090  -0.0134 42  ASN B ND2 
1859 N  N   . TRP B 51  ? 0.1509 0.1153 0.1662 0.0096  0.0022  -0.0093 43  TRP B N   
1860 C  CA  . TRP B 51  ? 0.1453 0.1114 0.1583 0.0098  0.0027  -0.0058 43  TRP B CA  
1861 C  C   . TRP B 51  ? 0.1485 0.1131 0.1633 0.0111  0.0057  -0.0026 43  TRP B C   
1862 O  O   . TRP B 51  ? 0.1422 0.1079 0.1560 0.0113  0.0065  0.0000  43  TRP B O   
1863 C  CB  . TRP B 51  ? 0.1433 0.1129 0.1514 0.0103  0.0010  -0.0047 43  TRP B CB  
1864 C  CG  . TRP B 51  ? 0.1453 0.1156 0.1520 0.0118  0.0013  -0.0037 43  TRP B CG  
1865 C  CD1 . TRP B 51  ? 0.1435 0.1145 0.1489 0.0122  0.0001  -0.0056 43  TRP B CD1 
1866 C  CD2 . TRP B 51  ? 0.1494 0.1202 0.1557 0.0136  0.0031  -0.0005 43  TRP B CD2 
1867 N  NE1 . TRP B 51  ? 0.1450 0.1167 0.1495 0.0139  0.0011  -0.0038 43  TRP B NE1 
1868 C  CE2 . TRP B 51  ? 0.1485 0.1202 0.1536 0.0147  0.0028  -0.0007 43  TRP B CE2 
1869 C  CE3 . TRP B 51  ? 0.1518 0.1227 0.1585 0.0144  0.0050  0.0027  43  TRP B CE3 
1870 C  CZ2 . TRP B 51  ? 0.1525 0.1251 0.1572 0.0167  0.0043  0.0022  43  TRP B CZ2 
1871 C  CZ3 . TRP B 51  ? 0.1554 0.1274 0.1614 0.0165  0.0063  0.0056  43  TRP B CZ3 
1872 C  CH2 . TRP B 51  ? 0.1534 0.1263 0.1586 0.0176  0.0060  0.0053  43  TRP B CH2 
1873 N  N   . LYS B 52  ? 0.1519 0.1140 0.1693 0.0122  0.0074  -0.0027 44  LYS B N   
1874 C  CA  . LYS B 52  ? 0.1567 0.1172 0.1762 0.0137  0.0105  0.0007  44  LYS B CA  
1875 C  C   . LYS B 52  ? 0.1538 0.1119 0.1777 0.0129  0.0124  0.0011  44  LYS B C   
1876 O  O   . LYS B 52  ? 0.1586 0.1161 0.1835 0.0142  0.0150  0.0046  44  LYS B O   
1877 C  CB  . LYS B 52  ? 0.1632 0.1213 0.1849 0.0152  0.0121  0.0004  44  LYS B CB  
1878 C  CG  . LYS B 52  ? 0.1673 0.1280 0.1849 0.0163  0.0105  0.0004  44  LYS B CG  
1879 C  CD  . LYS B 52  ? 0.1727 0.1309 0.1925 0.0176  0.0119  -0.0005 44  LYS B CD  
1880 C  CE  . LYS B 52  ? 0.1770 0.1381 0.1931 0.0196  0.0118  0.0019  44  LYS B CE  
1881 N  NZ  . LYS B 52  ? 0.1849 0.1443 0.2019 0.0208  0.0123  0.0000  44  LYS B NZ  
1882 N  N   . ASP B 53  ? 0.1530 0.1098 0.1797 0.0109  0.0114  -0.0023 45  ASP B N   
1883 C  CA  . ASP B 53  ? 0.1512 0.1064 0.1823 0.0098  0.0130  -0.0020 45  ASP B CA  
1884 C  C   . ASP B 53  ? 0.1487 0.1066 0.1766 0.0090  0.0116  -0.0013 45  ASP B C   
1885 O  O   . ASP B 53  ? 0.1440 0.1012 0.1752 0.0079  0.0124  -0.0016 45  ASP B O   
1886 C  CB  . ASP B 53  ? 0.1542 0.1069 0.1907 0.0081  0.0126  -0.0063 45  ASP B CB  
1887 C  CG  . ASP B 53  ? 0.1625 0.1116 0.2031 0.0087  0.0145  -0.0074 45  ASP B CG  
1888 O  OD1 . ASP B 53  ? 0.1637 0.1129 0.2037 0.0085  0.0126  -0.0109 45  ASP B OD1 
1889 O  OD2 . ASP B 53  ? 0.1666 0.1129 0.2112 0.0096  0.0180  -0.0046 45  ASP B OD2 
1890 N  N   . GLY B 54  ? 0.1439 0.1052 0.1660 0.0096  0.0097  -0.0003 46  GLY B N   
1891 C  CA  . GLY B 54  ? 0.1406 0.1043 0.1597 0.0087  0.0080  -0.0004 46  GLY B CA  
1892 C  C   . GLY B 54  ? 0.1413 0.1049 0.1620 0.0068  0.0059  -0.0042 46  GLY B C   
1893 O  O   . GLY B 54  ? 0.1409 0.1039 0.1626 0.0063  0.0046  -0.0069 46  GLY B O   
1894 N  N   . CYS B 55  ? 0.1412 0.1056 0.1622 0.0058  0.0057  -0.0042 47  CYS B N   
1895 C  CA  . CYS B 55  ? 0.1374 0.1016 0.1611 0.0042  0.0042  -0.0075 47  CYS B CA  
1896 C  C   . CYS B 55  ? 0.1383 0.1016 0.1655 0.0035  0.0059  -0.0066 47  CYS B C   
1897 O  O   . CYS B 55  ? 0.1329 0.0978 0.1580 0.0033  0.0056  -0.0058 47  CYS B O   
1898 C  CB  . CYS B 55  ? 0.1349 0.1016 0.1544 0.0037  0.0012  -0.0089 47  CYS B CB  
1899 S  SG  . CYS B 55  ? 0.1228 0.0902 0.1449 0.0021  -0.0009 -0.0126 47  CYS B SG  
1900 N  N   . ALA B 56  ? 0.1430 0.1037 0.1760 0.0033  0.0081  -0.0068 48  ALA B N   
1901 C  CA  . ALA B 56  ? 0.1466 0.1063 0.1839 0.0030  0.0107  -0.0051 48  ALA B CA  
1902 C  C   . ALA B 56  ? 0.1501 0.1108 0.1900 0.0013  0.0093  -0.0075 48  ALA B C   
1903 O  O   . ALA B 56  ? 0.1484 0.1099 0.1892 0.0003  0.0068  -0.0110 48  ALA B O   
1904 C  CB  . ALA B 56  ? 0.1501 0.1066 0.1937 0.0031  0.0136  -0.0046 48  ALA B CB  
1905 N  N   . PRO B 57  ? 0.1555 0.1165 0.1967 0.0013  0.0111  -0.0056 49  PRO B N   
1906 C  CA  . PRO B 57  ? 0.1620 0.1225 0.2024 0.0027  0.0142  -0.0015 49  PRO B CA  
1907 C  C   . PRO B 57  ? 0.1655 0.1284 0.1985 0.0040  0.0134  0.0005  49  PRO B C   
1908 O  O   . PRO B 57  ? 0.1789 0.1422 0.2107 0.0053  0.0157  0.0036  49  PRO B O   
1909 C  CB  . PRO B 57  ? 0.1630 0.1233 0.2086 0.0019  0.0160  -0.0012 49  PRO B CB  
1910 C  CG  . PRO B 57  ? 0.1580 0.1202 0.2031 0.0005  0.0128  -0.0046 49  PRO B CG  
1911 C  CD  . PRO B 57  ? 0.1559 0.1179 0.2006 -0.0002 0.0101  -0.0077 49  PRO B CD  
1912 N  N   . VAL B 58  ? 0.1613 0.1260 0.1898 0.0036  0.0103  -0.0015 50  VAL B N   
1913 C  CA  . VAL B 58  ? 0.1553 0.1223 0.1778 0.0043  0.0093  -0.0004 50  VAL B CA  
1914 C  C   . VAL B 58  ? 0.1543 0.1224 0.1718 0.0057  0.0090  0.0013  50  VAL B C   
1915 O  O   . VAL B 58  ? 0.1566 0.1264 0.1702 0.0068  0.0096  0.0033  50  VAL B O   
1916 C  CB  . VAL B 58  ? 0.1501 0.1184 0.1710 0.0031  0.0063  -0.0032 50  VAL B CB  
1917 C  CG1 . VAL B 58  ? 0.1489 0.1191 0.1639 0.0036  0.0053  -0.0026 50  VAL B CG1 
1918 C  CG2 . VAL B 58  ? 0.1509 0.1187 0.1765 0.0019  0.0066  -0.0046 50  VAL B CG2 
1919 N  N   . PHE B 59  ? 0.1503 0.1180 0.1677 0.0058  0.0080  0.0005  51  PHE B N   
1920 C  CA  . PHE B 59  ? 0.1448 0.1141 0.1577 0.0069  0.0072  0.0018  51  PHE B CA  
1921 C  C   . PHE B 59  ? 0.1407 0.1087 0.1552 0.0083  0.0092  0.0038  51  PHE B C   
1922 O  O   . PHE B 59  ? 0.1398 0.1053 0.1586 0.0079  0.0100  0.0028  51  PHE B O   
1923 C  CB  . PHE B 59  ? 0.1453 0.1156 0.1559 0.0061  0.0042  -0.0007 51  PHE B CB  
1924 C  CG  . PHE B 59  ? 0.1489 0.1206 0.1576 0.0050  0.0023  -0.0023 51  PHE B CG  
1925 C  CD1 . PHE B 59  ? 0.1495 0.1231 0.1542 0.0053  0.0018  -0.0014 51  PHE B CD1 
1926 C  CD2 . PHE B 59  ? 0.1509 0.1220 0.1618 0.0037  0.0008  -0.0050 51  PHE B CD2 
1927 C  CE1 . PHE B 59  ? 0.1511 0.1255 0.1545 0.0043  0.0002  -0.0030 51  PHE B CE1 
1928 C  CE2 . PHE B 59  ? 0.1504 0.1226 0.1598 0.0029  -0.0008 -0.0062 51  PHE B CE2 
1929 C  CZ  . PHE B 59  ? 0.1481 0.1217 0.1538 0.0031  -0.0010 -0.0052 51  PHE B CZ  
1930 N  N   . SER B 60  ? 0.1397 0.1096 0.1506 0.0100  0.0099  0.0065  52  SER B N   
1931 C  CA  . SER B 60  ? 0.1455 0.1146 0.1574 0.0118  0.0118  0.0090  52  SER B CA  
1932 C  C   . SER B 60  ? 0.1454 0.1147 0.1563 0.0118  0.0101  0.0076  52  SER B C   
1933 O  O   . SER B 60  ? 0.1484 0.1194 0.1565 0.0108  0.0074  0.0056  52  SER B O   
1934 C  CB  . SER B 60  ? 0.1463 0.1182 0.1543 0.0139  0.0130  0.0126  52  SER B CB  
1935 O  OG  . SER B 60  ? 0.1414 0.1167 0.1444 0.0139  0.0103  0.0119  52  SER B OG  
1936 N  N   . PRO B 61  ? 0.1445 0.1120 0.1577 0.0130  0.0119  0.0090  53  PRO B N   
1937 C  CA  . PRO B 61  ? 0.1453 0.1134 0.1571 0.0136  0.0107  0.0082  53  PRO B CA  
1938 C  C   . PRO B 61  ? 0.1440 0.1163 0.1505 0.0142  0.0087  0.0091  53  PRO B C   
1939 O  O   . PRO B 61  ? 0.1417 0.1152 0.1465 0.0134  0.0064  0.0071  53  PRO B O   
1940 C  CB  . PRO B 61  ? 0.1487 0.1146 0.1635 0.0155  0.0137  0.0108  53  PRO B CB  
1941 C  CG  . PRO B 61  ? 0.1486 0.1111 0.1685 0.0148  0.0161  0.0108  53  PRO B CG  
1942 C  CD  . PRO B 61  ? 0.1475 0.1122 0.1652 0.0141  0.0155  0.0112  53  PRO B CD  
1943 N  N   . ARG B 62  ? 0.1452 0.1200 0.1493 0.0155  0.0095  0.0120  54  ARG B N   
1944 C  CA  . ARG B 62  ? 0.1462 0.1254 0.1457 0.0161  0.0076  0.0128  54  ARG B CA  
1945 C  C   . ARG B 62  ? 0.1376 0.1185 0.1346 0.0141  0.0047  0.0100  54  ARG B C   
1946 O  O   . ARG B 62  ? 0.1359 0.1190 0.1309 0.0137  0.0027  0.0091  54  ARG B O   
1947 C  CB  . ARG B 62  ? 0.1545 0.1364 0.1519 0.0183  0.0091  0.0164  54  ARG B CB  
1948 C  CG  . ARG B 62  ? 0.1583 0.1453 0.1513 0.0191  0.0072  0.0172  54  ARG B CG  
1949 C  CD  . ARG B 62  ? 0.1614 0.1493 0.1548 0.0197  0.0065  0.0174  54  ARG B CD  
1950 N  NE  . ARG B 62  ? 0.1725 0.1657 0.1626 0.0207  0.0049  0.0186  54  ARG B NE  
1951 C  CZ  . ARG B 62  ? 0.1800 0.1752 0.1700 0.0213  0.0040  0.0189  54  ARG B CZ  
1952 N  NH1 . ARG B 62  ? 0.1898 0.1819 0.1824 0.0212  0.0046  0.0182  54  ARG B NH1 
1953 N  NH2 . ARG B 62  ? 0.1769 0.1775 0.1643 0.0220  0.0024  0.0198  54  ARG B NH2 
1954 N  N   . GLN B 63  ? 0.1312 0.1110 0.1288 0.0129  0.0048  0.0089  55  GLN B N   
1955 C  CA  . GLN B 63  ? 0.1253 0.1059 0.1213 0.0110  0.0024  0.0063  55  GLN B CA  
1956 C  C   . GLN B 63  ? 0.1247 0.1042 0.1218 0.0098  0.0007  0.0038  55  GLN B C   
1957 O  O   . GLN B 63  ? 0.1217 0.1032 0.1167 0.0090  -0.0013 0.0027  55  GLN B O   
1958 C  CB  . GLN B 63  ? 0.1209 0.0999 0.1182 0.0101  0.0032  0.0055  55  GLN B CB  
1959 C  CG  . GLN B 63  ? 0.1167 0.0961 0.1128 0.0084  0.0012  0.0030  55  GLN B CG  
1960 C  CD  . GLN B 63  ? 0.1158 0.0985 0.1079 0.0084  -0.0003 0.0030  55  GLN B CD  
1961 O  OE1 . GLN B 63  ? 0.1153 0.0990 0.1057 0.0087  0.0003  0.0035  55  GLN B OE1 
1962 N  NE2 . GLN B 63  ? 0.1125 0.0970 0.1031 0.0081  -0.0020 0.0025  55  GLN B NE2 
1963 N  N   . MET B 64  ? 0.1283 0.1049 0.1287 0.0097  0.0016  0.0029  56  MET B N   
1964 C  CA  . MET B 64  ? 0.1291 0.1050 0.1301 0.0089  0.0001  0.0005  56  MET B CA  
1965 C  C   . MET B 64  ? 0.1267 0.1044 0.1259 0.0099  -0.0005 0.0014  56  MET B C   
1966 O  O   . MET B 64  ? 0.1218 0.1009 0.1196 0.0094  -0.0023 0.0001  56  MET B O   
1967 C  CB  . MET B 64  ? 0.1366 0.1093 0.1417 0.0086  0.0011  -0.0010 56  MET B CB  
1968 C  CG  . MET B 64  ? 0.1427 0.1139 0.1502 0.0073  0.0012  -0.0024 56  MET B CG  
1969 S  SD  . MET B 64  ? 0.1476 0.1204 0.1535 0.0057  -0.0015 -0.0049 56  MET B SD  
1970 C  CE  . MET B 64  ? 0.1532 0.1280 0.1559 0.0057  -0.0015 -0.0030 56  MET B CE  
1971 N  N   . GLU B 65  ? 0.1276 0.1056 0.1271 0.0117  0.0012  0.0039  57  GLU B N   
1972 C  CA  . GLU B 65  ? 0.1251 0.1050 0.1232 0.0129  0.0009  0.0050  57  GLU B CA  
1973 C  C   . GLU B 65  ? 0.1196 0.1035 0.1145 0.0124  -0.0011 0.0052  57  GLU B C   
1974 O  O   . GLU B 65  ? 0.1143 0.0996 0.1084 0.0122  -0.0024 0.0045  57  GLU B O   
1975 C  CB  . GLU B 65  ? 0.1326 0.1126 0.1315 0.0151  0.0033  0.0082  57  GLU B CB  
1976 C  CG  . GLU B 65  ? 0.1365 0.1189 0.1342 0.0165  0.0030  0.0096  57  GLU B CG  
1977 C  CD  . GLU B 65  ? 0.1458 0.1282 0.1445 0.0190  0.0054  0.0128  57  GLU B CD  
1978 O  OE1 . GLU B 65  ? 0.1520 0.1340 0.1511 0.0198  0.0071  0.0149  57  GLU B OE1 
1979 O  OE2 . GLU B 65  ? 0.1505 0.1337 0.1494 0.0203  0.0057  0.0137  57  GLU B OE2 
1980 N  N   . LEU B 66  ? 0.1147 0.1005 0.1080 0.0122  -0.0013 0.0062  58  LEU B N   
1981 C  CA  . LEU B 66  ? 0.1127 0.1022 0.1034 0.0115  -0.0032 0.0060  58  LEU B CA  
1982 C  C   . LEU B 66  ? 0.1096 0.0985 0.1003 0.0096  -0.0050 0.0034  58  LEU B C   
1983 O  O   . LEU B 66  ? 0.1072 0.0983 0.0972 0.0092  -0.0063 0.0031  58  LEU B O   
1984 C  CB  . LEU B 66  ? 0.1127 0.1041 0.1017 0.0116  -0.0032 0.0067  58  LEU B CB  
1985 C  CG  . LEU B 66  ? 0.1165 0.1097 0.1046 0.0138  -0.0016 0.0097  58  LEU B CG  
1986 C  CD1 . LEU B 66  ? 0.1185 0.1129 0.1047 0.0140  -0.0013 0.0101  58  LEU B CD1 
1987 C  CD2 . LEU B 66  ? 0.1175 0.1149 0.1045 0.0148  -0.0026 0.0110  58  LEU B CD2 
1988 N  N   . HIS B 67  ? 0.1086 0.0948 0.1004 0.0085  -0.0049 0.0018  59  HIS B N   
1989 C  CA  . HIS B 67  ? 0.1083 0.0942 0.0999 0.0069  -0.0065 -0.0002 59  HIS B CA  
1990 C  C   . HIS B 67  ? 0.1078 0.0935 0.1000 0.0070  -0.0071 -0.0011 59  HIS B C   
1991 O  O   . HIS B 67  ? 0.1052 0.0924 0.0966 0.0063  -0.0084 -0.0015 59  HIS B O   
1992 C  CB  . HIS B 67  ? 0.1085 0.0919 0.1015 0.0061  -0.0061 -0.0015 59  HIS B CB  
1993 C  CG  . HIS B 67  ? 0.1080 0.0915 0.1003 0.0047  -0.0074 -0.0031 59  HIS B CG  
1994 N  ND1 . HIS B 67  ? 0.1068 0.0886 0.1002 0.0040  -0.0072 -0.0042 59  HIS B ND1 
1995 C  CD2 . HIS B 67  ? 0.1073 0.0925 0.0986 0.0039  -0.0088 -0.0035 59  HIS B CD2 
1996 C  CE1 . HIS B 67  ? 0.1081 0.0904 0.1009 0.0029  -0.0084 -0.0052 59  HIS B CE1 
1997 N  NE2 . HIS B 67  ? 0.1072 0.0914 0.0988 0.0028  -0.0093 -0.0049 59  HIS B NE2 
1998 N  N   . TYR B 68  ? 0.1114 0.0952 0.1050 0.0080  -0.0061 -0.0011 60  TYR B N   
1999 C  CA  . TYR B 68  ? 0.1128 0.0964 0.1067 0.0084  -0.0066 -0.0021 60  TYR B CA  
2000 C  C   . TYR B 68  ? 0.1164 0.1022 0.1094 0.0096  -0.0065 -0.0006 60  TYR B C   
2001 O  O   . TYR B 68  ? 0.1140 0.1016 0.1060 0.0094  -0.0075 -0.0007 60  TYR B O   
2002 C  CB  . TYR B 68  ? 0.1141 0.0946 0.1103 0.0089  -0.0055 -0.0034 60  TYR B CB  
2003 C  CG  . TYR B 68  ? 0.1118 0.0919 0.1081 0.0095  -0.0059 -0.0049 60  TYR B CG  
2004 C  CD1 . TYR B 68  ? 0.1102 0.0913 0.1054 0.0090  -0.0075 -0.0064 60  TYR B CD1 
2005 C  CD2 . TYR B 68  ? 0.1130 0.0917 0.1106 0.0108  -0.0047 -0.0050 60  TYR B CD2 
2006 C  CE1 . TYR B 68  ? 0.1117 0.0928 0.1066 0.0099  -0.0078 -0.0078 60  TYR B CE1 
2007 C  CE2 . TYR B 68  ? 0.1136 0.0920 0.1111 0.0116  -0.0050 -0.0068 60  TYR B CE2 
2008 C  CZ  . TYR B 68  ? 0.1133 0.0931 0.1092 0.0112  -0.0066 -0.0082 60  TYR B CZ  
2009 O  OH  . TYR B 68  ? 0.1163 0.0961 0.1117 0.0122  -0.0069 -0.0099 60  TYR B OH  
2010 N  N   . THR B 69  ? 0.1221 0.1079 0.1155 0.0109  -0.0050 0.0011  61  THR B N   
2011 C  CA  . THR B 69  ? 0.1263 0.1142 0.1193 0.0124  -0.0047 0.0027  61  THR B CA  
2012 C  C   . THR B 69  ? 0.1275 0.1195 0.1191 0.0122  -0.0056 0.0043  61  THR B C   
2013 O  O   . THR B 69  ? 0.1291 0.1236 0.1206 0.0132  -0.0056 0.0055  61  THR B O   
2014 C  CB  . THR B 69  ? 0.1297 0.1161 0.1240 0.0142  -0.0027 0.0041  61  THR B CB  
2015 O  OG1 . THR B 69  ? 0.1327 0.1202 0.1268 0.0147  -0.0019 0.0063  61  THR B OG1 
2016 C  CG2 . THR B 69  ? 0.1315 0.1138 0.1280 0.0142  -0.0016 0.0023  61  THR B CG2 
2017 N  N   . LYS B 70  ? 0.1296 0.1226 0.1204 0.0110  -0.0064 0.0042  62  LYS B N   
2018 C  CA  . LYS B 70  ? 0.1328 0.1299 0.1225 0.0104  -0.0077 0.0049  62  LYS B CA  
2019 C  C   . LYS B 70  ? 0.1243 0.1218 0.1139 0.0085  -0.0092 0.0032  62  LYS B C   
2020 O  O   . LYS B 70  ? 0.1234 0.1229 0.1133 0.0080  -0.0099 0.0033  62  LYS B O   
2021 C  CB  . LYS B 70  ? 0.1434 0.1425 0.1322 0.0109  -0.0074 0.0062  62  LYS B CB  
2022 C  CG  . LYS B 70  ? 0.1569 0.1555 0.1460 0.0132  -0.0056 0.0084  62  LYS B CG  
2023 C  CD  . LYS B 70  ? 0.1695 0.1708 0.1590 0.0148  -0.0053 0.0102  62  LYS B CD  
2024 C  CE  . LYS B 70  ? 0.1864 0.1860 0.1768 0.0171  -0.0030 0.0123  62  LYS B CE  
2025 N  NZ  . LYS B 70  ? 0.2030 0.2051 0.1939 0.0188  -0.0027 0.0140  62  LYS B NZ  
2026 N  N   . HIS B 71  ? 0.1213 0.1167 0.1106 0.0073  -0.0094 0.0019  63  HIS B N   
2027 C  CA  . HIS B 71  ? 0.1197 0.1154 0.1091 0.0055  -0.0106 0.0005  63  HIS B CA  
2028 C  C   . HIS B 71  ? 0.1177 0.1122 0.1078 0.0053  -0.0108 -0.0002 63  HIS B C   
2029 O  O   . HIS B 71  ? 0.1160 0.1123 0.1064 0.0048  -0.0115 0.0000  63  HIS B O   
2030 C  CB  . HIS B 71  ? 0.1186 0.1125 0.1076 0.0045  -0.0107 -0.0008 63  HIS B CB  
2031 C  CG  . HIS B 71  ? 0.1197 0.1154 0.1075 0.0048  -0.0106 -0.0002 63  HIS B CG  
2032 N  ND1 . HIS B 71  ? 0.1172 0.1158 0.1043 0.0039  -0.0117 -0.0007 63  HIS B ND1 
2033 C  CD2 . HIS B 71  ? 0.1213 0.1166 0.1085 0.0060  -0.0094 0.0009  63  HIS B CD2 
2034 C  CE1 . HIS B 71  ? 0.1194 0.1196 0.1050 0.0046  -0.0115 -0.0001 63  HIS B CE1 
2035 N  NE2 . HIS B 71  ? 0.1210 0.1192 0.1066 0.0061  -0.0099 0.0011  63  HIS B NE2 
2036 N  N   . HIS B 72  ? 0.1177 0.1094 0.1081 0.0059  -0.0102 -0.0009 64  HIS B N   
2037 C  CA  . HIS B 72  ? 0.1197 0.1108 0.1103 0.0060  -0.0106 -0.0017 64  HIS B CA  
2038 C  C   . HIS B 72  ? 0.1202 0.1134 0.1107 0.0071  -0.0104 -0.0005 64  HIS B C   
2039 O  O   . HIS B 72  ? 0.1165 0.1110 0.1069 0.0068  -0.0108 -0.0003 64  HIS B O   
2040 C  CB  . HIS B 72  ? 0.1199 0.1081 0.1110 0.0065  -0.0102 -0.0031 64  HIS B CB  
2041 C  CG  . HIS B 72  ? 0.1208 0.1087 0.1118 0.0065  -0.0109 -0.0042 64  HIS B CG  
2042 N  ND1 . HIS B 72  ? 0.1211 0.1071 0.1125 0.0069  -0.0109 -0.0060 64  HIS B ND1 
2043 C  CD2 . HIS B 72  ? 0.1207 0.1101 0.1110 0.0064  -0.0114 -0.0038 64  HIS B CD2 
2044 C  CE1 . HIS B 72  ? 0.1209 0.1077 0.1117 0.0071  -0.0117 -0.0065 64  HIS B CE1 
2045 N  NE2 . HIS B 72  ? 0.1210 0.1097 0.1111 0.0069  -0.0118 -0.0050 64  HIS B NE2 
2046 N  N   . LYS B 73  ? 0.1209 0.1143 0.1114 0.0085  -0.0095 0.0004  65  LYS B N   
2047 C  CA  . LYS B 73  ? 0.1240 0.1195 0.1145 0.0097  -0.0091 0.0016  65  LYS B CA  
2048 C  C   . LYS B 73  ? 0.1192 0.1182 0.1100 0.0088  -0.0099 0.0028  65  LYS B C   
2049 O  O   . LYS B 73  ? 0.1168 0.1174 0.1079 0.0091  -0.0099 0.0034  65  LYS B O   
2050 C  CB  . LYS B 73  ? 0.1340 0.1295 0.1248 0.0112  -0.0080 0.0028  65  LYS B CB  
2051 C  CG  . LYS B 73  ? 0.1425 0.1407 0.1334 0.0127  -0.0075 0.0044  65  LYS B CG  
2052 C  CD  . LYS B 73  ? 0.1519 0.1483 0.1432 0.0147  -0.0060 0.0048  65  LYS B CD  
2053 C  CE  . LYS B 73  ? 0.1587 0.1580 0.1504 0.0164  -0.0052 0.0070  65  LYS B CE  
2054 N  NZ  . LYS B 73  ? 0.1644 0.1679 0.1563 0.0160  -0.0060 0.0081  65  LYS B NZ  
2055 N  N   . ALA B 74  ? 0.1145 0.1149 0.1055 0.0077  -0.0105 0.0030  66  ALA B N   
2056 C  CA  . ALA B 74  ? 0.1131 0.1171 0.1051 0.0066  -0.0113 0.0037  66  ALA B CA  
2057 C  C   . ALA B 74  ? 0.1114 0.1147 0.1041 0.0053  -0.0118 0.0030  66  ALA B C   
2058 O  O   . ALA B 74  ? 0.1104 0.1161 0.1045 0.0049  -0.0119 0.0038  66  ALA B O   
2059 C  CB  . ALA B 74  ? 0.1124 0.1182 0.1043 0.0058  -0.0121 0.0035  66  ALA B CB  
2060 N  N   . TYR B 75  ? 0.1126 0.1129 0.1048 0.0046  -0.0119 0.0016  67  TYR B N   
2061 C  CA  . TYR B 75  ? 0.1170 0.1165 0.1099 0.0037  -0.0121 0.0012  67  TYR B CA  
2062 C  C   . TYR B 75  ? 0.1201 0.1202 0.1128 0.0051  -0.0115 0.0021  67  TYR B C   
2063 O  O   . TYR B 75  ? 0.1246 0.1260 0.1184 0.0048  -0.0113 0.0031  67  TYR B O   
2064 C  CB  . TYR B 75  ? 0.1169 0.1133 0.1092 0.0031  -0.0123 -0.0003 67  TYR B CB  
2065 C  CG  . TYR B 75  ? 0.1163 0.1122 0.1089 0.0017  -0.0128 -0.0013 67  TYR B CG  
2066 C  CD1 . TYR B 75  ? 0.1197 0.1173 0.1136 0.0001  -0.0133 -0.0014 67  TYR B CD1 
2067 C  CD2 . TYR B 75  ? 0.1171 0.1111 0.1088 0.0018  -0.0126 -0.0022 67  TYR B CD2 
2068 C  CE1 . TYR B 75  ? 0.1186 0.1159 0.1124 -0.0011 -0.0138 -0.0026 67  TYR B CE1 
2069 C  CE2 . TYR B 75  ? 0.1183 0.1121 0.1098 0.0008  -0.0129 -0.0030 67  TYR B CE2 
2070 C  CZ  . TYR B 75  ? 0.1185 0.1138 0.1108 -0.0006 -0.0136 -0.0034 67  TYR B CZ  
2071 O  OH  . TYR B 75  ? 0.1205 0.1157 0.1123 -0.0015 -0.0139 -0.0046 67  TYR B OH  
2072 N  N   . VAL B 76  ? 0.1232 0.1221 0.1145 0.0068  -0.0110 0.0019  68  VAL B N   
2073 C  CA  . VAL B 76  ? 0.1278 0.1275 0.1185 0.0085  -0.0103 0.0025  68  VAL B CA  
2074 C  C   . VAL B 76  ? 0.1285 0.1315 0.1202 0.0090  -0.0098 0.0044  68  VAL B C   
2075 O  O   . VAL B 76  ? 0.1256 0.1300 0.1177 0.0094  -0.0094 0.0055  68  VAL B O   
2076 C  CB  . VAL B 76  ? 0.1290 0.1267 0.1183 0.0102  -0.0099 0.0013  68  VAL B CB  
2077 C  CG1 . VAL B 76  ? 0.1300 0.1288 0.1184 0.0121  -0.0092 0.0017  68  VAL B CG1 
2078 C  CG2 . VAL B 76  ? 0.1307 0.1256 0.1195 0.0097  -0.0105 -0.0007 68  VAL B CG2 
2079 N  N   . ASP B 77  ? 0.1315 0.1359 0.1238 0.0090  -0.0098 0.0050  69  ASP B N   
2080 C  CA  . ASP B 77  ? 0.1362 0.1442 0.1299 0.0096  -0.0094 0.0069  69  ASP B CA  
2081 C  C   . ASP B 77  ? 0.1398 0.1502 0.1358 0.0078  -0.0098 0.0077  69  ASP B C   
2082 O  O   . ASP B 77  ? 0.1404 0.1530 0.1375 0.0084  -0.0091 0.0092  69  ASP B O   
2083 C  CB  . ASP B 77  ? 0.1386 0.1481 0.1325 0.0100  -0.0095 0.0075  69  ASP B CB  
2084 C  CG  . ASP B 77  ? 0.1421 0.1493 0.1346 0.0120  -0.0085 0.0072  69  ASP B CG  
2085 O  OD1 . ASP B 77  ? 0.1490 0.1543 0.1404 0.0132  -0.0079 0.0065  69  ASP B OD1 
2086 O  OD2 . ASP B 77  ? 0.1455 0.1529 0.1380 0.0125  -0.0084 0.0076  69  ASP B OD2 
2087 N  N   . LYS B 78  ? 0.1378 0.1475 0.1345 0.0058  -0.0108 0.0066  70  LYS B N   
2088 C  CA  . LYS B 78  ? 0.1406 0.1522 0.1401 0.0039  -0.0111 0.0070  70  LYS B CA  
2089 C  C   . LYS B 78  ? 0.1337 0.1438 0.1335 0.0039  -0.0103 0.0075  70  LYS B C   
2090 O  O   . LYS B 78  ? 0.1295 0.1415 0.1319 0.0033  -0.0098 0.0089  70  LYS B O   
2091 C  CB  . LYS B 78  ? 0.1475 0.1587 0.1476 0.0018  -0.0123 0.0053  70  LYS B CB  
2092 C  CG  . LYS B 78  ? 0.1576 0.1709 0.1611 -0.0004 -0.0128 0.0052  70  LYS B CG  
2093 C  CD  . LYS B 78  ? 0.1654 0.1834 0.1710 -0.0007 -0.0134 0.0059  70  LYS B CD  
2094 C  CE  . LYS B 78  ? 0.1695 0.1899 0.1794 -0.0032 -0.0139 0.0054  70  LYS B CE  
2095 N  NZ  . LYS B 78  ? 0.1734 0.1936 0.1834 -0.0051 -0.0153 0.0029  70  LYS B NZ  
2096 N  N   . LEU B 79  ? 0.1304 0.1373 0.1279 0.0048  -0.0102 0.0066  71  LEU B N   
2097 C  CA  . LEU B 79  ? 0.1327 0.1387 0.1299 0.0055  -0.0094 0.0074  71  LEU B CA  
2098 C  C   . LEU B 79  ? 0.1293 0.1378 0.1266 0.0073  -0.0083 0.0094  71  LEU B C   
2099 O  O   . LEU B 79  ? 0.1299 0.1398 0.1291 0.0071  -0.0073 0.0112  71  LEU B O   
2100 C  CB  . LEU B 79  ? 0.1354 0.1383 0.1299 0.0064  -0.0097 0.0059  71  LEU B CB  
2101 C  CG  . LEU B 79  ? 0.1427 0.1454 0.1360 0.0080  -0.0091 0.0066  71  LEU B CG  
2102 C  CD1 . LEU B 79  ? 0.1466 0.1494 0.1421 0.0070  -0.0085 0.0081  71  LEU B CD1 
2103 C  CD2 . LEU B 79  ? 0.1450 0.1453 0.1358 0.0089  -0.0097 0.0047  71  LEU B CD2 
2104 N  N   . ASN B 80  ? 0.1249 0.1338 0.1203 0.0091  -0.0080 0.0093  72  ASN B N   
2105 C  CA  . ASN B 80  ? 0.1274 0.1387 0.1226 0.0110  -0.0068 0.0110  72  ASN B CA  
2106 C  C   . ASN B 80  ? 0.1260 0.1409 0.1249 0.0100  -0.0063 0.0131  72  ASN B C   
2107 O  O   . ASN B 80  ? 0.1237 0.1403 0.1237 0.0108  -0.0050 0.0151  72  ASN B O   
2108 C  CB  . ASN B 80  ? 0.1289 0.1399 0.1219 0.0131  -0.0066 0.0103  72  ASN B CB  
2109 C  CG  . ASN B 80  ? 0.1329 0.1409 0.1227 0.0145  -0.0068 0.0083  72  ASN B CG  
2110 O  OD1 . ASN B 80  ? 0.1302 0.1380 0.1188 0.0152  -0.0066 0.0083  72  ASN B OD1 
2111 N  ND2 . ASN B 80  ? 0.1359 0.1420 0.1248 0.0147  -0.0072 0.0065  72  ASN B ND2 
2112 N  N   . ALA B 81  ? 0.1264 0.1426 0.1273 0.0083  -0.0072 0.0127  73  ALA B N   
2113 C  CA  . ALA B 81  ? 0.1275 0.1476 0.1324 0.0072  -0.0070 0.0143  73  ALA B CA  
2114 C  C   . ALA B 81  ? 0.1314 0.1515 0.1395 0.0054  -0.0066 0.0150  73  ALA B C   
2115 O  O   . ALA B 81  ? 0.1360 0.1588 0.1471 0.0054  -0.0054 0.0171  73  ALA B O   
2116 C  CB  . ALA B 81  ? 0.1274 0.1493 0.1336 0.0058  -0.0084 0.0133  73  ALA B CB  
2117 N  N   . LEU B 82  ? 0.1311 0.1482 0.1389 0.0039  -0.0073 0.0135  74  LEU B N   
2118 C  CA  . LEU B 82  ? 0.1326 0.1491 0.1436 0.0022  -0.0066 0.0142  74  LEU B CA  
2119 C  C   . LEU B 82  ? 0.1366 0.1522 0.1466 0.0041  -0.0049 0.0162  74  LEU B C   
2120 O  O   . LEU B 82  ? 0.1323 0.1488 0.1458 0.0034  -0.0036 0.0181  74  LEU B O   
2121 C  CB  . LEU B 82  ? 0.1317 0.1451 0.1427 0.0002  -0.0078 0.0119  74  LEU B CB  
2122 C  CG  . LEU B 82  ? 0.1324 0.1473 0.1452 -0.0020 -0.0094 0.0099  74  LEU B CG  
2123 C  CD1 . LEU B 82  ? 0.1321 0.1436 0.1436 -0.0033 -0.0103 0.0075  74  LEU B CD1 
2124 C  CD2 . LEU B 82  ? 0.1349 0.1529 0.1531 -0.0041 -0.0092 0.0105  74  LEU B CD2 
2125 N  N   . ALA B 83  ? 0.1435 0.1576 0.1490 0.0065  -0.0048 0.0158  75  ALA B N   
2126 C  CA  . ALA B 83  ? 0.1482 0.1619 0.1522 0.0085  -0.0034 0.0176  75  ALA B CA  
2127 C  C   . ALA B 83  ? 0.1506 0.1676 0.1552 0.0105  -0.0016 0.0203  75  ALA B C   
2128 O  O   . ALA B 83  ? 0.1459 0.1636 0.1509 0.0117  0.0000  0.0226  75  ALA B O   
2129 C  CB  . ALA B 83  ? 0.1514 0.1628 0.1506 0.0103  -0.0041 0.0158  75  ALA B CB  
2130 N  N   . GLY B 84  ? 0.1560 0.1752 0.1607 0.0109  -0.0018 0.0203  76  GLY B N   
2131 C  CA  . GLY B 84  ? 0.1617 0.1840 0.1663 0.0133  0.0000  0.0227  76  GLY B CA  
2132 C  C   . GLY B 84  ? 0.1687 0.1900 0.1687 0.0163  0.0008  0.0230  76  GLY B C   
2133 O  O   . GLY B 84  ? 0.1764 0.1952 0.1726 0.0171  -0.0004 0.0206  76  GLY B O   
2134 N  N   . THR B 85  ? 0.1751 0.1984 0.1756 0.0180  0.0029  0.0259  77  THR B N   
2135 C  CA  . THR B 85  ? 0.1803 0.2035 0.1763 0.0212  0.0038  0.0264  77  THR B CA  
2136 C  C   . THR B 85  ? 0.1858 0.2079 0.1825 0.0210  0.0045  0.0280  77  THR B C   
2137 O  O   . THR B 85  ? 0.1755 0.1979 0.1686 0.0237  0.0051  0.0287  77  THR B O   
2138 C  CB  . THR B 85  ? 0.1817 0.2083 0.1771 0.0240  0.0059  0.0290  77  THR B CB  
2139 O  OG1 . THR B 85  ? 0.1846 0.2133 0.1852 0.0228  0.0078  0.0325  77  THR B OG1 
2140 C  CG2 . THR B 85  ? 0.1773 0.2051 0.1721 0.0247  0.0056  0.0278  77  THR B CG2 
2141 N  N   . THR B 86  ? 0.1928 0.2139 0.1943 0.0179  0.0044  0.0286  78  THR B N   
2142 C  CA  . THR B 86  ? 0.1945 0.2143 0.1977 0.0175  0.0054  0.0304  78  THR B CA  
2143 C  C   . THR B 86  ? 0.1934 0.2108 0.1922 0.0189  0.0043  0.0288  78  THR B C   
2144 O  O   . THR B 86  ? 0.2000 0.2173 0.1985 0.0202  0.0055  0.0310  78  THR B O   
2145 C  CB  . THR B 86  ? 0.2028 0.2210 0.2117 0.0136  0.0049  0.0299  78  THR B CB  
2146 O  OG1 . THR B 86  ? 0.2097 0.2305 0.2229 0.0120  0.0053  0.0305  78  THR B OG1 
2147 C  CG2 . THR B 86  ? 0.2072 0.2242 0.2192 0.0132  0.0067  0.0325  78  THR B CG2 
2148 N  N   . TYR B 87  ? 0.1879 0.2036 0.1836 0.0185  0.0020  0.0251  79  TYR B N   
2149 C  CA  . TYR B 87  ? 0.1821 0.1957 0.1743 0.0194  0.0006  0.0232  79  TYR B CA  
2150 C  C   . TYR B 87  ? 0.1791 0.1935 0.1659 0.0222  -0.0003 0.0211  79  TYR B C   
2151 O  O   . TYR B 87  ? 0.1755 0.1883 0.1597 0.0225  -0.0019 0.0186  79  TYR B O   
2152 C  CB  . TYR B 87  ? 0.1771 0.1876 0.1710 0.0163  -0.0012 0.0204  79  TYR B CB  
2153 C  CG  . TYR B 87  ? 0.1803 0.1899 0.1796 0.0135  -0.0004 0.0219  79  TYR B CG  
2154 C  CD1 . TYR B 87  ? 0.1807 0.1889 0.1814 0.0135  0.0005  0.0235  79  TYR B CD1 
2155 C  CD2 . TYR B 87  ? 0.1816 0.1919 0.1847 0.0111  -0.0005 0.0217  79  TYR B CD2 
2156 C  CE1 . TYR B 87  ? 0.1799 0.1870 0.1859 0.0110  0.0015  0.0246  79  TYR B CE1 
2157 C  CE2 . TYR B 87  ? 0.1816 0.1912 0.1898 0.0085  0.0002  0.0226  79  TYR B CE2 
2158 C  CZ  . TYR B 87  ? 0.1849 0.1926 0.1947 0.0084  0.0013  0.0240  79  TYR B CZ  
2159 O  OH  . TYR B 87  ? 0.1898 0.1963 0.2050 0.0057  0.0020  0.0244  79  TYR B OH  
2160 N  N   . ASP B 88  ? 0.1784 0.1953 0.1637 0.0243  0.0008  0.0221  80  ASP B N   
2161 C  CA  . ASP B 88  ? 0.1822 0.1999 0.1626 0.0270  0.0001  0.0199  80  ASP B CA  
2162 C  C   . ASP B 88  ? 0.1861 0.2046 0.1625 0.0296  -0.0002 0.0197  80  ASP B C   
2163 O  O   . ASP B 88  ? 0.1895 0.2098 0.1659 0.0312  0.0014  0.0229  80  ASP B O   
2164 C  CB  . ASP B 88  ? 0.1871 0.2076 0.1670 0.0289  0.0018  0.0215  80  ASP B CB  
2165 C  CG  . ASP B 88  ? 0.1894 0.2094 0.1719 0.0269  0.0015  0.0205  80  ASP B CG  
2166 O  OD1 . ASP B 88  ? 0.1944 0.2123 0.1796 0.0239  0.0002  0.0193  80  ASP B OD1 
2167 O  OD2 . ASP B 88  ? 0.1903 0.2120 0.1719 0.0286  0.0024  0.0209  80  ASP B OD2 
2168 N  N   . GLY B 89  ? 0.1848 0.2021 0.1582 0.0301  -0.0022 0.0159  81  GLY B N   
2169 C  CA  . GLY B 89  ? 0.1911 0.2096 0.1607 0.0326  -0.0030 0.0149  81  GLY B CA  
2170 C  C   . GLY B 89  ? 0.1941 0.2108 0.1652 0.0310  -0.0042 0.0146  81  GLY B C   
2171 O  O   . GLY B 89  ? 0.1979 0.2155 0.1663 0.0326  -0.0054 0.0132  81  GLY B O   
2172 N  N   . LYS B 90  ? 0.1882 0.2026 0.1636 0.0279  -0.0038 0.0158  82  LYS B N   
2173 C  CA  . LYS B 90  ? 0.1867 0.1989 0.1639 0.0262  -0.0048 0.0153  82  LYS B CA  
2174 C  C   . LYS B 90  ? 0.1748 0.1845 0.1520 0.0243  -0.0070 0.0112  82  LYS B C   
2175 O  O   . LYS B 90  ? 0.1736 0.1823 0.1513 0.0230  -0.0074 0.0093  82  LYS B O   
2176 C  CB  . LYS B 90  ? 0.1926 0.2033 0.1745 0.0236  -0.0035 0.0179  82  LYS B CB  
2177 C  CG  . LYS B 90  ? 0.2085 0.2212 0.1916 0.0251  -0.0010 0.0223  82  LYS B CG  
2178 C  CD  . LYS B 90  ? 0.2157 0.2264 0.2033 0.0231  0.0000  0.0244  82  LYS B CD  
2179 C  CE  . LYS B 90  ? 0.2284 0.2409 0.2161 0.0256  0.0023  0.0286  82  LYS B CE  
2180 N  NZ  . LYS B 90  ? 0.2294 0.2443 0.2178 0.0268  0.0044  0.0315  82  LYS B NZ  
2181 N  N   . SER B 91  ? 0.1644 0.1733 0.1415 0.0241  -0.0082 0.0100  83  SER B N   
2182 C  CA  . SER B 91  ? 0.1594 0.1657 0.1375 0.0220  -0.0099 0.0067  83  SER B CA  
2183 C  C   . SER B 91  ? 0.1544 0.1581 0.1363 0.0188  -0.0094 0.0074  83  SER B C   
2184 O  O   . SER B 91  ? 0.1458 0.1494 0.1300 0.0181  -0.0080 0.0102  83  SER B O   
2185 C  CB  . SER B 91  ? 0.1595 0.1660 0.1369 0.0227  -0.0112 0.0056  83  SER B CB  
2186 O  OG  . SER B 91  ? 0.1602 0.1659 0.1399 0.0220  -0.0102 0.0082  83  SER B OG  
2187 N  N   . ILE B 92  ? 0.1502 0.1518 0.1329 0.0169  -0.0105 0.0047  84  ILE B N   
2188 C  CA  . ILE B 92  ? 0.1529 0.1524 0.1387 0.0141  -0.0103 0.0049  84  ILE B CA  
2189 C  C   . ILE B 92  ? 0.1602 0.1584 0.1478 0.0132  -0.0101 0.0059  84  ILE B C   
2190 O  O   . ILE B 92  ? 0.1543 0.1515 0.1446 0.0115  -0.0092 0.0073  84  ILE B O   
2191 C  CB  . ILE B 92  ? 0.1533 0.1509 0.1392 0.0127  -0.0114 0.0020  84  ILE B CB  
2192 C  CG1 . ILE B 92  ? 0.1532 0.1517 0.1377 0.0137  -0.0113 0.0012  84  ILE B CG1 
2193 C  CG2 . ILE B 92  ? 0.1471 0.1429 0.1357 0.0100  -0.0113 0.0021  84  ILE B CG2 
2194 C  CD1 . ILE B 92  ? 0.1548 0.1548 0.1400 0.0137  -0.0101 0.0034  84  ILE B CD1 
2195 N  N   . GLU B 93  ? 0.1662 0.1644 0.1526 0.0144  -0.0109 0.0050  85  GLU B N   
2196 C  CA  . GLU B 93  ? 0.1792 0.1763 0.1674 0.0139  -0.0106 0.0062  85  GLU B CA  
2197 C  C   . GLU B 93  ? 0.1877 0.1857 0.1769 0.0148  -0.0088 0.0097  85  GLU B C   
2198 O  O   . GLU B 93  ? 0.1954 0.1916 0.1875 0.0134  -0.0079 0.0109  85  GLU B O   
2199 C  CB  . GLU B 93  ? 0.1805 0.1782 0.1673 0.0153  -0.0118 0.0047  85  GLU B CB  
2200 C  CG  . GLU B 93  ? 0.1840 0.1800 0.1712 0.0138  -0.0132 0.0015  85  GLU B CG  
2201 C  CD  . GLU B 93  ? 0.1893 0.1867 0.1754 0.0152  -0.0147 -0.0006 85  GLU B CD  
2202 O  OE1 . GLU B 93  ? 0.1810 0.1781 0.1682 0.0153  -0.0149 -0.0004 85  GLU B OE1 
2203 O  OE2 . GLU B 93  ? 0.1888 0.1875 0.1731 0.0161  -0.0156 -0.0026 85  GLU B OE2 
2204 N  N   . GLU B 94  ? 0.1976 0.1983 0.1848 0.0172  -0.0081 0.0114  86  GLU B N   
2205 C  CA  . GLU B 94  ? 0.2080 0.2099 0.1965 0.0182  -0.0060 0.0154  86  GLU B CA  
2206 C  C   . GLU B 94  ? 0.1967 0.1972 0.1889 0.0156  -0.0048 0.0163  86  GLU B C   
2207 O  O   . GLU B 94  ? 0.2039 0.2033 0.1994 0.0148  -0.0033 0.0186  86  GLU B O   
2208 C  CB  . GLU B 94  ? 0.2273 0.2326 0.2125 0.0214  -0.0053 0.0170  86  GLU B CB  
2209 C  CG  . GLU B 94  ? 0.2553 0.2629 0.2372 0.0246  -0.0061 0.0170  86  GLU B CG  
2210 C  CD  . GLU B 94  ? 0.2907 0.3021 0.2686 0.0279  -0.0057 0.0178  86  GLU B CD  
2211 O  OE1 . GLU B 94  ? 0.3598 0.3735 0.3364 0.0307  -0.0044 0.0211  86  GLU B OE1 
2212 O  OE2 . GLU B 94  ? 0.2779 0.2901 0.2537 0.0281  -0.0066 0.0154  86  GLU B OE2 
2213 N  N   . ILE B 95  ? 0.1863 0.1868 0.1783 0.0143  -0.0055 0.0145  87  ILE B N   
2214 C  CA  . ILE B 95  ? 0.1872 0.1872 0.1828 0.0118  -0.0048 0.0151  87  ILE B CA  
2215 C  C   . ILE B 95  ? 0.1843 0.1814 0.1830 0.0091  -0.0051 0.0140  87  ILE B C   
2216 O  O   . ILE B 95  ? 0.1756 0.1719 0.1780 0.0076  -0.0038 0.0155  87  ILE B O   
2217 C  CB  . ILE B 95  ? 0.1847 0.1855 0.1792 0.0112  -0.0057 0.0133  87  ILE B CB  
2218 C  CG1 . ILE B 95  ? 0.1918 0.1954 0.1838 0.0139  -0.0051 0.0145  87  ILE B CG1 
2219 C  CG2 . ILE B 95  ? 0.1806 0.1814 0.1789 0.0086  -0.0053 0.0136  87  ILE B CG2 
2220 C  CD1 . ILE B 95  ? 0.1958 0.1999 0.1861 0.0138  -0.0060 0.0124  87  ILE B CD1 
2221 N  N   . ILE B 96  ? 0.1864 0.1817 0.1836 0.0085  -0.0066 0.0112  88  ILE B N   
2222 C  CA  . ILE B 96  ? 0.1900 0.1827 0.1895 0.0063  -0.0070 0.0098  88  ILE B CA  
2223 C  C   . ILE B 96  ? 0.1947 0.1861 0.1968 0.0064  -0.0055 0.0120  88  ILE B C   
2224 O  O   . ILE B 96  ? 0.1908 0.1806 0.1964 0.0043  -0.0047 0.0121  88  ILE B O   
2225 C  CB  . ILE B 96  ? 0.1865 0.1780 0.1839 0.0064  -0.0085 0.0072  88  ILE B CB  
2226 C  CG1 . ILE B 96  ? 0.1864 0.1784 0.1821 0.0059  -0.0096 0.0051  88  ILE B CG1 
2227 C  CG2 . ILE B 96  ? 0.1830 0.1717 0.1824 0.0046  -0.0085 0.0060  88  ILE B CG2 
2228 C  CD1 . ILE B 96  ? 0.1885 0.1799 0.1820 0.0067  -0.0109 0.0029  88  ILE B CD1 
2229 N  N   . LEU B 97  ? 0.2039 0.1961 0.2044 0.0089  -0.0050 0.0136  89  LEU B N   
2230 C  CA  . LEU B 97  ? 0.2106 0.2017 0.2134 0.0095  -0.0033 0.0162  89  LEU B CA  
2231 C  C   . LEU B 97  ? 0.2006 0.1922 0.2067 0.0092  -0.0012 0.0192  89  LEU B C   
2232 O  O   . LEU B 97  ? 0.1997 0.1891 0.2099 0.0076  0.0002  0.0201  89  LEU B O   
2233 C  CB  . LEU B 97  ? 0.2295 0.2223 0.2293 0.0128  -0.0035 0.0175  89  LEU B CB  
2234 C  CG  . LEU B 97  ? 0.2526 0.2441 0.2546 0.0139  -0.0019 0.0200  89  LEU B CG  
2235 C  CD1 . LEU B 97  ? 0.2618 0.2505 0.2649 0.0124  -0.0029 0.0176  89  LEU B CD1 
2236 C  CD2 . LEU B 97  ? 0.2551 0.2496 0.2541 0.0177  -0.0016 0.0225  89  LEU B CD2 
2237 N  N   . ALA B 98  ? 0.1907 0.1852 0.1953 0.0105  -0.0008 0.0207  90  ALA B N   
2238 C  CA  . ALA B 98  ? 0.1925 0.1879 0.2006 0.0102  0.0014  0.0237  90  ALA B CA  
2239 C  C   . ALA B 98  ? 0.1939 0.1876 0.2069 0.0065  0.0015  0.0223  90  ALA B C   
2240 O  O   . ALA B 98  ? 0.1891 0.1817 0.2067 0.0054  0.0035  0.0244  90  ALA B O   
2241 C  CB  . ALA B 98  ? 0.1931 0.1920 0.1987 0.0121  0.0017  0.0250  90  ALA B CB  
2242 N  N   . VAL B 99  ? 0.1863 0.1795 0.1984 0.0045  -0.0005 0.0189  91  VAL B N   
2243 C  CA  . VAL B 99  ? 0.1855 0.1780 0.2018 0.0013  -0.0005 0.0175  91  VAL B CA  
2244 C  C   . VAL B 99  ? 0.1852 0.1745 0.2030 -0.0009 -0.0014 0.0146  91  VAL B C   
2245 O  O   . VAL B 99  ? 0.1777 0.1668 0.1984 -0.0036 -0.0018 0.0128  91  VAL B O   
2246 C  CB  . VAL B 99  ? 0.1853 0.1804 0.2005 0.0006  -0.0018 0.0161  91  VAL B CB  
2247 C  CG1 . VAL B 99  ? 0.1887 0.1869 0.2034 0.0026  -0.0005 0.0191  91  VAL B CG1 
2248 C  CG2 . VAL B 99  ? 0.1838 0.1787 0.1945 0.0010  -0.0039 0.0133  91  VAL B CG2 
2249 N  N   . ALA B 100 ? 0.1999 0.1872 0.2158 0.0002  -0.0016 0.0142  92  ALA B N   
2250 C  CA  . ALA B 100 ? 0.2073 0.1916 0.2238 -0.0015 -0.0024 0.0114  92  ALA B CA  
2251 C  C   . ALA B 100 ? 0.2199 0.2020 0.2419 -0.0039 -0.0010 0.0113  92  ALA B C   
2252 O  O   . ALA B 100 ? 0.2166 0.1974 0.2398 -0.0061 -0.0019 0.0083  92  ALA B O   
2253 C  CB  . ALA B 100 ? 0.2065 0.1894 0.2205 0.0005  -0.0025 0.0117  92  ALA B CB  
2254 N  N   . ASN B 101 ? 0.2476 0.2295 0.2733 -0.0035 0.0012  0.0145  93  ASN B N   
2255 C  CA  . ASN B 101 ? 0.2719 0.2514 0.3038 -0.0059 0.0029  0.0144  93  ASN B CA  
2256 C  C   . ASN B 101 ? 0.2943 0.2759 0.3308 -0.0075 0.0038  0.0156  93  ASN B C   
2257 O  O   . ASN B 101 ? 0.3203 0.3003 0.3625 -0.0086 0.0060  0.0172  93  ASN B O   
2258 C  CB  . ASN B 101 ? 0.2747 0.2515 0.3090 -0.0044 0.0053  0.0173  93  ASN B CB  
2259 C  CG  . ASN B 101 ? 0.2859 0.2604 0.3172 -0.0032 0.0046  0.0160  93  ASN B CG  
2260 O  OD1 . ASN B 101 ? 0.2826 0.2564 0.3120 -0.0046 0.0027  0.0123  93  ASN B OD1 
2261 N  ND2 . ASN B 101 ? 0.2932 0.2670 0.3243 -0.0006 0.0062  0.0192  93  ASN B ND2 
2262 N  N   . ASP B 102 ? 0.2970 0.2820 0.3312 -0.0076 0.0023  0.0149  94  ASP B N   
2263 C  CA  . ASP B 102 ? 0.2962 0.2840 0.3343 -0.0088 0.0030  0.0161  94  ASP B CA  
2264 C  C   . ASP B 102 ? 0.2927 0.2817 0.3318 -0.0116 0.0008  0.0120  94  ASP B C   
2265 O  O   . ASP B 102 ? 0.2774 0.2686 0.3121 -0.0110 -0.0012 0.0105  94  ASP B O   
2266 C  CB  . ASP B 102 ? 0.3006 0.2919 0.3352 -0.0061 0.0033  0.0189  94  ASP B CB  
2267 C  CG  . ASP B 102 ? 0.3109 0.3054 0.3496 -0.0071 0.0042  0.0206  94  ASP B CG  
2268 O  OD1 . ASP B 102 ? 0.3408 0.3355 0.3846 -0.0102 0.0039  0.0187  94  ASP B OD1 
2269 O  OD2 . ASP B 102 ? 0.2863 0.2834 0.3234 -0.0047 0.0052  0.0236  94  ASP B OD2 
2270 N  N   . ALA B 103 ? 0.2819 0.2695 0.3267 -0.0146 0.0013  0.0103  95  ALA B N   
2271 C  CA  . ALA B 103 ? 0.2859 0.2749 0.3318 -0.0173 -0.0009 0.0062  95  ALA B CA  
2272 C  C   . ALA B 103 ? 0.2854 0.2794 0.3321 -0.0177 -0.0018 0.0066  95  ALA B C   
2273 O  O   . ALA B 103 ? 0.3298 0.3262 0.3755 -0.0190 -0.0041 0.0036  95  ALA B O   
2274 C  CB  . ALA B 103 ? 0.3028 0.2894 0.3553 -0.0204 -0.0001 0.0040  95  ALA B CB  
2275 N  N   . GLU B 104 ? 0.2543 0.2503 0.3028 -0.0164 -0.0001 0.0105  96  GLU B N   
2276 C  CA  . GLU B 104 ? 0.2520 0.2528 0.3007 -0.0164 -0.0008 0.0112  96  GLU B CA  
2277 C  C   . GLU B 104 ? 0.2433 0.2459 0.2847 -0.0140 -0.0026 0.0108  96  GLU B C   
2278 O  O   . GLU B 104 ? 0.2470 0.2534 0.2880 -0.0140 -0.0037 0.0106  96  GLU B O   
2279 C  CB  . GLU B 104 ? 0.2513 0.2539 0.3040 -0.0154 0.0019  0.0156  96  GLU B CB  
2280 N  N   . LYS B 105 ? 0.2365 0.2363 0.2725 -0.0119 -0.0028 0.0108  97  LYS B N   
2281 C  CA  . LYS B 105 ? 0.2253 0.2263 0.2549 -0.0094 -0.0039 0.0110  97  LYS B CA  
2282 C  C   . LYS B 105 ? 0.2110 0.2096 0.2362 -0.0092 -0.0056 0.0081  97  LYS B C   
2283 O  O   . LYS B 105 ? 0.2089 0.2068 0.2293 -0.0070 -0.0060 0.0084  97  LYS B O   
2284 C  CB  . LYS B 105 ? 0.2269 0.2277 0.2543 -0.0063 -0.0021 0.0146  97  LYS B CB  
2285 N  N   . LYS B 106 ? 0.1942 0.1916 0.2212 -0.0116 -0.0066 0.0051  98  LYS B N   
2286 C  CA  . LYS B 106 ? 0.1820 0.1775 0.2051 -0.0115 -0.0080 0.0024  98  LYS B CA  
2287 C  C   . LYS B 106 ? 0.1650 0.1628 0.1835 -0.0101 -0.0095 0.0019  98  LYS B C   
2288 O  O   . LYS B 106 ? 0.1629 0.1593 0.1774 -0.0086 -0.0100 0.0015  98  LYS B O   
2289 C  CB  . LYS B 106 ? 0.1799 0.1742 0.2057 -0.0142 -0.0088 -0.0008 98  LYS B CB  
2290 N  N   . GLY B 107 ? 0.1513 0.1530 0.1711 -0.0105 -0.0101 0.0022  99  GLY B N   
2291 C  CA  . GLY B 107 ? 0.1411 0.1452 0.1574 -0.0091 -0.0111 0.0022  99  GLY B CA  
2292 C  C   . GLY B 107 ? 0.1343 0.1374 0.1469 -0.0064 -0.0104 0.0041  99  GLY B C   
2293 O  O   . GLY B 107 ? 0.1278 0.1299 0.1365 -0.0052 -0.0111 0.0031  99  GLY B O   
2294 N  N   . LEU B 108 ? 0.1323 0.1356 0.1461 -0.0054 -0.0089 0.0066  100 LEU B N   
2295 C  CA  . LEU B 108 ? 0.1300 0.1326 0.1403 -0.0027 -0.0083 0.0081  100 LEU B CA  
2296 C  C   . LEU B 108 ? 0.1258 0.1250 0.1335 -0.0020 -0.0085 0.0069  100 LEU B C   
2297 O  O   . LEU B 108 ? 0.1271 0.1257 0.1312 -0.0004 -0.0091 0.0064  100 LEU B O   
2298 C  CB  . LEU B 108 ? 0.1329 0.1369 0.1452 -0.0016 -0.0065 0.0111  100 LEU B CB  
2299 C  CG  . LEU B 108 ? 0.1365 0.1401 0.1449 0.0014  -0.0058 0.0126  100 LEU B CG  
2300 C  CD1 . LEU B 108 ? 0.1388 0.1438 0.1437 0.0031  -0.0066 0.0118  100 LEU B CD1 
2301 C  CD2 . LEU B 108 ? 0.1418 0.1471 0.1521 0.0027  -0.0038 0.0158  100 LEU B CD2 
2302 N  N   . PHE B 109 ? 0.1208 0.1177 0.1307 -0.0033 -0.0081 0.0066  101 PHE B N   
2303 C  CA  . PHE B 109 ? 0.1179 0.1118 0.1259 -0.0028 -0.0084 0.0054  101 PHE B CA  
2304 C  C   . PHE B 109 ? 0.1153 0.1087 0.1206 -0.0031 -0.0099 0.0029  101 PHE B C   
2305 O  O   . PHE B 109 ? 0.1171 0.1094 0.1195 -0.0017 -0.0102 0.0024  101 PHE B O   
2306 C  CB  . PHE B 109 ? 0.1201 0.1115 0.1313 -0.0044 -0.0076 0.0052  101 PHE B CB  
2307 C  CG  . PHE B 109 ? 0.1196 0.1081 0.1290 -0.0039 -0.0079 0.0039  101 PHE B CG  
2308 C  CD1 . PHE B 109 ? 0.1193 0.1070 0.1276 -0.0020 -0.0072 0.0055  101 PHE B CD1 
2309 C  CD2 . PHE B 109 ? 0.1184 0.1056 0.1274 -0.0053 -0.0089 0.0012  101 PHE B CD2 
2310 C  CE1 . PHE B 109 ? 0.1214 0.1069 0.1284 -0.0015 -0.0075 0.0043  101 PHE B CE1 
2311 C  CE2 . PHE B 109 ? 0.1180 0.1028 0.1255 -0.0048 -0.0090 0.0001  101 PHE B CE2 
2312 C  CZ  . PHE B 109 ? 0.1191 0.1030 0.1259 -0.0030 -0.0084 0.0017  101 PHE B CZ  
2313 N  N   . ASN B 110 ? 0.1133 0.1075 0.1195 -0.0048 -0.0107 0.0013  102 ASN B N   
2314 C  CA  . ASN B 110 ? 0.1138 0.1077 0.1175 -0.0049 -0.0118 -0.0007 102 ASN B CA  
2315 C  C   . ASN B 110 ? 0.1138 0.1087 0.1145 -0.0030 -0.0121 -0.0002 102 ASN B C   
2316 O  O   . ASN B 110 ? 0.1124 0.1057 0.1110 -0.0023 -0.0124 -0.0012 102 ASN B O   
2317 C  CB  . ASN B 110 ? 0.1128 0.1086 0.1179 -0.0067 -0.0127 -0.0022 102 ASN B CB  
2318 C  CG  . ASN B 110 ? 0.1154 0.1096 0.1231 -0.0087 -0.0126 -0.0038 102 ASN B CG  
2319 O  OD1 . ASN B 110 ? 0.1182 0.1094 0.1260 -0.0086 -0.0119 -0.0040 102 ASN B OD1 
2320 N  ND2 . ASN B 110 ? 0.1167 0.1131 0.1265 -0.0105 -0.0134 -0.0051 102 ASN B ND2 
2321 N  N   . GLN B 111 ? 0.1138 0.1112 0.1147 -0.0021 -0.0118 0.0013  103 GLN B N   
2322 C  CA  . GLN B 111 ? 0.1140 0.1120 0.1123 -0.0003 -0.0119 0.0016  103 GLN B CA  
2323 C  C   . GLN B 111 ? 0.1101 0.1064 0.1066 0.0014  -0.0115 0.0019  103 GLN B C   
2324 O  O   . GLN B 111 ? 0.1064 0.1016 0.1009 0.0024  -0.0118 0.0009  103 GLN B O   
2325 C  CB  . GLN B 111 ? 0.1157 0.1169 0.1147 0.0004  -0.0116 0.0032  103 GLN B CB  
2326 C  CG  . GLN B 111 ? 0.1175 0.1214 0.1189 -0.0012 -0.0121 0.0032  103 GLN B CG  
2327 C  CD  . GLN B 111 ? 0.1194 0.1234 0.1198 -0.0018 -0.0131 0.0015  103 GLN B CD  
2328 O  OE1 . GLN B 111 ? 0.1231 0.1268 0.1211 -0.0005 -0.0132 0.0014  103 GLN B OE1 
2329 N  NE2 . GLN B 111 ? 0.1190 0.1232 0.1209 -0.0038 -0.0137 0.0002  103 GLN B NE2 
2330 N  N   . ALA B 112 ? 0.1095 0.1057 0.1070 0.0018  -0.0108 0.0032  104 ALA B N   
2331 C  CA  . ALA B 112 ? 0.1092 0.1047 0.1048 0.0037  -0.0105 0.0036  104 ALA B CA  
2332 C  C   . ALA B 112 ? 0.1067 0.0998 0.1016 0.0034  -0.0111 0.0019  104 ALA B C   
2333 O  O   . ALA B 112 ? 0.1115 0.1041 0.1045 0.0047  -0.0116 0.0008  104 ALA B O   
2334 C  CB  . ALA B 112 ? 0.1107 0.1071 0.1076 0.0043  -0.0094 0.0058  104 ALA B CB  
2335 N  N   . ALA B 113 ? 0.1029 0.0945 0.0995 0.0018  -0.0111 0.0014  105 ALA B N   
2336 C  CA  . ALA B 113 ? 0.1016 0.0910 0.0978 0.0015  -0.0115 0.0000  105 ALA B CA  
2337 C  C   . ALA B 113 ? 0.0995 0.0884 0.0943 0.0013  -0.0122 -0.0018 105 ALA B C   
2338 O  O   . ALA B 113 ? 0.1027 0.0905 0.0966 0.0021  -0.0126 -0.0028 105 ALA B O   
2339 C  CB  . ALA B 113 ? 0.1016 0.0894 0.1000 -0.0001 -0.0111 -0.0002 105 ALA B CB  
2340 N  N   . GLN B 114 ? 0.0973 0.0872 0.0922 0.0005  -0.0124 -0.0020 106 GLN B N   
2341 C  CA  . GLN B 114 ? 0.0960 0.0855 0.0898 0.0006  -0.0127 -0.0032 106 GLN B CA  
2342 C  C   . GLN B 114 ? 0.0955 0.0851 0.0879 0.0023  -0.0127 -0.0032 106 GLN B C   
2343 O  O   . GLN B 114 ? 0.0951 0.0834 0.0871 0.0026  -0.0128 -0.0043 106 GLN B O   
2344 C  CB  . GLN B 114 ? 0.0954 0.0865 0.0895 -0.0003 -0.0129 -0.0031 106 GLN B CB  
2345 C  CG  . GLN B 114 ? 0.0963 0.0867 0.0913 -0.0020 -0.0131 -0.0042 106 GLN B CG  
2346 C  CD  . GLN B 114 ? 0.0961 0.0844 0.0901 -0.0021 -0.0131 -0.0056 106 GLN B CD  
2347 O  OE1 . GLN B 114 ? 0.0956 0.0820 0.0899 -0.0019 -0.0129 -0.0059 106 GLN B OE1 
2348 N  NE2 . GLN B 114 ? 0.0961 0.0851 0.0891 -0.0022 -0.0132 -0.0061 106 GLN B NE2 
2349 N  N   . HIS B 115 ? 0.0958 0.0869 0.0878 0.0034  -0.0125 -0.0021 107 HIS B N   
2350 C  CA  . HIS B 115 ? 0.0951 0.0864 0.0858 0.0051  -0.0124 -0.0025 107 HIS B CA  
2351 C  C   . HIS B 115 ? 0.0953 0.0853 0.0857 0.0057  -0.0129 -0.0038 107 HIS B C   
2352 O  O   . HIS B 115 ? 0.0937 0.0826 0.0839 0.0061  -0.0131 -0.0053 107 HIS B O   
2353 C  CB  . HIS B 115 ? 0.0960 0.0894 0.0863 0.0062  -0.0120 -0.0010 107 HIS B CB  
2354 C  CG  . HIS B 115 ? 0.0975 0.0912 0.0862 0.0082  -0.0119 -0.0016 107 HIS B CG  
2355 N  ND1 . HIS B 115 ? 0.0970 0.0894 0.0853 0.0086  -0.0120 -0.0032 107 HIS B ND1 
2356 C  CD2 . HIS B 115 ? 0.0990 0.0942 0.0865 0.0098  -0.0116 -0.0009 107 HIS B CD2 
2357 C  CE1 . HIS B 115 ? 0.0998 0.0928 0.0868 0.0104  -0.0120 -0.0038 107 HIS B CE1 
2358 N  NE2 . HIS B 115 ? 0.1000 0.0948 0.0862 0.0112  -0.0118 -0.0025 107 HIS B NE2 
2359 N  N   . PHE B 116 ? 0.0976 0.0877 0.0882 0.0057  -0.0129 -0.0032 108 PHE B N   
2360 C  CA  . PHE B 116 ? 0.0986 0.0880 0.0891 0.0063  -0.0135 -0.0043 108 PHE B CA  
2361 C  C   . PHE B 116 ? 0.0999 0.0873 0.0914 0.0051  -0.0137 -0.0058 108 PHE B C   
2362 O  O   . PHE B 116 ? 0.1010 0.0879 0.0926 0.0056  -0.0142 -0.0074 108 PHE B O   
2363 C  CB  . PHE B 116 ? 0.0993 0.0891 0.0901 0.0066  -0.0133 -0.0029 108 PHE B CB  
2364 C  CG  . PHE B 116 ? 0.0983 0.0879 0.0892 0.0073  -0.0139 -0.0039 108 PHE B CG  
2365 C  CD1 . PHE B 116 ? 0.0991 0.0904 0.0886 0.0092  -0.0145 -0.0043 108 PHE B CD1 
2366 C  CD2 . PHE B 116 ? 0.0977 0.0854 0.0901 0.0061  -0.0140 -0.0046 108 PHE B CD2 
2367 C  CE1 . PHE B 116 ? 0.1005 0.0921 0.0903 0.0099  -0.0153 -0.0053 108 PHE B CE1 
2368 C  CE2 . PHE B 116 ? 0.0974 0.0852 0.0903 0.0067  -0.0145 -0.0054 108 PHE B CE2 
2369 C  CZ  . PHE B 116 ? 0.0995 0.0893 0.0911 0.0086  -0.0153 -0.0058 108 PHE B CZ  
2370 N  N   . ASN B 117 ? 0.1005 0.0871 0.0930 0.0037  -0.0134 -0.0054 109 ASN B N   
2371 C  CA  . ASN B 117 ? 0.1012 0.0861 0.0945 0.0027  -0.0134 -0.0066 109 ASN B CA  
2372 C  C   . ASN B 117 ? 0.1018 0.0862 0.0950 0.0029  -0.0133 -0.0076 109 ASN B C   
2373 O  O   . ASN B 117 ? 0.1031 0.0864 0.0973 0.0029  -0.0134 -0.0088 109 ASN B O   
2374 C  CB  . ASN B 117 ? 0.1002 0.0844 0.0940 0.0013  -0.0130 -0.0063 109 ASN B CB  
2375 C  CG  . ASN B 117 ? 0.1012 0.0852 0.0959 0.0009  -0.0128 -0.0056 109 ASN B CG  
2376 O  OD1 . ASN B 117 ? 0.1008 0.0848 0.0957 0.0018  -0.0129 -0.0052 109 ASN B OD1 
2377 N  ND2 . ASN B 117 ? 0.1016 0.0854 0.0971 -0.0004 -0.0126 -0.0055 109 ASN B ND2 
2378 N  N   . HIS B 118 ? 0.1002 0.0853 0.0927 0.0032  -0.0130 -0.0070 110 HIS B N   
2379 C  CA  . HIS B 118 ? 0.1009 0.0853 0.0936 0.0035  -0.0125 -0.0075 110 HIS B CA  
2380 C  C   . HIS B 118 ? 0.1029 0.0869 0.0959 0.0046  -0.0127 -0.0088 110 HIS B C   
2381 O  O   . HIS B 118 ? 0.1016 0.0842 0.0960 0.0045  -0.0124 -0.0099 110 HIS B O   
2382 C  CB  . HIS B 118 ? 0.1018 0.0874 0.0938 0.0037  -0.0121 -0.0062 110 HIS B CB  
2383 C  CG  . HIS B 118 ? 0.1007 0.0867 0.0925 0.0027  -0.0119 -0.0056 110 HIS B CG  
2384 N  ND1 . HIS B 118 ? 0.1026 0.0898 0.0943 0.0018  -0.0123 -0.0052 110 HIS B ND1 
2385 C  CD2 . HIS B 118 ? 0.1002 0.0856 0.0920 0.0025  -0.0114 -0.0056 110 HIS B CD2 
2386 C  CE1 . HIS B 118 ? 0.1008 0.0884 0.0923 0.0011  -0.0123 -0.0052 110 HIS B CE1 
2387 N  NE2 . HIS B 118 ? 0.0997 0.0863 0.0909 0.0016  -0.0116 -0.0053 110 HIS B NE2 
2388 N  N   . THR B 119 ? 0.1061 0.0915 0.0982 0.0056  -0.0132 -0.0087 111 THR B N   
2389 C  CA  . THR B 119 ? 0.1087 0.0942 0.1008 0.0067  -0.0137 -0.0103 111 THR B CA  
2390 C  C   . THR B 119 ? 0.1100 0.0948 0.1035 0.0063  -0.0144 -0.0119 111 THR B C   
2391 O  O   . THR B 119 ? 0.1109 0.0949 0.1060 0.0063  -0.0144 -0.0138 111 THR B O   
2392 C  CB  . THR B 119 ? 0.1111 0.0987 0.1013 0.0081  -0.0141 -0.0098 111 THR B CB  
2393 O  OG1 . THR B 119 ? 0.1097 0.0982 0.0990 0.0085  -0.0134 -0.0082 111 THR B OG1 
2394 C  CG2 . THR B 119 ? 0.1119 0.1000 0.1016 0.0095  -0.0148 -0.0120 111 THR B CG2 
2395 N  N   . PHE B 120 ? 0.1124 0.0976 0.1060 0.0058  -0.0147 -0.0112 112 PHE B N   
2396 C  CA  . PHE B 120 ? 0.1139 0.0988 0.1090 0.0055  -0.0153 -0.0125 112 PHE B CA  
2397 C  C   . PHE B 120 ? 0.1118 0.0949 0.1092 0.0044  -0.0146 -0.0132 112 PHE B C   
2398 O  O   . PHE B 120 ? 0.1082 0.0910 0.1076 0.0043  -0.0149 -0.0150 112 PHE B O   
2399 C  CB  . PHE B 120 ? 0.1182 0.1036 0.1130 0.0054  -0.0154 -0.0112 112 PHE B CB  
2400 C  CG  . PHE B 120 ? 0.1216 0.1077 0.1177 0.0058  -0.0162 -0.0122 112 PHE B CG  
2401 C  CD1 . PHE B 120 ? 0.1262 0.1145 0.1215 0.0073  -0.0173 -0.0128 112 PHE B CD1 
2402 C  CD2 . PHE B 120 ? 0.1244 0.1091 0.1225 0.0048  -0.0159 -0.0127 112 PHE B CD2 
2403 C  CE1 . PHE B 120 ? 0.1298 0.1193 0.1264 0.0078  -0.0182 -0.0137 112 PHE B CE1 
2404 C  CE2 . PHE B 120 ? 0.1245 0.1102 0.1242 0.0052  -0.0166 -0.0135 112 PHE B CE2 
2405 C  CZ  . PHE B 120 ? 0.1276 0.1157 0.1266 0.0067  -0.0178 -0.0141 112 PHE B CZ  
2406 N  N   . TYR B 121 ? 0.1134 0.0954 0.1104 0.0036  -0.0137 -0.0119 113 TYR B N   
2407 C  CA  . TYR B 121 ? 0.1133 0.0937 0.1119 0.0027  -0.0127 -0.0121 113 TYR B CA  
2408 C  C   . TYR B 121 ? 0.1136 0.0931 0.1138 0.0030  -0.0122 -0.0130 113 TYR B C   
2409 O  O   . TYR B 121 ? 0.1145 0.0931 0.1172 0.0026  -0.0118 -0.0139 113 TYR B O   
2410 C  CB  . TYR B 121 ? 0.1141 0.0944 0.1112 0.0022  -0.0120 -0.0105 113 TYR B CB  
2411 C  CG  . TYR B 121 ? 0.1155 0.0946 0.1134 0.0018  -0.0108 -0.0102 113 TYR B CG  
2412 C  CD1 . TYR B 121 ? 0.1162 0.0945 0.1156 0.0013  -0.0102 -0.0106 113 TYR B CD1 
2413 C  CD2 . TYR B 121 ? 0.1167 0.0958 0.1141 0.0022  -0.0099 -0.0092 113 TYR B CD2 
2414 C  CE1 . TYR B 121 ? 0.1163 0.0937 0.1162 0.0012  -0.0089 -0.0100 113 TYR B CE1 
2415 C  CE2 . TYR B 121 ? 0.1179 0.0962 0.1159 0.0022  -0.0086 -0.0085 113 TYR B CE2 
2416 C  CZ  . TYR B 121 ? 0.1168 0.0942 0.1160 0.0017  -0.0080 -0.0089 113 TYR B CZ  
2417 O  OH  . TYR B 121 ? 0.1159 0.0928 0.1156 0.0020  -0.0064 -0.0079 113 TYR B OH  
2418 N  N   . PHE B 122 ? 0.1183 0.0981 0.1175 0.0037  -0.0119 -0.0126 114 PHE B N   
2419 C  CA  . PHE B 122 ? 0.1216 0.1000 0.1227 0.0040  -0.0111 -0.0134 114 PHE B CA  
2420 C  C   . PHE B 122 ? 0.1231 0.1015 0.1265 0.0040  -0.0119 -0.0160 114 PHE B C   
2421 O  O   . PHE B 122 ? 0.1288 0.1056 0.1351 0.0038  -0.0111 -0.0172 114 PHE B O   
2422 C  CB  . PHE B 122 ? 0.1218 0.1005 0.1213 0.0049  -0.0106 -0.0126 114 PHE B CB  
2423 C  CG  . PHE B 122 ? 0.1223 0.1013 0.1204 0.0049  -0.0097 -0.0102 114 PHE B CG  
2424 C  CD1 . PHE B 122 ? 0.1227 0.1005 0.1219 0.0045  -0.0084 -0.0093 114 PHE B CD1 
2425 C  CD2 . PHE B 122 ? 0.1204 0.1012 0.1162 0.0053  -0.0101 -0.0089 114 PHE B CD2 
2426 C  CE1 . PHE B 122 ? 0.1222 0.1010 0.1199 0.0047  -0.0078 -0.0072 114 PHE B CE1 
2427 C  CE2 . PHE B 122 ? 0.1201 0.1018 0.1149 0.0053  -0.0095 -0.0070 114 PHE B CE2 
2428 C  CZ  . PHE B 122 ? 0.1201 0.1008 0.1155 0.0050  -0.0085 -0.0063 114 PHE B CZ  
2429 N  N   . ARG B 123 ? 0.1201 0.1003 0.1223 0.0045  -0.0135 -0.0170 115 ARG B N   
2430 C  CA  . ARG B 123 ? 0.1228 0.1038 0.1269 0.0047  -0.0146 -0.0196 115 ARG B CA  
2431 C  C   . ARG B 123 ? 0.1216 0.1025 0.1286 0.0037  -0.0148 -0.0203 115 ARG B C   
2432 O  O   . ARG B 123 ? 0.1219 0.1033 0.1317 0.0035  -0.0156 -0.0227 115 ARG B O   
2433 C  CB  . ARG B 123 ? 0.1235 0.1070 0.1249 0.0059  -0.0162 -0.0202 115 ARG B CB  
2434 C  CG  . ARG B 123 ? 0.1260 0.1099 0.1255 0.0071  -0.0161 -0.0206 115 ARG B CG  
2435 C  CD  . ARG B 123 ? 0.1279 0.1146 0.1241 0.0087  -0.0173 -0.0206 115 ARG B CD  
2436 N  NE  . ARG B 123 ? 0.1288 0.1156 0.1226 0.0099  -0.0167 -0.0198 115 ARG B NE  
2437 C  CZ  . ARG B 123 ? 0.1317 0.1209 0.1226 0.0115  -0.0171 -0.0193 115 ARG B CZ  
2438 N  NH1 . ARG B 123 ? 0.1329 0.1244 0.1224 0.0123  -0.0182 -0.0191 115 ARG B NH1 
2439 N  NH2 . ARG B 123 ? 0.1344 0.1237 0.1236 0.0125  -0.0163 -0.0186 115 ARG B NH2 
2440 N  N   . CYS B 124 ? 0.1167 0.0970 0.1233 0.0030  -0.0140 -0.0183 116 CYS B N   
2441 C  CA  . CYS B 124 ? 0.1150 0.0950 0.1243 0.0022  -0.0137 -0.0186 116 CYS B CA  
2442 C  C   . CYS B 124 ? 0.1166 0.0946 0.1291 0.0014  -0.0121 -0.0186 116 CYS B C   
2443 O  O   . CYS B 124 ? 0.1139 0.0916 0.1292 0.0008  -0.0116 -0.0189 116 CYS B O   
2444 C  CB  . CYS B 124 ? 0.1127 0.0927 0.1201 0.0020  -0.0135 -0.0167 116 CYS B CB  
2445 S  SG  . CYS B 124 ? 0.1101 0.0923 0.1151 0.0030  -0.0151 -0.0165 116 CYS B SG  
2446 N  N   . ILE B 125 ? 0.1192 0.0957 0.1314 0.0017  -0.0110 -0.0181 117 ILE B N   
2447 C  CA  . ILE B 125 ? 0.1214 0.0959 0.1371 0.0011  -0.0090 -0.0178 117 ILE B CA  
2448 C  C   . ILE B 125 ? 0.1274 0.1008 0.1456 0.0013  -0.0087 -0.0194 117 ILE B C   
2449 O  O   . ILE B 125 ? 0.1327 0.1065 0.1488 0.0021  -0.0096 -0.0202 117 ILE B O   
2450 C  CB  . ILE B 125 ? 0.1231 0.0967 0.1367 0.0014  -0.0073 -0.0149 117 ILE B CB  
2451 C  CG1 . ILE B 125 ? 0.1252 0.0989 0.1355 0.0023  -0.0073 -0.0138 117 ILE B CG1 
2452 C  CG2 . ILE B 125 ? 0.1208 0.0953 0.1323 0.0011  -0.0076 -0.0138 117 ILE B CG2 
2453 C  CD1 . ILE B 125 ? 0.1246 0.0980 0.1331 0.0027  -0.0057 -0.0111 117 ILE B CD1 
2454 N  N   . THR B 126 ? 0.1311 0.1028 0.1541 0.0006  -0.0072 -0.0200 118 THR B N   
2455 C  CA  . THR B 126 ? 0.1360 0.1061 0.1626 0.0005  -0.0066 -0.0219 118 THR B CA  
2456 C  C   . THR B 126 ? 0.1382 0.1060 0.1700 -0.0002 -0.0040 -0.0208 118 THR B C   
2457 O  O   . THR B 126 ? 0.1378 0.1060 0.1714 -0.0009 -0.0034 -0.0200 118 THR B O   
2458 C  CB  . THR B 126 ? 0.1379 0.1098 0.1666 0.0001  -0.0089 -0.0257 118 THR B CB  
2459 O  OG1 . THR B 126 ? 0.1471 0.1176 0.1779 0.0003  -0.0087 -0.0281 118 THR B OG1 
2460 C  CG2 . THR B 126 ? 0.1391 0.1115 0.1726 -0.0011 -0.0090 -0.0270 118 THR B CG2 
2461 N  N   . PRO B 127 ? 0.1426 0.1079 0.1770 0.0001  -0.0021 -0.0206 119 PRO B N   
2462 C  CA  . PRO B 127 ? 0.1439 0.1068 0.1833 -0.0004 0.0009  -0.0190 119 PRO B CA  
2463 C  C   . PRO B 127 ? 0.1449 0.1083 0.1899 -0.0019 0.0007  -0.0210 119 PRO B C   
2464 O  O   . PRO B 127 ? 0.1398 0.1041 0.1877 -0.0027 -0.0012 -0.0247 119 PRO B O   
2465 C  CB  . PRO B 127 ? 0.1467 0.1069 0.1890 0.0000  0.0024  -0.0197 119 PRO B CB  
2466 C  CG  . PRO B 127 ? 0.1460 0.1071 0.1830 0.0012  0.0009  -0.0200 119 PRO B CG  
2467 C  CD  . PRO B 127 ? 0.1448 0.1091 0.1780 0.0009  -0.0022 -0.0217 119 PRO B CD  
2468 N  N   . ASN B 128 ? 0.1501 0.1134 0.1965 -0.0022 0.0024  -0.0186 120 ASN B N   
2469 C  CA  . ASN B 128 ? 0.1553 0.1193 0.2076 -0.0035 0.0026  -0.0199 120 ASN B CA  
2470 C  C   . ASN B 128 ? 0.1498 0.1170 0.2008 -0.0041 -0.0005 -0.0223 120 ASN B C   
2471 O  O   . ASN B 128 ? 0.1440 0.1124 0.1999 -0.0051 -0.0007 -0.0237 120 ASN B O   
2472 C  CB  . ASN B 128 ? 0.1620 0.1238 0.2224 -0.0047 0.0040  -0.0220 120 ASN B CB  
2473 C  CG  . ASN B 128 ? 0.1707 0.1290 0.2331 -0.0040 0.0078  -0.0190 120 ASN B CG  
2474 O  OD1 . ASN B 128 ? 0.1787 0.1349 0.2426 -0.0038 0.0083  -0.0202 120 ASN B OD1 
2475 N  ND2 . ASN B 128 ? 0.1694 0.1272 0.2317 -0.0034 0.0105  -0.0150 120 ASN B ND2 
2476 N  N   . GLY B 129 ? 0.1548 0.1236 0.1996 -0.0032 -0.0027 -0.0225 121 GLY B N   
2477 C  CA  . GLY B 129 ? 0.1591 0.1310 0.2024 -0.0034 -0.0056 -0.0244 121 GLY B CA  
2478 C  C   . GLY B 129 ? 0.1607 0.1345 0.2080 -0.0041 -0.0078 -0.0285 121 GLY B C   
2479 O  O   . GLY B 129 ? 0.1639 0.1363 0.2157 -0.0048 -0.0072 -0.0305 121 GLY B O   
2480 N  N   . LYS B 130 ? 0.1691 0.1460 0.2146 -0.0038 -0.0103 -0.0298 122 LYS B N   
2481 C  CA  . LYS B 130 ? 0.1781 0.1578 0.2275 -0.0044 -0.0126 -0.0336 122 LYS B CA  
2482 C  C   . LYS B 130 ? 0.1725 0.1552 0.2228 -0.0044 -0.0137 -0.0334 122 LYS B C   
2483 O  O   . LYS B 130 ? 0.1603 0.1437 0.2058 -0.0035 -0.0140 -0.0311 122 LYS B O   
2484 C  CB  . LYS B 130 ? 0.2026 0.1840 0.2479 -0.0033 -0.0151 -0.0359 122 LYS B CB  
2485 C  CG  . LYS B 130 ? 0.2289 0.2077 0.2744 -0.0033 -0.0142 -0.0370 122 LYS B CG  
2486 C  CD  . LYS B 130 ? 0.2602 0.2412 0.3017 -0.0021 -0.0167 -0.0395 122 LYS B CD  
2487 C  CE  . LYS B 130 ? 0.2851 0.2632 0.3250 -0.0015 -0.0155 -0.0397 122 LYS B CE  
2488 N  NZ  . LYS B 130 ? 0.2959 0.2709 0.3424 -0.0029 -0.0136 -0.0411 122 LYS B NZ  
2489 N  N   . ALA B 131 ? 0.1759 0.1605 0.2329 -0.0056 -0.0143 -0.0358 123 ALA B N   
2490 C  CA  . ALA B 131 ? 0.1810 0.1687 0.2399 -0.0056 -0.0152 -0.0356 123 ALA B CA  
2491 C  C   . ALA B 131 ? 0.1796 0.1707 0.2334 -0.0041 -0.0180 -0.0358 123 ALA B C   
2492 O  O   . ALA B 131 ? 0.1884 0.1811 0.2392 -0.0032 -0.0201 -0.0378 123 ALA B O   
2493 C  CB  . ALA B 131 ? 0.1851 0.1749 0.2526 -0.0071 -0.0158 -0.0387 123 ALA B CB  
2494 N  N   . MET B 132 ? 0.1746 0.1670 0.2276 -0.0035 -0.0178 -0.0337 124 MET B N   
2495 C  CA  . MET B 132 ? 0.1723 0.1683 0.2218 -0.0020 -0.0201 -0.0337 124 MET B CA  
2496 C  C   . MET B 132 ? 0.1704 0.1710 0.2234 -0.0019 -0.0230 -0.0375 124 MET B C   
2497 O  O   . MET B 132 ? 0.1791 0.1813 0.2387 -0.0031 -0.0231 -0.0390 124 MET B O   
2498 C  CB  . MET B 132 ? 0.1707 0.1673 0.2207 -0.0016 -0.0192 -0.0313 124 MET B CB  
2499 C  CG  . MET B 132 ? 0.1702 0.1635 0.2148 -0.0010 -0.0173 -0.0279 124 MET B CG  
2500 S  SD  . MET B 132 ? 0.1631 0.1576 0.2078 -0.0002 -0.0167 -0.0257 124 MET B SD  
2501 C  CE  . MET B 132 ? 0.1617 0.1514 0.2017 -0.0003 -0.0139 -0.0227 124 MET B CE  
2502 N  N   . PRO B 133 ? 0.1678 0.1710 0.2167 -0.0005 -0.0255 -0.0389 125 PRO B N   
2503 C  CA  . PRO B 133 ? 0.1694 0.1780 0.2213 0.0000  -0.0285 -0.0423 125 PRO B CA  
2504 C  C   . PRO B 133 ? 0.1765 0.1884 0.2300 0.0008  -0.0290 -0.0407 125 PRO B C   
2505 O  O   . PRO B 133 ? 0.1754 0.1854 0.2256 0.0015  -0.0274 -0.0370 125 PRO B O   
2506 C  CB  . PRO B 133 ? 0.1717 0.1824 0.2175 0.0019  -0.0306 -0.0432 125 PRO B CB  
2507 C  CG  . PRO B 133 ? 0.1708 0.1765 0.2119 0.0019  -0.0286 -0.0412 125 PRO B CG  
2508 C  CD  . PRO B 133 ? 0.1673 0.1690 0.2092 0.0008  -0.0256 -0.0377 125 PRO B CD  
2509 N  N   . LYS B 134 ? 0.1780 0.1948 0.2366 0.0006  -0.0312 -0.0435 126 LYS B N   
2510 C  CA  . LYS B 134 ? 0.1831 0.2034 0.2446 0.0013  -0.0316 -0.0423 126 LYS B CA  
2511 C  C   . LYS B 134 ? 0.1828 0.2047 0.2380 0.0039  -0.0322 -0.0393 126 LYS B C   
2512 O  O   . LYS B 134 ? 0.1849 0.2064 0.2401 0.0046  -0.0310 -0.0364 126 LYS B O   
2513 C  CB  . LYS B 134 ? 0.1743 0.2007 0.2422 0.0009  -0.0345 -0.0464 126 LYS B CB  
2514 N  N   . SER B 135 ? 0.1878 0.2113 0.2378 0.0055  -0.0340 -0.0400 127 SER B N   
2515 C  CA  . SER B 135 ? 0.1912 0.2169 0.2360 0.0082  -0.0347 -0.0373 127 SER B CA  
2516 C  C   . SER B 135 ? 0.1865 0.2068 0.2272 0.0083  -0.0318 -0.0330 127 SER B C   
2517 O  O   . SER B 135 ? 0.1769 0.1977 0.2165 0.0097  -0.0312 -0.0302 127 SER B O   
2518 C  CB  . SER B 135 ? 0.2004 0.2290 0.2404 0.0100  -0.0370 -0.0389 127 SER B CB  
2519 O  OG  . SER B 135 ? 0.2020 0.2329 0.2374 0.0128  -0.0374 -0.0358 127 SER B OG  
2520 N  N   . PHE B 136 ? 0.1839 0.1991 0.2229 0.0068  -0.0300 -0.0328 128 PHE B N   
2521 C  CA  . PHE B 136 ? 0.1769 0.1872 0.2123 0.0067  -0.0274 -0.0292 128 PHE B CA  
2522 C  C   . PHE B 136 ? 0.1780 0.1862 0.2172 0.0055  -0.0253 -0.0278 128 PHE B C   
2523 O  O   . PHE B 136 ? 0.1715 0.1780 0.2086 0.0062  -0.0238 -0.0249 128 PHE B O   
2524 C  CB  . PHE B 136 ? 0.1743 0.1804 0.2067 0.0056  -0.0262 -0.0293 128 PHE B CB  
2525 C  CG  . PHE B 136 ? 0.1649 0.1666 0.1940 0.0054  -0.0238 -0.0260 128 PHE B CG  
2526 C  CD1 . PHE B 136 ? 0.1667 0.1685 0.1913 0.0070  -0.0237 -0.0236 128 PHE B CD1 
2527 C  CD2 . PHE B 136 ? 0.1602 0.1581 0.1910 0.0037  -0.0215 -0.0253 128 PHE B CD2 
2528 C  CE1 . PHE B 136 ? 0.1656 0.1635 0.1876 0.0066  -0.0217 -0.0211 128 PHE B CE1 
2529 C  CE2 . PHE B 136 ? 0.1638 0.1582 0.1915 0.0036  -0.0195 -0.0227 128 PHE B CE2 
2530 C  CZ  . PHE B 136 ? 0.1653 0.1597 0.1888 0.0049  -0.0197 -0.0208 128 PHE B CZ  
2531 N  N   . GLU B 137 ? 0.1814 0.1897 0.2263 0.0038  -0.0249 -0.0297 129 GLU B N   
2532 C  CA  . GLU B 137 ? 0.1918 0.1986 0.2406 0.0029  -0.0228 -0.0284 129 GLU B CA  
2533 C  C   . GLU B 137 ? 0.1935 0.2033 0.2433 0.0044  -0.0232 -0.0270 129 GLU B C   
2534 O  O   . GLU B 137 ? 0.1874 0.1950 0.2370 0.0046  -0.0211 -0.0246 129 GLU B O   
2535 C  CB  . GLU B 137 ? 0.2097 0.2173 0.2655 0.0010  -0.0226 -0.0309 129 GLU B CB  
2536 C  CG  . GLU B 137 ? 0.2332 0.2391 0.2930 0.0001  -0.0200 -0.0292 129 GLU B CG  
2537 C  CD  . GLU B 137 ? 0.2652 0.2718 0.3324 -0.0018 -0.0195 -0.0314 129 GLU B CD  
2538 O  OE1 . GLU B 137 ? 0.2989 0.3020 0.3672 -0.0031 -0.0177 -0.0314 129 GLU B OE1 
2539 O  OE2 . GLU B 137 ? 0.3372 0.3482 0.4097 -0.0018 -0.0210 -0.0331 129 GLU B OE2 
2540 N  N   . SER B 138 ? 0.1885 0.2036 0.2393 0.0057  -0.0260 -0.0285 130 SER B N   
2541 C  CA  . SER B 138 ? 0.1915 0.2102 0.2435 0.0075  -0.0266 -0.0271 130 SER B CA  
2542 C  C   . SER B 138 ? 0.1925 0.2090 0.2388 0.0093  -0.0255 -0.0236 130 SER B C   
2543 O  O   . SER B 138 ? 0.1924 0.2086 0.2396 0.0102  -0.0242 -0.0214 130 SER B O   
2544 C  CB  . SER B 138 ? 0.1882 0.2136 0.2418 0.0088  -0.0301 -0.0295 130 SER B CB  
2545 O  OG  . SER B 138 ? 0.1952 0.2242 0.2493 0.0110  -0.0306 -0.0276 130 SER B OG  
2546 N  N   . ALA B 139 ? 0.1929 0.2079 0.2338 0.0099  -0.0259 -0.0232 131 ALA B N   
2547 C  CA  . ALA B 139 ? 0.1960 0.2086 0.2322 0.0113  -0.0247 -0.0200 131 ALA B CA  
2548 C  C   . ALA B 139 ? 0.1967 0.2036 0.2323 0.0100  -0.0216 -0.0183 131 ALA B C   
2549 O  O   . ALA B 139 ? 0.2029 0.2083 0.2373 0.0110  -0.0203 -0.0159 131 ALA B O   
2550 C  CB  . ALA B 139 ? 0.2006 0.2130 0.2317 0.0120  -0.0256 -0.0200 131 ALA B CB  
2551 N  N   . VAL B 140 ? 0.1944 0.1984 0.2309 0.0079  -0.0205 -0.0194 132 VAL B N   
2552 C  CA  . VAL B 140 ? 0.1936 0.1930 0.2299 0.0068  -0.0177 -0.0180 132 VAL B CA  
2553 C  C   . VAL B 140 ? 0.1918 0.1921 0.2323 0.0070  -0.0166 -0.0174 132 VAL B C   
2554 O  O   . VAL B 140 ? 0.1961 0.1937 0.2354 0.0074  -0.0147 -0.0157 132 VAL B O   
2555 C  CB  . VAL B 140 ? 0.1987 0.1953 0.2353 0.0048  -0.0167 -0.0191 132 VAL B CB  
2556 C  CG1 . VAL B 140 ? 0.2011 0.1938 0.2370 0.0040  -0.0139 -0.0176 132 VAL B CG1 
2557 C  CG2 . VAL B 140 ? 0.2013 0.1967 0.2337 0.0046  -0.0175 -0.0195 132 VAL B CG2 
2558 N  N   . THR B 141 ? 0.1874 0.1914 0.2330 0.0068  -0.0177 -0.0191 133 THR B N   
2559 C  CA  . THR B 141 ? 0.1927 0.1978 0.2431 0.0068  -0.0165 -0.0186 133 THR B CA  
2560 C  C   . THR B 141 ? 0.1913 0.1982 0.2413 0.0090  -0.0167 -0.0168 133 THR B C   
2561 O  O   . THR B 141 ? 0.1853 0.1901 0.2359 0.0093  -0.0145 -0.0153 133 THR B O   
2562 C  CB  . THR B 141 ? 0.1969 0.2060 0.2538 0.0059  -0.0178 -0.0210 133 THR B CB  
2563 O  OG1 . THR B 141 ? 0.1965 0.2034 0.2542 0.0039  -0.0173 -0.0225 133 THR B OG1 
2564 C  CG2 . THR B 141 ? 0.2000 0.2101 0.2622 0.0058  -0.0162 -0.0203 133 THR B CG2 
2565 N  N   . ALA B 142 ? 0.1979 0.2083 0.2465 0.0106  -0.0190 -0.0169 134 ALA B N   
2566 C  CA  . ALA B 142 ? 0.1992 0.2113 0.2469 0.0131  -0.0191 -0.0147 134 ALA B CA  
2567 C  C   . ALA B 142 ? 0.2051 0.2120 0.2486 0.0135  -0.0167 -0.0122 134 ALA B C   
2568 O  O   . ALA B 142 ? 0.2039 0.2101 0.2483 0.0148  -0.0153 -0.0104 134 ALA B O   
2569 C  CB  . ALA B 142 ? 0.1962 0.2130 0.2420 0.0149  -0.0220 -0.0150 134 ALA B CB  
2570 N  N   . GLN B 143 ? 0.2121 0.2153 0.2512 0.0124  -0.0163 -0.0123 135 GLN B N   
2571 C  CA  . GLN B 143 ? 0.2168 0.2155 0.2521 0.0127  -0.0144 -0.0104 135 GLN B CA  
2572 C  C   . GLN B 143 ? 0.2069 0.2013 0.2428 0.0114  -0.0118 -0.0103 135 GLN B C   
2573 O  O   . GLN B 143 ? 0.2096 0.2013 0.2445 0.0121  -0.0100 -0.0089 135 GLN B O   
2574 C  CB  . GLN B 143 ? 0.2382 0.2351 0.2691 0.0119  -0.0150 -0.0106 135 GLN B CB  
2575 C  CG  . GLN B 143 ? 0.2610 0.2532 0.2885 0.0116  -0.0132 -0.0091 135 GLN B CG  
2576 C  CD  . GLN B 143 ? 0.2926 0.2853 0.3191 0.0137  -0.0130 -0.0068 135 GLN B CD  
2577 O  OE1 . GLN B 143 ? 0.3447 0.3406 0.3700 0.0151  -0.0147 -0.0063 135 GLN B OE1 
2578 N  NE2 . GLN B 143 ? 0.2985 0.2881 0.3254 0.0141  -0.0109 -0.0055 135 GLN B NE2 
2579 N  N   . PHE B 144 ? 0.1912 0.1849 0.2283 0.0096  -0.0114 -0.0119 136 PHE B N   
2580 C  CA  . PHE B 144 ? 0.1800 0.1698 0.2165 0.0084  -0.0089 -0.0118 136 PHE B CA  
2581 C  C   . PHE B 144 ? 0.1707 0.1617 0.2118 0.0083  -0.0077 -0.0121 136 PHE B C   
2582 O  O   . PHE B 144 ? 0.1693 0.1576 0.2102 0.0078  -0.0055 -0.0119 136 PHE B O   
2583 C  CB  . PHE B 144 ? 0.1760 0.1636 0.2098 0.0067  -0.0088 -0.0128 136 PHE B CB  
2584 C  CG  . PHE B 144 ? 0.1802 0.1660 0.2094 0.0067  -0.0095 -0.0123 136 PHE B CG  
2585 C  CD1 . PHE B 144 ? 0.1840 0.1662 0.2100 0.0065  -0.0080 -0.0116 136 PHE B CD1 
2586 C  CD2 . PHE B 144 ? 0.1786 0.1666 0.2068 0.0069  -0.0116 -0.0128 136 PHE B CD2 
2587 C  CE1 . PHE B 144 ? 0.1854 0.1664 0.2080 0.0063  -0.0086 -0.0111 136 PHE B CE1 
2588 C  CE2 . PHE B 144 ? 0.1779 0.1646 0.2022 0.0069  -0.0120 -0.0121 136 PHE B CE2 
2589 C  CZ  . PHE B 144 ? 0.1815 0.1647 0.2032 0.0066  -0.0105 -0.0112 136 PHE B CZ  
2590 N  N   . GLY B 145 ? 0.1638 0.1592 0.2094 0.0089  -0.0092 -0.0127 137 GLY B N   
2591 C  CA  . GLY B 145 ? 0.1585 0.1558 0.2095 0.0088  -0.0080 -0.0128 137 GLY B CA  
2592 C  C   . GLY B 145 ? 0.1558 0.1541 0.2101 0.0070  -0.0082 -0.0144 137 GLY B C   
2593 O  O   . GLY B 145 ? 0.1582 0.1604 0.2181 0.0069  -0.0090 -0.0152 137 GLY B O   
2594 N  N   . SER B 146 ? 0.1526 0.1478 0.2038 0.0056  -0.0076 -0.0148 138 SER B N   
2595 C  CA  . SER B 146 ? 0.1552 0.1509 0.2091 0.0040  -0.0078 -0.0162 138 SER B CA  
2596 C  C   . SER B 146 ? 0.1583 0.1509 0.2074 0.0031  -0.0079 -0.0164 138 SER B C   
2597 O  O   . SER B 146 ? 0.1560 0.1457 0.1998 0.0036  -0.0073 -0.0154 138 SER B O   
2598 C  CB  . SER B 146 ? 0.1574 0.1523 0.2153 0.0033  -0.0051 -0.0156 138 SER B CB  
2599 O  OG  . SER B 146 ? 0.1615 0.1524 0.2150 0.0037  -0.0026 -0.0141 138 SER B OG  
2600 N  N   . VAL B 147 ? 0.1556 0.1487 0.2067 0.0018  -0.0086 -0.0178 139 VAL B N   
2601 C  CA  . VAL B 147 ? 0.1611 0.1513 0.2081 0.0011  -0.0084 -0.0179 139 VAL B CA  
2602 C  C   . VAL B 147 ? 0.1608 0.1475 0.2050 0.0010  -0.0055 -0.0162 139 VAL B C   
2603 O  O   . VAL B 147 ? 0.1546 0.1389 0.1934 0.0011  -0.0054 -0.0155 139 VAL B O   
2604 C  CB  . VAL B 147 ? 0.1638 0.1548 0.2144 -0.0002 -0.0091 -0.0196 139 VAL B CB  
2605 C  CG1 . VAL B 147 ? 0.1628 0.1507 0.2094 -0.0008 -0.0084 -0.0193 139 VAL B CG1 
2606 C  CG2 . VAL B 147 ? 0.1671 0.1620 0.2197 0.0000  -0.0122 -0.0218 139 VAL B CG2 
2607 N  N   . GLU B 148 ? 0.1590 0.1455 0.2067 0.0008  -0.0033 -0.0154 140 GLU B N   
2608 C  CA  . GLU B 148 ? 0.1634 0.1470 0.2083 0.0010  -0.0005 -0.0139 140 GLU B CA  
2609 C  C   . GLU B 148 ? 0.1634 0.1454 0.2032 0.0021  -0.0002 -0.0132 140 GLU B C   
2610 O  O   . GLU B 148 ? 0.1596 0.1393 0.1947 0.0021  0.0008  -0.0126 140 GLU B O   
2611 C  CB  . GLU B 148 ? 0.1653 0.1493 0.2151 0.0008  0.0020  -0.0131 140 GLU B CB  
2612 C  CG  . GLU B 148 ? 0.1738 0.1581 0.2282 -0.0005 0.0025  -0.0135 140 GLU B CG  
2613 C  CD  . GLU B 148 ? 0.1876 0.1693 0.2380 -0.0008 0.0030  -0.0130 140 GLU B CD  
2614 O  OE1 . GLU B 148 ? 0.2001 0.1798 0.2454 -0.0001 0.0044  -0.0116 140 GLU B OE1 
2615 O  OE2 . GLU B 148 ? 0.1993 0.1813 0.2519 -0.0018 0.0019  -0.0141 140 GLU B OE2 
2616 N  N   . GLN B 149 ? 0.1589 0.1422 0.1996 0.0029  -0.0011 -0.0133 141 GLN B N   
2617 C  CA  . GLN B 149 ? 0.1610 0.1426 0.1976 0.0039  -0.0008 -0.0128 141 GLN B CA  
2618 C  C   . GLN B 149 ? 0.1554 0.1358 0.1874 0.0036  -0.0025 -0.0130 141 GLN B C   
2619 O  O   . GLN B 149 ? 0.1502 0.1281 0.1781 0.0037  -0.0018 -0.0128 141 GLN B O   
2620 C  CB  . GLN B 149 ? 0.1670 0.1504 0.2064 0.0051  -0.0012 -0.0125 141 GLN B CB  
2621 C  CG  . GLN B 149 ? 0.1801 0.1641 0.2233 0.0056  0.0010  -0.0120 141 GLN B CG  
2622 C  CD  . GLN B 149 ? 0.1907 0.1775 0.2381 0.0068  0.0006  -0.0117 141 GLN B CD  
2623 O  OE1 . GLN B 149 ? 0.1870 0.1774 0.2387 0.0067  -0.0012 -0.0122 141 GLN B OE1 
2624 N  NE2 . GLN B 149 ? 0.2008 0.1862 0.2473 0.0081  0.0022  -0.0109 141 GLN B NE2 
2625 N  N   . PHE B 150 ? 0.1484 0.1307 0.1813 0.0033  -0.0047 -0.0137 142 PHE B N   
2626 C  CA  . PHE B 150 ? 0.1448 0.1262 0.1736 0.0031  -0.0061 -0.0138 142 PHE B CA  
2627 C  C   . PHE B 150 ? 0.1459 0.1251 0.1717 0.0022  -0.0050 -0.0137 142 PHE B C   
2628 O  O   . PHE B 150 ? 0.1424 0.1198 0.1641 0.0022  -0.0050 -0.0134 142 PHE B O   
2629 C  CB  . PHE B 150 ? 0.1424 0.1264 0.1723 0.0031  -0.0085 -0.0147 142 PHE B CB  
2630 C  CG  . PHE B 150 ? 0.1413 0.1242 0.1675 0.0026  -0.0093 -0.0149 142 PHE B CG  
2631 C  CD1 . PHE B 150 ? 0.1427 0.1243 0.1650 0.0030  -0.0096 -0.0141 142 PHE B CD1 
2632 C  CD2 . PHE B 150 ? 0.1403 0.1233 0.1673 0.0017  -0.0095 -0.0157 142 PHE B CD2 
2633 C  CE1 . PHE B 150 ? 0.1457 0.1265 0.1648 0.0026  -0.0102 -0.0141 142 PHE B CE1 
2634 C  CE2 . PHE B 150 ? 0.1431 0.1251 0.1667 0.0014  -0.0101 -0.0157 142 PHE B CE2 
2635 C  CZ  . PHE B 150 ? 0.1455 0.1266 0.1652 0.0019  -0.0105 -0.0149 142 PHE B CZ  
2636 N  N   . LYS B 151 ? 0.1537 0.1331 0.1817 0.0016  -0.0042 -0.0139 143 LYS B N   
2637 C  CA  . LYS B 151 ? 0.1581 0.1357 0.1833 0.0010  -0.0032 -0.0134 143 LYS B CA  
2638 C  C   . LYS B 151 ? 0.1524 0.1282 0.1743 0.0014  -0.0015 -0.0127 143 LYS B C   
2639 O  O   . LYS B 151 ? 0.1523 0.1269 0.1701 0.0013  -0.0015 -0.0125 143 LYS B O   
2640 C  CB  . LYS B 151 ? 0.1677 0.1457 0.1967 0.0005  -0.0021 -0.0134 143 LYS B CB  
2641 C  CG  . LYS B 151 ? 0.1771 0.1564 0.2085 -0.0001 -0.0040 -0.0146 143 LYS B CG  
2642 C  CD  . LYS B 151 ? 0.1846 0.1638 0.2202 -0.0009 -0.0027 -0.0147 143 LYS B CD  
2643 C  CE  . LYS B 151 ? 0.1943 0.1745 0.2317 -0.0014 -0.0047 -0.0164 143 LYS B CE  
2644 N  NZ  . LYS B 151 ? 0.2095 0.1896 0.2525 -0.0023 -0.0037 -0.0171 143 LYS B NZ  
2645 N  N   . ASP B 152 ? 0.1495 0.1252 0.1731 0.0020  0.0000  -0.0124 144 ASP B N   
2646 C  CA  . ASP B 152 ? 0.1479 0.1221 0.1684 0.0025  0.0018  -0.0122 144 ASP B CA  
2647 C  C   . ASP B 152 ? 0.1442 0.1170 0.1609 0.0025  0.0007  -0.0128 144 ASP B C   
2648 O  O   . ASP B 152 ? 0.1376 0.1094 0.1505 0.0024  0.0011  -0.0130 144 ASP B O   
2649 C  CB  . ASP B 152 ? 0.1562 0.1307 0.1796 0.0033  0.0035  -0.0119 144 ASP B CB  
2650 C  CG  . ASP B 152 ? 0.1646 0.1375 0.1846 0.0040  0.0053  -0.0120 144 ASP B CG  
2651 O  OD1 . ASP B 152 ? 0.1762 0.1486 0.1937 0.0042  0.0067  -0.0116 144 ASP B OD1 
2652 O  OD2 . ASP B 152 ? 0.1705 0.1426 0.1903 0.0046  0.0054  -0.0125 144 ASP B OD2 
2653 N  N   . ALA B 153 ? 0.1413 0.1146 0.1594 0.0027  -0.0006 -0.0129 145 ALA B N   
2654 C  CA  . ALA B 153 ? 0.1364 0.1084 0.1518 0.0027  -0.0014 -0.0132 145 ALA B CA  
2655 C  C   . ALA B 153 ? 0.1318 0.1037 0.1443 0.0019  -0.0027 -0.0133 145 ALA B C   
2656 O  O   . ALA B 153 ? 0.1337 0.1042 0.1433 0.0016  -0.0027 -0.0137 145 ALA B O   
2657 C  CB  . ALA B 153 ? 0.1342 0.1070 0.1519 0.0035  -0.0023 -0.0129 145 ALA B CB  
2658 N  N   . PHE B 154 ? 0.1276 0.1009 0.1410 0.0016  -0.0037 -0.0131 146 PHE B N   
2659 C  CA  . PHE B 154 ? 0.1256 0.0990 0.1365 0.0010  -0.0049 -0.0131 146 PHE B CA  
2660 C  C   . PHE B 154 ? 0.1271 0.0997 0.1351 0.0007  -0.0038 -0.0130 146 PHE B C   
2661 O  O   . PHE B 154 ? 0.1248 0.0969 0.1299 0.0003  -0.0043 -0.0132 146 PHE B O   
2662 C  CB  . PHE B 154 ? 0.1224 0.0974 0.1352 0.0010  -0.0061 -0.0131 146 PHE B CB  
2663 C  CG  . PHE B 154 ? 0.1192 0.0945 0.1297 0.0006  -0.0073 -0.0131 146 PHE B CG  
2664 C  CD1 . PHE B 154 ? 0.1169 0.0932 0.1270 0.0009  -0.0088 -0.0130 146 PHE B CD1 
2665 C  CD2 . PHE B 154 ? 0.1201 0.0949 0.1288 0.0002  -0.0067 -0.0128 146 PHE B CD2 
2666 C  CE1 . PHE B 154 ? 0.1154 0.0920 0.1235 0.0008  -0.0097 -0.0129 146 PHE B CE1 
2667 C  CE2 . PHE B 154 ? 0.1185 0.0936 0.1252 0.0001  -0.0077 -0.0126 146 PHE B CE2 
2668 C  CZ  . PHE B 154 ? 0.1156 0.0916 0.1222 0.0003  -0.0092 -0.0127 146 PHE B CZ  
2669 N  N   . VAL B 155 ? 0.1301 0.1028 0.1391 0.0009  -0.0024 -0.0127 147 VAL B N   
2670 C  CA  . VAL B 155 ? 0.1308 0.1032 0.1369 0.0010  -0.0011 -0.0124 147 VAL B CA  
2671 C  C   . VAL B 155 ? 0.1366 0.1081 0.1398 0.0011  -0.0007 -0.0133 147 VAL B C   
2672 O  O   . VAL B 155 ? 0.1407 0.1123 0.1405 0.0009  -0.0010 -0.0136 147 VAL B O   
2673 C  CB  . VAL B 155 ? 0.1322 0.1049 0.1403 0.0016  0.0008  -0.0116 147 VAL B CB  
2674 C  CG1 . VAL B 155 ? 0.1345 0.1072 0.1392 0.0022  0.0023  -0.0110 147 VAL B CG1 
2675 C  CG2 . VAL B 155 ? 0.1299 0.1033 0.1413 0.0013  0.0006  -0.0110 147 VAL B CG2 
2676 N  N   . GLN B 156 ? 0.1360 0.1065 0.1404 0.0015  -0.0001 -0.0138 148 GLN B N   
2677 C  CA  . GLN B 156 ? 0.1384 0.1076 0.1404 0.0015  0.0003  -0.0151 148 GLN B CA  
2678 C  C   . GLN B 156 ? 0.1381 0.1070 0.1384 0.0006  -0.0013 -0.0157 148 GLN B C   
2679 O  O   . GLN B 156 ? 0.1391 0.1077 0.1365 0.0002  -0.0014 -0.0168 148 GLN B O   
2680 C  CB  . GLN B 156 ? 0.1361 0.1042 0.1405 0.0020  0.0011  -0.0154 148 GLN B CB  
2681 N  N   . ALA B 157 ? 0.1360 0.1050 0.1381 0.0003  -0.0026 -0.0151 149 ALA B N   
2682 C  CA  . ALA B 157 ? 0.1379 0.1067 0.1390 -0.0005 -0.0038 -0.0153 149 ALA B CA  
2683 C  C   . ALA B 157 ? 0.1372 0.1073 0.1358 -0.0010 -0.0046 -0.0152 149 ALA B C   
2684 O  O   . ALA B 157 ? 0.1370 0.1071 0.1340 -0.0017 -0.0051 -0.0160 149 ALA B O   
2685 C  CB  . ALA B 157 ? 0.1380 0.1073 0.1414 -0.0002 -0.0049 -0.0143 149 ALA B CB  
2686 N  N   . GLY B 158 ? 0.1354 0.1068 0.1343 -0.0006 -0.0046 -0.0143 150 GLY B N   
2687 C  CA  . GLY B 158 ? 0.1341 0.1068 0.1309 -0.0009 -0.0051 -0.0139 150 GLY B CA  
2688 C  C   . GLY B 158 ? 0.1369 0.1100 0.1307 -0.0008 -0.0044 -0.0146 150 GLY B C   
2689 O  O   . GLY B 158 ? 0.1357 0.1098 0.1274 -0.0012 -0.0053 -0.0150 150 GLY B O   
2690 N  N   . VAL B 159 ? 0.1402 0.1129 0.1338 0.0000  -0.0029 -0.0148 151 VAL B N   
2691 C  CA  . VAL B 159 ? 0.1419 0.1154 0.1323 0.0004  -0.0021 -0.0156 151 VAL B CA  
2692 C  C   . VAL B 159 ? 0.1458 0.1188 0.1347 -0.0004 -0.0029 -0.0177 151 VAL B C   
2693 O  O   . VAL B 159 ? 0.1508 0.1254 0.1369 -0.0005 -0.0035 -0.0187 151 VAL B O   
2694 C  CB  . VAL B 159 ? 0.1408 0.1139 0.1315 0.0015  -0.0001 -0.0153 151 VAL B CB  
2695 C  CG1 . VAL B 159 ? 0.1457 0.1198 0.1324 0.0022  0.0006  -0.0165 151 VAL B CG1 
2696 C  CG2 . VAL B 159 ? 0.1371 0.1109 0.1294 0.0023  0.0010  -0.0132 151 VAL B CG2 
2697 N  N   . ASN B 160 ? 0.1459 0.1168 0.1370 -0.0009 -0.0030 -0.0185 152 ASN B N   
2698 C  CA  . ASN B 160 ? 0.1502 0.1201 0.1407 -0.0018 -0.0034 -0.0207 152 ASN B CA  
2699 C  C   . ASN B 160 ? 0.1472 0.1173 0.1387 -0.0031 -0.0050 -0.0207 152 ASN B C   
2700 O  O   . ASN B 160 ? 0.1433 0.1122 0.1354 -0.0041 -0.0053 -0.0223 152 ASN B O   
2701 C  CB  . ASN B 160 ? 0.1570 0.1243 0.1497 -0.0016 -0.0023 -0.0214 152 ASN B CB  
2702 C  CG  . ASN B 160 ? 0.1630 0.1300 0.1550 -0.0003 -0.0005 -0.0216 152 ASN B CG  
2703 O  OD1 . ASN B 160 ? 0.1695 0.1375 0.1585 0.0002  0.0000  -0.0228 152 ASN B OD1 
2704 N  ND2 . ASN B 160 ? 0.1649 0.1309 0.1597 0.0004  0.0004  -0.0205 152 ASN B ND2 
2705 N  N   . ASN B 161 ? 0.1405 0.1120 0.1324 -0.0031 -0.0058 -0.0189 153 ASN B N   
2706 C  CA  . ASN B 161 ? 0.1380 0.1101 0.1306 -0.0041 -0.0071 -0.0186 153 ASN B CA  
2707 C  C   . ASN B 161 ? 0.1359 0.1101 0.1263 -0.0047 -0.0080 -0.0197 153 ASN B C   
2708 O  O   . ASN B 161 ? 0.1345 0.1110 0.1231 -0.0042 -0.0084 -0.0188 153 ASN B O   
2709 C  CB  . ASN B 161 ? 0.1395 0.1125 0.1331 -0.0036 -0.0077 -0.0164 153 ASN B CB  
2710 C  CG  . ASN B 161 ? 0.1412 0.1142 0.1363 -0.0043 -0.0086 -0.0158 153 ASN B CG  
2711 O  OD1 . ASN B 161 ? 0.1453 0.1178 0.1409 -0.0053 -0.0088 -0.0168 153 ASN B OD1 
2712 N  ND2 . ASN B 161 ? 0.1464 0.1200 0.1422 -0.0038 -0.0090 -0.0142 153 ASN B ND2 
2713 N  N   . PHE B 162 ? 0.1336 0.1073 0.1244 -0.0058 -0.0083 -0.0218 154 PHE B N   
2714 C  CA  . PHE B 162 ? 0.1312 0.1073 0.1198 -0.0064 -0.0092 -0.0236 154 PHE B CA  
2715 C  C   . PHE B 162 ? 0.1278 0.1064 0.1168 -0.0071 -0.0106 -0.0226 154 PHE B C   
2716 O  O   . PHE B 162 ? 0.1240 0.1018 0.1157 -0.0079 -0.0109 -0.0218 154 PHE B O   
2717 C  CB  . PHE B 162 ? 0.1328 0.1076 0.1222 -0.0076 -0.0092 -0.0268 154 PHE B CB  
2718 C  CG  . PHE B 162 ? 0.1344 0.1123 0.1214 -0.0080 -0.0103 -0.0292 154 PHE B CG  
2719 C  CD1 . PHE B 162 ? 0.1349 0.1146 0.1180 -0.0066 -0.0100 -0.0297 154 PHE B CD1 
2720 C  CD2 . PHE B 162 ? 0.1348 0.1139 0.1233 -0.0097 -0.0116 -0.0309 154 PHE B CD2 
2721 C  CE1 . PHE B 162 ? 0.1393 0.1224 0.1197 -0.0066 -0.0111 -0.0320 154 PHE B CE1 
2722 C  CE2 . PHE B 162 ? 0.1386 0.1212 0.1250 -0.0101 -0.0129 -0.0333 154 PHE B CE2 
2723 C  CZ  . PHE B 162 ? 0.1403 0.1251 0.1224 -0.0084 -0.0128 -0.0340 154 PHE B CZ  
2724 N  N   . GLY B 163 ? 0.1264 0.1083 0.1128 -0.0064 -0.0113 -0.0224 155 GLY B N   
2725 C  CA  . GLY B 163 ? 0.1249 0.1098 0.1115 -0.0068 -0.0125 -0.0214 155 GLY B CA  
2726 C  C   . GLY B 163 ? 0.1218 0.1064 0.1090 -0.0059 -0.0122 -0.0184 155 GLY B C   
2727 O  O   . GLY B 163 ? 0.1216 0.1049 0.1082 -0.0047 -0.0111 -0.0172 155 GLY B O   
2728 N  N   . SER B 164 ? 0.1178 0.1037 0.1064 -0.0064 -0.0130 -0.0174 156 SER B N   
2729 C  CA  . SER B 164 ? 0.1145 0.1002 0.1037 -0.0056 -0.0128 -0.0149 156 SER B CA  
2730 C  C   . SER B 164 ? 0.1139 0.0966 0.1055 -0.0058 -0.0123 -0.0145 156 SER B C   
2731 O  O   . SER B 164 ? 0.1111 0.0925 0.1044 -0.0069 -0.0122 -0.0154 156 SER B O   
2732 C  CB  . SER B 164 ? 0.1137 0.1022 0.1033 -0.0058 -0.0137 -0.0139 156 SER B CB  
2733 O  OG  . SER B 164 ? 0.1146 0.1065 0.1023 -0.0054 -0.0144 -0.0143 156 SER B OG  
2734 N  N   . GLY B 165 ? 0.1133 0.0951 0.1050 -0.0048 -0.0118 -0.0130 157 GLY B N   
2735 C  CA  . GLY B 165 ? 0.1122 0.0920 0.1058 -0.0047 -0.0115 -0.0124 157 GLY B CA  
2736 C  C   . GLY B 165 ? 0.1107 0.0898 0.1043 -0.0035 -0.0111 -0.0115 157 GLY B C   
2737 O  O   . GLY B 165 ? 0.1098 0.0898 0.1024 -0.0028 -0.0110 -0.0109 157 GLY B O   
2738 N  N   . TRP B 166 ? 0.1082 0.0858 0.1034 -0.0033 -0.0109 -0.0114 158 TRP B N   
2739 C  CA  . TRP B 166 ? 0.1026 0.0799 0.0984 -0.0023 -0.0108 -0.0108 158 TRP B CA  
2740 C  C   . TRP B 166 ? 0.1041 0.0798 0.1013 -0.0021 -0.0103 -0.0113 158 TRP B C   
2741 O  O   . TRP B 166 ? 0.1045 0.0792 0.1024 -0.0025 -0.0101 -0.0115 158 TRP B O   
2742 C  CB  . TRP B 166 ? 0.0994 0.0776 0.0957 -0.0018 -0.0115 -0.0098 158 TRP B CB  
2743 C  CG  . TRP B 166 ? 0.0970 0.0768 0.0923 -0.0018 -0.0119 -0.0092 158 TRP B CG  
2744 C  CD1 . TRP B 166 ? 0.0964 0.0771 0.0916 -0.0026 -0.0121 -0.0088 158 TRP B CD1 
2745 C  CD2 . TRP B 166 ? 0.0946 0.0754 0.0892 -0.0011 -0.0121 -0.0088 158 TRP B CD2 
2746 N  NE1 . TRP B 166 ? 0.0943 0.0768 0.0887 -0.0022 -0.0124 -0.0081 158 TRP B NE1 
2747 C  CE2 . TRP B 166 ? 0.0943 0.0767 0.0881 -0.0012 -0.0123 -0.0080 158 TRP B CE2 
2748 C  CE3 . TRP B 166 ? 0.0939 0.0744 0.0888 -0.0003 -0.0119 -0.0090 158 TRP B CE3 
2749 C  CZ2 . TRP B 166 ? 0.0935 0.0771 0.0866 -0.0004 -0.0124 -0.0074 158 TRP B CZ2 
2750 C  CZ3 . TRP B 166 ? 0.0942 0.0754 0.0886 0.0004  -0.0120 -0.0086 158 TRP B CZ3 
2751 C  CH2 . TRP B 166 ? 0.0952 0.0779 0.0886 0.0004  -0.0121 -0.0077 158 TRP B CH2 
2752 N  N   . THR B 167 ? 0.1029 0.0785 0.1009 -0.0014 -0.0100 -0.0115 159 THR B N   
2753 C  CA  . THR B 167 ? 0.1044 0.0790 0.1042 -0.0011 -0.0096 -0.0117 159 THR B CA  
2754 C  C   . THR B 167 ? 0.1029 0.0786 0.1040 -0.0002 -0.0104 -0.0114 159 THR B C   
2755 O  O   . THR B 167 ? 0.1019 0.0784 0.1031 0.0000  -0.0107 -0.0115 159 THR B O   
2756 C  CB  . THR B 167 ? 0.1053 0.0792 0.1052 -0.0010 -0.0085 -0.0124 159 THR B CB  
2757 O  OG1 . THR B 167 ? 0.1081 0.0813 0.1063 -0.0016 -0.0079 -0.0130 159 THR B OG1 
2758 C  CG2 . THR B 167 ? 0.1044 0.0777 0.1067 -0.0005 -0.0080 -0.0126 159 THR B CG2 
2759 N  N   . TRP B 168 ? 0.1024 0.0781 0.1047 0.0003  -0.0106 -0.0110 160 TRP B N   
2760 C  CA  . TRP B 168 ? 0.1030 0.0803 0.1061 0.0014  -0.0116 -0.0108 160 TRP B CA  
2761 C  C   . TRP B 168 ? 0.1034 0.0812 0.1088 0.0021  -0.0117 -0.0110 160 TRP B C   
2762 O  O   . TRP B 168 ? 0.1028 0.0794 0.1090 0.0021  -0.0108 -0.0108 160 TRP B O   
2763 C  CB  . TRP B 168 ? 0.1035 0.0815 0.1057 0.0019  -0.0120 -0.0095 160 TRP B CB  
2764 C  CG  . TRP B 168 ? 0.1030 0.0809 0.1035 0.0012  -0.0120 -0.0090 160 TRP B CG  
2765 C  CD1 . TRP B 168 ? 0.1038 0.0804 0.1040 0.0002  -0.0113 -0.0090 160 TRP B CD1 
2766 C  CD2 . TRP B 168 ? 0.1030 0.0824 0.1022 0.0016  -0.0127 -0.0086 160 TRP B CD2 
2767 N  NE1 . TRP B 168 ? 0.1030 0.0805 0.1020 -0.0002 -0.0116 -0.0084 160 TRP B NE1 
2768 C  CE2 . TRP B 168 ? 0.1033 0.0824 0.1016 0.0007  -0.0123 -0.0081 160 TRP B CE2 
2769 C  CE3 . TRP B 168 ? 0.1015 0.0826 0.1003 0.0027  -0.0135 -0.0089 160 TRP B CE3 
2770 C  CZ2 . TRP B 168 ? 0.1024 0.0829 0.0996 0.0010  -0.0127 -0.0075 160 TRP B CZ2 
2771 C  CZ3 . TRP B 168 ? 0.1023 0.0844 0.0996 0.0029  -0.0138 -0.0085 160 TRP B CZ3 
2772 C  CH2 . TRP B 168 ? 0.1029 0.0847 0.0994 0.0021  -0.0133 -0.0076 160 TRP B CH2 
2773 N  N   . LEU B 169 ? 0.1029 0.0827 0.1093 0.0029  -0.0127 -0.0114 161 LEU B N   
2774 C  CA  . LEU B 169 ? 0.1063 0.0876 0.1147 0.0040  -0.0133 -0.0114 161 LEU B CA  
2775 C  C   . LEU B 169 ? 0.1099 0.0934 0.1172 0.0053  -0.0144 -0.0107 161 LEU B C   
2776 O  O   . LEU B 169 ? 0.1111 0.0957 0.1171 0.0055  -0.0153 -0.0112 161 LEU B O   
2777 C  CB  . LEU B 169 ? 0.1041 0.0868 0.1152 0.0039  -0.0138 -0.0129 161 LEU B CB  
2778 C  CG  . LEU B 169 ? 0.1031 0.0883 0.1167 0.0050  -0.0147 -0.0132 161 LEU B CG  
2779 C  CD1 . LEU B 169 ? 0.1066 0.0908 0.1214 0.0054  -0.0135 -0.0122 161 LEU B CD1 
2780 C  CD2 . LEU B 169 ? 0.1020 0.0886 0.1188 0.0045  -0.0152 -0.0150 161 LEU B CD2 
2781 N  N   . CYS B 170 ? 0.1154 0.0994 0.1229 0.0065  -0.0142 -0.0092 162 CYS B N   
2782 C  CA  . CYS B 170 ? 0.1188 0.1048 0.1249 0.0081  -0.0149 -0.0078 162 CYS B CA  
2783 C  C   . CYS B 170 ? 0.1208 0.1092 0.1283 0.0100  -0.0156 -0.0072 162 CYS B C   
2784 O  O   . CYS B 170 ? 0.1212 0.1091 0.1310 0.0100  -0.0150 -0.0073 162 CYS B O   
2785 C  CB  . CYS B 170 ? 0.1208 0.1046 0.1257 0.0079  -0.0136 -0.0059 162 CYS B CB  
2786 S  SG  . CYS B 170 ? 0.1268 0.1084 0.1301 0.0059  -0.0130 -0.0064 162 CYS B SG  
2787 N  N   . VAL B 171 ? 0.1247 0.1162 0.1308 0.0118  -0.0167 -0.0065 163 VAL B N   
2788 C  CA  . VAL B 171 ? 0.1302 0.1246 0.1369 0.0141  -0.0172 -0.0051 163 VAL B CA  
2789 C  C   . VAL B 171 ? 0.1367 0.1295 0.1427 0.0150  -0.0155 -0.0019 163 VAL B C   
2790 O  O   . VAL B 171 ? 0.1329 0.1243 0.1370 0.0145  -0.0148 -0.0010 163 VAL B O   
2791 C  CB  . VAL B 171 ? 0.1319 0.1309 0.1370 0.0159  -0.0192 -0.0058 163 VAL B CB  
2792 C  CG1 . VAL B 171 ? 0.1336 0.1360 0.1383 0.0189  -0.0196 -0.0036 163 VAL B CG1 
2793 C  CG2 . VAL B 171 ? 0.1320 0.1328 0.1388 0.0150  -0.0209 -0.0092 163 VAL B CG2 
2794 N  N   . ASP B 172 ? 0.1427 0.1354 0.1505 0.0163  -0.0147 -0.0003 164 ASP B N   
2795 C  CA  . ASP B 172 ? 0.1571 0.1483 0.1650 0.0173  -0.0129 0.0028  164 ASP B CA  
2796 C  C   . ASP B 172 ? 0.1656 0.1609 0.1729 0.0207  -0.0135 0.0051  164 ASP B C   
2797 O  O   . ASP B 172 ? 0.1660 0.1629 0.1753 0.0221  -0.0136 0.0057  164 ASP B O   
2798 C  CB  . ASP B 172 ? 0.1673 0.1547 0.1778 0.0164  -0.0111 0.0032  164 ASP B CB  
2799 C  CG  . ASP B 172 ? 0.1743 0.1593 0.1856 0.0173  -0.0089 0.0062  164 ASP B CG  
2800 O  OD1 . ASP B 172 ? 0.1816 0.1680 0.1917 0.0188  -0.0086 0.0086  164 ASP B OD1 
2801 O  OD2 . ASP B 172 ? 0.1854 0.1669 0.1988 0.0164  -0.0073 0.0062  164 ASP B OD2 
2802 N  N   . PRO B 173 ? 0.1737 0.1711 0.1784 0.0221  -0.0137 0.0067  165 PRO B N   
2803 C  CA  . PRO B 173 ? 0.1849 0.1870 0.1885 0.0257  -0.0143 0.0090  165 PRO B CA  
2804 C  C   . PRO B 173 ? 0.1949 0.1957 0.2004 0.0275  -0.0122 0.0127  165 PRO B C   
2805 O  O   . PRO B 173 ? 0.1948 0.1993 0.2005 0.0304  -0.0127 0.0143  165 PRO B O   
2806 C  CB  . PRO B 173 ? 0.1851 0.1886 0.1853 0.0266  -0.0143 0.0101  165 PRO B CB  
2807 C  CG  . PRO B 173 ? 0.1838 0.1829 0.1841 0.0235  -0.0133 0.0090  165 PRO B CG  
2808 C  CD  . PRO B 173 ? 0.1773 0.1734 0.1799 0.0207  -0.0135 0.0062  165 PRO B CD  
2809 N  N   . SER B 174 ? 0.2132 0.2088 0.2207 0.0258  -0.0097 0.0138  166 SER B N   
2810 C  CA  . SER B 174 ? 0.2343 0.2280 0.2443 0.0274  -0.0074 0.0173  166 SER B CA  
2811 C  C   . SER B 174 ? 0.2480 0.2413 0.2608 0.0276  -0.0074 0.0164  166 SER B C   
2812 O  O   . SER B 174 ? 0.2580 0.2497 0.2731 0.0291  -0.0055 0.0190  166 SER B O   
2813 C  CB  . SER B 174 ? 0.2313 0.2194 0.2429 0.0254  -0.0047 0.0185  166 SER B CB  
2814 O  OG  . SER B 174 ? 0.2401 0.2242 0.2535 0.0223  -0.0044 0.0155  166 SER B OG  
2815 N  N   . ASN B 175 ? 0.2629 0.2576 0.2757 0.0262  -0.0095 0.0128  167 ASN B N   
2816 C  CA  . ASN B 175 ? 0.2706 0.2648 0.2863 0.0259  -0.0094 0.0116  167 ASN B CA  
2817 C  C   . ASN B 175 ? 0.2471 0.2466 0.2628 0.0267  -0.0122 0.0095  167 ASN B C   
2818 O  O   . ASN B 175 ? 0.2369 0.2359 0.2539 0.0248  -0.0130 0.0065  167 ASN B O   
2819 C  CB  . ASN B 175 ? 0.2955 0.2845 0.3122 0.0225  -0.0084 0.0091  167 ASN B CB  
2820 C  CG  . ASN B 175 ? 0.3424 0.3267 0.3616 0.0223  -0.0057 0.0105  167 ASN B CG  
2821 O  OD1 . ASN B 175 ? 0.3966 0.3813 0.4181 0.0238  -0.0050 0.0115  167 ASN B OD1 
2822 N  ND2 . ASN B 175 ? 0.3596 0.3396 0.3786 0.0205  -0.0040 0.0107  167 ASN B ND2 
2823 N  N   . LYS B 176 ? 0.2500 0.2549 0.2643 0.0297  -0.0136 0.0109  168 LYS B N   
2824 C  CA  . LYS B 176 ? 0.2452 0.2560 0.2595 0.0307  -0.0166 0.0087  168 LYS B CA  
2825 C  C   . LYS B 176 ? 0.2173 0.2279 0.2310 0.0278  -0.0183 0.0045  168 LYS B C   
2826 O  O   . LYS B 176 ? 0.2072 0.2200 0.2231 0.0271  -0.0199 0.0019  168 LYS B O   
2827 C  CB  . LYS B 176 ? 0.2703 0.2826 0.2883 0.0317  -0.0166 0.0089  168 LYS B CB  
2828 C  CG  . LYS B 176 ? 0.3000 0.3117 0.3190 0.0346  -0.0144 0.0134  168 LYS B CG  
2829 C  CD  . LYS B 176 ? 0.3216 0.3375 0.3437 0.0370  -0.0150 0.0143  168 LYS B CD  
2830 C  CE  . LYS B 176 ? 0.3396 0.3528 0.3653 0.0346  -0.0144 0.0119  168 LYS B CE  
2831 N  NZ  . LYS B 176 ? 0.3651 0.3722 0.3925 0.0345  -0.0110 0.0142  168 LYS B NZ  
2832 N  N   . ASN B 177 ? 0.1985 0.2063 0.2096 0.0262  -0.0179 0.0041  169 ASN B N   
2833 C  CA  . ASN B 177 ? 0.1902 0.1976 0.2005 0.0237  -0.0192 0.0005  169 ASN B CA  
2834 C  C   . ASN B 177 ? 0.1810 0.1853 0.1942 0.0210  -0.0188 -0.0019 169 ASN B C   
2835 O  O   . ASN B 177 ? 0.1640 0.1691 0.1777 0.0194  -0.0201 -0.0049 169 ASN B O   
2836 C  CB  . ASN B 177 ? 0.1881 0.2014 0.1974 0.0252  -0.0221 -0.0016 169 ASN B CB  
2837 C  CG  . ASN B 177 ? 0.1912 0.2075 0.1966 0.0278  -0.0225 0.0003  169 ASN B CG  
2838 O  OD1 . ASN B 177 ? 0.1989 0.2123 0.2024 0.0279  -0.0207 0.0028  169 ASN B OD1 
2839 N  ND2 . ASN B 177 ? 0.1889 0.2111 0.1933 0.0300  -0.0249 -0.0008 169 ASN B ND2 
2840 N  N   . GLN B 178 ? 0.1724 0.1733 0.1877 0.0205  -0.0168 -0.0006 170 GLN B N   
2841 C  CA  . GLN B 178 ? 0.1673 0.1653 0.1850 0.0182  -0.0160 -0.0025 170 GLN B CA  
2842 C  C   . GLN B 178 ? 0.1632 0.1580 0.1792 0.0156  -0.0157 -0.0043 170 GLN B C   
2843 O  O   . GLN B 178 ? 0.1625 0.1554 0.1759 0.0152  -0.0151 -0.0033 170 GLN B O   
2844 C  CB  . GLN B 178 ? 0.1655 0.1599 0.1849 0.0183  -0.0136 -0.0008 170 GLN B CB  
2845 N  N   . LEU B 179 ? 0.1597 0.1542 0.1774 0.0138  -0.0160 -0.0066 171 LEU B N   
2846 C  CA  . LEU B 179 ? 0.1574 0.1488 0.1739 0.0115  -0.0155 -0.0081 171 LEU B CA  
2847 C  C   . LEU B 179 ? 0.1593 0.1464 0.1757 0.0104  -0.0133 -0.0073 171 LEU B C   
2848 O  O   . LEU B 179 ? 0.1640 0.1502 0.1825 0.0108  -0.0122 -0.0069 171 LEU B O   
2849 C  CB  . LEU B 179 ? 0.1534 0.1459 0.1722 0.0103  -0.0162 -0.0105 171 LEU B CB  
2850 C  CG  . LEU B 179 ? 0.1563 0.1528 0.1752 0.0109  -0.0185 -0.0121 171 LEU B CG  
2851 C  CD1 . LEU B 179 ? 0.1560 0.1539 0.1788 0.0099  -0.0191 -0.0144 171 LEU B CD1 
2852 C  CD2 . LEU B 179 ? 0.1560 0.1512 0.1717 0.0101  -0.0188 -0.0126 171 LEU B CD2 
2853 N  N   . VAL B 180 ? 0.1600 0.1444 0.1740 0.0091  -0.0126 -0.0073 172 VAL B N   
2854 C  CA  . VAL B 180 ? 0.1573 0.1378 0.1710 0.0081  -0.0107 -0.0069 172 VAL B CA  
2855 C  C   . VAL B 180 ? 0.1488 0.1274 0.1606 0.0061  -0.0105 -0.0082 172 VAL B C   
2856 O  O   . VAL B 180 ? 0.1438 0.1235 0.1540 0.0059  -0.0115 -0.0084 172 VAL B O   
2857 C  CB  . VAL B 180 ? 0.1644 0.1437 0.1777 0.0091  -0.0098 -0.0047 172 VAL B CB  
2858 C  CG1 . VAL B 180 ? 0.1607 0.1401 0.1716 0.0088  -0.0103 -0.0041 172 VAL B CG1 
2859 C  CG2 . VAL B 180 ? 0.1758 0.1512 0.1899 0.0083  -0.0078 -0.0048 172 VAL B CG2 
2860 N  N   . ILE B 181 ? 0.1414 0.1175 0.1534 0.0050  -0.0092 -0.0090 173 ILE B N   
2861 C  CA  . ILE B 181 ? 0.1361 0.1108 0.1461 0.0035  -0.0089 -0.0100 173 ILE B CA  
2862 C  C   . ILE B 181 ? 0.1340 0.1067 0.1426 0.0028  -0.0083 -0.0095 173 ILE B C   
2863 O  O   . ILE B 181 ? 0.1316 0.1026 0.1412 0.0031  -0.0073 -0.0090 173 ILE B O   
2864 C  CB  . ILE B 181 ? 0.1374 0.1109 0.1480 0.0028  -0.0078 -0.0112 173 ILE B CB  
2865 C  CG1 . ILE B 181 ? 0.1384 0.1140 0.1513 0.0032  -0.0083 -0.0116 173 ILE B CG1 
2866 C  CG2 . ILE B 181 ? 0.1397 0.1120 0.1478 0.0015  -0.0075 -0.0119 173 ILE B CG2 
2867 C  CD1 . ILE B 181 ? 0.1389 0.1137 0.1531 0.0029  -0.0069 -0.0122 173 ILE B CD1 
2868 N  N   . ASP B 182 ? 0.1314 0.1044 0.1381 0.0020  -0.0089 -0.0096 174 ASP B N   
2869 C  CA  . ASP B 182 ? 0.1306 0.1022 0.1364 0.0012  -0.0084 -0.0092 174 ASP B CA  
2870 C  C   . ASP B 182 ? 0.1301 0.1016 0.1340 -0.0001 -0.0087 -0.0102 174 ASP B C   
2871 O  O   . ASP B 182 ? 0.1308 0.1039 0.1336 -0.0001 -0.0095 -0.0103 174 ASP B O   
2872 C  CB  . ASP B 182 ? 0.1285 0.1015 0.1343 0.0021  -0.0090 -0.0075 174 ASP B CB  
2873 C  CG  . ASP B 182 ? 0.1307 0.1022 0.1368 0.0014  -0.0082 -0.0067 174 ASP B CG  
2874 O  OD1 . ASP B 182 ? 0.1373 0.1065 0.1450 0.0013  -0.0070 -0.0065 174 ASP B OD1 
2875 O  OD2 . ASP B 182 ? 0.1309 0.1033 0.1359 0.0010  -0.0087 -0.0061 174 ASP B OD2 
2876 N  N   . ASN B 183 ? 0.1286 0.0985 0.1322 -0.0012 -0.0080 -0.0111 175 ASN B N   
2877 C  CA  . ASN B 183 ? 0.1243 0.0947 0.1261 -0.0024 -0.0083 -0.0120 175 ASN B CA  
2878 C  C   . ASN B 183 ? 0.1224 0.0930 0.1245 -0.0031 -0.0086 -0.0114 175 ASN B C   
2879 O  O   . ASN B 183 ? 0.1239 0.0930 0.1277 -0.0033 -0.0079 -0.0110 175 ASN B O   
2880 C  CB  . ASN B 183 ? 0.1243 0.0932 0.1257 -0.0031 -0.0075 -0.0138 175 ASN B CB  
2881 C  CG  . ASN B 183 ? 0.1237 0.0930 0.1240 -0.0026 -0.0071 -0.0144 175 ASN B CG  
2882 O  OD1 . ASN B 183 ? 0.1219 0.0924 0.1223 -0.0019 -0.0075 -0.0136 175 ASN B OD1 
2883 N  ND2 . ASN B 183 ? 0.1254 0.0937 0.1248 -0.0029 -0.0063 -0.0159 175 ASN B ND2 
2884 N  N   . THR B 184 ? 0.1182 0.0906 0.1189 -0.0034 -0.0094 -0.0111 176 THR B N   
2885 C  CA  . THR B 184 ? 0.1187 0.0918 0.1198 -0.0043 -0.0096 -0.0107 176 THR B CA  
2886 C  C   . THR B 184 ? 0.1206 0.0949 0.1203 -0.0054 -0.0101 -0.0120 176 THR B C   
2887 O  O   . THR B 184 ? 0.1225 0.0976 0.1204 -0.0051 -0.0104 -0.0126 176 THR B O   
2888 C  CB  . THR B 184 ? 0.1158 0.0907 0.1168 -0.0034 -0.0101 -0.0088 176 THR B CB  
2889 O  OG1 . THR B 184 ? 0.1124 0.0889 0.1116 -0.0028 -0.0109 -0.0088 176 THR B OG1 
2890 C  CG2 . THR B 184 ? 0.1158 0.0902 0.1180 -0.0021 -0.0097 -0.0073 176 THR B CG2 
2891 N  N   . SER B 185 ? 0.1211 0.0957 0.1219 -0.0066 -0.0103 -0.0124 177 SER B N   
2892 C  CA  . SER B 185 ? 0.1207 0.0971 0.1205 -0.0077 -0.0110 -0.0137 177 SER B CA  
2893 C  C   . SER B 185 ? 0.1169 0.0960 0.1167 -0.0077 -0.0117 -0.0123 177 SER B C   
2894 O  O   . SER B 185 ? 0.1163 0.0953 0.1179 -0.0076 -0.0114 -0.0108 177 SER B O   
2895 C  CB  . SER B 185 ? 0.1242 0.0996 0.1261 -0.0094 -0.0107 -0.0156 177 SER B CB  
2896 O  OG  . SER B 185 ? 0.1260 0.1039 0.1273 -0.0105 -0.0117 -0.0171 177 SER B OG  
2897 N  N   . ASN B 186 ? 0.1161 0.0974 0.1139 -0.0076 -0.0124 -0.0126 178 ASN B N   
2898 C  CA  . ASN B 186 ? 0.1136 0.0977 0.1114 -0.0075 -0.0130 -0.0115 178 ASN B CA  
2899 C  C   . ASN B 186 ? 0.1136 0.0977 0.1113 -0.0062 -0.0128 -0.0093 178 ASN B C   
2900 O  O   . ASN B 186 ? 0.1111 0.0949 0.1072 -0.0049 -0.0127 -0.0090 178 ASN B O   
2901 C  CB  . ASN B 186 ? 0.1147 0.1001 0.1149 -0.0092 -0.0134 -0.0122 178 ASN B CB  
2902 C  CG  . ASN B 186 ? 0.1160 0.1026 0.1155 -0.0103 -0.0141 -0.0147 178 ASN B CG  
2903 O  OD1 . ASN B 186 ? 0.1171 0.1041 0.1138 -0.0095 -0.0143 -0.0154 178 ASN B OD1 
2904 N  ND2 . ASN B 186 ? 0.1172 0.1049 0.1193 -0.0120 -0.0145 -0.0159 178 ASN B ND2 
2905 N  N   . ALA B 187 ? 0.1145 0.0991 0.1140 -0.0063 -0.0126 -0.0080 179 ALA B N   
2906 C  CA  . ALA B 187 ? 0.1161 0.1011 0.1152 -0.0048 -0.0123 -0.0061 179 ALA B CA  
2907 C  C   . ALA B 187 ? 0.1187 0.1017 0.1187 -0.0041 -0.0116 -0.0054 179 ALA B C   
2908 O  O   . ALA B 187 ? 0.1150 0.0985 0.1145 -0.0027 -0.0115 -0.0040 179 ALA B O   
2909 C  CB  . ALA B 187 ? 0.1166 0.1038 0.1167 -0.0049 -0.0123 -0.0047 179 ALA B CB  
2910 N  N   . GLY B 188 ? 0.1241 0.1049 0.1251 -0.0049 -0.0112 -0.0065 180 GLY B N   
2911 C  CA  . GLY B 188 ? 0.1295 0.1085 0.1318 -0.0042 -0.0105 -0.0056 180 GLY B CA  
2912 C  C   . GLY B 188 ? 0.1333 0.1127 0.1340 -0.0023 -0.0108 -0.0049 180 GLY B C   
2913 O  O   . GLY B 188 ? 0.1338 0.1133 0.1330 -0.0020 -0.0113 -0.0060 180 GLY B O   
2914 N  N   . CYS B 189 ? 0.1381 0.1178 0.1394 -0.0011 -0.0103 -0.0031 181 CYS B N   
2915 C  CA  . CYS B 189 ? 0.1447 0.1258 0.1444 0.0008  -0.0108 -0.0025 181 CYS B CA  
2916 C  C   . CYS B 189 ? 0.1468 0.1272 0.1475 0.0021  -0.0103 -0.0013 181 CYS B C   
2917 O  O   . CYS B 189 ? 0.1418 0.1220 0.1440 0.0024  -0.0093 0.0006  181 CYS B O   
2918 C  CB  . CYS B 189 ? 0.1474 0.1307 0.1460 0.0017  -0.0110 -0.0012 181 CYS B CB  
2919 S  SG  . CYS B 189 ? 0.1504 0.1358 0.1467 0.0040  -0.0118 -0.0011 181 CYS B SG  
2920 N  N   . PRO B 190 ? 0.1533 0.1335 0.1536 0.0029  -0.0108 -0.0022 182 PRO B N   
2921 C  CA  . PRO B 190 ? 0.1547 0.1344 0.1562 0.0041  -0.0104 -0.0013 182 PRO B CA  
2922 C  C   . PRO B 190 ? 0.1575 0.1388 0.1588 0.0061  -0.0099 0.0013  182 PRO B C   
2923 O  O   . PRO B 190 ? 0.1566 0.1371 0.1595 0.0069  -0.0090 0.0028  182 PRO B O   
2924 C  CB  . PRO B 190 ? 0.1565 0.1371 0.1573 0.0048  -0.0115 -0.0029 182 PRO B CB  
2925 C  CG  . PRO B 190 ? 0.1549 0.1349 0.1550 0.0033  -0.0119 -0.0048 182 PRO B CG  
2926 C  CD  . PRO B 190 ? 0.1538 0.1343 0.1530 0.0026  -0.0118 -0.0042 182 PRO B CD  
2927 N  N   . LEU B 191 ? 0.1585 0.1423 0.1580 0.0071  -0.0105 0.0019  183 LEU B N   
2928 C  CA  . LEU B 191 ? 0.1659 0.1517 0.1647 0.0094  -0.0100 0.0045  183 LEU B CA  
2929 C  C   . LEU B 191 ? 0.1666 0.1509 0.1677 0.0090  -0.0081 0.0070  183 LEU B C   
2930 O  O   . LEU B 191 ? 0.1613 0.1463 0.1628 0.0109  -0.0071 0.0096  183 LEU B O   
2931 C  CB  . LEU B 191 ? 0.1699 0.1585 0.1662 0.0105  -0.0107 0.0046  183 LEU B CB  
2932 C  CG  . LEU B 191 ? 0.1760 0.1644 0.1724 0.0093  -0.0100 0.0052  183 LEU B CG  
2933 C  CD1 . LEU B 191 ? 0.1768 0.1661 0.1740 0.0103  -0.0084 0.0085  183 LEU B CD1 
2934 C  CD2 . LEU B 191 ? 0.1760 0.1662 0.1700 0.0097  -0.0111 0.0037  183 LEU B CD2 
2935 N  N   . THR B 192 ? 0.1665 0.1487 0.1695 0.0066  -0.0074 0.0063  184 THR B N   
2936 C  CA  . THR B 192 ? 0.1708 0.1513 0.1769 0.0058  -0.0056 0.0083  184 THR B CA  
2937 C  C   . THR B 192 ? 0.1808 0.1588 0.1891 0.0062  -0.0045 0.0087  184 THR B C   
2938 O  O   . THR B 192 ? 0.1800 0.1566 0.1911 0.0063  -0.0027 0.0109  184 THR B O   
2939 C  CB  . THR B 192 ? 0.1707 0.1498 0.1785 0.0030  -0.0054 0.0068  184 THR B CB  
2940 O  OG1 . THR B 192 ? 0.1634 0.1405 0.1715 0.0014  -0.0060 0.0040  184 THR B OG1 
2941 C  CG2 . THR B 192 ? 0.1692 0.1509 0.1752 0.0028  -0.0063 0.0065  184 THR B CG2 
2942 N  N   . LYS B 193 ? 0.1828 0.1602 0.1902 0.0063  -0.0055 0.0068  185 LYS B N   
2943 C  CA  . LYS B 193 ? 0.1882 0.1638 0.1975 0.0070  -0.0047 0.0072  185 LYS B CA  
2944 C  C   . LYS B 193 ? 0.1836 0.1617 0.1917 0.0100  -0.0050 0.0092  185 LYS B C   
2945 O  O   . LYS B 193 ? 0.1879 0.1649 0.1976 0.0111  -0.0042 0.0100  185 LYS B O   
2946 C  CB  . LYS B 193 ? 0.1919 0.1662 0.2007 0.0058  -0.0056 0.0042  185 LYS B CB  
2947 C  CG  . LYS B 193 ? 0.1978 0.1691 0.2082 0.0033  -0.0050 0.0021  185 LYS B CG  
2948 C  CD  . LYS B 193 ? 0.2019 0.1722 0.2119 0.0030  -0.0056 -0.0002 185 LYS B CD  
2949 C  CE  . LYS B 193 ? 0.2005 0.1689 0.2107 0.0006  -0.0055 -0.0028 185 LYS B CE  
2950 N  NZ  . LYS B 193 ? 0.2020 0.1723 0.2099 -0.0003 -0.0069 -0.0039 185 LYS B NZ  
2951 N  N   . GLY B 194 ? 0.1755 0.1571 0.1808 0.0116  -0.0061 0.0097  186 GLY B N   
2952 C  CA  . GLY B 194 ? 0.1753 0.1601 0.1791 0.0145  -0.0069 0.0109  186 GLY B CA  
2953 C  C   . GLY B 194 ? 0.1723 0.1584 0.1749 0.0146  -0.0090 0.0080  186 GLY B C   
2954 O  O   . GLY B 194 ? 0.1848 0.1741 0.1866 0.0169  -0.0100 0.0085  186 GLY B O   
2955 N  N   . LEU B 195 ? 0.1583 0.1426 0.1612 0.0122  -0.0096 0.0052  187 LEU B N   
2956 C  CA  . LEU B 195 ? 0.1516 0.1370 0.1542 0.0119  -0.0112 0.0025  187 LEU B CA  
2957 C  C   . LEU B 195 ? 0.1479 0.1357 0.1480 0.0121  -0.0128 0.0010  187 LEU B C   
2958 O  O   . LEU B 195 ? 0.1510 0.1387 0.1499 0.0115  -0.0126 0.0013  187 LEU B O   
2959 C  CB  . LEU B 195 ? 0.1493 0.1314 0.1533 0.0095  -0.0108 0.0005  187 LEU B CB  
2960 C  CG  . LEU B 195 ? 0.1491 0.1285 0.1555 0.0092  -0.0092 0.0012  187 LEU B CG  
2961 C  CD1 . LEU B 195 ? 0.1462 0.1228 0.1533 0.0070  -0.0089 -0.0012 187 LEU B CD1 
2962 C  CD2 . LEU B 195 ? 0.1484 0.1294 0.1560 0.0113  -0.0094 0.0021  187 LEU B CD2 
2963 N  N   . ARG B 196 ? 0.1446 0.1347 0.1445 0.0129  -0.0144 -0.0008 188 ARG B N   
2964 C  CA  . ARG B 196 ? 0.1427 0.1351 0.1408 0.0131  -0.0160 -0.0028 188 ARG B CA  
2965 C  C   . ARG B 196 ? 0.1388 0.1299 0.1383 0.0112  -0.0166 -0.0056 188 ARG B C   
2966 O  O   . ARG B 196 ? 0.1345 0.1262 0.1357 0.0112  -0.0172 -0.0069 188 ARG B O   
2967 C  CB  . ARG B 196 ? 0.1464 0.1431 0.1437 0.0157  -0.0175 -0.0028 188 ARG B CB  
2968 C  CG  . ARG B 196 ? 0.1525 0.1510 0.1483 0.0182  -0.0167 0.0004  188 ARG B CG  
2969 C  CD  . ARG B 196 ? 0.1615 0.1646 0.1565 0.0210  -0.0182 0.0005  188 ARG B CD  
2970 N  NE  . ARG B 196 ? 0.1734 0.1783 0.1666 0.0236  -0.0171 0.0041  188 ARG B NE  
2971 C  CZ  . ARG B 196 ? 0.1815 0.1911 0.1727 0.0268  -0.0181 0.0051  188 ARG B CZ  
2972 N  NH1 . ARG B 196 ? 0.1768 0.1901 0.1676 0.0277  -0.0205 0.0023  188 ARG B NH1 
2973 N  NH2 . ARG B 196 ? 0.1857 0.1964 0.1754 0.0291  -0.0166 0.0088  188 ARG B NH2 
2974 N  N   . PRO B 197 ? 0.1337 0.1230 0.1323 0.0096  -0.0163 -0.0065 189 PRO B N   
2975 C  CA  . PRO B 197 ? 0.1313 0.1191 0.1312 0.0079  -0.0164 -0.0086 189 PRO B CA  
2976 C  C   . PRO B 197 ? 0.1285 0.1183 0.1292 0.0083  -0.0178 -0.0108 189 PRO B C   
2977 O  O   . PRO B 197 ? 0.1314 0.1234 0.1305 0.0096  -0.0188 -0.0114 189 PRO B O   
2978 C  CB  . PRO B 197 ? 0.1319 0.1182 0.1304 0.0067  -0.0157 -0.0084 189 PRO B CB  
2979 C  CG  . PRO B 197 ? 0.1338 0.1218 0.1303 0.0081  -0.0158 -0.0070 189 PRO B CG  
2980 C  CD  . PRO B 197 ? 0.1346 0.1237 0.1314 0.0095  -0.0156 -0.0052 189 PRO B CD  
2981 N  N   . VAL B 198 ? 0.1249 0.1139 0.1280 0.0074  -0.0178 -0.0123 190 VAL B N   
2982 C  CA  . VAL B 198 ? 0.1231 0.1135 0.1279 0.0072  -0.0188 -0.0147 190 VAL B CA  
2983 C  C   . VAL B 198 ? 0.1216 0.1095 0.1276 0.0055  -0.0179 -0.0157 190 VAL B C   
2984 O  O   . VAL B 198 ? 0.1194 0.1077 0.1267 0.0052  -0.0184 -0.0176 190 VAL B O   
2985 C  CB  . VAL B 198 ? 0.1272 0.1197 0.1347 0.0078  -0.0198 -0.0156 190 VAL B CB  
2986 C  CG1 . VAL B 198 ? 0.1303 0.1257 0.1364 0.0099  -0.0206 -0.0143 190 VAL B CG1 
2987 C  CG2 . VAL B 198 ? 0.1269 0.1175 0.1369 0.0068  -0.0185 -0.0152 190 VAL B CG2 
2988 N  N   . LEU B 199 ? 0.1150 0.1003 0.1207 0.0045  -0.0164 -0.0144 191 LEU B N   
2989 C  CA  . LEU B 199 ? 0.1112 0.0944 0.1175 0.0031  -0.0153 -0.0147 191 LEU B CA  
2990 C  C   . LEU B 199 ? 0.1082 0.0897 0.1123 0.0025  -0.0142 -0.0132 191 LEU B C   
2991 O  O   . LEU B 199 ? 0.1070 0.0880 0.1107 0.0026  -0.0138 -0.0122 191 LEU B O   
2992 C  CB  . LEU B 199 ? 0.1104 0.0930 0.1199 0.0025  -0.0146 -0.0154 191 LEU B CB  
2993 C  CG  . LEU B 199 ? 0.1105 0.0911 0.1207 0.0015  -0.0130 -0.0152 191 LEU B CG  
2994 C  CD1 . LEU B 199 ? 0.1088 0.0889 0.1194 0.0012  -0.0128 -0.0158 191 LEU B CD1 
2995 C  CD2 . LEU B 199 ? 0.1105 0.0909 0.1238 0.0012  -0.0122 -0.0155 191 LEU B CD2 
2996 N  N   . ALA B 200 ? 0.1066 0.0872 0.1095 0.0020  -0.0137 -0.0130 192 ALA B N   
2997 C  CA  . ALA B 200 ? 0.1058 0.0852 0.1069 0.0014  -0.0128 -0.0119 192 ALA B CA  
2998 C  C   . ALA B 200 ? 0.1095 0.0879 0.1110 0.0008  -0.0117 -0.0120 192 ALA B C   
2999 O  O   . ALA B 200 ? 0.1102 0.0886 0.1127 0.0010  -0.0116 -0.0125 192 ALA B O   
3000 C  CB  . ALA B 200 ? 0.1069 0.0872 0.1060 0.0017  -0.0132 -0.0111 192 ALA B CB  
3001 N  N   . VAL B 201 ? 0.1080 0.0855 0.1087 0.0002  -0.0108 -0.0116 193 VAL B N   
3002 C  CA  . VAL B 201 ? 0.1087 0.0857 0.1089 0.0000  -0.0097 -0.0112 193 VAL B CA  
3003 C  C   . VAL B 201 ? 0.1102 0.0876 0.1078 -0.0003 -0.0097 -0.0106 193 VAL B C   
3004 O  O   . VAL B 201 ? 0.1067 0.0838 0.1037 -0.0008 -0.0098 -0.0108 193 VAL B O   
3005 C  CB  . VAL B 201 ? 0.1105 0.0866 0.1124 -0.0001 -0.0086 -0.0115 193 VAL B CB  
3006 C  CG1 . VAL B 201 ? 0.1117 0.0875 0.1125 0.0000  -0.0072 -0.0107 193 VAL B CG1 
3007 C  CG2 . VAL B 201 ? 0.1102 0.0864 0.1153 0.0001  -0.0087 -0.0122 193 VAL B CG2 
3008 N  N   . ASP B 202 ? 0.1095 0.0876 0.1059 -0.0001 -0.0097 -0.0099 194 ASP B N   
3009 C  CA  . ASP B 202 ? 0.1069 0.0862 0.1012 -0.0004 -0.0099 -0.0094 194 ASP B CA  
3010 C  C   . ASP B 202 ? 0.1072 0.0864 0.1005 -0.0005 -0.0090 -0.0095 194 ASP B C   
3011 O  O   . ASP B 202 ? 0.1049 0.0837 0.0985 0.0001  -0.0080 -0.0091 194 ASP B O   
3012 C  CB  . ASP B 202 ? 0.1071 0.0873 0.1008 0.0003  -0.0099 -0.0085 194 ASP B CB  
3013 C  CG  . ASP B 202 ? 0.1084 0.0906 0.1004 0.0001  -0.0105 -0.0079 194 ASP B CG  
3014 O  OD1 . ASP B 202 ? 0.1058 0.0885 0.0972 -0.0007 -0.0109 -0.0084 194 ASP B OD1 
3015 O  OD2 . ASP B 202 ? 0.1130 0.0962 0.1047 0.0007  -0.0104 -0.0070 194 ASP B OD2 
3016 N  N   . VAL B 203 ? 0.1087 0.0882 0.1009 -0.0012 -0.0094 -0.0102 195 VAL B N   
3017 C  CA  . VAL B 203 ? 0.1111 0.0911 0.1016 -0.0011 -0.0087 -0.0106 195 VAL B CA  
3018 C  C   . VAL B 203 ? 0.1121 0.0944 0.1006 -0.0014 -0.0095 -0.0107 195 VAL B C   
3019 O  O   . VAL B 203 ? 0.1154 0.0986 0.1021 -0.0014 -0.0093 -0.0115 195 VAL B O   
3020 C  CB  . VAL B 203 ? 0.1136 0.0920 0.1046 -0.0015 -0.0082 -0.0118 195 VAL B CB  
3021 C  CG1 . VAL B 203 ? 0.1133 0.0902 0.1063 -0.0009 -0.0073 -0.0115 195 VAL B CG1 
3022 C  CG2 . VAL B 203 ? 0.1144 0.0920 0.1063 -0.0025 -0.0090 -0.0128 195 VAL B CG2 
3023 N  N   . TRP B 204 ? 0.1123 0.0958 0.1010 -0.0015 -0.0104 -0.0100 196 TRP B N   
3024 C  CA  . TRP B 204 ? 0.1118 0.0982 0.0990 -0.0014 -0.0110 -0.0097 196 TRP B CA  
3025 C  C   . TRP B 204 ? 0.1108 0.0981 0.0964 -0.0001 -0.0100 -0.0086 196 TRP B C   
3026 O  O   . TRP B 204 ? 0.1094 0.0952 0.0959 0.0008  -0.0089 -0.0075 196 TRP B O   
3027 C  CB  . TRP B 204 ? 0.1112 0.0988 0.0991 -0.0013 -0.0116 -0.0086 196 TRP B CB  
3028 C  CG  . TRP B 204 ? 0.1134 0.1010 0.1028 -0.0025 -0.0125 -0.0091 196 TRP B CG  
3029 C  CD1 . TRP B 204 ? 0.1142 0.0997 0.1051 -0.0030 -0.0124 -0.0095 196 TRP B CD1 
3030 C  CD2 . TRP B 204 ? 0.1154 0.1056 0.1051 -0.0032 -0.0134 -0.0091 196 TRP B CD2 
3031 N  NE1 . TRP B 204 ? 0.1147 0.1009 0.1069 -0.0039 -0.0130 -0.0095 196 TRP B NE1 
3032 C  CE2 . TRP B 204 ? 0.1167 0.1058 0.1084 -0.0041 -0.0136 -0.0093 196 TRP B CE2 
3033 C  CE3 . TRP B 204 ? 0.1166 0.1102 0.1055 -0.0030 -0.0140 -0.0087 196 TRP B CE3 
3034 C  CZ2 . TRP B 204 ? 0.1176 0.1086 0.1108 -0.0051 -0.0142 -0.0092 196 TRP B CZ2 
3035 C  CZ3 . TRP B 204 ? 0.1198 0.1156 0.1102 -0.0040 -0.0149 -0.0088 196 TRP B CZ3 
3036 C  CH2 . TRP B 204 ? 0.1172 0.1116 0.1099 -0.0051 -0.0149 -0.0090 196 TRP B CH2 
3037 N  N   . GLU B 205 ? 0.1112 0.1009 0.0946 0.0002  -0.0103 -0.0090 197 GLU B N   
3038 C  CA  . GLU B 205 ? 0.1123 0.1031 0.0939 0.0018  -0.0091 -0.0077 197 GLU B CA  
3039 C  C   . GLU B 205 ? 0.1128 0.1040 0.0950 0.0031  -0.0084 -0.0053 197 GLU B C   
3040 O  O   . GLU B 205 ? 0.1141 0.1045 0.0963 0.0044  -0.0067 -0.0038 197 GLU B O   
3041 C  CB  . GLU B 205 ? 0.1160 0.1103 0.0948 0.0021  -0.0098 -0.0086 197 GLU B CB  
3042 C  CG  . GLU B 205 ? 0.1172 0.1107 0.0953 0.0011  -0.0101 -0.0112 197 GLU B CG  
3043 C  CD  . GLU B 205 ? 0.1200 0.1171 0.0951 0.0015  -0.0110 -0.0126 197 GLU B CD  
3044 O  OE1 . GLU B 205 ? 0.1195 0.1198 0.0944 0.0010  -0.0125 -0.0131 197 GLU B OE1 
3045 O  OE2 . GLU B 205 ? 0.1217 0.1187 0.0947 0.0023  -0.0101 -0.0134 197 GLU B OE2 
3046 N  N   . HIS B 206 ? 0.1122 0.1045 0.0952 0.0028  -0.0094 -0.0049 198 HIS B N   
3047 C  CA  . HIS B 206 ? 0.1154 0.1078 0.0992 0.0041  -0.0086 -0.0028 198 HIS B CA  
3048 C  C   . HIS B 206 ? 0.1136 0.1026 0.0996 0.0043  -0.0073 -0.0024 198 HIS B C   
3049 O  O   . HIS B 206 ? 0.1179 0.1064 0.1047 0.0055  -0.0063 -0.0008 198 HIS B O   
3050 C  CB  . HIS B 206 ? 0.1148 0.1091 0.0992 0.0038  -0.0098 -0.0025 198 HIS B CB  
3051 C  CG  . HIS B 206 ? 0.1136 0.1060 0.0997 0.0025  -0.0105 -0.0036 198 HIS B CG  
3052 N  ND1 . HIS B 206 ? 0.1140 0.1079 0.1005 0.0013  -0.0118 -0.0045 198 HIS B ND1 
3053 C  CD2 . HIS B 206 ? 0.1148 0.1044 0.1026 0.0024  -0.0101 -0.0039 198 HIS B CD2 
3054 C  CE1 . HIS B 206 ? 0.1123 0.1043 0.1003 0.0007  -0.0120 -0.0049 198 HIS B CE1 
3055 N  NE2 . HIS B 206 ? 0.1129 0.1024 0.1014 0.0014  -0.0111 -0.0047 198 HIS B NE2 
3056 N  N   . ALA B 207 ? 0.1108 0.0974 0.0980 0.0032  -0.0074 -0.0039 199 ALA B N   
3057 C  CA  . ALA B 207 ? 0.1095 0.0933 0.0993 0.0033  -0.0065 -0.0039 199 ALA B CA  
3058 C  C   . ALA B 207 ? 0.1103 0.0930 0.1008 0.0043  -0.0045 -0.0028 199 ALA B C   
3059 O  O   . ALA B 207 ? 0.1128 0.0937 0.1056 0.0047  -0.0034 -0.0023 199 ALA B O   
3060 C  CB  . ALA B 207 ? 0.1065 0.0886 0.0975 0.0021  -0.0073 -0.0057 199 ALA B CB  
3061 N  N   . TYR B 208 ? 0.1126 0.0965 0.1010 0.0047  -0.0040 -0.0025 200 TYR B N   
3062 C  CA  . TYR B 208 ? 0.1125 0.0957 0.1014 0.0057  -0.0019 -0.0012 200 TYR B CA  
3063 C  C   . TYR B 208 ? 0.1168 0.1025 0.1028 0.0074  -0.0009 0.0007  200 TYR B C   
3064 O  O   . TYR B 208 ? 0.1200 0.1051 0.1065 0.0086  0.0013  0.0024  200 TYR B O   
3065 C  CB  . TYR B 208 ? 0.1110 0.0929 0.1003 0.0049  -0.0017 -0.0027 200 TYR B CB  
3066 C  CG  . TYR B 208 ? 0.1103 0.0937 0.0967 0.0044  -0.0029 -0.0043 200 TYR B CG  
3067 C  CD1 . TYR B 208 ? 0.1115 0.0969 0.0949 0.0054  -0.0023 -0.0039 200 TYR B CD1 
3068 C  CD2 . TYR B 208 ? 0.1096 0.0923 0.0966 0.0028  -0.0046 -0.0063 200 TYR B CD2 
3069 C  CE1 . TYR B 208 ? 0.1133 0.1000 0.0943 0.0047  -0.0035 -0.0059 200 TYR B CE1 
3070 C  CE2 . TYR B 208 ? 0.1083 0.0919 0.0933 0.0022  -0.0055 -0.0079 200 TYR B CE2 
3071 C  CZ  . TYR B 208 ? 0.1115 0.0971 0.0937 0.0030  -0.0051 -0.0080 200 TYR B CZ  
3072 O  OH  . TYR B 208 ? 0.1123 0.0986 0.0928 0.0022  -0.0061 -0.0102 200 TYR B OH  
3073 N  N   . TYR B 209 ? 0.1175 0.1062 0.1008 0.0076  -0.0023 0.0006  201 TYR B N   
3074 C  CA  . TYR B 209 ? 0.1209 0.1130 0.1010 0.0093  -0.0018 0.0020  201 TYR B CA  
3075 C  C   . TYR B 209 ? 0.1248 0.1174 0.1052 0.0115  0.0002  0.0053  201 TYR B C   
3076 O  O   . TYR B 209 ? 0.1273 0.1216 0.1055 0.0133  0.0016  0.0070  201 TYR B O   
3077 C  CB  . TYR B 209 ? 0.1210 0.1168 0.0984 0.0089  -0.0042 0.0007  201 TYR B CB  
3078 C  CG  . TYR B 209 ? 0.1217 0.1206 0.0954 0.0098  -0.0043 0.0001  201 TYR B CG  
3079 C  CD1 . TYR B 209 ? 0.1206 0.1188 0.0934 0.0085  -0.0050 -0.0026 201 TYR B CD1 
3080 C  CD2 . TYR B 209 ? 0.1238 0.1264 0.0948 0.0121  -0.0036 0.0023  201 TYR B CD2 
3081 C  CE1 . TYR B 209 ? 0.1231 0.1241 0.0924 0.0094  -0.0051 -0.0036 201 TYR B CE1 
3082 C  CE2 . TYR B 209 ? 0.1264 0.1322 0.0936 0.0132  -0.0038 0.0016  201 TYR B CE2 
3083 C  CZ  . TYR B 209 ? 0.1260 0.1310 0.0923 0.0118  -0.0046 -0.0015 201 TYR B CZ  
3084 O  OH  . TYR B 209 ? 0.1290 0.1372 0.0913 0.0129  -0.0049 -0.0027 201 TYR B OH  
3085 N  N   . LYS B 210 ? 0.1262 0.1171 0.1092 0.0115  0.0005  0.0062  202 LYS B N   
3086 C  CA  . LYS B 210 ? 0.1304 0.1212 0.1144 0.0136  0.0028  0.0095  202 LYS B CA  
3087 C  C   . LYS B 210 ? 0.1322 0.1203 0.1183 0.0143  0.0056  0.0109  202 LYS B C   
3088 O  O   . LYS B 210 ? 0.1407 0.1300 0.1259 0.0165  0.0077  0.0137  202 LYS B O   
3089 C  CB  . LYS B 210 ? 0.1292 0.1185 0.1157 0.0135  0.0026  0.0097  202 LYS B CB  
3090 C  CG  . LYS B 210 ? 0.1322 0.1201 0.1211 0.0154  0.0053  0.0128  202 LYS B CG  
3091 C  CD  . LYS B 210 ? 0.1369 0.1282 0.1231 0.0181  0.0065  0.0161  202 LYS B CD  
3092 C  CE  . LYS B 210 ? 0.1374 0.1326 0.1214 0.0187  0.0046  0.0164  202 LYS B CE  
3093 N  NZ  . LYS B 210 ? 0.1430 0.1413 0.1253 0.0217  0.0061  0.0201  202 LYS B NZ  
3094 N  N   . ASP B 211 ? 0.1284 0.1132 0.1176 0.0126  0.0057  0.0090  203 ASP B N   
3095 C  CA  . ASP B 211 ? 0.1291 0.1112 0.1215 0.0128  0.0083  0.0100  203 ASP B CA  
3096 C  C   . ASP B 211 ? 0.1300 0.1130 0.1206 0.0128  0.0087  0.0095  203 ASP B C   
3097 O  O   . ASP B 211 ? 0.1328 0.1149 0.1249 0.0138  0.0113  0.0113  203 ASP B O   
3098 C  CB  . ASP B 211 ? 0.1257 0.1043 0.1230 0.0109  0.0080  0.0080  203 ASP B CB  
3099 C  CG  . ASP B 211 ? 0.1258 0.1029 0.1255 0.0113  0.0083  0.0086  203 ASP B CG  
3100 O  OD1 . ASP B 211 ? 0.1284 0.1067 0.1271 0.0131  0.0095  0.0112  203 ASP B OD1 
3101 O  OD2 . ASP B 211 ? 0.1214 0.0965 0.1241 0.0098  0.0073  0.0064  203 ASP B OD2 
3102 N  N   . PHE B 212 ? 0.1280 0.1125 0.1156 0.0117  0.0064  0.0070  204 PHE B N   
3103 C  CA  . PHE B 212 ? 0.1281 0.1130 0.1143 0.0116  0.0068  0.0060  204 PHE B CA  
3104 C  C   . PHE B 212 ? 0.1306 0.1191 0.1115 0.0125  0.0058  0.0055  204 PHE B C   
3105 O  O   . PHE B 212 ? 0.1331 0.1221 0.1123 0.0129  0.0065  0.0049  204 PHE B O   
3106 C  CB  . PHE B 212 ? 0.1257 0.1084 0.1140 0.0094  0.0053  0.0030  204 PHE B CB  
3107 C  CG  . PHE B 212 ? 0.1238 0.1035 0.1173 0.0085  0.0062  0.0030  204 PHE B CG  
3108 C  CD1 . PHE B 212 ? 0.1261 0.1042 0.1224 0.0086  0.0083  0.0036  204 PHE B CD1 
3109 C  CD2 . PHE B 212 ? 0.1228 0.1012 0.1185 0.0076  0.0051  0.0023  204 PHE B CD2 
3110 C  CE1 . PHE B 212 ? 0.1237 0.0994 0.1254 0.0076  0.0091  0.0032  204 PHE B CE1 
3111 C  CE2 . PHE B 212 ? 0.1221 0.0981 0.1228 0.0068  0.0058  0.0018  204 PHE B CE2 
3112 C  CZ  . PHE B 212 ? 0.1210 0.0957 0.1249 0.0067  0.0077  0.0022  204 PHE B CZ  
3113 N  N   . GLU B 213 ? 0.1324 0.1237 0.1108 0.0131  0.0043  0.0058  205 GLU B N   
3114 C  CA  . GLU B 213 ? 0.1327 0.1280 0.1064 0.0136  0.0027  0.0047  205 GLU B CA  
3115 C  C   . GLU B 213 ? 0.1333 0.1276 0.1066 0.0116  0.0011  0.0010  205 GLU B C   
3116 O  O   . GLU B 213 ? 0.1254 0.1172 0.1014 0.0096  -0.0001 -0.0007 205 GLU B O   
3117 C  CB  . GLU B 213 ? 0.1369 0.1350 0.1075 0.0165  0.0048  0.0072  205 GLU B CB  
3118 C  CG  . GLU B 213 ? 0.1377 0.1371 0.1087 0.0187  0.0063  0.0111  205 GLU B CG  
3119 C  CD  . GLU B 213 ? 0.1420 0.1434 0.1106 0.0217  0.0091  0.0144  205 GLU B CD  
3120 O  OE1 . GLU B 213 ? 0.1458 0.1453 0.1154 0.0220  0.0113  0.0149  205 GLU B OE1 
3121 O  OE2 . GLU B 213 ? 0.1449 0.1501 0.1108 0.0241  0.0093  0.0168  205 GLU B OE2 
3122 N  N   . ASN B 214 ? 0.1367 0.1327 0.1067 0.0123  0.0013  -0.0001 206 ASN B N   
3123 C  CA  . ASN B 214 ? 0.1400 0.1349 0.1097 0.0106  0.0001  -0.0035 206 ASN B CA  
3124 C  C   . ASN B 214 ? 0.1382 0.1289 0.1113 0.0096  0.0014  -0.0041 206 ASN B C   
3125 O  O   . ASN B 214 ? 0.1353 0.1247 0.1086 0.0082  0.0005  -0.0067 206 ASN B O   
3126 C  CB  . ASN B 214 ? 0.1451 0.1430 0.1102 0.0120  0.0002  -0.0048 206 ASN B CB  
3127 C  CG  . ASN B 214 ? 0.1522 0.1501 0.1161 0.0143  0.0032  -0.0024 206 ASN B CG  
3128 O  OD1 . ASN B 214 ? 0.1515 0.1508 0.1151 0.0163  0.0048  0.0011  206 ASN B OD1 
3129 N  ND2 . ASN B 214 ? 0.1578 0.1543 0.1214 0.0142  0.0042  -0.0039 206 ASN B ND2 
3130 N  N   . ARG B 215 ? 0.1387 0.1274 0.1147 0.0103  0.0035  -0.0016 207 ARG B N   
3131 C  CA  . ARG B 215 ? 0.1401 0.1259 0.1191 0.0098  0.0050  -0.0019 207 ARG B CA  
3132 C  C   . ARG B 215 ? 0.1363 0.1195 0.1194 0.0076  0.0036  -0.0034 207 ARG B C   
3133 O  O   . ARG B 215 ? 0.1319 0.1132 0.1189 0.0073  0.0045  -0.0023 207 ARG B O   
3134 C  CB  . ARG B 215 ? 0.1449 0.1303 0.1258 0.0114  0.0081  0.0013  207 ARG B CB  
3135 C  CG  . ARG B 215 ? 0.1510 0.1394 0.1276 0.0140  0.0098  0.0031  207 ARG B CG  
3136 C  CD  . ARG B 215 ? 0.1554 0.1432 0.1344 0.0158  0.0132  0.0069  207 ARG B CD  
3137 N  NE  . ARG B 215 ? 0.1543 0.1414 0.1357 0.0160  0.0135  0.0091  207 ARG B NE  
3138 C  CZ  . ARG B 215 ? 0.1554 0.1395 0.1424 0.0149  0.0144  0.0098  207 ARG B CZ  
3139 N  NH1 . ARG B 215 ? 0.1523 0.1338 0.1435 0.0134  0.0150  0.0086  207 ARG B NH1 
3140 N  NH2 . ARG B 215 ? 0.1566 0.1403 0.1451 0.0153  0.0147  0.0116  207 ARG B NH2 
3141 N  N   . ARG B 216 ? 0.1355 0.1185 0.1177 0.0062  0.0014  -0.0059 208 ARG B N   
3142 C  CA  . ARG B 216 ? 0.1340 0.1149 0.1194 0.0045  0.0001  -0.0072 208 ARG B CA  
3143 C  C   . ARG B 216 ? 0.1309 0.1096 0.1197 0.0043  0.0014  -0.0072 208 ARG B C   
3144 O  O   . ARG B 216 ? 0.1287 0.1060 0.1210 0.0035  0.0010  -0.0072 208 ARG B O   
3145 C  CB  . ARG B 216 ? 0.1362 0.1172 0.1204 0.0032  -0.0019 -0.0097 208 ARG B CB  
3146 C  CG  . ARG B 216 ? 0.1349 0.1142 0.1220 0.0018  -0.0031 -0.0104 208 ARG B CG  
3147 C  CD  . ARG B 216 ? 0.1372 0.1160 0.1238 0.0006  -0.0045 -0.0125 208 ARG B CD  
3148 N  NE  . ARG B 216 ? 0.1398 0.1205 0.1246 0.0001  -0.0060 -0.0131 208 ARG B NE  
3149 C  CZ  . ARG B 216 ? 0.1420 0.1224 0.1271 -0.0012 -0.0072 -0.0147 208 ARG B CZ  
3150 N  NH1 . ARG B 216 ? 0.1427 0.1208 0.1295 -0.0018 -0.0070 -0.0158 208 ARG B NH1 
3151 N  NH2 . ARG B 216 ? 0.1417 0.1242 0.1257 -0.0017 -0.0085 -0.0152 208 ARG B NH2 
3152 N  N   . PRO B 217 ? 0.1322 0.1108 0.1201 0.0050  0.0029  -0.0075 209 PRO B N   
3153 C  CA  . PRO B 217 ? 0.1334 0.1103 0.1251 0.0048  0.0041  -0.0074 209 PRO B CA  
3154 C  C   . PRO B 217 ? 0.1333 0.1096 0.1289 0.0052  0.0057  -0.0053 209 PRO B C   
3155 O  O   . PRO B 217 ? 0.1334 0.1085 0.1332 0.0043  0.0056  -0.0057 209 PRO B O   
3156 C  CB  . PRO B 217 ? 0.1342 0.1114 0.1239 0.0058  0.0057  -0.0079 209 PRO B CB  
3157 C  CG  . PRO B 217 ? 0.1353 0.1140 0.1202 0.0059  0.0044  -0.0094 209 PRO B CG  
3158 C  CD  . PRO B 217 ? 0.1338 0.1141 0.1175 0.0059  0.0033  -0.0083 209 PRO B CD  
3159 N  N   . ASP B 218 ? 0.1347 0.1120 0.1291 0.0064  0.0071  -0.0032 210 ASP B N   
3160 C  CA  . ASP B 218 ? 0.1347 0.1111 0.1334 0.0066  0.0088  -0.0012 210 ASP B CA  
3161 C  C   . ASP B 218 ? 0.1316 0.1071 0.1328 0.0054  0.0070  -0.0019 210 ASP B C   
3162 O  O   . ASP B 218 ? 0.1266 0.1008 0.1326 0.0047  0.0075  -0.0020 210 ASP B O   
3163 C  CB  . ASP B 218 ? 0.1402 0.1178 0.1370 0.0085  0.0109  0.0016  210 ASP B CB  
3164 C  CG  . ASP B 218 ? 0.1469 0.1256 0.1418 0.0101  0.0133  0.0028  210 ASP B CG  
3165 O  OD1 . ASP B 218 ? 0.1488 0.1266 0.1460 0.0097  0.0142  0.0021  210 ASP B OD1 
3166 O  OD2 . ASP B 218 ? 0.1550 0.1356 0.1461 0.0119  0.0144  0.0045  210 ASP B OD2 
3167 N  N   . TYR B 219 ? 0.1315 0.1079 0.1296 0.0052  0.0050  -0.0026 211 TYR B N   
3168 C  CA  . TYR B 219 ? 0.1306 0.1065 0.1302 0.0042  0.0032  -0.0035 211 TYR B CA  
3169 C  C   . TYR B 219 ? 0.1317 0.1065 0.1341 0.0029  0.0019  -0.0054 211 TYR B C   
3170 O  O   . TYR B 219 ? 0.1294 0.1034 0.1354 0.0024  0.0017  -0.0058 211 TYR B O   
3171 C  CB  . TYR B 219 ? 0.1296 0.1069 0.1252 0.0041  0.0013  -0.0040 211 TYR B CB  
3172 C  CG  . TYR B 219 ? 0.1263 0.1034 0.1226 0.0030  -0.0009 -0.0053 211 TYR B CG  
3173 C  CD1 . TYR B 219 ? 0.1269 0.1033 0.1253 0.0031  -0.0010 -0.0048 211 TYR B CD1 
3174 C  CD2 . TYR B 219 ? 0.1253 0.1028 0.1202 0.0021  -0.0027 -0.0069 211 TYR B CD2 
3175 C  CE1 . TYR B 219 ? 0.1251 0.1015 0.1237 0.0024  -0.0028 -0.0060 211 TYR B CE1 
3176 C  CE2 . TYR B 219 ? 0.1237 0.1011 0.1190 0.0014  -0.0044 -0.0077 211 TYR B CE2 
3177 C  CZ  . TYR B 219 ? 0.1232 0.1003 0.1202 0.0016  -0.0045 -0.0072 211 TYR B CZ  
3178 O  OH  . TYR B 219 ? 0.1166 0.0939 0.1138 0.0012  -0.0060 -0.0079 211 TYR B OH  
3179 N  N   . LEU B 220 ? 0.1365 0.1115 0.1375 0.0025  0.0012  -0.0067 212 LEU B N   
3180 C  CA  . LEU B 220 ? 0.1379 0.1121 0.1415 0.0016  0.0001  -0.0083 212 LEU B CA  
3181 C  C   . LEU B 220 ? 0.1424 0.1160 0.1508 0.0015  0.0013  -0.0081 212 LEU B C   
3182 O  O   . LEU B 220 ? 0.1416 0.1152 0.1530 0.0009  0.0001  -0.0092 212 LEU B O   
3183 C  CB  . LEU B 220 ? 0.1400 0.1142 0.1415 0.0014  -0.0005 -0.0094 212 LEU B CB  
3184 C  CG  . LEU B 220 ? 0.1395 0.1142 0.1376 0.0010  -0.0021 -0.0100 212 LEU B CG  
3185 C  CD1 . LEU B 220 ? 0.1425 0.1170 0.1386 0.0009  -0.0022 -0.0112 212 LEU B CD1 
3186 C  CD2 . LEU B 220 ? 0.1391 0.1138 0.1386 0.0004  -0.0039 -0.0106 212 LEU B CD2 
3187 N  N   . LYS B 221 ? 0.1484 0.1220 0.1577 0.0022  0.0037  -0.0068 213 LYS B N   
3188 C  CA  . LYS B 221 ? 0.1540 0.1272 0.1685 0.0021  0.0051  -0.0065 213 LYS B CA  
3189 C  C   . LYS B 221 ? 0.1559 0.1285 0.1740 0.0017  0.0054  -0.0061 213 LYS B C   
3190 O  O   . LYS B 221 ? 0.1594 0.1320 0.1823 0.0009  0.0049  -0.0073 213 LYS B O   
3191 C  CB  . LYS B 221 ? 0.1621 0.1353 0.1764 0.0031  0.0079  -0.0049 213 LYS B CB  
3192 C  CG  . LYS B 221 ? 0.1662 0.1397 0.1787 0.0033  0.0076  -0.0060 213 LYS B CG  
3193 C  CD  . LYS B 221 ? 0.1779 0.1517 0.1904 0.0044  0.0103  -0.0048 213 LYS B CD  
3194 C  CE  . LYS B 221 ? 0.1826 0.1563 0.1947 0.0045  0.0100  -0.0062 213 LYS B CE  
3195 N  NZ  . LYS B 221 ? 0.1902 0.1642 0.2026 0.0057  0.0128  -0.0051 213 LYS B NZ  
3196 N  N   . GLU B 222 ? 0.1571 0.1294 0.1731 0.0023  0.0060  -0.0047 214 GLU B N   
3197 C  CA  . GLU B 222 ? 0.1581 0.1295 0.1778 0.0022  0.0070  -0.0041 214 GLU B CA  
3198 C  C   . GLU B 222 ? 0.1506 0.1218 0.1713 0.0013  0.0045  -0.0061 214 GLU B C   
3199 O  O   . GLU B 222 ? 0.1493 0.1198 0.1747 0.0006  0.0047  -0.0070 214 GLU B O   
3200 C  CB  . GLU B 222 ? 0.1667 0.1380 0.1839 0.0035  0.0086  -0.0016 214 GLU B CB  
3201 C  CG  . GLU B 222 ? 0.1787 0.1500 0.1963 0.0047  0.0118  0.0009  214 GLU B CG  
3202 C  CD  . GLU B 222 ? 0.1918 0.1633 0.2071 0.0064  0.0137  0.0038  214 GLU B CD  
3203 O  OE1 . GLU B 222 ? 0.2059 0.1768 0.2219 0.0065  0.0135  0.0042  214 GLU B OE1 
3204 O  OE2 . GLU B 222 ? 0.2163 0.1890 0.2291 0.0079  0.0156  0.0058  214 GLU B OE2 
3205 N  N   . ILE B 223 ? 0.1431 0.1151 0.1596 0.0012  0.0022  -0.0071 215 ILE B N   
3206 C  CA  . ILE B 223 ? 0.1389 0.1111 0.1556 0.0006  0.0000  -0.0089 215 ILE B CA  
3207 C  C   . ILE B 223 ? 0.1379 0.1105 0.1589 -0.0002 -0.0012 -0.0110 215 ILE B C   
3208 O  O   . ILE B 223 ? 0.1343 0.1069 0.1567 -0.0005 -0.0024 -0.0124 215 ILE B O   
3209 C  CB  . ILE B 223 ? 0.1371 0.1104 0.1489 0.0008  -0.0019 -0.0092 215 ILE B CB  
3210 C  CG1 . ILE B 223 ? 0.1333 0.1068 0.1447 0.0007  -0.0036 -0.0101 215 ILE B CG1 
3211 C  CG2 . ILE B 223 ? 0.1368 0.1106 0.1478 0.0004  -0.0029 -0.0101 215 ILE B CG2 
3212 C  CD1 . ILE B 223 ? 0.1328 0.1072 0.1398 0.0009  -0.0049 -0.0099 215 ILE B CD1 
3213 N  N   . TRP B 224 ? 0.1354 0.1085 0.1586 -0.0005 -0.0008 -0.0113 216 TRP B N   
3214 C  CA  . TRP B 224 ? 0.1328 0.1068 0.1606 -0.0012 -0.0018 -0.0132 216 TRP B CA  
3215 C  C   . TRP B 224 ? 0.1341 0.1075 0.1669 -0.0018 -0.0013 -0.0141 216 TRP B C   
3216 O  O   . TRP B 224 ? 0.1282 0.1027 0.1636 -0.0023 -0.0031 -0.0164 216 TRP B O   
3217 C  CB  . TRP B 224 ? 0.1294 0.1039 0.1596 -0.0012 -0.0007 -0.0128 216 TRP B CB  
3218 C  CG  . TRP B 224 ? 0.1289 0.1039 0.1553 -0.0007 -0.0012 -0.0124 216 TRP B CG  
3219 C  CD1 . TRP B 224 ? 0.1296 0.1042 0.1546 -0.0002 0.0006  -0.0111 216 TRP B CD1 
3220 C  CD2 . TRP B 224 ? 0.1277 0.1035 0.1514 -0.0006 -0.0034 -0.0134 216 TRP B CD2 
3221 N  NE1 . TRP B 224 ? 0.1295 0.1043 0.1513 0.0001  -0.0004 -0.0115 216 TRP B NE1 
3222 C  CE2 . TRP B 224 ? 0.1277 0.1032 0.1488 -0.0002 -0.0028 -0.0127 216 TRP B CE2 
3223 C  CE3 . TRP B 224 ? 0.1262 0.1031 0.1494 -0.0007 -0.0057 -0.0147 216 TRP B CE3 
3224 C  CZ2 . TRP B 224 ? 0.1265 0.1024 0.1452 0.0001  -0.0043 -0.0131 216 TRP B CZ2 
3225 C  CZ3 . TRP B 224 ? 0.1252 0.1027 0.1455 -0.0002 -0.0071 -0.0148 216 TRP B CZ3 
3226 C  CH2 . TRP B 224 ? 0.1248 0.1016 0.1432 0.0000  -0.0063 -0.0139 216 TRP B CH2 
3227 N  N   . SER B 225 ? 0.1402 0.1119 0.1744 -0.0016 0.0011  -0.0125 217 SER B N   
3228 C  CA  . SER B 225 ? 0.1491 0.1198 0.1888 -0.0023 0.0019  -0.0135 217 SER B CA  
3229 C  C   . SER B 225 ? 0.1447 0.1148 0.1830 -0.0022 0.0006  -0.0147 217 SER B C   
3230 O  O   . SER B 225 ? 0.1479 0.1171 0.1909 -0.0028 0.0009  -0.0162 217 SER B O   
3231 C  CB  . SER B 225 ? 0.1588 0.1279 0.2017 -0.0021 0.0054  -0.0110 217 SER B CB  
3232 O  OG  . SER B 225 ? 0.1730 0.1415 0.2108 -0.0008 0.0067  -0.0083 217 SER B OG  
3233 N  N   . VAL B 226 ? 0.1372 0.1078 0.1696 -0.0014 -0.0008 -0.0143 218 VAL B N   
3234 C  CA  . VAL B 226 ? 0.1346 0.1049 0.1657 -0.0012 -0.0022 -0.0157 218 VAL B CA  
3235 C  C   . VAL B 226 ? 0.1299 0.1024 0.1580 -0.0011 -0.0052 -0.0176 218 VAL B C   
3236 O  O   . VAL B 226 ? 0.1263 0.0990 0.1522 -0.0007 -0.0063 -0.0184 218 VAL B O   
3237 C  CB  . VAL B 226 ? 0.1336 0.1028 0.1612 -0.0002 -0.0010 -0.0135 218 VAL B CB  
3238 C  CG1 . VAL B 226 ? 0.1377 0.1048 0.1689 0.0000  0.0021  -0.0116 218 VAL B CG1 
3239 C  CG2 . VAL B 226 ? 0.1337 0.1040 0.1556 0.0004  -0.0014 -0.0116 218 VAL B CG2 
3240 N  N   . ILE B 227 ? 0.1225 0.0966 0.1508 -0.0014 -0.0062 -0.0181 219 ILE B N   
3241 C  CA  . ILE B 227 ? 0.1211 0.0973 0.1466 -0.0010 -0.0088 -0.0194 219 ILE B CA  
3242 C  C   . ILE B 227 ? 0.1213 0.0986 0.1498 -0.0012 -0.0104 -0.0224 219 ILE B C   
3243 O  O   . ILE B 227 ? 0.1200 0.0975 0.1537 -0.0020 -0.0101 -0.0239 219 ILE B O   
3244 C  CB  . ILE B 227 ? 0.1182 0.0958 0.1429 -0.0009 -0.0095 -0.0189 219 ILE B CB  
3245 C  CG1 . ILE B 227 ? 0.1168 0.0933 0.1380 -0.0007 -0.0081 -0.0165 219 ILE B CG1 
3246 C  CG2 . ILE B 227 ? 0.1165 0.0964 0.1392 -0.0003 -0.0119 -0.0202 219 ILE B CG2 
3247 C  CD1 . ILE B 227 ? 0.1170 0.0933 0.1332 -0.0002 -0.0086 -0.0155 219 ILE B CD1 
3248 N  N   . ASP B 228 ? 0.1253 0.1036 0.1505 -0.0004 -0.0121 -0.0233 220 ASP B N   
3249 C  CA  . ASP B 228 ? 0.1282 0.1083 0.1551 -0.0003 -0.0140 -0.0264 220 ASP B CA  
3250 C  C   . ASP B 228 ? 0.1309 0.1143 0.1570 0.0002  -0.0161 -0.0271 220 ASP B C   
3251 O  O   . ASP B 228 ? 0.1269 0.1117 0.1487 0.0013  -0.0173 -0.0266 220 ASP B O   
3252 C  CB  . ASP B 228 ? 0.1307 0.1105 0.1543 0.0006  -0.0145 -0.0269 220 ASP B CB  
3253 C  CG  . ASP B 228 ? 0.1313 0.1131 0.1560 0.0010  -0.0165 -0.0305 220 ASP B CG  
3254 O  OD1 . ASP B 228 ? 0.1348 0.1190 0.1625 0.0006  -0.0180 -0.0325 220 ASP B OD1 
3255 O  OD2 . ASP B 228 ? 0.1274 0.1088 0.1499 0.0018  -0.0167 -0.0312 220 ASP B OD2 
3256 N  N   . TRP B 229 ? 0.1373 0.1217 0.1678 -0.0005 -0.0162 -0.0281 221 TRP B N   
3257 C  CA  . TRP B 229 ? 0.1395 0.1272 0.1700 0.0001  -0.0180 -0.0286 221 TRP B CA  
3258 C  C   . TRP B 229 ? 0.1460 0.1371 0.1758 0.0011  -0.0207 -0.0313 221 TRP B C   
3259 O  O   . TRP B 229 ? 0.1437 0.1378 0.1718 0.0022  -0.0223 -0.0311 221 TRP B O   
3260 C  CB  . TRP B 229 ? 0.1386 0.1270 0.1746 -0.0008 -0.0174 -0.0289 221 TRP B CB  
3261 C  CG  . TRP B 229 ? 0.1373 0.1231 0.1732 -0.0013 -0.0149 -0.0260 221 TRP B CG  
3262 C  CD1 . TRP B 229 ? 0.1381 0.1218 0.1778 -0.0024 -0.0126 -0.0254 221 TRP B CD1 
3263 C  CD2 . TRP B 229 ? 0.1351 0.1204 0.1670 -0.0006 -0.0143 -0.0235 221 TRP B CD2 
3264 N  NE1 . TRP B 229 ? 0.1401 0.1222 0.1779 -0.0022 -0.0107 -0.0227 221 TRP B NE1 
3265 C  CE2 . TRP B 229 ? 0.1356 0.1186 0.1688 -0.0013 -0.0118 -0.0218 221 TRP B CE2 
3266 C  CE3 . TRP B 229 ? 0.1355 0.1220 0.1632 0.0005  -0.0155 -0.0226 221 TRP B CE3 
3267 C  CZ2 . TRP B 229 ? 0.1347 0.1167 0.1647 -0.0008 -0.0107 -0.0196 221 TRP B CZ2 
3268 C  CZ3 . TRP B 229 ? 0.1372 0.1224 0.1625 0.0007  -0.0143 -0.0204 221 TRP B CZ3 
3269 C  CH2 . TRP B 229 ? 0.1377 0.1207 0.1641 0.0000  -0.0120 -0.0191 221 TRP B CH2 
3270 N  N   . GLU B 230 ? 0.1548 0.1454 0.1854 0.0009  -0.0211 -0.0337 222 GLU B N   
3271 C  CA  . GLU B 230 ? 0.1652 0.1592 0.1943 0.0021  -0.0236 -0.0365 222 GLU B CA  
3272 C  C   . GLU B 230 ? 0.1592 0.1537 0.1816 0.0038  -0.0240 -0.0346 222 GLU B C   
3273 O  O   . GLU B 230 ? 0.1575 0.1555 0.1775 0.0054  -0.0259 -0.0350 222 GLU B O   
3274 C  CB  . GLU B 230 ? 0.1816 0.1749 0.2139 0.0013  -0.0239 -0.0401 222 GLU B CB  
3275 C  CG  . GLU B 230 ? 0.1939 0.1877 0.2336 -0.0004 -0.0240 -0.0426 222 GLU B CG  
3276 C  CD  . GLU B 230 ? 0.2176 0.2098 0.2617 -0.0015 -0.0237 -0.0461 222 GLU B CD  
3277 O  OE1 . GLU B 230 ? 0.2336 0.2247 0.2747 -0.0007 -0.0239 -0.0472 222 GLU B OE1 
3278 O  OE2 . GLU B 230 ? 0.2380 0.2301 0.2891 -0.0031 -0.0233 -0.0479 222 GLU B OE2 
3279 N  N   . PHE B 231 ? 0.1532 0.1445 0.1730 0.0037  -0.0222 -0.0323 223 PHE B N   
3280 C  CA  . PHE B 231 ? 0.1470 0.1386 0.1612 0.0051  -0.0222 -0.0299 223 PHE B CA  
3281 C  C   . PHE B 231 ? 0.1457 0.1385 0.1584 0.0056  -0.0223 -0.0274 223 PHE B C   
3282 O  O   . PHE B 231 ? 0.1420 0.1372 0.1516 0.0072  -0.0234 -0.0267 223 PHE B O   
3283 C  CB  . PHE B 231 ? 0.1437 0.1319 0.1559 0.0047  -0.0202 -0.0278 223 PHE B CB  
3284 C  CG  . PHE B 231 ? 0.1427 0.1314 0.1500 0.0058  -0.0201 -0.0253 223 PHE B CG  
3285 C  CD1 . PHE B 231 ? 0.1448 0.1352 0.1490 0.0074  -0.0211 -0.0260 223 PHE B CD1 
3286 C  CD2 . PHE B 231 ? 0.1409 0.1284 0.1468 0.0054  -0.0190 -0.0224 223 PHE B CD2 
3287 C  CE1 . PHE B 231 ? 0.1429 0.1340 0.1432 0.0085  -0.0208 -0.0235 223 PHE B CE1 
3288 C  CE2 . PHE B 231 ? 0.1391 0.1271 0.1413 0.0063  -0.0189 -0.0202 223 PHE B CE2 
3289 C  CZ  . PHE B 231 ? 0.1402 0.1299 0.1397 0.0078  -0.0196 -0.0206 223 PHE B CZ  
3290 N  N   . VAL B 232 ? 0.1427 0.1337 0.1577 0.0044  -0.0210 -0.0261 224 VAL B N   
3291 C  CA  . VAL B 232 ? 0.1415 0.1334 0.1557 0.0049  -0.0210 -0.0240 224 VAL B CA  
3292 C  C   . VAL B 232 ? 0.1449 0.1409 0.1598 0.0062  -0.0231 -0.0252 224 VAL B C   
3293 O  O   . VAL B 232 ? 0.1481 0.1457 0.1602 0.0076  -0.0235 -0.0235 224 VAL B O   
3294 C  CB  . VAL B 232 ? 0.1402 0.1300 0.1573 0.0035  -0.0194 -0.0230 224 VAL B CB  
3295 C  CG1 . VAL B 232 ? 0.1388 0.1292 0.1552 0.0041  -0.0193 -0.0212 224 VAL B CG1 
3296 C  CG2 . VAL B 232 ? 0.1396 0.1259 0.1554 0.0026  -0.0174 -0.0215 224 VAL B CG2 
3297 N  N   . ALA B 233 ? 0.1447 0.1426 0.1636 0.0057  -0.0243 -0.0282 225 ALA B N   
3298 C  CA  . ALA B 233 ? 0.1485 0.1511 0.1684 0.0071  -0.0265 -0.0296 225 ALA B CA  
3299 C  C   . ALA B 233 ? 0.1536 0.1591 0.1689 0.0092  -0.0281 -0.0300 225 ALA B C   
3300 O  O   . ALA B 233 ? 0.1599 0.1687 0.1736 0.0110  -0.0292 -0.0288 225 ALA B O   
3301 C  CB  . ALA B 233 ? 0.1476 0.1520 0.1731 0.0059  -0.0276 -0.0332 225 ALA B CB  
3302 N  N   . LYS B 234 ? 0.1565 0.1610 0.1699 0.0092  -0.0282 -0.0314 226 LYS B N   
3303 C  CA  . LYS B 234 ? 0.1592 0.1663 0.1680 0.0114  -0.0293 -0.0315 226 LYS B CA  
3304 C  C   . LYS B 234 ? 0.1608 0.1674 0.1655 0.0127  -0.0282 -0.0273 226 LYS B C   
3305 O  O   . LYS B 234 ? 0.1645 0.1746 0.1664 0.0149  -0.0292 -0.0264 226 LYS B O   
3306 C  CB  . LYS B 234 ? 0.1637 0.1690 0.1711 0.0111  -0.0290 -0.0334 226 LYS B CB  
3307 N  N   . MET B 235 ? 0.1561 0.1586 0.1606 0.0113  -0.0261 -0.0248 227 MET B N   
3308 C  CA  . MET B 235 ? 0.1577 0.1593 0.1592 0.0121  -0.0249 -0.0211 227 MET B CA  
3309 C  C   . MET B 235 ? 0.1617 0.1654 0.1643 0.0131  -0.0253 -0.0197 227 MET B C   
3310 O  O   . MET B 235 ? 0.1706 0.1758 0.1706 0.0150  -0.0252 -0.0173 227 MET B O   
3311 C  CB  . MET B 235 ? 0.1569 0.1541 0.1587 0.0103  -0.0228 -0.0193 227 MET B CB  
3312 C  CG  . MET B 235 ? 0.1592 0.1545 0.1594 0.0097  -0.0221 -0.0197 227 MET B CG  
3313 S  SD  . MET B 235 ? 0.1682 0.1656 0.1638 0.0119  -0.0224 -0.0188 227 MET B SD  
3314 C  CE  . MET B 235 ? 0.1670 0.1673 0.1630 0.0129  -0.0244 -0.0229 227 MET B CE  
3315 N  N   . HIS B 236 ? 0.1610 0.1649 0.1675 0.0121  -0.0256 -0.0210 228 HIS B N   
3316 C  CA  . HIS B 236 ? 0.1679 0.1738 0.1758 0.0131  -0.0260 -0.0197 228 HIS B CA  
3317 C  C   . HIS B 236 ? 0.1686 0.1800 0.1751 0.0157  -0.0282 -0.0205 228 HIS B C   
3318 O  O   . HIS B 236 ? 0.1573 0.1704 0.1622 0.0177  -0.0280 -0.0178 228 HIS B O   
3319 C  CB  . HIS B 236 ? 0.1715 0.1770 0.1843 0.0116  -0.0259 -0.0211 228 HIS B CB  
3320 C  CG  . HIS B 236 ? 0.1773 0.1851 0.1918 0.0128  -0.0262 -0.0198 228 HIS B CG  
3321 N  ND1 . HIS B 236 ? 0.1852 0.1978 0.2022 0.0139  -0.0283 -0.0216 228 HIS B ND1 
3322 C  CD2 . HIS B 236 ? 0.1804 0.1867 0.1947 0.0133  -0.0247 -0.0169 228 HIS B CD2 
3323 C  CE1 . HIS B 236 ? 0.1834 0.1974 0.2015 0.0151  -0.0280 -0.0196 228 HIS B CE1 
3324 N  NE2 . HIS B 236 ? 0.1806 0.1904 0.1972 0.0147  -0.0257 -0.0167 228 HIS B NE2 
3325 N  N   . ALA B 237 ? 0.1676 0.1817 0.1749 0.0158  -0.0301 -0.0240 229 ALA B N   
3326 C  CA  . ALA B 237 ? 0.1699 0.1899 0.1758 0.0183  -0.0325 -0.0255 229 ALA B CA  
3327 C  C   . ALA B 237 ? 0.1706 0.1920 0.1711 0.0208  -0.0322 -0.0229 229 ALA B C   
3328 O  O   . ALA B 237 ? 0.1712 0.1965 0.1700 0.0235  -0.0330 -0.0212 229 ALA B O   
3329 C  CB  . ALA B 237 ? 0.1667 0.1887 0.1743 0.0176  -0.0345 -0.0304 229 ALA B CB  
3330 N  N   . GLN B 238 ? 0.1715 0.1896 0.1694 0.0202  -0.0309 -0.0222 230 GLN B N   
3331 C  CA  . GLN B 238 ? 0.1737 0.1928 0.1669 0.0225  -0.0301 -0.0195 230 GLN B CA  
3332 C  C   . GLN B 238 ? 0.1708 0.1884 0.1635 0.0232  -0.0283 -0.0148 230 GLN B C   
3333 O  O   . GLN B 238 ? 0.1739 0.1942 0.1641 0.0258  -0.0281 -0.0122 230 GLN B O   
3334 C  CB  . GLN B 238 ? 0.1714 0.1874 0.1625 0.0215  -0.0291 -0.0200 230 GLN B CB  
3335 N  N   . ALA B 239 ? 0.1724 0.1858 0.1679 0.0209  -0.0267 -0.0138 231 ALA B N   
3336 C  CA  . ALA B 239 ? 0.1744 0.1857 0.1701 0.0212  -0.0248 -0.0098 231 ALA B CA  
3337 C  C   . ALA B 239 ? 0.1849 0.1994 0.1815 0.0234  -0.0253 -0.0081 231 ALA B C   
3338 O  O   . ALA B 239 ? 0.1776 0.1916 0.1734 0.0248  -0.0237 -0.0045 231 ALA B O   
3339 C  CB  . ALA B 239 ? 0.1675 0.1737 0.1658 0.0182  -0.0232 -0.0098 231 ALA B CB  
3340 N  N   . ILE B 240 ? 0.1988 0.2167 0.1976 0.0237  -0.0273 -0.0107 232 ILE B N   
3341 C  CA  . ILE B 240 ? 0.2211 0.2428 0.2210 0.0260  -0.0280 -0.0093 232 ILE B CA  
3342 C  C   . ILE B 240 ? 0.2334 0.2616 0.2302 0.0295  -0.0300 -0.0094 232 ILE B C   
3343 O  O   . ILE B 240 ? 0.2555 0.2874 0.2526 0.0320  -0.0305 -0.0075 232 ILE B O   
3344 C  CB  . ILE B 240 ? 0.2170 0.2394 0.2215 0.0246  -0.0291 -0.0118 232 ILE B CB  
3345 C  CG1 . ILE B 240 ? 0.2194 0.2453 0.2251 0.0240  -0.0317 -0.0164 232 ILE B CG1 
3346 C  CG2 . ILE B 240 ? 0.2178 0.2344 0.2250 0.0215  -0.0270 -0.0116 232 ILE B CG2 
3347 C  CD1 . ILE B 240 ? 0.2209 0.2487 0.2317 0.0229  -0.0329 -0.0186 232 ILE B CD1 
3348 N  N   . LYS B 241 ? 0.2487 0.2785 0.2426 0.0299  -0.0312 -0.0116 233 LYS B N   
3349 C  CA  . LYS B 241 ? 0.2703 0.3066 0.2608 0.0332  -0.0333 -0.0123 233 LYS B CA  
3350 C  C   . LYS B 241 ? 0.2802 0.3182 0.2676 0.0366  -0.0318 -0.0072 233 LYS B C   
3351 O  O   . LYS B 241 ? 0.3182 0.3622 0.3039 0.0400  -0.0333 -0.0066 233 LYS B O   
3352 C  CB  . LYS B 241 ? 0.2620 0.2988 0.2496 0.0330  -0.0342 -0.0154 233 LYS B CB  
3353 O  OXT . LYS B 241 ? 0.2927 0.3265 0.2796 0.0362  -0.0291 -0.0035 233 LYS B OXT 
3354 FE FE  . FE2 C .   ? 0.1697 0.1260 0.1214 -0.0049 -0.0034 0.0039  301 FE2 A FE  
3355 FE FE  . FE2 D .   ? 0.1315 0.1176 0.1221 0.0011  -0.0110 -0.0057 301 FE2 B FE  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -7  ?   ?   ?   A . n 
A 1 2   ALA 2   -6  ?   ?   ?   A . n 
A 1 3   HIS 3   -5  ?   ?   ?   A . n 
A 1 4   HIS 4   -4  ?   ?   ?   A . n 
A 1 5   HIS 5   -3  ?   ?   ?   A . n 
A 1 6   HIS 6   -2  ?   ?   ?   A . n 
A 1 7   HIS 7   -1  ?   ?   ?   A . n 
A 1 8   HIS 8   0   ?   ?   ?   A . n 
A 1 9   MET 9   1   ?   ?   ?   A . n 
A 1 10  LEU 10  2   ?   ?   ?   A . n 
A 1 11  ARG 11  3   ?   ?   ?   A . n 
A 1 12  ARG 12  4   ?   ?   ?   A . n 
A 1 13  ALA 13  5   ?   ?   ?   A . n 
A 1 14  VAL 14  6   ?   ?   ?   A . n 
A 1 15  ASN 15  7   ?   ?   ?   A . n 
A 1 16  ILE 16  8   ?   ?   ?   A . n 
A 1 17  SER 17  9   ?   ?   ?   A . n 
A 1 18  ILE 18  10  ?   ?   ?   A . n 
A 1 19  ALA 19  11  ?   ?   ?   A . n 
A 1 20  ARG 20  12  ?   ?   ?   A . n 
A 1 21  GLY 21  13  ?   ?   ?   A . n 
A 1 22  ARG 22  14  ?   ?   ?   A . n 
A 1 23  MET 23  15  ?   ?   ?   A . n 
A 1 24  ALA 24  16  ?   ?   ?   A . n 
A 1 25  LEU 25  17  ?   ?   ?   A . n 
A 1 26  MET 26  18  ?   ?   ?   A . n 
A 1 27  SER 27  19  ?   ?   ?   A . n 
A 1 28  TYR 28  20  20  TYR TYR A . n 
A 1 29  ALA 29  21  21  ALA ALA A . n 
A 1 30  THR 30  22  22  THR THR A . n 
A 1 31  LEU 31  23  23  LEU LEU A . n 
A 1 32  PRO 32  24  24  PRO PRO A . n 
A 1 33  ASP 33  25  25  ASP ASP A . n 
A 1 34  LEU 34  26  26  LEU LEU A . n 
A 1 35  LEU 35  27  27  LEU LEU A . n 
A 1 36  LYS 36  28  28  LYS LYS A . n 
A 1 37  PRO 37  29  29  PRO PRO A . n 
A 1 38  SER 38  30  30  SER SER A . n 
A 1 39  GLY 39  31  31  GLY GLY A . n 
A 1 40  ALA 40  32  32  ALA ALA A . n 
A 1 41  PRO 41  33  33  PRO PRO A . n 
A 1 42  ALA 42  34  34  ALA ALA A . n 
A 1 43  GLU 43  35  35  GLU GLU A . n 
A 1 44  LEU 44  36  36  LEU LEU A . n 
A 1 45  PRO 45  37  37  PRO PRO A . n 
A 1 46  LYS 46  38  38  LYS LYS A . n 
A 1 47  LEU 47  39  39  LEU LEU A . n 
A 1 48  GLY 48  40  40  GLY GLY A . n 
A 1 49  PHE 49  41  41  PHE PHE A . n 
A 1 50  ASN 50  42  42  ASN ASN A . n 
A 1 51  TRP 51  43  43  TRP TRP A . n 
A 1 52  LYS 52  44  44  LYS LYS A . n 
A 1 53  ASP 53  45  45  ASP ASP A . n 
A 1 54  GLY 54  46  46  GLY GLY A . n 
A 1 55  CYS 55  47  47  CYS CYS A . n 
A 1 56  ALA 56  48  48  ALA ALA A . n 
A 1 57  PRO 57  49  49  PRO PRO A . n 
A 1 58  VAL 58  50  50  VAL VAL A . n 
A 1 59  PHE 59  51  51  PHE PHE A . n 
A 1 60  SER 60  52  52  SER SER A . n 
A 1 61  PRO 61  53  53  PRO PRO A . n 
A 1 62  ARG 62  54  54  ARG ARG A . n 
A 1 63  GLN 63  55  55  GLN GLN A . n 
A 1 64  MET 64  56  56  MET MET A . n 
A 1 65  GLU 65  57  57  GLU GLU A . n 
A 1 66  LEU 66  58  58  LEU LEU A . n 
A 1 67  HIS 67  59  59  HIS HIS A . n 
A 1 68  TYR 68  60  60  TYR TYR A . n 
A 1 69  THR 69  61  61  THR THR A . n 
A 1 70  LYS 70  62  62  LYS LYS A . n 
A 1 71  HIS 71  63  63  HIS HIS A . n 
A 1 72  HIS 72  64  64  HIS HIS A . n 
A 1 73  LYS 73  65  65  LYS LYS A . n 
A 1 74  ALA 74  66  66  ALA ALA A . n 
A 1 75  TYR 75  67  67  TYR TYR A . n 
A 1 76  VAL 76  68  68  VAL VAL A . n 
A 1 77  ASP 77  69  69  ASP ASP A . n 
A 1 78  LYS 78  70  70  LYS LYS A . n 
A 1 79  LEU 79  71  71  LEU LEU A . n 
A 1 80  ASN 80  72  72  ASN ASN A . n 
A 1 81  ALA 81  73  73  ALA ALA A . n 
A 1 82  LEU 82  74  74  LEU LEU A . n 
A 1 83  ALA 83  75  75  ALA ALA A . n 
A 1 84  GLY 84  76  76  GLY GLY A . n 
A 1 85  THR 85  77  77  THR THR A . n 
A 1 86  THR 86  78  78  THR THR A . n 
A 1 87  TYR 87  79  79  TYR TYR A . n 
A 1 88  ASP 88  80  80  ASP ASP A . n 
A 1 89  GLY 89  81  81  GLY GLY A . n 
A 1 90  LYS 90  82  82  LYS LYS A . n 
A 1 91  SER 91  83  83  SER SER A . n 
A 1 92  ILE 92  84  84  ILE ILE A . n 
A 1 93  GLU 93  85  85  GLU GLU A . n 
A 1 94  GLU 94  86  86  GLU GLU A . n 
A 1 95  ILE 95  87  87  ILE ILE A . n 
A 1 96  ILE 96  88  88  ILE ILE A . n 
A 1 97  LEU 97  89  89  LEU LEU A . n 
A 1 98  ALA 98  90  90  ALA ALA A . n 
A 1 99  VAL 99  91  91  VAL VAL A . n 
A 1 100 ALA 100 92  92  ALA ALA A . n 
A 1 101 ASN 101 93  93  ASN ASN A . n 
A 1 102 ASP 102 94  94  ASP ASP A . n 
A 1 103 ALA 103 95  95  ALA ALA A . n 
A 1 104 GLU 104 96  96  GLU GLU A . n 
A 1 105 LYS 105 97  97  LYS LYS A . n 
A 1 106 LYS 106 98  98  LYS LYS A . n 
A 1 107 GLY 107 99  99  GLY GLY A . n 
A 1 108 LEU 108 100 100 LEU LEU A . n 
A 1 109 PHE 109 101 101 PHE PHE A . n 
A 1 110 ASN 110 102 102 ASN ASN A . n 
A 1 111 GLN 111 103 103 GLN GLN A . n 
A 1 112 ALA 112 104 104 ALA ALA A . n 
A 1 113 ALA 113 105 105 ALA ALA A . n 
A 1 114 GLN 114 106 106 GLN GLN A . n 
A 1 115 HIS 115 107 107 HIS HIS A . n 
A 1 116 PHE 116 108 108 PHE PHE A . n 
A 1 117 ASN 117 109 109 ASN ASN A . n 
A 1 118 HIS 118 110 110 HIS HIS A . n 
A 1 119 THR 119 111 111 THR THR A . n 
A 1 120 PHE 120 112 112 PHE PHE A . n 
A 1 121 TYR 121 113 113 TYR TYR A . n 
A 1 122 PHE 122 114 114 PHE PHE A . n 
A 1 123 ARG 123 115 115 ARG ARG A . n 
A 1 124 CYS 124 116 116 CYS CYS A . n 
A 1 125 ILE 125 117 117 ILE ILE A . n 
A 1 126 THR 126 118 118 THR THR A . n 
A 1 127 PRO 127 119 119 PRO PRO A . n 
A 1 128 ASN 128 120 120 ASN ASN A . n 
A 1 129 GLY 129 121 121 GLY GLY A . n 
A 1 130 LYS 130 122 122 LYS LYS A . n 
A 1 131 ALA 131 123 123 ALA ALA A . n 
A 1 132 MET 132 124 124 MET MET A . n 
A 1 133 PRO 133 125 125 PRO PRO A . n 
A 1 134 LYS 134 126 126 LYS LYS A . n 
A 1 135 SER 135 127 127 SER SER A . n 
A 1 136 PHE 136 128 128 PHE PHE A . n 
A 1 137 GLU 137 129 129 GLU GLU A . n 
A 1 138 SER 138 130 130 SER SER A . n 
A 1 139 ALA 139 131 131 ALA ALA A . n 
A 1 140 VAL 140 132 132 VAL VAL A . n 
A 1 141 THR 141 133 133 THR THR A . n 
A 1 142 ALA 142 134 134 ALA ALA A . n 
A 1 143 GLN 143 135 135 GLN GLN A . n 
A 1 144 PHE 144 136 136 PHE PHE A . n 
A 1 145 GLY 145 137 137 GLY GLY A . n 
A 1 146 SER 146 138 138 SER SER A . n 
A 1 147 VAL 147 139 139 VAL VAL A . n 
A 1 148 GLU 148 140 140 GLU GLU A . n 
A 1 149 GLN 149 141 141 GLN GLN A . n 
A 1 150 PHE 150 142 142 PHE PHE A . n 
A 1 151 LYS 151 143 143 LYS LYS A . n 
A 1 152 ASP 152 144 144 ASP ASP A . n 
A 1 153 ALA 153 145 145 ALA ALA A . n 
A 1 154 PHE 154 146 146 PHE PHE A . n 
A 1 155 VAL 155 147 147 VAL VAL A . n 
A 1 156 GLN 156 148 148 GLN GLN A . n 
A 1 157 ALA 157 149 149 ALA ALA A . n 
A 1 158 GLY 158 150 150 GLY GLY A . n 
A 1 159 VAL 159 151 151 VAL VAL A . n 
A 1 160 ASN 160 152 152 ASN ASN A . n 
A 1 161 ASN 161 153 153 ASN ASN A . n 
A 1 162 PHE 162 154 154 PHE PHE A . n 
A 1 163 GLY 163 155 155 GLY GLY A . n 
A 1 164 SER 164 156 156 SER SER A . n 
A 1 165 GLY 165 157 157 GLY GLY A . n 
A 1 166 TRP 166 158 158 TRP TRP A . n 
A 1 167 THR 167 159 159 THR THR A . n 
A 1 168 TRP 168 160 160 TRP TRP A . n 
A 1 169 LEU 169 161 161 LEU LEU A . n 
A 1 170 CYS 170 162 162 CYS CYS A . n 
A 1 171 VAL 171 163 163 VAL VAL A . n 
A 1 172 ASP 172 164 164 ASP ASP A . n 
A 1 173 PRO 173 165 165 PRO PRO A . n 
A 1 174 SER 174 166 166 SER SER A . n 
A 1 175 ASN 175 167 167 ASN ASN A . n 
A 1 176 LYS 176 168 168 LYS LYS A . n 
A 1 177 ASN 177 169 169 ASN ASN A . n 
A 1 178 GLN 178 170 170 GLN GLN A . n 
A 1 179 LEU 179 171 171 LEU LEU A . n 
A 1 180 VAL 180 172 172 VAL VAL A . n 
A 1 181 ILE 181 173 173 ILE ILE A . n 
A 1 182 ASP 182 174 174 ASP ASP A . n 
A 1 183 ASN 183 175 175 ASN ASN A . n 
A 1 184 THR 184 176 176 THR THR A . n 
A 1 185 SER 185 177 177 SER SER A . n 
A 1 186 ASN 186 178 178 ASN ASN A . n 
A 1 187 ALA 187 179 179 ALA ALA A . n 
A 1 188 GLY 188 180 180 GLY GLY A . n 
A 1 189 CYS 189 181 181 CYS CYS A . n 
A 1 190 PRO 190 182 182 PRO PRO A . n 
A 1 191 LEU 191 183 183 LEU LEU A . n 
A 1 192 THR 192 184 184 THR THR A . n 
A 1 193 LYS 193 185 185 LYS LYS A . n 
A 1 194 GLY 194 186 186 GLY GLY A . n 
A 1 195 LEU 195 187 187 LEU LEU A . n 
A 1 196 ARG 196 188 188 ARG ARG A . n 
A 1 197 PRO 197 189 189 PRO PRO A . n 
A 1 198 VAL 198 190 190 VAL VAL A . n 
A 1 199 LEU 199 191 191 LEU LEU A . n 
A 1 200 ALA 200 192 192 ALA ALA A . n 
A 1 201 VAL 201 193 193 VAL VAL A . n 
A 1 202 ASP 202 194 194 ASP ASP A . n 
A 1 203 VAL 203 195 195 VAL VAL A . n 
A 1 204 TRP 204 196 196 TRP TRP A . n 
A 1 205 GLU 205 197 197 GLU GLU A . n 
A 1 206 HIS 206 198 198 HIS HIS A . n 
A 1 207 ALA 207 199 199 ALA ALA A . n 
A 1 208 TYR 208 200 200 TYR TYR A . n 
A 1 209 TYR 209 201 201 TYR TYR A . n 
A 1 210 LYS 210 202 202 LYS LYS A . n 
A 1 211 ASP 211 203 203 ASP ASP A . n 
A 1 212 PHE 212 204 204 PHE PHE A . n 
A 1 213 GLU 213 205 205 GLU GLU A . n 
A 1 214 ASN 214 206 206 ASN ASN A . n 
A 1 215 ARG 215 207 207 ARG ARG A . n 
A 1 216 ARG 216 208 208 ARG ARG A . n 
A 1 217 PRO 217 209 209 PRO PRO A . n 
A 1 218 ASP 218 210 210 ASP ASP A . n 
A 1 219 TYR 219 211 211 TYR TYR A . n 
A 1 220 LEU 220 212 212 LEU LEU A . n 
A 1 221 LYS 221 213 213 LYS LYS A . n 
A 1 222 GLU 222 214 214 GLU GLU A . n 
A 1 223 ILE 223 215 215 ILE ILE A . n 
A 1 224 TRP 224 216 216 TRP TRP A . n 
A 1 225 SER 225 217 217 SER SER A . n 
A 1 226 VAL 226 218 218 VAL VAL A . n 
A 1 227 ILE 227 219 219 ILE ILE A . n 
A 1 228 ASP 228 220 220 ASP ASP A . n 
A 1 229 TRP 229 221 221 TRP TRP A . n 
A 1 230 GLU 230 222 222 GLU GLU A . n 
A 1 231 PHE 231 223 223 PHE PHE A . n 
A 1 232 VAL 232 224 224 VAL VAL A . n 
A 1 233 ALA 233 225 225 ALA ALA A . n 
A 1 234 LYS 234 226 226 LYS LYS A . n 
A 1 235 MET 235 227 227 MET MET A . n 
A 1 236 HIS 236 228 228 HIS HIS A . n 
A 1 237 ALA 237 229 229 ALA ALA A . n 
A 1 238 GLN 238 230 230 GLN GLN A . n 
A 1 239 ALA 239 231 231 ALA ALA A . n 
A 1 240 ILE 240 232 232 ILE ILE A . n 
A 1 241 LYS 241 233 233 LYS LYS A . n 
B 1 1   MET 1   -7  ?   ?   ?   B . n 
B 1 2   ALA 2   -6  ?   ?   ?   B . n 
B 1 3   HIS 3   -5  ?   ?   ?   B . n 
B 1 4   HIS 4   -4  ?   ?   ?   B . n 
B 1 5   HIS 5   -3  ?   ?   ?   B . n 
B 1 6   HIS 6   -2  ?   ?   ?   B . n 
B 1 7   HIS 7   -1  ?   ?   ?   B . n 
B 1 8   HIS 8   0   ?   ?   ?   B . n 
B 1 9   MET 9   1   ?   ?   ?   B . n 
B 1 10  LEU 10  2   ?   ?   ?   B . n 
B 1 11  ARG 11  3   ?   ?   ?   B . n 
B 1 12  ARG 12  4   ?   ?   ?   B . n 
B 1 13  ALA 13  5   ?   ?   ?   B . n 
B 1 14  VAL 14  6   ?   ?   ?   B . n 
B 1 15  ASN 15  7   ?   ?   ?   B . n 
B 1 16  ILE 16  8   ?   ?   ?   B . n 
B 1 17  SER 17  9   ?   ?   ?   B . n 
B 1 18  ILE 18  10  ?   ?   ?   B . n 
B 1 19  ALA 19  11  ?   ?   ?   B . n 
B 1 20  ARG 20  12  ?   ?   ?   B . n 
B 1 21  GLY 21  13  ?   ?   ?   B . n 
B 1 22  ARG 22  14  ?   ?   ?   B . n 
B 1 23  MET 23  15  ?   ?   ?   B . n 
B 1 24  ALA 24  16  ?   ?   ?   B . n 
B 1 25  LEU 25  17  ?   ?   ?   B . n 
B 1 26  MET 26  18  ?   ?   ?   B . n 
B 1 27  SER 27  19  ?   ?   ?   B . n 
B 1 28  TYR 28  20  20  TYR TYR B . n 
B 1 29  ALA 29  21  21  ALA ALA B . n 
B 1 30  THR 30  22  22  THR THR B . n 
B 1 31  LEU 31  23  23  LEU LEU B . n 
B 1 32  PRO 32  24  24  PRO PRO B . n 
B 1 33  ASP 33  25  25  ASP ASP B . n 
B 1 34  LEU 34  26  26  LEU LEU B . n 
B 1 35  LEU 35  27  27  LEU LEU B . n 
B 1 36  LYS 36  28  28  LYS LYS B . n 
B 1 37  PRO 37  29  29  PRO PRO B . n 
B 1 38  SER 38  30  30  SER SER B . n 
B 1 39  GLY 39  31  31  GLY GLY B . n 
B 1 40  ALA 40  32  32  ALA ALA B . n 
B 1 41  PRO 41  33  33  PRO PRO B . n 
B 1 42  ALA 42  34  34  ALA ALA B . n 
B 1 43  GLU 43  35  35  GLU GLU B . n 
B 1 44  LEU 44  36  36  LEU LEU B . n 
B 1 45  PRO 45  37  37  PRO PRO B . n 
B 1 46  LYS 46  38  38  LYS LYS B . n 
B 1 47  LEU 47  39  39  LEU LEU B . n 
B 1 48  GLY 48  40  40  GLY GLY B . n 
B 1 49  PHE 49  41  41  PHE PHE B . n 
B 1 50  ASN 50  42  42  ASN ASN B . n 
B 1 51  TRP 51  43  43  TRP TRP B . n 
B 1 52  LYS 52  44  44  LYS LYS B . n 
B 1 53  ASP 53  45  45  ASP ASP B . n 
B 1 54  GLY 54  46  46  GLY GLY B . n 
B 1 55  CYS 55  47  47  CYS CYS B . n 
B 1 56  ALA 56  48  48  ALA ALA B . n 
B 1 57  PRO 57  49  49  PRO PRO B . n 
B 1 58  VAL 58  50  50  VAL VAL B . n 
B 1 59  PHE 59  51  51  PHE PHE B . n 
B 1 60  SER 60  52  52  SER SER B . n 
B 1 61  PRO 61  53  53  PRO PRO B . n 
B 1 62  ARG 62  54  54  ARG ARG B . n 
B 1 63  GLN 63  55  55  GLN GLN B . n 
B 1 64  MET 64  56  56  MET MET B . n 
B 1 65  GLU 65  57  57  GLU GLU B . n 
B 1 66  LEU 66  58  58  LEU LEU B . n 
B 1 67  HIS 67  59  59  HIS HIS B . n 
B 1 68  TYR 68  60  60  TYR TYR B . n 
B 1 69  THR 69  61  61  THR THR B . n 
B 1 70  LYS 70  62  62  LYS LYS B . n 
B 1 71  HIS 71  63  63  HIS HIS B . n 
B 1 72  HIS 72  64  64  HIS HIS B . n 
B 1 73  LYS 73  65  65  LYS LYS B . n 
B 1 74  ALA 74  66  66  ALA ALA B . n 
B 1 75  TYR 75  67  67  TYR TYR B . n 
B 1 76  VAL 76  68  68  VAL VAL B . n 
B 1 77  ASP 77  69  69  ASP ASP B . n 
B 1 78  LYS 78  70  70  LYS LYS B . n 
B 1 79  LEU 79  71  71  LEU LEU B . n 
B 1 80  ASN 80  72  72  ASN ASN B . n 
B 1 81  ALA 81  73  73  ALA ALA B . n 
B 1 82  LEU 82  74  74  LEU LEU B . n 
B 1 83  ALA 83  75  75  ALA ALA B . n 
B 1 84  GLY 84  76  76  GLY GLY B . n 
B 1 85  THR 85  77  77  THR THR B . n 
B 1 86  THR 86  78  78  THR THR B . n 
B 1 87  TYR 87  79  79  TYR TYR B . n 
B 1 88  ASP 88  80  80  ASP ASP B . n 
B 1 89  GLY 89  81  81  GLY GLY B . n 
B 1 90  LYS 90  82  82  LYS LYS B . n 
B 1 91  SER 91  83  83  SER SER B . n 
B 1 92  ILE 92  84  84  ILE ILE B . n 
B 1 93  GLU 93  85  85  GLU GLU B . n 
B 1 94  GLU 94  86  86  GLU GLU B . n 
B 1 95  ILE 95  87  87  ILE ILE B . n 
B 1 96  ILE 96  88  88  ILE ILE B . n 
B 1 97  LEU 97  89  89  LEU LEU B . n 
B 1 98  ALA 98  90  90  ALA ALA B . n 
B 1 99  VAL 99  91  91  VAL VAL B . n 
B 1 100 ALA 100 92  92  ALA ALA B . n 
B 1 101 ASN 101 93  93  ASN ASN B . n 
B 1 102 ASP 102 94  94  ASP ASP B . n 
B 1 103 ALA 103 95  95  ALA ALA B . n 
B 1 104 GLU 104 96  96  GLU GLU B . n 
B 1 105 LYS 105 97  97  LYS LYS B . n 
B 1 106 LYS 106 98  98  LYS LYS B . n 
B 1 107 GLY 107 99  99  GLY GLY B . n 
B 1 108 LEU 108 100 100 LEU LEU B . n 
B 1 109 PHE 109 101 101 PHE PHE B . n 
B 1 110 ASN 110 102 102 ASN ASN B . n 
B 1 111 GLN 111 103 103 GLN GLN B . n 
B 1 112 ALA 112 104 104 ALA ALA B . n 
B 1 113 ALA 113 105 105 ALA ALA B . n 
B 1 114 GLN 114 106 106 GLN GLN B . n 
B 1 115 HIS 115 107 107 HIS HIS B . n 
B 1 116 PHE 116 108 108 PHE PHE B . n 
B 1 117 ASN 117 109 109 ASN ASN B . n 
B 1 118 HIS 118 110 110 HIS HIS B . n 
B 1 119 THR 119 111 111 THR THR B . n 
B 1 120 PHE 120 112 112 PHE PHE B . n 
B 1 121 TYR 121 113 113 TYR TYR B . n 
B 1 122 PHE 122 114 114 PHE PHE B . n 
B 1 123 ARG 123 115 115 ARG ARG B . n 
B 1 124 CYS 124 116 116 CYS CYS B . n 
B 1 125 ILE 125 117 117 ILE ILE B . n 
B 1 126 THR 126 118 118 THR THR B . n 
B 1 127 PRO 127 119 119 PRO PRO B . n 
B 1 128 ASN 128 120 120 ASN ASN B . n 
B 1 129 GLY 129 121 121 GLY GLY B . n 
B 1 130 LYS 130 122 122 LYS LYS B . n 
B 1 131 ALA 131 123 123 ALA ALA B . n 
B 1 132 MET 132 124 124 MET MET B . n 
B 1 133 PRO 133 125 125 PRO PRO B . n 
B 1 134 LYS 134 126 126 LYS LYS B . n 
B 1 135 SER 135 127 127 SER SER B . n 
B 1 136 PHE 136 128 128 PHE PHE B . n 
B 1 137 GLU 137 129 129 GLU GLU B . n 
B 1 138 SER 138 130 130 SER SER B . n 
B 1 139 ALA 139 131 131 ALA ALA B . n 
B 1 140 VAL 140 132 132 VAL VAL B . n 
B 1 141 THR 141 133 133 THR THR B . n 
B 1 142 ALA 142 134 134 ALA ALA B . n 
B 1 143 GLN 143 135 135 GLN GLN B . n 
B 1 144 PHE 144 136 136 PHE PHE B . n 
B 1 145 GLY 145 137 137 GLY GLY B . n 
B 1 146 SER 146 138 138 SER SER B . n 
B 1 147 VAL 147 139 139 VAL VAL B . n 
B 1 148 GLU 148 140 140 GLU GLU B . n 
B 1 149 GLN 149 141 141 GLN GLN B . n 
B 1 150 PHE 150 142 142 PHE PHE B . n 
B 1 151 LYS 151 143 143 LYS LYS B . n 
B 1 152 ASP 152 144 144 ASP ASP B . n 
B 1 153 ALA 153 145 145 ALA ALA B . n 
B 1 154 PHE 154 146 146 PHE PHE B . n 
B 1 155 VAL 155 147 147 VAL VAL B . n 
B 1 156 GLN 156 148 148 GLN GLN B . n 
B 1 157 ALA 157 149 149 ALA ALA B . n 
B 1 158 GLY 158 150 150 GLY GLY B . n 
B 1 159 VAL 159 151 151 VAL VAL B . n 
B 1 160 ASN 160 152 152 ASN ASN B . n 
B 1 161 ASN 161 153 153 ASN ASN B . n 
B 1 162 PHE 162 154 154 PHE PHE B . n 
B 1 163 GLY 163 155 155 GLY GLY B . n 
B 1 164 SER 164 156 156 SER SER B . n 
B 1 165 GLY 165 157 157 GLY GLY B . n 
B 1 166 TRP 166 158 158 TRP TRP B . n 
B 1 167 THR 167 159 159 THR THR B . n 
B 1 168 TRP 168 160 160 TRP TRP B . n 
B 1 169 LEU 169 161 161 LEU LEU B . n 
B 1 170 CYS 170 162 162 CYS CYS B . n 
B 1 171 VAL 171 163 163 VAL VAL B . n 
B 1 172 ASP 172 164 164 ASP ASP B . n 
B 1 173 PRO 173 165 165 PRO PRO B . n 
B 1 174 SER 174 166 166 SER SER B . n 
B 1 175 ASN 175 167 167 ASN ASN B . n 
B 1 176 LYS 176 168 168 LYS LYS B . n 
B 1 177 ASN 177 169 169 ASN ASN B . n 
B 1 178 GLN 178 170 170 GLN GLN B . n 
B 1 179 LEU 179 171 171 LEU LEU B . n 
B 1 180 VAL 180 172 172 VAL VAL B . n 
B 1 181 ILE 181 173 173 ILE ILE B . n 
B 1 182 ASP 182 174 174 ASP ASP B . n 
B 1 183 ASN 183 175 175 ASN ASN B . n 
B 1 184 THR 184 176 176 THR THR B . n 
B 1 185 SER 185 177 177 SER SER B . n 
B 1 186 ASN 186 178 178 ASN ASN B . n 
B 1 187 ALA 187 179 179 ALA ALA B . n 
B 1 188 GLY 188 180 180 GLY GLY B . n 
B 1 189 CYS 189 181 181 CYS CYS B . n 
B 1 190 PRO 190 182 182 PRO PRO B . n 
B 1 191 LEU 191 183 183 LEU LEU B . n 
B 1 192 THR 192 184 184 THR THR B . n 
B 1 193 LYS 193 185 185 LYS LYS B . n 
B 1 194 GLY 194 186 186 GLY GLY B . n 
B 1 195 LEU 195 187 187 LEU LEU B . n 
B 1 196 ARG 196 188 188 ARG ARG B . n 
B 1 197 PRO 197 189 189 PRO PRO B . n 
B 1 198 VAL 198 190 190 VAL VAL B . n 
B 1 199 LEU 199 191 191 LEU LEU B . n 
B 1 200 ALA 200 192 192 ALA ALA B . n 
B 1 201 VAL 201 193 193 VAL VAL B . n 
B 1 202 ASP 202 194 194 ASP ASP B . n 
B 1 203 VAL 203 195 195 VAL VAL B . n 
B 1 204 TRP 204 196 196 TRP TRP B . n 
B 1 205 GLU 205 197 197 GLU GLU B . n 
B 1 206 HIS 206 198 198 HIS HIS B . n 
B 1 207 ALA 207 199 199 ALA ALA B . n 
B 1 208 TYR 208 200 200 TYR TYR B . n 
B 1 209 TYR 209 201 201 TYR TYR B . n 
B 1 210 LYS 210 202 202 LYS LYS B . n 
B 1 211 ASP 211 203 203 ASP ASP B . n 
B 1 212 PHE 212 204 204 PHE PHE B . n 
B 1 213 GLU 213 205 205 GLU GLU B . n 
B 1 214 ASN 214 206 206 ASN ASN B . n 
B 1 215 ARG 215 207 207 ARG ARG B . n 
B 1 216 ARG 216 208 208 ARG ARG B . n 
B 1 217 PRO 217 209 209 PRO PRO B . n 
B 1 218 ASP 218 210 210 ASP ASP B . n 
B 1 219 TYR 219 211 211 TYR TYR B . n 
B 1 220 LEU 220 212 212 LEU LEU B . n 
B 1 221 LYS 221 213 213 LYS LYS B . n 
B 1 222 GLU 222 214 214 GLU GLU B . n 
B 1 223 ILE 223 215 215 ILE ILE B . n 
B 1 224 TRP 224 216 216 TRP TRP B . n 
B 1 225 SER 225 217 217 SER SER B . n 
B 1 226 VAL 226 218 218 VAL VAL B . n 
B 1 227 ILE 227 219 219 ILE ILE B . n 
B 1 228 ASP 228 220 220 ASP ASP B . n 
B 1 229 TRP 229 221 221 TRP TRP B . n 
B 1 230 GLU 230 222 222 GLU GLU B . n 
B 1 231 PHE 231 223 223 PHE PHE B . n 
B 1 232 VAL 232 224 224 VAL VAL B . n 
B 1 233 ALA 233 225 225 ALA ALA B . n 
B 1 234 LYS 234 226 226 LYS LYS B . n 
B 1 235 MET 235 227 227 MET MET B . n 
B 1 236 HIS 236 228 228 HIS HIS B . n 
B 1 237 ALA 237 229 229 ALA ALA B . n 
B 1 238 GLN 238 230 230 GLN GLN B . n 
B 1 239 ALA 239 231 231 ALA ALA B . n 
B 1 240 ILE 240 232 232 ILE ILE B . n 
B 1 241 LYS 241 233 233 LYS LYS B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NIAID, National Institute of Allergy and Infectious Diseases' 
_pdbx_SG_project.full_name_of_center   'Seattle Structural Genomics Center for Infectious Disease' 
_pdbx_SG_project.initial_of_center     SSGCID 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? B ASP 202 ? B ASP 194 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 118 ? B HIS 110 ? 1_555 118.1 ? 
2  OD2 ? B ASP 202 ? B ASP 194 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 206 ? B HIS 198 ? 1_555 122.0 ? 
3  NE2 ? B HIS 118 ? B HIS 110 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 206 ? B HIS 198 ? 1_555 119.8 ? 
4  OD2 ? B ASP 202 ? B ASP 194 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 O   ? F HOH .   ? B HOH 402 ? 1_555 90.3  ? 
5  NE2 ? B HIS 118 ? B HIS 110 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 O   ? F HOH .   ? B HOH 402 ? 1_555 89.8  ? 
6  NE2 ? B HIS 206 ? B HIS 198 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 O   ? F HOH .   ? B HOH 402 ? 1_555 87.4  ? 
7  OD2 ? B ASP 202 ? B ASP 194 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 67  ? B HIS 59  ? 1_555 81.1  ? 
8  NE2 ? B HIS 118 ? B HIS 110 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 67  ? B HIS 59  ? 1_555 95.9  ? 
9  NE2 ? B HIS 206 ? B HIS 198 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 67  ? B HIS 59  ? 1_555 95.6  ? 
10 O   ? F HOH .   ? B HOH 402 ? 1_555 FE ? D FE2 . ? B FE2 301 ? 1_555 NE2 ? B HIS 67  ? B HIS 59  ? 1_555 171.2 ? 
11 OD2 ? A ASP 202 ? A ASP 194 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 206 ? A HIS 198 ? 1_555 123.0 ? 
12 OD2 ? A ASP 202 ? A ASP 194 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 118 ? A HIS 110 ? 1_555 116.0 ? 
13 NE2 ? A HIS 206 ? A HIS 198 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 118 ? A HIS 110 ? 1_555 120.3 ? 
14 OD2 ? A ASP 202 ? A ASP 194 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 67  ? A HIS 59  ? 1_555 79.9  ? 
15 NE2 ? A HIS 206 ? A HIS 198 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 67  ? A HIS 59  ? 1_555 99.4  ? 
16 NE2 ? A HIS 118 ? A HIS 110 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 67  ? A HIS 59  ? 1_555 98.6  ? 
17 OD2 ? A ASP 202 ? A ASP 194 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 O   ? E HOH .   ? A HOH 402 ? 1_555 86.3  ? 
18 NE2 ? A HIS 206 ? A HIS 198 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 O   ? E HOH .   ? A HOH 402 ? 1_555 86.3  ? 
19 NE2 ? A HIS 118 ? A HIS 110 ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 O   ? E HOH .   ? A HOH 402 ? 1_555 89.5  ? 
20 NE2 ? A HIS 67  ? A HIS 59  ? 1_555 FE ? C FE2 . ? A FE2 301 ? 1_555 O   ? E HOH .   ? A HOH 402 ? 1_555 166.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-09-26 
2 'Structure model' 1 1 2015-06-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 10.2983 1.0483  6.1511  0.0531 0.0108 0.0024 0.0000 -0.0076 0.0009  0.6030 0.2751 0.1527 -0.0847 
0.0463  -0.0099 0.0286  -0.0256 -0.0031 0.0231  -0.0274 0.0054  -0.0343 -0.0137 -0.0050 
'X-RAY DIFFRACTION' 2 ? refined 24.5696 11.2692 31.6990 0.0306 0.0120 0.0273 0.0022 -0.0133 -0.0104 0.4817 0.2454 0.2134 -0.1651 
-0.1367 -0.0257 -0.0113 0.0275  -0.0162 -0.0289 0.0100  -0.0346 0.0047  -0.0024 -0.0133 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 20  A 233 ? . . . . ? 
'X-RAY DIFFRACTION' 2 1 A 301 A 301 ? . . . . ? 
'X-RAY DIFFRACTION' 3 2 B 20  B 233 ? . . . . ? 
'X-RAY DIFFRACTION' 4 2 B 301 B 301 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     4H3E 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           44.150 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        44.150 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 XSCALE      .        ?                                package 'Wolfgang Kabsch'    ?                           'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
2 PHASER      2.5.1    'Fri Jul 6 14:21:49 2012 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/                                 ?          ? 
3 REFMAC      5.7.0029 ?                                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 
4 PDB_EXTRACT 3.11     'April 22, 2011'                 package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
5 XDS         .        ?                                ?       ?                    ?                           'data reduction'  
?                                                                           ?          ? 
# 
_pdbx_entry_details.entry_id             4H3E 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'L128F IS A NATURAL VARIANT.' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              207 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              207 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              207 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.33 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.03 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 62  ? ? -107.86 -63.95  
2 1 ASN A 178 ? ? 62.88   -112.52 
3 1 GLU A 205 ? ? 51.71   -130.73 
4 1 LYS B 62  ? ? -109.52 -63.21  
5 1 ASN B 178 ? ? 59.51   -111.63 
6 1 GLU B 205 ? ? 50.69   -131.12 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 38  ? CG  ? A LYS 46  CG  
2  1 Y 1 A LYS 38  ? CD  ? A LYS 46  CD  
3  1 Y 1 A LYS 38  ? CE  ? A LYS 46  CE  
4  1 Y 1 A LYS 38  ? NZ  ? A LYS 46  NZ  
5  1 Y 1 A LYS 126 ? CG  ? A LYS 134 CG  
6  1 Y 1 A LYS 126 ? CD  ? A LYS 134 CD  
7  1 Y 1 A LYS 126 ? CE  ? A LYS 134 CE  
8  1 Y 1 A LYS 126 ? NZ  ? A LYS 134 NZ  
9  1 Y 1 A GLN 170 ? CG  ? A GLN 178 CG  
10 1 Y 1 A GLN 170 ? CD  ? A GLN 178 CD  
11 1 Y 1 A GLN 170 ? OE1 ? A GLN 178 OE1 
12 1 Y 1 A GLN 170 ? NE2 ? A GLN 178 NE2 
13 1 Y 1 A LYS 233 ? CG  ? A LYS 241 CG  
14 1 Y 1 A LYS 233 ? CD  ? A LYS 241 CD  
15 1 Y 1 A LYS 233 ? CE  ? A LYS 241 CE  
16 1 Y 1 A LYS 233 ? NZ  ? A LYS 241 NZ  
17 1 Y 1 B GLU 96  ? CG  ? B GLU 104 CG  
18 1 Y 1 B GLU 96  ? CD  ? B GLU 104 CD  
19 1 Y 1 B GLU 96  ? OE1 ? B GLU 104 OE1 
20 1 Y 1 B GLU 96  ? OE2 ? B GLU 104 OE2 
21 1 Y 1 B LYS 97  ? CG  ? B LYS 105 CG  
22 1 Y 1 B LYS 97  ? CD  ? B LYS 105 CD  
23 1 Y 1 B LYS 97  ? CE  ? B LYS 105 CE  
24 1 Y 1 B LYS 97  ? NZ  ? B LYS 105 NZ  
25 1 Y 1 B LYS 98  ? CG  ? B LYS 106 CG  
26 1 Y 1 B LYS 98  ? CD  ? B LYS 106 CD  
27 1 Y 1 B LYS 98  ? CE  ? B LYS 106 CE  
28 1 Y 1 B LYS 98  ? NZ  ? B LYS 106 NZ  
29 1 Y 1 B LYS 126 ? CG  ? B LYS 134 CG  
30 1 Y 1 B LYS 126 ? CD  ? B LYS 134 CD  
31 1 Y 1 B LYS 126 ? CE  ? B LYS 134 CE  
32 1 Y 1 B LYS 126 ? NZ  ? B LYS 134 NZ  
33 1 Y 1 B GLN 148 ? CG  ? B GLN 156 CG  
34 1 Y 1 B GLN 148 ? CD  ? B GLN 156 CD  
35 1 Y 1 B GLN 148 ? OE1 ? B GLN 156 OE1 
36 1 Y 1 B GLN 148 ? NE2 ? B GLN 156 NE2 
37 1 Y 1 B GLN 170 ? CG  ? B GLN 178 CG  
38 1 Y 1 B GLN 170 ? CD  ? B GLN 178 CD  
39 1 Y 1 B GLN 170 ? OE1 ? B GLN 178 OE1 
40 1 Y 1 B GLN 170 ? NE2 ? B GLN 178 NE2 
41 1 Y 1 B LYS 226 ? CG  ? B LYS 234 CG  
42 1 Y 1 B LYS 226 ? CD  ? B LYS 234 CD  
43 1 Y 1 B LYS 226 ? CE  ? B LYS 234 CE  
44 1 Y 1 B LYS 226 ? NZ  ? B LYS 234 NZ  
45 1 Y 1 B GLN 230 ? CG  ? B GLN 238 CG  
46 1 Y 1 B GLN 230 ? CD  ? B GLN 238 CD  
47 1 Y 1 B GLN 230 ? OE1 ? B GLN 238 OE1 
48 1 Y 1 B GLN 230 ? NE2 ? B GLN 238 NE2 
49 1 Y 1 B LYS 233 ? CG  ? B LYS 241 CG  
50 1 Y 1 B LYS 233 ? CD  ? B LYS 241 CD  
51 1 Y 1 B LYS 233 ? CE  ? B LYS 241 CE  
52 1 Y 1 B LYS 233 ? NZ  ? B LYS 241 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -7 ? A MET 1  
2  1 Y 1 A ALA -6 ? A ALA 2  
3  1 Y 1 A HIS -5 ? A HIS 3  
4  1 Y 1 A HIS -4 ? A HIS 4  
5  1 Y 1 A HIS -3 ? A HIS 5  
6  1 Y 1 A HIS -2 ? A HIS 6  
7  1 Y 1 A HIS -1 ? A HIS 7  
8  1 Y 1 A HIS 0  ? A HIS 8  
9  1 Y 1 A MET 1  ? A MET 9  
10 1 Y 1 A LEU 2  ? A LEU 10 
11 1 Y 1 A ARG 3  ? A ARG 11 
12 1 Y 1 A ARG 4  ? A ARG 12 
13 1 Y 1 A ALA 5  ? A ALA 13 
14 1 Y 1 A VAL 6  ? A VAL 14 
15 1 Y 1 A ASN 7  ? A ASN 15 
16 1 Y 1 A ILE 8  ? A ILE 16 
17 1 Y 1 A SER 9  ? A SER 17 
18 1 Y 1 A ILE 10 ? A ILE 18 
19 1 Y 1 A ALA 11 ? A ALA 19 
20 1 Y 1 A ARG 12 ? A ARG 20 
21 1 Y 1 A GLY 13 ? A GLY 21 
22 1 Y 1 A ARG 14 ? A ARG 22 
23 1 Y 1 A MET 15 ? A MET 23 
24 1 Y 1 A ALA 16 ? A ALA 24 
25 1 Y 1 A LEU 17 ? A LEU 25 
26 1 Y 1 A MET 18 ? A MET 26 
27 1 Y 1 A SER 19 ? A SER 27 
28 1 Y 1 B MET -7 ? B MET 1  
29 1 Y 1 B ALA -6 ? B ALA 2  
30 1 Y 1 B HIS -5 ? B HIS 3  
31 1 Y 1 B HIS -4 ? B HIS 4  
32 1 Y 1 B HIS -3 ? B HIS 5  
33 1 Y 1 B HIS -2 ? B HIS 6  
34 1 Y 1 B HIS -1 ? B HIS 7  
35 1 Y 1 B HIS 0  ? B HIS 8  
36 1 Y 1 B MET 1  ? B MET 9  
37 1 Y 1 B LEU 2  ? B LEU 10 
38 1 Y 1 B ARG 3  ? B ARG 11 
39 1 Y 1 B ARG 4  ? B ARG 12 
40 1 Y 1 B ALA 5  ? B ALA 13 
41 1 Y 1 B VAL 6  ? B VAL 14 
42 1 Y 1 B ASN 7  ? B ASN 15 
43 1 Y 1 B ILE 8  ? B ILE 16 
44 1 Y 1 B SER 9  ? B SER 17 
45 1 Y 1 B ILE 10 ? B ILE 18 
46 1 Y 1 B ALA 11 ? B ALA 19 
47 1 Y 1 B ARG 12 ? B ARG 20 
48 1 Y 1 B GLY 13 ? B GLY 21 
49 1 Y 1 B ARG 14 ? B ARG 22 
50 1 Y 1 B MET 15 ? B MET 23 
51 1 Y 1 B ALA 16 ? B ALA 24 
52 1 Y 1 B LEU 17 ? B LEU 25 
53 1 Y 1 B MET 18 ? B MET 26 
54 1 Y 1 B SER 19 ? B SER 27 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (II) ION' FE2 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FE2 1   301 234 FE2 FE2 A . 
D 2 FE2 1   301 234 FE2 FE2 B . 
E 3 HOH 1   401 1   HOH HOH A . 
E 3 HOH 2   402 2   HOH HOH A . 
E 3 HOH 3   403 3   HOH HOH A . 
E 3 HOH 4   404 4   HOH HOH A . 
E 3 HOH 5   405 5   HOH HOH A . 
E 3 HOH 6   406 20  HOH HOH A . 
E 3 HOH 7   407 24  HOH HOH A . 
E 3 HOH 8   408 26  HOH HOH A . 
E 3 HOH 9   409 27  HOH HOH A . 
E 3 HOH 10  410 28  HOH HOH A . 
E 3 HOH 11  411 29  HOH HOH A . 
E 3 HOH 12  412 31  HOH HOH A . 
E 3 HOH 13  413 33  HOH HOH A . 
E 3 HOH 14  414 35  HOH HOH A . 
E 3 HOH 15  415 43  HOH HOH A . 
E 3 HOH 16  416 47  HOH HOH A . 
E 3 HOH 17  417 49  HOH HOH A . 
E 3 HOH 18  418 50  HOH HOH A . 
E 3 HOH 19  419 54  HOH HOH A . 
E 3 HOH 20  420 61  HOH HOH A . 
E 3 HOH 21  421 62  HOH HOH A . 
E 3 HOH 22  422 63  HOH HOH A . 
E 3 HOH 23  423 64  HOH HOH A . 
E 3 HOH 24  424 65  HOH HOH A . 
E 3 HOH 25  425 66  HOH HOH A . 
E 3 HOH 26  426 67  HOH HOH A . 
E 3 HOH 27  427 68  HOH HOH A . 
E 3 HOH 28  428 69  HOH HOH A . 
E 3 HOH 29  429 72  HOH HOH A . 
E 3 HOH 30  430 76  HOH HOH A . 
E 3 HOH 31  431 78  HOH HOH A . 
E 3 HOH 32  432 79  HOH HOH A . 
E 3 HOH 33  433 80  HOH HOH A . 
E 3 HOH 34  434 82  HOH HOH A . 
E 3 HOH 35  435 85  HOH HOH A . 
E 3 HOH 36  436 87  HOH HOH A . 
E 3 HOH 37  437 88  HOH HOH A . 
E 3 HOH 38  438 93  HOH HOH A . 
E 3 HOH 39  439 96  HOH HOH A . 
E 3 HOH 40  440 97  HOH HOH A . 
E 3 HOH 41  441 99  HOH HOH A . 
E 3 HOH 42  442 101 HOH HOH A . 
E 3 HOH 43  443 106 HOH HOH A . 
E 3 HOH 44  444 114 HOH HOH A . 
E 3 HOH 45  445 116 HOH HOH A . 
E 3 HOH 46  446 118 HOH HOH A . 
E 3 HOH 47  447 120 HOH HOH A . 
E 3 HOH 48  448 121 HOH HOH A . 
E 3 HOH 49  449 122 HOH HOH A . 
E 3 HOH 50  450 123 HOH HOH A . 
E 3 HOH 51  451 124 HOH HOH A . 
E 3 HOH 52  452 125 HOH HOH A . 
E 3 HOH 53  453 126 HOH HOH A . 
E 3 HOH 54  454 127 HOH HOH A . 
E 3 HOH 55  455 128 HOH HOH A . 
E 3 HOH 56  456 129 HOH HOH A . 
E 3 HOH 57  457 130 HOH HOH A . 
E 3 HOH 58  458 131 HOH HOH A . 
E 3 HOH 59  459 132 HOH HOH A . 
E 3 HOH 60  460 133 HOH HOH A . 
E 3 HOH 61  461 134 HOH HOH A . 
E 3 HOH 62  462 137 HOH HOH A . 
E 3 HOH 63  463 138 HOH HOH A . 
E 3 HOH 64  464 139 HOH HOH A . 
E 3 HOH 65  465 140 HOH HOH A . 
E 3 HOH 66  466 141 HOH HOH A . 
E 3 HOH 67  467 142 HOH HOH A . 
E 3 HOH 68  468 143 HOH HOH A . 
E 3 HOH 69  469 144 HOH HOH A . 
E 3 HOH 70  470 145 HOH HOH A . 
E 3 HOH 71  471 146 HOH HOH A . 
E 3 HOH 72  472 149 HOH HOH A . 
E 3 HOH 73  473 150 HOH HOH A . 
E 3 HOH 74  474 151 HOH HOH A . 
E 3 HOH 75  475 152 HOH HOH A . 
E 3 HOH 76  476 153 HOH HOH A . 
E 3 HOH 77  477 155 HOH HOH A . 
E 3 HOH 78  478 156 HOH HOH A . 
E 3 HOH 79  479 157 HOH HOH A . 
E 3 HOH 80  480 158 HOH HOH A . 
E 3 HOH 81  481 159 HOH HOH A . 
E 3 HOH 82  482 160 HOH HOH A . 
E 3 HOH 83  483 161 HOH HOH A . 
E 3 HOH 84  484 162 HOH HOH A . 
E 3 HOH 85  485 200 HOH HOH A . 
E 3 HOH 86  486 201 HOH HOH A . 
E 3 HOH 87  487 202 HOH HOH A . 
E 3 HOH 88  488 203 HOH HOH A . 
E 3 HOH 89  489 204 HOH HOH A . 
E 3 HOH 90  490 205 HOH HOH A . 
E 3 HOH 91  491 206 HOH HOH A . 
E 3 HOH 92  492 207 HOH HOH A . 
E 3 HOH 93  493 208 HOH HOH A . 
E 3 HOH 94  494 209 HOH HOH A . 
E 3 HOH 95  495 210 HOH HOH A . 
E 3 HOH 96  496 211 HOH HOH A . 
E 3 HOH 97  497 212 HOH HOH A . 
E 3 HOH 98  498 213 HOH HOH A . 
E 3 HOH 99  499 214 HOH HOH A . 
E 3 HOH 100 500 216 HOH HOH A . 
E 3 HOH 101 501 221 HOH HOH A . 
E 3 HOH 102 502 222 HOH HOH A . 
E 3 HOH 103 503 223 HOH HOH A . 
E 3 HOH 104 504 224 HOH HOH A . 
E 3 HOH 105 505 225 HOH HOH A . 
E 3 HOH 106 506 226 HOH HOH A . 
E 3 HOH 107 507 227 HOH HOH A . 
E 3 HOH 108 508 228 HOH HOH A . 
E 3 HOH 109 509 229 HOH HOH A . 
E 3 HOH 110 510 230 HOH HOH A . 
E 3 HOH 111 511 231 HOH HOH A . 
E 3 HOH 112 512 232 HOH HOH A . 
E 3 HOH 113 513 233 HOH HOH A . 
E 3 HOH 114 514 234 HOH HOH A . 
E 3 HOH 115 515 235 HOH HOH A . 
E 3 HOH 116 516 236 HOH HOH A . 
E 3 HOH 117 517 237 HOH HOH A . 
E 3 HOH 118 518 238 HOH HOH A . 
E 3 HOH 119 519 239 HOH HOH A . 
E 3 HOH 120 520 240 HOH HOH A . 
E 3 HOH 121 521 241 HOH HOH A . 
E 3 HOH 122 522 242 HOH HOH A . 
E 3 HOH 123 523 243 HOH HOH A . 
E 3 HOH 124 524 244 HOH HOH A . 
E 3 HOH 125 525 245 HOH HOH A . 
E 3 HOH 126 526 246 HOH HOH A . 
E 3 HOH 127 527 247 HOH HOH A . 
E 3 HOH 128 528 248 HOH HOH A . 
E 3 HOH 129 529 249 HOH HOH A . 
E 3 HOH 130 530 250 HOH HOH A . 
E 3 HOH 131 531 251 HOH HOH A . 
E 3 HOH 132 532 252 HOH HOH A . 
E 3 HOH 133 533 253 HOH HOH A . 
E 3 HOH 134 534 254 HOH HOH A . 
E 3 HOH 135 535 255 HOH HOH A . 
E 3 HOH 136 536 256 HOH HOH A . 
E 3 HOH 137 537 257 HOH HOH A . 
E 3 HOH 138 538 268 HOH HOH A . 
E 3 HOH 139 539 283 HOH HOH A . 
E 3 HOH 140 540 292 HOH HOH A . 
E 3 HOH 141 541 293 HOH HOH A . 
E 3 HOH 142 542 294 HOH HOH A . 
E 3 HOH 143 543 295 HOH HOH A . 
E 3 HOH 144 544 296 HOH HOH A . 
E 3 HOH 145 545 297 HOH HOH A . 
E 3 HOH 146 546 298 HOH HOH A . 
E 3 HOH 147 547 299 HOH HOH A . 
E 3 HOH 148 548 300 HOH HOH A . 
E 3 HOH 149 549 301 HOH HOH A . 
E 3 HOH 150 550 302 HOH HOH A . 
E 3 HOH 151 551 303 HOH HOH A . 
E 3 HOH 152 552 304 HOH HOH A . 
E 3 HOH 153 553 305 HOH HOH A . 
E 3 HOH 154 554 306 HOH HOH A . 
E 3 HOH 155 555 335 HOH HOH A . 
E 3 HOH 156 556 336 HOH HOH A . 
E 3 HOH 157 557 337 HOH HOH A . 
E 3 HOH 158 558 338 HOH HOH A . 
E 3 HOH 159 559 339 HOH HOH A . 
E 3 HOH 160 560 340 HOH HOH A . 
E 3 HOH 161 561 341 HOH HOH A . 
E 3 HOH 162 562 342 HOH HOH A . 
E 3 HOH 163 563 343 HOH HOH A . 
E 3 HOH 164 564 344 HOH HOH A . 
E 3 HOH 165 565 345 HOH HOH A . 
E 3 HOH 166 566 346 HOH HOH A . 
E 3 HOH 167 567 347 HOH HOH A . 
E 3 HOH 168 568 348 HOH HOH A . 
F 3 HOH 1   401 6   HOH HOH B . 
F 3 HOH 2   402 7   HOH HOH B . 
F 3 HOH 3   403 8   HOH HOH B . 
F 3 HOH 4   404 9   HOH HOH B . 
F 3 HOH 5   405 10  HOH HOH B . 
F 3 HOH 6   406 11  HOH HOH B . 
F 3 HOH 7   407 12  HOH HOH B . 
F 3 HOH 8   408 13  HOH HOH B . 
F 3 HOH 9   409 14  HOH HOH B . 
F 3 HOH 10  410 15  HOH HOH B . 
F 3 HOH 11  411 16  HOH HOH B . 
F 3 HOH 12  412 17  HOH HOH B . 
F 3 HOH 13  413 18  HOH HOH B . 
F 3 HOH 14  414 19  HOH HOH B . 
F 3 HOH 15  415 21  HOH HOH B . 
F 3 HOH 16  416 22  HOH HOH B . 
F 3 HOH 17  417 23  HOH HOH B . 
F 3 HOH 18  418 25  HOH HOH B . 
F 3 HOH 19  419 30  HOH HOH B . 
F 3 HOH 20  420 32  HOH HOH B . 
F 3 HOH 21  421 34  HOH HOH B . 
F 3 HOH 22  422 36  HOH HOH B . 
F 3 HOH 23  423 37  HOH HOH B . 
F 3 HOH 24  424 38  HOH HOH B . 
F 3 HOH 25  425 39  HOH HOH B . 
F 3 HOH 26  426 40  HOH HOH B . 
F 3 HOH 27  427 41  HOH HOH B . 
F 3 HOH 28  428 42  HOH HOH B . 
F 3 HOH 29  429 44  HOH HOH B . 
F 3 HOH 30  430 45  HOH HOH B . 
F 3 HOH 31  431 46  HOH HOH B . 
F 3 HOH 32  432 48  HOH HOH B . 
F 3 HOH 33  433 51  HOH HOH B . 
F 3 HOH 34  434 52  HOH HOH B . 
F 3 HOH 35  435 53  HOH HOH B . 
F 3 HOH 36  436 55  HOH HOH B . 
F 3 HOH 37  437 56  HOH HOH B . 
F 3 HOH 38  438 57  HOH HOH B . 
F 3 HOH 39  439 58  HOH HOH B . 
F 3 HOH 40  440 59  HOH HOH B . 
F 3 HOH 41  441 60  HOH HOH B . 
F 3 HOH 42  442 70  HOH HOH B . 
F 3 HOH 43  443 71  HOH HOH B . 
F 3 HOH 44  444 73  HOH HOH B . 
F 3 HOH 45  445 74  HOH HOH B . 
F 3 HOH 46  446 75  HOH HOH B . 
F 3 HOH 47  447 77  HOH HOH B . 
F 3 HOH 48  448 81  HOH HOH B . 
F 3 HOH 49  449 83  HOH HOH B . 
F 3 HOH 50  450 84  HOH HOH B . 
F 3 HOH 51  451 86  HOH HOH B . 
F 3 HOH 52  452 89  HOH HOH B . 
F 3 HOH 53  453 90  HOH HOH B . 
F 3 HOH 54  454 91  HOH HOH B . 
F 3 HOH 55  455 92  HOH HOH B . 
F 3 HOH 56  456 94  HOH HOH B . 
F 3 HOH 57  457 95  HOH HOH B . 
F 3 HOH 58  458 98  HOH HOH B . 
F 3 HOH 59  459 100 HOH HOH B . 
F 3 HOH 60  460 102 HOH HOH B . 
F 3 HOH 61  461 103 HOH HOH B . 
F 3 HOH 62  462 104 HOH HOH B . 
F 3 HOH 63  463 105 HOH HOH B . 
F 3 HOH 64  464 107 HOH HOH B . 
F 3 HOH 65  465 108 HOH HOH B . 
F 3 HOH 66  466 109 HOH HOH B . 
F 3 HOH 67  467 110 HOH HOH B . 
F 3 HOH 68  468 111 HOH HOH B . 
F 3 HOH 69  469 112 HOH HOH B . 
F 3 HOH 70  470 113 HOH HOH B . 
F 3 HOH 71  471 115 HOH HOH B . 
F 3 HOH 72  472 117 HOH HOH B . 
F 3 HOH 73  473 119 HOH HOH B . 
F 3 HOH 74  474 135 HOH HOH B . 
F 3 HOH 75  475 136 HOH HOH B . 
F 3 HOH 76  476 147 HOH HOH B . 
F 3 HOH 77  477 148 HOH HOH B . 
F 3 HOH 78  478 154 HOH HOH B . 
F 3 HOH 79  479 163 HOH HOH B . 
F 3 HOH 80  480 164 HOH HOH B . 
F 3 HOH 81  481 165 HOH HOH B . 
F 3 HOH 82  482 166 HOH HOH B . 
F 3 HOH 83  483 167 HOH HOH B . 
F 3 HOH 84  484 168 HOH HOH B . 
F 3 HOH 85  485 169 HOH HOH B . 
F 3 HOH 86  486 170 HOH HOH B . 
F 3 HOH 87  487 171 HOH HOH B . 
F 3 HOH 88  488 172 HOH HOH B . 
F 3 HOH 89  489 173 HOH HOH B . 
F 3 HOH 90  490 174 HOH HOH B . 
F 3 HOH 91  491 175 HOH HOH B . 
F 3 HOH 92  492 176 HOH HOH B . 
F 3 HOH 93  493 177 HOH HOH B . 
F 3 HOH 94  494 178 HOH HOH B . 
F 3 HOH 95  495 179 HOH HOH B . 
F 3 HOH 96  496 180 HOH HOH B . 
F 3 HOH 97  497 181 HOH HOH B . 
F 3 HOH 98  498 182 HOH HOH B . 
F 3 HOH 99  499 183 HOH HOH B . 
F 3 HOH 100 500 184 HOH HOH B . 
F 3 HOH 101 501 185 HOH HOH B . 
F 3 HOH 102 502 186 HOH HOH B . 
F 3 HOH 103 503 187 HOH HOH B . 
F 3 HOH 104 504 188 HOH HOH B . 
F 3 HOH 105 505 189 HOH HOH B . 
F 3 HOH 106 506 190 HOH HOH B . 
F 3 HOH 107 507 191 HOH HOH B . 
F 3 HOH 108 508 192 HOH HOH B . 
F 3 HOH 109 509 193 HOH HOH B . 
F 3 HOH 110 510 194 HOH HOH B . 
F 3 HOH 111 511 195 HOH HOH B . 
F 3 HOH 112 512 196 HOH HOH B . 
F 3 HOH 113 513 197 HOH HOH B . 
F 3 HOH 114 514 198 HOH HOH B . 
F 3 HOH 115 515 199 HOH HOH B . 
F 3 HOH 116 516 215 HOH HOH B . 
F 3 HOH 117 517 217 HOH HOH B . 
F 3 HOH 118 518 218 HOH HOH B . 
F 3 HOH 119 519 219 HOH HOH B . 
F 3 HOH 120 520 220 HOH HOH B . 
F 3 HOH 121 521 258 HOH HOH B . 
F 3 HOH 122 522 259 HOH HOH B . 
F 3 HOH 123 523 260 HOH HOH B . 
F 3 HOH 124 524 261 HOH HOH B . 
F 3 HOH 125 525 262 HOH HOH B . 
F 3 HOH 126 526 263 HOH HOH B . 
F 3 HOH 127 527 264 HOH HOH B . 
F 3 HOH 128 528 265 HOH HOH B . 
F 3 HOH 129 529 266 HOH HOH B . 
F 3 HOH 130 530 267 HOH HOH B . 
F 3 HOH 131 531 269 HOH HOH B . 
F 3 HOH 132 532 270 HOH HOH B . 
F 3 HOH 133 533 271 HOH HOH B . 
F 3 HOH 134 534 272 HOH HOH B . 
F 3 HOH 135 535 273 HOH HOH B . 
F 3 HOH 136 536 274 HOH HOH B . 
F 3 HOH 137 537 275 HOH HOH B . 
F 3 HOH 138 538 276 HOH HOH B . 
F 3 HOH 139 539 277 HOH HOH B . 
F 3 HOH 140 540 278 HOH HOH B . 
F 3 HOH 141 541 279 HOH HOH B . 
F 3 HOH 142 542 280 HOH HOH B . 
F 3 HOH 143 543 281 HOH HOH B . 
F 3 HOH 144 544 282 HOH HOH B . 
F 3 HOH 145 545 284 HOH HOH B . 
F 3 HOH 146 546 285 HOH HOH B . 
F 3 HOH 147 547 286 HOH HOH B . 
F 3 HOH 148 548 287 HOH HOH B . 
F 3 HOH 149 549 288 HOH HOH B . 
F 3 HOH 150 550 289 HOH HOH B . 
F 3 HOH 151 551 290 HOH HOH B . 
F 3 HOH 152 552 291 HOH HOH B . 
F 3 HOH 153 553 307 HOH HOH B . 
F 3 HOH 154 554 308 HOH HOH B . 
F 3 HOH 155 555 309 HOH HOH B . 
F 3 HOH 156 556 310 HOH HOH B . 
F 3 HOH 157 557 311 HOH HOH B . 
F 3 HOH 158 558 312 HOH HOH B . 
F 3 HOH 159 559 313 HOH HOH B . 
F 3 HOH 160 560 314 HOH HOH B . 
F 3 HOH 161 561 315 HOH HOH B . 
F 3 HOH 162 562 316 HOH HOH B . 
F 3 HOH 163 563 317 HOH HOH B . 
F 3 HOH 164 564 318 HOH HOH B . 
F 3 HOH 165 565 319 HOH HOH B . 
F 3 HOH 166 566 320 HOH HOH B . 
F 3 HOH 167 567 321 HOH HOH B . 
F 3 HOH 168 568 322 HOH HOH B . 
F 3 HOH 169 569 323 HOH HOH B . 
F 3 HOH 170 570 324 HOH HOH B . 
F 3 HOH 171 571 325 HOH HOH B . 
F 3 HOH 172 572 326 HOH HOH B . 
F 3 HOH 173 573 327 HOH HOH B . 
F 3 HOH 174 574 328 HOH HOH B . 
F 3 HOH 175 575 329 HOH HOH B . 
F 3 HOH 176 576 330 HOH HOH B . 
F 3 HOH 177 577 331 HOH HOH B . 
F 3 HOH 178 578 332 HOH HOH B . 
F 3 HOH 179 579 333 HOH HOH B . 
F 3 HOH 180 580 334 HOH HOH B . 
#