data_4HBN
# 
_entry.id   4HBN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HBN         
RCSB  RCSB075263   
WWPDB D_1000075263 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4HBN 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, X.'       1  
'Marni, F.'    2  
'Wu, X.'       3  
'Su, Z.'       4  
'Musayev, F.'  5  
'Shrestha, S.' 6  
'Xie, C.'      7  
'Gao, W.'      8  
'Liu, Q.'      9  
'Zhou, L.'     10 
# 
_citation.id                        primary 
_citation.title                     
;Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                2116 
_citation.page_last                 2123 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23103389 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.09.017 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, X.'       1  
primary 'Marni, F.'    2  
primary 'Wu, S.'       3  
primary 'Su, Z.'       4  
primary 'Musayev, F.'  5  
primary 'Shrestha, S.' 6  
primary 'Xie, C.'      7  
primary 'Gao, W.'      8  
primary 'Liu, Q.'      9  
primary 'Zhou, L.'     10 
# 
_cell.entry_id           4HBN 
_cell.length_a           95.467 
_cell.length_b           95.467 
_cell.length_c           115.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4HBN 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4' 24211.742 1  ? S672R 
'C-linker and CNBD: unp residues 521-724' ? 
2 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                                           329.206   1  ? ?     ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                                                  94.971    1  ? ?     ? ? 
4 water       nat water                                                                            18.015    60 ? ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANA
DPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTARVRADTYC
RLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANA
DPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTARVRADTYC
RLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASP n 
1 3   SER n 
1 4   SER n 
1 5   ARG n 
1 6   ARG n 
1 7   GLN n 
1 8   TYR n 
1 9   GLN n 
1 10  GLU n 
1 11  LYS n 
1 12  TYR n 
1 13  LYS n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLN n 
1 18  TYR n 
1 19  MET n 
1 20  SER n 
1 21  PHE n 
1 22  HIS n 
1 23  LYS n 
1 24  LEU n 
1 25  PRO n 
1 26  PRO n 
1 27  ASP n 
1 28  THR n 
1 29  ARG n 
1 30  GLN n 
1 31  ARG n 
1 32  ILE n 
1 33  HIS n 
1 34  ASP n 
1 35  TYR n 
1 36  TYR n 
1 37  GLU n 
1 38  HIS n 
1 39  ARG n 
1 40  TYR n 
1 41  GLN n 
1 42  GLY n 
1 43  LYS n 
1 44  MET n 
1 45  PHE n 
1 46  ASP n 
1 47  GLU n 
1 48  GLU n 
1 49  SER n 
1 50  ILE n 
1 51  LEU n 
1 52  GLY n 
1 53  GLU n 
1 54  LEU n 
1 55  SER n 
1 56  GLU n 
1 57  PRO n 
1 58  LEU n 
1 59  ARG n 
1 60  GLU n 
1 61  GLU n 
1 62  ILE n 
1 63  ILE n 
1 64  ASN n 
1 65  PHE n 
1 66  ASN n 
1 67  CYS n 
1 68  ARG n 
1 69  LYS n 
1 70  LEU n 
1 71  VAL n 
1 72  ALA n 
1 73  SER n 
1 74  MET n 
1 75  PRO n 
1 76  LEU n 
1 77  PHE n 
1 78  ALA n 
1 79  ASN n 
1 80  ALA n 
1 81  ASP n 
1 82  PRO n 
1 83  ASN n 
1 84  PHE n 
1 85  VAL n 
1 86  THR n 
1 87  SER n 
1 88  MET n 
1 89  LEU n 
1 90  THR n 
1 91  LYS n 
1 92  LEU n 
1 93  ARG n 
1 94  PHE n 
1 95  GLU n 
1 96  VAL n 
1 97  PHE n 
1 98  GLN n 
1 99  PRO n 
1 100 GLY n 
1 101 ASP n 
1 102 TYR n 
1 103 ILE n 
1 104 ILE n 
1 105 ARG n 
1 106 GLU n 
1 107 GLY n 
1 108 THR n 
1 109 ILE n 
1 110 GLY n 
1 111 LYS n 
1 112 LYS n 
1 113 MET n 
1 114 TYR n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 HIS n 
1 119 GLY n 
1 120 VAL n 
1 121 VAL n 
1 122 SER n 
1 123 VAL n 
1 124 LEU n 
1 125 THR n 
1 126 LYS n 
1 127 GLY n 
1 128 ASN n 
1 129 LYS n 
1 130 GLU n 
1 131 THR n 
1 132 LYS n 
1 133 LEU n 
1 134 ALA n 
1 135 ASP n 
1 136 GLY n 
1 137 SER n 
1 138 TYR n 
1 139 PHE n 
1 140 GLY n 
1 141 GLU n 
1 142 ILE n 
1 143 CYS n 
1 144 LEU n 
1 145 LEU n 
1 146 THR n 
1 147 ARG n 
1 148 GLY n 
1 149 ARG n 
1 150 ARG n 
1 151 THR n 
1 152 ALA n 
1 153 ARG n 
1 154 VAL n 
1 155 ARG n 
1 156 ALA n 
1 157 ASP n 
1 158 THR n 
1 159 TYR n 
1 160 CYS n 
1 161 ARG n 
1 162 LEU n 
1 163 TYR n 
1 164 SER n 
1 165 LEU n 
1 166 SER n 
1 167 VAL n 
1 168 ASP n 
1 169 ASN n 
1 170 PHE n 
1 171 ASN n 
1 172 GLU n 
1 173 VAL n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 TYR n 
1 178 PRO n 
1 179 MET n 
1 180 MET n 
1 181 ARG n 
1 182 ARG n 
1 183 ALA n 
1 184 PHE n 
1 185 GLU n 
1 186 THR n 
1 187 VAL n 
1 188 ALA n 
1 189 LEU n 
1 190 ASP n 
1 191 ARG n 
1 192 LEU n 
1 193 ASP n 
1 194 ARG n 
1 195 ILE n 
1 196 GLY n 
1 197 LYS n 
1 198 LYS n 
1 199 ASN n 
1 200 SER n 
1 201 ILE n 
1 202 LEU n 
1 203 LEU n 
1 204 HIS n 
1 205 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HCN4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pET28 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSMT3_hHCN4_S672R 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HCN4_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y3Q4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCR
LYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHK
;
_struct_ref.pdbx_align_begin           521 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4HBN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 205 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y3Q4 
_struct_ref_seq.db_align_beg                  521 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  724 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       521 
_struct_ref_seq.pdbx_auth_seq_align_end       724 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4HBN SER A 1   ? UNP Q9Y3Q4 ?   ?   'EXPRESSION TAG'      520 1 
1 4HBN ARG A 153 ? UNP Q9Y3Q4 SER 672 'ENGINEERED MUTATION' 672 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                        ?                  'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4HBN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   54.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_details    
'1.6 M KH2PO4/Na2HPO4 and 0.1 M Phosphate-Citrate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2010-12-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    No. 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     4HBN 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   3.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   8484 
_reflns.number_all                   55982 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.60 2.69  100  0.232 ? 7.6  ? ? ? ? ? ? ? 1  1 
2.69 2.80  100  0.209 ? 8.0  ? ? ? ? ? ? ? 2  1 
2.80 2.93  99.9 0.176 ? 9.4  ? ? ? ? ? ? ? 3  1 
2.93 3.08  100  0.131 ? 11.4 ? ? ? ? ? ? ? 4  1 
3.08 3.28  99.9 0.099 ? 14.2 ? ? ? ? ? ? ? 5  1 
3.28 3.53  99.8 0.084 ? 16.3 ? ? ? ? ? ? ? 6  1 
3.53 3.88  99.3 0.100 ? 15.2 ? ? ? ? ? ? ? 7  1 
3.88 4.44  99.5 0.036 ? 40.3 ? ? ? ? ? ? ? 8  1 
4.44 5.59  100  0.027 ? 52.5 ? ? ? ? ? ? ? 9  1 
5.59 29.17 93.7 0.019 ? 65.4 ? ? ? ? ? ? ? 10 1 
# 
_refine.entry_id                                 4HBN 
_refine.ls_number_reflns_obs                     7972 
_refine.ls_number_reflns_all                     8484 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    97.68 
_refine.ls_R_factor_obs                          0.25941 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25746 
_refine.ls_R_factor_R_free                       0.29669 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  400 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.903 
_refine.correlation_coeff_Fo_to_Fc_free          0.879 
_refine.B_iso_mean                               48.092 
_refine.aniso_B[1][1]                            -1.85 
_refine.aniso_B[2][2]                            -1.85 
_refine.aniso_B[3][3]                            3.69 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.816 
_refine.pdbx_overall_ESU_R_Free                  0.364 
_refine.overall_SU_ML                            0.293 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.493 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1605 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             60 
_refine_hist.number_atoms_total               1692 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.007  0.022  ? 1668 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.238  1.980  ? 2251 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 6.488  5.000  ? 197  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 34.072 22.500 ? 84   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 20.028 15.000 ? 287  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 23.661 15.000 ? 18   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.083  0.200  ? 239  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.009  0.021  ? 1270 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1.017  1.500  ? 989  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1.900  2.000  ? 1584 ? 'X-RAY DIFFRACTION' 
r_scbond_it            2.848  3.000  ? 679  ? 'X-RAY DIFFRACTION' 
r_scangle_it           4.491  4.500  ? 667  ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.667 
_refine_ls_shell.number_reflns_R_work             581 
_refine_ls_shell.R_factor_R_work                  0.251 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.286 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             30 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4HBN 
_struct.title                     'Crystal structure of the human HCN4 channel C-terminus carrying the S672R mutation' 
_struct.pdbx_descriptor           'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HBN 
_struct_keywords.pdbx_keywords   NEUROPEPTIDE 
_struct_keywords.text            'cAMP binding, cAMP, NEUROPEPTIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3   ? HIS A 22  ? SER A 522 HIS A 541 1 ? 20 
HELX_P HELX_P2  2  PRO A 25  ? GLN A 41  ? PRO A 544 GLN A 560 1 ? 17 
HELX_P HELX_P3  3  ASP A 46  ? LEU A 54  ? ASP A 565 LEU A 573 1 ? 9  
HELX_P HELX_P4  4  SER A 55  ? CYS A 67  ? SER A 574 CYS A 586 1 ? 13 
HELX_P HELX_P5  5  CYS A 67  ? SER A 73  ? CYS A 586 SER A 592 1 ? 7  
HELX_P HELX_P6  6  MET A 74  ? ASN A 79  ? MET A 593 ASN A 598 1 ? 6  
HELX_P HELX_P7  7  ASP A 81  ? THR A 90  ? ASP A 600 THR A 609 1 ? 10 
HELX_P HELX_P8  8  GLU A 141 ? ARG A 147 ? GLU A 660 ARG A 666 1 ? 7  
HELX_P HELX_P9  9  VAL A 167 ? TYR A 177 ? VAL A 686 TYR A 696 1 ? 11 
HELX_P HELX_P10 10 MET A 180 ? GLY A 196 ? MET A 699 GLY A 715 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 93  ? PHE A 97  ? ARG A 612 PHE A 616 
A 2 CYS A 160 ? SER A 166 ? CYS A 679 SER A 685 
A 3 LYS A 112 ? HIS A 118 ? LYS A 631 HIS A 637 
A 4 TYR A 138 ? PHE A 139 ? TYR A 657 PHE A 658 
B 1 TYR A 102 ? ILE A 104 ? TYR A 621 ILE A 623 
B 2 ARG A 153 ? ALA A 156 ? ARG A 672 ALA A 675 
B 3 VAL A 121 ? LEU A 124 ? VAL A 640 LEU A 643 
B 4 GLU A 130 ? LEU A 133 ? GLU A 649 LEU A 652 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 95  ? N GLU A 614 O LEU A 162 ? O LEU A 681 
A 2 3 O LEU A 165 ? O LEU A 684 N MET A 113 ? N MET A 632 
A 3 4 N TYR A 114 ? N TYR A 633 O PHE A 139 ? O PHE A 658 
B 1 2 N ILE A 104 ? N ILE A 623 O VAL A 154 ? O VAL A 673 
B 2 3 O ARG A 155 ? O ARG A 674 N SER A 122 ? N SER A 641 
B 3 4 N VAL A 123 ? N VAL A 642 O THR A 131 ? O THR A 650 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CMP A 801' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 A 802' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 VAL A 123 ? VAL A 642 . ? 1_555 ? 
2  AC1 12 THR A 131 ? THR A 650 . ? 1_555 ? 
3  AC1 12 PHE A 139 ? PHE A 658 . ? 1_555 ? 
4  AC1 12 GLY A 140 ? GLY A 659 . ? 1_555 ? 
5  AC1 12 GLU A 141 ? GLU A 660 . ? 1_555 ? 
6  AC1 12 ILE A 142 ? ILE A 661 . ? 1_555 ? 
7  AC1 12 CYS A 143 ? CYS A 662 . ? 1_555 ? 
8  AC1 12 ARG A 150 ? ARG A 669 . ? 1_555 ? 
9  AC1 12 THR A 151 ? THR A 670 . ? 1_555 ? 
10 AC1 12 ARG A 191 ? ARG A 710 . ? 1_555 ? 
11 AC1 12 ARG A 194 ? ARG A 713 . ? 1_555 ? 
12 AC1 12 HOH D .   ? HOH A 948 . ? 1_555 ? 
13 AC2 2  SER A 49  ? SER A 568 . ? 1_555 ? 
14 AC2 2  GLU A 53  ? GLU A 572 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4HBN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4HBN 
_atom_sites.fract_transf_matrix[1][1]   0.010475 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010475 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008621 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . SER A 1 1   ? -18.817 10.429  6.870  1.00 89.48  ? 520 SER A N     1 
ATOM   2    C CA    . SER A 1 1   ? -17.835 9.868   5.896  1.00 89.44  ? 520 SER A CA    1 
ATOM   3    C C     . SER A 1 1   ? -17.281 8.518   6.363  1.00 89.73  ? 520 SER A C     1 
ATOM   4    O O     . SER A 1 1   ? -17.181 8.255   7.566  1.00 89.88  ? 520 SER A O     1 
ATOM   5    C CB    . SER A 1 1   ? -16.695 10.865  5.669  1.00 89.61  ? 520 SER A CB    1 
ATOM   6    O OG    . SER A 1 1   ? -16.105 10.690  4.392  1.00 88.99  ? 520 SER A OG    1 
ATOM   7    N N     . ASP A 1 2   ? -16.920 7.670   5.401  1.00 89.61  ? 521 ASP A N     1 
ATOM   8    C CA    . ASP A 1 2   ? -16.485 6.300   5.685  1.00 89.05  ? 521 ASP A CA    1 
ATOM   9    C C     . ASP A 1 2   ? -14.961 6.152   5.695  1.00 88.65  ? 521 ASP A C     1 
ATOM   10   O O     . ASP A 1 2   ? -14.289 6.434   4.701  1.00 88.81  ? 521 ASP A O     1 
ATOM   11   C CB    . ASP A 1 2   ? -17.119 5.319   4.695  1.00 88.90  ? 521 ASP A CB    1 
ATOM   12   N N     . SER A 1 3   ? -14.427 5.719   6.834  1.00 87.81  ? 522 SER A N     1 
ATOM   13   C CA    . SER A 1 3   ? -13.006 5.382   6.962  1.00 86.70  ? 522 SER A CA    1 
ATOM   14   C C     . SER A 1 3   ? -12.711 4.661   8.280  1.00 85.52  ? 522 SER A C     1 
ATOM   15   O O     . SER A 1 3   ? -11.843 3.786   8.347  1.00 85.52  ? 522 SER A O     1 
ATOM   16   C CB    . SER A 1 3   ? -12.133 6.635   6.855  1.00 87.22  ? 522 SER A CB    1 
ATOM   17   O OG    . SER A 1 3   ? -10.888 6.444   7.516  1.00 87.32  ? 522 SER A OG    1 
ATOM   18   N N     . SER A 1 4   ? -13.400 5.088   9.335  1.00 83.79  ? 523 SER A N     1 
ATOM   19   C CA    . SER A 1 4   ? -13.416 4.380   10.611 1.00 81.51  ? 523 SER A CA    1 
ATOM   20   C C     . SER A 1 4   ? -14.374 3.194   10.522 1.00 80.67  ? 523 SER A C     1 
ATOM   21   O O     . SER A 1 4   ? -14.490 2.411   11.469 1.00 80.41  ? 523 SER A O     1 
ATOM   22   C CB    . SER A 1 4   ? -13.846 5.325   11.739 1.00 81.27  ? 523 SER A CB    1 
ATOM   23   O OG    . SER A 1 4   ? -15.097 5.936   11.460 1.00 78.24  ? 523 SER A OG    1 
ATOM   24   N N     . ARG A 1 5   ? -15.085 3.100   9.397  1.00 79.00  ? 524 ARG A N     1 
ATOM   25   C CA    . ARG A 1 5   ? -15.916 1.941   9.083  1.00 76.95  ? 524 ARG A CA    1 
ATOM   26   C C     . ARG A 1 5   ? -15.016 0.758   8.782  1.00 75.28  ? 524 ARG A C     1 
ATOM   27   O O     . ARG A 1 5   ? -15.374 -0.387  9.055  1.00 75.27  ? 524 ARG A O     1 
ATOM   28   C CB    . ARG A 1 5   ? -16.815 2.214   7.875  1.00 76.65  ? 524 ARG A CB    1 
ATOM   29   C CG    . ARG A 1 5   ? -17.801 3.355   8.075  1.00 79.19  ? 524 ARG A CG    1 
ATOM   30   C CD    . ARG A 1 5   ? -19.199 2.997   7.558  1.00 81.68  ? 524 ARG A CD    1 
ATOM   31   N NE    . ARG A 1 5   ? -19.879 2.054   8.447  1.00 82.51  ? 524 ARG A NE    1 
ATOM   32   C CZ    . ARG A 1 5   ? -21.199 1.897   8.526  1.00 83.52  ? 524 ARG A CZ    1 
ATOM   33   N NH1   . ARG A 1 5   ? -22.011 2.613   7.757  1.00 84.62  ? 524 ARG A NH1   1 
ATOM   34   N NH2   . ARG A 1 5   ? -21.710 1.014   9.377  1.00 81.50  ? 524 ARG A NH2   1 
ATOM   35   N N     . ARG A 1 6   ? -13.838 1.046   8.235  1.00 73.23  ? 525 ARG A N     1 
ATOM   36   C CA    . ARG A 1 6   ? -12.970 0.001   7.706  1.00 71.89  ? 525 ARG A CA    1 
ATOM   37   C C     . ARG A 1 6   ? -12.221 -0.670  8.838  1.00 70.44  ? 525 ARG A C     1 
ATOM   38   O O     . ARG A 1 6   ? -12.074 -1.893  8.850  1.00 70.84  ? 525 ARG A O     1 
ATOM   39   C CB    . ARG A 1 6   ? -11.981 0.553   6.679  1.00 72.27  ? 525 ARG A CB    1 
ATOM   40   C CG    . ARG A 1 6   ? -12.575 0.757   5.291  1.00 72.81  ? 525 ARG A CG    1 
ATOM   41   C CD    . ARG A 1 6   ? -11.511 1.217   4.308  1.00 72.49  ? 525 ARG A CD    1 
ATOM   42   N NE    . ARG A 1 6   ? -11.421 2.672   4.199  1.00 71.17  ? 525 ARG A NE    1 
ATOM   43   C CZ    . ARG A 1 6   ? -10.406 3.401   4.657  1.00 70.65  ? 525 ARG A CZ    1 
ATOM   44   N NH1   . ARG A 1 6   ? -9.396  2.815   5.293  1.00 68.42  ? 525 ARG A NH1   1 
ATOM   45   N NH2   . ARG A 1 6   ? -10.397 4.719   4.472  1.00 68.40  ? 525 ARG A NH2   1 
ATOM   46   N N     . GLN A 1 7   ? -11.761 0.137   9.791  1.00 68.03  ? 526 GLN A N     1 
ATOM   47   C CA    . GLN A 1 7   ? -11.183 -0.390  11.021 1.00 65.36  ? 526 GLN A CA    1 
ATOM   48   C C     . GLN A 1 7   ? -12.169 -1.333  11.715 1.00 63.32  ? 526 GLN A C     1 
ATOM   49   O O     . GLN A 1 7   ? -11.766 -2.401  12.190 1.00 62.85  ? 526 GLN A O     1 
ATOM   50   C CB    . GLN A 1 7   ? -10.757 0.744   11.951 1.00 65.89  ? 526 GLN A CB    1 
ATOM   51   N N     . TYR A 1 8   ? -13.450 -0.953  11.727 1.00 59.61  ? 527 TYR A N     1 
ATOM   52   C CA    . TYR A 1 8   ? -14.518 -1.837  12.188 1.00 57.17  ? 527 TYR A CA    1 
ATOM   53   C C     . TYR A 1 8   ? -14.612 -3.104  11.340 1.00 55.96  ? 527 TYR A C     1 
ATOM   54   O O     . TYR A 1 8   ? -14.599 -4.213  11.867 1.00 55.85  ? 527 TYR A O     1 
ATOM   55   C CB    . TYR A 1 8   ? -15.882 -1.137  12.247 1.00 55.97  ? 527 TYR A CB    1 
ATOM   56   C CG    . TYR A 1 8   ? -16.979 -2.073  12.715 1.00 56.28  ? 527 TYR A CG    1 
ATOM   57   C CD1   . TYR A 1 8   ? -17.055 -2.469  14.046 1.00 58.89  ? 527 TYR A CD1   1 
ATOM   58   C CD2   . TYR A 1 8   ? -17.865 -2.657  11.814 1.00 57.24  ? 527 TYR A CD2   1 
ATOM   59   C CE1   . TYR A 1 8   ? -18.018 -3.378  14.482 1.00 60.02  ? 527 TYR A CE1   1 
ATOM   60   C CE2   . TYR A 1 8   ? -18.827 -3.573  12.238 1.00 56.93  ? 527 TYR A CE2   1 
ATOM   61   C CZ    . TYR A 1 8   ? -18.898 -3.929  13.574 1.00 59.99  ? 527 TYR A CZ    1 
ATOM   62   O OH    . TYR A 1 8   ? -19.855 -4.816  14.020 1.00 60.61  ? 527 TYR A OH    1 
ATOM   63   N N     . GLN A 1 9   ? -14.739 -2.939  10.030 1.00 54.57  ? 528 GLN A N     1 
ATOM   64   C CA    . GLN A 1 9   ? -14.780 -4.086  9.136  1.00 53.35  ? 528 GLN A CA    1 
ATOM   65   C C     . GLN A 1 9   ? -13.508 -4.899  9.302  1.00 52.93  ? 528 GLN A C     1 
ATOM   66   O O     . GLN A 1 9   ? -13.565 -6.122  9.427  1.00 52.66  ? 528 GLN A O     1 
ATOM   67   C CB    . GLN A 1 9   ? -14.968 -3.635  7.683  1.00 53.16  ? 528 GLN A CB    1 
ATOM   68   C CG    . GLN A 1 9   ? -16.435 -3.385  7.304  1.00 50.60  ? 528 GLN A CG    1 
ATOM   69   C CD    . GLN A 1 9   ? -16.651 -2.038  6.634  1.00 50.90  ? 528 GLN A CD    1 
ATOM   70   O OE1   . GLN A 1 9   ? -15.763 -1.526  5.941  1.00 49.68  ? 528 GLN A OE1   1 
ATOM   71   N NE2   . GLN A 1 9   ? -17.840 -1.460  6.828  1.00 49.86  ? 528 GLN A NE2   1 
ATOM   72   N N     . GLU A 1 10  ? -12.383 -4.195  9.408  1.00 52.62  ? 529 GLU A N     1 
ATOM   73   C CA    . GLU A 1 10  ? -11.069 -4.815  9.543  1.00 53.07  ? 529 GLU A CA    1 
ATOM   74   C C     . GLU A 1 10  ? -10.943 -5.564  10.864 1.00 52.42  ? 529 GLU A C     1 
ATOM   75   O O     . GLU A 1 10  ? -10.428 -6.682  10.911 1.00 53.10  ? 529 GLU A O     1 
ATOM   76   C CB    . GLU A 1 10  ? -9.962  -3.765  9.429  1.00 53.01  ? 529 GLU A CB    1 
ATOM   77   C CG    . GLU A 1 10  ? -8.671  -4.284  8.811  1.00 59.63  ? 529 GLU A CG    1 
ATOM   78   C CD    . GLU A 1 10  ? -7.717  -3.166  8.399  1.00 69.49  ? 529 GLU A CD    1 
ATOM   79   O OE1   . GLU A 1 10  ? -8.152  -2.238  7.675  1.00 71.97  ? 529 GLU A OE1   1 
ATOM   80   O OE2   . GLU A 1 10  ? -6.524  -3.222  8.784  1.00 70.36  ? 529 GLU A OE2   1 
ATOM   81   N N     . LYS A 1 11  ? -11.413 -4.941  11.938 1.00 50.83  ? 530 LYS A N     1 
ATOM   82   C CA    . LYS A 1 11  ? -11.400 -5.589  13.230 1.00 48.81  ? 530 LYS A CA    1 
ATOM   83   C C     . LYS A 1 11  ? -12.357 -6.774  13.241 1.00 49.31  ? 530 LYS A C     1 
ATOM   84   O O     . LYS A 1 11  ? -11.977 -7.889  13.622 1.00 48.61  ? 530 LYS A O     1 
ATOM   85   C CB    . LYS A 1 11  ? -11.791 -4.591  14.317 1.00 48.77  ? 530 LYS A CB    1 
ATOM   86   C CG    . LYS A 1 11  ? -11.976 -5.221  15.677 1.00 47.12  ? 530 LYS A CG    1 
ATOM   87   C CD    . LYS A 1 11  ? -10.744 -6.020  16.066 1.00 48.13  ? 530 LYS A CD    1 
ATOM   88   C CE    . LYS A 1 11  ? -9.518  -5.123  16.213 1.00 48.99  ? 530 LYS A CE    1 
ATOM   89   N NZ    . LYS A 1 11  ? -8.260  -5.909  16.091 1.00 54.34  ? 530 LYS A NZ    1 
ATOM   90   N N     . TYR A 1 12  ? -13.617 -6.525  12.886 1.00 48.90  ? 531 TYR A N     1 
ATOM   91   C CA    . TYR A 1 12  ? -14.612 -7.586  12.954 1.00 49.41  ? 531 TYR A CA    1 
ATOM   92   C C     . TYR A 1 12  ? -14.227 -8.778  12.086 1.00 50.78  ? 531 TYR A C     1 
ATOM   93   O O     . TYR A 1 12  ? -14.524 -9.919  12.438 1.00 51.47  ? 531 TYR A O     1 
ATOM   94   C CB    . TYR A 1 12  ? -16.025 -7.122  12.595 1.00 48.37  ? 531 TYR A CB    1 
ATOM   95   C CG    . TYR A 1 12  ? -17.039 -8.202  12.902 1.00 47.50  ? 531 TYR A CG    1 
ATOM   96   C CD1   . TYR A 1 12  ? -17.309 -8.569  14.225 1.00 45.33  ? 531 TYR A CD1   1 
ATOM   97   C CD2   . TYR A 1 12  ? -17.646 -8.924  11.881 1.00 44.09  ? 531 TYR A CD2   1 
ATOM   98   C CE1   . TYR A 1 12  ? -18.193 -9.595  14.525 1.00 46.39  ? 531 TYR A CE1   1 
ATOM   99   C CE2   . TYR A 1 12  ? -18.540 -9.961  12.169 1.00 46.76  ? 531 TYR A CE2   1 
ATOM   100  C CZ    . TYR A 1 12  ? -18.809 -10.287 13.493 1.00 48.11  ? 531 TYR A CZ    1 
ATOM   101  O OH    . TYR A 1 12  ? -19.703 -11.292 13.786 1.00 47.80  ? 531 TYR A OH    1 
ATOM   102  N N     . LYS A 1 13  ? -13.581 -8.511  10.953 1.00 51.08  ? 532 LYS A N     1 
ATOM   103  C CA    . LYS A 1 13  ? -13.012 -9.579  10.148 1.00 51.90  ? 532 LYS A CA    1 
ATOM   104  C C     . LYS A 1 13  ? -12.101 -10.448 11.004 1.00 51.54  ? 532 LYS A C     1 
ATOM   105  O O     . LYS A 1 13  ? -12.198 -11.677 10.996 1.00 52.23  ? 532 LYS A O     1 
ATOM   106  C CB    . LYS A 1 13  ? -12.243 -9.013  8.951  1.00 52.58  ? 532 LYS A CB    1 
ATOM   107  C CG    . LYS A 1 13  ? -12.213 -9.965  7.771  1.00 55.74  ? 532 LYS A CG    1 
ATOM   108  C CD    . LYS A 1 13  ? -11.991 -9.262  6.437  1.00 59.32  ? 532 LYS A CD    1 
ATOM   109  C CE    . LYS A 1 13  ? -11.788 -10.294 5.320  1.00 60.65  ? 532 LYS A CE    1 
ATOM   110  N NZ    . LYS A 1 13  ? -10.993 -9.775  4.161  1.00 63.51  ? 532 LYS A NZ    1 
ATOM   111  N N     . GLN A 1 14  ? -11.243 -9.798  11.781 1.00 51.14  ? 533 GLN A N     1 
ATOM   112  C CA    . GLN A 1 14  ? -10.363 -10.503 12.700 1.00 50.38  ? 533 GLN A CA    1 
ATOM   113  C C     . GLN A 1 14  ? -11.142 -11.347 13.704 1.00 49.75  ? 533 GLN A C     1 
ATOM   114  O O     . GLN A 1 14  ? -10.861 -12.540 13.876 1.00 50.32  ? 533 GLN A O     1 
ATOM   115  C CB    . GLN A 1 14  ? -9.457  -9.515  13.425 1.00 50.53  ? 533 GLN A CB    1 
ATOM   116  C CG    . GLN A 1 14  ? -8.008  -9.952  13.469 1.00 51.82  ? 533 GLN A CG    1 
ATOM   117  C CD    . GLN A 1 14  ? -7.258  -9.300  14.601 1.00 51.19  ? 533 GLN A CD    1 
ATOM   118  O OE1   . GLN A 1 14  ? -7.202  -8.070  14.686 1.00 54.92  ? 533 GLN A OE1   1 
ATOM   119  N NE2   . GLN A 1 14  ? -6.669  -10.116 15.476 1.00 47.83  ? 533 GLN A NE2   1 
ATOM   120  N N     . VAL A 1 15  ? -12.154 -10.743 14.321 1.00 48.21  ? 534 VAL A N     1 
ATOM   121  C CA    . VAL A 1 15  ? -13.087 -11.489 15.160 1.00 47.07  ? 534 VAL A CA    1 
ATOM   122  C C     . VAL A 1 15  ? -13.638 -12.736 14.463 1.00 47.85  ? 534 VAL A C     1 
ATOM   123  O O     . VAL A 1 15  ? -13.785 -13.792 15.082 1.00 47.05  ? 534 VAL A O     1 
ATOM   124  C CB    . VAL A 1 15  ? -14.236 -10.589 15.653 1.00 46.86  ? 534 VAL A CB    1 
ATOM   125  C CG1   . VAL A 1 15  ? -15.197 -11.360 16.547 1.00 44.65  ? 534 VAL A CG1   1 
ATOM   126  C CG2   . VAL A 1 15  ? -13.673 -9.385  16.388 1.00 44.72  ? 534 VAL A CG2   1 
ATOM   127  N N     . GLU A 1 16  ? -13.915 -12.630 13.165 1.00 49.08  ? 535 GLU A N     1 
ATOM   128  C CA    . GLU A 1 16  ? -14.581 -13.719 12.452 1.00 50.36  ? 535 GLU A CA    1 
ATOM   129  C C     . GLU A 1 16  ? -13.663 -14.927 12.377 1.00 51.11  ? 535 GLU A C     1 
ATOM   130  O O     . GLU A 1 16  ? -14.109 -16.068 12.484 1.00 51.10  ? 535 GLU A O     1 
ATOM   131  C CB    . GLU A 1 16  ? -15.039 -13.296 11.051 1.00 50.92  ? 535 GLU A CB    1 
ATOM   132  C CG    . GLU A 1 16  ? -16.438 -12.654 10.982 1.00 52.32  ? 535 GLU A CG    1 
ATOM   133  C CD    . GLU A 1 16  ? -16.921 -12.370 9.551  1.00 51.97  ? 535 GLU A CD    1 
ATOM   134  O OE1   . GLU A 1 16  ? -16.141 -11.843 8.731  1.00 49.00  ? 535 GLU A OE1   1 
ATOM   135  O OE2   . GLU A 1 16  ? -18.102 -12.646 9.248  1.00 53.19  ? 535 GLU A OE2   1 
ATOM   136  N N     . GLN A 1 17  ? -12.370 -14.652 12.238 1.00 52.33  ? 536 GLN A N     1 
ATOM   137  C CA    . GLN A 1 17  ? -11.364 -15.695 12.057 1.00 52.84  ? 536 GLN A CA    1 
ATOM   138  C C     . GLN A 1 17  ? -11.010 -16.247 13.426 1.00 52.08  ? 536 GLN A C     1 
ATOM   139  O O     . GLN A 1 17  ? -10.649 -17.419 13.569 1.00 52.14  ? 536 GLN A O     1 
ATOM   140  C CB    . GLN A 1 17  ? -10.110 -15.122 11.382 1.00 52.85  ? 536 GLN A CB    1 
ATOM   141  C CG    . GLN A 1 17  ? -10.347 -14.627 9.963  1.00 54.97  ? 536 GLN A CG    1 
ATOM   142  C CD    . GLN A 1 17  ? -9.282  -13.653 9.490  1.00 57.10  ? 536 GLN A CD    1 
ATOM   143  O OE1   . GLN A 1 17  ? -9.398  -13.060 8.414  1.00 57.69  ? 536 GLN A OE1   1 
ATOM   144  N NE2   . GLN A 1 17  ? -8.229  -13.497 10.283 1.00 56.60  ? 536 GLN A NE2   1 
ATOM   145  N N     . TYR A 1 18  ? -11.077 -15.363 14.417 1.00 51.56  ? 537 TYR A N     1 
ATOM   146  C CA    . TYR A 1 18  ? -10.889 -15.733 15.808 1.00 49.87  ? 537 TYR A CA    1 
ATOM   147  C C     . TYR A 1 18  ? -11.981 -16.715 16.208 1.00 48.72  ? 537 TYR A C     1 
ATOM   148  O O     . TYR A 1 18  ? -11.708 -17.732 16.834 1.00 48.84  ? 537 TYR A O     1 
ATOM   149  C CB    . TYR A 1 18  ? -10.962 -14.481 16.673 1.00 50.09  ? 537 TYR A CB    1 
ATOM   150  C CG    . TYR A 1 18  ? -10.986 -14.748 18.161 1.00 52.49  ? 537 TYR A CG    1 
ATOM   151  C CD1   . TYR A 1 18  ? -12.184 -14.793 18.868 1.00 53.91  ? 537 TYR A CD1   1 
ATOM   152  C CD2   . TYR A 1 18  ? -9.803  -14.914 18.868 1.00 53.62  ? 537 TYR A CD2   1 
ATOM   153  C CE1   . TYR A 1 18  ? -12.194 -14.988 20.242 1.00 55.41  ? 537 TYR A CE1   1 
ATOM   154  C CE2   . TYR A 1 18  ? -9.805  -15.156 20.220 1.00 54.52  ? 537 TYR A CE2   1 
ATOM   155  C CZ    . TYR A 1 18  ? -10.997 -15.176 20.904 1.00 55.48  ? 537 TYR A CZ    1 
ATOM   156  O OH    . TYR A 1 18  ? -10.972 -15.393 22.255 1.00 56.69  ? 537 TYR A OH    1 
ATOM   157  N N     . MET A 1 19  ? -13.213 -16.429 15.809 1.00 47.90  ? 538 MET A N     1 
ATOM   158  C CA    . MET A 1 19  ? -14.326 -17.281 16.184 1.00 48.47  ? 538 MET A CA    1 
ATOM   159  C C     . MET A 1 19  ? -14.166 -18.618 15.492 1.00 49.17  ? 538 MET A C     1 
ATOM   160  O O     . MET A 1 19  ? -14.268 -19.664 16.129 1.00 49.12  ? 538 MET A O     1 
ATOM   161  C CB    . MET A 1 19  ? -15.679 -16.631 15.856 1.00 48.53  ? 538 MET A CB    1 
ATOM   162  C CG    . MET A 1 19  ? -16.067 -15.502 16.818 1.00 47.00  ? 538 MET A CG    1 
ATOM   163  S SD    . MET A 1 19  ? -17.745 -14.837 16.671 1.00 41.51  ? 538 MET A SD    1 
ATOM   164  C CE    . MET A 1 19  ? -17.883 -14.657 14.883 1.00 43.91  ? 538 MET A CE    1 
ATOM   165  N N     . SER A 1 20  ? -13.838 -18.574 14.205 1.00 50.55  ? 539 SER A N     1 
ATOM   166  C CA    . SER A 1 20  ? -13.688 -19.783 13.407 1.00 52.19  ? 539 SER A CA    1 
ATOM   167  C C     . SER A 1 20  ? -12.503 -20.630 13.846 1.00 53.03  ? 539 SER A C     1 
ATOM   168  O O     . SER A 1 20  ? -12.557 -21.855 13.762 1.00 53.14  ? 539 SER A O     1 
ATOM   169  C CB    . SER A 1 20  ? -13.550 -19.464 11.916 1.00 52.28  ? 539 SER A CB    1 
ATOM   170  O OG    . SER A 1 20  ? -12.878 -20.518 11.233 1.00 52.91  ? 539 SER A OG    1 
ATOM   171  N N     . PHE A 1 21  ? -11.417 -19.987 14.258 1.00 53.91  ? 540 PHE A N     1 
ATOM   172  C CA    . PHE A 1 21  ? -10.268 -20.729 14.769 1.00 55.57  ? 540 PHE A CA    1 
ATOM   173  C C     . PHE A 1 21  ? -10.646 -21.530 16.013 1.00 55.62  ? 540 PHE A C     1 
ATOM   174  O O     . PHE A 1 21  ? -10.166 -22.647 16.212 1.00 56.48  ? 540 PHE A O     1 
ATOM   175  C CB    . PHE A 1 21  ? -9.094  -19.789 15.071 1.00 56.56  ? 540 PHE A CB    1 
ATOM   176  C CG    . PHE A 1 21  ? -7.851  -20.492 15.572 1.00 58.38  ? 540 PHE A CG    1 
ATOM   177  C CD1   . PHE A 1 21  ? -7.408  -21.670 14.977 1.00 60.69  ? 540 PHE A CD1   1 
ATOM   178  C CD2   . PHE A 1 21  ? -7.101  -19.943 16.603 1.00 58.28  ? 540 PHE A CD2   1 
ATOM   179  C CE1   . PHE A 1 21  ? -6.250  -22.297 15.415 1.00 62.78  ? 540 PHE A CE1   1 
ATOM   180  C CE2   . PHE A 1 21  ? -5.949  -20.561 17.057 1.00 59.19  ? 540 PHE A CE2   1 
ATOM   181  C CZ    . PHE A 1 21  ? -5.521  -21.741 16.463 1.00 62.87  ? 540 PHE A CZ    1 
ATOM   182  N N     . HIS A 1 22  ? -11.499 -20.940 16.848 1.00 55.49  ? 541 HIS A N     1 
ATOM   183  C CA    . HIS A 1 22  ? -11.951 -21.571 18.080 1.00 54.54  ? 541 HIS A CA    1 
ATOM   184  C C     . HIS A 1 22  ? -13.238 -22.376 17.871 1.00 53.05  ? 541 HIS A C     1 
ATOM   185  O O     . HIS A 1 22  ? -13.795 -22.944 18.814 1.00 53.63  ? 541 HIS A O     1 
ATOM   186  C CB    . HIS A 1 22  ? -12.117 -20.524 19.191 1.00 55.48  ? 541 HIS A CB    1 
ATOM   187  C CG    . HIS A 1 22  ? -10.823 -19.964 19.705 1.00 59.14  ? 541 HIS A CG    1 
ATOM   188  N ND1   . HIS A 1 22  ? -9.836  -20.750 20.264 1.00 60.72  ? 541 HIS A ND1   1 
ATOM   189  C CD2   . HIS A 1 22  ? -10.372 -18.687 19.781 1.00 62.64  ? 541 HIS A CD2   1 
ATOM   190  C CE1   . HIS A 1 22  ? -8.830  -19.983 20.650 1.00 61.76  ? 541 HIS A CE1   1 
ATOM   191  N NE2   . HIS A 1 22  ? -9.130  -18.727 20.368 1.00 61.97  ? 541 HIS A NE2   1 
ATOM   192  N N     . LYS A 1 23  ? -13.697 -22.455 16.627 1.00 50.97  ? 542 LYS A N     1 
ATOM   193  C CA    . LYS A 1 23  ? -14.770 -23.377 16.279 1.00 48.72  ? 542 LYS A CA    1 
ATOM   194  C C     . LYS A 1 23  ? -15.973 -23.154 17.189 1.00 46.94  ? 542 LYS A C     1 
ATOM   195  O O     . LYS A 1 23  ? -16.635 -24.109 17.603 1.00 47.39  ? 542 LYS A O     1 
ATOM   196  C CB    . LYS A 1 23  ? -14.283 -24.827 16.384 1.00 49.35  ? 542 LYS A CB    1 
ATOM   197  C CG    . LYS A 1 23  ? -13.255 -25.227 15.319 1.00 51.05  ? 542 LYS A CG    1 
ATOM   198  C CD    . LYS A 1 23  ? -12.843 -26.690 15.469 1.00 54.14  ? 542 LYS A CD    1 
ATOM   199  C CE    . LYS A 1 23  ? -11.499 -26.988 14.797 1.00 55.78  ? 542 LYS A CE    1 
ATOM   200  N NZ    . LYS A 1 23  ? -10.757 -28.105 15.471 1.00 53.74  ? 542 LYS A NZ    1 
ATOM   201  N N     . LEU A 1 24  ? -16.248 -21.887 17.490 1.00 44.03  ? 543 LEU A N     1 
ATOM   202  C CA    . LEU A 1 24  ? -17.353 -21.509 18.377 1.00 41.70  ? 543 LEU A CA    1 
ATOM   203  C C     . LEU A 1 24  ? -18.736 -21.918 17.856 1.00 41.44  ? 543 LEU A C     1 
ATOM   204  O O     . LEU A 1 24  ? -19.003 -21.887 16.656 1.00 41.84  ? 543 LEU A O     1 
ATOM   205  C CB    . LEU A 1 24  ? -17.341 -20.001 18.670 1.00 40.03  ? 543 LEU A CB    1 
ATOM   206  C CG    . LEU A 1 24  ? -16.149 -19.329 19.352 1.00 34.78  ? 543 LEU A CG    1 
ATOM   207  C CD1   . LEU A 1 24  ? -16.481 -17.883 19.613 1.00 27.39  ? 543 LEU A CD1   1 
ATOM   208  C CD2   . LEU A 1 24  ? -15.760 -20.010 20.639 1.00 29.80  ? 543 LEU A CD2   1 
ATOM   209  N N     . PRO A 1 25  ? -19.645 -22.258 18.770 1.00 41.45  ? 544 PRO A N     1 
ATOM   210  C CA    . PRO A 1 25  ? -21.014 -22.545 18.381 1.00 42.54  ? 544 PRO A CA    1 
ATOM   211  C C     . PRO A 1 25  ? -21.616 -21.403 17.572 1.00 43.66  ? 544 PRO A C     1 
ATOM   212  O O     . PRO A 1 25  ? -21.167 -20.258 17.683 1.00 45.39  ? 544 PRO A O     1 
ATOM   213  C CB    . PRO A 1 25  ? -21.737 -22.667 19.727 1.00 42.15  ? 544 PRO A CB    1 
ATOM   214  C CG    . PRO A 1 25  ? -20.705 -23.162 20.649 1.00 42.62  ? 544 PRO A CG    1 
ATOM   215  C CD    . PRO A 1 25  ? -19.406 -22.535 20.197 1.00 42.33  ? 544 PRO A CD    1 
ATOM   216  N N     . PRO A 1 26  ? -22.671 -21.704 16.802 1.00 43.78  ? 545 PRO A N     1 
ATOM   217  C CA    . PRO A 1 26  ? -23.334 -20.726 15.942 1.00 42.71  ? 545 PRO A CA    1 
ATOM   218  C C     . PRO A 1 26  ? -24.111 -19.687 16.746 1.00 41.77  ? 545 PRO A C     1 
ATOM   219  O O     . PRO A 1 26  ? -24.200 -18.523 16.349 1.00 41.86  ? 545 PRO A O     1 
ATOM   220  C CB    . PRO A 1 26  ? -24.298 -21.592 15.123 1.00 44.30  ? 545 PRO A CB    1 
ATOM   221  C CG    . PRO A 1 26  ? -23.716 -23.005 15.184 1.00 44.15  ? 545 PRO A CG    1 
ATOM   222  C CD    . PRO A 1 26  ? -23.179 -23.073 16.583 1.00 44.03  ? 545 PRO A CD    1 
ATOM   223  N N     . ASP A 1 27  ? -24.694 -20.105 17.863 1.00 40.27  ? 546 ASP A N     1 
ATOM   224  C CA    . ASP A 1 27  ? -25.472 -19.189 18.676 1.00 38.27  ? 546 ASP A CA    1 
ATOM   225  C C     . ASP A 1 27  ? -24.522 -18.162 19.255 1.00 36.68  ? 546 ASP A C     1 
ATOM   226  O O     . ASP A 1 27  ? -24.855 -16.982 19.392 1.00 37.00  ? 546 ASP A O     1 
ATOM   227  C CB    . ASP A 1 27  ? -26.124 -19.926 19.836 1.00 39.47  ? 546 ASP A CB    1 
ATOM   228  C CG    . ASP A 1 27  ? -27.245 -20.833 19.402 1.00 40.14  ? 546 ASP A CG    1 
ATOM   229  O OD1   . ASP A 1 27  ? -27.616 -20.812 18.205 1.00 39.67  ? 546 ASP A OD1   1 
ATOM   230  O OD2   . ASP A 1 27  ? -27.765 -21.543 20.296 1.00 44.03  ? 546 ASP A OD2   1 
ATOM   231  N N     . THR A 1 28  ? -23.335 -18.631 19.604 1.00 34.20  ? 547 THR A N     1 
ATOM   232  C CA    . THR A 1 28  ? -22.310 -17.745 20.101 1.00 32.30  ? 547 THR A CA    1 
ATOM   233  C C     . THR A 1 28  ? -21.879 -16.774 19.012 1.00 32.40  ? 547 THR A C     1 
ATOM   234  O O     . THR A 1 28  ? -21.713 -15.580 19.268 1.00 31.06  ? 547 THR A O     1 
ATOM   235  C CB    . THR A 1 28  ? -21.103 -18.536 20.577 1.00 32.39  ? 547 THR A CB    1 
ATOM   236  O OG1   . THR A 1 28  ? -21.539 -19.563 21.485 1.00 34.46  ? 547 THR A OG1   1 
ATOM   237  C CG2   . THR A 1 28  ? -20.083 -17.597 21.234 1.00 29.10  ? 547 THR A CG2   1 
ATOM   238  N N     . ARG A 1 29  ? -21.642 -17.288 17.810 1.00 32.20  ? 548 ARG A N     1 
ATOM   239  C CA    . ARG A 1 29  ? -21.122 -16.446 16.748 1.00 33.05  ? 548 ARG A CA    1 
ATOM   240  C C     . ARG A 1 29  ? -22.140 -15.358 16.428 1.00 33.33  ? 548 ARG A C     1 
ATOM   241  O O     . ARG A 1 29  ? -21.817 -14.166 16.363 1.00 32.88  ? 548 ARG A O     1 
ATOM   242  C CB    . ARG A 1 29  ? -20.792 -17.274 15.506 1.00 34.59  ? 548 ARG A CB    1 
ATOM   243  C CG    . ARG A 1 29  ? -19.765 -18.383 15.732 1.00 37.90  ? 548 ARG A CG    1 
ATOM   244  C CD    . ARG A 1 29  ? -19.257 -18.963 14.412 1.00 43.89  ? 548 ARG A CD    1 
ATOM   245  N NE    . ARG A 1 29  ? -18.419 -20.149 14.623 1.00 50.05  ? 548 ARG A NE    1 
ATOM   246  C CZ    . ARG A 1 29  ? -17.379 -20.502 13.867 1.00 50.31  ? 548 ARG A CZ    1 
ATOM   247  N NH1   . ARG A 1 29  ? -16.995 -19.757 12.837 1.00 49.31  ? 548 ARG A NH1   1 
ATOM   248  N NH2   . ARG A 1 29  ? -16.714 -21.611 14.148 1.00 50.21  ? 548 ARG A NH2   1 
ATOM   249  N N     . GLN A 1 30  ? -23.400 -15.759 16.361 1.00 33.93  ? 549 GLN A N     1 
ATOM   250  C CA    . GLN A 1 30  ? -24.481 -14.802 16.179 1.00 36.15  ? 549 GLN A CA    1 
ATOM   251  C C     . GLN A 1 30  ? -24.515 -13.730 17.255 1.00 36.94  ? 549 GLN A C     1 
ATOM   252  O O     . GLN A 1 30  ? -24.498 -12.533 16.960 1.00 38.57  ? 549 GLN A O     1 
ATOM   253  C CB    . GLN A 1 30  ? -25.824 -15.528 16.148 1.00 37.06  ? 549 GLN A CB    1 
ATOM   254  C CG    . GLN A 1 30  ? -26.884 -14.776 15.354 1.00 43.51  ? 549 GLN A CG    1 
ATOM   255  C CD    . GLN A 1 30  ? -26.328 -14.148 14.078 1.00 49.48  ? 549 GLN A CD    1 
ATOM   256  O OE1   . GLN A 1 30  ? -25.482 -14.735 13.384 1.00 49.19  ? 549 GLN A OE1   1 
ATOM   257  N NE2   . GLN A 1 30  ? -26.799 -12.942 13.770 1.00 50.90  ? 549 GLN A NE2   1 
ATOM   258  N N     . ARG A 1 31  ? -24.673 -14.177 18.500 1.00 37.87  ? 550 ARG A N     1 
ATOM   259  C CA    . ARG A 1 31  ? -24.559 -13.316 19.667 1.00 36.63  ? 550 ARG A CA    1 
ATOM   260  C C     . ARG A 1 31  ? -23.387 -12.370 19.594 1.00 35.59  ? 550 ARG A C     1 
ATOM   261  O O     . ARG A 1 31  ? -23.511 -11.224 19.995 1.00 36.26  ? 550 ARG A O     1 
ATOM   262  C CB    . ARG A 1 31  ? -24.455 -14.153 20.933 1.00 36.15  ? 550 ARG A CB    1 
ATOM   263  C CG    . ARG A 1 31  ? -25.816 -14.692 21.354 1.00 41.27  ? 550 ARG A CG    1 
ATOM   264  C CD    . ARG A 1 31  ? -25.768 -15.339 22.726 1.00 41.72  ? 550 ARG A CD    1 
ATOM   265  N NE    . ARG A 1 31  ? -24.780 -16.420 22.783 1.00 40.35  ? 550 ARG A NE    1 
ATOM   266  C CZ    . ARG A 1 31  ? -25.108 -17.710 22.717 1.00 45.95  ? 550 ARG A CZ    1 
ATOM   267  N NH1   . ARG A 1 31  ? -26.393 -18.043 22.575 1.00 42.10  ? 550 ARG A NH1   1 
ATOM   268  N NH2   . ARG A 1 31  ? -24.170 -18.661 22.782 1.00 48.78  ? 550 ARG A NH2   1 
ATOM   269  N N     . ILE A 1 32  ? -22.237 -12.845 19.136 1.00 36.51  ? 551 ILE A N     1 
ATOM   270  C CA    . ILE A 1 32  ? -21.065 -11.981 19.116 1.00 36.55  ? 551 ILE A CA    1 
ATOM   271  C C     . ILE A 1 32  ? -21.232 -10.959 18.008 1.00 36.88  ? 551 ILE A C     1 
ATOM   272  O O     . ILE A 1 32  ? -20.930 -9.787  18.198 1.00 36.07  ? 551 ILE A O     1 
ATOM   273  C CB    . ILE A 1 32  ? -19.745 -12.734 18.907 1.00 36.10  ? 551 ILE A CB    1 
ATOM   274  C CG1   . ILE A 1 32  ? -19.526 -13.753 20.023 1.00 35.09  ? 551 ILE A CG1   1 
ATOM   275  C CG2   . ILE A 1 32  ? -18.594 -11.728 18.895 1.00 35.71  ? 551 ILE A CG2   1 
ATOM   276  C CD1   . ILE A 1 32  ? -18.138 -14.398 20.021 1.00 28.71  ? 551 ILE A CD1   1 
ATOM   277  N N     . HIS A 1 33  ? -21.711 -11.422 16.856 1.00 38.53  ? 552 HIS A N     1 
ATOM   278  C CA    . HIS A 1 33  ? -22.069 -10.530 15.762 1.00 40.37  ? 552 HIS A CA    1 
ATOM   279  C C     . HIS A 1 33  ? -22.969 -9.406  16.271 1.00 42.62  ? 552 HIS A C     1 
ATOM   280  O O     . HIS A 1 33  ? -22.592 -8.222  16.188 1.00 43.31  ? 552 HIS A O     1 
ATOM   281  C CB    . HIS A 1 33  ? -22.781 -11.289 14.637 1.00 40.73  ? 552 HIS A CB    1 
ATOM   282  C CG    . HIS A 1 33  ? -23.325 -10.398 13.565 1.00 41.87  ? 552 HIS A CG    1 
ATOM   283  N ND1   . HIS A 1 33  ? -22.723 -10.267 12.332 1.00 44.21  ? 552 HIS A ND1   1 
ATOM   284  C CD2   . HIS A 1 33  ? -24.378 -9.545  13.562 1.00 45.11  ? 552 HIS A CD2   1 
ATOM   285  C CE1   . HIS A 1 33  ? -23.391 -9.386  11.608 1.00 46.90  ? 552 HIS A CE1   1 
ATOM   286  N NE2   . HIS A 1 33  ? -24.400 -8.932  12.331 1.00 49.52  ? 552 HIS A NE2   1 
ATOM   287  N N     . ASP A 1 34  ? -24.152 -9.769  16.780 1.00 42.34  ? 553 ASP A N     1 
ATOM   288  C CA    . ASP A 1 34  ? -25.123 -8.764  17.202 1.00 43.78  ? 553 ASP A CA    1 
ATOM   289  C C     . ASP A 1 34  ? -24.583 -7.807  18.263 1.00 43.64  ? 553 ASP A C     1 
ATOM   290  O O     . ASP A 1 34  ? -24.981 -6.646  18.326 1.00 44.45  ? 553 ASP A O     1 
ATOM   291  C CB    . ASP A 1 34  ? -26.411 -9.414  17.704 1.00 44.41  ? 553 ASP A CB    1 
ATOM   292  C CG    . ASP A 1 34  ? -26.992 -10.400 16.715 1.00 48.49  ? 553 ASP A CG    1 
ATOM   293  O OD1   . ASP A 1 34  ? -27.008 -10.099 15.496 1.00 45.81  ? 553 ASP A OD1   1 
ATOM   294  O OD2   . ASP A 1 34  ? -27.464 -11.466 17.180 1.00 53.01  ? 553 ASP A OD2   1 
ATOM   295  N N     . TYR A 1 35  ? -23.713 -8.297  19.138 1.00 43.36  ? 554 TYR A N     1 
ATOM   296  C CA    . TYR A 1 35  ? -23.170 -7.428  20.175 1.00 43.44  ? 554 TYR A CA    1 
ATOM   297  C C     . TYR A 1 35  ? -22.397 -6.301  19.504 1.00 42.59  ? 554 TYR A C     1 
ATOM   298  O O     . TYR A 1 35  ? -22.726 -5.120  19.662 1.00 40.93  ? 554 TYR A O     1 
ATOM   299  C CB    . TYR A 1 35  ? -22.284 -8.208  21.155 1.00 43.47  ? 554 TYR A CB    1 
ATOM   300  C CG    . TYR A 1 35  ? -21.341 -7.347  21.960 1.00 44.00  ? 554 TYR A CG    1 
ATOM   301  C CD1   . TYR A 1 35  ? -21.699 -6.878  23.219 1.00 43.84  ? 554 TYR A CD1   1 
ATOM   302  C CD2   . TYR A 1 35  ? -20.082 -7.008  21.464 1.00 46.26  ? 554 TYR A CD2   1 
ATOM   303  C CE1   . TYR A 1 35  ? -20.830 -6.099  23.966 1.00 42.90  ? 554 TYR A CE1   1 
ATOM   304  C CE2   . TYR A 1 35  ? -19.215 -6.210  22.193 1.00 43.81  ? 554 TYR A CE2   1 
ATOM   305  C CZ    . TYR A 1 35  ? -19.589 -5.766  23.443 1.00 42.95  ? 554 TYR A CZ    1 
ATOM   306  O OH    . TYR A 1 35  ? -18.714 -4.984  24.164 1.00 40.79  ? 554 TYR A OH    1 
ATOM   307  N N     . TYR A 1 36  ? -21.406 -6.679  18.705 1.00 42.22  ? 555 TYR A N     1 
ATOM   308  C CA    . TYR A 1 36  ? -20.640 -5.690  17.959 1.00 41.88  ? 555 TYR A CA    1 
ATOM   309  C C     . TYR A 1 36  ? -21.562 -4.672  17.299 1.00 41.73  ? 555 TYR A C     1 
ATOM   310  O O     . TYR A 1 36  ? -21.435 -3.475  17.559 1.00 41.39  ? 555 TYR A O     1 
ATOM   311  C CB    . TYR A 1 36  ? -19.726 -6.364  16.941 1.00 41.18  ? 555 TYR A CB    1 
ATOM   312  C CG    . TYR A 1 36  ? -18.377 -6.745  17.508 1.00 40.27  ? 555 TYR A CG    1 
ATOM   313  C CD1   . TYR A 1 36  ? -17.316 -5.838  17.524 1.00 38.55  ? 555 TYR A CD1   1 
ATOM   314  C CD2   . TYR A 1 36  ? -18.156 -8.017  18.008 1.00 39.75  ? 555 TYR A CD2   1 
ATOM   315  C CE1   . TYR A 1 36  ? -16.064 -6.206  18.004 1.00 35.96  ? 555 TYR A CE1   1 
ATOM   316  C CE2   . TYR A 1 36  ? -16.923 -8.384  18.513 1.00 39.63  ? 555 TYR A CE2   1 
ATOM   317  C CZ    . TYR A 1 36  ? -15.883 -7.479  18.507 1.00 41.33  ? 555 TYR A CZ    1 
ATOM   318  O OH    . TYR A 1 36  ? -14.671 -7.872  19.035 1.00 46.60  ? 555 TYR A OH    1 
ATOM   319  N N     . GLU A 1 37  ? -22.533 -5.153  16.522 1.00 42.06  ? 556 GLU A N     1 
ATOM   320  C CA    . GLU A 1 37  ? -23.563 -4.285  15.946 1.00 43.69  ? 556 GLU A CA    1 
ATOM   321  C C     . GLU A 1 37  ? -24.082 -3.246  16.951 1.00 45.14  ? 556 GLU A C     1 
ATOM   322  O O     . GLU A 1 37  ? -24.087 -2.043  16.671 1.00 46.08  ? 556 GLU A O     1 
ATOM   323  C CB    . GLU A 1 37  ? -24.723 -5.104  15.361 1.00 43.08  ? 556 GLU A CB    1 
ATOM   324  N N     . HIS A 1 38  ? -24.482 -3.706  18.134 1.00 45.71  ? 557 HIS A N     1 
ATOM   325  C CA    . HIS A 1 38  ? -25.012 -2.816  19.152 1.00 46.49  ? 557 HIS A CA    1 
ATOM   326  C C     . HIS A 1 38  ? -23.976 -1.950  19.854 1.00 47.29  ? 557 HIS A C     1 
ATOM   327  O O     . HIS A 1 38  ? -24.309 -0.897  20.388 1.00 48.46  ? 557 HIS A O     1 
ATOM   328  C CB    . HIS A 1 38  ? -25.821 -3.603  20.175 1.00 46.54  ? 557 HIS A CB    1 
ATOM   329  C CG    . HIS A 1 38  ? -27.144 -4.051  19.647 1.00 46.17  ? 557 HIS A CG    1 
ATOM   330  N ND1   . HIS A 1 38  ? -28.339 -3.541  20.110 1.00 45.24  ? 557 HIS A ND1   1 
ATOM   331  C CD2   . HIS A 1 38  ? -27.457 -4.893  18.635 1.00 43.65  ? 557 HIS A CD2   1 
ATOM   332  C CE1   . HIS A 1 38  ? -29.335 -4.102  19.448 1.00 44.99  ? 557 HIS A CE1   1 
ATOM   333  N NE2   . HIS A 1 38  ? -28.827 -4.931  18.552 1.00 45.80  ? 557 HIS A NE2   1 
ATOM   334  N N     . ARG A 1 39  ? -22.724 -2.378  19.878 1.00 48.40  ? 558 ARG A N     1 
ATOM   335  C CA    . ARG A 1 39  ? -21.745 -1.635  20.657 1.00 49.60  ? 558 ARG A CA    1 
ATOM   336  C C     . ARG A 1 39  ? -20.999 -0.599  19.831 1.00 49.92  ? 558 ARG A C     1 
ATOM   337  O O     . ARG A 1 39  ? -20.474 0.357   20.391 1.00 49.63  ? 558 ARG A O     1 
ATOM   338  C CB    . ARG A 1 39  ? -20.751 -2.568  21.343 1.00 49.60  ? 558 ARG A CB    1 
ATOM   339  C CG    . ARG A 1 39  ? -19.449 -1.890  21.728 1.00 51.59  ? 558 ARG A CG    1 
ATOM   340  C CD    . ARG A 1 39  ? -19.650 -0.945  22.906 1.00 51.90  ? 558 ARG A CD    1 
ATOM   341  N NE    . ARG A 1 39  ? -18.759 -1.324  23.991 1.00 54.66  ? 558 ARG A NE    1 
ATOM   342  C CZ    . ARG A 1 39  ? -17.623 -0.705  24.289 1.00 57.87  ? 558 ARG A CZ    1 
ATOM   343  N NH1   . ARG A 1 39  ? -17.249 0.378   23.603 1.00 49.21  ? 558 ARG A NH1   1 
ATOM   344  N NH2   . ARG A 1 39  ? -16.890 -1.160  25.307 1.00 59.11  ? 558 ARG A NH2   1 
ATOM   345  N N     . TYR A 1 40  ? -20.946 -0.802  18.514 1.00 51.07  ? 559 TYR A N     1 
ATOM   346  C CA    . TYR A 1 40  ? -20.137 0.028   17.618 1.00 51.03  ? 559 TYR A CA    1 
ATOM   347  C C     . TYR A 1 40  ? -20.931 0.580   16.415 1.00 52.60  ? 559 TYR A C     1 
ATOM   348  O O     . TYR A 1 40  ? -20.445 1.436   15.665 1.00 52.92  ? 559 TYR A O     1 
ATOM   349  C CB    . TYR A 1 40  ? -18.897 -0.755  17.168 1.00 50.30  ? 559 TYR A CB    1 
ATOM   350  C CG    . TYR A 1 40  ? -17.981 -1.202  18.292 1.00 49.10  ? 559 TYR A CG    1 
ATOM   351  C CD1   . TYR A 1 40  ? -17.344 -0.269  19.115 1.00 50.28  ? 559 TYR A CD1   1 
ATOM   352  C CD2   . TYR A 1 40  ? -17.745 -2.551  18.530 1.00 45.40  ? 559 TYR A CD2   1 
ATOM   353  C CE1   . TYR A 1 40  ? -16.515 -0.667  20.154 1.00 46.68  ? 559 TYR A CE1   1 
ATOM   354  C CE2   . TYR A 1 40  ? -16.886 -2.961  19.534 1.00 45.08  ? 559 TYR A CE2   1 
ATOM   355  C CZ    . TYR A 1 40  ? -16.276 -2.017  20.347 1.00 47.32  ? 559 TYR A CZ    1 
ATOM   356  O OH    . TYR A 1 40  ? -15.440 -2.416  21.364 1.00 40.99  ? 559 TYR A OH    1 
ATOM   357  N N     . GLN A 1 41  ? -22.173 0.120   16.272 1.00 53.70  ? 560 GLN A N     1 
ATOM   358  C CA    . GLN A 1 41  ? -23.043 0.496   15.157 1.00 55.01  ? 560 GLN A CA    1 
ATOM   359  C C     . GLN A 1 41  ? -22.316 0.653   13.839 1.00 54.99  ? 560 GLN A C     1 
ATOM   360  O O     . GLN A 1 41  ? -22.824 1.323   12.946 1.00 55.81  ? 560 GLN A O     1 
ATOM   361  C CB    . GLN A 1 41  ? -23.824 1.780   15.441 1.00 55.55  ? 560 GLN A CB    1 
ATOM   362  C CG    . GLN A 1 41  ? -24.911 1.649   16.485 1.00 58.35  ? 560 GLN A CG    1 
ATOM   363  C CD    . GLN A 1 41  ? -24.758 2.693   17.567 1.00 63.68  ? 560 GLN A CD    1 
ATOM   364  O OE1   . GLN A 1 41  ? -23.638 3.031   17.962 1.00 67.49  ? 560 GLN A OE1   1 
ATOM   365  N NE2   . GLN A 1 41  ? -25.878 3.221   18.048 1.00 62.50  ? 560 GLN A NE2   1 
ATOM   366  N N     . GLY A 1 42  ? -21.128 0.065   13.728 1.00 55.02  ? 561 GLY A N     1 
ATOM   367  C CA    . GLY A 1 42  ? -20.455 -0.058  12.435 1.00 54.83  ? 561 GLY A CA    1 
ATOM   368  C C     . GLY A 1 42  ? -19.113 0.639   12.285 1.00 54.37  ? 561 GLY A C     1 
ATOM   369  O O     . GLY A 1 42  ? -18.330 0.267   11.410 1.00 54.67  ? 561 GLY A O     1 
ATOM   370  N N     . LYS A 1 43  ? -18.859 1.668   13.096 1.00 54.24  ? 562 LYS A N     1 
ATOM   371  C CA    . LYS A 1 43  ? -17.582 2.390   13.075 1.00 53.80  ? 562 LYS A CA    1 
ATOM   372  C C     . LYS A 1 43  ? -16.773 2.005   14.303 1.00 54.42  ? 562 LYS A C     1 
ATOM   373  O O     . LYS A 1 43  ? -17.330 1.540   15.299 1.00 53.44  ? 562 LYS A O     1 
ATOM   374  C CB    . LYS A 1 43  ? -17.790 3.912   13.090 1.00 52.97  ? 562 LYS A CB    1 
ATOM   375  C CG    . LYS A 1 43  ? -18.457 4.529   11.869 1.00 53.08  ? 562 LYS A CG    1 
ATOM   376  C CD    . LYS A 1 43  ? -19.897 4.920   12.173 1.00 52.33  ? 562 LYS A CD    1 
ATOM   377  C CE    . LYS A 1 43  ? -20.581 5.585   10.980 1.00 52.09  ? 562 LYS A CE    1 
ATOM   378  N NZ    . LYS A 1 43  ? -22.070 5.393   11.004 1.00 52.41  ? 562 LYS A NZ    1 
ATOM   379  N N     . MET A 1 44  ? -15.472 2.276   14.257 1.00 55.46  ? 563 MET A N     1 
ATOM   380  C CA    . MET A 1 44  ? -14.616 2.141   15.438 1.00 57.21  ? 563 MET A CA    1 
ATOM   381  C C     . MET A 1 44  ? -13.524 3.225   15.522 1.00 58.02  ? 563 MET A C     1 
ATOM   382  O O     . MET A 1 44  ? -12.752 3.415   14.579 1.00 59.40  ? 563 MET A O     1 
ATOM   383  C CB    . MET A 1 44  ? -13.998 0.740   15.462 1.00 57.03  ? 563 MET A CB    1 
ATOM   384  C CG    . MET A 1 44  ? -13.428 0.313   16.809 1.00 56.86  ? 563 MET A CG    1 
ATOM   385  S SD    . MET A 1 44  ? -13.732 -1.437  17.124 1.00 55.28  ? 563 MET A SD    1 
ATOM   386  C CE    . MET A 1 44  ? -13.808 -2.092  15.463 1.00 50.27  ? 563 MET A CE    1 
ATOM   387  N N     . PHE A 1 45  ? -13.484 3.962   16.628 1.00 57.93  ? 564 PHE A N     1 
ATOM   388  C CA    . PHE A 1 45  ? -12.458 4.987   16.823 1.00 58.58  ? 564 PHE A CA    1 
ATOM   389  C C     . PHE A 1 45  ? -11.593 4.747   18.067 1.00 59.49  ? 564 PHE A C     1 
ATOM   390  O O     . PHE A 1 45  ? -12.029 4.111   19.030 1.00 59.91  ? 564 PHE A O     1 
ATOM   391  C CB    . PHE A 1 45  ? -13.074 6.389   16.896 1.00 57.80  ? 564 PHE A CB    1 
ATOM   392  C CG    . PHE A 1 45  ? -14.426 6.502   16.259 1.00 54.90  ? 564 PHE A CG    1 
ATOM   393  C CD1   . PHE A 1 45  ? -15.564 6.061   16.922 1.00 55.43  ? 564 PHE A CD1   1 
ATOM   394  C CD2   . PHE A 1 45  ? -14.574 7.117   15.030 1.00 52.54  ? 564 PHE A CD2   1 
ATOM   395  C CE1   . PHE A 1 45  ? -16.828 6.173   16.343 1.00 53.11  ? 564 PHE A CE1   1 
ATOM   396  C CE2   . PHE A 1 45  ? -15.828 7.243   14.448 1.00 50.48  ? 564 PHE A CE2   1 
ATOM   397  C CZ    . PHE A 1 45  ? -16.958 6.774   15.107 1.00 51.46  ? 564 PHE A CZ    1 
ATOM   398  N N     . ASP A 1 46  ? -10.380 5.296   18.055 1.00 60.07  ? 565 ASP A N     1 
ATOM   399  C CA    . ASP A 1 46  ? -9.474  5.212   19.197 1.00 59.84  ? 565 ASP A CA    1 
ATOM   400  C C     . ASP A 1 46  ? -9.928  6.107   20.348 1.00 59.71  ? 565 ASP A C     1 
ATOM   401  O O     . ASP A 1 46  ? -9.109  6.738   21.023 1.00 59.86  ? 565 ASP A O     1 
ATOM   402  C CB    . ASP A 1 46  ? -8.057  5.592   18.768 1.00 60.39  ? 565 ASP A CB    1 
ATOM   403  C CG    . ASP A 1 46  ? -7.311  4.441   18.117 1.00 61.47  ? 565 ASP A CG    1 
ATOM   404  O OD1   . ASP A 1 46  ? -7.947  3.656   17.379 1.00 61.41  ? 565 ASP A OD1   1 
ATOM   405  O OD2   . ASP A 1 46  ? -6.084  4.330   18.344 1.00 61.80  ? 565 ASP A OD2   1 
ATOM   406  N N     . GLU A 1 47  ? -11.235 6.134   20.583 1.00 59.11  ? 566 GLU A N     1 
ATOM   407  C CA    . GLU A 1 47  ? -11.837 7.054   21.537 1.00 58.75  ? 566 GLU A CA    1 
ATOM   408  C C     . GLU A 1 47  ? -10.901 7.343   22.711 1.00 58.88  ? 566 GLU A C     1 
ATOM   409  O O     . GLU A 1 47  ? -10.760 8.490   23.140 1.00 59.10  ? 566 GLU A O     1 
ATOM   410  C CB    . GLU A 1 47  ? -13.170 6.500   22.038 1.00 58.54  ? 566 GLU A CB    1 
ATOM   411  C CG    . GLU A 1 47  ? -14.215 7.565   22.302 1.00 58.54  ? 566 GLU A CG    1 
ATOM   412  C CD    . GLU A 1 47  ? -15.198 7.163   23.389 1.00 56.93  ? 566 GLU A CD    1 
ATOM   413  O OE1   . GLU A 1 47  ? -16.208 7.877   23.574 1.00 56.79  ? 566 GLU A OE1   1 
ATOM   414  O OE2   . GLU A 1 47  ? -14.958 6.138   24.061 1.00 54.90  ? 566 GLU A OE2   1 
ATOM   415  N N     . GLU A 1 48  ? -10.229 6.308   23.203 1.00 58.11  ? 567 GLU A N     1 
ATOM   416  C CA    . GLU A 1 48  ? -9.275  6.471   24.289 1.00 57.55  ? 567 GLU A CA    1 
ATOM   417  C C     . GLU A 1 48  ? -8.118  7.361   23.841 1.00 56.50  ? 567 GLU A C     1 
ATOM   418  O O     . GLU A 1 48  ? -7.676  8.261   24.565 1.00 56.51  ? 567 GLU A O     1 
ATOM   419  C CB    . GLU A 1 48  ? -8.762  5.099   24.740 1.00 58.32  ? 567 GLU A CB    1 
ATOM   420  C CG    . GLU A 1 48  ? -8.114  5.077   26.123 1.00 59.60  ? 567 GLU A CG    1 
ATOM   421  C CD    . GLU A 1 48  ? -7.298  3.811   26.368 1.00 63.07  ? 567 GLU A CD    1 
ATOM   422  O OE1   . GLU A 1 48  ? -7.880  2.702   26.288 1.00 61.51  ? 567 GLU A OE1   1 
ATOM   423  O OE2   . GLU A 1 48  ? -6.075  3.929   26.627 1.00 61.57  ? 567 GLU A OE2   1 
ATOM   424  N N     . SER A 1 49  ? -7.641  7.130   22.626 1.00 54.83  ? 568 SER A N     1 
ATOM   425  C CA    . SER A 1 49  ? -6.575  7.967   22.107 1.00 53.69  ? 568 SER A CA    1 
ATOM   426  C C     . SER A 1 49  ? -7.065  9.373   21.788 1.00 52.29  ? 568 SER A C     1 
ATOM   427  O O     . SER A 1 49  ? -6.455  10.360  22.198 1.00 52.01  ? 568 SER A O     1 
ATOM   428  C CB    . SER A 1 49  ? -5.958  7.349   20.865 1.00 53.80  ? 568 SER A CB    1 
ATOM   429  O OG    . SER A 1 49  ? -4.774  8.058   20.556 1.00 56.70  ? 568 SER A OG    1 
ATOM   430  N N     . ILE A 1 50  ? -8.170  9.461   21.057 1.00 50.28  ? 569 ILE A N     1 
ATOM   431  C CA    . ILE A 1 50  ? -8.774  10.754  20.777 1.00 48.45  ? 569 ILE A CA    1 
ATOM   432  C C     . ILE A 1 50  ? -8.926  11.558  22.059 1.00 49.36  ? 569 ILE A C     1 
ATOM   433  O O     . ILE A 1 50  ? -8.485  12.703  22.152 1.00 50.02  ? 569 ILE A O     1 
ATOM   434  C CB    . ILE A 1 50  ? -10.139 10.619  20.091 1.00 47.45  ? 569 ILE A CB    1 
ATOM   435  C CG1   . ILE A 1 50  ? -9.975  9.958   18.722 1.00 43.69  ? 569 ILE A CG1   1 
ATOM   436  C CG2   . ILE A 1 50  ? -10.800 11.992  19.953 1.00 46.19  ? 569 ILE A CG2   1 
ATOM   437  C CD1   . ILE A 1 50  ? -11.283 9.737   17.982 1.00 39.80  ? 569 ILE A CD1   1 
ATOM   438  N N     . LEU A 1 51  ? -9.527  10.936  23.066 1.00 50.64  ? 570 LEU A N     1 
ATOM   439  C CA    . LEU A 1 51  ? -9.824  11.627  24.313 1.00 50.18  ? 570 LEU A CA    1 
ATOM   440  C C     . LEU A 1 51  ? -8.543  12.134  24.966 1.00 50.39  ? 570 LEU A C     1 
ATOM   441  O O     . LEU A 1 51  ? -8.465  13.304  25.351 1.00 51.25  ? 570 LEU A O     1 
ATOM   442  C CB    . LEU A 1 51  ? -10.640 10.724  25.244 1.00 49.43  ? 570 LEU A CB    1 
ATOM   443  C CG    . LEU A 1 51  ? -12.146 11.023  25.354 1.00 51.29  ? 570 LEU A CG    1 
ATOM   444  C CD1   . LEU A 1 51  ? -12.719 11.805  24.156 1.00 52.80  ? 570 LEU A CD1   1 
ATOM   445  C CD2   . LEU A 1 51  ? -12.977 9.778   25.638 1.00 47.12  ? 570 LEU A CD2   1 
ATOM   446  N N     . GLY A 1 52  ? -7.521  11.279  24.994 1.00 50.14  ? 571 GLY A N     1 
ATOM   447  C CA    . GLY A 1 52  ? -6.242  11.585  25.630 1.00 48.44  ? 571 GLY A CA    1 
ATOM   448  C C     . GLY A 1 52  ? -5.558  12.793  25.033 1.00 48.55  ? 571 GLY A C     1 
ATOM   449  O O     . GLY A 1 52  ? -4.946  13.594  25.745 1.00 50.69  ? 571 GLY A O     1 
ATOM   450  N N     . GLU A 1 53  ? -5.702  12.958  23.726 1.00 47.89  ? 572 GLU A N     1 
ATOM   451  C CA    . GLU A 1 53  ? -5.202  14.138  23.033 1.00 47.60  ? 572 GLU A CA    1 
ATOM   452  C C     . GLU A 1 53  ? -5.895  15.428  23.461 1.00 46.84  ? 572 GLU A C     1 
ATOM   453  O O     . GLU A 1 53  ? -5.300  16.498  23.417 1.00 45.82  ? 572 GLU A O     1 
ATOM   454  C CB    . GLU A 1 53  ? -5.368  13.952  21.521 1.00 48.79  ? 572 GLU A CB    1 
ATOM   455  C CG    . GLU A 1 53  ? -4.742  12.672  20.989 1.00 48.98  ? 572 GLU A CG    1 
ATOM   456  C CD    . GLU A 1 53  ? -4.969  12.450  19.502 1.00 53.30  ? 572 GLU A CD    1 
ATOM   457  O OE1   . GLU A 1 53  ? -4.449  11.431  19.003 1.00 56.32  ? 572 GLU A OE1   1 
ATOM   458  O OE2   . GLU A 1 53  ? -5.655  13.265  18.835 1.00 48.60  ? 572 GLU A OE2   1 
ATOM   459  N N     . LEU A 1 54  ? -7.172  15.325  23.817 1.00 47.14  ? 573 LEU A N     1 
ATOM   460  C CA    . LEU A 1 54  ? -7.944  16.486  24.239 1.00 48.05  ? 573 LEU A CA    1 
ATOM   461  C C     . LEU A 1 54  ? -7.551  16.939  25.630 1.00 48.88  ? 573 LEU A C     1 
ATOM   462  O O     . LEU A 1 54  ? -6.727  16.306  26.296 1.00 50.25  ? 573 LEU A O     1 
ATOM   463  C CB    . LEU A 1 54  ? -9.444  16.190  24.222 1.00 48.39  ? 573 LEU A CB    1 
ATOM   464  C CG    . LEU A 1 54  ? -10.040 15.924  22.839 1.00 48.79  ? 573 LEU A CG    1 
ATOM   465  C CD1   . LEU A 1 54  ? -11.557 15.805  22.911 1.00 45.09  ? 573 LEU A CD1   1 
ATOM   466  C CD2   . LEU A 1 54  ? -9.599  17.009  21.860 1.00 46.46  ? 573 LEU A CD2   1 
ATOM   467  N N     . SER A 1 55  ? -8.134  18.055  26.054 1.00 48.29  ? 574 SER A N     1 
ATOM   468  C CA    . SER A 1 55  ? -8.002  18.507  27.426 1.00 47.75  ? 574 SER A CA    1 
ATOM   469  C C     . SER A 1 55  ? -9.232  18.156  28.266 1.00 46.92  ? 574 SER A C     1 
ATOM   470  O O     . SER A 1 55  ? -10.223 17.635  27.751 1.00 47.08  ? 574 SER A O     1 
ATOM   471  C CB    . SER A 1 55  ? -7.760  20.017  27.468 1.00 20.00  ? 574 SER A CB    1 
ATOM   472  O OG    . SER A 1 55  ? -8.877  20.727  26.961 1.00 20.00  ? 574 SER A OG    1 
ATOM   473  N N     . GLU A 1 56  ? -9.168  18.437  29.564 1.00 45.67  ? 575 GLU A N     1 
ATOM   474  C CA    . GLU A 1 56  ? -10.230 18.029  30.477 1.00 44.77  ? 575 GLU A CA    1 
ATOM   475  C C     . GLU A 1 56  ? -11.514 18.791  30.136 1.00 43.63  ? 575 GLU A C     1 
ATOM   476  O O     . GLU A 1 56  ? -12.595 18.188  30.030 1.00 43.35  ? 575 GLU A O     1 
ATOM   477  C CB    . GLU A 1 56  ? -9.814  18.246  31.946 1.00 45.45  ? 575 GLU A CB    1 
ATOM   478  C CG    . GLU A 1 56  ? -10.641 17.499  33.021 1.00 47.55  ? 575 GLU A CG    1 
ATOM   479  C CD    . GLU A 1 56  ? -10.959 16.041  32.665 1.00 53.74  ? 575 GLU A CD    1 
ATOM   480  O OE1   . GLU A 1 56  ? -10.152 15.377  31.971 1.00 53.39  ? 575 GLU A OE1   1 
ATOM   481  O OE2   . GLU A 1 56  ? -12.041 15.556  33.061 1.00 55.88  ? 575 GLU A OE2   1 
ATOM   482  N N     . PRO A 1 57  ? -11.392 20.116  29.937 1.00 42.39  ? 576 PRO A N     1 
ATOM   483  C CA    . PRO A 1 57  ? -12.538 20.980  29.638 1.00 40.84  ? 576 PRO A CA    1 
ATOM   484  C C     . PRO A 1 57  ? -13.334 20.498  28.414 1.00 41.08  ? 576 PRO A C     1 
ATOM   485  O O     . PRO A 1 57  ? -14.580 20.567  28.416 1.00 39.84  ? 576 PRO A O     1 
ATOM   486  C CB    . PRO A 1 57  ? -11.879 22.332  29.362 1.00 40.65  ? 576 PRO A CB    1 
ATOM   487  C CG    . PRO A 1 57  ? -10.642 22.313  30.201 1.00 42.06  ? 576 PRO A CG    1 
ATOM   488  C CD    . PRO A 1 57  ? -10.153 20.892  30.160 1.00 42.41  ? 576 PRO A CD    1 
ATOM   489  N N     . LEU A 1 58  ? -12.620 19.996  27.399 1.00 38.66  ? 577 LEU A N     1 
ATOM   490  C CA    . LEU A 1 58  ? -13.258 19.443  26.206 1.00 37.03  ? 577 LEU A CA    1 
ATOM   491  C C     . LEU A 1 58  ? -13.875 18.078  26.450 1.00 37.31  ? 577 LEU A C     1 
ATOM   492  O O     . LEU A 1 58  ? -15.016 17.831  26.070 1.00 37.67  ? 577 LEU A O     1 
ATOM   493  C CB    . LEU A 1 58  ? -12.280 19.348  25.038 1.00 35.29  ? 577 LEU A CB    1 
ATOM   494  C CG    . LEU A 1 58  ? -11.923 20.687  24.430 1.00 30.62  ? 577 LEU A CG    1 
ATOM   495  C CD1   . LEU A 1 58  ? -10.745 20.497  23.529 1.00 32.61  ? 577 LEU A CD1   1 
ATOM   496  C CD2   . LEU A 1 58  ? -13.104 21.287  23.694 1.00 28.54  ? 577 LEU A CD2   1 
ATOM   497  N N     . ARG A 1 59  ? -13.095 17.164  27.008 1.00 37.46  ? 578 ARG A N     1 
ATOM   498  C CA    . ARG A 1 59  ? -13.591 15.817  27.236 1.00 38.09  ? 578 ARG A CA    1 
ATOM   499  C C     . ARG A 1 59  ? -14.908 15.911  27.995 1.00 39.09  ? 578 ARG A C     1 
ATOM   500  O O     . ARG A 1 59  ? -15.809 15.083  27.799 1.00 41.27  ? 578 ARG A O     1 
ATOM   501  C CB    . ARG A 1 59  ? -12.581 15.013  28.053 1.00 38.25  ? 578 ARG A CB    1 
ATOM   502  C CG    . ARG A 1 59  ? -11.425 14.438  27.255 1.00 40.32  ? 578 ARG A CG    1 
ATOM   503  C CD    . ARG A 1 59  ? -10.785 13.266  27.995 1.00 36.03  ? 578 ARG A CD    1 
ATOM   504  N NE    . ARG A 1 59  ? -10.071 13.713  29.183 1.00 35.57  ? 578 ARG A NE    1 
ATOM   505  C CZ    . ARG A 1 59  ? -8.906  14.357  29.165 1.00 37.80  ? 578 ARG A CZ    1 
ATOM   506  N NH1   . ARG A 1 59  ? -8.296  14.653  28.020 1.00 39.25  ? 578 ARG A NH1   1 
ATOM   507  N NH2   . ARG A 1 59  ? -8.359  14.743  30.304 1.00 34.53  ? 578 ARG A NH2   1 
ATOM   508  N N     . GLU A 1 60  ? -14.998 16.895  28.888 1.00 38.02  ? 579 GLU A N     1 
ATOM   509  C CA    . GLU A 1 60  ? -16.139 17.010  29.788 1.00 38.56  ? 579 GLU A CA    1 
ATOM   510  C C     . GLU A 1 60  ? -17.314 17.553  28.983 1.00 38.21  ? 579 GLU A C     1 
ATOM   511  O O     . GLU A 1 60  ? -18.474 17.241  29.226 1.00 39.52  ? 579 GLU A O     1 
ATOM   512  C CB    . GLU A 1 60  ? -15.814 17.956  30.945 1.00 37.46  ? 579 GLU A CB    1 
ATOM   513  C CG    . GLU A 1 60  ? -14.782 17.421  31.910 1.00 40.08  ? 579 GLU A CG    1 
ATOM   514  C CD    . GLU A 1 60  ? -14.561 18.367  33.083 1.00 47.52  ? 579 GLU A CD    1 
ATOM   515  O OE1   . GLU A 1 60  ? -15.068 19.508  33.006 1.00 46.45  ? 579 GLU A OE1   1 
ATOM   516  O OE2   . GLU A 1 60  ? -13.892 17.984  34.077 1.00 47.34  ? 579 GLU A OE2   1 
ATOM   517  N N     . GLU A 1 61  ? -17.001 18.386  28.009 1.00 37.42  ? 580 GLU A N     1 
ATOM   518  C CA    . GLU A 1 61  ? -18.027 19.013  27.204 1.00 37.22  ? 580 GLU A CA    1 
ATOM   519  C C     . GLU A 1 61  ? -18.648 17.931  26.333 1.00 36.81  ? 580 GLU A C     1 
ATOM   520  O O     . GLU A 1 61  ? -19.873 17.808  26.219 1.00 36.44  ? 580 GLU A O     1 
ATOM   521  C CB    . GLU A 1 61  ? -17.339 20.049  26.341 1.00 38.64  ? 580 GLU A CB    1 
ATOM   522  C CG    . GLU A 1 61  ? -18.088 21.318  26.115 1.00 40.56  ? 580 GLU A CG    1 
ATOM   523  C CD    . GLU A 1 61  ? -17.590 21.952  24.837 1.00 44.99  ? 580 GLU A CD    1 
ATOM   524  O OE1   . GLU A 1 61  ? -16.395 22.336  24.817 1.00 44.45  ? 580 GLU A OE1   1 
ATOM   525  O OE2   . GLU A 1 61  ? -18.349 21.925  23.834 1.00 44.12  ? 580 GLU A OE2   1 
ATOM   526  N N     . ILE A 1 62  ? -17.782 17.093  25.774 1.00 36.36  ? 581 ILE A N     1 
ATOM   527  C CA    . ILE A 1 62  ? -18.225 15.883  25.094 1.00 35.87  ? 581 ILE A CA    1 
ATOM   528  C C     . ILE A 1 62  ? -19.064 14.940  25.952 1.00 36.11  ? 581 ILE A C     1 
ATOM   529  O O     . ILE A 1 62  ? -20.211 14.663  25.604 1.00 37.90  ? 581 ILE A O     1 
ATOM   530  C CB    . ILE A 1 62  ? -17.060 15.133  24.476 1.00 35.72  ? 581 ILE A CB    1 
ATOM   531  C CG1   . ILE A 1 62  ? -16.543 15.931  23.272 1.00 37.47  ? 581 ILE A CG1   1 
ATOM   532  C CG2   . ILE A 1 62  ? -17.502 13.741  24.101 1.00 33.84  ? 581 ILE A CG2   1 
ATOM   533  C CD1   . ILE A 1 62  ? -15.018 16.061  23.223 1.00 41.78  ? 581 ILE A CD1   1 
ATOM   534  N N     . ILE A 1 63  ? -18.545 14.468  27.085 1.00 35.57  ? 582 ILE A N     1 
ATOM   535  C CA    . ILE A 1 63  ? -19.291 13.441  27.817 1.00 34.82  ? 582 ILE A CA    1 
ATOM   536  C C     . ILE A 1 63  ? -20.608 14.051  28.269 1.00 33.90  ? 582 ILE A C     1 
ATOM   537  O O     . ILE A 1 63  ? -21.674 13.433  28.174 1.00 33.50  ? 582 ILE A O     1 
ATOM   538  C CB    . ILE A 1 63  ? -18.513 12.876  29.007 1.00 34.20  ? 582 ILE A CB    1 
ATOM   539  C CG1   . ILE A 1 63  ? -19.392 11.909  29.822 1.00 35.59  ? 582 ILE A CG1   1 
ATOM   540  C CG2   . ILE A 1 63  ? -18.086 14.028  29.889 1.00 38.35  ? 582 ILE A CG2   1 
ATOM   541  C CD1   . ILE A 1 63  ? -19.426 10.458  29.349 1.00 31.81  ? 582 ILE A CD1   1 
ATOM   542  N N     . ASN A 1 64  ? -20.536 15.322  28.653 1.00 33.31  ? 583 ASN A N     1 
ATOM   543  C CA    . ASN A 1 64  ? -21.731 16.053  29.048 1.00 31.93  ? 583 ASN A CA    1 
ATOM   544  C C     . ASN A 1 64  ? -22.766 16.135  27.937 1.00 31.16  ? 583 ASN A C     1 
ATOM   545  O O     . ASN A 1 64  ? -23.925 15.805  28.135 1.00 28.75  ? 583 ASN A O     1 
ATOM   546  C CB    . ASN A 1 64  ? -21.371 17.420  29.630 1.00 30.76  ? 583 ASN A CB    1 
ATOM   547  C CG    . ASN A 1 64  ? -21.256 17.378  31.146 1.00 32.37  ? 583 ASN A CG    1 
ATOM   548  O OD1   . ASN A 1 64  ? -22.166 16.881  31.804 1.00 38.47  ? 583 ASN A OD1   1 
ATOM   549  N ND2   . ASN A 1 64  ? -20.124 17.830  31.707 1.00 27.55  ? 583 ASN A ND2   1 
ATOM   550  N N     . PHE A 1 65  ? -22.339 16.542  26.748 1.00 33.17  ? 584 PHE A N     1 
ATOM   551  C CA    . PHE A 1 65  ? -23.254 16.559  25.625 1.00 33.52  ? 584 PHE A CA    1 
ATOM   552  C C     . PHE A 1 65  ? -23.833 15.165  25.406 1.00 35.02  ? 584 PHE A C     1 
ATOM   553  O O     . PHE A 1 65  ? -25.044 15.008  25.226 1.00 35.25  ? 584 PHE A O     1 
ATOM   554  C CB    . PHE A 1 65  ? -22.556 17.071  24.376 1.00 33.95  ? 584 PHE A CB    1 
ATOM   555  C CG    . PHE A 1 65  ? -23.445 17.134  23.169 1.00 36.41  ? 584 PHE A CG    1 
ATOM   556  C CD1   . PHE A 1 65  ? -24.353 18.171  23.010 1.00 34.70  ? 584 PHE A CD1   1 
ATOM   557  C CD2   . PHE A 1 65  ? -23.367 16.158  22.182 1.00 37.33  ? 584 PHE A CD2   1 
ATOM   558  C CE1   . PHE A 1 65  ? -25.152 18.244  21.882 1.00 33.92  ? 584 PHE A CE1   1 
ATOM   559  C CE2   . PHE A 1 65  ? -24.177 16.226  21.047 1.00 36.71  ? 584 PHE A CE2   1 
ATOM   560  C CZ    . PHE A 1 65  ? -25.077 17.260  20.907 1.00 34.26  ? 584 PHE A CZ    1 
ATOM   561  N N     . ASN A 1 66  ? -22.989 14.139  25.501 1.00 36.66  ? 585 ASN A N     1 
ATOM   562  C CA    . ASN A 1 66  ? -23.424 12.780  25.167 1.00 37.32  ? 585 ASN A CA    1 
ATOM   563  C C     . ASN A 1 66  ? -24.373 12.130  26.177 1.00 37.02  ? 585 ASN A C     1 
ATOM   564  O O     . ASN A 1 66  ? -25.022 11.120  25.904 1.00 38.76  ? 585 ASN A O     1 
ATOM   565  C CB    . ASN A 1 66  ? -22.209 11.892  24.916 1.00 37.15  ? 585 ASN A CB    1 
ATOM   566  C CG    . ASN A 1 66  ? -21.471 12.262  23.641 1.00 40.78  ? 585 ASN A CG    1 
ATOM   567  O OD1   . ASN A 1 66  ? -21.959 13.048  22.817 1.00 43.50  ? 585 ASN A OD1   1 
ATOM   568  N ND2   . ASN A 1 66  ? -20.295 11.667  23.457 1.00 43.52  ? 585 ASN A ND2   1 
ATOM   569  N N     . CYS A 1 67  ? -24.441 12.702  27.366 1.00 36.89  ? 586 CYS A N     1 
ATOM   570  C CA    . CYS A 1 67  ? -25.206 12.103  28.439 1.00 35.98  ? 586 CYS A CA    1 
ATOM   571  C C     . CYS A 1 67  ? -26.348 13.025  28.858 1.00 35.24  ? 586 CYS A C     1 
ATOM   572  O O     . CYS A 1 67  ? -26.840 12.965  29.985 1.00 35.83  ? 586 CYS A O     1 
ATOM   573  C CB    . CYS A 1 67  ? -24.254 11.808  29.595 1.00 36.01  ? 586 CYS A CB    1 
ATOM   574  S SG    . CYS A 1 67  ? -22.953 10.647  29.094 1.00 36.04  ? 586 CYS A SG    1 
ATOM   575  N N     . ARG A 1 68  ? -26.761 13.889  27.940 1.00 34.69  ? 587 ARG A N     1 
ATOM   576  C CA    . ARG A 1 68  ? -27.845 14.815  28.207 1.00 35.30  ? 587 ARG A CA    1 
ATOM   577  C C     . ARG A 1 68  ? -29.111 14.098  28.651 1.00 36.43  ? 587 ARG A C     1 
ATOM   578  O O     . ARG A 1 68  ? -29.644 14.400  29.719 1.00 38.66  ? 587 ARG A O     1 
ATOM   579  C CB    . ARG A 1 68  ? -28.096 15.710  26.998 1.00 35.39  ? 587 ARG A CB    1 
ATOM   580  C CG    . ARG A 1 68  ? -27.441 17.068  27.134 1.00 33.15  ? 587 ARG A CG    1 
ATOM   581  C CD    . ARG A 1 68  ? -26.642 17.348  25.917 1.00 35.00  ? 587 ARG A CD    1 
ATOM   582  N NE    . ARG A 1 68  ? -27.444 17.925  24.846 1.00 36.34  ? 587 ARG A NE    1 
ATOM   583  C CZ    . ARG A 1 68  ? -27.696 17.333  23.683 1.00 39.50  ? 587 ARG A CZ    1 
ATOM   584  N NH1   . ARG A 1 68  ? -27.199 16.121  23.443 1.00 37.15  ? 587 ARG A NH1   1 
ATOM   585  N NH2   . ARG A 1 68  ? -28.423 17.971  22.756 1.00 34.31  ? 587 ARG A NH2   1 
ATOM   586  N N     . LYS A 1 69  ? -29.544 13.101  27.884 1.00 36.26  ? 588 LYS A N     1 
ATOM   587  C CA    . LYS A 1 69  ? -30.658 12.251  28.292 1.00 36.68  ? 588 LYS A CA    1 
ATOM   588  C C     . LYS A 1 69  ? -30.397 11.440  29.577 1.00 37.13  ? 588 LYS A C     1 
ATOM   589  O O     . LYS A 1 69  ? -31.285 11.340  30.420 1.00 38.33  ? 588 LYS A O     1 
ATOM   590  C CB    . LYS A 1 69  ? -31.163 11.373  27.137 1.00 36.09  ? 588 LYS A CB    1 
ATOM   591  C CG    . LYS A 1 69  ? -32.400 10.518  27.480 1.00 40.89  ? 588 LYS A CG    1 
ATOM   592  C CD    . LYS A 1 69  ? -33.558 10.634  26.480 1.00 45.43  ? 588 LYS A CD    1 
ATOM   593  C CE    . LYS A 1 69  ? -33.456 9.617   25.332 1.00 50.19  ? 588 LYS A CE    1 
ATOM   594  N NZ    . LYS A 1 69  ? -34.233 10.021  24.112 1.00 48.92  ? 588 LYS A NZ    1 
ATOM   595  N N     . LEU A 1 70  ? -29.195 10.892  29.750 1.00 37.20  ? 589 LEU A N     1 
ATOM   596  C CA    . LEU A 1 70  ? -28.833 10.212  30.999 1.00 37.71  ? 589 LEU A CA    1 
ATOM   597  C C     . LEU A 1 70  ? -29.068 11.145  32.182 1.00 38.62  ? 589 LEU A C     1 
ATOM   598  O O     . LEU A 1 70  ? -29.736 10.776  33.140 1.00 38.42  ? 589 LEU A O     1 
ATOM   599  C CB    . LEU A 1 70  ? -27.357 9.807   30.989 1.00 37.17  ? 589 LEU A CB    1 
ATOM   600  C CG    . LEU A 1 70  ? -26.874 8.504   31.630 1.00 35.06  ? 589 LEU A CG    1 
ATOM   601  C CD1   . LEU A 1 70  ? -25.458 8.714   32.148 1.00 29.59  ? 589 LEU A CD1   1 
ATOM   602  C CD2   . LEU A 1 70  ? -27.797 7.999   32.719 1.00 31.69  ? 589 LEU A CD2   1 
ATOM   603  N N     . VAL A 1 71  ? -28.572 12.376  32.065 1.00 40.32  ? 590 VAL A N     1 
ATOM   604  C CA    . VAL A 1 71  ? -28.577 13.353  33.160 1.00 40.36  ? 590 VAL A CA    1 
ATOM   605  C C     . VAL A 1 71  ? -29.973 13.917  33.466 1.00 40.81  ? 590 VAL A C     1 
ATOM   606  O O     . VAL A 1 71  ? -30.360 14.083  34.625 1.00 38.59  ? 590 VAL A O     1 
ATOM   607  C CB    . VAL A 1 71  ? -27.591 14.511  32.856 1.00 40.25  ? 590 VAL A CB    1 
ATOM   608  C CG1   . VAL A 1 71  ? -27.565 15.517  33.994 1.00 40.15  ? 590 VAL A CG1   1 
ATOM   609  C CG2   . VAL A 1 71  ? -26.197 13.972  32.583 1.00 37.65  ? 590 VAL A CG2   1 
ATOM   610  N N     . ALA A 1 72  ? -30.729 14.213  32.417 1.00 41.98  ? 591 ALA A N     1 
ATOM   611  C CA    . ALA A 1 72  ? -32.061 14.782  32.594 1.00 43.91  ? 591 ALA A CA    1 
ATOM   612  C C     . ALA A 1 72  ? -33.055 13.774  33.163 1.00 44.21  ? 591 ALA A C     1 
ATOM   613  O O     . ALA A 1 72  ? -33.963 14.137  33.903 1.00 43.72  ? 591 ALA A O     1 
ATOM   614  C CB    . ALA A 1 72  ? -32.570 15.326  31.283 1.00 44.75  ? 591 ALA A CB    1 
ATOM   615  N N     . SER A 1 73  ? -32.882 12.501  32.822 1.00 45.52  ? 592 SER A N     1 
ATOM   616  C CA    . SER A 1 73  ? -33.892 11.493  33.154 1.00 46.01  ? 592 SER A CA    1 
ATOM   617  C C     . SER A 1 73  ? -33.652 10.890  34.542 1.00 45.42  ? 592 SER A C     1 
ATOM   618  O O     . SER A 1 73  ? -34.464 10.088  35.029 1.00 45.19  ? 592 SER A O     1 
ATOM   619  C CB    . SER A 1 73  ? -33.969 10.406  32.072 1.00 46.07  ? 592 SER A CB    1 
ATOM   620  O OG    . SER A 1 73  ? -32.998 9.381   32.273 1.00 50.16  ? 592 SER A OG    1 
ATOM   621  N N     . MET A 1 74  ? -32.547 11.298  35.169 1.00 43.86  ? 593 MET A N     1 
ATOM   622  C CA    . MET A 1 74  ? -32.125 10.739  36.447 1.00 42.94  ? 593 MET A CA    1 
ATOM   623  C C     . MET A 1 74  ? -32.062 11.804  37.560 1.00 42.69  ? 593 MET A C     1 
ATOM   624  O O     . MET A 1 74  ? -31.078 12.546  37.681 1.00 41.07  ? 593 MET A O     1 
ATOM   625  C CB    . MET A 1 74  ? -30.796 9.999   36.280 1.00 42.48  ? 593 MET A CB    1 
ATOM   626  C CG    . MET A 1 74  ? -30.282 9.333   37.554 1.00 45.94  ? 593 MET A CG    1 
ATOM   627  S SD    . MET A 1 74  ? -28.707 8.469   37.333 1.00 47.08  ? 593 MET A SD    1 
ATOM   628  C CE    . MET A 1 74  ? -29.289 7.074   36.356 1.00 49.28  ? 593 MET A CE    1 
ATOM   629  N N     . PRO A 1 75  ? -33.125 11.880  38.387 1.00 42.74  ? 594 PRO A N     1 
ATOM   630  C CA    . PRO A 1 75  ? -33.217 12.856  39.477 1.00 41.75  ? 594 PRO A CA    1 
ATOM   631  C C     . PRO A 1 75  ? -31.900 13.145  40.168 1.00 40.75  ? 594 PRO A C     1 
ATOM   632  O O     . PRO A 1 75  ? -31.512 14.311  40.304 1.00 40.10  ? 594 PRO A O     1 
ATOM   633  C CB    . PRO A 1 75  ? -34.202 12.203  40.447 1.00 40.72  ? 594 PRO A CB    1 
ATOM   634  C CG    . PRO A 1 75  ? -35.187 11.518  39.518 1.00 42.44  ? 594 PRO A CG    1 
ATOM   635  C CD    . PRO A 1 75  ? -34.339 11.038  38.320 1.00 42.75  ? 594 PRO A CD    1 
ATOM   636  N N     . LEU A 1 76  ? -31.209 12.081  40.561 1.00 41.15  ? 595 LEU A N     1 
ATOM   637  C CA    . LEU A 1 76  ? -30.004 12.180  41.383 1.00 39.90  ? 595 LEU A CA    1 
ATOM   638  C C     . LEU A 1 76  ? -28.939 12.995  40.668 1.00 39.28  ? 595 LEU A C     1 
ATOM   639  O O     . LEU A 1 76  ? -28.352 13.886  41.272 1.00 39.30  ? 595 LEU A O     1 
ATOM   640  C CB    . LEU A 1 76  ? -29.494 10.783  41.768 1.00 40.66  ? 595 LEU A CB    1 
ATOM   641  C CG    . LEU A 1 76  ? -28.335 10.636  42.765 1.00 41.22  ? 595 LEU A CG    1 
ATOM   642  C CD1   . LEU A 1 76  ? -28.608 9.498   43.735 1.00 41.24  ? 595 LEU A CD1   1 
ATOM   643  C CD2   . LEU A 1 76  ? -27.008 10.416  42.042 1.00 38.69  ? 595 LEU A CD2   1 
ATOM   644  N N     . PHE A 1 77  ? -28.758 12.737  39.372 1.00 39.05  ? 596 PHE A N     1 
ATOM   645  C CA    . PHE A 1 77  ? -27.939 13.572  38.489 1.00 37.48  ? 596 PHE A CA    1 
ATOM   646  C C     . PHE A 1 77  ? -28.533 14.927  38.094 1.00 37.33  ? 596 PHE A C     1 
ATOM   647  O O     . PHE A 1 77  ? -27.819 15.929  38.048 1.00 37.42  ? 596 PHE A O     1 
ATOM   648  C CB    . PHE A 1 77  ? -27.604 12.794  37.220 1.00 37.33  ? 596 PHE A CB    1 
ATOM   649  C CG    . PHE A 1 77  ? -26.462 11.848  37.385 1.00 38.20  ? 596 PHE A CG    1 
ATOM   650  C CD1   . PHE A 1 77  ? -25.919 11.612  38.638 1.00 42.91  ? 596 PHE A CD1   1 
ATOM   651  C CD2   . PHE A 1 77  ? -25.929 11.195  36.302 1.00 37.04  ? 596 PHE A CD2   1 
ATOM   652  C CE1   . PHE A 1 77  ? -24.861 10.735  38.801 1.00 41.11  ? 596 PHE A CE1   1 
ATOM   653  C CE2   . PHE A 1 77  ? -24.887 10.308  36.470 1.00 38.74  ? 596 PHE A CE2   1 
ATOM   654  C CZ    . PHE A 1 77  ? -24.347 10.089  37.710 1.00 36.57  ? 596 PHE A CZ    1 
ATOM   655  N N     . ALA A 1 78  ? -29.818 14.951  37.750 1.00 37.53  ? 597 ALA A N     1 
ATOM   656  C CA    . ALA A 1 78  ? -30.451 16.171  37.253 1.00 38.25  ? 597 ALA A CA    1 
ATOM   657  C C     . ALA A 1 78  ? -30.581 17.271  38.301 1.00 39.03  ? 597 ALA A C     1 
ATOM   658  O O     . ALA A 1 78  ? -30.344 18.437  38.001 1.00 40.78  ? 597 ALA A O     1 
ATOM   659  C CB    . ALA A 1 78  ? -31.795 15.869  36.650 1.00 38.39  ? 597 ALA A CB    1 
ATOM   660  N N     . ASN A 1 79  ? -30.975 16.917  39.519 1.00 40.29  ? 598 ASN A N     1 
ATOM   661  C CA    . ASN A 1 79  ? -31.059 17.901  40.596 1.00 41.50  ? 598 ASN A CA    1 
ATOM   662  C C     . ASN A 1 79  ? -29.750 18.077  41.362 1.00 42.76  ? 598 ASN A C     1 
ATOM   663  O O     . ASN A 1 79  ? -29.737 18.582  42.486 1.00 43.71  ? 598 ASN A O     1 
ATOM   664  C CB    . ASN A 1 79  ? -32.201 17.559  41.545 1.00 41.06  ? 598 ASN A CB    1 
ATOM   665  C CG    . ASN A 1 79  ? -33.471 17.215  40.804 1.00 42.23  ? 598 ASN A CG    1 
ATOM   666  O OD1   . ASN A 1 79  ? -34.080 16.169  41.045 1.00 40.16  ? 598 ASN A OD1   1 
ATOM   667  N ND2   . ASN A 1 79  ? -33.837 18.059  39.840 1.00 41.62  ? 598 ASN A ND2   1 
ATOM   668  N N     . ALA A 1 80  ? -28.649 17.677  40.734 1.00 42.97  ? 599 ALA A N     1 
ATOM   669  C CA    . ALA A 1 80  ? -27.342 17.766  41.364 1.00 43.02  ? 599 ALA A CA    1 
ATOM   670  C C     . ALA A 1 80  ? -26.468 18.842  40.730 1.00 42.59  ? 599 ALA A C     1 
ATOM   671  O O     . ALA A 1 80  ? -26.680 19.234  39.577 1.00 44.29  ? 599 ALA A O     1 
ATOM   672  C CB    . ALA A 1 80  ? -26.642 16.415  41.330 1.00 42.79  ? 599 ALA A CB    1 
ATOM   673  N N     . ASP A 1 81  ? -25.472 19.285  41.490 1.00 42.18  ? 600 ASP A N     1 
ATOM   674  C CA    . ASP A 1 81  ? -24.490 20.255  41.023 1.00 42.03  ? 600 ASP A CA    1 
ATOM   675  C C     . ASP A 1 81  ? -23.769 19.721  39.795 1.00 42.08  ? 600 ASP A C     1 
ATOM   676  O O     . ASP A 1 81  ? -23.058 18.710  39.869 1.00 42.98  ? 600 ASP A O     1 
ATOM   677  C CB    . ASP A 1 81  ? -23.472 20.531  42.123 1.00 42.71  ? 600 ASP A CB    1 
ATOM   678  C CG    . ASP A 1 81  ? -22.310 21.373  41.642 1.00 43.98  ? 600 ASP A CG    1 
ATOM   679  O OD1   . ASP A 1 81  ? -22.222 21.609  40.416 1.00 45.69  ? 600 ASP A OD1   1 
ATOM   680  O OD2   . ASP A 1 81  ? -21.471 21.766  42.483 1.00 41.06  ? 600 ASP A OD2   1 
ATOM   681  N N     . PRO A 1 82  ? -23.972 20.386  38.648 1.00 41.05  ? 601 PRO A N     1 
ATOM   682  C CA    . PRO A 1 82  ? -23.453 19.814  37.415 1.00 40.03  ? 601 PRO A CA    1 
ATOM   683  C C     . PRO A 1 82  ? -21.962 19.551  37.467 1.00 39.92  ? 601 PRO A C     1 
ATOM   684  O O     . PRO A 1 82  ? -21.448 18.873  36.578 1.00 41.52  ? 601 PRO A O     1 
ATOM   685  C CB    . PRO A 1 82  ? -23.791 20.880  36.373 1.00 39.88  ? 601 PRO A CB    1 
ATOM   686  C CG    . PRO A 1 82  ? -25.062 21.463  36.880 1.00 39.53  ? 601 PRO A CG    1 
ATOM   687  C CD    . PRO A 1 82  ? -24.949 21.459  38.387 1.00 39.87  ? 601 PRO A CD    1 
ATOM   688  N N     . ASN A 1 83  ? -21.279 20.086  38.481 1.00 39.17  ? 602 ASN A N     1 
ATOM   689  C CA    . ASN A 1 83  ? -19.840 19.863  38.651 1.00 37.64  ? 602 ASN A CA    1 
ATOM   690  C C     . ASN A 1 83  ? -19.577 18.468  39.228 1.00 37.72  ? 602 ASN A C     1 
ATOM   691  O O     . ASN A 1 83  ? -18.644 17.773  38.819 1.00 37.87  ? 602 ASN A O     1 
ATOM   692  C CB    . ASN A 1 83  ? -19.207 20.937  39.545 1.00 37.06  ? 602 ASN A CB    1 
ATOM   693  C CG    . ASN A 1 83  ? -19.387 22.353  39.002 1.00 38.90  ? 602 ASN A CG    1 
ATOM   694  O OD1   . ASN A 1 83  ? -19.680 23.314  39.741 1.00 32.37  ? 602 ASN A OD1   1 
ATOM   695  N ND2   . ASN A 1 83  ? -19.222 22.487  37.696 1.00 41.93  ? 602 ASN A ND2   1 
ATOM   696  N N     . PHE A 1 84  ? -20.408 18.064  40.183 1.00 36.59  ? 603 PHE A N     1 
ATOM   697  C CA    . PHE A 1 84  ? -20.354 16.719  40.732 1.00 34.83  ? 603 PHE A CA    1 
ATOM   698  C C     . PHE A 1 84  ? -20.735 15.736  39.634 1.00 33.81  ? 603 PHE A C     1 
ATOM   699  O O     . PHE A 1 84  ? -20.080 14.710  39.451 1.00 33.90  ? 603 PHE A O     1 
ATOM   700  C CB    . PHE A 1 84  ? -21.296 16.571  41.942 1.00 35.49  ? 603 PHE A CB    1 
ATOM   701  C CG    . PHE A 1 84  ? -21.834 15.166  42.132 1.00 33.86  ? 603 PHE A CG    1 
ATOM   702  C CD1   . PHE A 1 84  ? -21.045 14.185  42.708 1.00 29.47  ? 603 PHE A CD1   1 
ATOM   703  C CD2   . PHE A 1 84  ? -23.119 14.826  41.697 1.00 33.31  ? 603 PHE A CD2   1 
ATOM   704  C CE1   . PHE A 1 84  ? -21.522 12.896  42.862 1.00 32.73  ? 603 PHE A CE1   1 
ATOM   705  C CE2   . PHE A 1 84  ? -23.612 13.535  41.848 1.00 28.60  ? 603 PHE A CE2   1 
ATOM   706  C CZ    . PHE A 1 84  ? -22.810 12.568  42.428 1.00 31.35  ? 603 PHE A CZ    1 
ATOM   707  N N     . VAL A 1 85  ? -21.794 16.058  38.908 1.00 32.33  ? 604 VAL A N     1 
ATOM   708  C CA    . VAL A 1 85  ? -22.242 15.228  37.787 1.00 32.04  ? 604 VAL A CA    1 
ATOM   709  C C     . VAL A 1 85  ? -21.113 14.990  36.793 1.00 31.75  ? 604 VAL A C     1 
ATOM   710  O O     . VAL A 1 85  ? -20.670 13.864  36.611 1.00 32.40  ? 604 VAL A O     1 
ATOM   711  C CB    . VAL A 1 85  ? -23.517 15.829  37.112 1.00 31.53  ? 604 VAL A CB    1 
ATOM   712  C CG1   . VAL A 1 85  ? -24.038 14.943  36.002 1.00 29.08  ? 604 VAL A CG1   1 
ATOM   713  C CG2   . VAL A 1 85  ? -24.618 16.031  38.175 1.00 30.04  ? 604 VAL A CG2   1 
ATOM   714  N N     . THR A 1 86  ? -20.637 16.055  36.162 1.00 33.03  ? 605 THR A N     1 
ATOM   715  C CA    . THR A 1 86  ? -19.481 15.993  35.267 1.00 33.17  ? 605 THR A CA    1 
ATOM   716  C C     . THR A 1 86  ? -18.426 15.027  35.789 1.00 35.10  ? 605 THR A C     1 
ATOM   717  O O     . THR A 1 86  ? -17.980 14.132  35.071 1.00 36.54  ? 605 THR A O     1 
ATOM   718  C CB    . THR A 1 86  ? -18.802 17.376  35.160 1.00 32.60  ? 605 THR A CB    1 
ATOM   719  O OG1   . THR A 1 86  ? -19.711 18.285  34.539 1.00 30.92  ? 605 THR A OG1   1 
ATOM   720  C CG2   . THR A 1 86  ? -17.535 17.291  34.327 1.00 28.63  ? 605 THR A CG2   1 
ATOM   721  N N     . SER A 1 87  ? -17.995 15.242  37.027 1.00 34.78  ? 606 SER A N     1 
ATOM   722  C CA    . SER A 1 87  ? -16.862 14.521  37.561 1.00 35.11  ? 606 SER A CA    1 
ATOM   723  C C     . SER A 1 87  ? -17.205 13.037  37.633 1.00 35.20  ? 606 SER A C     1 
ATOM   724  O O     . SER A 1 87  ? -16.309 12.190  37.622 1.00 37.47  ? 606 SER A O     1 
ATOM   725  C CB    . SER A 1 87  ? -16.517 15.064  38.944 1.00 34.40  ? 606 SER A CB    1 
ATOM   726  O OG    . SER A 1 87  ? -15.720 14.125  39.633 1.00 39.19  ? 606 SER A OG    1 
ATOM   727  N N     . MET A 1 88  ? -18.497 12.723  37.674 1.00 33.56  ? 607 MET A N     1 
ATOM   728  C CA    . MET A 1 88  ? -18.952 11.333  37.742 1.00 33.90  ? 607 MET A CA    1 
ATOM   729  C C     . MET A 1 88  ? -19.052 10.710  36.354 1.00 33.78  ? 607 MET A C     1 
ATOM   730  O O     . MET A 1 88  ? -18.528 9.619   36.121 1.00 33.19  ? 607 MET A O     1 
ATOM   731  C CB    . MET A 1 88  ? -20.298 11.237  38.458 1.00 33.67  ? 607 MET A CB    1 
ATOM   732  C CG    . MET A 1 88  ? -20.785 9.828   38.681 1.00 37.85  ? 607 MET A CG    1 
ATOM   733  S SD    . MET A 1 88  ? -21.459 9.533   40.336 1.00 44.38  ? 607 MET A SD    1 
ATOM   734  C CE    . MET A 1 88  ? -20.017 9.830   41.348 1.00 35.29  ? 607 MET A CE    1 
ATOM   735  N N     . LEU A 1 89  ? -19.698 11.422  35.432 1.00 33.76  ? 608 LEU A N     1 
ATOM   736  C CA    . LEU A 1 89  ? -19.718 11.061  33.996 1.00 34.66  ? 608 LEU A CA    1 
ATOM   737  C C     . LEU A 1 89  ? -18.339 10.662  33.469 1.00 32.87  ? 608 LEU A C     1 
ATOM   738  O O     . LEU A 1 89  ? -18.170 9.705   32.723 1.00 33.71  ? 608 LEU A O     1 
ATOM   739  C CB    . LEU A 1 89  ? -20.239 12.244  33.151 1.00 33.94  ? 608 LEU A CB    1 
ATOM   740  C CG    . LEU A 1 89  ? -21.734 12.373  32.854 1.00 33.50  ? 608 LEU A CG    1 
ATOM   741  C CD1   . LEU A 1 89  ? -22.592 12.098  34.074 1.00 32.77  ? 608 LEU A CD1   1 
ATOM   742  C CD2   . LEU A 1 89  ? -22.028 13.758  32.322 1.00 33.91  ? 608 LEU A CD2   1 
ATOM   743  N N     . THR A 1 90  ? -17.358 11.431  33.903 1.00 31.96  ? 609 THR A N     1 
ATOM   744  C CA    . THR A 1 90  ? -16.017 11.430  33.379 1.00 30.81  ? 609 THR A CA    1 
ATOM   745  C C     . THR A 1 90  ? -15.341 10.122  33.768 1.00 31.42  ? 609 THR A C     1 
ATOM   746  O O     . THR A 1 90  ? -14.253 9.784   33.319 1.00 32.18  ? 609 THR A O     1 
ATOM   747  C CB    . THR A 1 90  ? -15.322 12.680  33.974 1.00 31.61  ? 609 THR A CB    1 
ATOM   748  O OG1   . THR A 1 90  ? -14.516 13.336  32.991 1.00 30.82  ? 609 THR A OG1   1 
ATOM   749  C CG2   . THR A 1 90  ? -14.582 12.409  35.282 1.00 27.25  ? 609 THR A CG2   1 
ATOM   750  N N     . LYS A 1 91  ? -16.028 9.342   34.580 1.00 32.93  ? 610 LYS A N     1 
ATOM   751  C CA    . LYS A 1 91  ? -15.438 8.149   35.148 1.00 33.26  ? 610 LYS A CA    1 
ATOM   752  C C     . LYS A 1 91  ? -16.273 6.928   34.778 1.00 34.54  ? 610 LYS A C     1 
ATOM   753  O O     . LYS A 1 91  ? -15.838 5.790   34.969 1.00 35.43  ? 610 LYS A O     1 
ATOM   754  C CB    . LYS A 1 91  ? -15.338 8.305   36.665 1.00 33.75  ? 610 LYS A CB    1 
ATOM   755  C CG    . LYS A 1 91  ? -14.090 9.059   37.076 1.00 35.46  ? 610 LYS A CG    1 
ATOM   756  C CD    . LYS A 1 91  ? -14.184 9.633   38.473 1.00 38.44  ? 610 LYS A CD    1 
ATOM   757  C CE    . LYS A 1 91  ? -13.092 10.675  38.695 1.00 37.53  ? 610 LYS A CE    1 
ATOM   758  N NZ    . LYS A 1 91  ? -13.476 12.005  38.136 1.00 41.30  ? 610 LYS A NZ    1 
ATOM   759  N N     . LEU A 1 92  ? -17.471 7.154   34.250 1.00 33.16  ? 611 LEU A N     1 
ATOM   760  C CA    . LEU A 1 92  ? -18.285 6.025   33.845 1.00 34.64  ? 611 LEU A CA    1 
ATOM   761  C C     . LEU A 1 92  ? -17.585 5.349   32.688 1.00 36.29  ? 611 LEU A C     1 
ATOM   762  O O     . LEU A 1 92  ? -16.842 6.001   31.942 1.00 36.34  ? 611 LEU A O     1 
ATOM   763  C CB    . LEU A 1 92  ? -19.682 6.463   33.415 1.00 33.94  ? 611 LEU A CB    1 
ATOM   764  C CG    . LEU A 1 92  ? -20.320 7.373   34.452 1.00 32.76  ? 611 LEU A CG    1 
ATOM   765  C CD1   . LEU A 1 92  ? -21.563 8.077   33.919 1.00 23.68  ? 611 LEU A CD1   1 
ATOM   766  C CD2   . LEU A 1 92  ? -20.607 6.513   35.664 1.00 33.77  ? 611 LEU A CD2   1 
ATOM   767  N N     . ARG A 1 93  ? -17.837 4.051   32.528 1.00 35.98  ? 612 ARG A N     1 
ATOM   768  C CA    . ARG A 1 93  ? -17.346 3.363   31.346 1.00 35.59  ? 612 ARG A CA    1 
ATOM   769  C C     . ARG A 1 93  ? -18.531 2.712   30.664 1.00 36.16  ? 612 ARG A C     1 
ATOM   770  O O     . ARG A 1 93  ? -19.342 2.046   31.318 1.00 37.81  ? 612 ARG A O     1 
ATOM   771  C CB    . ARG A 1 93  ? -16.288 2.337   31.704 1.00 34.42  ? 612 ARG A CB    1 
ATOM   772  N N     . PHE A 1 94  ? -18.631 2.925   29.355 1.00 34.24  ? 613 PHE A N     1 
ATOM   773  C CA    . PHE A 1 94  ? -19.776 2.501   28.587 1.00 33.09  ? 613 PHE A CA    1 
ATOM   774  C C     . PHE A 1 94  ? -19.740 0.991   28.443 1.00 33.19  ? 613 PHE A C     1 
ATOM   775  O O     . PHE A 1 94  ? -18.688 0.430   28.169 1.00 35.04  ? 613 PHE A O     1 
ATOM   776  C CB    . PHE A 1 94  ? -19.722 3.158   27.209 1.00 32.55  ? 613 PHE A CB    1 
ATOM   777  C CG    . PHE A 1 94  ? -20.953 2.938   26.381 1.00 33.83  ? 613 PHE A CG    1 
ATOM   778  C CD1   . PHE A 1 94  ? -22.211 3.218   26.890 1.00 33.66  ? 613 PHE A CD1   1 
ATOM   779  C CD2   . PHE A 1 94  ? -20.857 2.469   25.082 1.00 36.53  ? 613 PHE A CD2   1 
ATOM   780  C CE1   . PHE A 1 94  ? -23.353 3.056   26.120 1.00 30.97  ? 613 PHE A CE1   1 
ATOM   781  C CE2   . PHE A 1 94  ? -21.999 2.331   24.292 1.00 35.40  ? 613 PHE A CE2   1 
ATOM   782  C CZ    . PHE A 1 94  ? -23.246 2.640   24.814 1.00 32.81  ? 613 PHE A CZ    1 
ATOM   783  N N     . GLU A 1 95  ? -20.892 0.341   28.566 1.00 33.08  ? 614 GLU A N     1 
ATOM   784  C CA    . GLU A 1 95  ? -20.977 -1.093  28.362 1.00 34.60  ? 614 GLU A CA    1 
ATOM   785  C C     . GLU A 1 95  ? -22.307 -1.481  27.752 1.00 36.31  ? 614 GLU A C     1 
ATOM   786  O O     . GLU A 1 95  ? -23.363 -0.977  28.167 1.00 37.39  ? 614 GLU A O     1 
ATOM   787  C CB    . GLU A 1 95  ? -20.822 -1.838  29.683 1.00 36.44  ? 614 GLU A CB    1 
ATOM   788  C CG    . GLU A 1 95  ? -19.380 -2.006  30.172 1.00 38.95  ? 614 GLU A CG    1 
ATOM   789  C CD    . GLU A 1 95  ? -19.332 -2.380  31.640 1.00 44.40  ? 614 GLU A CD    1 
ATOM   790  O OE1   . GLU A 1 95  ? -20.312 -2.980  32.132 1.00 41.98  ? 614 GLU A OE1   1 
ATOM   791  O OE2   . GLU A 1 95  ? -18.328 -2.055  32.310 1.00 50.17  ? 614 GLU A OE2   1 
ATOM   792  N N     . VAL A 1 96  ? -22.265 -2.418  26.806 1.00 36.40  ? 615 VAL A N     1 
ATOM   793  C CA    . VAL A 1 96  ? -23.501 -2.987  26.292 1.00 36.85  ? 615 VAL A CA    1 
ATOM   794  C C     . VAL A 1 96  ? -23.783 -4.416  26.735 1.00 37.51  ? 615 VAL A C     1 
ATOM   795  O O     . VAL A 1 96  ? -22.870 -5.243  26.783 1.00 38.27  ? 615 VAL A O     1 
ATOM   796  C CB    . VAL A 1 96  ? -23.601 -2.861  24.771 1.00 36.54  ? 615 VAL A CB    1 
ATOM   797  C CG1   . VAL A 1 96  ? -24.842 -3.600  24.276 1.00 32.33  ? 615 VAL A CG1   1 
ATOM   798  C CG2   . VAL A 1 96  ? -23.640 -1.376  24.398 1.00 36.62  ? 615 VAL A CG2   1 
ATOM   799  N N     . PHE A 1 97  ? -25.059 -4.695  27.001 1.00 38.50  ? 616 PHE A N     1 
ATOM   800  C CA    . PHE A 1 97  ? -25.522 -6.005  27.448 1.00 39.97  ? 616 PHE A CA    1 
ATOM   801  C C     . PHE A 1 97  ? -26.709 -6.522  26.644 1.00 41.51  ? 616 PHE A C     1 
ATOM   802  O O     . PHE A 1 97  ? -27.626 -5.760  26.326 1.00 42.81  ? 616 PHE A O     1 
ATOM   803  C CB    . PHE A 1 97  ? -25.892 -5.944  28.925 1.00 39.24  ? 616 PHE A CB    1 
ATOM   804  C CG    . PHE A 1 97  ? -24.705 -5.976  29.835 1.00 42.14  ? 616 PHE A CG    1 
ATOM   805  C CD1   . PHE A 1 97  ? -24.056 -4.804  30.184 1.00 44.26  ? 616 PHE A CD1   1 
ATOM   806  C CD2   . PHE A 1 97  ? -24.202 -7.188  30.302 1.00 40.91  ? 616 PHE A CD2   1 
ATOM   807  C CE1   . PHE A 1 97  ? -22.931 -4.838  31.005 1.00 46.40  ? 616 PHE A CE1   1 
ATOM   808  C CE2   . PHE A 1 97  ? -23.097 -7.230  31.121 1.00 39.07  ? 616 PHE A CE2   1 
ATOM   809  C CZ    . PHE A 1 97  ? -22.452 -6.060  31.474 1.00 43.37  ? 616 PHE A CZ    1 
ATOM   810  N N     . GLN A 1 98  ? -26.700 -7.819  26.331 1.00 42.66  ? 617 GLN A N     1 
ATOM   811  C CA    . GLN A 1 98  ? -27.748 -8.430  25.510 1.00 42.14  ? 617 GLN A CA    1 
ATOM   812  C C     . GLN A 1 98  ? -28.811 -9.158  26.319 1.00 42.22  ? 617 GLN A C     1 
ATOM   813  O O     . GLN A 1 98  ? -28.619 -9.478  27.487 1.00 41.69  ? 617 GLN A O     1 
ATOM   814  C CB    . GLN A 1 98  ? -27.151 -9.407  24.504 1.00 42.89  ? 617 GLN A CB    1 
ATOM   815  C CG    . GLN A 1 98  ? -25.965 -8.902  23.700 1.00 44.77  ? 617 GLN A CG    1 
ATOM   816  C CD    . GLN A 1 98  ? -25.237 -10.055 23.015 1.00 49.41  ? 617 GLN A CD    1 
ATOM   817  O OE1   . GLN A 1 98  ? -24.116 -10.411 23.390 1.00 53.44  ? 617 GLN A OE1   1 
ATOM   818  N NE2   . GLN A 1 98  ? -25.905 -10.691 22.058 1.00 49.00  ? 617 GLN A NE2   1 
ATOM   819  N N     . PRO A 1 99  ? -29.955 -9.437  25.691 1.00 43.17  ? 618 PRO A N     1 
ATOM   820  C CA    . PRO A 1 99  ? -31.043 -9.986  26.481 1.00 43.70  ? 618 PRO A CA    1 
ATOM   821  C C     . PRO A 1 99  ? -30.610 -11.308 27.096 1.00 43.81  ? 618 PRO A C     1 
ATOM   822  O O     . PRO A 1 99  ? -29.875 -12.067 26.471 1.00 44.70  ? 618 PRO A O     1 
ATOM   823  C CB    . PRO A 1 99  ? -32.148 -10.205 25.436 1.00 44.95  ? 618 PRO A CB    1 
ATOM   824  C CG    . PRO A 1 99  ? -31.833 -9.253  24.313 1.00 43.70  ? 618 PRO A CG    1 
ATOM   825  C CD    . PRO A 1 99  ? -30.334 -9.211  24.283 1.00 43.56  ? 618 PRO A CD    1 
ATOM   826  N N     . GLY A 1 100 ? -31.050 -11.586 28.314 1.00 43.70  ? 619 GLY A N     1 
ATOM   827  C CA    . GLY A 1 100 ? -30.701 -12.848 28.953 1.00 43.59  ? 619 GLY A CA    1 
ATOM   828  C C     . GLY A 1 100 ? -29.524 -12.735 29.906 1.00 45.02  ? 619 GLY A C     1 
ATOM   829  O O     . GLY A 1 100 ? -29.511 -13.376 30.967 1.00 46.31  ? 619 GLY A O     1 
ATOM   830  N N     . ASP A 1 101 ? -28.549 -11.901 29.544 1.00 44.44  ? 620 ASP A N     1 
ATOM   831  C CA    . ASP A 1 101 ? -27.302 -11.749 30.287 1.00 43.10  ? 620 ASP A CA    1 
ATOM   832  C C     . ASP A 1 101 ? -27.473 -11.619 31.797 1.00 44.14  ? 620 ASP A C     1 
ATOM   833  O O     . ASP A 1 101 ? -28.510 -11.167 32.302 1.00 43.96  ? 620 ASP A O     1 
ATOM   834  C CB    . ASP A 1 101 ? -26.536 -10.520 29.797 1.00 43.54  ? 620 ASP A CB    1 
ATOM   835  C CG    . ASP A 1 101 ? -25.667 -10.804 28.584 1.00 42.19  ? 620 ASP A CG    1 
ATOM   836  O OD1   . ASP A 1 101 ? -25.473 -11.990 28.239 1.00 39.49  ? 620 ASP A OD1   1 
ATOM   837  O OD2   . ASP A 1 101 ? -25.185 -9.826  27.969 1.00 39.22  ? 620 ASP A OD2   1 
ATOM   838  N N     . TYR A 1 102 ? -26.402 -11.952 32.508 1.00 43.85  ? 621 TYR A N     1 
ATOM   839  C CA    . TYR A 1 102 ? -26.310 -11.669 33.927 1.00 43.73  ? 621 TYR A CA    1 
ATOM   840  C C     . TYR A 1 102 ? -25.327 -10.542 34.195 1.00 44.32  ? 621 TYR A C     1 
ATOM   841  O O     . TYR A 1 102 ? -24.110 -10.723 34.157 1.00 44.41  ? 621 TYR A O     1 
ATOM   842  C CB    . TYR A 1 102 ? -25.976 -12.936 34.705 1.00 43.53  ? 621 TYR A CB    1 
ATOM   843  C CG    . TYR A 1 102 ? -27.238 -13.714 34.991 1.00 48.58  ? 621 TYR A CG    1 
ATOM   844  C CD1   . TYR A 1 102 ? -28.462 -13.269 34.494 1.00 53.28  ? 621 TYR A CD1   1 
ATOM   845  C CD2   . TYR A 1 102 ? -27.231 -14.860 35.780 1.00 51.93  ? 621 TYR A CD2   1 
ATOM   846  C CE1   . TYR A 1 102 ? -29.648 -13.925 34.788 1.00 54.32  ? 621 TYR A CE1   1 
ATOM   847  C CE2   . TYR A 1 102 ? -28.412 -15.545 36.055 1.00 55.14  ? 621 TYR A CE2   1 
ATOM   848  C CZ    . TYR A 1 102 ? -29.615 -15.058 35.562 1.00 55.54  ? 621 TYR A CZ    1 
ATOM   849  O OH    . TYR A 1 102 ? -30.800 -15.690 35.837 1.00 56.68  ? 621 TYR A OH    1 
ATOM   850  N N     . ILE A 1 103 ? -25.884 -9.353  34.389 1.00 44.10  ? 622 ILE A N     1 
ATOM   851  C CA    . ILE A 1 103 ? -25.109 -8.179  34.718 1.00 44.21  ? 622 ILE A CA    1 
ATOM   852  C C     . ILE A 1 103 ? -24.484 -8.378  36.098 1.00 45.37  ? 622 ILE A C     1 
ATOM   853  O O     . ILE A 1 103 ? -23.286 -8.146  36.291 1.00 46.02  ? 622 ILE A O     1 
ATOM   854  C CB    . ILE A 1 103 ? -26.016 -6.935  34.731 1.00 44.03  ? 622 ILE A CB    1 
ATOM   855  C CG1   . ILE A 1 103 ? -26.673 -6.740  33.360 1.00 44.09  ? 622 ILE A CG1   1 
ATOM   856  C CG2   . ILE A 1 103 ? -25.230 -5.695  35.140 1.00 42.56  ? 622 ILE A CG2   1 
ATOM   857  C CD1   . ILE A 1 103 ? -27.972 -5.975  33.434 1.00 44.05  ? 622 ILE A CD1   1 
ATOM   858  N N     . ILE A 1 104 ? -25.304 -8.825  37.046 1.00 45.88  ? 623 ILE A N     1 
ATOM   859  C CA    . ILE A 1 104 ? -24.894 -9.015  38.433 1.00 46.08  ? 623 ILE A CA    1 
ATOM   860  C C     . ILE A 1 104 ? -25.479 -10.337 38.909 1.00 46.31  ? 623 ILE A C     1 
ATOM   861  O O     . ILE A 1 104 ? -26.658 -10.612 38.691 1.00 46.43  ? 623 ILE A O     1 
ATOM   862  C CB    . ILE A 1 104 ? -25.438 -7.882  39.326 1.00 46.22  ? 623 ILE A CB    1 
ATOM   863  C CG1   . ILE A 1 104 ? -24.621 -6.597  39.133 1.00 48.14  ? 623 ILE A CG1   1 
ATOM   864  C CG2   . ILE A 1 104 ? -25.462 -8.296  40.791 1.00 44.98  ? 623 ILE A CG2   1 
ATOM   865  C CD1   . ILE A 1 104 ? -25.428 -5.308  39.313 1.00 43.94  ? 623 ILE A CD1   1 
ATOM   866  N N     . ARG A 1 105 ? -24.644 -11.150 39.547 1.00 46.69  ? 624 ARG A N     1 
ATOM   867  C CA    . ARG A 1 105 ? -25.101 -12.353 40.242 1.00 46.96  ? 624 ARG A CA    1 
ATOM   868  C C     . ARG A 1 105 ? -25.160 -12.147 41.748 1.00 47.29  ? 624 ARG A C     1 
ATOM   869  O O     . ARG A 1 105 ? -24.262 -11.552 42.347 1.00 46.96  ? 624 ARG A O     1 
ATOM   870  C CB    . ARG A 1 105 ? -24.165 -13.528 39.958 1.00 47.58  ? 624 ARG A CB    1 
ATOM   871  C CG    . ARG A 1 105 ? -24.156 -13.981 38.516 1.00 46.17  ? 624 ARG A CG    1 
ATOM   872  C CD    . ARG A 1 105 ? -23.159 -15.103 38.319 1.00 45.79  ? 624 ARG A CD    1 
ATOM   873  N NE    . ARG A 1 105 ? -23.067 -15.431 36.904 1.00 49.38  ? 624 ARG A NE    1 
ATOM   874  C CZ    . ARG A 1 105 ? -23.911 -16.239 36.269 1.00 49.52  ? 624 ARG A CZ    1 
ATOM   875  N NH1   . ARG A 1 105 ? -24.880 -16.856 36.941 1.00 50.25  ? 624 ARG A NH1   1 
ATOM   876  N NH2   . ARG A 1 105 ? -23.765 -16.448 34.966 1.00 48.48  ? 624 ARG A NH2   1 
ATOM   877  N N     . GLU A 1 106 ? -26.193 -12.704 42.363 1.00 47.89  ? 625 GLU A N     1 
ATOM   878  C CA    . GLU A 1 106 ? -26.302 -12.723 43.808 1.00 49.30  ? 625 GLU A CA    1 
ATOM   879  C C     . GLU A 1 106 ? -25.102 -13.444 44.429 1.00 49.62  ? 625 GLU A C     1 
ATOM   880  O O     . GLU A 1 106 ? -24.473 -14.281 43.788 1.00 49.60  ? 625 GLU A O     1 
ATOM   881  C CB    . GLU A 1 106 ? -27.602 -13.421 44.190 1.00 49.65  ? 625 GLU A CB    1 
ATOM   882  C CG    . GLU A 1 106 ? -27.763 -13.666 45.671 1.00 55.17  ? 625 GLU A CG    1 
ATOM   883  C CD    . GLU A 1 106 ? -29.182 -13.428 46.123 1.00 63.35  ? 625 GLU A CD    1 
ATOM   884  O OE1   . GLU A 1 106 ? -30.099 -13.553 45.276 1.00 67.09  ? 625 GLU A OE1   1 
ATOM   885  O OE2   . GLU A 1 106 ? -29.380 -13.100 47.313 1.00 65.34  ? 625 GLU A OE2   1 
ATOM   886  N N     . GLY A 1 107 ? -24.787 -13.126 45.678 1.00 50.42  ? 626 GLY A N     1 
ATOM   887  C CA    . GLY A 1 107 ? -23.719 -13.818 46.391 1.00 53.22  ? 626 GLY A CA    1 
ATOM   888  C C     . GLY A 1 107 ? -22.308 -13.381 46.021 1.00 55.07  ? 626 GLY A C     1 
ATOM   889  O O     . GLY A 1 107 ? -21.357 -13.621 46.778 1.00 55.94  ? 626 GLY A O     1 
ATOM   890  N N     . THR A 1 108 ? -22.161 -12.737 44.862 1.00 55.88  ? 627 THR A N     1 
ATOM   891  C CA    . THR A 1 108 ? -20.849 -12.315 44.355 1.00 56.33  ? 627 THR A CA    1 
ATOM   892  C C     . THR A 1 108 ? -20.340 -11.032 45.018 1.00 56.00  ? 627 THR A C     1 
ATOM   893  O O     . THR A 1 108 ? -21.127 -10.128 45.306 1.00 56.65  ? 627 THR A O     1 
ATOM   894  C CB    . THR A 1 108 ? -20.891 -12.105 42.833 1.00 57.16  ? 627 THR A CB    1 
ATOM   895  O OG1   . THR A 1 108 ? -21.994 -11.248 42.507 1.00 58.82  ? 627 THR A OG1   1 
ATOM   896  C CG2   . THR A 1 108 ? -21.063 -13.445 42.100 1.00 57.65  ? 627 THR A CG2   1 
ATOM   897  N N     . ILE A 1 109 ? -19.036 -10.954 45.278 1.00 55.35  ? 628 ILE A N     1 
ATOM   898  C CA    . ILE A 1 109 ? -18.474 -9.755  45.898 1.00 54.59  ? 628 ILE A CA    1 
ATOM   899  C C     . ILE A 1 109 ? -18.539 -8.641  44.860 1.00 55.17  ? 628 ILE A C     1 
ATOM   900  O O     . ILE A 1 109 ? -17.947 -8.770  43.791 1.00 56.34  ? 628 ILE A O     1 
ATOM   901  C CB    . ILE A 1 109 ? -16.997 -9.945  46.372 1.00 54.39  ? 628 ILE A CB    1 
ATOM   902  C CG1   . ILE A 1 109 ? -16.827 -11.215 47.197 1.00 52.62  ? 628 ILE A CG1   1 
ATOM   903  C CG2   . ILE A 1 109 ? -16.533 -8.791  47.261 1.00 51.09  ? 628 ILE A CG2   1 
ATOM   904  C CD1   . ILE A 1 109 ? -15.427 -11.335 47.746 1.00 50.61  ? 628 ILE A CD1   1 
ATOM   905  N N     . GLY A 1 110 ? -19.256 -7.558  45.157 1.00 55.16  ? 629 GLY A N     1 
ATOM   906  C CA    . GLY A 1 110 ? -19.495 -6.511  44.155 1.00 54.53  ? 629 GLY A CA    1 
ATOM   907  C C     . GLY A 1 110 ? -18.490 -5.373  44.187 1.00 53.77  ? 629 GLY A C     1 
ATOM   908  O O     . GLY A 1 110 ? -18.304 -4.745  45.229 1.00 55.91  ? 629 GLY A O     1 
ATOM   909  N N     . LYS A 1 111 ? -17.862 -5.077  43.051 1.00 51.46  ? 630 LYS A N     1 
ATOM   910  C CA    . LYS A 1 111 ? -16.844 -4.029  43.002 1.00 49.01  ? 630 LYS A CA    1 
ATOM   911  C C     . LYS A 1 111 ? -17.147 -2.871  42.039 1.00 47.89  ? 630 LYS A C     1 
ATOM   912  O O     . LYS A 1 111 ? -16.261 -2.056  41.770 1.00 47.53  ? 630 LYS A O     1 
ATOM   913  C CB    . LYS A 1 111 ? -15.455 -4.640  42.716 1.00 49.30  ? 630 LYS A CB    1 
ATOM   914  N N     . LYS A 1 112 ? -18.403 -2.758  41.594 1.00 46.27  ? 631 LYS A N     1 
ATOM   915  C CA    . LYS A 1 112 ? -18.833 -1.742  40.625 1.00 44.89  ? 631 LYS A CA    1 
ATOM   916  C C     . LYS A 1 112 ? -20.361 -1.545  40.564 1.00 44.09  ? 631 LYS A C     1 
ATOM   917  O O     . LYS A 1 112 ? -21.114 -2.403  41.032 1.00 44.83  ? 631 LYS A O     1 
ATOM   918  C CB    . LYS A 1 112 ? -18.276 -2.085  39.239 1.00 45.57  ? 631 LYS A CB    1 
ATOM   919  C CG    . LYS A 1 112 ? -18.988 -3.235  38.546 1.00 45.44  ? 631 LYS A CG    1 
ATOM   920  C CD    . LYS A 1 112 ? -18.205 -3.717  37.344 1.00 44.24  ? 631 LYS A CD    1 
ATOM   921  C CE    . LYS A 1 112 ? -18.535 -2.877  36.131 1.00 45.70  ? 631 LYS A CE    1 
ATOM   922  N NZ    . LYS A 1 112 ? -17.964 -3.491  34.894 1.00 47.24  ? 631 LYS A NZ    1 
ATOM   923  N N     . MET A 1 113 ? -20.827 -0.424  40.009 1.00 41.59  ? 632 MET A N     1 
ATOM   924  C CA    . MET A 1 113 ? -22.267 -0.197  39.825 1.00 39.87  ? 632 MET A CA    1 
ATOM   925  C C     . MET A 1 113 ? -22.618 0.284   38.414 1.00 40.85  ? 632 MET A C     1 
ATOM   926  O O     . MET A 1 113 ? -21.729 0.599   37.613 1.00 40.66  ? 632 MET A O     1 
ATOM   927  C CB    . MET A 1 113 ? -22.815 0.784   40.859 1.00 39.75  ? 632 MET A CB    1 
ATOM   928  C CG    . MET A 1 113 ? -22.324 2.224   40.677 1.00 38.81  ? 632 MET A CG    1 
ATOM   929  S SD    . MET A 1 113 ? -23.246 3.459   41.625 1.00 33.04  ? 632 MET A SD    1 
ATOM   930  C CE    . MET A 1 113 ? -24.808 3.539   40.757 1.00 33.85  ? 632 MET A CE    1 
ATOM   931  N N     . TYR A 1 114 ? -23.917 0.364   38.116 1.00 40.52  ? 633 TYR A N     1 
ATOM   932  C CA    . TYR A 1 114 ? -24.380 0.618   36.743 1.00 39.09  ? 633 TYR A CA    1 
ATOM   933  C C     . TYR A 1 114 ? -25.411 1.744   36.652 1.00 39.17  ? 633 TYR A C     1 
ATOM   934  O O     . TYR A 1 114 ? -26.213 1.956   37.558 1.00 40.19  ? 633 TYR A O     1 
ATOM   935  C CB    . TYR A 1 114 ? -24.945 -0.660  36.112 1.00 38.99  ? 633 TYR A CB    1 
ATOM   936  C CG    . TYR A 1 114 ? -23.945 -1.799  36.029 1.00 38.43  ? 633 TYR A CG    1 
ATOM   937  C CD1   . TYR A 1 114 ? -23.757 -2.674  37.098 1.00 33.05  ? 633 TYR A CD1   1 
ATOM   938  C CD2   . TYR A 1 114 ? -23.174 -1.983  34.880 1.00 40.15  ? 633 TYR A CD2   1 
ATOM   939  C CE1   . TYR A 1 114 ? -22.822 -3.700  37.028 1.00 35.97  ? 633 TYR A CE1   1 
ATOM   940  C CE2   . TYR A 1 114 ? -22.236 -3.003  34.803 1.00 38.38  ? 633 TYR A CE2   1 
ATOM   941  C CZ    . TYR A 1 114 ? -22.063 -3.850  35.878 1.00 36.36  ? 633 TYR A CZ    1 
ATOM   942  O OH    . TYR A 1 114 ? -21.109 -4.832  35.801 1.00 38.70  ? 633 TYR A OH    1 
ATOM   943  N N     . PHE A 1 115 ? -25.365 2.495   35.561 1.00 38.82  ? 634 PHE A N     1 
ATOM   944  C CA    . PHE A 1 115 ? -26.367 3.513   35.297 1.00 37.55  ? 634 PHE A CA    1 
ATOM   945  C C     . PHE A 1 115 ? -27.058 3.099   34.011 1.00 38.27  ? 634 PHE A C     1 
ATOM   946  O O     . PHE A 1 115 ? -26.435 3.035   32.952 1.00 36.97  ? 634 PHE A O     1 
ATOM   947  C CB    . PHE A 1 115 ? -25.736 4.914   35.182 1.00 36.84  ? 634 PHE A CB    1 
ATOM   948  C CG    . PHE A 1 115 ? -25.207 5.445   36.488 1.00 34.39  ? 634 PHE A CG    1 
ATOM   949  C CD1   . PHE A 1 115 ? -26.020 6.188   37.332 1.00 30.20  ? 634 PHE A CD1   1 
ATOM   950  C CD2   . PHE A 1 115 ? -23.903 5.164   36.898 1.00 34.78  ? 634 PHE A CD2   1 
ATOM   951  C CE1   . PHE A 1 115 ? -25.553 6.614   38.587 1.00 24.72  ? 634 PHE A CE1   1 
ATOM   952  C CE2   . PHE A 1 115 ? -23.431 5.590   38.153 1.00 27.69  ? 634 PHE A CE2   1 
ATOM   953  C CZ    . PHE A 1 115 ? -24.260 6.339   38.974 1.00 23.86  ? 634 PHE A CZ    1 
ATOM   954  N N     . ILE A 1 116 ? -28.319 2.695   34.127 1.00 39.52  ? 635 ILE A N     1 
ATOM   955  C CA    . ILE A 1 116 ? -29.059 2.284   32.951 1.00 39.35  ? 635 ILE A CA    1 
ATOM   956  C C     . ILE A 1 116 ? -29.202 3.528   32.095 1.00 40.82  ? 635 ILE A C     1 
ATOM   957  O O     . ILE A 1 116 ? -29.908 4.462   32.468 1.00 41.58  ? 635 ILE A O     1 
ATOM   958  C CB    . ILE A 1 116 ? -30.443 1.712   33.298 1.00 37.93  ? 635 ILE A CB    1 
ATOM   959  C CG1   . ILE A 1 116 ? -30.307 0.489   34.205 1.00 37.85  ? 635 ILE A CG1   1 
ATOM   960  C CG2   . ILE A 1 116 ? -31.160 1.305   32.024 1.00 40.27  ? 635 ILE A CG2   1 
ATOM   961  C CD1   . ILE A 1 116 ? -31.617 -0.034  34.789 1.00 32.42  ? 635 ILE A CD1   1 
ATOM   962  N N     . GLN A 1 117 ? -28.487 3.583   30.980 1.00 42.06  ? 636 GLN A N     1 
ATOM   963  C CA    . GLN A 1 117 ? -28.762 4.655   30.046 1.00 43.37  ? 636 GLN A CA    1 
ATOM   964  C C     . GLN A 1 117 ? -30.044 4.281   29.343 1.00 43.05  ? 636 GLN A C     1 
ATOM   965  O O     . GLN A 1 117 ? -30.996 5.060   29.301 1.00 43.28  ? 636 GLN A O     1 
ATOM   966  C CB    . GLN A 1 117 ? -27.644 4.828   29.015 1.00 44.63  ? 636 GLN A CB    1 
ATOM   967  C CG    . GLN A 1 117 ? -28.011 5.790   27.866 1.00 46.69  ? 636 GLN A CG    1 
ATOM   968  C CD    . GLN A 1 117 ? -26.828 6.079   26.979 1.00 52.12  ? 636 GLN A CD    1 
ATOM   969  O OE1   . GLN A 1 117 ? -26.637 7.205   26.503 1.00 51.65  ? 636 GLN A OE1   1 
ATOM   970  N NE2   . GLN A 1 117 ? -25.977 5.070   26.806 1.00 54.50  ? 636 GLN A NE2   1 
ATOM   971  N N     . HIS A 1 118 ? -30.033 3.095   28.746 1.00 43.49  ? 637 HIS A N     1 
ATOM   972  C CA    . HIS A 1 118 ? -31.152 2.649   27.922 1.00 43.04  ? 637 HIS A CA    1 
ATOM   973  C C     . HIS A 1 118 ? -31.324 1.142   28.021 1.00 41.27  ? 637 HIS A C     1 
ATOM   974  O O     . HIS A 1 118 ? -30.398 0.393   27.707 1.00 40.01  ? 637 HIS A O     1 
ATOM   975  C CB    . HIS A 1 118 ? -30.947 3.062   26.459 1.00 43.18  ? 637 HIS A CB    1 
ATOM   976  C CG    . HIS A 1 118 ? -32.055 2.629   25.545 1.00 46.84  ? 637 HIS A CG    1 
ATOM   977  N ND1   . HIS A 1 118 ? -33.369 3.011   25.727 1.00 50.32  ? 637 HIS A ND1   1 
ATOM   978  C CD2   . HIS A 1 118 ? -32.041 1.860   24.431 1.00 49.37  ? 637 HIS A CD2   1 
ATOM   979  C CE1   . HIS A 1 118 ? -34.113 2.498   24.765 1.00 52.07  ? 637 HIS A CE1   1 
ATOM   980  N NE2   . HIS A 1 118 ? -33.334 1.782   23.973 1.00 52.88  ? 637 HIS A NE2   1 
ATOM   981  N N     . GLY A 1 119 ? -32.512 0.718   28.450 1.00 40.82  ? 638 GLY A N     1 
ATOM   982  C CA    . GLY A 1 119 ? -32.921 -0.687  28.392 1.00 40.57  ? 638 GLY A CA    1 
ATOM   983  C C     . GLY A 1 119 ? -33.573 -1.106  29.688 1.00 41.03  ? 638 GLY A C     1 
ATOM   984  O O     . GLY A 1 119 ? -33.727 -0.292  30.589 1.00 42.73  ? 638 GLY A O     1 
ATOM   985  N N     . VAL A 1 120 ? -33.981 -2.363  29.797 1.00 41.46  ? 639 VAL A N     1 
ATOM   986  C CA    . VAL A 1 120 ? -34.749 -2.787  30.962 1.00 42.11  ? 639 VAL A CA    1 
ATOM   987  C C     . VAL A 1 120 ? -34.026 -3.959  31.596 1.00 43.24  ? 639 VAL A C     1 
ATOM   988  O O     . VAL A 1 120 ? -33.666 -4.905  30.900 1.00 43.98  ? 639 VAL A O     1 
ATOM   989  C CB    . VAL A 1 120 ? -36.177 -3.251  30.585 1.00 42.49  ? 639 VAL A CB    1 
ATOM   990  C CG1   . VAL A 1 120 ? -36.955 -3.665  31.829 1.00 42.27  ? 639 VAL A CG1   1 
ATOM   991  C CG2   . VAL A 1 120 ? -36.928 -2.172  29.811 1.00 41.54  ? 639 VAL A CG2   1 
ATOM   992  N N     . VAL A 1 121 ? -33.763 -3.866  32.896 1.00 43.11  ? 640 VAL A N     1 
ATOM   993  C CA    . VAL A 1 121 ? -33.106 -4.946  33.619 1.00 43.14  ? 640 VAL A CA    1 
ATOM   994  C C     . VAL A 1 121 ? -34.110 -5.543  34.589 1.00 45.41  ? 640 VAL A C     1 
ATOM   995  O O     . VAL A 1 121 ? -35.103 -4.897  34.933 1.00 46.05  ? 640 VAL A O     1 
ATOM   996  C CB    . VAL A 1 121 ? -31.882 -4.457  34.417 1.00 42.65  ? 640 VAL A CB    1 
ATOM   997  C CG1   . VAL A 1 121 ? -30.847 -3.848  33.488 1.00 43.19  ? 640 VAL A CG1   1 
ATOM   998  C CG2   . VAL A 1 121 ? -32.290 -3.486  35.504 1.00 36.66  ? 640 VAL A CG2   1 
ATOM   999  N N     . SER A 1 122 ? -33.839 -6.764  35.039 1.00 45.91  ? 641 SER A N     1 
ATOM   1000 C CA    . SER A 1 122 ? -34.697 -7.420  36.000 1.00 46.94  ? 641 SER A CA    1 
ATOM   1001 C C     . SER A 1 122 ? -33.930 -7.713  37.270 1.00 47.19  ? 641 SER A C     1 
ATOM   1002 O O     . SER A 1 122 ? -32.840 -8.289  37.206 1.00 47.62  ? 641 SER A O     1 
ATOM   1003 C CB    . SER A 1 122 ? -35.246 -8.714  35.399 1.00 47.80  ? 641 SER A CB    1 
ATOM   1004 O OG    . SER A 1 122 ? -36.226 -8.414  34.416 1.00 49.93  ? 641 SER A OG    1 
ATOM   1005 N N     . VAL A 1 123 ? -34.499 -7.307  38.405 1.00 47.78  ? 642 VAL A N     1 
ATOM   1006 C CA    . VAL A 1 123 ? -33.870 -7.494  39.715 1.00 48.48  ? 642 VAL A CA    1 
ATOM   1007 C C     . VAL A 1 123 ? -34.649 -8.534  40.510 1.00 50.98  ? 642 VAL A C     1 
ATOM   1008 O O     . VAL A 1 123 ? -35.871 -8.419  40.658 1.00 51.10  ? 642 VAL A O     1 
ATOM   1009 C CB    . VAL A 1 123 ? -33.779 -6.173  40.523 1.00 48.01  ? 642 VAL A CB    1 
ATOM   1010 C CG1   . VAL A 1 123 ? -32.864 -6.331  41.748 1.00 44.58  ? 642 VAL A CG1   1 
ATOM   1011 C CG2   . VAL A 1 123 ? -33.277 -5.051  39.639 1.00 45.86  ? 642 VAL A CG2   1 
ATOM   1012 N N     . LEU A 1 124 ? -33.942 -9.560  40.985 1.00 52.80  ? 643 LEU A N     1 
ATOM   1013 C CA    . LEU A 1 124 ? -34.568 -10.657 41.717 1.00 54.26  ? 643 LEU A CA    1 
ATOM   1014 C C     . LEU A 1 124 ? -33.843 -11.012 43.019 1.00 55.52  ? 643 LEU A C     1 
ATOM   1015 O O     . LEU A 1 124 ? -32.838 -11.729 43.005 1.00 54.85  ? 643 LEU A O     1 
ATOM   1016 C CB    . LEU A 1 124 ? -34.701 -11.892 40.828 1.00 54.23  ? 643 LEU A CB    1 
ATOM   1017 C CG    . LEU A 1 124 ? -35.454 -13.042 41.503 1.00 55.09  ? 643 LEU A CG    1 
ATOM   1018 C CD1   . LEU A 1 124 ? -36.913 -12.694 41.723 1.00 54.83  ? 643 LEU A CD1   1 
ATOM   1019 C CD2   . LEU A 1 124 ? -35.325 -14.315 40.689 1.00 57.37  ? 643 LEU A CD2   1 
ATOM   1020 N N     . THR A 1 125 ? -34.390 -10.547 44.141 1.00 56.96  ? 644 THR A N     1 
ATOM   1021 C CA    . THR A 1 125 ? -33.654 -10.528 45.411 1.00 58.07  ? 644 THR A CA    1 
ATOM   1022 C C     . THR A 1 125 ? -33.734 -11.843 46.171 1.00 58.55  ? 644 THR A C     1 
ATOM   1023 O O     . THR A 1 125 ? -32.762 -12.601 46.214 1.00 59.75  ? 644 THR A O     1 
ATOM   1024 C CB    . THR A 1 125 ? -34.118 -9.374  46.293 1.00 58.45  ? 644 THR A CB    1 
ATOM   1025 N N     . GLY A 1 127 ? -34.623 -15.893 46.518 1.00 73.63  ? 646 GLY A N     1 
ATOM   1026 C CA    . GLY A 1 127 ? -35.248 -14.806 45.769 1.00 73.59  ? 646 GLY A CA    1 
ATOM   1027 C C     . GLY A 1 127 ? -36.662 -14.480 46.225 1.00 73.55  ? 646 GLY A C     1 
ATOM   1028 O O     . GLY A 1 127 ? -37.433 -15.383 46.567 1.00 72.99  ? 646 GLY A O     1 
ATOM   1029 N N     . ASN A 1 128 ? -36.990 -13.185 46.239 1.00 73.11  ? 647 ASN A N     1 
ATOM   1030 C CA    . ASN A 1 128 ? -38.367 -12.706 46.446 1.00 72.76  ? 647 ASN A CA    1 
ATOM   1031 C C     . ASN A 1 128 ? -39.039 -12.326 45.110 1.00 72.16  ? 647 ASN A C     1 
ATOM   1032 O O     . ASN A 1 128 ? -38.988 -13.109 44.153 1.00 71.88  ? 647 ASN A O     1 
ATOM   1033 C CB    . ASN A 1 128 ? -38.402 -11.542 47.456 1.00 72.42  ? 647 ASN A CB    1 
ATOM   1034 N N     . LYS A 1 129 ? -39.667 -11.150 45.037 1.00 71.21  ? 648 LYS A N     1 
ATOM   1035 C CA    . LYS A 1 129 ? -40.284 -10.690 43.784 1.00 70.65  ? 648 LYS A CA    1 
ATOM   1036 C C     . LYS A 1 129 ? -39.282 -10.058 42.805 1.00 70.31  ? 648 LYS A C     1 
ATOM   1037 O O     . LYS A 1 129 ? -38.294 -9.434  43.215 1.00 69.95  ? 648 LYS A O     1 
ATOM   1038 C CB    . LYS A 1 129 ? -41.455 -9.739  44.059 1.00 69.97  ? 648 LYS A CB    1 
ATOM   1039 N N     . GLU A 1 130 ? -39.548 -10.220 41.509 1.00 69.46  ? 649 GLU A N     1 
ATOM   1040 C CA    . GLU A 1 130 ? -38.793 -9.505  40.476 1.00 68.43  ? 649 GLU A CA    1 
ATOM   1041 C C     . GLU A 1 130 ? -39.214 -8.041  40.369 1.00 67.24  ? 649 GLU A C     1 
ATOM   1042 O O     . GLU A 1 130 ? -40.304 -7.735  39.883 1.00 67.37  ? 649 GLU A O     1 
ATOM   1043 C CB    . GLU A 1 130 ? -38.922 -10.201 39.116 1.00 68.58  ? 649 GLU A CB    1 
ATOM   1044 N N     . THR A 1 131 ? -38.347 -7.147  40.839 1.00 65.89  ? 650 THR A N     1 
ATOM   1045 C CA    . THR A 1 131 ? -38.472 -5.709  40.594 1.00 63.90  ? 650 THR A CA    1 
ATOM   1046 C C     . THR A 1 131 ? -37.744 -5.325  39.313 1.00 62.05  ? 650 THR A C     1 
ATOM   1047 O O     . THR A 1 131 ? -36.689 -5.885  39.019 1.00 61.65  ? 650 THR A O     1 
ATOM   1048 C CB    . THR A 1 131 ? -37.848 -4.897  41.746 1.00 64.33  ? 650 THR A CB    1 
ATOM   1049 O OG1   . THR A 1 131 ? -38.168 -5.514  43.000 1.00 64.76  ? 650 THR A OG1   1 
ATOM   1050 C CG2   . THR A 1 131 ? -38.357 -3.456  41.742 1.00 64.44  ? 650 THR A CG2   1 
ATOM   1051 N N     . LYS A 1 132 ? -38.293 -4.350  38.586 1.00 60.67  ? 651 LYS A N     1 
ATOM   1052 C CA    . LYS A 1 132 ? -37.786 -3.921  37.269 1.00 58.54  ? 651 LYS A CA    1 
ATOM   1053 C C     . LYS A 1 132 ? -37.279 -2.471  37.283 1.00 56.45  ? 651 LYS A C     1 
ATOM   1054 O O     . LYS A 1 132 ? -37.847 -1.613  37.972 1.00 55.98  ? 651 LYS A O     1 
ATOM   1055 C CB    . LYS A 1 132 ? -38.875 -4.044  36.194 1.00 59.07  ? 651 LYS A CB    1 
ATOM   1056 C CG    . LYS A 1 132 ? -39.525 -5.417  36.069 1.00 62.25  ? 651 LYS A CG    1 
ATOM   1057 C CD    . LYS A 1 132 ? -38.874 -6.266  34.982 1.00 67.65  ? 651 LYS A CD    1 
ATOM   1058 C CE    . LYS A 1 132 ? -39.382 -7.714  35.011 1.00 70.09  ? 651 LYS A CE    1 
ATOM   1059 N NZ    . LYS A 1 132 ? -39.144 -8.411  36.322 1.00 71.27  ? 651 LYS A NZ    1 
ATOM   1060 N N     . LEU A 1 133 ? -36.240 -2.205  36.490 1.00 53.03  ? 652 LEU A N     1 
ATOM   1061 C CA    . LEU A 1 133 ? -35.611 -0.887  36.422 1.00 50.14  ? 652 LEU A CA    1 
ATOM   1062 C C     . LEU A 1 133 ? -35.290 -0.528  34.979 1.00 48.25  ? 652 LEU A C     1 
ATOM   1063 O O     . LEU A 1 133 ? -34.915 -1.385  34.197 1.00 48.55  ? 652 LEU A O     1 
ATOM   1064 C CB    . LEU A 1 133 ? -34.322 -0.868  37.238 1.00 50.54  ? 652 LEU A CB    1 
ATOM   1065 C CG    . LEU A 1 133 ? -34.398 -1.122  38.751 1.00 51.25  ? 652 LEU A CG    1 
ATOM   1066 C CD1   . LEU A 1 133 ? -32.994 -1.099  39.343 1.00 46.86  ? 652 LEU A CD1   1 
ATOM   1067 C CD2   . LEU A 1 133 ? -35.304 -0.103  39.451 1.00 50.74  ? 652 LEU A CD2   1 
ATOM   1068 N N     . ALA A 1 134 ? -35.464 0.733   34.611 1.00 45.53  ? 653 ALA A N     1 
ATOM   1069 C CA    . ALA A 1 134 ? -35.176 1.155   33.245 1.00 44.10  ? 653 ALA A CA    1 
ATOM   1070 C C     . ALA A 1 134 ? -34.372 2.467   33.175 1.00 43.29  ? 653 ALA A C     1 
ATOM   1071 O O     . ALA A 1 134 ? -33.752 2.877   34.172 1.00 41.04  ? 653 ALA A O     1 
ATOM   1072 C CB    . ALA A 1 134 ? -36.465 1.252   32.433 1.00 42.80  ? 653 ALA A CB    1 
ATOM   1073 N N     . ASP A 1 135 ? -34.370 3.090   31.994 1.00 41.75  ? 654 ASP A N     1 
ATOM   1074 C CA    . ASP A 1 135 ? -33.625 4.328   31.753 1.00 43.00  ? 654 ASP A CA    1 
ATOM   1075 C C     . ASP A 1 135 ? -33.834 5.289   32.902 1.00 42.82  ? 654 ASP A C     1 
ATOM   1076 O O     . ASP A 1 135 ? -34.946 5.412   33.418 1.00 43.21  ? 654 ASP A O     1 
ATOM   1077 C CB    . ASP A 1 135 ? -34.082 5.048   30.477 1.00 43.21  ? 654 ASP A CB    1 
ATOM   1078 C CG    . ASP A 1 135 ? -34.441 4.102   29.351 1.00 44.99  ? 654 ASP A CG    1 
ATOM   1079 O OD1   . ASP A 1 135 ? -35.119 3.086   29.615 1.00 46.07  ? 654 ASP A OD1   1 
ATOM   1080 O OD2   . ASP A 1 135 ? -34.132 4.440   28.186 1.00 47.98  ? 654 ASP A OD2   1 
ATOM   1081 N N     . GLY A 1 136 ? -32.771 5.969   33.309 1.00 42.48  ? 655 GLY A N     1 
ATOM   1082 C CA    . GLY A 1 136 ? -32.874 6.871   34.449 1.00 42.96  ? 655 GLY A CA    1 
ATOM   1083 C C     . GLY A 1 136 ? -32.777 6.201   35.809 1.00 43.40  ? 655 GLY A C     1 
ATOM   1084 O O     . GLY A 1 136 ? -33.051 6.828   36.844 1.00 44.21  ? 655 GLY A O     1 
ATOM   1085 N N     . SER A 1 137 ? -32.370 4.936   35.822 1.00 43.33  ? 656 SER A N     1 
ATOM   1086 C CA    . SER A 1 137 ? -32.131 4.238   37.089 1.00 43.82  ? 656 SER A CA    1 
ATOM   1087 C C     . SER A 1 137 ? -30.715 3.689   37.151 1.00 43.30  ? 656 SER A C     1 
ATOM   1088 O O     . SER A 1 137 ? -29.980 3.710   36.160 1.00 44.04  ? 656 SER A O     1 
ATOM   1089 C CB    . SER A 1 137 ? -33.142 3.113   37.320 1.00 43.16  ? 656 SER A CB    1 
ATOM   1090 O OG    . SER A 1 137 ? -34.460 3.628   37.292 1.00 44.76  ? 656 SER A OG    1 
ATOM   1091 N N     . TYR A 1 138 ? -30.344 3.222   38.335 1.00 42.12  ? 657 TYR A N     1 
ATOM   1092 C CA    . TYR A 1 138 ? -29.060 2.592   38.561 1.00 41.71  ? 657 TYR A CA    1 
ATOM   1093 C C     . TYR A 1 138 ? -29.252 1.457   39.556 1.00 41.83  ? 657 TYR A C     1 
ATOM   1094 O O     . TYR A 1 138 ? -30.350 1.245   40.092 1.00 40.40  ? 657 TYR A O     1 
ATOM   1095 C CB    . TYR A 1 138 ? -28.047 3.603   39.105 1.00 42.00  ? 657 TYR A CB    1 
ATOM   1096 C CG    . TYR A 1 138 ? -28.485 4.290   40.384 1.00 42.38  ? 657 TYR A CG    1 
ATOM   1097 C CD1   . TYR A 1 138 ? -28.067 3.837   41.620 1.00 41.75  ? 657 TYR A CD1   1 
ATOM   1098 C CD2   . TYR A 1 138 ? -29.318 5.401   40.343 1.00 45.58  ? 657 TYR A CD2   1 
ATOM   1099 C CE1   . TYR A 1 138 ? -28.416 4.509   42.778 1.00 45.92  ? 657 TYR A CE1   1 
ATOM   1100 C CE2   . TYR A 1 138 ? -29.709 6.049   41.481 1.00 46.80  ? 657 TYR A CE2   1 
ATOM   1101 C CZ    . TYR A 1 138 ? -29.255 5.602   42.703 1.00 47.50  ? 657 TYR A CZ    1 
ATOM   1102 O OH    . TYR A 1 138 ? -29.675 6.253   43.843 1.00 48.64  ? 657 TYR A OH    1 
ATOM   1103 N N     . PHE A 1 139 ? -28.180 0.707   39.777 1.00 41.50  ? 658 PHE A N     1 
ATOM   1104 C CA    . PHE A 1 139 ? -28.257 -0.445  40.655 1.00 42.00  ? 658 PHE A CA    1 
ATOM   1105 C C     . PHE A 1 139 ? -26.842 -0.937  40.927 1.00 42.18  ? 658 PHE A C     1 
ATOM   1106 O O     . PHE A 1 139 ? -25.887 -0.540  40.254 1.00 42.67  ? 658 PHE A O     1 
ATOM   1107 C CB    . PHE A 1 139 ? -29.138 -1.535  40.031 1.00 42.08  ? 658 PHE A CB    1 
ATOM   1108 C CG    . PHE A 1 139 ? -28.633 -2.053  38.705 1.00 43.56  ? 658 PHE A CG    1 
ATOM   1109 C CD1   . PHE A 1 139 ? -27.604 -2.996  38.647 1.00 43.63  ? 658 PHE A CD1   1 
ATOM   1110 C CD2   . PHE A 1 139 ? -29.194 -1.610  37.514 1.00 42.44  ? 658 PHE A CD2   1 
ATOM   1111 C CE1   . PHE A 1 139 ? -27.134 -3.479  37.418 1.00 42.72  ? 658 PHE A CE1   1 
ATOM   1112 C CE2   . PHE A 1 139 ? -28.734 -2.096  36.280 1.00 42.82  ? 658 PHE A CE2   1 
ATOM   1113 C CZ    . PHE A 1 139 ? -27.696 -3.022  36.232 1.00 39.78  ? 658 PHE A CZ    1 
ATOM   1114 N N     . GLY A 1 140 ? -26.704 -1.765  41.949 1.00 42.14  ? 659 GLY A N     1 
ATOM   1115 C CA    . GLY A 1 140 ? -25.413 -2.319  42.275 1.00 41.99  ? 659 GLY A CA    1 
ATOM   1116 C C     . GLY A 1 140 ? -24.619 -1.321  43.069 1.00 42.91  ? 659 GLY A C     1 
ATOM   1117 O O     . GLY A 1 140 ? -23.401 -1.442  43.153 1.00 43.71  ? 659 GLY A O     1 
ATOM   1118 N N     . GLU A 1 141 ? -25.300 -0.329  43.638 1.00 44.03  ? 660 GLU A N     1 
ATOM   1119 C CA    . GLU A 1 141 ? -24.639 0.643   44.509 1.00 44.30  ? 660 GLU A CA    1 
ATOM   1120 C C     . GLU A 1 141 ? -24.466 0.130   45.927 1.00 45.14  ? 660 GLU A C     1 
ATOM   1121 O O     . GLU A 1 141 ? -23.620 0.633   46.672 1.00 47.63  ? 660 GLU A O     1 
ATOM   1122 C CB    . GLU A 1 141 ? -25.356 1.996   44.503 1.00 44.29  ? 660 GLU A CB    1 
ATOM   1123 C CG    . GLU A 1 141 ? -26.648 2.034   45.278 1.00 42.76  ? 660 GLU A CG    1 
ATOM   1124 C CD    . GLU A 1 141 ? -27.737 1.183   44.654 1.00 44.27  ? 660 GLU A CD    1 
ATOM   1125 O OE1   . GLU A 1 141 ? -27.624 0.817   43.454 1.00 40.37  ? 660 GLU A OE1   1 
ATOM   1126 O OE2   . GLU A 1 141 ? -28.700 0.865   45.390 1.00 39.65  ? 660 GLU A OE2   1 
ATOM   1127 N N     . ILE A 1 142 ? -25.233 -0.898  46.276 1.00 45.48  ? 661 ILE A N     1 
ATOM   1128 C CA    . ILE A 1 142 ? -25.244 -1.465  47.627 1.00 45.76  ? 661 ILE A CA    1 
ATOM   1129 C C     . ILE A 1 142 ? -23.923 -2.143  48.035 1.00 46.51  ? 661 ILE A C     1 
ATOM   1130 O O     . ILE A 1 142 ? -23.539 -2.114  49.212 1.00 45.38  ? 661 ILE A O     1 
ATOM   1131 C CB    . ILE A 1 142 ? -26.413 -2.474  47.805 1.00 45.72  ? 661 ILE A CB    1 
ATOM   1132 C CG1   . ILE A 1 142 ? -27.766 -1.783  47.627 1.00 44.09  ? 661 ILE A CG1   1 
ATOM   1133 C CG2   . ILE A 1 142 ? -26.348 -3.169  49.167 1.00 45.35  ? 661 ILE A CG2   1 
ATOM   1134 C CD1   . ILE A 1 142 ? -28.941 -2.750  47.527 1.00 44.04  ? 661 ILE A CD1   1 
ATOM   1135 N N     . CYS A 1 143 ? -23.233 -2.773  47.088 1.00 46.25  ? 662 CYS A N     1 
ATOM   1136 C CA    . CYS A 1 143 ? -21.924 -3.330  47.426 1.00 47.27  ? 662 CYS A CA    1 
ATOM   1137 C C     . CYS A 1 143 ? -20.859 -2.259  47.508 1.00 47.11  ? 662 CYS A C     1 
ATOM   1138 O O     . CYS A 1 143 ? -19.791 -2.481  48.082 1.00 47.39  ? 662 CYS A O     1 
ATOM   1139 C CB    . CYS A 1 143 ? -21.480 -4.399  46.437 1.00 46.59  ? 662 CYS A CB    1 
ATOM   1140 S SG    . CYS A 1 143 ? -22.344 -5.942  46.694 1.00 52.48  ? 662 CYS A SG    1 
ATOM   1141 N N     . LEU A 1 144 ? -21.103 -1.140  46.837 1.00 46.78  ? 663 LEU A N     1 
ATOM   1142 C CA    . LEU A 1 144 ? -20.155 -0.038  46.876 1.00 47.15  ? 663 LEU A CA    1 
ATOM   1143 C C     . LEU A 1 144 ? -20.214 0.639   48.254 1.00 48.02  ? 663 LEU A C     1 
ATOM   1144 O O     . LEU A 1 144 ? -19.191 0.986   48.864 1.00 47.89  ? 663 LEU A O     1 
ATOM   1145 C CB    . LEU A 1 144 ? -20.437 0.948   45.739 1.00 46.34  ? 663 LEU A CB    1 
ATOM   1146 C CG    . LEU A 1 144 ? -19.701 0.679   44.428 1.00 43.41  ? 663 LEU A CG    1 
ATOM   1147 C CD1   . LEU A 1 144 ? -19.884 -0.766  44.024 1.00 41.89  ? 663 LEU A CD1   1 
ATOM   1148 C CD2   . LEU A 1 144 ? -20.187 1.624   43.345 1.00 39.10  ? 663 LEU A CD2   1 
ATOM   1149 N N     . LEU A 1 145 ? -21.428 0.796   48.756 1.00 48.05  ? 664 LEU A N     1 
ATOM   1150 C CA    . LEU A 1 145 ? -21.594 1.312   50.093 1.00 48.65  ? 664 LEU A CA    1 
ATOM   1151 C C     . LEU A 1 145 ? -21.141 0.290   51.138 1.00 49.54  ? 664 LEU A C     1 
ATOM   1152 O O     . LEU A 1 145 ? -20.379 0.629   52.041 1.00 50.02  ? 664 LEU A O     1 
ATOM   1153 C CB    . LEU A 1 145 ? -23.044 1.736   50.299 1.00 48.69  ? 664 LEU A CB    1 
ATOM   1154 C CG    . LEU A 1 145 ? -23.579 2.775   49.308 1.00 47.83  ? 664 LEU A CG    1 
ATOM   1155 C CD1   . LEU A 1 145 ? -25.091 2.818   49.378 1.00 43.70  ? 664 LEU A CD1   1 
ATOM   1156 C CD2   . LEU A 1 145 ? -22.997 4.147   49.621 1.00 46.37  ? 664 LEU A CD2   1 
ATOM   1157 N N     . THR A 1 146 ? -21.548 -0.969  50.997 1.00 50.25  ? 665 THR A N     1 
ATOM   1158 C CA    . THR A 1 146 ? -21.364 -1.937  52.083 1.00 50.90  ? 665 THR A CA    1 
ATOM   1159 C C     . THR A 1 146 ? -20.114 -2.812  51.984 1.00 50.87  ? 665 THR A C     1 
ATOM   1160 O O     . THR A 1 146 ? -19.710 -3.435  52.961 1.00 50.90  ? 665 THR A O     1 
ATOM   1161 C CB    . THR A 1 146 ? -22.593 -2.856  52.259 1.00 51.06  ? 665 THR A CB    1 
ATOM   1162 O OG1   . THR A 1 146 ? -22.429 -4.038  51.464 1.00 51.39  ? 665 THR A OG1   1 
ATOM   1163 C CG2   . THR A 1 146 ? -23.869 -2.131  51.847 1.00 51.63  ? 665 THR A CG2   1 
ATOM   1164 N N     . ARG A 1 147 ? -19.530 -2.911  50.798 1.00 51.37  ? 666 ARG A N     1 
ATOM   1165 C CA    . ARG A 1 147 ? -18.400 -3.813  50.597 1.00 52.42  ? 666 ARG A CA    1 
ATOM   1166 C C     . ARG A 1 147 ? -18.703 -5.248  51.056 1.00 52.25  ? 666 ARG A C     1 
ATOM   1167 O O     . ARG A 1 147 ? -17.882 -5.882  51.718 1.00 52.23  ? 666 ARG A O     1 
ATOM   1168 C CB    . ARG A 1 147 ? -17.148 -3.279  51.308 1.00 53.18  ? 666 ARG A CB    1 
ATOM   1169 C CG    . ARG A 1 147 ? -16.649 -1.926  50.808 1.00 54.93  ? 666 ARG A CG    1 
ATOM   1170 C CD    . ARG A 1 147 ? -15.176 -1.720  51.150 1.00 59.12  ? 666 ARG A CD    1 
ATOM   1171 N NE    . ARG A 1 147 ? -14.556 -0.677  50.329 1.00 62.71  ? 666 ARG A NE    1 
ATOM   1172 C CZ    . ARG A 1 147 ? -13.298 -0.714  49.890 1.00 62.21  ? 666 ARG A CZ    1 
ATOM   1173 N NH1   . ARG A 1 147 ? -12.519 -1.743  50.191 1.00 62.26  ? 666 ARG A NH1   1 
ATOM   1174 N NH2   . ARG A 1 147 ? -12.814 0.274   49.148 1.00 60.52  ? 666 ARG A NH2   1 
ATOM   1175 N N     . GLY A 1 148 ? -19.888 -5.747  50.709 1.00 52.01  ? 667 GLY A N     1 
ATOM   1176 C CA    . GLY A 1 148 ? -20.251 -7.149  50.911 1.00 50.47  ? 667 GLY A CA    1 
ATOM   1177 C C     . GLY A 1 148 ? -20.710 -7.790  49.616 1.00 50.90  ? 667 GLY A C     1 
ATOM   1178 O O     . GLY A 1 148 ? -20.107 -7.567  48.561 1.00 50.76  ? 667 GLY A O     1 
ATOM   1179 N N     . ARG A 1 149 ? -21.774 -8.589  49.686 1.00 51.04  ? 668 ARG A N     1 
ATOM   1180 C CA    . ARG A 1 149 ? -22.165 -9.452  48.560 1.00 51.04  ? 668 ARG A CA    1 
ATOM   1181 C C     . ARG A 1 149 ? -23.387 -8.897  47.845 1.00 50.91  ? 668 ARG A C     1 
ATOM   1182 O O     . ARG A 1 149 ? -24.233 -8.251  48.474 1.00 50.75  ? 668 ARG A O     1 
ATOM   1183 C CB    . ARG A 1 149 ? -22.452 -10.896 49.003 1.00 50.52  ? 668 ARG A CB    1 
ATOM   1184 C CG    . ARG A 1 149 ? -21.407 -11.532 49.927 1.00 52.92  ? 668 ARG A CG    1 
ATOM   1185 C CD    . ARG A 1 149 ? -20.147 -11.941 49.169 1.00 55.74  ? 668 ARG A CD    1 
ATOM   1186 N NE    . ARG A 1 149 ? -19.293 -12.896 49.874 1.00 52.18  ? 668 ARG A NE    1 
ATOM   1187 C CZ    . ARG A 1 149 ? -18.658 -13.899 49.275 1.00 50.35  ? 668 ARG A CZ    1 
ATOM   1188 N NH1   . ARG A 1 149 ? -18.854 -14.109 47.981 1.00 50.97  ? 668 ARG A NH1   1 
ATOM   1189 N NH2   . ARG A 1 149 ? -17.860 -14.704 49.963 1.00 46.92  ? 668 ARG A NH2   1 
ATOM   1190 N N     . ARG A 1 150 ? -23.481 -9.161  46.539 1.00 50.53  ? 669 ARG A N     1 
ATOM   1191 C CA    . ARG A 1 150 ? -24.593 -8.662  45.736 1.00 50.08  ? 669 ARG A CA    1 
ATOM   1192 C C     . ARG A 1 150 ? -25.919 -9.114  46.333 1.00 49.77  ? 669 ARG A C     1 
ATOM   1193 O O     . ARG A 1 150 ? -26.198 -10.307 46.412 1.00 49.96  ? 669 ARG A O     1 
ATOM   1194 C CB    . ARG A 1 150 ? -24.476 -9.109  44.278 1.00 49.89  ? 669 ARG A CB    1 
ATOM   1195 C CG    . ARG A 1 150 ? -23.251 -8.586  43.551 1.00 48.78  ? 669 ARG A CG    1 
ATOM   1196 C CD    . ARG A 1 150 ? -23.260 -7.073  43.398 1.00 47.99  ? 669 ARG A CD    1 
ATOM   1197 N NE    . ARG A 1 150 ? -22.456 -6.635  42.256 1.00 49.38  ? 669 ARG A NE    1 
ATOM   1198 C CZ    . ARG A 1 150 ? -22.173 -5.365  41.959 1.00 47.39  ? 669 ARG A CZ    1 
ATOM   1199 N NH1   . ARG A 1 150 ? -22.601 -4.384  42.744 1.00 44.78  ? 669 ARG A NH1   1 
ATOM   1200 N NH2   . ARG A 1 150 ? -21.438 -5.080  40.888 1.00 42.48  ? 669 ARG A NH2   1 
ATOM   1201 N N     . THR A 1 151 ? -26.701 -8.156  46.814 1.00 48.89  ? 670 THR A N     1 
ATOM   1202 C CA    . THR A 1 151 ? -27.931 -8.466  47.531 1.00 49.16  ? 670 THR A CA    1 
ATOM   1203 C C     . THR A 1 151 ? -29.077 -8.957  46.639 1.00 49.02  ? 670 THR A C     1 
ATOM   1204 O O     . THR A 1 151 ? -30.213 -9.116  47.103 1.00 50.27  ? 670 THR A O     1 
ATOM   1205 C CB    . THR A 1 151 ? -28.428 -7.250  48.328 1.00 50.05  ? 670 THR A CB    1 
ATOM   1206 O OG1   . THR A 1 151 ? -28.910 -6.245  47.418 1.00 47.39  ? 670 THR A OG1   1 
ATOM   1207 C CG2   . THR A 1 151 ? -27.307 -6.708  49.233 1.00 49.22  ? 670 THR A CG2   1 
ATOM   1208 N N     . ALA A 1 152 ? -28.782 -9.210  45.371 1.00 47.46  ? 671 ALA A N     1 
ATOM   1209 C CA    . ALA A 1 152 ? -29.768 -9.780  44.459 1.00 47.02  ? 671 ALA A CA    1 
ATOM   1210 C C     . ALA A 1 152 ? -29.084 -10.233 43.187 1.00 47.05  ? 671 ALA A C     1 
ATOM   1211 O O     . ALA A 1 152 ? -27.856 -10.292 43.117 1.00 49.20  ? 671 ALA A O     1 
ATOM   1212 C CB    . ALA A 1 152 ? -30.838 -8.761  44.127 1.00 46.96  ? 671 ALA A CB    1 
ATOM   1213 N N     . ARG A 1 153 ? -29.886 -10.523 42.173 1.00 46.46  ? 672 ARG A N     1 
ATOM   1214 C CA    . ARG A 1 153 ? -29.392 -10.843 40.840 1.00 45.48  ? 672 ARG A CA    1 
ATOM   1215 C C     . ARG A 1 153 ? -29.937 -9.773  39.911 1.00 44.52  ? 672 ARG A C     1 
ATOM   1216 O O     . ARG A 1 153 ? -31.069 -9.309  40.107 1.00 44.97  ? 672 ARG A O     1 
ATOM   1217 C CB    . ARG A 1 153 ? -29.937 -12.208 40.417 1.00 45.73  ? 672 ARG A CB    1 
ATOM   1218 C CG    . ARG A 1 153 ? -29.232 -12.848 39.231 1.00 48.71  ? 672 ARG A CG    1 
ATOM   1219 C CD    . ARG A 1 153 ? -29.020 -14.356 39.438 1.00 50.39  ? 672 ARG A CD    1 
ATOM   1220 N NE    . ARG A 1 153 ? -27.842 -14.665 40.251 1.00 50.55  ? 672 ARG A NE    1 
ATOM   1221 C CZ    . ARG A 1 153 ? -27.014 -15.697 40.061 1.00 52.94  ? 672 ARG A CZ    1 
ATOM   1222 N NH1   . ARG A 1 153 ? -27.197 -16.571 39.068 1.00 49.46  ? 672 ARG A NH1   1 
ATOM   1223 N NH2   . ARG A 1 153 ? -25.975 -15.853 40.880 1.00 53.37  ? 672 ARG A NH2   1 
ATOM   1224 N N     . VAL A 1 154 ? -29.139 -9.347  38.936 1.00 42.35  ? 673 VAL A N     1 
ATOM   1225 C CA    . VAL A 1 154 ? -29.656 -8.455  37.900 1.00 41.48  ? 673 VAL A CA    1 
ATOM   1226 C C     . VAL A 1 154 ? -29.448 -8.957  36.469 1.00 41.70  ? 673 VAL A C     1 
ATOM   1227 O O     . VAL A 1 154 ? -28.324 -9.256  36.046 1.00 40.99  ? 673 VAL A O     1 
ATOM   1228 C CB    . VAL A 1 154 ? -29.129 -7.025  38.041 1.00 41.03  ? 673 VAL A CB    1 
ATOM   1229 C CG1   . VAL A 1 154 ? -30.009 -6.077  37.253 1.00 37.83  ? 673 VAL A CG1   1 
ATOM   1230 C CG2   . VAL A 1 154 ? -29.088 -6.637  39.507 1.00 39.87  ? 673 VAL A CG2   1 
ATOM   1231 N N     . ARG A 1 155 ? -30.549 -9.025  35.725 1.00 41.75  ? 674 ARG A N     1 
ATOM   1232 C CA    . ARG A 1 155 ? -30.561 -9.711  34.435 1.00 43.08  ? 674 ARG A CA    1 
ATOM   1233 C C     . ARG A 1 155 ? -31.138 -8.774  33.388 1.00 41.68  ? 674 ARG A C     1 
ATOM   1234 O O     . ARG A 1 155 ? -32.189 -8.174  33.613 1.00 42.37  ? 674 ARG A O     1 
ATOM   1235 C CB    . ARG A 1 155 ? -31.401 -10.998 34.529 1.00 43.63  ? 674 ARG A CB    1 
ATOM   1236 C CG    . ARG A 1 155 ? -31.418 -11.809 33.231 1.00 49.16  ? 674 ARG A CG    1 
ATOM   1237 C CD    . ARG A 1 155 ? -32.548 -12.828 33.195 1.00 48.35  ? 674 ARG A CD    1 
ATOM   1238 N NE    . ARG A 1 155 ? -33.811 -12.160 32.896 1.00 48.28  ? 674 ARG A NE    1 
ATOM   1239 C CZ    . ARG A 1 155 ? -34.998 -12.574 33.333 1.00 51.31  ? 674 ARG A CZ    1 
ATOM   1240 N NH1   . ARG A 1 155 ? -35.070 -13.668 34.081 1.00 51.15  ? 674 ARG A NH1   1 
ATOM   1241 N NH2   . ARG A 1 155 ? -36.104 -11.885 33.048 1.00 51.10  ? 674 ARG A NH2   1 
ATOM   1242 N N     . ALA A 1 156 ? -30.434 -8.585  32.279 1.00 41.16  ? 675 ALA A N     1 
ATOM   1243 C CA    . ALA A 1 156 ? -30.942 -7.706  31.226 1.00 40.03  ? 675 ALA A CA    1 
ATOM   1244 C C     . ALA A 1 156 ? -32.131 -8.357  30.543 1.00 41.51  ? 675 ALA A C     1 
ATOM   1245 O O     . ALA A 1 156 ? -32.091 -9.556  30.243 1.00 42.31  ? 675 ALA A O     1 
ATOM   1246 C CB    . ALA A 1 156 ? -29.882 -7.432  30.220 1.00 40.02  ? 675 ALA A CB    1 
ATOM   1247 N N     . ASP A 1 157 ? -33.187 -7.582  30.307 1.00 41.35  ? 676 ASP A N     1 
ATOM   1248 C CA    . ASP A 1 157 ? -34.319 -8.044  29.498 1.00 42.75  ? 676 ASP A CA    1 
ATOM   1249 C C     . ASP A 1 157 ? -34.160 -7.629  28.040 1.00 43.22  ? 676 ASP A C     1 
ATOM   1250 O O     . ASP A 1 157 ? -34.568 -8.358  27.144 1.00 43.37  ? 676 ASP A O     1 
ATOM   1251 C CB    . ASP A 1 157 ? -35.656 -7.509  30.024 1.00 43.07  ? 676 ASP A CB    1 
ATOM   1252 C CG    . ASP A 1 157 ? -36.010 -8.042  31.418 1.00 44.84  ? 676 ASP A CG    1 
ATOM   1253 O OD1   . ASP A 1 157 ? -36.904 -7.447  32.045 1.00 45.06  ? 676 ASP A OD1   1 
ATOM   1254 O OD2   . ASP A 1 157 ? -35.430 -9.045  31.902 1.00 44.74  ? 676 ASP A OD2   1 
ATOM   1255 N N     . THR A 1 158 ? -33.592 -6.453  27.797 1.00 43.75  ? 677 THR A N     1 
ATOM   1256 C CA    . THR A 1 158 ? -33.395 -5.987  26.425 1.00 44.59  ? 677 THR A CA    1 
ATOM   1257 C C     . THR A 1 158 ? -31.913 -5.796  26.210 1.00 45.59  ? 677 THR A C     1 
ATOM   1258 O O     . THR A 1 158 ? -31.123 -5.994  27.136 1.00 46.78  ? 677 THR A O     1 
ATOM   1259 C CB    . THR A 1 158 ? -34.001 -4.605  26.184 1.00 44.56  ? 677 THR A CB    1 
ATOM   1260 O OG1   . THR A 1 158 ? -33.287 -3.640  26.966 1.00 42.32  ? 677 THR A OG1   1 
ATOM   1261 C CG2   . THR A 1 158 ? -35.482 -4.572  26.544 1.00 46.26  ? 677 THR A CG2   1 
ATOM   1262 N N     . TYR A 1 159 ? -31.558 -5.383  24.997 1.00 45.34  ? 678 TYR A N     1 
ATOM   1263 C CA    . TYR A 1 159 ? -30.245 -4.823  24.701 1.00 45.63  ? 678 TYR A CA    1 
ATOM   1264 C C     . TYR A 1 159 ? -30.008 -3.574  25.554 1.00 45.90  ? 678 TYR A C     1 
ATOM   1265 O O     . TYR A 1 159 ? -30.450 -2.475  25.214 1.00 47.70  ? 678 TYR A O     1 
ATOM   1266 C CB    . TYR A 1 159 ? -30.139 -4.501  23.201 1.00 45.46  ? 678 TYR A CB    1 
ATOM   1267 C CG    . TYR A 1 159 ? -29.683 -5.689  22.373 1.00 47.84  ? 678 TYR A CG    1 
ATOM   1268 C CD1   . TYR A 1 159 ? -30.608 -6.571  21.811 1.00 52.91  ? 678 TYR A CD1   1 
ATOM   1269 C CD2   . TYR A 1 159 ? -28.327 -5.996  22.237 1.00 48.73  ? 678 TYR A CD2   1 
ATOM   1270 C CE1   . TYR A 1 159 ? -30.192 -7.710  21.095 1.00 54.17  ? 678 TYR A CE1   1 
ATOM   1271 C CE2   . TYR A 1 159 ? -27.900 -7.117  21.514 1.00 49.01  ? 678 TYR A CE2   1 
ATOM   1272 C CZ    . TYR A 1 159 ? -28.833 -7.963  20.935 1.00 52.02  ? 678 TYR A CZ    1 
ATOM   1273 O OH    . TYR A 1 159 ? -28.423 -9.059  20.205 1.00 48.01  ? 678 TYR A OH    1 
ATOM   1274 N N     . CYS A 1 160 ? -29.386 -3.764  26.710 1.00 44.92  ? 679 CYS A N     1 
ATOM   1275 C CA    . CYS A 1 160 ? -29.111 -2.662  27.611 1.00 44.67  ? 679 CYS A CA    1 
ATOM   1276 C C     . CYS A 1 160 ? -27.922 -1.850  27.106 1.00 43.85  ? 679 CYS A C     1 
ATOM   1277 O O     . CYS A 1 160 ? -26.951 -2.398  26.583 1.00 43.85  ? 679 CYS A O     1 
ATOM   1278 C CB    . CYS A 1 160 ? -28.795 -3.192  29.010 1.00 44.89  ? 679 CYS A CB    1 
ATOM   1279 S SG    . CYS A 1 160 ? -30.218 -3.813  29.893 1.00 45.00  ? 679 CYS A SG    1 
ATOM   1280 N N     . ARG A 1 161 ? -27.961 -0.546  27.334 1.00 41.68  ? 680 ARG A N     1 
ATOM   1281 C CA    . ARG A 1 161 ? -26.766 0.267   27.158 1.00 39.59  ? 680 ARG A CA    1 
ATOM   1282 C C     . ARG A 1 161 ? -26.484 0.966   28.470 1.00 37.27  ? 680 ARG A C     1 
ATOM   1283 O O     . ARG A 1 161 ? -27.267 1.808   28.913 1.00 38.69  ? 680 ARG A O     1 
ATOM   1284 C CB    . ARG A 1 161 ? -26.981 1.306   26.065 1.00 38.64  ? 680 ARG A CB    1 
ATOM   1285 C CG    . ARG A 1 161 ? -26.750 0.778   24.677 1.00 42.63  ? 680 ARG A CG    1 
ATOM   1286 C CD    . ARG A 1 161 ? -26.460 1.919   23.710 1.00 47.86  ? 680 ARG A CD    1 
ATOM   1287 N NE    . ARG A 1 161 ? -27.515 2.925   23.761 1.00 52.40  ? 680 ARG A NE    1 
ATOM   1288 C CZ    . ARG A 1 161 ? -28.779 2.693   23.421 1.00 55.53  ? 680 ARG A CZ    1 
ATOM   1289 N NH1   . ARG A 1 161 ? -29.146 1.475   23.026 1.00 58.67  ? 680 ARG A NH1   1 
ATOM   1290 N NH2   . ARG A 1 161 ? -29.671 3.677   23.461 1.00 55.40  ? 680 ARG A NH2   1 
ATOM   1291 N N     . LEU A 1 162 ? -25.393 0.598   29.118 1.00 34.51  ? 681 LEU A N     1 
ATOM   1292 C CA    . LEU A 1 162 ? -25.188 1.086   30.463 1.00 33.73  ? 681 LEU A CA    1 
ATOM   1293 C C     . LEU A 1 162 ? -23.914 1.899   30.587 1.00 32.13  ? 681 LEU A C     1 
ATOM   1294 O O     . LEU A 1 162 ? -23.090 1.935   29.674 1.00 30.66  ? 681 LEU A O     1 
ATOM   1295 C CB    . LEU A 1 162 ? -25.120 -0.076  31.458 1.00 35.23  ? 681 LEU A CB    1 
ATOM   1296 C CG    . LEU A 1 162 ? -26.095 -1.242  31.391 1.00 35.38  ? 681 LEU A CG    1 
ATOM   1297 C CD1   . LEU A 1 162 ? -25.543 -2.332  32.299 1.00 37.98  ? 681 LEU A CD1   1 
ATOM   1298 C CD2   . LEU A 1 162 ? -27.504 -0.814  31.815 1.00 33.24  ? 681 LEU A CD2   1 
ATOM   1299 N N     . TYR A 1 163 ? -23.728 2.464   31.775 1.00 31.19  ? 682 TYR A N     1 
ATOM   1300 C CA    . TYR A 1 163 ? -22.449 3.013   32.182 1.00 29.99  ? 682 TYR A CA    1 
ATOM   1301 C C     . TYR A 1 163 ? -22.076 2.441   33.545 1.00 31.32  ? 682 TYR A C     1 
ATOM   1302 O O     . TYR A 1 163 ? -22.869 2.489   34.499 1.00 31.19  ? 682 TYR A O     1 
ATOM   1303 C CB    . TYR A 1 163 ? -22.541 4.530   32.276 1.00 29.79  ? 682 TYR A CB    1 
ATOM   1304 C CG    . TYR A 1 163 ? -22.458 5.259   30.958 1.00 28.50  ? 682 TYR A CG    1 
ATOM   1305 C CD1   . TYR A 1 163 ? -21.243 5.435   30.321 1.00 28.79  ? 682 TYR A CD1   1 
ATOM   1306 C CD2   . TYR A 1 163 ? -23.587 5.831   30.386 1.00 27.73  ? 682 TYR A CD2   1 
ATOM   1307 C CE1   . TYR A 1 163 ? -21.159 6.136   29.124 1.00 33.42  ? 682 TYR A CE1   1 
ATOM   1308 C CE2   . TYR A 1 163 ? -23.519 6.511   29.181 1.00 30.10  ? 682 TYR A CE2   1 
ATOM   1309 C CZ    . TYR A 1 163 ? -22.302 6.666   28.560 1.00 30.01  ? 682 TYR A CZ    1 
ATOM   1310 O OH    . TYR A 1 163 ? -22.222 7.333   27.365 1.00 33.85  ? 682 TYR A OH    1 
ATOM   1311 N N     . SER A 1 164 ? -20.848 1.933   33.639 1.00 31.46  ? 683 SER A N     1 
ATOM   1312 C CA    . SER A 1 164 ? -20.364 1.367   34.875 1.00 32.13  ? 683 SER A CA    1 
ATOM   1313 C C     . SER A 1 164 ? -19.464 2.328   35.633 1.00 33.81  ? 683 SER A C     1 
ATOM   1314 O O     . SER A 1 164 ? -18.736 3.131   35.037 1.00 33.06  ? 683 SER A O     1 
ATOM   1315 C CB    . SER A 1 164 ? -19.652 0.040   34.632 1.00 33.23  ? 683 SER A CB    1 
ATOM   1316 O OG    . SER A 1 164 ? -18.590 0.189   33.709 1.00 36.76  ? 683 SER A OG    1 
ATOM   1317 N N     . LEU A 1 165 ? -19.548 2.218   36.958 1.00 34.58  ? 684 LEU A N     1 
ATOM   1318 C CA    . LEU A 1 165 ? -18.748 2.989   37.894 1.00 35.74  ? 684 LEU A CA    1 
ATOM   1319 C C     . LEU A 1 165 ? -18.143 2.051   38.941 1.00 37.07  ? 684 LEU A C     1 
ATOM   1320 O O     . LEU A 1 165 ? -18.857 1.306   39.629 1.00 36.85  ? 684 LEU A O     1 
ATOM   1321 C CB    . LEU A 1 165 ? -19.627 4.015   38.616 1.00 34.69  ? 684 LEU A CB    1 
ATOM   1322 C CG    . LEU A 1 165 ? -18.837 5.047   39.412 1.00 32.79  ? 684 LEU A CG    1 
ATOM   1323 C CD1   . LEU A 1 165 ? -18.014 5.949   38.488 1.00 35.57  ? 684 LEU A CD1   1 
ATOM   1324 C CD2   . LEU A 1 165 ? -19.770 5.868   40.248 1.00 36.19  ? 684 LEU A CD2   1 
ATOM   1325 N N     . SER A 1 166 ? -16.830 2.134   39.114 1.00 38.26  ? 685 SER A N     1 
ATOM   1326 C CA    . SER A 1 166 ? -16.160 1.239   40.049 1.00 40.78  ? 685 SER A CA    1 
ATOM   1327 C C     . SER A 1 166 ? -16.204 1.836   41.457 1.00 40.85  ? 685 SER A C     1 
ATOM   1328 O O     . SER A 1 166 ? -16.470 3.024   41.621 1.00 41.73  ? 685 SER A O     1 
ATOM   1329 C CB    . SER A 1 166 ? -14.712 1.041   39.623 1.00 40.14  ? 685 SER A CB    1 
ATOM   1330 O OG    . SER A 1 166 ? -14.008 2.236   39.905 1.00 43.00  ? 685 SER A OG    1 
ATOM   1331 N N     . VAL A 1 167 ? -15.916 1.022   42.465 1.00 41.20  ? 686 VAL A N     1 
ATOM   1332 C CA    . VAL A 1 167 ? -15.997 1.484   43.846 1.00 42.16  ? 686 VAL A CA    1 
ATOM   1333 C C     . VAL A 1 167 ? -14.946 2.548   44.090 1.00 42.80  ? 686 VAL A C     1 
ATOM   1334 O O     . VAL A 1 167 ? -15.236 3.579   44.709 1.00 43.46  ? 686 VAL A O     1 
ATOM   1335 C CB    . VAL A 1 167 ? -15.873 0.326   44.872 1.00 42.69  ? 686 VAL A CB    1 
ATOM   1336 C CG1   . VAL A 1 167 ? -14.452 -0.196  44.939 1.00 41.53  ? 686 VAL A CG1   1 
ATOM   1337 C CG2   . VAL A 1 167 ? -16.389 0.748   46.260 1.00 43.41  ? 686 VAL A CG2   1 
ATOM   1338 N N     . ASP A 1 168 ? -13.748 2.305   43.561 1.00 43.87  ? 687 ASP A N     1 
ATOM   1339 C CA    . ASP A 1 168 ? -12.655 3.284   43.553 1.00 44.02  ? 687 ASP A CA    1 
ATOM   1340 C C     . ASP A 1 168 ? -13.167 4.679   43.207 1.00 43.18  ? 687 ASP A C     1 
ATOM   1341 O O     . ASP A 1 168 ? -13.138 5.584   44.055 1.00 43.04  ? 687 ASP A O     1 
ATOM   1342 C CB    . ASP A 1 168 ? -11.576 2.880   42.539 1.00 44.25  ? 687 ASP A CB    1 
ATOM   1343 C CG    . ASP A 1 168 ? -11.180 1.422   42.660 1.00 49.19  ? 687 ASP A CG    1 
ATOM   1344 O OD1   . ASP A 1 168 ? -10.146 1.156   43.310 1.00 51.40  ? 687 ASP A OD1   1 
ATOM   1345 O OD2   . ASP A 1 168 ? -11.918 0.544   42.140 1.00 51.03  ? 687 ASP A OD2   1 
ATOM   1346 N N     . ASN A 1 169 ? -13.643 4.825   41.967 1.00 41.77  ? 688 ASN A N     1 
ATOM   1347 C CA    . ASN A 1 169 ? -14.133 6.098   41.428 1.00 40.36  ? 688 ASN A CA    1 
ATOM   1348 C C     . ASN A 1 169 ? -15.361 6.586   42.175 1.00 41.21  ? 688 ASN A C     1 
ATOM   1349 O O     . ASN A 1 169 ? -15.525 7.779   42.430 1.00 41.95  ? 688 ASN A O     1 
ATOM   1350 C CB    . ASN A 1 169 ? -14.524 5.949   39.962 1.00 39.46  ? 688 ASN A CB    1 
ATOM   1351 C CG    . ASN A 1 169 ? -13.408 5.410   39.117 1.00 37.71  ? 688 ASN A CG    1 
ATOM   1352 O OD1   . ASN A 1 169 ? -12.425 6.093   38.869 1.00 38.77  ? 688 ASN A OD1   1 
ATOM   1353 N ND2   . ASN A 1 169 ? -13.560 4.184   38.649 1.00 40.24  ? 688 ASN A ND2   1 
ATOM   1354 N N     . PHE A 1 170 ? -16.254 5.659   42.483 1.00 40.38  ? 689 PHE A N     1 
ATOM   1355 C CA    . PHE A 1 170 ? -17.387 6.016   43.282 1.00 41.48  ? 689 PHE A CA    1 
ATOM   1356 C C     . PHE A 1 170 ? -16.872 6.712   44.538 1.00 41.75  ? 689 PHE A C     1 
ATOM   1357 O O     . PHE A 1 170 ? -17.194 7.876   44.766 1.00 42.23  ? 689 PHE A O     1 
ATOM   1358 C CB    . PHE A 1 170 ? -18.222 4.776   43.583 1.00 41.80  ? 689 PHE A CB    1 
ATOM   1359 C CG    . PHE A 1 170 ? -19.407 5.030   44.462 1.00 42.30  ? 689 PHE A CG    1 
ATOM   1360 C CD1   . PHE A 1 170 ? -20.501 5.729   43.987 1.00 45.49  ? 689 PHE A CD1   1 
ATOM   1361 C CD2   . PHE A 1 170 ? -19.474 4.464   45.721 1.00 41.35  ? 689 PHE A CD2   1 
ATOM   1362 C CE1   . PHE A 1 170 ? -21.638 5.892   44.775 1.00 47.45  ? 689 PHE A CE1   1 
ATOM   1363 C CE2   . PHE A 1 170 ? -20.596 4.624   46.511 1.00 45.19  ? 689 PHE A CE2   1 
ATOM   1364 C CZ    . PHE A 1 170 ? -21.682 5.335   46.042 1.00 45.52  ? 689 PHE A CZ    1 
ATOM   1365 N N     . ASN A 1 171 ? -15.991 6.064   45.299 1.00 42.96  ? 690 ASN A N     1 
ATOM   1366 C CA    . ASN A 1 171 ? -15.589 6.641   46.598 1.00 43.65  ? 690 ASN A CA    1 
ATOM   1367 C C     . ASN A 1 171 ? -14.750 7.896   46.440 1.00 43.80  ? 690 ASN A C     1 
ATOM   1368 O O     . ASN A 1 171 ? -14.663 8.719   47.355 1.00 44.76  ? 690 ASN A O     1 
ATOM   1369 C CB    . ASN A 1 171 ? -14.873 5.639   47.512 1.00 43.15  ? 690 ASN A CB    1 
ATOM   1370 C CG    . ASN A 1 171 ? -15.761 4.476   47.904 1.00 43.28  ? 690 ASN A CG    1 
ATOM   1371 O OD1   . ASN A 1 171 ? -16.937 4.651   48.225 1.00 44.93  ? 690 ASN A OD1   1 
ATOM   1372 N ND2   . ASN A 1 171 ? -15.221 3.276   47.814 1.00 38.96  ? 690 ASN A ND2   1 
ATOM   1373 N N     . GLU A 1 172 ? -14.134 8.041   45.276 1.00 42.90  ? 691 GLU A N     1 
ATOM   1374 C CA    . GLU A 1 172 ? -13.332 9.221   45.025 1.00 43.50  ? 691 GLU A CA    1 
ATOM   1375 C C     . GLU A 1 172 ? -14.258 10.415  44.834 1.00 42.64  ? 691 GLU A C     1 
ATOM   1376 O O     . GLU A 1 172 ? -14.128 11.441  45.514 1.00 42.61  ? 691 GLU A O     1 
ATOM   1377 C CB    . GLU A 1 172 ? -12.441 9.012   43.798 1.00 43.68  ? 691 GLU A CB    1 
ATOM   1378 C CG    . GLU A 1 172 ? -11.546 10.196  43.521 1.00 46.49  ? 691 GLU A CG    1 
ATOM   1379 C CD    . GLU A 1 172 ? -10.951 10.170  42.121 1.00 51.23  ? 691 GLU A CD    1 
ATOM   1380 O OE1   . GLU A 1 172 ? -10.945 9.090   41.488 1.00 52.25  ? 691 GLU A OE1   1 
ATOM   1381 O OE2   . GLU A 1 172 ? -10.481 11.233  41.661 1.00 47.76  ? 691 GLU A OE2   1 
ATOM   1382 N N     . VAL A 1 173 ? -15.218 10.255  43.928 1.00 41.66  ? 692 VAL A N     1 
ATOM   1383 C CA    . VAL A 1 173 ? -16.130 11.338  43.586 1.00 41.29  ? 692 VAL A CA    1 
ATOM   1384 C C     . VAL A 1 173 ? -16.950 11.779  44.793 1.00 42.57  ? 692 VAL A C     1 
ATOM   1385 O O     . VAL A 1 173 ? -17.362 12.939  44.884 1.00 43.20  ? 692 VAL A O     1 
ATOM   1386 C CB    . VAL A 1 173 ? -17.066 10.958  42.439 1.00 39.45  ? 692 VAL A CB    1 
ATOM   1387 C CG1   . VAL A 1 173 ? -17.725 12.200  41.907 1.00 40.56  ? 692 VAL A CG1   1 
ATOM   1388 C CG2   . VAL A 1 173 ? -16.286 10.309  41.331 1.00 38.27  ? 692 VAL A CG2   1 
ATOM   1389 N N     . LEU A 1 174 ? -17.166 10.850  45.721 1.00 43.74  ? 693 LEU A N     1 
ATOM   1390 C CA    . LEU A 1 174 ? -18.028 11.101  46.869 1.00 45.14  ? 693 LEU A CA    1 
ATOM   1391 C C     . LEU A 1 174 ? -17.254 11.657  48.060 1.00 46.20  ? 693 LEU A C     1 
ATOM   1392 O O     . LEU A 1 174 ? -17.840 12.190  48.998 1.00 45.94  ? 693 LEU A O     1 
ATOM   1393 C CB    . LEU A 1 174 ? -18.824 9.846   47.254 1.00 44.64  ? 693 LEU A CB    1 
ATOM   1394 C CG    . LEU A 1 174 ? -19.962 9.424   46.315 1.00 43.43  ? 693 LEU A CG    1 
ATOM   1395 C CD1   . LEU A 1 174 ? -20.815 8.356   46.968 1.00 41.46  ? 693 LEU A CD1   1 
ATOM   1396 C CD2   . LEU A 1 174 ? -20.829 10.616  45.948 1.00 44.13  ? 693 LEU A CD2   1 
ATOM   1397 N N     . GLU A 1 175 ? -15.931 11.579  47.997 1.00 47.95  ? 694 GLU A N     1 
ATOM   1398 C CA    . GLU A 1 175 ? -15.100 12.177  49.029 1.00 50.02  ? 694 GLU A CA    1 
ATOM   1399 C C     . GLU A 1 175 ? -14.938 13.664  48.727 1.00 50.72  ? 694 GLU A C     1 
ATOM   1400 O O     . GLU A 1 175 ? -14.823 14.492  49.638 1.00 51.11  ? 694 GLU A O     1 
ATOM   1401 C CB    . GLU A 1 175 ? -13.744 11.471  49.091 1.00 50.07  ? 694 GLU A CB    1 
ATOM   1402 C CG    . GLU A 1 175 ? -12.960 11.735  50.358 1.00 53.78  ? 694 GLU A CG    1 
ATOM   1403 C CD    . GLU A 1 175 ? -11.728 12.590  50.102 1.00 59.70  ? 694 GLU A CD    1 
ATOM   1404 O OE1   . GLU A 1 175 ? -10.775 12.075  49.471 1.00 60.37  ? 694 GLU A OE1   1 
ATOM   1405 O OE2   . GLU A 1 175 ? -11.701 13.760  50.554 1.00 60.04  ? 694 GLU A OE2   1 
ATOM   1406 N N     . GLU A 1 176 ? -14.978 13.984  47.438 1.00 50.85  ? 695 GLU A N     1 
ATOM   1407 C CA    . GLU A 1 176 ? -14.926 15.354  46.948 1.00 52.55  ? 695 GLU A CA    1 
ATOM   1408 C C     . GLU A 1 176 ? -16.285 16.078  47.104 1.00 53.26  ? 695 GLU A C     1 
ATOM   1409 O O     . GLU A 1 176 ? -16.357 17.305  47.261 1.00 52.26  ? 695 GLU A O     1 
ATOM   1410 C CB    . GLU A 1 176 ? -14.489 15.285  45.483 1.00 52.83  ? 695 GLU A CB    1 
ATOM   1411 C CG    . GLU A 1 176 ? -14.463 16.586  44.705 1.00 56.55  ? 695 GLU A CG    1 
ATOM   1412 C CD    . GLU A 1 176 ? -13.964 16.389  43.280 1.00 63.17  ? 695 GLU A CD    1 
ATOM   1413 O OE1   . GLU A 1 176 ? -13.911 15.223  42.808 1.00 63.87  ? 695 GLU A OE1   1 
ATOM   1414 O OE2   . GLU A 1 176 ? -13.601 17.402  42.640 1.00 65.56  ? 695 GLU A OE2   1 
ATOM   1415 N N     . TYR A 1 177 ? -17.363 15.297  47.095 1.00 53.07  ? 696 TYR A N     1 
ATOM   1416 C CA    . TYR A 1 177 ? -18.714 15.838  47.101 1.00 52.57  ? 696 TYR A CA    1 
ATOM   1417 C C     . TYR A 1 177 ? -19.593 15.042  48.052 1.00 51.67  ? 696 TYR A C     1 
ATOM   1418 O O     . TYR A 1 177 ? -20.527 14.396  47.595 1.00 51.88  ? 696 TYR A O     1 
ATOM   1419 C CB    . TYR A 1 177 ? -19.319 15.724  45.698 1.00 52.30  ? 696 TYR A CB    1 
ATOM   1420 C CG    . TYR A 1 177 ? -18.700 16.635  44.663 1.00 53.77  ? 696 TYR A CG    1 
ATOM   1421 C CD1   . TYR A 1 177 ? -18.995 17.997  44.644 1.00 55.27  ? 696 TYR A CD1   1 
ATOM   1422 C CD2   . TYR A 1 177 ? -17.874 16.131  43.661 1.00 53.30  ? 696 TYR A CD2   1 
ATOM   1423 C CE1   . TYR A 1 177 ? -18.431 18.848  43.686 1.00 54.86  ? 696 TYR A CE1   1 
ATOM   1424 C CE2   . TYR A 1 177 ? -17.313 16.970  42.697 1.00 52.37  ? 696 TYR A CE2   1 
ATOM   1425 C CZ    . TYR A 1 177 ? -17.598 18.331  42.708 1.00 53.93  ? 696 TYR A CZ    1 
ATOM   1426 O OH    . TYR A 1 177 ? -17.075 19.184  41.749 1.00 52.29  ? 696 TYR A OH    1 
ATOM   1427 N N     . PRO A 1 178 ? -19.317 15.103  49.368 1.00 50.83  ? 697 PRO A N     1 
ATOM   1428 C CA    . PRO A 1 178 ? -19.905 14.219  50.375 1.00 49.33  ? 697 PRO A CA    1 
ATOM   1429 C C     . PRO A 1 178 ? -21.423 14.336  50.511 1.00 49.72  ? 697 PRO A C     1 
ATOM   1430 O O     . PRO A 1 178 ? -22.105 13.324  50.681 1.00 49.78  ? 697 PRO A O     1 
ATOM   1431 C CB    . PRO A 1 178 ? -19.233 14.662  51.677 1.00 49.25  ? 697 PRO A CB    1 
ATOM   1432 C CG    . PRO A 1 178 ? -18.068 15.485  51.282 1.00 48.93  ? 697 PRO A CG    1 
ATOM   1433 C CD    . PRO A 1 178 ? -18.428 16.109  49.975 1.00 51.15  ? 697 PRO A CD    1 
ATOM   1434 N N     . MET A 1 179 ? -21.958 15.549  50.439 1.00 50.18  ? 698 MET A N     1 
ATOM   1435 C CA    . MET A 1 179 ? -23.412 15.730  50.430 1.00 51.77  ? 698 MET A CA    1 
ATOM   1436 C C     . MET A 1 179 ? -24.117 14.628  49.626 1.00 52.43  ? 698 MET A C     1 
ATOM   1437 O O     . MET A 1 179 ? -25.240 14.223  49.966 1.00 53.19  ? 698 MET A O     1 
ATOM   1438 C CB    . MET A 1 179 ? -23.818 17.098  49.872 1.00 50.97  ? 698 MET A CB    1 
ATOM   1439 C CG    . MET A 1 179 ? -22.830 18.232  50.119 1.00 58.05  ? 698 MET A CG    1 
ATOM   1440 S SD    . MET A 1 179 ? -23.226 19.235  51.571 1.00 69.47  ? 698 MET A SD    1 
ATOM   1441 C CE    . MET A 1 179 ? -22.855 20.909  51.006 1.00 65.30  ? 698 MET A CE    1 
ATOM   1442 N N     . MET A 1 180 ? -23.473 14.172  48.547 1.00 51.28  ? 699 MET A N     1 
ATOM   1443 C CA    . MET A 1 180 ? -24.099 13.259  47.597 1.00 49.65  ? 699 MET A CA    1 
ATOM   1444 C C     . MET A 1 180 ? -24.059 11.799  48.035 1.00 49.00  ? 699 MET A C     1 
ATOM   1445 O O     . MET A 1 180 ? -24.764 10.965  47.479 1.00 48.52  ? 699 MET A O     1 
ATOM   1446 C CB    . MET A 1 180 ? -23.477 13.400  46.202 1.00 51.01  ? 699 MET A CB    1 
ATOM   1447 C CG    . MET A 1 180 ? -23.674 14.754  45.519 1.00 48.59  ? 699 MET A CG    1 
ATOM   1448 S SD    . MET A 1 180 ? -25.398 15.254  45.460 1.00 46.60  ? 699 MET A SD    1 
ATOM   1449 C CE    . MET A 1 180 ? -26.106 13.886  44.546 1.00 46.37  ? 699 MET A CE    1 
ATOM   1450 N N     . ARG A 1 181 ? -23.254 11.480  49.042 1.00 49.11  ? 700 ARG A N     1 
ATOM   1451 C CA    . ARG A 1 181 ? -23.231 10.118  49.559 1.00 48.50  ? 700 ARG A CA    1 
ATOM   1452 C C     . ARG A 1 181 ? -24.594 9.682   50.061 1.00 48.73  ? 700 ARG A C     1 
ATOM   1453 O O     . ARG A 1 181 ? -25.006 8.549   49.823 1.00 49.08  ? 700 ARG A O     1 
ATOM   1454 C CB    . ARG A 1 181 ? -22.223 9.974   50.685 1.00 48.98  ? 700 ARG A CB    1 
ATOM   1455 C CG    . ARG A 1 181 ? -22.033 8.537   51.106 1.00 49.29  ? 700 ARG A CG    1 
ATOM   1456 C CD    . ARG A 1 181 ? -20.759 8.380   51.909 1.00 52.00  ? 700 ARG A CD    1 
ATOM   1457 N NE    . ARG A 1 181 ? -19.613 8.086   51.052 1.00 54.20  ? 700 ARG A NE    1 
ATOM   1458 C CZ    . ARG A 1 181 ? -19.429 6.931   50.425 1.00 55.06  ? 700 ARG A CZ    1 
ATOM   1459 N NH1   . ARG A 1 181 ? -20.324 5.956   50.537 1.00 54.33  ? 700 ARG A NH1   1 
ATOM   1460 N NH2   . ARG A 1 181 ? -18.351 6.760   49.674 1.00 55.57  ? 700 ARG A NH2   1 
ATOM   1461 N N     . ARG A 1 182 ? -25.285 10.589  50.749 1.00 48.77  ? 701 ARG A N     1 
ATOM   1462 C CA    . ARG A 1 182 ? -26.599 10.320  51.336 1.00 48.57  ? 701 ARG A CA    1 
ATOM   1463 C C     . ARG A 1 182 ? -27.698 10.014  50.319 1.00 46.47  ? 701 ARG A C     1 
ATOM   1464 O O     . ARG A 1 182 ? -28.571 9.193   50.573 1.00 46.17  ? 701 ARG A O     1 
ATOM   1465 C CB    . ARG A 1 182 ? -27.031 11.480  52.233 1.00 49.41  ? 701 ARG A CB    1 
ATOM   1466 C CG    . ARG A 1 182 ? -26.717 11.272  53.710 1.00 58.01  ? 701 ARG A CG    1 
ATOM   1467 C CD    . ARG A 1 182 ? -27.968 10.886  54.517 1.00 68.36  ? 701 ARG A CD    1 
ATOM   1468 N NE    . ARG A 1 182 ? -29.080 11.807  54.267 1.00 75.15  ? 701 ARG A NE    1 
ATOM   1469 C CZ    . ARG A 1 182 ? -30.254 11.781  54.899 1.00 77.00  ? 701 ARG A CZ    1 
ATOM   1470 N NH1   . ARG A 1 182 ? -30.493 10.877  55.845 1.00 75.61  ? 701 ARG A NH1   1 
ATOM   1471 N NH2   . ARG A 1 182 ? -31.197 12.659  54.574 1.00 76.97  ? 701 ARG A NH2   1 
ATOM   1472 N N     . ALA A 1 183 ? -27.680 10.691  49.178 1.00 45.65  ? 702 ALA A N     1 
ATOM   1473 C CA    . ALA A 1 183 ? -28.580 10.340  48.080 1.00 43.80  ? 702 ALA A CA    1 
ATOM   1474 C C     . ALA A 1 183 ? -28.512 8.850   47.791 1.00 43.29  ? 702 ALA A C     1 
ATOM   1475 O O     . ALA A 1 183 ? -29.515 8.155   47.902 1.00 43.46  ? 702 ALA A O     1 
ATOM   1476 C CB    . ALA A 1 183 ? -28.236 11.140  46.832 1.00 43.60  ? 702 ALA A CB    1 
ATOM   1477 N N     . PHE A 1 184 ? -27.316 8.355   47.478 1.00 43.09  ? 703 PHE A N     1 
ATOM   1478 C CA    . PHE A 1 184 ? -27.121 6.941   47.166 1.00 43.19  ? 703 PHE A CA    1 
ATOM   1479 C C     . PHE A 1 184 ? -27.468 6.080   48.373 1.00 44.54  ? 703 PHE A C     1 
ATOM   1480 O O     . PHE A 1 184 ? -28.025 4.994   48.214 1.00 45.70  ? 703 PHE A O     1 
ATOM   1481 C CB    . PHE A 1 184 ? -25.671 6.646   46.749 1.00 42.84  ? 703 PHE A CB    1 
ATOM   1482 C CG    . PHE A 1 184 ? -25.354 6.966   45.305 1.00 39.14  ? 703 PHE A CG    1 
ATOM   1483 C CD1   . PHE A 1 184 ? -25.984 6.295   44.270 1.00 38.13  ? 703 PHE A CD1   1 
ATOM   1484 C CD2   . PHE A 1 184 ? -24.364 7.890   44.986 1.00 38.04  ? 703 PHE A CD2   1 
ATOM   1485 C CE1   . PHE A 1 184 ? -25.669 6.580   42.939 1.00 38.34  ? 703 PHE A CE1   1 
ATOM   1486 C CE2   . PHE A 1 184 ? -24.050 8.188   43.656 1.00 36.90  ? 703 PHE A CE2   1 
ATOM   1487 C CZ    . PHE A 1 184 ? -24.690 7.524   42.634 1.00 35.64  ? 703 PHE A CZ    1 
ATOM   1488 N N     . GLU A 1 185 ? -27.087 6.537   49.567 1.00 45.09  ? 704 GLU A N     1 
ATOM   1489 C CA    . GLU A 1 185 ? -27.503 5.912   50.833 1.00 45.18  ? 704 GLU A CA    1 
ATOM   1490 C C     . GLU A 1 185 ? -29.016 5.753   50.972 1.00 44.84  ? 704 GLU A C     1 
ATOM   1491 O O     . GLU A 1 185 ? -29.493 4.644   51.232 1.00 44.65  ? 704 GLU A O     1 
ATOM   1492 C CB    . GLU A 1 185 ? -26.984 6.689   52.048 1.00 44.08  ? 704 GLU A CB    1 
ATOM   1493 C CG    . GLU A 1 185 ? -25.482 6.577   52.267 1.00 49.68  ? 704 GLU A CG    1 
ATOM   1494 C CD    . GLU A 1 185 ? -25.054 6.990   53.670 1.00 52.36  ? 704 GLU A CD    1 
ATOM   1495 O OE1   . GLU A 1 185 ? -23.985 6.525   54.126 1.00 51.08  ? 704 GLU A OE1   1 
ATOM   1496 O OE2   . GLU A 1 185 ? -25.796 7.760   54.319 1.00 54.68  ? 704 GLU A OE2   1 
ATOM   1497 N N     . THR A 1 186 ? -29.752 6.861   50.873 1.00 43.55  ? 705 THR A N     1 
ATOM   1498 C CA    . THR A 1 186 ? -31.209 6.803   50.963 1.00 44.06  ? 705 THR A CA    1 
ATOM   1499 C C     . THR A 1 186 ? -31.745 5.674   50.079 1.00 43.46  ? 705 THR A C     1 
ATOM   1500 O O     . THR A 1 186 ? -32.328 4.707   50.565 1.00 43.03  ? 705 THR A O     1 
ATOM   1501 C CB    . THR A 1 186 ? -31.894 8.119   50.526 1.00 44.14  ? 705 THR A CB    1 
ATOM   1502 O OG1   . THR A 1 186 ? -31.316 9.236   51.213 1.00 45.27  ? 705 THR A OG1   1 
ATOM   1503 C CG2   . THR A 1 186 ? -33.383 8.054   50.835 1.00 42.35  ? 705 THR A CG2   1 
ATOM   1504 N N     . VAL A 1 187 ? -31.504 5.789   48.780 1.00 43.08  ? 706 VAL A N     1 
ATOM   1505 C CA    . VAL A 1 187 ? -31.952 4.789   47.820 1.00 43.45  ? 706 VAL A CA    1 
ATOM   1506 C C     . VAL A 1 187 ? -31.609 3.351   48.222 1.00 43.94  ? 706 VAL A C     1 
ATOM   1507 O O     . VAL A 1 187 ? -32.484 2.482   48.281 1.00 43.97  ? 706 VAL A O     1 
ATOM   1508 C CB    . VAL A 1 187 ? -31.431 5.123   46.425 1.00 42.64  ? 706 VAL A CB    1 
ATOM   1509 C CG1   . VAL A 1 187 ? -31.690 3.981   45.456 1.00 44.37  ? 706 VAL A CG1   1 
ATOM   1510 C CG2   . VAL A 1 187 ? -32.107 6.384   45.956 1.00 41.74  ? 706 VAL A CG2   1 
ATOM   1511 N N     . ALA A 1 188 ? -30.355 3.114   48.579 1.00 44.13  ? 707 ALA A N     1 
ATOM   1512 C CA    . ALA A 1 188 ? -29.959 1.789   49.012 1.00 45.22  ? 707 ALA A CA    1 
ATOM   1513 C C     . ALA A 1 188 ? -30.837 1.236   50.154 1.00 47.57  ? 707 ALA A C     1 
ATOM   1514 O O     . ALA A 1 188 ? -31.278 0.070   50.096 1.00 48.77  ? 707 ALA A O     1 
ATOM   1515 C CB    . ALA A 1 188 ? -28.497 1.787   49.384 1.00 45.14  ? 707 ALA A CB    1 
ATOM   1516 N N     . LEU A 1 189 ? -31.120 2.053   51.173 1.00 46.73  ? 708 LEU A N     1 
ATOM   1517 C CA    . LEU A 1 189 ? -31.973 1.593   52.277 1.00 47.23  ? 708 LEU A CA    1 
ATOM   1518 C C     . LEU A 1 189 ? -33.378 1.205   51.822 1.00 47.03  ? 708 LEU A C     1 
ATOM   1519 O O     . LEU A 1 189 ? -33.789 0.074   52.021 1.00 46.20  ? 708 LEU A O     1 
ATOM   1520 C CB    . LEU A 1 189 ? -32.056 2.614   53.413 1.00 46.93  ? 708 LEU A CB    1 
ATOM   1521 C CG    . LEU A 1 189 ? -30.718 2.962   54.062 1.00 48.66  ? 708 LEU A CG    1 
ATOM   1522 C CD1   . LEU A 1 189 ? -30.822 4.184   54.980 1.00 54.61  ? 708 LEU A CD1   1 
ATOM   1523 C CD2   . LEU A 1 189 ? -30.156 1.766   54.793 1.00 47.84  ? 708 LEU A CD2   1 
ATOM   1524 N N     . ASP A 1 190 ? -34.099 2.122   51.187 1.00 48.40  ? 709 ASP A N     1 
ATOM   1525 C CA    . ASP A 1 190 ? -35.410 1.794   50.637 1.00 50.32  ? 709 ASP A CA    1 
ATOM   1526 C C     . ASP A 1 190 ? -35.368 0.386   50.066 1.00 51.17  ? 709 ASP A C     1 
ATOM   1527 O O     . ASP A 1 190 ? -36.218 -0.447  50.376 1.00 52.26  ? 709 ASP A O     1 
ATOM   1528 C CB    . ASP A 1 190 ? -35.827 2.799   49.564 1.00 50.00  ? 709 ASP A CB    1 
ATOM   1529 C CG    . ASP A 1 190 ? -35.912 4.219   50.099 1.00 52.98  ? 709 ASP A CG    1 
ATOM   1530 O OD1   . ASP A 1 190 ? -36.630 4.449   51.092 1.00 58.42  ? 709 ASP A OD1   1 
ATOM   1531 O OD2   . ASP A 1 190 ? -35.272 5.124   49.529 1.00 54.89  ? 709 ASP A OD2   1 
ATOM   1532 N N     . ARG A 1 191 ? -34.330 0.107   49.285 1.00 52.41  ? 710 ARG A N     1 
ATOM   1533 C CA    . ARG A 1 191 ? -34.155 -1.202  48.667 1.00 53.58  ? 710 ARG A CA    1 
ATOM   1534 C C     . ARG A 1 191 ? -33.836 -2.341  49.645 1.00 55.09  ? 710 ARG A C     1 
ATOM   1535 O O     . ARG A 1 191 ? -34.372 -3.439  49.522 1.00 55.21  ? 710 ARG A O     1 
ATOM   1536 C CB    . ARG A 1 191 ? -33.111 -1.113  47.552 1.00 52.95  ? 710 ARG A CB    1 
ATOM   1537 C CG    . ARG A 1 191 ? -33.545 -0.233  46.389 1.00 49.14  ? 710 ARG A CG    1 
ATOM   1538 C CD    . ARG A 1 191 ? -32.354 0.222   45.575 1.00 45.08  ? 710 ARG A CD    1 
ATOM   1539 N NE    . ARG A 1 191 ? -32.788 0.715   44.273 1.00 46.22  ? 710 ARG A NE    1 
ATOM   1540 C CZ    . ARG A 1 191 ? -32.003 0.898   43.213 1.00 39.75  ? 710 ARG A CZ    1 
ATOM   1541 N NH1   . ARG A 1 191 ? -30.693 0.683   43.262 1.00 39.11  ? 710 ARG A NH1   1 
ATOM   1542 N NH2   . ARG A 1 191 ? -32.548 1.313   42.086 1.00 37.02  ? 710 ARG A NH2   1 
ATOM   1543 N N     . LEU A 1 192 ? -32.954 -2.099  50.606 1.00 58.42  ? 711 LEU A N     1 
ATOM   1544 C CA    . LEU A 1 192 ? -32.713 -3.090  51.656 1.00 61.76  ? 711 LEU A CA    1 
ATOM   1545 C C     . LEU A 1 192 ? -33.965 -3.404  52.465 1.00 64.01  ? 711 LEU A C     1 
ATOM   1546 O O     . LEU A 1 192 ? -34.085 -4.485  53.034 1.00 64.78  ? 711 LEU A O     1 
ATOM   1547 C CB    . LEU A 1 192 ? -31.612 -2.634  52.608 1.00 60.77  ? 711 LEU A CB    1 
ATOM   1548 C CG    . LEU A 1 192 ? -30.202 -3.100  52.258 1.00 60.91  ? 711 LEU A CG    1 
ATOM   1549 C CD1   . LEU A 1 192 ? -30.226 -4.557  51.838 1.00 59.96  ? 711 LEU A CD1   1 
ATOM   1550 C CD2   . LEU A 1 192 ? -29.635 -2.215  51.160 1.00 61.18  ? 711 LEU A CD2   1 
ATOM   1551 N N     . ASP A 1 193 ? -34.873 -2.439  52.548 1.00 67.29  ? 712 ASP A N     1 
ATOM   1552 C CA    . ASP A 1 193 ? -36.107 -2.613  53.300 1.00 71.04  ? 712 ASP A CA    1 
ATOM   1553 C C     . ASP A 1 193 ? -37.244 -3.151  52.434 1.00 72.64  ? 712 ASP A C     1 
ATOM   1554 O O     . ASP A 1 193 ? -38.241 -3.648  52.956 1.00 73.15  ? 712 ASP A O     1 
ATOM   1555 C CB    . ASP A 1 193 ? -36.510 -1.314  54.013 1.00 71.54  ? 712 ASP A CB    1 
ATOM   1556 C CG    . ASP A 1 193 ? -35.906 -1.198  55.416 1.00 74.21  ? 712 ASP A CG    1 
ATOM   1557 O OD1   . ASP A 1 193 ? -36.150 -2.106  56.244 1.00 74.40  ? 712 ASP A OD1   1 
ATOM   1558 O OD2   . ASP A 1 193 ? -35.197 -0.201  55.696 1.00 75.61  ? 712 ASP A OD2   1 
ATOM   1559 N N     . ARG A 1 194 ? -37.088 -3.071  51.116 1.00 74.68  ? 713 ARG A N     1 
ATOM   1560 C CA    . ARG A 1 194 ? -37.889 -3.897  50.221 1.00 76.95  ? 713 ARG A CA    1 
ATOM   1561 C C     . ARG A 1 194 ? -37.386 -5.347  50.169 1.00 78.54  ? 713 ARG A C     1 
ATOM   1562 O O     . ARG A 1 194 ? -38.103 -6.226  49.690 1.00 78.37  ? 713 ARG A O     1 
ATOM   1563 C CB    . ARG A 1 194 ? -37.958 -3.288  48.822 1.00 76.98  ? 713 ARG A CB    1 
ATOM   1564 C CG    . ARG A 1 194 ? -38.922 -2.113  48.693 1.00 77.99  ? 713 ARG A CG    1 
ATOM   1565 C CD    . ARG A 1 194 ? -39.089 -1.694  47.230 1.00 78.82  ? 713 ARG A CD    1 
ATOM   1566 N NE    . ARG A 1 194 ? -39.362 -0.264  47.081 1.00 77.86  ? 713 ARG A NE    1 
ATOM   1567 C CZ    . ARG A 1 194 ? -38.465 0.701   47.280 1.00 78.59  ? 713 ARG A CZ    1 
ATOM   1568 N NH1   . ARG A 1 194 ? -37.225 0.407   47.656 1.00 77.10  ? 713 ARG A NH1   1 
ATOM   1569 N NH2   . ARG A 1 194 ? -38.812 1.973   47.117 1.00 79.57  ? 713 ARG A NH2   1 
ATOM   1570 N N     . ILE A 1 195 ? -36.174 -5.593  50.676 1.00 80.49  ? 714 ILE A N     1 
ATOM   1571 C CA    . ILE A 1 195 ? -35.722 -6.948  51.029 1.00 82.61  ? 714 ILE A CA    1 
ATOM   1572 C C     . ILE A 1 195 ? -36.036 -7.291  52.489 1.00 84.02  ? 714 ILE A C     1 
ATOM   1573 O O     . ILE A 1 195 ? -37.064 -7.901  52.798 1.00 84.09  ? 714 ILE A O     1 
ATOM   1574 C CB    . ILE A 1 195 ? -34.190 -7.134  50.833 1.00 82.72  ? 714 ILE A CB    1 
ATOM   1575 C CG1   . ILE A 1 195 ? -33.780 -6.892  49.375 1.00 83.44  ? 714 ILE A CG1   1 
ATOM   1576 C CG2   . ILE A 1 195 ? -33.747 -8.524  51.298 1.00 82.11  ? 714 ILE A CG2   1 
ATOM   1577 C CD1   . ILE A 1 195 ? -32.282 -7.061  49.111 1.00 82.14  ? 714 ILE A CD1   1 
ATOM   1578 N N     . GLY A 1 196 ? -35.134 -6.875  53.377 1.00 85.86  ? 715 GLY A N     1 
ATOM   1579 C CA    . GLY A 1 196 ? -35.111 -7.307  54.768 1.00 87.46  ? 715 GLY A CA    1 
ATOM   1580 C C     . GLY A 1 196 ? -33.671 -7.425  55.233 1.00 88.97  ? 715 GLY A C     1 
ATOM   1581 O O     . GLY A 1 196 ? -33.202 -8.521  55.557 1.00 88.76  ? 715 GLY A O     1 
ATOM   1582 N N     . LYS A 1 197 ? -32.967 -6.292  55.245 1.00 90.22  ? 716 LYS A N     1 
ATOM   1583 C CA    . LYS A 1 197 ? -31.559 -6.229  55.659 1.00 91.43  ? 716 LYS A CA    1 
ATOM   1584 C C     . LYS A 1 197 ? -31.128 -4.788  55.995 1.00 92.17  ? 716 LYS A C     1 
ATOM   1585 O O     . LYS A 1 197 ? -31.919 -3.845  55.859 1.00 92.28  ? 716 LYS A O     1 
ATOM   1586 C CB    . LYS A 1 197 ? -30.663 -6.812  54.555 1.00 91.22  ? 716 LYS A CB    1 
ATOM   1587 C CG    . LYS A 1 197 ? -29.598 -7.792  55.035 1.00 91.20  ? 716 LYS A CG    1 
ATOM   1588 C CD    . LYS A 1 197 ? -28.787 -8.360  53.880 1.00 89.75  ? 716 LYS A CD    1 
ATOM   1589 C CE    . LYS A 1 197 ? -29.482 -9.568  53.266 1.00 89.83  ? 716 LYS A CE    1 
ATOM   1590 N NZ    . LYS A 1 197 ? -28.842 -9.964  51.983 1.00 90.29  ? 716 LYS A NZ    1 
ATOM   1591 N N     . LYS A 1 198 ? -29.895 -4.636  56.484 1.00 92.57  ? 717 LYS A N     1 
ATOM   1592 C CA    . LYS A 1 198 ? -29.179 -3.351  56.497 1.00 92.95  ? 717 LYS A CA    1 
ATOM   1593 C C     . LYS A 1 198 ? -27.745 -3.516  57.023 1.00 93.46  ? 717 LYS A C     1 
ATOM   1594 O O     . LYS A 1 198 ? -27.384 -4.585  57.531 1.00 93.65  ? 717 LYS A O     1 
ATOM   1595 C CB    . LYS A 1 198 ? -29.939 -2.300  57.305 1.00 92.85  ? 717 LYS A CB    1 
ATOM   1596 N N     . ASN A 1 199 ? -26.921 -2.479  56.878 1.00 93.48  ? 718 ASN A N     1 
ATOM   1597 C CA    . ASN A 1 199 ? -25.509 -2.570  57.267 1.00 93.61  ? 718 ASN A CA    1 
ATOM   1598 C C     . ASN A 1 199 ? -25.122 -1.698  58.472 1.00 93.70  ? 718 ASN A C     1 
ATOM   1599 O O     . ASN A 1 199 ? -25.933 -0.930  58.999 1.00 93.60  ? 718 ASN A O     1 
ATOM   1600 C CB    . ASN A 1 199 ? -24.592 -2.304  56.071 1.00 93.16  ? 718 ASN A CB    1 
ATOM   1601 N N     . SER A 1 200 ? -23.885 -1.859  58.928 1.00 93.44  ? 719 SER A N     1 
ATOM   1602 C CA    . SER A 1 200 ? -23.420 -1.192  60.134 1.00 93.60  ? 719 SER A CA    1 
ATOM   1603 C C     . SER A 1 200 ? -21.932 -1.464  60.336 1.00 93.85  ? 719 SER A C     1 
ATOM   1604 O O     . SER A 1 200 ? -21.093 -0.996  59.559 1.00 94.08  ? 719 SER A O     1 
ATOM   1605 C CB    . SER A 1 200 ? -24.231 -1.651  61.346 1.00 93.27  ? 719 SER A CB    1 
HETATM 1606 P P     . CMP B 2 .   ? -26.240 -4.788  44.749 1.00 44.08  ? 801 CMP A P     1 
HETATM 1607 O O1P   . CMP B 2 .   ? -26.326 -5.378  46.141 1.00 44.47  ? 801 CMP A O1P   1 
HETATM 1608 O O2P   . CMP B 2 .   ? -24.834 -4.343  44.409 1.00 44.46  ? 801 CMP A O2P   1 
HETATM 1609 O "O5'" . CMP B 2 .   ? -26.739 -5.851  43.651 1.00 40.00  ? 801 CMP A "O5'" 1 
HETATM 1610 C "C5'" . CMP B 2 .   ? -28.117 -6.042  43.358 1.00 38.15  ? 801 CMP A "C5'" 1 
HETATM 1611 C "C4'" . CMP B 2 .   ? -28.653 -4.639  43.159 1.00 41.17  ? 801 CMP A "C4'" 1 
HETATM 1612 O "O4'" . CMP B 2 .   ? -30.032 -4.622  42.836 1.00 41.10  ? 801 CMP A "O4'" 1 
HETATM 1613 C "C3'" . CMP B 2 .   ? -28.598 -3.879  44.465 1.00 43.51  ? 801 CMP A "C3'" 1 
HETATM 1614 O "O3'" . CMP B 2 .   ? -27.245 -3.532  44.675 1.00 43.40  ? 801 CMP A "O3'" 1 
HETATM 1615 C "C2'" . CMP B 2 .   ? -29.537 -2.722  44.214 1.00 41.72  ? 801 CMP A "C2'" 1 
HETATM 1616 O "O2'" . CMP B 2 .   ? -28.835 -1.676  43.542 1.00 41.81  ? 801 CMP A "O2'" 1 
HETATM 1617 C "C1'" . CMP B 2 .   ? -30.539 -3.366  43.267 1.00 41.52  ? 801 CMP A "C1'" 1 
HETATM 1618 N N9    . CMP B 2 .   ? -31.760 -3.672  44.025 1.00 41.98  ? 801 CMP A N9    1 
HETATM 1619 C C8    . CMP B 2 .   ? -31.865 -4.556  45.025 1.00 45.43  ? 801 CMP A C8    1 
HETATM 1620 N N7    . CMP B 2 .   ? -33.133 -4.589  45.502 1.00 49.30  ? 801 CMP A N7    1 
HETATM 1621 C C5    . CMP B 2 .   ? -33.859 -3.711  44.782 1.00 47.48  ? 801 CMP A C5    1 
HETATM 1622 C C6    . CMP B 2 .   ? -35.270 -3.247  44.762 1.00 51.45  ? 801 CMP A C6    1 
HETATM 1623 N N6    . CMP B 2 .   ? -36.178 -3.759  45.630 1.00 55.51  ? 801 CMP A N6    1 
HETATM 1624 N N1    . CMP B 2 .   ? -35.613 -2.321  43.836 1.00 50.48  ? 801 CMP A N1    1 
HETATM 1625 C C2    . CMP B 2 .   ? -34.703 -1.844  42.958 1.00 52.36  ? 801 CMP A C2    1 
HETATM 1626 N N3    . CMP B 2 .   ? -33.409 -2.214  42.910 1.00 46.81  ? 801 CMP A N3    1 
HETATM 1627 C C4    . CMP B 2 .   ? -32.942 -3.120  43.794 1.00 43.65  ? 801 CMP A C4    1 
HETATM 1628 P P     . PO4 C 3 .   ? -2.040  9.561   20.782 1.00 105.91 ? 802 PO4 A P     1 
HETATM 1629 O O1    . PO4 C 3 .   ? -0.585  9.135   20.773 1.00 105.62 ? 802 PO4 A O1    1 
HETATM 1630 O O2    . PO4 C 3 .   ? -2.514  9.690   19.354 1.00 106.54 ? 802 PO4 A O2    1 
HETATM 1631 O O3    . PO4 C 3 .   ? -2.883  8.541   21.521 1.00 104.77 ? 802 PO4 A O3    1 
HETATM 1632 O O4    . PO4 C 3 .   ? -2.170  10.911  21.453 1.00 107.40 ? 802 PO4 A O4    1 
HETATM 1633 O O     . HOH D 4 .   ? -16.357 21.771  29.608 1.00 31.10  ? 901 HOH A O     1 
HETATM 1634 O O     . HOH D 4 .   ? -25.159 -12.259 25.636 1.00 21.52  ? 902 HOH A O     1 
HETATM 1635 O O     . HOH D 4 .   ? -31.015 -15.751 30.721 1.00 40.77  ? 903 HOH A O     1 
HETATM 1636 O O     . HOH D 4 .   ? -29.067 -16.593 29.051 1.00 45.88  ? 904 HOH A O     1 
HETATM 1637 O O     . HOH D 4 .   ? -11.395 10.501  33.967 1.00 31.85  ? 905 HOH A O     1 
HETATM 1638 O O     . HOH D 4 .   ? -27.865 13.562  49.181 1.00 36.25  ? 906 HOH A O     1 
HETATM 1639 O O     . HOH D 4 .   ? -28.352 -13.126 19.582 1.00 53.46  ? 907 HOH A O     1 
HETATM 1640 O O     . HOH D 4 .   ? -32.071 8.696   40.586 1.00 31.05  ? 908 HOH A O     1 
HETATM 1641 O O     . HOH D 4 .   ? -35.178 6.023   24.134 1.00 39.27  ? 909 HOH A O     1 
HETATM 1642 O O     . HOH D 4 .   ? -31.649 -1.468  22.212 1.00 82.26  ? 910 HOH A O     1 
HETATM 1643 O O     . HOH D 4 .   ? -31.518 -1.926  18.205 1.00 52.65  ? 911 HOH A O     1 
HETATM 1644 O O     . HOH D 4 .   ? -37.123 1.081   21.434 1.00 44.20  ? 912 HOH A O     1 
HETATM 1645 O O     . HOH D 4 .   ? -26.657 13.543  22.925 1.00 30.33  ? 913 HOH A O     1 
HETATM 1646 O O     . HOH D 4 .   ? -37.276 15.737  40.441 1.00 48.95  ? 914 HOH A O     1 
HETATM 1647 O O     . HOH D 4 .   ? -36.331 18.847  39.174 1.00 38.03  ? 915 HOH A O     1 
HETATM 1648 O O     . HOH D 4 .   ? -19.513 24.025  42.749 1.00 41.51  ? 916 HOH A O     1 
HETATM 1649 O O     . HOH D 4 .   ? -19.148 10.191  25.854 1.00 46.38  ? 917 HOH A O     1 
HETATM 1650 O O     . HOH D 4 .   ? -10.924 1.590   28.064 1.00 44.96  ? 918 HOH A O     1 
HETATM 1651 O O     . HOH D 4 .   ? -11.588 5.991   26.423 1.00 51.17  ? 919 HOH A O     1 
HETATM 1652 O O     . HOH D 4 .   ? -12.561 -1.056  31.786 1.00 29.35  ? 920 HOH A O     1 
HETATM 1653 O O     . HOH D 4 .   ? -23.974 -8.851  8.402  1.00 41.60  ? 921 HOH A O     1 
HETATM 1654 O O     . HOH D 4 .   ? -27.459 -7.615  8.604  1.00 49.13  ? 922 HOH A O     1 
HETATM 1655 O O     . HOH D 4 .   ? -27.659 4.520   19.242 1.00 58.91  ? 923 HOH A O     1 
HETATM 1656 O O     . HOH D 4 .   ? -24.860 5.231   11.334 1.00 41.91  ? 924 HOH A O     1 
HETATM 1657 O O     . HOH D 4 .   ? -29.455 15.052  43.318 1.00 34.90  ? 925 HOH A O     1 
HETATM 1658 O O     . HOH D 4 .   ? -27.937 17.267  46.238 1.00 40.25  ? 926 HOH A O     1 
HETATM 1659 O O     . HOH D 4 .   ? -25.399 -23.016 21.418 1.00 41.96  ? 927 HOH A O     1 
HETATM 1660 O O     . HOH D 4 .   ? -16.389 18.286  37.494 1.00 38.34  ? 928 HOH A O     1 
HETATM 1661 O O     . HOH D 4 .   ? -12.280 13.195  40.928 1.00 30.84  ? 929 HOH A O     1 
HETATM 1662 O O     . HOH D 4 .   ? -11.945 14.634  37.976 1.00 30.64  ? 930 HOH A O     1 
HETATM 1663 O O     . HOH D 4 .   ? -18.558 20.573  35.361 1.00 45.29  ? 931 HOH A O     1 
HETATM 1664 O O     . HOH D 4 .   ? -18.680 20.544  29.976 1.00 31.64  ? 932 HOH A O     1 
HETATM 1665 O O     . HOH D 4 .   ? -22.859 21.342  32.493 1.00 27.63  ? 933 HOH A O     1 
HETATM 1666 O O     . HOH D 4 .   ? -25.385 20.276  29.246 1.00 26.37  ? 934 HOH A O     1 
HETATM 1667 O O     . HOH D 4 .   ? -29.301 17.450  30.130 1.00 14.57  ? 935 HOH A O     1 
HETATM 1668 O O     . HOH D 4 .   ? -26.659 18.129  30.473 1.00 25.70  ? 936 HOH A O     1 
HETATM 1669 O O     . HOH D 4 .   ? -22.786 18.059  33.777 1.00 29.39  ? 937 HOH A O     1 
HETATM 1670 O O     . HOH D 4 .   ? -15.491 3.547   36.732 1.00 31.70  ? 938 HOH A O     1 
HETATM 1671 O O     . HOH D 4 .   ? -16.646 4.993   27.627 1.00 47.20  ? 939 HOH A O     1 
HETATM 1672 O O     . HOH D 4 .   ? -23.581 -9.551  26.470 1.00 45.47  ? 940 HOH A O     1 
HETATM 1673 O O     . HOH D 4 .   ? -18.166 -6.925  39.536 1.00 40.10  ? 941 HOH A O     1 
HETATM 1674 O O     . HOH D 4 .   ? -20.654 -8.754  40.141 1.00 31.91  ? 942 HOH A O     1 
HETATM 1675 O O     . HOH D 4 .   ? -14.864 -4.488  37.478 1.00 49.70  ? 943 HOH A O     1 
HETATM 1676 O O     . HOH D 4 .   ? -11.649 -3.851  51.246 1.00 53.51  ? 944 HOH A O     1 
HETATM 1677 O O     . HOH D 4 .   ? -8.742  -4.039  52.030 1.00 43.71  ? 945 HOH A O     1 
HETATM 1678 O O     . HOH D 4 .   ? -11.520 -1.528  47.177 1.00 46.58  ? 946 HOH A O     1 
HETATM 1679 O O     . HOH D 4 .   ? -9.970  -1.773  43.324 1.00 42.09  ? 947 HOH A O     1 
HETATM 1680 O O     . HOH D 4 .   ? -37.509 -0.701  43.723 1.00 60.69  ? 948 HOH A O     1 
HETATM 1681 O O     . HOH D 4 .   ? -4.657  14.485  29.108 1.00 32.81  ? 949 HOH A O     1 
HETATM 1682 O O     . HOH D 4 .   ? -18.702 -15.009 11.119 1.00 51.24  ? 950 HOH A O     1 
HETATM 1683 O O     . HOH D 4 .   ? -31.096 6.936   26.707 1.00 66.66  ? 951 HOH A O     1 
HETATM 1684 O O     . HOH D 4 .   ? -28.124 -1.226  21.379 1.00 53.31  ? 952 HOH A O     1 
HETATM 1685 O O     . HOH D 4 .   ? -36.954 2.838   35.925 1.00 32.27  ? 953 HOH A O     1 
HETATM 1686 O O     . HOH D 4 .   ? -6.321  11.595  40.438 1.00 31.78  ? 954 HOH A O     1 
HETATM 1687 O O     . HOH D 4 .   ? -21.098 2.760   53.314 1.00 57.43  ? 955 HOH A O     1 
HETATM 1688 O O     . HOH D 4 .   ? -19.357 8.129   26.808 1.00 35.17  ? 956 HOH A O     1 
HETATM 1689 O O     . HOH D 4 .   ? -37.334 2.880   38.314 1.00 31.05  ? 957 HOH A O     1 
HETATM 1690 O O     . HOH D 4 .   ? -28.704 -7.386  57.206 1.00 46.18  ? 958 HOH A O     1 
HETATM 1691 O O     . HOH D 4 .   ? -25.818 -7.025  57.323 1.00 61.12  ? 959 HOH A O     1 
HETATM 1692 O O     . HOH D 4 .   ? -22.473 -5.552  59.202 1.00 41.34  ? 960 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   520 520 SER SER A . n 
A 1 2   ASP 2   521 521 ASP ASP A . n 
A 1 3   SER 3   522 522 SER SER A . n 
A 1 4   SER 4   523 523 SER SER A . n 
A 1 5   ARG 5   524 524 ARG ARG A . n 
A 1 6   ARG 6   525 525 ARG ARG A . n 
A 1 7   GLN 7   526 526 GLN GLN A . n 
A 1 8   TYR 8   527 527 TYR TYR A . n 
A 1 9   GLN 9   528 528 GLN GLN A . n 
A 1 10  GLU 10  529 529 GLU GLU A . n 
A 1 11  LYS 11  530 530 LYS LYS A . n 
A 1 12  TYR 12  531 531 TYR TYR A . n 
A 1 13  LYS 13  532 532 LYS LYS A . n 
A 1 14  GLN 14  533 533 GLN GLN A . n 
A 1 15  VAL 15  534 534 VAL VAL A . n 
A 1 16  GLU 16  535 535 GLU GLU A . n 
A 1 17  GLN 17  536 536 GLN GLN A . n 
A 1 18  TYR 18  537 537 TYR TYR A . n 
A 1 19  MET 19  538 538 MET MET A . n 
A 1 20  SER 20  539 539 SER SER A . n 
A 1 21  PHE 21  540 540 PHE PHE A . n 
A 1 22  HIS 22  541 541 HIS HIS A . n 
A 1 23  LYS 23  542 542 LYS LYS A . n 
A 1 24  LEU 24  543 543 LEU LEU A . n 
A 1 25  PRO 25  544 544 PRO PRO A . n 
A 1 26  PRO 26  545 545 PRO PRO A . n 
A 1 27  ASP 27  546 546 ASP ASP A . n 
A 1 28  THR 28  547 547 THR THR A . n 
A 1 29  ARG 29  548 548 ARG ARG A . n 
A 1 30  GLN 30  549 549 GLN GLN A . n 
A 1 31  ARG 31  550 550 ARG ARG A . n 
A 1 32  ILE 32  551 551 ILE ILE A . n 
A 1 33  HIS 33  552 552 HIS HIS A . n 
A 1 34  ASP 34  553 553 ASP ASP A . n 
A 1 35  TYR 35  554 554 TYR TYR A . n 
A 1 36  TYR 36  555 555 TYR TYR A . n 
A 1 37  GLU 37  556 556 GLU GLU A . n 
A 1 38  HIS 38  557 557 HIS HIS A . n 
A 1 39  ARG 39  558 558 ARG ARG A . n 
A 1 40  TYR 40  559 559 TYR TYR A . n 
A 1 41  GLN 41  560 560 GLN GLN A . n 
A 1 42  GLY 42  561 561 GLY GLY A . n 
A 1 43  LYS 43  562 562 LYS LYS A . n 
A 1 44  MET 44  563 563 MET MET A . n 
A 1 45  PHE 45  564 564 PHE PHE A . n 
A 1 46  ASP 46  565 565 ASP ASP A . n 
A 1 47  GLU 47  566 566 GLU GLU A . n 
A 1 48  GLU 48  567 567 GLU GLU A . n 
A 1 49  SER 49  568 568 SER SER A . n 
A 1 50  ILE 50  569 569 ILE ILE A . n 
A 1 51  LEU 51  570 570 LEU LEU A . n 
A 1 52  GLY 52  571 571 GLY GLY A . n 
A 1 53  GLU 53  572 572 GLU GLU A . n 
A 1 54  LEU 54  573 573 LEU LEU A . n 
A 1 55  SER 55  574 574 SER SER A . n 
A 1 56  GLU 56  575 575 GLU GLU A . n 
A 1 57  PRO 57  576 576 PRO PRO A . n 
A 1 58  LEU 58  577 577 LEU LEU A . n 
A 1 59  ARG 59  578 578 ARG ARG A . n 
A 1 60  GLU 60  579 579 GLU GLU A . n 
A 1 61  GLU 61  580 580 GLU GLU A . n 
A 1 62  ILE 62  581 581 ILE ILE A . n 
A 1 63  ILE 63  582 582 ILE ILE A . n 
A 1 64  ASN 64  583 583 ASN ASN A . n 
A 1 65  PHE 65  584 584 PHE PHE A . n 
A 1 66  ASN 66  585 585 ASN ASN A . n 
A 1 67  CYS 67  586 586 CYS CYS A . n 
A 1 68  ARG 68  587 587 ARG ARG A . n 
A 1 69  LYS 69  588 588 LYS LYS A . n 
A 1 70  LEU 70  589 589 LEU LEU A . n 
A 1 71  VAL 71  590 590 VAL VAL A . n 
A 1 72  ALA 72  591 591 ALA ALA A . n 
A 1 73  SER 73  592 592 SER SER A . n 
A 1 74  MET 74  593 593 MET MET A . n 
A 1 75  PRO 75  594 594 PRO PRO A . n 
A 1 76  LEU 76  595 595 LEU LEU A . n 
A 1 77  PHE 77  596 596 PHE PHE A . n 
A 1 78  ALA 78  597 597 ALA ALA A . n 
A 1 79  ASN 79  598 598 ASN ASN A . n 
A 1 80  ALA 80  599 599 ALA ALA A . n 
A 1 81  ASP 81  600 600 ASP ASP A . n 
A 1 82  PRO 82  601 601 PRO PRO A . n 
A 1 83  ASN 83  602 602 ASN ASN A . n 
A 1 84  PHE 84  603 603 PHE PHE A . n 
A 1 85  VAL 85  604 604 VAL VAL A . n 
A 1 86  THR 86  605 605 THR THR A . n 
A 1 87  SER 87  606 606 SER SER A . n 
A 1 88  MET 88  607 607 MET MET A . n 
A 1 89  LEU 89  608 608 LEU LEU A . n 
A 1 90  THR 90  609 609 THR THR A . n 
A 1 91  LYS 91  610 610 LYS LYS A . n 
A 1 92  LEU 92  611 611 LEU LEU A . n 
A 1 93  ARG 93  612 612 ARG ARG A . n 
A 1 94  PHE 94  613 613 PHE PHE A . n 
A 1 95  GLU 95  614 614 GLU GLU A . n 
A 1 96  VAL 96  615 615 VAL VAL A . n 
A 1 97  PHE 97  616 616 PHE PHE A . n 
A 1 98  GLN 98  617 617 GLN GLN A . n 
A 1 99  PRO 99  618 618 PRO PRO A . n 
A 1 100 GLY 100 619 619 GLY GLY A . n 
A 1 101 ASP 101 620 620 ASP ASP A . n 
A 1 102 TYR 102 621 621 TYR TYR A . n 
A 1 103 ILE 103 622 622 ILE ILE A . n 
A 1 104 ILE 104 623 623 ILE ILE A . n 
A 1 105 ARG 105 624 624 ARG ARG A . n 
A 1 106 GLU 106 625 625 GLU GLU A . n 
A 1 107 GLY 107 626 626 GLY GLY A . n 
A 1 108 THR 108 627 627 THR THR A . n 
A 1 109 ILE 109 628 628 ILE ILE A . n 
A 1 110 GLY 110 629 629 GLY GLY A . n 
A 1 111 LYS 111 630 630 LYS LYS A . n 
A 1 112 LYS 112 631 631 LYS LYS A . n 
A 1 113 MET 113 632 632 MET MET A . n 
A 1 114 TYR 114 633 633 TYR TYR A . n 
A 1 115 PHE 115 634 634 PHE PHE A . n 
A 1 116 ILE 116 635 635 ILE ILE A . n 
A 1 117 GLN 117 636 636 GLN GLN A . n 
A 1 118 HIS 118 637 637 HIS HIS A . n 
A 1 119 GLY 119 638 638 GLY GLY A . n 
A 1 120 VAL 120 639 639 VAL VAL A . n 
A 1 121 VAL 121 640 640 VAL VAL A . n 
A 1 122 SER 122 641 641 SER SER A . n 
A 1 123 VAL 123 642 642 VAL VAL A . n 
A 1 124 LEU 124 643 643 LEU LEU A . n 
A 1 125 THR 125 644 644 THR LYS A . n 
A 1 126 LYS 126 645 ?   ?   ?   A . n 
A 1 127 GLY 127 646 646 GLY GLY A . n 
A 1 128 ASN 128 647 647 ASN ASN A . n 
A 1 129 LYS 129 648 648 LYS LYS A . n 
A 1 130 GLU 130 649 649 GLU GLU A . n 
A 1 131 THR 131 650 650 THR THR A . n 
A 1 132 LYS 132 651 651 LYS LYS A . n 
A 1 133 LEU 133 652 652 LEU LEU A . n 
A 1 134 ALA 134 653 653 ALA ALA A . n 
A 1 135 ASP 135 654 654 ASP ASP A . n 
A 1 136 GLY 136 655 655 GLY GLY A . n 
A 1 137 SER 137 656 656 SER SER A . n 
A 1 138 TYR 138 657 657 TYR TYR A . n 
A 1 139 PHE 139 658 658 PHE PHE A . n 
A 1 140 GLY 140 659 659 GLY GLY A . n 
A 1 141 GLU 141 660 660 GLU GLU A . n 
A 1 142 ILE 142 661 661 ILE ILE A . n 
A 1 143 CYS 143 662 662 CYS CYS A . n 
A 1 144 LEU 144 663 663 LEU LEU A . n 
A 1 145 LEU 145 664 664 LEU LEU A . n 
A 1 146 THR 146 665 665 THR THR A . n 
A 1 147 ARG 147 666 666 ARG ARG A . n 
A 1 148 GLY 148 667 667 GLY GLY A . n 
A 1 149 ARG 149 668 668 ARG ARG A . n 
A 1 150 ARG 150 669 669 ARG ARG A . n 
A 1 151 THR 151 670 670 THR THR A . n 
A 1 152 ALA 152 671 671 ALA ALA A . n 
A 1 153 ARG 153 672 672 ARG ARG A . n 
A 1 154 VAL 154 673 673 VAL VAL A . n 
A 1 155 ARG 155 674 674 ARG ARG A . n 
A 1 156 ALA 156 675 675 ALA ALA A . n 
A 1 157 ASP 157 676 676 ASP ASP A . n 
A 1 158 THR 158 677 677 THR THR A . n 
A 1 159 TYR 159 678 678 TYR TYR A . n 
A 1 160 CYS 160 679 679 CYS CYS A . n 
A 1 161 ARG 161 680 680 ARG ARG A . n 
A 1 162 LEU 162 681 681 LEU LEU A . n 
A 1 163 TYR 163 682 682 TYR TYR A . n 
A 1 164 SER 164 683 683 SER SER A . n 
A 1 165 LEU 165 684 684 LEU LEU A . n 
A 1 166 SER 166 685 685 SER SER A . n 
A 1 167 VAL 167 686 686 VAL VAL A . n 
A 1 168 ASP 168 687 687 ASP ASP A . n 
A 1 169 ASN 169 688 688 ASN ASN A . n 
A 1 170 PHE 170 689 689 PHE PHE A . n 
A 1 171 ASN 171 690 690 ASN ASN A . n 
A 1 172 GLU 172 691 691 GLU GLU A . n 
A 1 173 VAL 173 692 692 VAL VAL A . n 
A 1 174 LEU 174 693 693 LEU LEU A . n 
A 1 175 GLU 175 694 694 GLU GLU A . n 
A 1 176 GLU 176 695 695 GLU GLU A . n 
A 1 177 TYR 177 696 696 TYR TYR A . n 
A 1 178 PRO 178 697 697 PRO PRO A . n 
A 1 179 MET 179 698 698 MET MET A . n 
A 1 180 MET 180 699 699 MET MET A . n 
A 1 181 ARG 181 700 700 ARG ARG A . n 
A 1 182 ARG 182 701 701 ARG ARG A . n 
A 1 183 ALA 183 702 702 ALA ALA A . n 
A 1 184 PHE 184 703 703 PHE PHE A . n 
A 1 185 GLU 185 704 704 GLU GLU A . n 
A 1 186 THR 186 705 705 THR THR A . n 
A 1 187 VAL 187 706 706 VAL VAL A . n 
A 1 188 ALA 188 707 707 ALA ALA A . n 
A 1 189 LEU 189 708 708 LEU LEU A . n 
A 1 190 ASP 190 709 709 ASP ASP A . n 
A 1 191 ARG 191 710 710 ARG ARG A . n 
A 1 192 LEU 192 711 711 LEU LEU A . n 
A 1 193 ASP 193 712 712 ASP ASP A . n 
A 1 194 ARG 194 713 713 ARG ARG A . n 
A 1 195 ILE 195 714 714 ILE ILE A . n 
A 1 196 GLY 196 715 715 GLY GLY A . n 
A 1 197 LYS 197 716 716 LYS LYS A . n 
A 1 198 LYS 198 717 717 LYS LYS A . n 
A 1 199 ASN 199 718 718 ASN ASN A . n 
A 1 200 SER 200 719 719 SER SER A . n 
A 1 201 ILE 201 720 ?   ?   ?   A . n 
A 1 202 LEU 202 721 ?   ?   ?   A . n 
A 1 203 LEU 203 722 ?   ?   ?   A . n 
A 1 204 HIS 204 723 ?   ?   ?   A . n 
A 1 205 LYS 205 724 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12630 ? 
1 MORE         -74   ? 
1 'SSA (A^2)'  38170 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-01-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
PHASES    phasing           .        ? 2 
REFMAC    refinement        5.5.0102 ? 3 
d*TREK    'data reduction'  .        ? 4 
d*TREK    'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    568 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O3 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   PO4 
_pdbx_validate_close_contact.auth_seq_id_2    802 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 522 ? ? -168.97 -37.32  
2 1 GLN A 560 ? ? 36.94   19.89   
3 1 ASP A 565 ? ? -72.62  40.38   
4 1 ASP A 620 ? ? -45.88  157.21  
5 1 ASN A 647 ? ? -100.11 -131.73 
6 1 ALA A 671 ? ? -167.89 -167.10 
7 1 TYR A 678 ? ? -59.63  92.75   
8 1 MET A 698 ? ? -37.55  -35.07  
9 1 ILE A 714 ? ? -91.20  -84.66  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 521 ? CG  ? A ASP 2   CG  
2  1 Y 1 A ASP 521 ? OD1 ? A ASP 2   OD1 
3  1 Y 1 A ASP 521 ? OD2 ? A ASP 2   OD2 
4  1 Y 1 A GLN 526 ? CG  ? A GLN 7   CG  
5  1 Y 1 A GLN 526 ? CD  ? A GLN 7   CD  
6  1 Y 1 A GLN 526 ? OE1 ? A GLN 7   OE1 
7  1 Y 1 A GLN 526 ? NE2 ? A GLN 7   NE2 
8  1 Y 1 A GLU 556 ? CG  ? A GLU 37  CG  
9  1 Y 1 A GLU 556 ? CD  ? A GLU 37  CD  
10 1 Y 1 A GLU 556 ? OE1 ? A GLU 37  OE1 
11 1 Y 1 A GLU 556 ? OE2 ? A GLU 37  OE2 
12 1 Y 1 A ARG 612 ? CG  ? A ARG 93  CG  
13 1 Y 1 A ARG 612 ? CD  ? A ARG 93  CD  
14 1 Y 1 A ARG 612 ? NE  ? A ARG 93  NE  
15 1 Y 1 A ARG 612 ? CZ  ? A ARG 93  CZ  
16 1 Y 1 A ARG 612 ? NH1 ? A ARG 93  NH1 
17 1 Y 1 A ARG 612 ? NH2 ? A ARG 93  NH2 
18 1 Y 1 A LYS 630 ? CG  ? A LYS 111 CG  
19 1 Y 1 A LYS 630 ? CD  ? A LYS 111 CD  
20 1 Y 1 A LYS 630 ? CE  ? A LYS 111 CE  
21 1 Y 1 A LYS 630 ? NZ  ? A LYS 111 NZ  
22 1 Y 1 A THR 644 ? OG1 ? A THR 125 OG1 
23 1 Y 1 A THR 644 ? CG2 ? A THR 125 CG2 
24 1 Y 1 A ASN 647 ? CG  ? A ASN 128 CG  
25 1 Y 1 A ASN 647 ? OD1 ? A ASN 128 OD1 
26 1 Y 1 A ASN 647 ? ND2 ? A ASN 128 ND2 
27 1 Y 1 A LYS 648 ? CG  ? A LYS 129 CG  
28 1 Y 1 A LYS 648 ? CD  ? A LYS 129 CD  
29 1 Y 1 A LYS 648 ? CE  ? A LYS 129 CE  
30 1 Y 1 A LYS 648 ? NZ  ? A LYS 129 NZ  
31 1 Y 1 A GLU 649 ? CG  ? A GLU 130 CG  
32 1 Y 1 A GLU 649 ? CD  ? A GLU 130 CD  
33 1 Y 1 A GLU 649 ? OE1 ? A GLU 130 OE1 
34 1 Y 1 A GLU 649 ? OE2 ? A GLU 130 OE2 
35 1 Y 1 A LYS 717 ? CG  ? A LYS 198 CG  
36 1 Y 1 A LYS 717 ? CD  ? A LYS 198 CD  
37 1 Y 1 A LYS 717 ? CE  ? A LYS 198 CE  
38 1 Y 1 A LYS 717 ? NZ  ? A LYS 198 NZ  
39 1 Y 1 A ASN 718 ? CG  ? A ASN 199 CG  
40 1 Y 1 A ASN 718 ? OD1 ? A ASN 199 OD1 
41 1 Y 1 A ASN 718 ? ND2 ? A ASN 199 ND2 
42 1 Y 1 A SER 719 ? OG  ? A SER 200 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 645 ? A LYS 126 
2 1 Y 1 A ILE 720 ? A ILE 201 
3 1 Y 1 A LEU 721 ? A LEU 202 
4 1 Y 1 A LEU 722 ? A LEU 203 
5 1 Y 1 A HIS 723 ? A HIS 204 
6 1 Y 1 A LYS 724 ? A LYS 205 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
3 'PHOSPHATE ION'                        PO4 
4 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CMP 1  801 201 CMP CMP A . 
C 3 PO4 1  802 1   PO4 PO4 A . 
D 4 HOH 1  901 1   HOH HOH A . 
D 4 HOH 2  902 2   HOH HOH A . 
D 4 HOH 3  903 3   HOH HOH A . 
D 4 HOH 4  904 4   HOH HOH A . 
D 4 HOH 5  905 5   HOH HOH A . 
D 4 HOH 6  906 6   HOH HOH A . 
D 4 HOH 7  907 7   HOH HOH A . 
D 4 HOH 8  908 8   HOH HOH A . 
D 4 HOH 9  909 9   HOH HOH A . 
D 4 HOH 10 910 10  HOH HOH A . 
D 4 HOH 11 911 11  HOH HOH A . 
D 4 HOH 12 912 12  HOH HOH A . 
D 4 HOH 13 913 13  HOH HOH A . 
D 4 HOH 14 914 14  HOH HOH A . 
D 4 HOH 15 915 15  HOH HOH A . 
D 4 HOH 16 916 16  HOH HOH A . 
D 4 HOH 17 917 17  HOH HOH A . 
D 4 HOH 18 918 18  HOH HOH A . 
D 4 HOH 19 919 19  HOH HOH A . 
D 4 HOH 20 920 20  HOH HOH A . 
D 4 HOH 21 921 21  HOH HOH A . 
D 4 HOH 22 922 22  HOH HOH A . 
D 4 HOH 23 923 23  HOH HOH A . 
D 4 HOH 24 924 24  HOH HOH A . 
D 4 HOH 25 925 25  HOH HOH A . 
D 4 HOH 26 926 26  HOH HOH A . 
D 4 HOH 27 927 27  HOH HOH A . 
D 4 HOH 28 928 28  HOH HOH A . 
D 4 HOH 29 929 29  HOH HOH A . 
D 4 HOH 30 930 30  HOH HOH A . 
D 4 HOH 31 931 31  HOH HOH A . 
D 4 HOH 32 932 32  HOH HOH A . 
D 4 HOH 33 933 33  HOH HOH A . 
D 4 HOH 34 934 34  HOH HOH A . 
D 4 HOH 35 935 35  HOH HOH A . 
D 4 HOH 36 936 36  HOH HOH A . 
D 4 HOH 37 937 37  HOH HOH A . 
D 4 HOH 38 938 38  HOH HOH A . 
D 4 HOH 39 939 39  HOH HOH A . 
D 4 HOH 40 940 40  HOH HOH A . 
D 4 HOH 41 941 41  HOH HOH A . 
D 4 HOH 42 942 42  HOH HOH A . 
D 4 HOH 43 943 43  HOH HOH A . 
D 4 HOH 44 944 44  HOH HOH A . 
D 4 HOH 45 945 45  HOH HOH A . 
D 4 HOH 46 946 46  HOH HOH A . 
D 4 HOH 47 947 47  HOH HOH A . 
D 4 HOH 48 948 48  HOH HOH A . 
D 4 HOH 49 949 49  HOH HOH A . 
D 4 HOH 50 950 50  HOH HOH A . 
D 4 HOH 51 951 51  HOH HOH A . 
D 4 HOH 52 952 52  HOH HOH A . 
D 4 HOH 53 953 53  HOH HOH A . 
D 4 HOH 54 954 54  HOH HOH A . 
D 4 HOH 55 955 55  HOH HOH A . 
D 4 HOH 56 956 56  HOH HOH A . 
D 4 HOH 57 957 57  HOH HOH A . 
D 4 HOH 58 958 58  HOH HOH A . 
D 4 HOH 59 959 59  HOH HOH A . 
D 4 HOH 60 960 60  HOH HOH A . 
#