data_4HFG
# 
_entry.id   4HFG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HFG         
RCSB  RCSB075399   
WWPDB D_1000075399 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2012-10-17 
_pdbx_database_PDB_obs_spr.pdb_id           4HFG 
_pdbx_database_PDB_obs_spr.replace_pdb_id   4FLD 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.entry_id                        4HFG 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-10-05 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ni, Z.'                               1  
'Xu, C.'                               2  
'Tempel, W.'                           3  
'El Bakkouri, M.'                      4  
'Loppnau, P.'                          5  
'Guo, X.'                              6  
'Bountra, C.'                          7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Min, J.'                              10 
'Greenblatt, J.F.'                     11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     'CID of human RPRD1B' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ni, Z.'           1  
primary 'Xu, C.'           2  
primary 'Tempel, W.'       3  
primary 'El Bakkouri, M.'  4  
primary 'Loppnau, P.'      5  
primary 'Guo, X.'          6  
primary 'Bountra, C.'      7  
primary 'Arrowsmith, C.H.' 8  
primary 'Edwards, A.M.'    9  
primary 'Min, J.'          10 
primary 'Greenblatt, J.F.' 11 
# 
_cell.entry_id           4HFG 
_cell.length_a           48.083 
_cell.length_b           48.492 
_cell.length_c           112.347 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4HFG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Regulation of nuclear pre-mRNA domain-containing protein 1B' 15560.666 2  ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                                                 96.063    6  ? ? ? ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                                         ?         10 ? ? ? ? 
4 water       nat water                                                         18.015    90 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cell cycle-related and expression-elevated protein in tumor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTRE
FESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTRE
FESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   PHE n 
1 5   SER n 
1 6   GLU n 
1 7   SER n 
1 8   ALA n 
1 9   LEU n 
1 10  GLU n 
1 11  LYS n 
1 12  LYS n 
1 13  LEU n 
1 14  SER n 
1 15  GLU n 
1 16  LEU n 
1 17  SER n 
1 18  ASN n 
1 19  SER n 
1 20  GLN n 
1 21  HIS n 
1 22  SER n 
1 23  VAL n 
1 24  GLN n 
1 25  THR n 
1 26  LEU n 
1 27  SER n 
1 28  LEU n 
1 29  TRP n 
1 30  LEU n 
1 31  ILE n 
1 32  HIS n 
1 33  HIS n 
1 34  ARG n 
1 35  LYS n 
1 36  HIS n 
1 37  ALA n 
1 38  GLY n 
1 39  PRO n 
1 40  ILE n 
1 41  VAL n 
1 42  SER n 
1 43  VAL n 
1 44  TRP n 
1 45  HIS n 
1 46  ARG n 
1 47  GLU n 
1 48  LEU n 
1 49  ARG n 
1 50  LYS n 
1 51  ALA n 
1 52  LYS n 
1 53  SER n 
1 54  ASN n 
1 55  ARG n 
1 56  LYS n 
1 57  LEU n 
1 58  THR n 
1 59  PHE n 
1 60  LEU n 
1 61  TYR n 
1 62  LEU n 
1 63  ALA n 
1 64  ASN n 
1 65  ASP n 
1 66  VAL n 
1 67  ILE n 
1 68  GLN n 
1 69  ASN n 
1 70  SER n 
1 71  LYS n 
1 72  ARG n 
1 73  LYS n 
1 74  GLY n 
1 75  PRO n 
1 76  GLU n 
1 77  PHE n 
1 78  THR n 
1 79  ARG n 
1 80  GLU n 
1 81  PHE n 
1 82  GLU n 
1 83  SER n 
1 84  VAL n 
1 85  LEU n 
1 86  VAL n 
1 87  ASP n 
1 88  ALA n 
1 89  PHE n 
1 90  SER n 
1 91  HIS n 
1 92  VAL n 
1 93  ALA n 
1 94  ARG n 
1 95  GLU n 
1 96  ALA n 
1 97  ASP n 
1 98  GLU n 
1 99  GLY n 
1 100 CYS n 
1 101 LYS n 
1 102 LYS n 
1 103 PRO n 
1 104 LEU n 
1 105 GLU n 
1 106 ARG n 
1 107 LEU n 
1 108 LEU n 
1 109 ASN n 
1 110 ILE n 
1 111 TRP n 
1 112 GLN n 
1 113 GLU n 
1 114 ARG n 
1 115 SER n 
1 116 VAL n 
1 117 TYR n 
1 118 GLY n 
1 119 GLY n 
1 120 GLU n 
1 121 PHE n 
1 122 ILE n 
1 123 GLN n 
1 124 GLN n 
1 125 LEU n 
1 126 LYS n 
1 127 LEU n 
1 128 SER n 
1 129 MET n 
1 130 GLU n 
1 131 ASP n 
1 132 SER n 
1 133 LYS n 
1 134 SER n 
1 135 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RPRD1B, C20orf77, CREPT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET15 MHL' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RPR1B_HUMAN 
_struct_ref.pdbx_db_accession          Q9NQG5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREF
ESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSP
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4HFG A 2 ? 135 ? Q9NQG5 2 ? 135 ? 2 135 
2 1 4HFG B 2 ? 135 ? Q9NQG5 2 ? 135 ? 2 135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4HFG GLY A 1  ? UNP Q9NQG5 ?   ?  'EXPRESSION TAG'      1  1 
1 4HFG HIS A 21 ? UNP Q9NQG5 GLN 21 'ENGINEERED MUTATION' 21 2 
2 4HFG GLY B 1  ? UNP Q9NQG5 ?   ?  'EXPRESSION TAG'      1  3 
2 4HFG HIS B 21 ? UNP Q9NQG5 GLN 21 'ENGINEERED MUTATION' 21 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'         ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4HFG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   43.3 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'30% PEG550MME, 0.1M ammounium sulfate, 0.1M sodium cacodylate, pH 6.5, vapor diffusion, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-07-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0441 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        1.0441 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     4HFG 
_reflns.d_resolution_high            2.000 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   18559 
_reflns.pdbx_Rmerge_I_obs            0.103 
_reflns.pdbx_netI_over_sigmaI        7.600 
_reflns.pdbx_chi_squared             1.473 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.000 2.030  ? ? ? 0.885 ? ? 1.596 6.100 ? 889  97.600  1  1 
2.030 2.070  ? ? ? 0.764 ? ? 1.320 6.400 ? 888  99.300  2  1 
2.070 2.110  ? ? ? 0.694 ? ? 1.382 6.500 ? 917  98.900  3  1 
2.110 2.150  ? ? ? 0.613 ? ? 1.342 6.700 ? 895  99.800  4  1 
2.150 2.200  ? ? ? 0.541 ? ? 1.304 6.900 ? 933  100.000 5  1 
2.200 2.250  ? ? ? 0.456 ? ? 1.416 7.000 ? 886  100.000 6  1 
2.250 2.310  ? ? ? 0.418 ? ? 1.433 7.200 ? 935  100.000 7  1 
2.310 2.370  ? ? ? 0.383 ? ? 1.428 7.200 ? 896  100.000 8  1 
2.370 2.440  ? ? ? 0.301 ? ? 1.375 7.200 ? 943  100.000 9  1 
2.440 2.520  ? ? ? 0.237 ? ? 1.366 7.300 ? 911  100.000 10 1 
2.520 2.610  ? ? ? 0.205 ? ? 1.315 7.200 ? 907  100.000 11 1 
2.610 2.710  ? ? ? 0.166 ? ? 1.352 7.200 ? 929  100.000 12 1 
2.710 2.840  ? ? ? 0.145 ? ? 1.362 7.200 ? 930  100.000 13 1 
2.840 2.990  ? ? ? 0.115 ? ? 1.272 7.100 ? 919  100.000 14 1 
2.990 3.170  ? ? ? 0.092 ? ? 1.370 7.100 ? 933  100.000 15 1 
3.170 3.420  ? ? ? 0.080 ? ? 1.660 7.100 ? 939  100.000 16 1 
3.420 3.760  ? ? ? 0.067 ? ? 2.114 7.000 ? 942  100.000 17 1 
3.760 4.310  ? ? ? 0.055 ? ? 2.201 6.900 ? 951  100.000 18 1 
4.310 5.420  ? ? ? 0.040 ? ? 1.485 6.700 ? 976  100.000 19 1 
5.420 40.000 ? ? ? 0.032 ? ? 1.344 6.500 ? 1040 99.900  20 1 
# 
_refine.entry_id                                 4HFG 
_refine.ls_d_res_high                            2.0000 
_refine.ls_d_res_low                             36.7300 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.3000 
_refine.ls_number_reflns_obs                     18272 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'thin shells (SFTOOLS)' 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED. RESOLVE, BUCCANEER, DM, ARP/WARP, COOT, CHAINSAW AND MOLPROBITY SERVER WERE ALSO USED.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1888 
_refine.ls_R_factor_R_work                       0.1847 
_refine.ls_wR_factor_R_work                      0.1708 
_refine.ls_R_factor_R_free                       0.2576 
_refine.ls_wR_factor_R_free                      0.2407 
_refine.ls_percent_reflns_R_free                 5.7000 
_refine.ls_number_reflns_R_free                  1033 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               37.0332 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -1.0400 
_refine.aniso_B[2][2]                            3.3200 
_refine.aniso_B[3][3]                            -2.2800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9620 
_refine.correlation_coeff_Fo_to_Fc_free          0.9190 
_refine.overall_SU_R_Cruickshank_DPI             0.1928 
_refine.overall_SU_R_free                        0.1882 
_refine.pdbx_overall_ESU_R                       0.1930 
_refine.pdbx_overall_ESU_R_Free                  0.1880 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_B                             10.5330 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 4FLB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8192 
_refine.B_iso_max                                81.610 
_refine.B_iso_min                                17.880 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2053 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             90 
_refine_hist.number_atoms_total               2183 
_refine_hist.d_res_high                       2.0000 
_refine_hist.d_res_low                        36.7300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2142 0.014  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1999 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2900 1.407  1.949  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      4579 0.826  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 263  5.337  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 103  36.173 23.204 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 376  14.458 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 18   17.035 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         320  0.078  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2403 0.007  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     527  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0000 
_refine_ls_shell.d_res_low                        2.0520 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.9200 
_refine_ls_shell.number_reflns_R_work             1274 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2840 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4HFG 
_struct.title                     'CID of human RPRD1B' 
_struct.pdbx_descriptor           rprd1b-cid 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HFG 
_struct_keywords.text            'Structural Genomics Consortium, SGC, TRANSCRIPTION, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 5   ? GLU A 15  ? SER A 5   GLU A 15  1 ? 11 
HELX_P HELX_P2  2  ASN A 18  ? HIS A 21  ? ASN A 18  HIS A 21  5 ? 4  
HELX_P HELX_P3  3  SER A 22  ? HIS A 33  ? SER A 22  HIS A 33  1 ? 12 
HELX_P HELX_P4  4  HIS A 36  ? ALA A 51  ? HIS A 36  ALA A 51  1 ? 16 
HELX_P HELX_P5  5  LYS A 52  ? LYS A 71  ? LYS A 52  LYS A 71  1 ? 20 
HELX_P HELX_P6  6  PRO A 75  ? GLU A 82  ? PRO A 75  GLU A 82  1 ? 8  
HELX_P HELX_P7  7  VAL A 84  ? ALA A 96  ? VAL A 84  ALA A 96  1 ? 13 
HELX_P HELX_P8  8  CYS A 100 ? ARG A 114 ? CYS A 100 ARG A 114 1 ? 15 
HELX_P HELX_P9  9  GLY A 118 ? ASP A 131 ? GLY A 118 ASP A 131 1 ? 14 
HELX_P HELX_P10 10 SER B 5   ? GLU B 15  ? SER B 5   GLU B 15  1 ? 11 
HELX_P HELX_P11 11 ASN B 18  ? HIS B 21  ? ASN B 18  HIS B 21  5 ? 4  
HELX_P HELX_P12 12 SER B 22  ? HIS B 33  ? SER B 22  HIS B 33  1 ? 12 
HELX_P HELX_P13 13 HIS B 36  ? ALA B 51  ? HIS B 36  ALA B 51  1 ? 16 
HELX_P HELX_P14 14 ARG B 55  ? LYS B 71  ? ARG B 55  LYS B 71  1 ? 17 
HELX_P HELX_P15 15 PRO B 75  ? SER B 83  ? PRO B 75  SER B 83  1 ? 9  
HELX_P HELX_P16 16 VAL B 84  ? ALA B 96  ? VAL B 84  ALA B 96  1 ? 13 
HELX_P HELX_P17 17 CYS B 100 ? ARG B 114 ? CYS B 100 ARG B 114 1 ? 15 
HELX_P HELX_P18 18 GLY B 118 ? GLU B 130 ? GLY B 118 GLU B 130 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 201' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 202' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 203' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 201' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 B 202' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS A 32  ? HIS A 32  . ? 1_555 ? 
2  AC1 6  ARG A 34  ? ARG A 34  . ? 1_555 ? 
3  AC1 6  LYS A 73  ? LYS A 73  . ? 1_555 ? 
4  AC1 6  HOH S .   ? HOH A 334 . ? 1_555 ? 
5  AC1 6  ARG B 106 ? ARG B 106 . ? 1_555 ? 
6  AC1 6  HOH T .   ? HOH B 334 . ? 1_555 ? 
7  AC2 5  ARG A 72  ? ARG A 72  . ? 1_555 ? 
8  AC2 5  LYS A 73  ? LYS A 73  . ? 1_555 ? 
9  AC2 5  ARG B 106 ? ARG B 106 . ? 1_555 ? 
10 AC2 5  ASN B 109 ? ASN B 109 . ? 1_555 ? 
11 AC2 5  HOH T .   ? HOH B 343 . ? 1_555 ? 
12 AC3 4  ARG A 106 ? ARG A 106 . ? 1_555 ? 
13 AC3 4  ASN A 109 ? ASN A 109 . ? 1_555 ? 
14 AC3 4  ARG B 72  ? ARG B 72  . ? 1_555 ? 
15 AC3 4  LYS B 73  ? LYS B 73  . ? 1_555 ? 
16 AC4 4  ARG A 106 ? ARG A 106 . ? 1_555 ? 
17 AC4 4  HIS B 32  ? HIS B 32  . ? 1_555 ? 
18 AC4 4  ARG B 34  ? ARG B 34  . ? 1_555 ? 
19 AC4 4  LYS B 73  ? LYS B 73  . ? 1_555 ? 
20 AC5 10 SER A 17  ? SER A 17  . ? 1_555 ? 
21 AC5 10 SER A 22  ? SER A 22  . ? 1_555 ? 
22 AC5 10 VAL A 23  ? VAL A 23  . ? 1_555 ? 
23 AC5 10 SER B 17  ? SER B 17  . ? 1_555 ? 
24 AC5 10 SER B 22  ? SER B 22  . ? 1_555 ? 
25 AC5 10 VAL B 23  ? VAL B 23  . ? 1_555 ? 
26 AC5 10 HOH T .   ? HOH B 301 . ? 1_555 ? 
27 AC5 10 HOH T .   ? HOH B 308 . ? 1_555 ? 
28 AC5 10 HOH T .   ? HOH B 309 . ? 1_555 ? 
29 AC5 10 HOH T .   ? HOH B 335 . ? 1_555 ? 
30 AC6 2  LYS A 12  ? LYS A 12  . ? 3_545 ? 
31 AC6 2  ASN B 54  ? ASN B 54  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4HFG 
_atom_sites.fract_transf_matrix[1][1]   0.020797 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020622 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008901 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 3   ? 9.962   60.305 31.880 1.00 62.33 ? 3   SER A N   1 
ATOM   2    C CA  . SER A 1 3   ? 11.229  59.785 32.473 1.00 62.82 ? 3   SER A CA  1 
ATOM   3    C C   . SER A 1 3   ? 11.182  58.246 32.427 1.00 60.62 ? 3   SER A C   1 
ATOM   4    O O   . SER A 1 3   ? 10.109  57.633 32.391 1.00 59.38 ? 3   SER A O   1 
ATOM   5    C CB  . SER A 1 3   ? 11.442  60.327 33.902 1.00 64.17 ? 3   SER A CB  1 
ATOM   6    N N   . PHE A 1 4   ? 12.352  57.630 32.377 1.00 59.89 ? 4   PHE A N   1 
ATOM   7    C CA  . PHE A 1 4   ? 12.455  56.187 32.464 1.00 57.66 ? 4   PHE A CA  1 
ATOM   8    C C   . PHE A 1 4   ? 12.236  55.730 33.903 1.00 58.52 ? 4   PHE A C   1 
ATOM   9    O O   . PHE A 1 4   ? 12.611  56.419 34.842 1.00 59.59 ? 4   PHE A O   1 
ATOM   10   C CB  . PHE A 1 4   ? 13.839  55.731 31.980 1.00 57.50 ? 4   PHE A CB  1 
ATOM   11   C CG  . PHE A 1 4   ? 14.117  54.276 32.217 1.00 56.38 ? 4   PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 4   ? 13.643  53.314 31.339 1.00 53.88 ? 4   PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 4   ? 14.850  53.869 33.317 1.00 58.36 ? 4   PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 4   ? 13.887  51.971 31.561 1.00 53.22 ? 4   PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 4   ? 15.105  52.528 33.531 1.00 58.08 ? 4   PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 4   ? 14.610  51.577 32.654 1.00 55.10 ? 4   PHE A CZ  1 
ATOM   17   N N   . SER A 1 5   ? 11.600  54.575 34.075 1.00 56.69 ? 5   SER A N   1 
ATOM   18   C CA  . SER A 1 5   ? 11.698  53.867 35.353 1.00 57.45 ? 5   SER A CA  1 
ATOM   19   C C   . SER A 1 5   ? 11.531  52.387 35.074 1.00 55.34 ? 5   SER A C   1 
ATOM   20   O O   . SER A 1 5   ? 10.833  51.978 34.133 1.00 52.07 ? 5   SER A O   1 
ATOM   21   C CB  . SER A 1 5   ? 10.676  54.372 36.396 1.00 58.59 ? 5   SER A CB  1 
ATOM   22   O OG  . SER A 1 5   ? 9.373   53.877 36.121 1.00 57.59 ? 5   SER A OG  1 
ATOM   23   N N   . GLU A 1 6   ? 12.209  51.587 35.876 1.00 56.47 ? 6   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 12.116  50.139 35.744 1.00 55.68 ? 6   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 10.690  49.629 35.960 1.00 53.52 ? 6   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 10.265  48.728 35.265 1.00 52.61 ? 6   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 13.099  49.453 36.696 1.00 58.75 ? 6   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 14.539  49.766 36.326 1.00 60.49 ? 6   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 15.567  48.997 37.121 1.00 63.59 ? 6   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 15.259  47.908 37.645 1.00 64.22 ? 6   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 16.706  49.494 37.206 1.00 66.96 ? 6   GLU A OE2 1 
ATOM   32   N N   . SER A 1 7   ? 9.952   50.206 36.905 1.00 54.25 ? 7   SER A N   1 
ATOM   33   C CA  . SER A 1 7   ? 8.565   49.785 37.144 1.00 53.55 ? 7   SER A CA  1 
ATOM   34   C C   . SER A 1 7   ? 7.674   50.138 35.962 1.00 50.06 ? 7   SER A C   1 
ATOM   35   O O   . SER A 1 7   ? 6.824   49.348 35.578 1.00 49.03 ? 7   SER A O   1 
ATOM   36   C CB  . SER A 1 7   ? 8.015   50.395 38.429 1.00 55.90 ? 7   SER A CB  1 
ATOM   37   O OG  . SER A 1 7   ? 8.175   51.787 38.377 1.00 56.58 ? 7   SER A OG  1 
ATOM   38   N N   . ALA A 1 8   ? 7.889   51.297 35.347 1.00 48.54 ? 8   ALA A N   1 
ATOM   39   C CA  . ALA A 1 8   ? 7.185   51.613 34.106 1.00 45.60 ? 8   ALA A CA  1 
ATOM   40   C C   . ALA A 1 8   ? 7.514   50.608 32.996 1.00 43.33 ? 8   ALA A C   1 
ATOM   41   O O   . ALA A 1 8   ? 6.632   50.221 32.174 1.00 40.13 ? 8   ALA A O   1 
ATOM   42   C CB  . ALA A 1 8   ? 7.537   53.009 33.645 1.00 46.55 ? 8   ALA A CB  1 
ATOM   43   N N   . LEU A 1 9   ? 8.777   50.192 32.949 1.00 43.33 ? 9   LEU A N   1 
ATOM   44   C CA  . LEU A 1 9   ? 9.182   49.230 31.931 1.00 41.89 ? 9   LEU A CA  1 
ATOM   45   C C   . LEU A 1 9   ? 8.500   47.913 32.204 1.00 41.31 ? 9   LEU A C   1 
ATOM   46   O O   . LEU A 1 9   ? 7.977   47.315 31.303 1.00 40.06 ? 9   LEU A O   1 
ATOM   47   C CB  . LEU A 1 9   ? 10.703  49.049 31.892 1.00 43.13 ? 9   LEU A CB  1 
ATOM   48   C CG  . LEU A 1 9   ? 11.213  47.940 30.928 1.00 42.15 ? 9   LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 9   ? 10.672  48.127 29.513 1.00 40.20 ? 9   LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 9   ? 12.734  47.913 30.953 1.00 43.89 ? 9   LEU A CD2 1 
ATOM   51   N N   . GLU A 1 10  ? 8.495   47.477 33.457 1.00 43.86 ? 10  GLU A N   1 
ATOM   52   C CA  . GLU A 1 10  ? 7.869   46.186 33.818 1.00 45.30 ? 10  GLU A CA  1 
ATOM   53   C C   . GLU A 1 10  ? 6.389   46.196 33.443 1.00 43.82 ? 10  GLU A C   1 
ATOM   54   O O   . GLU A 1 10  ? 5.854   45.200 32.958 1.00 42.36 ? 10  GLU A O   1 
ATOM   55   C CB  . GLU A 1 10  ? 8.049   45.885 35.311 1.00 49.32 ? 10  GLU A CB  1 
ATOM   56   C CG  . GLU A 1 10  ? 9.449   45.362 35.662 1.00 52.22 ? 10  GLU A CG  1 
ATOM   57   C CD  . GLU A 1 10  ? 9.873   45.554 37.120 1.00 56.08 ? 10  GLU A CD  1 
ATOM   58   O OE1 . GLU A 1 10  ? 9.116   46.134 37.926 1.00 58.22 ? 10  GLU A OE1 1 
ATOM   59   O OE2 . GLU A 1 10  ? 10.999  45.134 37.465 1.00 58.83 ? 10  GLU A OE2 1 
ATOM   60   N N   . LYS A 1 11  ? 5.743   47.346 33.640 1.00 44.13 ? 11  LYS A N   1 
ATOM   61   C CA  . LYS A 1 11  ? 4.343   47.495 33.311 1.00 43.70 ? 11  LYS A CA  1 
ATOM   62   C C   . LYS A 1 11  ? 4.194   47.347 31.813 1.00 40.68 ? 11  LYS A C   1 
ATOM   63   O O   . LYS A 1 11  ? 3.439   46.500 31.335 1.00 40.25 ? 11  LYS A O   1 
ATOM   64   C CB  . LYS A 1 11  ? 3.798   48.837 33.815 1.00 45.05 ? 11  LYS A CB  1 
ATOM   65   C CG  . LYS A 1 11  ? 2.278   48.951 33.753 1.00 45.60 ? 11  LYS A CG  1 
ATOM   66   N N   . LYS A 1 12  ? 4.976   48.104 31.057 1.00 39.80 ? 12  LYS A N   1 
ATOM   67   C CA  . LYS A 1 12  ? 4.876   48.072 29.595 1.00 37.28 ? 12  LYS A CA  1 
ATOM   68   C C   . LYS A 1 12  ? 5.134   46.693 29.015 1.00 36.44 ? 12  LYS A C   1 
ATOM   69   O O   . LYS A 1 12  ? 4.440   46.266 28.097 1.00 35.41 ? 12  LYS A O   1 
ATOM   70   C CB  . LYS A 1 12  ? 5.826   49.067 28.980 1.00 36.84 ? 12  LYS A CB  1 
ATOM   71   C CG  . LYS A 1 12  ? 5.382   50.496 29.229 1.00 37.19 ? 12  LYS A CG  1 
ATOM   72   C CD  . LYS A 1 12  ? 6.567   51.426 29.226 1.00 37.80 ? 12  LYS A CD  1 
ATOM   73   C CE  . LYS A 1 12  ? 6.092   52.835 29.535 1.00 38.73 ? 12  LYS A CE  1 
ATOM   74   N NZ  . LYS A 1 12  ? 5.352   53.366 28.373 1.00 37.62 ? 12  LYS A NZ  1 
ATOM   75   N N   . LEU A 1 13  ? 6.132   45.992 29.565 1.00 36.52 ? 13  LEU A N   1 
ATOM   76   C CA  . LEU A 1 13  ? 6.431   44.646 29.111 1.00 35.70 ? 13  LEU A CA  1 
ATOM   77   C C   . LEU A 1 13  ? 5.282   43.676 29.377 1.00 36.96 ? 13  LEU A C   1 
ATOM   78   O O   . LEU A 1 13  ? 5.016   42.780 28.544 1.00 34.85 ? 13  LEU A O   1 
ATOM   79   C CB  . LEU A 1 13  ? 7.690   44.128 29.791 1.00 37.10 ? 13  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 13  ? 8.989   44.842 29.413 1.00 36.43 ? 13  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 13  ? 10.108  44.458 30.364 1.00 39.01 ? 13  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 13  ? 9.358   44.529 27.962 1.00 35.07 ? 13  LEU A CD2 1 
ATOM   83   N N   . SER A 1 14  ? 4.637   43.816 30.549 1.00 39.82 ? 14  SER A N   1 
ATOM   84   C CA  . SER A 1 14  ? 3.474   42.971 30.893 1.00 42.21 ? 14  SER A CA  1 
ATOM   85   C C   . SER A 1 14  ? 2.318   43.177 29.891 1.00 42.66 ? 14  SER A C   1 
ATOM   86   O O   . SER A 1 14  ? 1.518   42.279 29.688 1.00 43.86 ? 14  SER A O   1 
ATOM   87   C CB  . SER A 1 14  ? 2.994   43.227 32.325 1.00 44.99 ? 14  SER A CB  1 
ATOM   88   O OG  . SER A 1 14  ? 2.362   44.499 32.439 1.00 44.70 ? 14  SER A OG  1 
ATOM   89   N N   . GLU A 1 15  ? 2.282   44.327 29.213 1.00 42.01 ? 15  GLU A N   1 
ATOM   90   C CA  . GLU A 1 15  ? 1.186   44.644 28.309 1.00 41.53 ? 15  GLU A CA  1 
ATOM   91   C C   . GLU A 1 15  ? 1.399   44.172 26.878 1.00 38.52 ? 15  GLU A C   1 
ATOM   92   O O   . GLU A 1 15  ? 0.506   44.291 26.072 1.00 38.04 ? 15  GLU A O   1 
ATOM   93   C CB  . GLU A 1 15  ? 0.867   46.139 28.381 1.00 44.30 ? 15  GLU A CB  1 
ATOM   94   C CG  . GLU A 1 15  ? 0.132   46.509 29.669 1.00 50.41 ? 15  GLU A CG  1 
ATOM   95   C CD  . GLU A 1 15  ? 0.363   47.936 30.175 1.00 54.94 ? 15  GLU A CD  1 
ATOM   96   O OE1 . GLU A 1 15  ? 1.042   48.733 29.508 1.00 60.29 ? 15  GLU A OE1 1 
ATOM   97   O OE2 . GLU A 1 15  ? -0.143  48.267 31.278 1.00 63.69 ? 15  GLU A OE2 1 
ATOM   98   N N   . LEU A 1 16  ? 2.565   43.622 26.538 1.00 37.05 ? 16  LEU A N   1 
ATOM   99   C CA  . LEU A 1 16  ? 2.779   43.120 25.178 1.00 34.44 ? 16  LEU A CA  1 
ATOM   100  C C   . LEU A 1 16  ? 1.853   41.930 24.849 1.00 34.50 ? 16  LEU A C   1 
ATOM   101  O O   . LEU A 1 16  ? 1.471   41.175 25.737 1.00 33.18 ? 16  LEU A O   1 
ATOM   102  C CB  . LEU A 1 16  ? 4.220   42.667 25.002 1.00 34.24 ? 16  LEU A CB  1 
ATOM   103  C CG  . LEU A 1 16  ? 5.324   43.713 25.176 1.00 33.66 ? 16  LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 16  ? 6.700   43.062 25.138 1.00 34.04 ? 16  LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 16  ? 5.181   44.751 24.090 1.00 32.37 ? 16  LEU A CD2 1 
ATOM   106  N N   . SER A 1 17  ? 1.523   41.790 23.569 1.00 34.45 ? 17  SER A N   1 
ATOM   107  C CA  . SER A 1 17  ? 0.689   40.692 23.058 1.00 35.32 ? 17  SER A CA  1 
ATOM   108  C C   . SER A 1 17  ? 1.279   39.322 23.233 1.00 36.13 ? 17  SER A C   1 
ATOM   109  O O   . SER A 1 17  ? 2.507   39.143 23.160 1.00 35.32 ? 17  SER A O   1 
ATOM   110  C CB  . SER A 1 17  ? 0.530   40.776 21.556 1.00 35.00 ? 17  SER A CB  1 
ATOM   111  O OG  . SER A 1 17  ? 0.060   42.013 21.135 1.00 38.16 ? 17  SER A OG  1 
ATOM   112  N N   . ASN A 1 18  ? 0.391   38.341 23.365 1.00 35.82 ? 18  ASN A N   1 
ATOM   113  C CA  A ASN A 1 18  ? 0.730   36.941 23.178 0.50 37.80 ? 18  ASN A CA  1 
ATOM   114  C CA  B ASN A 1 18  ? 0.822   36.974 23.212 0.50 37.42 ? 18  ASN A CA  1 
ATOM   115  C C   . ASN A 1 18  ? 1.331   36.780 21.770 1.00 35.27 ? 18  ASN A C   1 
ATOM   116  O O   . ASN A 1 18  ? 0.881   37.439 20.838 1.00 31.45 ? 18  ASN A O   1 
ATOM   117  C CB  A ASN A 1 18  ? -0.521  36.030 23.304 0.50 39.77 ? 18  ASN A CB  1 
ATOM   118  C CB  B ASN A 1 18  ? -0.255  35.947 23.657 0.50 39.47 ? 18  ASN A CB  1 
ATOM   119  C CG  A ASN A 1 18  ? -1.340  36.288 24.575 0.50 42.66 ? 18  ASN A CG  1 
ATOM   120  C CG  B ASN A 1 18  ? -1.317  35.669 22.607 0.50 39.20 ? 18  ASN A CG  1 
ATOM   121  O OD1 A ASN A 1 18  ? -2.556  36.475 24.509 0.50 44.34 ? 18  ASN A OD1 1 
ATOM   122  O OD1 B ASN A 1 18  ? -1.034  35.457 21.440 0.50 38.10 ? 18  ASN A OD1 1 
ATOM   123  N ND2 A ASN A 1 18  ? -0.685  36.294 25.728 0.50 44.78 ? 18  ASN A ND2 1 
ATOM   124  N ND2 B ASN A 1 18  ? -2.556  35.586 23.056 0.50 41.98 ? 18  ASN A ND2 1 
ATOM   125  N N   . SER A 1 19  ? 2.310   35.890 21.626 1.00 36.22 ? 19  SER A N   1 
ATOM   126  C CA  . SER A 1 19  ? 3.006   35.631 20.318 1.00 36.18 ? 19  SER A CA  1 
ATOM   127  C C   . SER A 1 19  ? 2.059   35.411 19.127 1.00 34.38 ? 19  SER A C   1 
ATOM   128  O O   . SER A 1 19  ? 2.290   35.990 18.060 1.00 34.81 ? 19  SER A O   1 
ATOM   129  C CB  . SER A 1 19  ? 3.931   34.415 20.443 1.00 37.22 ? 19  SER A CB  1 
ATOM   130  O OG  . SER A 1 19  ? 4.639   34.445 21.674 1.00 42.37 ? 19  SER A OG  1 
ATOM   131  N N   . GLN A 1 20  ? 0.986   34.615 19.322 1.00 34.46 ? 20  GLN A N   1 
ATOM   132  C CA  . GLN A 1 20  ? 0.055   34.254 18.233 1.00 33.42 ? 20  GLN A CA  1 
ATOM   133  C C   . GLN A 1 20  ? -0.617  35.481 17.664 1.00 32.07 ? 20  GLN A C   1 
ATOM   134  O O   . GLN A 1 20  ? -0.870  35.529 16.483 1.00 31.02 ? 20  GLN A O   1 
ATOM   135  C CB  . GLN A 1 20  ? -1.019  33.245 18.702 1.00 35.41 ? 20  GLN A CB  1 
ATOM   136  N N   . HIS A 1 21  ? -0.896  36.478 18.492 1.00 32.98 ? 21  HIS A N   1 
ATOM   137  C CA  . HIS A 1 21  ? -1.621  37.685 18.043 1.00 35.66 ? 21  HIS A CA  1 
ATOM   138  C C   . HIS A 1 21  ? -0.782  38.905 17.811 1.00 33.47 ? 21  HIS A C   1 
ATOM   139  O O   . HIS A 1 21  ? -1.316  39.990 17.591 1.00 34.35 ? 21  HIS A O   1 
ATOM   140  C CB  . HIS A 1 21  ? -2.728  38.015 19.060 1.00 39.84 ? 21  HIS A CB  1 
ATOM   141  C CG  . HIS A 1 21  ? -3.697  36.886 19.252 1.00 43.49 ? 21  HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 21  ? -4.166  36.526 20.462 1.00 48.17 ? 21  HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 21  ? -4.237  35.985 18.337 1.00 45.27 ? 21  HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 21  ? -4.985  35.461 20.329 1.00 48.85 ? 21  HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 21  ? -5.028  35.130 19.033 1.00 48.36 ? 21  HIS A NE2 1 
ATOM   146  N N   . SER A 1 22  ? 0.538   38.759 17.839 1.00 31.90 ? 22  SER A N   1 
ATOM   147  C CA  . SER A 1 22  ? 1.431   39.917 17.614 1.00 30.13 ? 22  SER A CA  1 
ATOM   148  C C   . SER A 1 22  ? 1.421   40.376 16.148 1.00 28.22 ? 22  SER A C   1 
ATOM   149  O O   . SER A 1 22  ? 1.111   39.604 15.218 1.00 25.53 ? 22  SER A O   1 
ATOM   150  C CB  . SER A 1 22  ? 2.854   39.555 18.050 1.00 30.84 ? 22  SER A CB  1 
ATOM   151  O OG  . SER A 1 22  ? 3.413   38.563 17.198 1.00 30.33 ? 22  SER A OG  1 
ATOM   152  N N   . VAL A 1 23  ? 1.792   41.643 15.952 1.00 27.01 ? 23  VAL A N   1 
ATOM   153  C CA  . VAL A 1 23  ? 1.896   42.228 14.654 1.00 24.61 ? 23  VAL A CA  1 
ATOM   154  C C   . VAL A 1 23  ? 2.869   41.416 13.830 1.00 25.22 ? 23  VAL A C   1 
ATOM   155  O O   . VAL A 1 23  ? 2.634   41.192 12.652 1.00 22.18 ? 23  VAL A O   1 
ATOM   156  C CB  . VAL A 1 23  ? 2.360   43.704 14.731 1.00 25.15 ? 23  VAL A CB  1 
ATOM   157  C CG1 . VAL A 1 23  ? 2.994   44.177 13.458 1.00 23.59 ? 23  VAL A CG1 1 
ATOM   158  C CG2 . VAL A 1 23  ? 1.199   44.609 15.026 1.00 26.22 ? 23  VAL A CG2 1 
ATOM   159  N N   . GLN A 1 24  ? 3.973   41.016 14.441 1.00 24.78 ? 24  GLN A N   1 
ATOM   160  C CA  . GLN A 1 24  ? 4.973   40.265 13.752 1.00 27.36 ? 24  GLN A CA  1 
ATOM   161  C C   . GLN A 1 24  ? 4.471   38.888 13.312 1.00 26.55 ? 24  GLN A C   1 
ATOM   162  O O   . GLN A 1 24  ? 4.788   38.427 12.233 1.00 27.00 ? 24  GLN A O   1 
ATOM   163  C CB  . GLN A 1 24  ? 6.218   40.194 14.617 1.00 30.86 ? 24  GLN A CB  1 
ATOM   164  C CG  . GLN A 1 24  ? 7.374   39.406 14.021 1.00 36.93 ? 24  GLN A CG  1 
ATOM   165  C CD  . GLN A 1 24  ? 8.079   40.018 12.789 1.00 37.68 ? 24  GLN A CD  1 
ATOM   166  O OE1 . GLN A 1 24  ? 8.196   39.355 11.738 1.00 36.44 ? 24  GLN A OE1 1 
ATOM   167  N NE2 . GLN A 1 24  ? 8.566   41.260 12.930 1.00 37.78 ? 24  GLN A NE2 1 
ATOM   168  N N   . THR A 1 25  ? 3.708   38.211 14.152 1.00 26.56 ? 25  THR A N   1 
ATOM   169  C CA  . THR A 1 25  ? 3.180   36.919 13.747 1.00 25.03 ? 25  THR A CA  1 
ATOM   170  C C   . THR A 1 25  ? 2.203   37.047 12.566 1.00 23.61 ? 25  THR A C   1 
ATOM   171  O O   . THR A 1 25  ? 2.326   36.341 11.546 1.00 22.53 ? 25  THR A O   1 
ATOM   172  C CB  . THR A 1 25  ? 2.572   36.148 14.916 1.00 26.31 ? 25  THR A CB  1 
ATOM   173  O OG1 . THR A 1 25  ? 3.614   35.797 15.850 1.00 27.16 ? 25  THR A OG1 1 
ATOM   174  C CG2 . THR A 1 25  ? 1.932   34.815 14.428 1.00 27.37 ? 25  THR A CG2 1 
ATOM   175  N N   . LEU A 1 26  ? 1.266   37.963 12.672 1.00 23.37 ? 26  LEU A N   1 
ATOM   176  C CA  . LEU A 1 26  ? 0.401   38.262 11.550 1.00 22.88 ? 26  LEU A CA  1 
ATOM   177  C C   . LEU A 1 26  ? 1.186   38.574 10.281 1.00 22.85 ? 26  LEU A C   1 
ATOM   178  O O   . LEU A 1 26  ? 0.835   38.079 9.206  1.00 21.45 ? 26  LEU A O   1 
ATOM   179  C CB  . LEU A 1 26  ? -0.583  39.404 11.885 1.00 21.95 ? 26  LEU A CB  1 
ATOM   180  C CG  . LEU A 1 26  ? -1.636  39.696 10.813 1.00 21.75 ? 26  LEU A CG  1 
ATOM   181  C CD1 . LEU A 1 26  ? -2.266  38.381 10.301 1.00 22.71 ? 26  LEU A CD1 1 
ATOM   182  C CD2 . LEU A 1 26  ? -2.703  40.644 11.362 1.00 22.72 ? 26  LEU A CD2 1 
ATOM   183  N N   . SER A 1 27  ? 2.223   39.425 10.394 1.00 22.52 ? 27  SER A N   1 
ATOM   184  C CA  A SER A 1 27  ? 3.010   39.841 9.230  0.50 21.96 ? 27  SER A CA  1 
ATOM   185  C CA  B SER A 1 27  ? 3.023   39.841 9.235  0.50 22.59 ? 27  SER A CA  1 
ATOM   186  C C   . SER A 1 27  ? 3.654   38.653 8.520  1.00 22.33 ? 27  SER A C   1 
ATOM   187  O O   . SER A 1 27  ? 3.730   38.633 7.282  1.00 22.35 ? 27  SER A O   1 
ATOM   188  C CB  A SER A 1 27  ? 4.111   40.855 9.628  0.50 22.27 ? 27  SER A CB  1 
ATOM   189  C CB  B SER A 1 27  ? 4.129   40.854 9.648  0.50 23.60 ? 27  SER A CB  1 
ATOM   190  O OG  A SER A 1 27  ? 5.251   40.179 10.135 0.50 20.73 ? 27  SER A OG  1 
ATOM   191  O OG  B SER A 1 27  ? 5.144   40.957 8.652  0.50 23.05 ? 27  SER A OG  1 
ATOM   192  N N   . LEU A 1 28  ? 4.116   37.674 9.291  1.00 23.46 ? 28  LEU A N   1 
ATOM   193  C CA  . LEU A 1 28  ? 4.655   36.429 8.730  1.00 25.29 ? 28  LEU A CA  1 
ATOM   194  C C   . LEU A 1 28  ? 3.638   35.682 7.872  1.00 24.99 ? 28  LEU A C   1 
ATOM   195  O O   . LEU A 1 28  ? 3.975   35.138 6.812  1.00 23.52 ? 28  LEU A O   1 
ATOM   196  C CB  . LEU A 1 28  ? 5.128   35.460 9.828  1.00 27.72 ? 28  LEU A CB  1 
ATOM   197  C CG  . LEU A 1 28  ? 6.402   35.741 10.638 1.00 31.00 ? 28  LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 28  ? 6.790   34.487 11.408 1.00 33.95 ? 28  LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 28  ? 7.563   36.139 9.735  1.00 31.23 ? 28  LEU A CD2 1 
ATOM   200  N N   . TRP A 1 29  ? 2.405   35.595 8.370  1.00 24.46 ? 29  TRP A N   1 
ATOM   201  C CA  . TRP A 1 29  ? 1.373   34.833 7.674  1.00 22.55 ? 29  TRP A CA  1 
ATOM   202  C C   . TRP A 1 29  ? 1.010   35.568 6.407  1.00 20.83 ? 29  TRP A C   1 
ATOM   203  O O   . TRP A 1 29  ? 0.858   34.974 5.372  1.00 20.84 ? 29  TRP A O   1 
ATOM   204  C CB  . TRP A 1 29  ? 0.222   34.617 8.635  1.00 24.39 ? 29  TRP A CB  1 
ATOM   205  C CG  . TRP A 1 29  ? -0.934  33.849 8.127  1.00 23.72 ? 29  TRP A CG  1 
ATOM   206  C CD1 . TRP A 1 29  ? -1.054  32.466 8.014  1.00 25.26 ? 29  TRP A CD1 1 
ATOM   207  C CD2 . TRP A 1 29  ? -2.228  34.396 7.654  1.00 23.45 ? 29  TRP A CD2 1 
ATOM   208  N NE1 . TRP A 1 29  ? -2.291  32.137 7.523  1.00 24.98 ? 29  TRP A NE1 1 
ATOM   209  C CE2 . TRP A 1 29  ? -3.039  33.255 7.284  1.00 24.50 ? 29  TRP A CE2 1 
ATOM   210  C CE3 . TRP A 1 29  ? -2.747  35.661 7.495  1.00 23.08 ? 29  TRP A CE3 1 
ATOM   211  C CZ2 . TRP A 1 29  ? -4.336  33.399 6.798  1.00 25.77 ? 29  TRP A CZ2 1 
ATOM   212  C CZ3 . TRP A 1 29  ? -4.041  35.799 6.968  1.00 24.44 ? 29  TRP A CZ3 1 
ATOM   213  C CH2 . TRP A 1 29  ? -4.819  34.684 6.634  1.00 25.06 ? 29  TRP A CH2 1 
ATOM   214  N N   . LEU A 1 30  ? 0.990   36.900 6.438  1.00 19.64 ? 30  LEU A N   1 
ATOM   215  C CA  . LEU A 1 30  ? 0.706   37.645 5.254  1.00 19.44 ? 30  LEU A CA  1 
ATOM   216  C C   . LEU A 1 30  ? 1.793   37.589 4.181  1.00 18.71 ? 30  LEU A C   1 
ATOM   217  O O   . LEU A 1 30  ? 1.487   37.522 2.965  1.00 17.88 ? 30  LEU A O   1 
ATOM   218  C CB  . LEU A 1 30  ? 0.359   39.108 5.603  1.00 19.96 ? 30  LEU A CB  1 
ATOM   219  C CG  . LEU A 1 30  ? -0.852  39.351 6.497  1.00 21.48 ? 30  LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 30  ? -0.941  40.836 6.827  1.00 22.25 ? 30  LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 30  ? -2.139  38.892 5.866  1.00 22.39 ? 30  LEU A CD2 1 
ATOM   222  N N   . ILE A 1 31  ? 3.071   37.669 4.598  1.00 18.38 ? 31  ILE A N   1 
ATOM   223  C CA  . ILE A 1 31  ? 4.178   37.591 3.658  1.00 18.21 ? 31  ILE A CA  1 
ATOM   224  C C   . ILE A 1 31  ? 4.138   36.179 3.026  1.00 18.68 ? 31  ILE A C   1 
ATOM   225  O O   . ILE A 1 31  ? 4.385   35.974 1.839  1.00 18.26 ? 31  ILE A O   1 
ATOM   226  C CB  . ILE A 1 31  ? 5.513   37.865 4.383  1.00 19.19 ? 31  ILE A CB  1 
ATOM   227  C CG1 . ILE A 1 31  ? 5.674   39.321 4.735  1.00 18.62 ? 31  ILE A CG1 1 
ATOM   228  C CG2 . ILE A 1 31  ? 6.737   37.384 3.579  1.00 20.99 ? 31  ILE A CG2 1 
ATOM   229  C CD1 . ILE A 1 31  ? 6.707   39.525 5.811  1.00 19.54 ? 31  ILE A CD1 1 
ATOM   230  N N   . HIS A 1 32  ? 3.800   35.212 3.826  1.00 19.31 ? 32  HIS A N   1 
ATOM   231  C CA  . HIS A 1 32  ? 3.617   33.881 3.271  1.00 20.81 ? 32  HIS A CA  1 
ATOM   232  C C   . HIS A 1 32  ? 2.566   33.888 2.183  1.00 21.24 ? 32  HIS A C   1 
ATOM   233  O O   . HIS A 1 32  ? 2.726   33.256 1.158  1.00 21.95 ? 32  HIS A O   1 
ATOM   234  C CB  . HIS A 1 32  ? 3.260   32.924 4.366  1.00 22.42 ? 32  HIS A CB  1 
ATOM   235  C CG  . HIS A 1 32  ? 2.978   31.547 3.878  1.00 23.77 ? 32  HIS A CG  1 
ATOM   236  N ND1 . HIS A 1 32  ? 3.940   30.765 3.385  1.00 26.31 ? 32  HIS A ND1 1 
ATOM   237  C CD2 . HIS A 1 32  ? 1.788   30.829 3.782  1.00 25.53 ? 32  HIS A CD2 1 
ATOM   238  C CE1 . HIS A 1 32  ? 3.414   29.561 2.992  1.00 27.26 ? 32  HIS A CE1 1 
ATOM   239  N NE2 . HIS A 1 32  ? 2.101   29.590 3.237  1.00 27.05 ? 32  HIS A NE2 1 
ATOM   240  N N   . HIS A 1 33  ? 1.502   34.656 2.376  1.00 20.77 ? 33  HIS A N   1 
ATOM   241  C CA  . HIS A 1 33  ? 0.404   34.691 1.439  1.00 21.58 ? 33  HIS A CA  1 
ATOM   242  C C   . HIS A 1 33  ? 0.490   35.857 0.507  1.00 21.29 ? 33  HIS A C   1 
ATOM   243  O O   . HIS A 1 33  ? -0.545  36.298 0.014  1.00 19.70 ? 33  HIS A O   1 
ATOM   244  C CB  . HIS A 1 33  ? -0.921  34.720 2.221  1.00 22.14 ? 33  HIS A CB  1 
ATOM   245  C CG  . HIS A 1 33  ? -1.258  33.410 2.812  1.00 23.04 ? 33  HIS A CG  1 
ATOM   246  N ND1 . HIS A 1 33  ? -1.368  32.298 2.067  1.00 25.30 ? 33  HIS A ND1 1 
ATOM   247  C CD2 . HIS A 1 33  ? -1.513  33.032 4.107  1.00 23.98 ? 33  HIS A CD2 1 
ATOM   248  C CE1 . HIS A 1 33  ? -1.706  31.256 2.850  1.00 25.50 ? 33  HIS A CE1 1 
ATOM   249  N NE2 . HIS A 1 33  ? -1.765  31.697 4.093  1.00 25.02 ? 33  HIS A NE2 1 
ATOM   250  N N   . ARG A 1 34  ? 1.733   36.273 0.187  1.00 21.14 ? 34  ARG A N   1 
ATOM   251  C CA  . ARG A 1 34  ? 2.026   37.435 -0.675 1.00 21.20 ? 34  ARG A CA  1 
ATOM   252  C C   . ARG A 1 34  ? 1.421   37.323 -2.090 1.00 23.29 ? 34  ARG A C   1 
ATOM   253  O O   . ARG A 1 34  ? 1.121   38.335 -2.688 1.00 24.27 ? 34  ARG A O   1 
ATOM   254  C CB  . ARG A 1 34  ? 3.528   37.673 -0.768 1.00 21.31 ? 34  ARG A CB  1 
ATOM   255  C CG  . ARG A 1 34  ? 4.351   36.523 -1.380 1.00 22.71 ? 34  ARG A CG  1 
ATOM   256  C CD  . ARG A 1 34  ? 5.834   36.817 -1.286 1.00 23.41 ? 34  ARG A CD  1 
ATOM   257  N NE  . ARG A 1 34  ? 6.709   35.695 -1.631 1.00 24.62 ? 34  ARG A NE  1 
ATOM   258  C CZ  . ARG A 1 34  ? 6.996   34.680 -0.810 1.00 25.87 ? 34  ARG A CZ  1 
ATOM   259  N NH1 . ARG A 1 34  ? 7.829   33.723 -1.217 1.00 28.17 ? 34  ARG A NH1 1 
ATOM   260  N NH2 . ARG A 1 34  ? 6.451   34.615 0.414  1.00 25.07 ? 34  ARG A NH2 1 
ATOM   261  N N   . LYS A 1 35  ? 1.201   36.101 -2.594 1.00 23.04 ? 35  LYS A N   1 
ATOM   262  C CA  . LYS A 1 35  ? 0.405   35.919 -3.831 1.00 25.38 ? 35  LYS A CA  1 
ATOM   263  C C   . LYS A 1 35  ? -1.059  36.475 -3.761 1.00 24.84 ? 35  LYS A C   1 
ATOM   264  O O   . LYS A 1 35  ? -1.695  36.678 -4.824 1.00 26.34 ? 35  LYS A O   1 
ATOM   265  C CB  . LYS A 1 35  ? 0.399   34.462 -4.253 1.00 27.58 ? 35  LYS A CB  1 
ATOM   266  C CG  . LYS A 1 35  ? 1.730   33.984 -4.799 1.00 30.52 ? 35  LYS A CG  1 
ATOM   267  C CD  . LYS A 1 35  ? 1.660   32.497 -5.085 1.00 34.48 ? 35  LYS A CD  1 
ATOM   268  C CE  . LYS A 1 35  ? 3.020   32.030 -5.573 1.00 40.37 ? 35  LYS A CE  1 
ATOM   269  N NZ  . LYS A 1 35  ? 3.025   30.553 -5.709 1.00 44.86 ? 35  LYS A NZ  1 
ATOM   270  N N   . HIS A 1 36  ? -1.562  36.709 -2.528 1.00 22.84 ? 36  HIS A N   1 
ATOM   271  C CA  . HIS A 1 36  ? -2.860  37.363 -2.241 1.00 22.48 ? 36  HIS A CA  1 
ATOM   272  C C   . HIS A 1 36  ? -2.741  38.803 -1.835 1.00 22.70 ? 36  HIS A C   1 
ATOM   273  O O   . HIS A 1 36  ? -3.637  39.324 -1.142 1.00 20.67 ? 36  HIS A O   1 
ATOM   274  C CB  . HIS A 1 36  ? -3.633  36.648 -1.107 1.00 21.44 ? 36  HIS A CB  1 
ATOM   275  C CG  . HIS A 1 36  ? -3.815  35.170 -1.341 1.00 22.31 ? 36  HIS A CG  1 
ATOM   276  N ND1 . HIS A 1 36  ? -4.986  34.631 -1.690 1.00 23.16 ? 36  HIS A ND1 1 
ATOM   277  C CD2 . HIS A 1 36  ? -2.893  34.119 -1.277 1.00 21.96 ? 36  HIS A CD2 1 
ATOM   278  C CE1 . HIS A 1 36  ? -4.822  33.293 -1.863 1.00 24.32 ? 36  HIS A CE1 1 
ATOM   279  N NE2 . HIS A 1 36  ? -3.538  32.996 -1.597 1.00 23.28 ? 36  HIS A NE2 1 
ATOM   280  N N   . ALA A 1 37  ? -1.660  39.471 -2.261 1.00 23.58 ? 37  ALA A N   1 
ATOM   281  C CA  . ALA A 1 37  ? -1.344  40.786 -1.709 1.00 23.58 ? 37  ALA A CA  1 
ATOM   282  C C   . ALA A 1 37  ? -2.388  41.867 -2.011 1.00 24.60 ? 37  ALA A C   1 
ATOM   283  O O   . ALA A 1 37  ? -2.670  42.694 -1.149 1.00 25.48 ? 37  ALA A O   1 
ATOM   284  C CB  . ALA A 1 37  ? 0.051   41.243 -2.141 1.00 24.00 ? 37  ALA A CB  1 
ATOM   285  N N   . GLY A 1 38  ? -2.894  41.919 -3.225 1.00 24.90 ? 38  GLY A N   1 
ATOM   286  C CA  . GLY A 1 38  ? -3.949  42.892 -3.574 1.00 26.19 ? 38  GLY A CA  1 
ATOM   287  C C   . GLY A 1 38  ? -5.187  42.751 -2.658 1.00 26.55 ? 38  GLY A C   1 
ATOM   288  O O   . GLY A 1 38  ? -5.568  43.691 -1.942 1.00 25.66 ? 38  GLY A O   1 
ATOM   289  N N   . PRO A 1 39  ? -5.751  41.558 -2.596 1.00 26.09 ? 39  PRO A N   1 
ATOM   290  C CA  . PRO A 1 39  ? -6.911  41.343 -1.678 1.00 27.52 ? 39  PRO A CA  1 
ATOM   291  C C   . PRO A 1 39  ? -6.590  41.571 -0.195 1.00 26.27 ? 39  PRO A C   1 
ATOM   292  O O   . PRO A 1 39  ? -7.427  42.134 0.531  1.00 26.77 ? 39  PRO A O   1 
ATOM   293  C CB  . PRO A 1 39  ? -7.302  39.894 -1.939 1.00 28.34 ? 39  PRO A CB  1 
ATOM   294  C CG  . PRO A 1 39  ? -6.837  39.645 -3.346 1.00 29.29 ? 39  PRO A CG  1 
ATOM   295  C CD  . PRO A 1 39  ? -5.592  40.465 -3.562 1.00 26.79 ? 39  PRO A CD  1 
ATOM   296  N N   . ILE A 1 40  ? -5.400  41.187 0.244  1.00 24.79 ? 40  ILE A N   1 
ATOM   297  C CA  . ILE A 1 40  ? -4.948  41.500 1.599  1.00 24.57 ? 40  ILE A CA  1 
ATOM   298  C C   . ILE A 1 40  ? -4.967  43.013 1.881  1.00 24.97 ? 40  ILE A C   1 
ATOM   299  O O   . ILE A 1 40  ? -5.484  43.464 2.909  1.00 25.31 ? 40  ILE A O   1 
ATOM   300  C CB  . ILE A 1 40  ? -3.538  40.896 1.880  1.00 24.40 ? 40  ILE A CB  1 
ATOM   301  C CG1 . ILE A 1 40  ? -3.622  39.373 2.022  1.00 24.26 ? 40  ILE A CG1 1 
ATOM   302  C CG2 . ILE A 1 40  ? -2.919  41.524 3.131  1.00 24.62 ? 40  ILE A CG2 1 
ATOM   303  C CD1 . ILE A 1 40  ? -2.277  38.633 2.049  1.00 24.49 ? 40  ILE A CD1 1 
ATOM   304  N N   . VAL A 1 41  ? -4.440  43.802 0.956  1.00 24.80 ? 41  VAL A N   1 
ATOM   305  C CA  . VAL A 1 41  ? -4.392  45.262 1.131  1.00 24.65 ? 41  VAL A CA  1 
ATOM   306  C C   . VAL A 1 41  ? -5.791  45.878 1.099  1.00 26.31 ? 41  VAL A C   1 
ATOM   307  O O   . VAL A 1 41  ? -6.100  46.814 1.862  1.00 27.42 ? 41  VAL A O   1 
ATOM   308  C CB  . VAL A 1 41  ? -3.476  45.891 0.063  1.00 24.93 ? 41  VAL A CB  1 
ATOM   309  C CG1 . VAL A 1 41  ? -3.605  47.402 0.011  1.00 26.97 ? 41  VAL A CG1 1 
ATOM   310  C CG2 . VAL A 1 41  ? -2.013  45.507 0.323  1.00 24.48 ? 41  VAL A CG2 1 
ATOM   311  N N   . SER A 1 42  ? -6.651  45.370 0.220  1.00 26.51 ? 42  SER A N   1 
ATOM   312  C CA  . SER A 1 42  ? -8.044  45.816 0.201  1.00 29.15 ? 42  SER A CA  1 
ATOM   313  C C   . SER A 1 42  ? -8.785  45.559 1.525  1.00 27.94 ? 42  SER A C   1 
ATOM   314  O O   . SER A 1 42  ? -9.446  46.440 2.055  1.00 29.75 ? 42  SER A O   1 
ATOM   315  C CB  . SER A 1 42  ? -8.755  45.179 -0.998 1.00 30.85 ? 42  SER A CB  1 
ATOM   316  O OG  . SER A 1 42  ? -10.035 45.696 -1.036 1.00 35.32 ? 42  SER A OG  1 
ATOM   317  N N   . VAL A 1 43  ? -8.644  44.361 2.079  1.00 25.94 ? 43  VAL A N   1 
ATOM   318  C CA  . VAL A 1 43  ? -9.225  44.050 3.370  1.00 25.86 ? 43  VAL A CA  1 
ATOM   319  C C   . VAL A 1 43  ? -8.613  44.856 4.494  1.00 25.23 ? 43  VAL A C   1 
ATOM   320  O O   . VAL A 1 43  ? -9.316  45.356 5.322  1.00 25.33 ? 43  VAL A O   1 
ATOM   321  C CB  . VAL A 1 43  ? -9.015  42.586 3.725  1.00 25.93 ? 43  VAL A CB  1 
ATOM   322  C CG1 . VAL A 1 43  ? -9.399  42.304 5.189  1.00 25.65 ? 43  VAL A CG1 1 
ATOM   323  C CG2 . VAL A 1 43  ? -9.830  41.699 2.786  1.00 27.35 ? 43  VAL A CG2 1 
ATOM   324  N N   . TRP A 1 44  ? -7.285  44.948 4.513  1.00 24.42 ? 44  TRP A N   1 
ATOM   325  C CA  . TRP A 1 44  ? -6.578  45.753 5.503  1.00 24.79 ? 44  TRP A CA  1 
ATOM   326  C C   . TRP A 1 44  ? -7.155  47.149 5.550  1.00 26.46 ? 44  TRP A C   1 
ATOM   327  O O   . TRP A 1 44  ? -7.466  47.668 6.608  1.00 29.07 ? 44  TRP A O   1 
ATOM   328  C CB  . TRP A 1 44  ? -5.045  45.761 5.177  1.00 23.58 ? 44  TRP A CB  1 
ATOM   329  C CG  . TRP A 1 44  ? -4.176  46.700 6.002  1.00 23.12 ? 44  TRP A CG  1 
ATOM   330  C CD1 . TRP A 1 44  ? -3.478  46.403 7.174  1.00 22.35 ? 44  TRP A CD1 1 
ATOM   331  C CD2 . TRP A 1 44  ? -3.853  48.113 5.715  1.00 24.39 ? 44  TRP A CD2 1 
ATOM   332  N NE1 . TRP A 1 44  ? -2.779  47.492 7.620  1.00 22.90 ? 44  TRP A NE1 1 
ATOM   333  C CE2 . TRP A 1 44  ? -2.976  48.559 6.804  1.00 24.12 ? 44  TRP A CE2 1 
ATOM   334  C CE3 . TRP A 1 44  ? -4.220  49.022 4.724  1.00 25.25 ? 44  TRP A CE3 1 
ATOM   335  C CZ2 . TRP A 1 44  ? -2.500  49.858 6.877  1.00 26.12 ? 44  TRP A CZ2 1 
ATOM   336  C CZ3 . TRP A 1 44  ? -3.715  50.343 4.797  1.00 26.46 ? 44  TRP A CZ3 1 
ATOM   337  C CH2 . TRP A 1 44  ? -2.869  50.746 5.840  1.00 26.16 ? 44  TRP A CH2 1 
ATOM   338  N N   . HIS A 1 45  ? -7.363  47.729 4.384  1.00 28.48 ? 45  HIS A N   1 
ATOM   339  C CA  . HIS A 1 45  ? -7.759  49.124 4.248  1.00 29.61 ? 45  HIS A CA  1 
ATOM   340  C C   . HIS A 1 45  ? -9.165  49.396 4.760  1.00 32.35 ? 45  HIS A C   1 
ATOM   341  O O   . HIS A 1 45  ? -9.428  50.396 5.433  1.00 31.68 ? 45  HIS A O   1 
ATOM   342  C CB  . HIS A 1 45  ? -7.640  49.493 2.785  1.00 31.08 ? 45  HIS A CB  1 
ATOM   343  C CG  . HIS A 1 45  ? -7.812  50.960 2.516  1.00 33.58 ? 45  HIS A CG  1 
ATOM   344  N ND1 . HIS A 1 45  ? -8.139  51.428 1.324  1.00 35.20 ? 45  HIS A ND1 1 
ATOM   345  C CD2 . HIS A 1 45  ? -7.677  52.079 3.361  1.00 35.41 ? 45  HIS A CD2 1 
ATOM   346  C CE1 . HIS A 1 45  ? -8.259  52.784 1.374  1.00 37.68 ? 45  HIS A CE1 1 
ATOM   347  N NE2 . HIS A 1 45  ? -7.969  53.179 2.620  1.00 37.20 ? 45  HIS A NE2 1 
ATOM   348  N N   . ARG A 1 46  ? -10.080 48.496 4.425  1.00 34.23 ? 46  ARG A N   1 
ATOM   349  C CA  . ARG A 1 46  ? -11.471 48.567 4.859  1.00 37.78 ? 46  ARG A CA  1 
ATOM   350  C C   . ARG A 1 46  ? -11.542 48.349 6.380  1.00 35.58 ? 46  ARG A C   1 
ATOM   351  O O   . ARG A 1 46  ? -12.224 49.104 7.099  1.00 36.47 ? 46  ARG A O   1 
ATOM   352  C CB  . ARG A 1 46  ? -12.273 47.502 4.109  1.00 42.43 ? 46  ARG A CB  1 
ATOM   353  C CG  . ARG A 1 46  ? -13.710 47.870 3.794  1.00 51.16 ? 46  ARG A CG  1 
ATOM   354  C CD  . ARG A 1 46  ? -14.421 46.682 3.122  1.00 56.30 ? 46  ARG A CD  1 
ATOM   355  N NE  . ARG A 1 46  ? -14.186 45.465 3.918  1.00 58.73 ? 46  ARG A NE  1 
ATOM   356  C CZ  . ARG A 1 46  ? -13.512 44.381 3.530  1.00 58.06 ? 46  ARG A CZ  1 
ATOM   357  N NH1 . ARG A 1 46  ? -13.019 44.286 2.291  1.00 57.95 ? 46  ARG A NH1 1 
ATOM   358  N NH2 . ARG A 1 46  ? -13.350 43.368 4.409  1.00 56.18 ? 46  ARG A NH2 1 
ATOM   359  N N   . GLU A 1 47  ? -10.801 47.354 6.878  1.00 32.43 ? 47  GLU A N   1 
ATOM   360  C CA  . GLU A 1 47  ? -10.825 47.045 8.308  1.00 32.32 ? 47  GLU A CA  1 
ATOM   361  C C   . GLU A 1 47  ? -10.192 48.152 9.155  1.00 32.37 ? 47  GLU A C   1 
ATOM   362  O O   . GLU A 1 47  ? -10.608 48.398 10.280 1.00 31.83 ? 47  GLU A O   1 
ATOM   363  C CB  . GLU A 1 47  ? -10.189 45.692 8.602  1.00 31.23 ? 47  GLU A CB  1 
ATOM   364  C CG  . GLU A 1 47  ? -10.921 44.505 7.950  1.00 32.91 ? 47  GLU A CG  1 
ATOM   365  C CD  . GLU A 1 47  ? -12.385 44.426 8.364  1.00 35.38 ? 47  GLU A CD  1 
ATOM   366  O OE1 . GLU A 1 47  ? -12.671 44.539 9.566  1.00 36.90 ? 47  GLU A OE1 1 
ATOM   367  O OE2 . GLU A 1 47  ? -13.253 44.306 7.496  1.00 38.45 ? 47  GLU A OE2 1 
ATOM   368  N N   . LEU A 1 48  ? -9.191  48.823 8.599  1.00 32.61 ? 48  LEU A N   1 
ATOM   369  C CA  . LEU A 1 48  ? -8.625  50.009 9.236  1.00 32.55 ? 48  LEU A CA  1 
ATOM   370  C C   . LEU A 1 48  ? -9.697  51.053 9.584  1.00 36.19 ? 48  LEU A C   1 
ATOM   371  O O   . LEU A 1 48  ? -9.697  51.642 10.678 1.00 35.50 ? 48  LEU A O   1 
ATOM   372  C CB  . LEU A 1 48  ? -7.591  50.661 8.301  1.00 30.88 ? 48  LEU A CB  1 
ATOM   373  C CG  . LEU A 1 48  ? -7.045  52.026 8.737  1.00 31.08 ? 48  LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 48  ? -6.299  51.984 10.053 1.00 30.11 ? 48  LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 48  ? -6.139  52.630 7.682  1.00 31.94 ? 48  LEU A CD2 1 
ATOM   376  N N   . ARG A 1 49  ? -10.568 51.337 8.624  1.00 38.58 ? 49  ARG A N   1 
ATOM   377  C CA  . ARG A 1 49  ? -11.566 52.353 8.824  1.00 42.49 ? 49  ARG A CA  1 
ATOM   378  C C   . ARG A 1 49  ? -12.623 51.873 9.818  1.00 41.66 ? 49  ARG A C   1 
ATOM   379  O O   . ARG A 1 49  ? -13.194 52.665 10.518 1.00 42.28 ? 49  ARG A O   1 
ATOM   380  C CB  . ARG A 1 49  ? -12.221 52.746 7.495  1.00 48.52 ? 49  ARG A CB  1 
ATOM   381  C CG  . ARG A 1 49  ? -11.324 53.552 6.564  1.00 52.20 ? 49  ARG A CG  1 
ATOM   382  C CD  . ARG A 1 49  ? -12.160 54.475 5.671  1.00 57.97 ? 49  ARG A CD  1 
ATOM   383  N NE  . ARG A 1 49  ? -11.311 55.449 4.977  1.00 61.77 ? 49  ARG A NE  1 
ATOM   384  C CZ  . ARG A 1 49  ? -11.216 56.743 5.288  1.00 64.67 ? 49  ARG A CZ  1 
ATOM   385  N NH1 . ARG A 1 49  ? -10.411 57.531 4.599  1.00 67.34 ? 49  ARG A NH1 1 
ATOM   386  N NH2 . ARG A 1 49  ? -11.910 57.265 6.278  1.00 66.83 ? 49  ARG A NH2 1 
ATOM   387  N N   . LYS A 1 50  ? -12.847 50.570 9.895  1.00 40.45 ? 50  LYS A N   1 
ATOM   388  C CA  . LYS A 1 50  ? -13.802 50.022 10.857 1.00 41.06 ? 50  LYS A CA  1 
ATOM   389  C C   . LYS A 1 50  ? -13.189 49.950 12.260 1.00 37.94 ? 50  LYS A C   1 
ATOM   390  O O   . LYS A 1 50  ? -13.912 49.853 13.201 1.00 37.34 ? 50  LYS A O   1 
ATOM   391  C CB  . LYS A 1 50  ? -14.279 48.604 10.431 1.00 43.70 ? 50  LYS A CB  1 
ATOM   392  C CG  . LYS A 1 50  ? -15.451 48.552 9.434  1.00 47.72 ? 50  LYS A CG  1 
ATOM   393  C CD  . LYS A 1 50  ? -15.418 47.314 8.510  1.00 49.35 ? 50  LYS A CD  1 
ATOM   394  C CE  . LYS A 1 50  ? -15.679 45.983 9.239  1.00 50.68 ? 50  LYS A CE  1 
ATOM   395  N N   . ALA A 1 51  ? -11.857 49.950 12.388 1.00 34.02 ? 51  ALA A N   1 
ATOM   396  C CA  . ALA A 1 51  ? -11.201 49.639 13.667 1.00 32.50 ? 51  ALA A CA  1 
ATOM   397  C C   . ALA A 1 51  ? -11.386 50.735 14.707 1.00 32.91 ? 51  ALA A C   1 
ATOM   398  O O   . ALA A 1 51  ? -11.439 51.910 14.404 1.00 33.06 ? 51  ALA A O   1 
ATOM   399  C CB  . ALA A 1 51  ? -9.709  49.340 13.468 1.00 30.43 ? 51  ALA A CB  1 
ATOM   400  N N   . LYS A 1 52  ? -11.465 50.337 15.956 1.00 33.62 ? 52  LYS A N   1 
ATOM   401  C CA  . LYS A 1 52  ? -11.536 51.307 17.051 1.00 35.13 ? 52  LYS A CA  1 
ATOM   402  C C   . LYS A 1 52  ? -10.285 52.175 17.027 1.00 34.40 ? 52  LYS A C   1 
ATOM   403  O O   . LYS A 1 52  ? -9.222  51.725 16.599 1.00 31.29 ? 52  LYS A O   1 
ATOM   404  C CB  . LYS A 1 52  ? -11.657 50.604 18.408 1.00 35.98 ? 52  LYS A CB  1 
ATOM   405  C CG  . LYS A 1 52  ? -13.088 50.353 18.837 1.00 39.18 ? 52  LYS A CG  1 
ATOM   406  N N   . SER A 1 53  ? -10.444 53.414 17.480 1.00 35.85 ? 53  SER A N   1 
ATOM   407  C CA  . SER A 1 53  ? -9.383  54.404 17.442 1.00 36.31 ? 53  SER A CA  1 
ATOM   408  C C   . SER A 1 53  ? -8.099  53.950 18.174 1.00 34.47 ? 53  SER A C   1 
ATOM   409  O O   . SER A 1 53  ? -6.991  54.296 17.737 1.00 32.46 ? 53  SER A O   1 
ATOM   410  C CB  . SER A 1 53  ? -9.879  55.738 17.992 1.00 38.55 ? 53  SER A CB  1 
ATOM   411  O OG  . SER A 1 53  ? -10.177 55.652 19.390 1.00 40.90 ? 53  SER A OG  1 
ATOM   412  N N   . ASN A 1 54  ? -8.244  53.137 19.228 1.00 34.39 ? 54  ASN A N   1 
ATOM   413  C CA  . ASN A 1 54  ? -7.056  52.569 19.904 1.00 34.53 ? 54  ASN A CA  1 
ATOM   414  C C   . ASN A 1 54  ? -6.289  51.489 19.138 1.00 32.60 ? 54  ASN A C   1 
ATOM   415  O O   . ASN A 1 54  ? -5.224  51.094 19.585 1.00 32.02 ? 54  ASN A O   1 
ATOM   416  C CB  . ASN A 1 54  ? -7.355  52.133 21.381 1.00 35.90 ? 54  ASN A CB  1 
ATOM   417  C CG  . ASN A 1 54  ? -8.296  50.934 21.494 1.00 36.81 ? 54  ASN A CG  1 
ATOM   418  O OD1 . ASN A 1 54  ? -8.779  50.387 20.504 1.00 37.37 ? 54  ASN A OD1 1 
ATOM   419  N ND2 . ASN A 1 54  ? -8.549  50.525 22.717 1.00 37.30 ? 54  ASN A ND2 1 
ATOM   420  N N   . ARG A 1 55  ? -6.818  50.995 18.007 1.00 32.02 ? 55  ARG A N   1 
ATOM   421  C CA  . ARG A 1 55  ? -6.109  49.965 17.191 1.00 31.38 ? 55  ARG A CA  1 
ATOM   422  C C   . ARG A 1 55  ? -5.627  50.533 15.886 1.00 27.96 ? 55  ARG A C   1 
ATOM   423  O O   . ARG A 1 55  ? -4.857  49.892 15.181 1.00 26.73 ? 55  ARG A O   1 
ATOM   424  C CB  . ARG A 1 55  ? -7.023  48.803 16.768 1.00 34.58 ? 55  ARG A CB  1 
ATOM   425  C CG  . ARG A 1 55  ? -7.916  48.237 17.837 1.00 41.50 ? 55  ARG A CG  1 
ATOM   426  C CD  . ARG A 1 55  ? -7.167  47.284 18.726 1.00 45.69 ? 55  ARG A CD  1 
ATOM   427  N NE  . ARG A 1 55  ? -8.089  46.332 19.307 1.00 52.54 ? 55  ARG A NE  1 
ATOM   428  C CZ  . ARG A 1 55  ? -7.896  45.679 20.444 1.00 56.40 ? 55  ARG A CZ  1 
ATOM   429  N NH1 . ARG A 1 55  ? -8.821  44.834 20.869 1.00 61.74 ? 55  ARG A NH1 1 
ATOM   430  N NH2 . ARG A 1 55  ? -6.802  45.852 21.153 1.00 56.16 ? 55  ARG A NH2 1 
ATOM   431  N N   . LYS A 1 56  ? -6.121  51.704 15.515 1.00 27.37 ? 56  LYS A N   1 
ATOM   432  C CA  . LYS A 1 56  ? -5.891  52.199 14.145 1.00 26.37 ? 56  LYS A CA  1 
ATOM   433  C C   . LYS A 1 56  ? -4.399  52.258 13.809 1.00 25.25 ? 56  LYS A C   1 
ATOM   434  O O   . LYS A 1 56  ? -3.981  51.793 12.737 1.00 24.16 ? 56  LYS A O   1 
ATOM   435  C CB  . LYS A 1 56  ? -6.570  53.573 13.890 1.00 27.34 ? 56  LYS A CB  1 
ATOM   436  C CG  . LYS A 1 56  ? -8.052  53.464 13.501 1.00 28.45 ? 56  LYS A CG  1 
ATOM   437  C CD  . LYS A 1 56  ? -8.758  54.807 13.435 1.00 30.19 ? 56  LYS A CD  1 
ATOM   438  C CE  . LYS A 1 56  ? -10.283 54.718 13.520 1.00 31.99 ? 56  LYS A CE  1 
ATOM   439  N NZ  . LYS A 1 56  ? -10.927 53.783 12.543 1.00 31.68 ? 56  LYS A NZ  1 
ATOM   440  N N   . LEU A 1 57  ? -3.588  52.801 14.719 1.00 25.34 ? 57  LEU A N   1 
ATOM   441  C CA  . LEU A 1 57  ? -2.131  52.908 14.436 1.00 24.73 ? 57  LEU A CA  1 
ATOM   442  C C   . LEU A 1 57  ? -1.508  51.528 14.261 1.00 23.09 ? 57  LEU A C   1 
ATOM   443  O O   . LEU A 1 57  ? -0.608  51.367 13.482 1.00 22.98 ? 57  LEU A O   1 
ATOM   444  C CB  . LEU A 1 57  ? -1.418  53.701 15.537 1.00 25.97 ? 57  LEU A CB  1 
ATOM   445  C CG  . LEU A 1 57  ? 0.121   53.744 15.485 1.00 25.35 ? 57  LEU A CG  1 
ATOM   446  C CD1 . LEU A 1 57  ? 0.613   54.433 14.215 1.00 26.87 ? 57  LEU A CD1 1 
ATOM   447  C CD2 . LEU A 1 57  ? 0.618   54.478 16.712 1.00 26.96 ? 57  LEU A CD2 1 
ATOM   448  N N   . THR A 1 58  ? -2.034  50.539 14.956 1.00 22.87 ? 58  THR A N   1 
ATOM   449  C CA  . THR A 1 58  ? -1.523  49.161 14.826 1.00 22.48 ? 58  THR A CA  1 
ATOM   450  C C   . THR A 1 58  ? -1.562  48.653 13.386 1.00 22.08 ? 58  THR A C   1 
ATOM   451  O O   . THR A 1 58  ? -0.705  47.885 12.974 1.00 22.05 ? 58  THR A O   1 
ATOM   452  C CB  . THR A 1 58  ? -2.249  48.191 15.754 1.00 23.09 ? 58  THR A CB  1 
ATOM   453  O OG1 . THR A 1 58  ? -2.402  48.780 17.032 1.00 24.55 ? 58  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 58  ? -1.423  46.923 15.936 1.00 22.82 ? 58  THR A CG2 1 
ATOM   455  N N   . PHE A 1 59  ? -2.523  49.128 12.606 1.00 23.20 ? 59  PHE A N   1 
ATOM   456  C CA  . PHE A 1 59  ? -2.640  48.746 11.205 1.00 23.24 ? 59  PHE A CA  1 
ATOM   457  C C   . PHE A 1 59  ? -1.419  49.217 10.405 1.00 22.31 ? 59  PHE A C   1 
ATOM   458  O O   . PHE A 1 59  ? -0.968  48.511 9.535  1.00 21.15 ? 59  PHE A O   1 
ATOM   459  C CB  . PHE A 1 59  ? -3.941  49.314 10.587 1.00 25.52 ? 59  PHE A CB  1 
ATOM   460  C CG  . PHE A 1 59  ? -5.170  48.474 10.901 1.00 26.43 ? 59  PHE A CG  1 
ATOM   461  C CD1 . PHE A 1 59  ? -5.644  48.368 12.211 1.00 27.16 ? 59  PHE A CD1 1 
ATOM   462  C CD2 . PHE A 1 59  ? -5.848  47.809 9.896  1.00 26.86 ? 59  PHE A CD2 1 
ATOM   463  C CE1 . PHE A 1 59  ? -6.745  47.583 12.511 1.00 28.08 ? 59  PHE A CE1 1 
ATOM   464  C CE2 . PHE A 1 59  ? -6.973  47.047 10.182 1.00 28.19 ? 59  PHE A CE2 1 
ATOM   465  C CZ  . PHE A 1 59  ? -7.405  46.915 11.485 1.00 28.53 ? 59  PHE A CZ  1 
ATOM   466  N N   . LEU A 1 60  ? -0.892  50.399 10.725 1.00 22.16 ? 60  LEU A N   1 
ATOM   467  C CA  . LEU A 1 60  ? 0.236   50.936 10.015 1.00 23.42 ? 60  LEU A CA  1 
ATOM   468  C C   . LEU A 1 60  ? 1.480   50.265 10.529 1.00 24.28 ? 60  LEU A C   1 
ATOM   469  O O   . LEU A 1 60  ? 2.395   49.994 9.766  1.00 26.42 ? 60  LEU A O   1 
ATOM   470  C CB  . LEU A 1 60  ? 0.310   52.463 10.154 1.00 23.91 ? 60  LEU A CB  1 
ATOM   471  C CG  . LEU A 1 60  ? -0.774  53.204 9.357  1.00 25.40 ? 60  LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 60  ? -0.629  54.766 9.441  1.00 26.92 ? 60  LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 60  ? -0.752  52.826 7.899  1.00 26.06 ? 60  LEU A CD2 1 
ATOM   474  N N   . TYR A 1 61  ? 1.502   49.914 11.803 1.00 24.01 ? 61  TYR A N   1 
ATOM   475  C CA  . TYR A 1 61  ? 2.635   49.115 12.298 1.00 24.05 ? 61  TYR A CA  1 
ATOM   476  C C   . TYR A 1 61  ? 2.716   47.763 11.573 1.00 24.18 ? 61  TYR A C   1 
ATOM   477  O O   . TYR A 1 61  ? 3.825   47.235 11.268 1.00 23.24 ? 61  TYR A O   1 
ATOM   478  C CB  . TYR A 1 61  ? 2.489   48.884 13.777 1.00 24.14 ? 61  TYR A CB  1 
ATOM   479  C CG  . TYR A 1 61  ? 2.740   50.069 14.692 1.00 24.69 ? 61  TYR A CG  1 
ATOM   480  C CD1 . TYR A 1 61  ? 3.498   51.170 14.287 1.00 25.68 ? 61  TYR A CD1 1 
ATOM   481  C CD2 . TYR A 1 61  ? 2.304   50.026 16.019 1.00 26.10 ? 61  TYR A CD2 1 
ATOM   482  C CE1 . TYR A 1 61  ? 3.776   52.209 15.157 1.00 26.74 ? 61  TYR A CE1 1 
ATOM   483  C CE2 . TYR A 1 61  ? 2.618   51.062 16.910 1.00 27.53 ? 61  TYR A CE2 1 
ATOM   484  C CZ  . TYR A 1 61  ? 3.325   52.156 16.453 1.00 27.01 ? 61  TYR A CZ  1 
ATOM   485  O OH  . TYR A 1 61  ? 3.623   53.159 17.325 1.00 28.91 ? 61  TYR A OH  1 
ATOM   486  N N   . LEU A 1 62  ? 1.548   47.146 11.369 1.00 24.10 ? 62  LEU A N   1 
ATOM   487  C CA  . LEU A 1 62  ? 1.488   45.896 10.611 1.00 22.70 ? 62  LEU A CA  1 
ATOM   488  C C   . LEU A 1 62  ? 1.987   46.112 9.179  1.00 23.67 ? 62  LEU A C   1 
ATOM   489  O O   . LEU A 1 62  ? 2.731   45.286 8.633  1.00 22.20 ? 62  LEU A O   1 
ATOM   490  C CB  . LEU A 1 62  ? 0.067   45.386 10.552 1.00 21.92 ? 62  LEU A CB  1 
ATOM   491  C CG  . LEU A 1 62  ? -0.158  44.139 9.719  1.00 21.84 ? 62  LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 62  ? 0.653   42.974 10.292 1.00 20.62 ? 62  LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 62  ? -1.663  43.851 9.685  1.00 22.44 ? 62  LEU A CD2 1 
ATOM   494  N N   . ALA A 1 63  ? 1.540   47.207 8.559  1.00 22.90 ? 63  ALA A N   1 
ATOM   495  C CA  . ALA A 1 63  ? 1.970   47.525 7.210  1.00 23.44 ? 63  ALA A CA  1 
ATOM   496  C C   . ALA A 1 63  ? 3.489   47.724 7.162  1.00 23.55 ? 63  ALA A C   1 
ATOM   497  O O   . ALA A 1 63  ? 4.150   47.252 6.249  1.00 24.87 ? 63  ALA A O   1 
ATOM   498  C CB  . ALA A 1 63  ? 1.273   48.766 6.703  1.00 23.53 ? 63  ALA A CB  1 
ATOM   499  N N   . ASN A 1 64  ? 4.030   48.411 8.145  1.00 24.56 ? 64  ASN A N   1 
ATOM   500  C CA  . ASN A 1 64  ? 5.502   48.663 8.227  1.00 25.49 ? 64  ASN A CA  1 
ATOM   501  C C   . ASN A 1 64  ? 6.267   47.338 8.195  1.00 24.97 ? 64  ASN A C   1 
ATOM   502  O O   . ASN A 1 64  ? 7.122   47.072 7.340  1.00 26.39 ? 64  ASN A O   1 
ATOM   503  C CB  . ASN A 1 64  ? 5.783   49.412 9.517  1.00 25.48 ? 64  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 64  ? 7.250   49.752 9.704  1.00 27.46 ? 64  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 64  ? 7.975   50.126 8.770  1.00 26.06 ? 64  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 64  ? 7.686   49.649 10.944 1.00 27.87 ? 64  ASN A ND2 1 
ATOM   507  N N   . ASP A 1 65  ? 5.867   46.475 9.087  1.00 23.91 ? 65  ASP A N   1 
ATOM   508  C CA  . ASP A 1 65  ? 6.442   45.153 9.185  1.00 25.97 ? 65  ASP A CA  1 
ATOM   509  C C   . ASP A 1 65  ? 6.360   44.348 7.886  1.00 25.50 ? 65  ASP A C   1 
ATOM   510  O O   . ASP A 1 65  ? 7.371   43.824 7.390  1.00 22.82 ? 65  ASP A O   1 
ATOM   511  C CB  . ASP A 1 65  ? 5.697   44.432 10.257 1.00 28.77 ? 65  ASP A CB  1 
ATOM   512  C CG  . ASP A 1 65  ? 6.536   43.603 11.020 1.00 36.15 ? 65  ASP A CG  1 
ATOM   513  O OD1 . ASP A 1 65  ? 6.864   42.515 10.441 1.00 38.75 ? 65  ASP A OD1 1 
ATOM   514  O OD2 . ASP A 1 65  ? 6.895   44.060 12.173 1.00 41.41 ? 65  ASP A OD2 1 
ATOM   515  N N   . VAL A 1 66  ? 5.143   44.244 7.351  1.00 22.90 ? 66  VAL A N   1 
ATOM   516  C CA  . VAL A 1 66  ? 4.909   43.525 6.102  1.00 22.70 ? 66  VAL A CA  1 
ATOM   517  C C   . VAL A 1 66  ? 5.724   44.097 4.963  1.00 22.67 ? 66  VAL A C   1 
ATOM   518  O O   . VAL A 1 66  ? 6.398   43.362 4.268  1.00 23.48 ? 66  VAL A O   1 
ATOM   519  C CB  . VAL A 1 66  ? 3.403   43.547 5.688  1.00 22.43 ? 66  VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 66  ? 3.174   42.831 4.339  1.00 23.29 ? 66  VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 66  ? 2.545   42.959 6.788  1.00 24.32 ? 66  VAL A CG2 1 
ATOM   522  N N   . ILE A 1 67  ? 5.685   45.429 4.778  1.00 22.89 ? 67  ILE A N   1 
ATOM   523  C CA  . ILE A 1 67  ? 6.381   46.024 3.683  1.00 23.66 ? 67  ILE A CA  1 
ATOM   524  C C   . ILE A 1 67  ? 7.894   45.798 3.790  1.00 23.97 ? 67  ILE A C   1 
ATOM   525  O O   . ILE A 1 67  ? 8.478   45.264 2.883  1.00 24.92 ? 67  ILE A O   1 
ATOM   526  C CB  . ILE A 1 67  ? 6.008   47.515 3.482  1.00 25.35 ? 67  ILE A CB  1 
ATOM   527  C CG1 . ILE A 1 67  ? 4.498   47.645 3.185  1.00 24.33 ? 67  ILE A CG1 1 
ATOM   528  C CG2 . ILE A 1 67  ? 6.742   48.068 2.285  1.00 27.61 ? 67  ILE A CG2 1 
ATOM   529  C CD1 . ILE A 1 67  ? 3.963   49.060 3.207  1.00 25.87 ? 67  ILE A CD1 1 
ATOM   530  N N   . GLN A 1 68  ? 8.509   46.191 4.890  1.00 24.27 ? 68  GLN A N   1 
ATOM   531  C CA  . GLN A 1 68  ? 9.948   46.086 5.017  1.00 25.25 ? 68  GLN A CA  1 
ATOM   532  C C   . GLN A 1 68  ? 10.419  44.622 4.938  1.00 25.47 ? 68  GLN A C   1 
ATOM   533  O O   . GLN A 1 68  ? 11.413  44.316 4.244  1.00 25.89 ? 68  GLN A O   1 
ATOM   534  C CB  . GLN A 1 68  ? 10.422  46.694 6.312  1.00 25.64 ? 68  GLN A CB  1 
ATOM   535  C CG  . GLN A 1 68  ? 10.224  48.194 6.424  1.00 27.37 ? 68  GLN A CG  1 
ATOM   536  C CD  . GLN A 1 68  ? 11.216  48.780 7.389  1.00 28.50 ? 68  GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 68  ? 12.382  48.812 7.117  1.00 30.64 ? 68  GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 68  ? 10.748  49.230 8.510  1.00 28.95 ? 68  GLN A NE2 1 
ATOM   539  N N   . ASN A 1 69  ? 9.712   43.713 5.602  1.00 24.41 ? 69  ASN A N   1 
ATOM   540  C CA  . ASN A 1 69  ? 10.178  42.322 5.608  1.00 24.61 ? 69  ASN A CA  1 
ATOM   541  C C   . ASN A 1 69  ? 9.775   41.479 4.366  1.00 24.37 ? 69  ASN A C   1 
ATOM   542  O O   . ASN A 1 69  ? 10.207  40.312 4.195  1.00 22.94 ? 69  ASN A O   1 
ATOM   543  C CB  . ASN A 1 69  ? 9.748   41.660 6.907  1.00 24.88 ? 69  ASN A CB  1 
ATOM   544  C CG  . ASN A 1 69  ? 10.345  42.336 8.115  1.00 26.87 ? 69  ASN A CG  1 
ATOM   545  O OD1 . ASN A 1 69  ? 11.505  42.720 8.103  1.00 29.17 ? 69  ASN A OD1 1 
ATOM   546  N ND2 . ASN A 1 69  ? 9.572   42.444 9.180  1.00 27.21 ? 69  ASN A ND2 1 
ATOM   547  N N   . SER A 1 70  ? 8.917   42.044 3.522  1.00 23.34 ? 70  SER A N   1 
ATOM   548  C CA  . SER A 1 70  ? 8.459   41.342 2.349  1.00 22.77 ? 70  SER A CA  1 
ATOM   549  C C   . SER A 1 70  ? 9.467   41.527 1.245  1.00 24.10 ? 70  SER A C   1 
ATOM   550  O O   . SER A 1 70  ? 9.516   40.710 0.347  1.00 23.76 ? 70  SER A O   1 
ATOM   551  C CB  . SER A 1 70  ? 7.098   41.858 1.865  1.00 21.81 ? 70  SER A CB  1 
ATOM   552  O OG  . SER A 1 70  ? 7.222   43.182 1.358  1.00 21.80 ? 70  SER A OG  1 
ATOM   553  N N   . LYS A 1 71  ? 10.276  42.590 1.315  1.00 25.62 ? 71  LYS A N   1 
ATOM   554  C CA  . LYS A 1 71  ? 11.200  42.933 0.220  1.00 28.46 ? 71  LYS A CA  1 
ATOM   555  C C   . LYS A 1 71  ? 12.107  41.778 -0.153 1.00 27.30 ? 71  LYS A C   1 
ATOM   556  O O   . LYS A 1 71  ? 12.342  41.517 -1.322 1.00 26.88 ? 71  LYS A O   1 
ATOM   557  C CB  . LYS A 1 71  ? 12.111  44.088 0.591  1.00 32.69 ? 71  LYS A CB  1 
ATOM   558  C CG  . LYS A 1 71  ? 11.419  45.360 1.014  1.00 35.66 ? 71  LYS A CG  1 
ATOM   559  C CD  . LYS A 1 71  ? 10.979  46.208 -0.148 1.00 38.82 ? 71  LYS A CD  1 
ATOM   560  C CE  . LYS A 1 71  ? 10.844  47.647 0.341  1.00 41.86 ? 71  LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 71  ? 9.923   48.462 -0.503 1.00 42.24 ? 71  LYS A NZ  1 
ATOM   562  N N   . ARG A 1 72  ? 12.622  41.105 0.867  1.00 27.32 ? 72  ARG A N   1 
ATOM   563  C CA  . ARG A 1 72  ? 13.528  39.957 0.687  1.00 28.03 ? 72  ARG A CA  1 
ATOM   564  C C   . ARG A 1 72  ? 12.828  38.750 0.019  1.00 27.29 ? 72  ARG A C   1 
ATOM   565  O O   . ARG A 1 72  ? 13.490  37.820 -0.490 1.00 26.76 ? 72  ARG A O   1 
ATOM   566  C CB  . ARG A 1 72  ? 14.179  39.577 2.032  1.00 28.54 ? 72  ARG A CB  1 
ATOM   567  C CG  . ARG A 1 72  ? 13.165  39.154 3.129  1.00 26.84 ? 72  ARG A CG  1 
ATOM   568  C CD  . ARG A 1 72  ? 13.782  39.105 4.524  1.00 26.37 ? 72  ARG A CD  1 
ATOM   569  N NE  . ARG A 1 72  ? 14.697  37.988 4.729  1.00 27.04 ? 72  ARG A NE  1 
ATOM   570  C CZ  . ARG A 1 72  ? 14.325  36.749 5.040  1.00 27.28 ? 72  ARG A CZ  1 
ATOM   571  N NH1 . ARG A 1 72  ? 13.040  36.440 5.166  1.00 26.25 ? 72  ARG A NH1 1 
ATOM   572  N NH2 . ARG A 1 72  ? 15.227  35.808 5.221  1.00 28.63 ? 72  ARG A NH2 1 
ATOM   573  N N   . LYS A 1 73  ? 11.506  38.810 -0.041 1.00 26.45 ? 73  LYS A N   1 
ATOM   574  C CA  . LYS A 1 73  ? 10.696  37.734 -0.629 1.00 26.42 ? 73  LYS A CA  1 
ATOM   575  C C   . LYS A 1 73  ? 10.265  38.084 -2.039 1.00 27.19 ? 73  LYS A C   1 
ATOM   576  O O   . LYS A 1 73  ? 10.496  37.308 -2.956 1.00 27.06 ? 73  LYS A O   1 
ATOM   577  C CB  . LYS A 1 73  ? 9.460   37.443 0.237  1.00 23.98 ? 73  LYS A CB  1 
ATOM   578  C CG  . LYS A 1 73  ? 9.739   36.802 1.585  1.00 23.78 ? 73  LYS A CG  1 
ATOM   579  C CD  . LYS A 1 73  ? 10.206  35.355 1.487  1.00 25.12 ? 73  LYS A CD  1 
ATOM   580  C CE  . LYS A 1 73  ? 10.593  34.851 2.851  1.00 26.30 ? 73  LYS A CE  1 
ATOM   581  N NZ  . LYS A 1 73  ? 11.169  33.476 2.870  1.00 28.76 ? 73  LYS A NZ  1 
ATOM   582  N N   . GLY A 1 74  ? 9.610   39.249 -2.189 1.00 28.35 ? 74  GLY A N   1 
ATOM   583  C CA  . GLY A 1 74  ? 9.244   39.804 -3.490 1.00 27.44 ? 74  GLY A CA  1 
ATOM   584  C C   . GLY A 1 74  ? 8.558   41.167 -3.421 1.00 27.44 ? 74  GLY A C   1 
ATOM   585  O O   . GLY A 1 74  ? 8.342   41.699 -2.332 1.00 26.13 ? 74  GLY A O   1 
ATOM   586  N N   . PRO A 1 75  ? 8.235   41.752 -4.598 1.00 28.42 ? 75  PRO A N   1 
ATOM   587  C CA  . PRO A 1 75  ? 7.773   43.149 -4.712 1.00 28.98 ? 75  PRO A CA  1 
ATOM   588  C C   . PRO A 1 75  ? 6.276   43.426 -4.454 1.00 27.27 ? 75  PRO A C   1 
ATOM   589  O O   . PRO A 1 75  ? 5.851   44.594 -4.494 1.00 27.71 ? 75  PRO A O   1 
ATOM   590  C CB  . PRO A 1 75  ? 8.103   43.476 -6.171 1.00 29.80 ? 75  PRO A CB  1 
ATOM   591  C CG  . PRO A 1 75  ? 7.764   42.165 -6.880 1.00 30.47 ? 75  PRO A CG  1 
ATOM   592  C CD  . PRO A 1 75  ? 8.311   41.109 -5.931 1.00 29.53 ? 75  PRO A CD  1 
ATOM   593  N N   . GLU A 1 76  ? 5.507   42.376 -4.173 1.00 27.35 ? 76  GLU A N   1 
ATOM   594  C CA  . GLU A 1 76  ? 4.064   42.449 -4.149 1.00 26.65 ? 76  GLU A CA  1 
ATOM   595  C C   . GLU A 1 76  ? 3.548   43.465 -3.128 1.00 25.14 ? 76  GLU A C   1 
ATOM   596  O O   . GLU A 1 76  ? 2.711   44.276 -3.460 1.00 25.38 ? 76  GLU A O   1 
ATOM   597  C CB  . GLU A 1 76  ? 3.438   41.081 -3.832 1.00 26.84 ? 76  GLU A CB  1 
ATOM   598  C CG  . GLU A 1 76  ? 3.756   39.964 -4.798 1.00 28.78 ? 76  GLU A CG  1 
ATOM   599  C CD  . GLU A 1 76  ? 5.019   39.142 -4.428 1.00 30.35 ? 76  GLU A CD  1 
ATOM   600  O OE1 . GLU A 1 76  ? 5.787   39.465 -3.464 1.00 28.53 ? 76  GLU A OE1 1 
ATOM   601  O OE2 . GLU A 1 76  ? 5.231   38.126 -5.119 1.00 32.16 ? 76  GLU A OE2 1 
ATOM   602  N N   . PHE A 1 77  ? 4.019   43.402 -1.893 1.00 24.25 ? 77  PHE A N   1 
ATOM   603  C CA  . PHE A 1 77  ? 3.432   44.213 -0.830 1.00 23.19 ? 77  PHE A CA  1 
ATOM   604  C C   . PHE A 1 77  ? 3.813   45.658 -0.955 1.00 24.92 ? 77  PHE A C   1 
ATOM   605  O O   . PHE A 1 77  ? 2.955   46.544 -0.718 1.00 25.25 ? 77  PHE A O   1 
ATOM   606  C CB  . PHE A 1 77  ? 3.691   43.659 0.577  1.00 22.04 ? 77  PHE A CB  1 
ATOM   607  C CG  . PHE A 1 77  ? 2.728   42.545 0.987  1.00 21.18 ? 77  PHE A CG  1 
ATOM   608  C CD1 . PHE A 1 77  ? 1.383   42.813 1.216  1.00 21.23 ? 77  PHE A CD1 1 
ATOM   609  C CD2 . PHE A 1 77  ? 3.178   41.231 1.159  1.00 21.84 ? 77  PHE A CD2 1 
ATOM   610  C CE1 . PHE A 1 77  ? 0.514   41.802 1.620  1.00 20.32 ? 77  PHE A CE1 1 
ATOM   611  C CE2 . PHE A 1 77  ? 2.305   40.212 1.526  1.00 21.31 ? 77  PHE A CE2 1 
ATOM   612  C CZ  . PHE A 1 77  ? 0.976   40.489 1.747  1.00 21.04 ? 77  PHE A CZ  1 
ATOM   613  N N   . THR A 1 78  ? 5.037   45.925 -1.391 1.00 24.71 ? 78  THR A N   1 
ATOM   614  C CA  . THR A 1 78  ? 5.438   47.328 -1.688 1.00 26.36 ? 78  THR A CA  1 
ATOM   615  C C   . THR A 1 78  ? 4.552   47.897 -2.779 1.00 27.77 ? 78  THR A C   1 
ATOM   616  O O   . THR A 1 78  ? 4.000   49.017 -2.657 1.00 28.53 ? 78  THR A O   1 
ATOM   617  C CB  . THR A 1 78  ? 6.918   47.363 -2.105 1.00 27.52 ? 78  THR A CB  1 
ATOM   618  O OG1 . THR A 1 78  ? 7.716   46.826 -1.022 1.00 26.00 ? 78  THR A OG1 1 
ATOM   619  C CG2 . THR A 1 78  ? 7.343   48.812 -2.485 1.00 30.00 ? 78  THR A CG2 1 
ATOM   620  N N   . ARG A 1 79  ? 4.387   47.116 -3.848 1.00 28.88 ? 79  ARG A N   1 
ATOM   621  C CA  . ARG A 1 79  ? 3.554   47.537 -4.962 1.00 30.40 ? 79  ARG A CA  1 
ATOM   622  C C   . ARG A 1 79  ? 2.066   47.735 -4.554 1.00 29.12 ? 79  ARG A C   1 
ATOM   623  O O   . ARG A 1 79  ? 1.470   48.745 -4.908 1.00 27.58 ? 79  ARG A O   1 
ATOM   624  C CB  . ARG A 1 79  ? 3.660   46.538 -6.108 1.00 32.39 ? 79  ARG A CB  1 
ATOM   625  C CG  . ARG A 1 79  ? 2.695   46.808 -7.257 1.00 36.08 ? 79  ARG A CG  1 
ATOM   626  C CD  . ARG A 1 79  ? 2.854   45.820 -8.394 1.00 38.62 ? 79  ARG A CD  1 
ATOM   627  N NE  . ARG A 1 79  ? 2.470   44.473 -7.967 1.00 39.81 ? 79  ARG A NE  1 
ATOM   628  C CZ  . ARG A 1 79  ? 3.203   43.361 -8.137 1.00 41.81 ? 79  ARG A CZ  1 
ATOM   629  N NH1 . ARG A 1 79  ? 4.382   43.374 -8.763 1.00 42.49 ? 79  ARG A NH1 1 
ATOM   630  N NH2 . ARG A 1 79  ? 2.728   42.207 -7.688 1.00 44.21 ? 79  ARG A NH2 1 
ATOM   631  N N   . GLU A 1 80  ? 1.469   46.765 -3.847 1.00 27.19 ? 80  GLU A N   1 
ATOM   632  C CA  . GLU A 1 80  ? 0.012   46.851 -3.566 1.00 28.09 ? 80  GLU A CA  1 
ATOM   633  C C   . GLU A 1 80  ? -0.346  47.893 -2.506 1.00 28.45 ? 80  GLU A C   1 
ATOM   634  O O   . GLU A 1 80  ? -1.419  48.510 -2.597 1.00 28.37 ? 80  GLU A O   1 
ATOM   635  C CB  . GLU A 1 80  ? -0.603  45.489 -3.195 1.00 27.50 ? 80  GLU A CB  1 
ATOM   636  C CG  . GLU A 1 80  ? -0.527  44.417 -4.284 1.00 28.30 ? 80  GLU A CG  1 
ATOM   637  C CD  . GLU A 1 80  ? -1.298  44.784 -5.548 1.00 30.28 ? 80  GLU A CD  1 
ATOM   638  O OE1 . GLU A 1 80  ? -2.290  45.485 -5.414 1.00 32.34 ? 80  GLU A OE1 1 
ATOM   639  O OE2 . GLU A 1 80  ? -0.875  44.431 -6.677 1.00 34.36 ? 80  GLU A OE2 1 
ATOM   640  N N   . PHE A 1 81  ? 0.523   48.098 -1.515 1.00 27.17 ? 81  PHE A N   1 
ATOM   641  C CA  . PHE A 1 81  ? 0.219   49.023 -0.413 1.00 28.56 ? 81  PHE A CA  1 
ATOM   642  C C   . PHE A 1 81  ? 0.294   50.450 -0.893 1.00 31.15 ? 81  PHE A C   1 
ATOM   643  O O   . PHE A 1 81  ? -0.318  51.341 -0.286 1.00 31.15 ? 81  PHE A O   1 
ATOM   644  C CB  . PHE A 1 81  ? 1.165   48.848 0.807  1.00 27.46 ? 81  PHE A CB  1 
ATOM   645  C CG  . PHE A 1 81  ? 0.647   47.932 1.873  1.00 25.77 ? 81  PHE A CG  1 
ATOM   646  C CD1 . PHE A 1 81  ? -0.341  48.341 2.743  1.00 27.93 ? 81  PHE A CD1 1 
ATOM   647  C CD2 . PHE A 1 81  ? 1.150   46.659 2.020  1.00 25.44 ? 81  PHE A CD2 1 
ATOM   648  C CE1 . PHE A 1 81  ? -0.816  47.490 3.751  1.00 26.30 ? 81  PHE A CE1 1 
ATOM   649  C CE2 . PHE A 1 81  ? 0.707   45.811 3.016  1.00 24.17 ? 81  PHE A CE2 1 
ATOM   650  C CZ  . PHE A 1 81  ? -0.284  46.210 3.887  1.00 24.51 ? 81  PHE A CZ  1 
ATOM   651  N N   . GLU A 1 82  ? 1.011   50.683 -2.001 1.00 32.72 ? 82  GLU A N   1 
ATOM   652  C CA  . GLU A 1 82  ? 1.263   52.042 -2.411 1.00 36.03 ? 82  GLU A CA  1 
ATOM   653  C C   . GLU A 1 82  ? -0.027  52.860 -2.597 1.00 37.36 ? 82  GLU A C   1 
ATOM   654  O O   . GLU A 1 82  ? -0.067  54.036 -2.218 1.00 38.10 ? 82  GLU A O   1 
ATOM   655  C CB  . GLU A 1 82  ? 2.069   52.079 -3.691 1.00 40.02 ? 82  GLU A CB  1 
ATOM   656  C CG  . GLU A 1 82  ? 2.358   53.498 -4.147 1.00 46.83 ? 82  GLU A CG  1 
ATOM   657  C CD  . GLU A 1 82  ? 3.642   53.624 -4.958 1.00 52.63 ? 82  GLU A CD  1 
ATOM   658  O OE1 . GLU A 1 82  ? 4.084   52.622 -5.551 1.00 52.66 ? 82  GLU A OE1 1 
ATOM   659  O OE2 . GLU A 1 82  ? 4.215   54.746 -4.993 1.00 60.74 ? 82  GLU A OE2 1 
ATOM   660  N N   . SER A 1 83  ? -1.047  52.262 -3.222 1.00 35.70 ? 83  SER A N   1 
ATOM   661  C CA  . SER A 1 83  ? -2.287  52.986 -3.564 1.00 37.18 ? 83  SER A CA  1 
ATOM   662  C C   . SER A 1 83  ? -3.226  53.307 -2.386 1.00 35.77 ? 83  SER A C   1 
ATOM   663  O O   . SER A 1 83  ? -4.187  54.077 -2.563 1.00 37.51 ? 83  SER A O   1 
ATOM   664  C CB  . SER A 1 83  ? -3.080  52.218 -4.640 1.00 37.94 ? 83  SER A CB  1 
ATOM   665  O OG  . SER A 1 83  ? -3.301  50.896 -4.198 1.00 36.43 ? 83  SER A OG  1 
ATOM   666  N N   . VAL A 1 84  ? -2.960  52.775 -1.200 1.00 32.91 ? 84  VAL A N   1 
ATOM   667  C CA  . VAL A 1 84  ? -3.841  53.020 -0.026 1.00 32.83 ? 84  VAL A CA  1 
ATOM   668  C C   . VAL A 1 84  ? -3.191  53.828 1.106  1.00 33.09 ? 84  VAL A C   1 
ATOM   669  O O   . VAL A 1 84  ? -3.884  54.264 2.023  1.00 32.93 ? 84  VAL A O   1 
ATOM   670  C CB  . VAL A 1 84  ? -4.419  51.702 0.571  1.00 30.40 ? 84  VAL A CB  1 
ATOM   671  C CG1 . VAL A 1 84  ? -5.203  50.923 -0.499 1.00 30.59 ? 84  VAL A CG1 1 
ATOM   672  C CG2 . VAL A 1 84  ? -3.324  50.841 1.174  1.00 28.58 ? 84  VAL A CG2 1 
ATOM   673  N N   . LEU A 1 85  ? -1.858  54.009 1.054  1.00 33.27 ? 85  LEU A N   1 
ATOM   674  C CA  . LEU A 1 85  ? -1.122  54.585 2.204  1.00 32.36 ? 85  LEU A CA  1 
ATOM   675  C C   . LEU A 1 85  ? -1.362  56.071 2.413  1.00 33.92 ? 85  LEU A C   1 
ATOM   676  O O   . LEU A 1 85  ? -1.337  56.548 3.528  1.00 32.91 ? 85  LEU A O   1 
ATOM   677  C CB  . LEU A 1 85  ? 0.381   54.289 2.119  1.00 32.06 ? 85  LEU A CB  1 
ATOM   678  C CG  . LEU A 1 85  ? 0.726   52.800 2.186  1.00 31.07 ? 85  LEU A CG  1 
ATOM   679  C CD1 . LEU A 1 85  ? 2.207   52.639 1.863  1.00 31.96 ? 85  LEU A CD1 1 
ATOM   680  C CD2 . LEU A 1 85  ? 0.428   52.153 3.532  1.00 30.25 ? 85  LEU A CD2 1 
ATOM   681  N N   . VAL A 1 86  ? -1.633  56.811 1.365  1.00 35.96 ? 86  VAL A N   1 
ATOM   682  C CA  . VAL A 1 86  ? -1.899  58.254 1.571  1.00 39.19 ? 86  VAL A CA  1 
ATOM   683  C C   . VAL A 1 86  ? -3.163  58.415 2.421  1.00 40.00 ? 86  VAL A C   1 
ATOM   684  O O   . VAL A 1 86  ? -3.196  59.180 3.419  1.00 40.24 ? 86  VAL A O   1 
ATOM   685  C CB  . VAL A 1 86  ? -2.032  59.000 0.238  1.00 42.18 ? 86  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 86  ? -2.587  60.436 0.436  1.00 45.08 ? 86  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 86  ? -0.671  59.043 -0.458 1.00 42.50 ? 86  VAL A CG2 1 
ATOM   688  N N   . ASP A 1 87  ? -4.194  57.670 2.036  1.00 39.91 ? 87  ASP A N   1 
ATOM   689  C CA  . ASP A 1 87  ? -5.454  57.694 2.744  1.00 40.57 ? 87  ASP A CA  1 
ATOM   690  C C   . ASP A 1 87  ? -5.312  57.141 4.167  1.00 38.08 ? 87  ASP A C   1 
ATOM   691  O O   . ASP A 1 87  ? -5.854  57.735 5.108  1.00 37.29 ? 87  ASP A O   1 
ATOM   692  C CB  . ASP A 1 87  ? -6.523  56.915 1.971  1.00 41.68 ? 87  ASP A CB  1 
ATOM   693  C CG  . ASP A 1 87  ? -7.808  56.784 2.758  1.00 42.94 ? 87  ASP A CG  1 
ATOM   694  O OD1 . ASP A 1 87  ? -8.549  57.780 2.858  1.00 43.91 ? 87  ASP A OD1 1 
ATOM   695  O OD2 . ASP A 1 87  ? -8.045  55.694 3.329  1.00 41.77 ? 87  ASP A OD2 1 
ATOM   696  N N   . ALA A 1 88  ? -4.607  56.004 4.310  1.00 35.14 ? 88  ALA A N   1 
ATOM   697  C CA  . ALA A 1 88  ? -4.363  55.399 5.598  1.00 32.65 ? 88  ALA A CA  1 
ATOM   698  C C   . ALA A 1 88  ? -3.687  56.363 6.563  1.00 32.94 ? 88  ALA A C   1 
ATOM   699  O O   . ALA A 1 88  ? -4.139  56.536 7.731  1.00 32.38 ? 88  ALA A O   1 
ATOM   700  C CB  . ALA A 1 88  ? -3.491  54.148 5.448  1.00 31.54 ? 88  ALA A CB  1 
ATOM   701  N N   . PHE A 1 89  ? -2.603  56.975 6.099  1.00 31.96 ? 89  PHE A N   1 
ATOM   702  C CA  . PHE A 1 89  ? -1.873  57.913 6.936  1.00 33.13 ? 89  PHE A CA  1 
ATOM   703  C C   . PHE A 1 89  ? -2.762  59.078 7.330  1.00 34.66 ? 89  PHE A C   1 
ATOM   704  O O   . PHE A 1 89  ? -2.778  59.483 8.483  1.00 35.18 ? 89  PHE A O   1 
ATOM   705  C CB  . PHE A 1 89  ? -0.609  58.427 6.244  1.00 34.10 ? 89  PHE A CB  1 
ATOM   706  C CG  . PHE A 1 89  ? 0.593   57.600 6.535  1.00 32.63 ? 89  PHE A CG  1 
ATOM   707  C CD1 . PHE A 1 89  ? 0.787   56.376 5.908  1.00 30.67 ? 89  PHE A CD1 1 
ATOM   708  C CD2 . PHE A 1 89  ? 1.516   58.017 7.481  1.00 33.60 ? 89  PHE A CD2 1 
ATOM   709  C CE1 . PHE A 1 89  ? 1.886   55.601 6.202  1.00 29.66 ? 89  PHE A CE1 1 
ATOM   710  C CE2 . PHE A 1 89  ? 2.609   57.226 7.796  1.00 32.43 ? 89  PHE A CE2 1 
ATOM   711  C CZ  . PHE A 1 89  ? 2.796   56.016 7.135  1.00 29.71 ? 89  PHE A CZ  1 
ATOM   712  N N   . SER A 1 90  ? -3.530  59.581 6.392  1.00 36.45 ? 90  SER A N   1 
ATOM   713  C CA  . SER A 1 90  ? -4.417  60.708 6.692  1.00 39.33 ? 90  SER A CA  1 
ATOM   714  C C   . SER A 1 90  ? -5.421  60.289 7.780  1.00 39.30 ? 90  SER A C   1 
ATOM   715  O O   . SER A 1 90  ? -5.624  60.998 8.766  1.00 40.76 ? 90  SER A O   1 
ATOM   716  C CB  . SER A 1 90  ? -5.161  61.132 5.456  1.00 41.29 ? 90  SER A CB  1 
ATOM   717  O OG  . SER A 1 90  ? -6.001  62.242 5.802  1.00 44.36 ? 90  SER A OG  1 
ATOM   718  N N   . HIS A 1 91  ? -5.989  59.096 7.604  1.00 37.58 ? 91  HIS A N   1 
ATOM   719  C CA  . HIS A 1 91  ? -7.057  58.584 8.468  1.00 37.04 ? 91  HIS A CA  1 
ATOM   720  C C   . HIS A 1 91  ? -6.587  58.335 9.901  1.00 35.70 ? 91  HIS A C   1 
ATOM   721  O O   . HIS A 1 91  ? -7.249  58.710 10.894 1.00 35.81 ? 91  HIS A O   1 
ATOM   722  C CB  . HIS A 1 91  ? -7.637  57.281 7.854  1.00 35.70 ? 91  HIS A CB  1 
ATOM   723  C CG  . HIS A 1 91  ? -8.720  56.669 8.704  1.00 36.59 ? 91  HIS A CG  1 
ATOM   724  N ND1 . HIS A 1 91  ? -9.908  57.300 8.935  1.00 39.25 ? 91  HIS A ND1 1 
ATOM   725  C CD2 . HIS A 1 91  ? -8.742  55.500 9.455  1.00 35.31 ? 91  HIS A CD2 1 
ATOM   726  C CE1 . HIS A 1 91  ? -10.641 56.558 9.781  1.00 39.20 ? 91  HIS A CE1 1 
ATOM   727  N NE2 . HIS A 1 91  ? -9.921  55.454 10.102 1.00 36.97 ? 91  HIS A NE2 1 
ATOM   728  N N   . VAL A 1 92  ? -5.437  57.666 10.010 1.00 33.29 ? 92  VAL A N   1 
ATOM   729  C CA  . VAL A 1 92  ? -4.854  57.391 11.278 1.00 32.20 ? 92  VAL A CA  1 
ATOM   730  C C   . VAL A 1 92  ? -4.556  58.692 11.999 1.00 33.70 ? 92  VAL A C   1 
ATOM   731  O O   . VAL A 1 92  ? -4.984  58.867 13.170 1.00 33.20 ? 92  VAL A O   1 
ATOM   732  C CB  . VAL A 1 92  ? -3.621  56.453 11.181 1.00 29.95 ? 92  VAL A CB  1 
ATOM   733  C CG1 . VAL A 1 92  ? -2.935  56.259 12.542 1.00 29.21 ? 92  VAL A CG1 1 
ATOM   734  C CG2 . VAL A 1 92  ? -4.050  55.118 10.667 1.00 28.87 ? 92  VAL A CG2 1 
ATOM   735  N N   . ALA A 1 93  ? -3.908  59.635 11.316 1.00 35.08 ? 93  ALA A N   1 
ATOM   736  C CA  . ALA A 1 93  ? -3.504  60.870 11.967 1.00 36.96 ? 93  ALA A CA  1 
ATOM   737  C C   . ALA A 1 93  ? -4.723  61.627 12.429 1.00 40.09 ? 93  ALA A C   1 
ATOM   738  O O   . ALA A 1 93  ? -4.706  62.205 13.510 1.00 40.69 ? 93  ALA A O   1 
ATOM   739  C CB  . ALA A 1 93  ? -2.680  61.744 11.034 1.00 38.70 ? 93  ALA A CB  1 
ATOM   740  N N   . ARG A 1 94  ? -5.773  61.629 11.607 1.00 42.36 ? 94  ARG A N   1 
ATOM   741  C CA  . ARG A 1 94  ? -7.024  62.310 11.972 1.00 46.56 ? 94  ARG A CA  1 
ATOM   742  C C   . ARG A 1 94  ? -7.847  61.523 13.021 1.00 44.68 ? 94  ARG A C   1 
ATOM   743  O O   . ARG A 1 94  ? -8.383  62.117 13.949 1.00 45.96 ? 94  ARG A O   1 
ATOM   744  C CB  . ARG A 1 94  ? -7.875  62.598 10.727 1.00 50.87 ? 94  ARG A CB  1 
ATOM   745  C CG  . ARG A 1 94  ? -7.348  63.730 9.826  1.00 55.62 ? 94  ARG A CG  1 
ATOM   746  C CD  . ARG A 1 94  ? -8.290  64.027 8.641  1.00 60.53 ? 94  ARG A CD  1 
ATOM   747  N NE  . ARG A 1 94  ? -8.260  62.991 7.584  1.00 63.06 ? 94  ARG A NE  1 
ATOM   748  C CZ  . ARG A 1 94  ? -9.067  61.904 7.490  1.00 65.51 ? 94  ARG A CZ  1 
ATOM   749  N NH1 . ARG A 1 94  ? -10.019 61.642 8.389  1.00 68.90 ? 94  ARG A NH1 1 
ATOM   750  N NH2 . ARG A 1 94  ? -8.930  61.057 6.470  1.00 65.57 ? 94  ARG A NH2 1 
ATOM   751  N N   . GLU A 1 95  ? -7.945  60.202 12.886 1.00 41.28 ? 95  GLU A N   1 
ATOM   752  C CA  . GLU A 1 95  ? -8.932  59.445 13.694 1.00 40.88 ? 95  GLU A CA  1 
ATOM   753  C C   . GLU A 1 95  ? -8.381  58.525 14.807 1.00 37.83 ? 95  GLU A C   1 
ATOM   754  O O   . GLU A 1 95  ? -9.129  58.122 15.692 1.00 38.91 ? 95  GLU A O   1 
ATOM   755  C CB  . GLU A 1 95  ? -9.869  58.644 12.781 1.00 41.20 ? 95  GLU A CB  1 
ATOM   756  C CG  . GLU A 1 95  ? -10.761 59.480 11.866 1.00 44.64 ? 95  GLU A CG  1 
ATOM   757  C CD  . GLU A 1 95  ? -11.704 60.374 12.634 1.00 48.42 ? 95  GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 95  ? -12.102 61.398 12.079 1.00 51.68 ? 95  GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 95  ? -12.024 60.062 13.815 1.00 49.28 ? 95  GLU A OE2 1 
ATOM   760  N N   . ALA A 1 96  ? -7.106  58.187 14.785 1.00 34.99 ? 96  ALA A N   1 
ATOM   761  C CA  . ALA A 1 96  ? -6.587  57.338 15.828 1.00 33.63 ? 96  ALA A CA  1 
ATOM   762  C C   . ALA A 1 96  ? -6.350  58.099 17.120 1.00 35.02 ? 96  ALA A C   1 
ATOM   763  O O   . ALA A 1 96  ? -6.386  59.347 17.188 1.00 36.02 ? 96  ALA A O   1 
ATOM   764  C CB  . ALA A 1 96  ? -5.310  56.625 15.377 1.00 31.40 ? 96  ALA A CB  1 
ATOM   765  N N   . ASP A 1 97  ? -6.124  57.314 18.163 1.00 36.02 ? 97  ASP A N   1 
ATOM   766  C CA  . ASP A 1 97  ? -5.864  57.840 19.503 1.00 37.84 ? 97  ASP A CA  1 
ATOM   767  C C   . ASP A 1 97  ? -4.625  58.717 19.457 1.00 38.33 ? 97  ASP A C   1 
ATOM   768  O O   . ASP A 1 97  ? -3.753  58.511 18.579 1.00 36.65 ? 97  ASP A O   1 
ATOM   769  C CB  . ASP A 1 97  ? -5.640  56.693 20.493 1.00 37.40 ? 97  ASP A CB  1 
ATOM   770  C CG  . ASP A 1 97  ? -6.933  56.077 21.003 1.00 39.87 ? 97  ASP A CG  1 
ATOM   771  O OD1 . ASP A 1 97  ? -8.051  56.409 20.514 1.00 40.86 ? 97  ASP A OD1 1 
ATOM   772  O OD2 . ASP A 1 97  ? -6.812  55.241 21.935 1.00 42.09 ? 97  ASP A OD2 1 
ATOM   773  N N   . GLU A 1 98  ? -4.542  59.648 20.411 1.00 40.51 ? 98  GLU A N   1 
ATOM   774  C CA  . GLU A 1 98  ? -3.414  60.591 20.547 1.00 42.50 ? 98  GLU A CA  1 
ATOM   775  C C   . GLU A 1 98  ? -2.022  59.935 20.564 1.00 42.13 ? 98  GLU A C   1 
ATOM   776  O O   . GLU A 1 98  ? -1.877  58.796 20.990 1.00 40.21 ? 98  GLU A O   1 
ATOM   777  C CB  . GLU A 1 98  ? -3.585  61.391 21.824 1.00 45.45 ? 98  GLU A CB  1 
ATOM   778  C CG  . GLU A 1 98  ? -3.303  60.580 23.076 1.00 45.74 ? 98  GLU A CG  1 
ATOM   779  C CD  . GLU A 1 98  ? -3.367  61.407 24.341 1.00 49.03 ? 98  GLU A CD  1 
ATOM   780  O OE1 . GLU A 1 98  ? -3.442  62.657 24.253 1.00 52.40 ? 98  GLU A OE1 1 
ATOM   781  O OE2 . GLU A 1 98  ? -3.363  60.803 25.442 1.00 48.34 ? 98  GLU A OE2 1 
ATOM   782  N N   . GLY A 1 99  ? -1.012  60.657 20.076 1.00 43.46 ? 99  GLY A N   1 
ATOM   783  C CA  . GLY A 1 99  ? 0.371   60.155 20.073 1.00 41.46 ? 99  GLY A CA  1 
ATOM   784  C C   . GLY A 1 99  ? 0.787   59.285 18.889 1.00 40.39 ? 99  GLY A C   1 
ATOM   785  O O   . GLY A 1 99  ? 1.767   58.554 18.967 1.00 37.49 ? 99  GLY A O   1 
ATOM   786  N N   . CYS A 1 100 ? 0.063   59.364 17.779 1.00 39.10 ? 100 CYS A N   1 
ATOM   787  C CA  . CYS A 1 100 ? 0.497   58.681 16.581 1.00 38.08 ? 100 CYS A CA  1 
ATOM   788  C C   . CYS A 1 100 ? 1.506   59.483 15.756 1.00 37.69 ? 100 CYS A C   1 
ATOM   789  O O   . CYS A 1 100 ? 2.194   58.910 14.935 1.00 35.93 ? 100 CYS A O   1 
ATOM   790  C CB  . CYS A 1 100 ? -0.708  58.317 15.715 1.00 38.56 ? 100 CYS A CB  1 
ATOM   791  S SG  . CYS A 1 100 ? -1.615  59.749 15.140 1.00 41.52 ? 100 CYS A SG  1 
ATOM   792  N N   . LYS A 1 101 ? 1.599   60.795 15.985 1.00 38.88 ? 101 LYS A N   1 
ATOM   793  C CA  . LYS A 1 101 ? 2.395   61.673 15.126 1.00 39.84 ? 101 LYS A CA  1 
ATOM   794  C C   . LYS A 1 101 ? 3.874   61.307 15.123 1.00 38.43 ? 101 LYS A C   1 
ATOM   795  O O   . LYS A 1 101 ? 4.446   61.105 14.056 1.00 39.11 ? 101 LYS A O   1 
ATOM   796  C CB  . LYS A 1 101 ? 2.235   63.149 15.531 1.00 42.13 ? 101 LYS A CB  1 
ATOM   797  N N   . LYS A 1 102 ? 4.496   61.242 16.299 1.00 37.76 ? 102 LYS A N   1 
ATOM   798  C CA  . LYS A 1 102 ? 5.929   60.912 16.387 1.00 37.77 ? 102 LYS A CA  1 
ATOM   799  C C   . LYS A 1 102 ? 6.168   59.504 15.889 1.00 35.62 ? 102 LYS A C   1 
ATOM   800  O O   . LYS A 1 102 ? 7.161   59.242 15.183 1.00 36.37 ? 102 LYS A O   1 
ATOM   801  C CB  . LYS A 1 102 ? 6.506   61.110 17.808 1.00 38.83 ? 102 LYS A CB  1 
ATOM   802  N N   . PRO A 1 103 ? 5.273   58.583 16.231 1.00 33.55 ? 103 PRO A N   1 
ATOM   803  C CA  . PRO A 1 103 ? 5.514   57.243 15.684 1.00 32.46 ? 103 PRO A CA  1 
ATOM   804  C C   . PRO A 1 103 ? 5.503   57.249 14.138 1.00 32.26 ? 103 PRO A C   1 
ATOM   805  O O   . PRO A 1 103 ? 6.371   56.648 13.504 1.00 32.09 ? 103 PRO A O   1 
ATOM   806  C CB  . PRO A 1 103 ? 4.322   56.430 16.237 1.00 30.77 ? 103 PRO A CB  1 
ATOM   807  C CG  . PRO A 1 103 ? 4.043   57.086 17.553 1.00 31.57 ? 103 PRO A CG  1 
ATOM   808  C CD  . PRO A 1 103 ? 4.351   58.550 17.387 1.00 33.61 ? 103 PRO A CD  1 
ATOM   809  N N   . LEU A 1 104 ? 4.546   57.977 13.570 1.00 33.28 ? 104 LEU A N   1 
ATOM   810  C CA  . LEU A 1 104 ? 4.365   58.013 12.126 1.00 34.85 ? 104 LEU A CA  1 
ATOM   811  C C   . LEU A 1 104 ? 5.456   58.804 11.397 1.00 37.37 ? 104 LEU A C   1 
ATOM   812  O O   . LEU A 1 104 ? 5.916   58.400 10.310 1.00 37.59 ? 104 LEU A O   1 
ATOM   813  C CB  . LEU A 1 104 ? 2.936   58.505 11.750 1.00 34.52 ? 104 LEU A CB  1 
ATOM   814  C CG  . LEU A 1 104 ? 1.872   57.396 12.020 1.00 33.10 ? 104 LEU A CG  1 
ATOM   815  C CD1 . LEU A 1 104 ? 0.490   57.749 11.509 1.00 33.93 ? 104 LEU A CD1 1 
ATOM   816  C CD2 . LEU A 1 104 ? 2.292   56.091 11.408 1.00 31.00 ? 104 LEU A CD2 1 
ATOM   817  N N   . GLU A 1 105 ? 5.876   59.896 12.000 1.00 39.25 ? 105 GLU A N   1 
ATOM   818  C CA  . GLU A 1 105 ? 7.034   60.657 11.482 1.00 42.06 ? 105 GLU A CA  1 
ATOM   819  C C   . GLU A 1 105 ? 8.298   59.778 11.432 1.00 41.56 ? 105 GLU A C   1 
ATOM   820  O O   . GLU A 1 105 ? 8.944   59.642 10.380 1.00 41.61 ? 105 GLU A O   1 
ATOM   821  C CB  . GLU A 1 105 ? 7.255   61.902 12.338 1.00 43.51 ? 105 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 105 ? 6.227   62.991 12.025 1.00 45.42 ? 105 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 105 ? 6.186   64.172 13.032 1.00 48.61 ? 105 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 105 ? 6.547   64.002 14.233 1.00 48.75 ? 105 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 105 ? 5.734   65.287 12.633 1.00 50.36 ? 105 GLU A OE2 1 
ATOM   826  N N   . ARG A 1 106 ? 8.616   59.170 12.568 1.00 40.70 ? 106 ARG A N   1 
ATOM   827  C CA  . ARG A 1 106 ? 9.793   58.310 12.724 1.00 40.06 ? 106 ARG A CA  1 
ATOM   828  C C   . ARG A 1 106 ? 9.806   57.205 11.672 1.00 37.13 ? 106 ARG A C   1 
ATOM   829  O O   . ARG A 1 106 ? 10.833  56.918 11.045 1.00 36.37 ? 106 ARG A O   1 
ATOM   830  C CB  . ARG A 1 106 ? 9.761   57.685 14.138 1.00 40.82 ? 106 ARG A CB  1 
ATOM   831  C CG  . ARG A 1 106 ? 10.762  56.540 14.404 1.00 40.16 ? 106 ARG A CG  1 
ATOM   832  C CD  . ARG A 1 106 ? 12.194  57.005 14.159 1.00 44.04 ? 106 ARG A CD  1 
ATOM   833  N NE  . ARG A 1 106 ? 12.539  58.191 14.985 1.00 46.64 ? 106 ARG A NE  1 
ATOM   834  C CZ  . ARG A 1 106 ? 12.993  58.135 16.246 1.00 48.30 ? 106 ARG A CZ  1 
ATOM   835  N NH1 . ARG A 1 106 ? 13.181  56.961 16.856 1.00 46.56 ? 106 ARG A NH1 1 
ATOM   836  N NH2 . ARG A 1 106 ? 13.287  59.265 16.906 1.00 50.94 ? 106 ARG A NH2 1 
ATOM   837  N N   . LEU A 1 107 ? 8.645   56.591 11.502 1.00 34.63 ? 107 LEU A N   1 
ATOM   838  C CA  . LEU A 1 107 ? 8.465   55.473 10.592 1.00 33.00 ? 107 LEU A CA  1 
ATOM   839  C C   . LEU A 1 107 ? 8.743   55.922 9.182  1.00 33.32 ? 107 LEU A C   1 
ATOM   840  O O   . LEU A 1 107 ? 9.320   55.202 8.409  1.00 31.73 ? 107 LEU A O   1 
ATOM   841  C CB  . LEU A 1 107 ? 7.036   54.960 10.724 1.00 32.42 ? 107 LEU A CB  1 
ATOM   842  C CG  . LEU A 1 107 ? 6.486   53.887 9.797  1.00 32.70 ? 107 LEU A CG  1 
ATOM   843  C CD1 . LEU A 1 107 ? 5.171   53.364 10.352 1.00 32.80 ? 107 LEU A CD1 1 
ATOM   844  C CD2 . LEU A 1 107 ? 6.265   54.431 8.392  1.00 33.95 ? 107 LEU A CD2 1 
ATOM   845  N N   . LEU A 1 108 ? 8.325   57.126 8.841  1.00 35.33 ? 108 LEU A N   1 
ATOM   846  C CA  . LEU A 1 108 ? 8.554   57.634 7.506  1.00 37.21 ? 108 LEU A CA  1 
ATOM   847  C C   . LEU A 1 108 ? 10.013  57.968 7.292  1.00 38.39 ? 108 LEU A C   1 
ATOM   848  O O   . LEU A 1 108 ? 10.518  57.720 6.230  1.00 38.05 ? 108 LEU A O   1 
ATOM   849  C CB  . LEU A 1 108 ? 7.710   58.888 7.237  1.00 39.74 ? 108 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 108 ? 6.249   58.512 6.985  1.00 39.58 ? 108 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 108 ? 5.400   59.760 6.786  1.00 41.69 ? 108 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 108 ? 6.108   57.545 5.802  1.00 38.82 ? 108 LEU A CD2 1 
ATOM   853  N N   . ASN A 1 109 ? 10.663  58.571 8.298  1.00 38.85 ? 109 ASN A N   1 
ATOM   854  C CA  . ASN A 1 109 ? 12.102  58.872 8.213  1.00 40.32 ? 109 ASN A CA  1 
ATOM   855  C C   . ASN A 1 109 ? 12.917  57.591 8.010  1.00 39.11 ? 109 ASN A C   1 
ATOM   856  O O   . ASN A 1 109 ? 13.857  57.579 7.265  1.00 40.41 ? 109 ASN A O   1 
ATOM   857  C CB  . ASN A 1 109 ? 12.578  59.636 9.448  1.00 40.87 ? 109 ASN A CB  1 
ATOM   858  C CG  . ASN A 1 109 ? 12.079  61.082 9.465  1.00 43.03 ? 109 ASN A CG  1 
ATOM   859  O OD1 . ASN A 1 109 ? 11.766  61.667 8.446  1.00 44.82 ? 109 ASN A OD1 1 
ATOM   860  N ND2 . ASN A 1 109 ? 12.045  61.652 10.610 1.00 43.89 ? 109 ASN A ND2 1 
ATOM   861  N N   . ILE A 1 110 ? 12.508  56.514 8.661  1.00 37.43 ? 110 ILE A N   1 
ATOM   862  C CA  . ILE A 1 110 ? 13.145  55.206 8.471  1.00 36.51 ? 110 ILE A CA  1 
ATOM   863  C C   . ILE A 1 110 ? 12.878  54.647 7.067  1.00 36.53 ? 110 ILE A C   1 
ATOM   864  O O   . ILE A 1 110 ? 13.796  54.142 6.406  1.00 36.84 ? 110 ILE A O   1 
ATOM   865  C CB  . ILE A 1 110 ? 12.715  54.233 9.595  1.00 35.38 ? 110 ILE A CB  1 
ATOM   866  C CG1 . ILE A 1 110 ? 13.480  54.588 10.883 1.00 36.43 ? 110 ILE A CG1 1 
ATOM   867  C CG2 . ILE A 1 110 ? 12.948  52.784 9.191  1.00 33.40 ? 110 ILE A CG2 1 
ATOM   868  C CD1 . ILE A 1 110 ? 12.905  53.949 12.138 1.00 35.64 ? 110 ILE A CD1 1 
ATOM   869  N N   . TRP A 1 111 ? 11.631  54.754 6.597  1.00 35.92 ? 111 TRP A N   1 
ATOM   870  C CA  . TRP A 1 111 ? 11.271  54.370 5.207  1.00 35.69 ? 111 TRP A CA  1 
ATOM   871  C C   . TRP A 1 111 ? 12.141  55.039 4.205  1.00 37.41 ? 111 TRP A C   1 
ATOM   872  O O   . TRP A 1 111 ? 12.637  54.400 3.280  1.00 36.30 ? 111 TRP A O   1 
ATOM   873  C CB  . TRP A 1 111 ? 9.821   54.707 4.885  1.00 34.70 ? 111 TRP A CB  1 
ATOM   874  C CG  . TRP A 1 111 ? 8.892   53.669 5.379  1.00 32.35 ? 111 TRP A CG  1 
ATOM   875  C CD1 . TRP A 1 111 ? 9.172   52.653 6.273  1.00 31.52 ? 111 TRP A CD1 1 
ATOM   876  C CD2 . TRP A 1 111 ? 7.479   53.509 5.046  1.00 31.80 ? 111 TRP A CD2 1 
ATOM   877  N NE1 . TRP A 1 111 ? 8.071   51.886 6.495  1.00 30.19 ? 111 TRP A NE1 1 
ATOM   878  C CE2 . TRP A 1 111 ? 7.014   52.357 5.791  1.00 29.87 ? 111 TRP A CE2 1 
ATOM   879  C CE3 . TRP A 1 111 ? 6.580   54.201 4.249  1.00 32.69 ? 111 TRP A CE3 1 
ATOM   880  C CZ2 . TRP A 1 111 ? 5.695   51.911 5.720  1.00 28.86 ? 111 TRP A CZ2 1 
ATOM   881  C CZ3 . TRP A 1 111 ? 5.268   53.757 4.184  1.00 31.26 ? 111 TRP A CZ3 1 
ATOM   882  C CH2 . TRP A 1 111 ? 4.836   52.627 4.896  1.00 30.12 ? 111 TRP A CH2 1 
ATOM   883  N N   . GLN A 1 112 ? 12.327  56.335 4.392  1.00 38.58 ? 112 GLN A N   1 
ATOM   884  C CA  . GLN A 1 112 ? 13.141  57.103 3.506  1.00 41.74 ? 112 GLN A CA  1 
ATOM   885  C C   . GLN A 1 112 ? 14.588  56.653 3.537  1.00 42.58 ? 112 GLN A C   1 
ATOM   886  O O   . GLN A 1 112 ? 15.193  56.455 2.493  1.00 42.04 ? 112 GLN A O   1 
ATOM   887  C CB  . GLN A 1 112 ? 13.081  58.587 3.872  1.00 44.71 ? 112 GLN A CB  1 
ATOM   888  C CG  . GLN A 1 112 ? 13.947  59.430 2.964  1.00 49.88 ? 112 GLN A CG  1 
ATOM   889  C CD  . GLN A 1 112 ? 13.211  60.636 2.418  1.00 53.33 ? 112 GLN A CD  1 
ATOM   890  O OE1 . GLN A 1 112 ? 13.206  60.873 1.209  1.00 57.29 ? 112 GLN A OE1 1 
ATOM   891  N NE2 . GLN A 1 112 ? 12.569  61.391 3.299  1.00 52.99 ? 112 GLN A NE2 1 
ATOM   892  N N   . GLU A 1 113 ? 15.138  56.520 4.743  1.00 42.87 ? 113 GLU A N   1 
ATOM   893  C CA  . GLU A 1 113 ? 16.540  56.136 4.914  1.00 44.47 ? 113 GLU A CA  1 
ATOM   894  C C   . GLU A 1 113 ? 16.805  54.767 4.329  1.00 42.36 ? 113 GLU A C   1 
ATOM   895  O O   . GLU A 1 113 ? 17.865  54.533 3.798  1.00 43.51 ? 113 GLU A O   1 
ATOM   896  C CB  . GLU A 1 113 ? 16.943  56.156 6.403  1.00 45.10 ? 113 GLU A CB  1 
ATOM   897  C CG  . GLU A 1 113 ? 17.277  57.553 6.949  1.00 47.95 ? 113 GLU A CG  1 
ATOM   898  C CD  . GLU A 1 113 ? 17.402  57.585 8.464  1.00 47.90 ? 113 GLU A CD  1 
ATOM   899  O OE1 . GLU A 1 113 ? 17.261  56.524 9.094  1.00 47.28 ? 113 GLU A OE1 1 
ATOM   900  O OE2 . GLU A 1 113 ? 17.604  58.670 9.045  1.00 51.22 ? 113 GLU A OE2 1 
ATOM   901  N N   . ARG A 1 114 ? 15.833  53.874 4.414  1.00 39.32 ? 114 ARG A N   1 
ATOM   902  C CA  . ARG A 1 114 ? 15.978  52.520 3.881  1.00 38.43 ? 114 ARG A CA  1 
ATOM   903  C C   . ARG A 1 114 ? 15.381  52.363 2.498  1.00 38.35 ? 114 ARG A C   1 
ATOM   904  O O   . ARG A 1 114 ? 15.246  51.243 2.013  1.00 37.25 ? 114 ARG A O   1 
ATOM   905  C CB  . ARG A 1 114 ? 15.346  51.498 4.840  1.00 36.37 ? 114 ARG A CB  1 
ATOM   906  C CG  . ARG A 1 114 ? 16.085  51.380 6.159  1.00 37.75 ? 114 ARG A CG  1 
ATOM   907  C CD  . ARG A 1 114 ? 15.322  50.549 7.173  1.00 37.31 ? 114 ARG A CD  1 
ATOM   908  N NE  . ARG A 1 114 ? 15.763  50.820 8.534  1.00 39.62 ? 114 ARG A NE  1 
ATOM   909  C CZ  . ARG A 1 114 ? 15.213  50.298 9.633  1.00 40.35 ? 114 ARG A CZ  1 
ATOM   910  N NH1 . ARG A 1 114 ? 14.185  49.441 9.539  1.00 40.99 ? 114 ARG A NH1 1 
ATOM   911  N NH2 . ARG A 1 114 ? 15.683  50.639 10.833 1.00 42.06 ? 114 ARG A NH2 1 
ATOM   912  N N   . SER A 1 115 ? 15.030  53.463 1.837  1.00 40.27 ? 115 SER A N   1 
ATOM   913  C CA  . SER A 1 115 ? 14.464  53.369 0.461  1.00 40.36 ? 115 SER A CA  1 
ATOM   914  C C   . SER A 1 115 ? 13.265  52.384 0.314  1.00 37.11 ? 115 SER A C   1 
ATOM   915  O O   . SER A 1 115 ? 13.119  51.664 -0.683 1.00 36.56 ? 115 SER A O   1 
ATOM   916  C CB  . SER A 1 115 ? 15.579  53.016 -0.534 1.00 41.99 ? 115 SER A CB  1 
ATOM   917  O OG  . SER A 1 115 ? 16.598  53.988 -0.464 1.00 45.30 ? 115 SER A OG  1 
ATOM   918  N N   . VAL A 1 116 ? 12.405  52.366 1.305  1.00 35.29 ? 116 VAL A N   1 
ATOM   919  C CA  . VAL A 1 116 ? 11.209  51.510 1.274  1.00 33.18 ? 116 VAL A CA  1 
ATOM   920  C C   . VAL A 1 116 ? 10.321  51.971 0.095  1.00 33.60 ? 116 VAL A C   1 
ATOM   921  O O   . VAL A 1 116 ? 9.793   51.148 -0.660 1.00 31.86 ? 116 VAL A O   1 
ATOM   922  C CB  . VAL A 1 116 ? 10.470  51.555 2.640  1.00 31.56 ? 116 VAL A CB  1 
ATOM   923  C CG1 . VAL A 1 116 ? 9.145   50.830 2.592  1.00 29.09 ? 116 VAL A CG1 1 
ATOM   924  C CG2 . VAL A 1 116 ? 11.332  50.966 3.754  1.00 31.40 ? 116 VAL A CG2 1 
ATOM   925  N N   . TYR A 1 117 ? 10.194  53.285 -0.043 1.00 34.91 ? 117 TYR A N   1 
ATOM   926  C CA  . TYR A 1 117 ? 9.586   53.945 -1.194 1.00 37.01 ? 117 TYR A CA  1 
ATOM   927  C C   . TYR A 1 117 ? 10.456  55.138 -1.521 1.00 40.42 ? 117 TYR A C   1 
ATOM   928  O O   . TYR A 1 117 ? 11.309  55.502 -0.717 1.00 39.95 ? 117 TYR A O   1 
ATOM   929  C CB  . TYR A 1 117 ? 8.209   54.491 -0.828 1.00 37.14 ? 117 TYR A CB  1 
ATOM   930  C CG  . TYR A 1 117 ? 7.175   53.440 -0.688 1.00 34.62 ? 117 TYR A CG  1 
ATOM   931  C CD1 . TYR A 1 117 ? 6.614   52.846 -1.803 1.00 34.84 ? 117 TYR A CD1 1 
ATOM   932  C CD2 . TYR A 1 117 ? 6.742   53.027 0.573  1.00 33.66 ? 117 TYR A CD2 1 
ATOM   933  C CE1 . TYR A 1 117 ? 5.636   51.833 -1.668 1.00 33.14 ? 117 TYR A CE1 1 
ATOM   934  C CE2 . TYR A 1 117 ? 5.771   52.026 0.723  1.00 31.81 ? 117 TYR A CE2 1 
ATOM   935  C CZ  . TYR A 1 117 ? 5.219   51.436 -0.405 1.00 31.56 ? 117 TYR A CZ  1 
ATOM   936  O OH  . TYR A 1 117 ? 4.254   50.438 -0.245 1.00 30.52 ? 117 TYR A OH  1 
ATOM   937  N N   . GLY A 1 118 ? 10.202  55.774 -2.663 1.00 43.42 ? 118 GLY A N   1 
ATOM   938  C CA  . GLY A 1 118 ? 10.918  56.970 -3.062 1.00 46.64 ? 118 GLY A CA  1 
ATOM   939  C C   . GLY A 1 118 ? 10.608  58.167 -2.194 1.00 48.78 ? 118 GLY A C   1 
ATOM   940  O O   . GLY A 1 118 ? 9.537   58.242 -1.613 1.00 48.04 ? 118 GLY A O   1 
ATOM   941  N N   . GLY A 1 119 ? 11.554  59.105 -2.110 1.00 51.57 ? 119 GLY A N   1 
ATOM   942  C CA  . GLY A 1 119 ? 11.424  60.313 -1.270 1.00 53.69 ? 119 GLY A CA  1 
ATOM   943  C C   . GLY A 1 119 ? 10.248  61.193 -1.650 1.00 54.72 ? 119 GLY A C   1 
ATOM   944  O O   . GLY A 1 119 ? 9.667   61.876 -0.807 1.00 54.26 ? 119 GLY A O   1 
ATOM   945  N N   . GLU A 1 120 ? 9.937   61.176 -2.942 1.00 56.17 ? 120 GLU A N   1 
ATOM   946  C CA  A GLU A 1 120 ? 8.727   61.827 -3.457 0.50 57.04 ? 120 GLU A CA  1 
ATOM   947  C CA  B GLU A 1 120 ? 8.719   61.754 -3.505 0.50 58.12 ? 120 GLU A CA  1 
ATOM   948  C C   . GLU A 1 120 ? 7.454   61.318 -2.727 1.00 54.98 ? 120 GLU A C   1 
ATOM   949  O O   . GLU A 1 120 ? 6.799   62.100 -2.017 1.00 54.97 ? 120 GLU A O   1 
ATOM   950  C CB  A GLU A 1 120 ? 8.615   61.663 -4.992 0.50 58.09 ? 120 GLU A CB  1 
ATOM   951  C CB  B GLU A 1 120 ? 8.619   61.336 -5.004 0.50 60.17 ? 120 GLU A CB  1 
ATOM   952  C CG  A GLU A 1 120 ? 9.662   62.436 -5.808 0.50 61.07 ? 120 GLU A CG  1 
ATOM   953  C CG  B GLU A 1 120 ? 8.936   59.845 -5.338 0.50 58.29 ? 120 GLU A CG  1 
ATOM   954  C CD  A GLU A 1 120 ? 10.786  61.557 -6.400 0.50 60.30 ? 120 GLU A CD  1 
ATOM   955  C CD  B GLU A 1 120 ? 10.392  59.570 -5.755 0.50 59.85 ? 120 GLU A CD  1 
ATOM   956  O OE1 A GLU A 1 120 ? 11.060  60.451 -5.871 0.50 56.16 ? 120 GLU A OE1 1 
ATOM   957  O OE1 B GLU A 1 120 ? 10.729  58.380 -5.944 0.50 59.24 ? 120 GLU A OE1 1 
ATOM   958  O OE2 A GLU A 1 120 ? 11.423  61.993 -7.394 0.50 61.72 ? 120 GLU A OE2 1 
ATOM   959  O OE2 B GLU A 1 120 ? 11.202  60.514 -5.886 0.50 62.19 ? 120 GLU A OE2 1 
ATOM   960  N N   . PHE A 1 121 ? 7.128   60.033 -2.857 1.00 51.43 ? 121 PHE A N   1 
ATOM   961  C CA  . PHE A 1 121 ? 5.979   59.426 -2.213 1.00 48.39 ? 121 PHE A CA  1 
ATOM   962  C C   . PHE A 1 121 ? 6.042   59.560 -0.676 1.00 47.21 ? 121 PHE A C   1 
ATOM   963  O O   . PHE A 1 121 ? 5.015   59.748 -0.024 1.00 47.30 ? 121 PHE A O   1 
ATOM   964  C CB  . PHE A 1 121 ? 5.889   57.931 -2.638 1.00 45.36 ? 121 PHE A CB  1 
ATOM   965  C CG  . PHE A 1 121 ? 4.657   57.220 -2.135 1.00 42.59 ? 121 PHE A CG  1 
ATOM   966  C CD1 . PHE A 1 121 ? 3.394   57.543 -2.627 1.00 43.20 ? 121 PHE A CD1 1 
ATOM   967  C CD2 . PHE A 1 121 ? 4.755   56.219 -1.173 1.00 39.93 ? 121 PHE A CD2 1 
ATOM   968  C CE1 . PHE A 1 121 ? 2.262   56.878 -2.163 1.00 40.62 ? 121 PHE A CE1 1 
ATOM   969  C CE2 . PHE A 1 121 ? 3.624   55.559 -0.704 1.00 37.34 ? 121 PHE A CE2 1 
ATOM   970  C CZ  . PHE A 1 121 ? 2.380   55.895 -1.202 1.00 38.46 ? 121 PHE A CZ  1 
ATOM   971  N N   . ILE A 1 122 ? 7.241   59.496 -0.102 1.00 46.28 ? 122 ILE A N   1 
ATOM   972  C CA  . ILE A 1 122 ? 7.401   59.703 1.336  1.00 45.25 ? 122 ILE A CA  1 
ATOM   973  C C   . ILE A 1 122 ? 6.940   61.130 1.739  1.00 46.93 ? 122 ILE A C   1 
ATOM   974  O O   . ILE A 1 122 ? 6.379   61.337 2.824  1.00 45.29 ? 122 ILE A O   1 
ATOM   975  C CB  . ILE A 1 122 ? 8.851   59.425 1.795  1.00 45.39 ? 122 ILE A CB  1 
ATOM   976  C CG1 . ILE A 1 122 ? 9.279   57.985 1.424  1.00 44.45 ? 122 ILE A CG1 1 
ATOM   977  C CG2 . ILE A 1 122 ? 8.988   59.667 3.295  1.00 44.44 ? 122 ILE A CG2 1 
ATOM   978  C CD1 . ILE A 1 122 ? 8.911   56.946 2.425  1.00 41.79 ? 122 ILE A CD1 1 
ATOM   979  N N   . GLN A 1 123 ? 7.125   62.101 0.852  1.00 49.45 ? 123 GLN A N   1 
ATOM   980  C CA  . GLN A 1 123 ? 6.715   63.477 1.164  1.00 52.50 ? 123 GLN A CA  1 
ATOM   981  C C   . GLN A 1 123 ? 5.170   63.638 1.128  1.00 53.03 ? 123 GLN A C   1 
ATOM   982  O O   . GLN A 1 123 ? 4.610   64.379 1.926  1.00 54.54 ? 123 GLN A O   1 
ATOM   983  C CB  . GLN A 1 123 ? 7.425   64.485 0.248  1.00 55.99 ? 123 GLN A CB  1 
ATOM   984  C CG  . GLN A 1 123 ? 7.706   65.825 0.926  1.00 58.66 ? 123 GLN A CG  1 
ATOM   985  N N   . GLN A 1 124 ? 4.485   62.921 0.229  1.00 53.26 ? 124 GLN A N   1 
ATOM   986  C CA  . GLN A 1 124 ? 2.994   62.942 0.175  1.00 53.47 ? 124 GLN A CA  1 
ATOM   987  C C   . GLN A 1 124 ? 2.407   62.371 1.458  1.00 49.81 ? 124 GLN A C   1 
ATOM   988  O O   . GLN A 1 124 ? 1.422   62.886 1.983  1.00 49.32 ? 124 GLN A O   1 
ATOM   989  C CB  . GLN A 1 124 ? 2.441   62.107 -0.993 1.00 53.63 ? 124 GLN A CB  1 
ATOM   990  C CG  . GLN A 1 124 ? 2.844   62.556 -2.398 1.00 58.10 ? 124 GLN A CG  1 
ATOM   991  C CD  . GLN A 1 124 ? 2.279   61.612 -3.440 1.00 58.42 ? 124 GLN A CD  1 
ATOM   992  O OE1 . GLN A 1 124 ? 1.191   61.070 -3.266 1.00 58.75 ? 124 GLN A OE1 1 
ATOM   993  N NE2 . GLN A 1 124 ? 3.027   61.371 -4.496 1.00 60.31 ? 124 GLN A NE2 1 
ATOM   994  N N   . LEU A 1 125 ? 3.026   61.299 1.942  1.00 46.90 ? 125 LEU A N   1 
ATOM   995  C CA  . LEU A 1 125 ? 2.644   60.687 3.211  1.00 46.03 ? 125 LEU A CA  1 
ATOM   996  C C   . LEU A 1 125 ? 2.799   61.671 4.368  1.00 46.71 ? 125 LEU A C   1 
ATOM   997  O O   . LEU A 1 125 ? 1.893   61.793 5.208  1.00 45.82 ? 125 LEU A O   1 
ATOM   998  C CB  . LEU A 1 125 ? 3.472   59.410 3.480  1.00 44.24 ? 125 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 125 ? 3.279   58.270 2.482  1.00 43.17 ? 125 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 125 ? 4.177   57.072 2.779  1.00 41.72 ? 125 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 125 ? 1.804   57.859 2.448  1.00 43.02 ? 125 LEU A CD2 1 
ATOM   1002 N N   . LYS A 1 126 ? 3.950   62.354 4.415  1.00 48.74 ? 126 LYS A N   1 
ATOM   1003 C CA  . LYS A 1 126 ? 4.193   63.378 5.441  1.00 51.10 ? 126 LYS A CA  1 
ATOM   1004 C C   . LYS A 1 126 ? 3.076   64.396 5.326  1.00 53.09 ? 126 LYS A C   1 
ATOM   1005 O O   . LYS A 1 126 ? 2.335   64.617 6.267  1.00 53.63 ? 126 LYS A O   1 
ATOM   1006 C CB  . LYS A 1 126 ? 5.584   64.055 5.286  1.00 53.68 ? 126 LYS A CB  1 
ATOM   1007 C CG  . LYS A 1 126 ? 6.681   63.471 6.185  1.00 51.87 ? 126 LYS A CG  1 
ATOM   1008 N N   . LEU A 1 127 ? 2.935   64.972 4.143  1.00 56.11 ? 127 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 127 ? 1.905   65.987 3.897  1.00 58.29 ? 127 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 127 ? 0.503   65.474 4.293  1.00 56.82 ? 127 LEU A C   1 
ATOM   1011 O O   . LEU A 1 127 ? -0.279  66.219 4.874  1.00 57.27 ? 127 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 127 ? 1.931   66.468 2.432  1.00 60.33 ? 127 LEU A CB  1 
ATOM   1013 N N   . SER A 1 128 ? 0.196   64.194 4.042  1.00 54.53 ? 128 SER A N   1 
ATOM   1014 C CA  . SER A 1 128 ? -1.183  63.740 4.252  1.00 53.56 ? 128 SER A CA  1 
ATOM   1015 C C   . SER A 1 128 ? -1.548  63.794 5.756  1.00 55.08 ? 128 SER A C   1 
ATOM   1016 O O   . SER A 1 128 ? -2.721  63.902 6.107  1.00 54.98 ? 128 SER A O   1 
ATOM   1017 C CB  . SER A 1 128 ? -1.470  62.380 3.597  1.00 49.96 ? 128 SER A CB  1 
ATOM   1018 O OG  . SER A 1 128 ? -1.453  61.348 4.543  1.00 47.48 ? 128 SER A OG  1 
ATOM   1019 N N   . MET A 1 129 ? -0.539  63.806 6.625  1.00 56.51 ? 129 MET A N   1 
ATOM   1020 C CA  . MET A 1 129 ? -0.759  64.028 8.050  1.00 58.66 ? 129 MET A CA  1 
ATOM   1021 C C   . MET A 1 129 ? -0.871  65.511 8.378  1.00 63.82 ? 129 MET A C   1 
ATOM   1022 O O   . MET A 1 129 ? -1.627  65.861 9.268  1.00 66.46 ? 129 MET A O   1 
ATOM   1023 C CB  . MET A 1 129 ? 0.355   63.396 8.856  1.00 57.39 ? 129 MET A CB  1 
ATOM   1024 C CG  . MET A 1 129 ? 0.544   61.926 8.542  1.00 54.92 ? 129 MET A CG  1 
ATOM   1025 S SD  . MET A 1 129 ? 1.780   61.092 9.567  1.00 56.42 ? 129 MET A SD  1 
ATOM   1026 C CE  . MET A 1 129 ? 3.201   62.165 9.345  1.00 55.55 ? 129 MET A CE  1 
ATOM   1027 N N   . GLU A 1 130 ? -0.135  66.368 7.656  1.00 68.28 ? 130 GLU A N   1 
ATOM   1028 C CA  . GLU A 1 130 ? -0.107  67.826 7.915  1.00 72.97 ? 130 GLU A CA  1 
ATOM   1029 C C   . GLU A 1 130 ? -1.485  68.368 8.311  1.00 76.20 ? 130 GLU A C   1 
ATOM   1030 O O   . GLU A 1 130 ? -1.691  68.726 9.470  1.00 77.75 ? 130 GLU A O   1 
ATOM   1031 C CB  . GLU A 1 130 ? 0.444   68.602 6.708  1.00 74.64 ? 130 GLU A CB  1 
ATOM   1032 N N   . ASP A 1 131 ? -2.424  68.416 7.361  1.00 79.04 ? 131 ASP A N   1 
ATOM   1033 C CA  . ASP A 1 131 ? -3.818  68.812 7.659  1.00 79.97 ? 131 ASP A CA  1 
ATOM   1034 C C   . ASP A 1 131 ? -4.567  67.663 8.357  1.00 76.58 ? 131 ASP A C   1 
ATOM   1035 O O   . ASP A 1 131 ? -4.857  66.636 7.738  1.00 71.01 ? 131 ASP A O   1 
ATOM   1036 C CB  . ASP A 1 131 ? -4.554  69.215 6.373  1.00 81.61 ? 131 ASP A CB  1 
ATOM   1037 N N   . SER B 1 3   ? -4.737  28.102 4.878  1.00 42.73 ? 3   SER B N   1 
ATOM   1038 C CA  . SER B 1 3   ? -4.953  28.748 3.573  1.00 40.37 ? 3   SER B CA  1 
ATOM   1039 C C   . SER B 1 3   ? -5.396  30.141 3.933  1.00 36.24 ? 3   SER B C   1 
ATOM   1040 O O   . SER B 1 3   ? -5.792  30.395 5.071  1.00 34.37 ? 3   SER B O   1 
ATOM   1041 C CB  . SER B 1 3   ? -6.023  28.063 2.765  1.00 44.01 ? 3   SER B CB  1 
ATOM   1042 O OG  . SER B 1 3   ? -6.146  26.732 3.156  1.00 49.10 ? 3   SER B OG  1 
ATOM   1043 N N   . PHE B 1 4   ? -5.293  31.026 2.956  1.00 33.42 ? 4   PHE B N   1 
ATOM   1044 C CA  . PHE B 1 4   ? -5.744  32.376 3.078  1.00 31.04 ? 4   PHE B CA  1 
ATOM   1045 C C   . PHE B 1 4   ? -7.273  32.467 2.791  1.00 31.94 ? 4   PHE B C   1 
ATOM   1046 O O   . PHE B 1 4   ? -7.806  31.796 1.912  1.00 33.04 ? 4   PHE B O   1 
ATOM   1047 C CB  . PHE B 1 4   ? -5.025  33.254 2.076  1.00 29.99 ? 4   PHE B CB  1 
ATOM   1048 C CG  . PHE B 1 4   ? -5.463  34.673 2.132  1.00 28.63 ? 4   PHE B CG  1 
ATOM   1049 C CD1 . PHE B 1 4   ? -4.931  35.512 3.046  1.00 27.57 ? 4   PHE B CD1 1 
ATOM   1050 C CD2 . PHE B 1 4   ? -6.473  35.128 1.282  1.00 29.70 ? 4   PHE B CD2 1 
ATOM   1051 C CE1 . PHE B 1 4   ? -5.398  36.820 3.173  1.00 27.54 ? 4   PHE B CE1 1 
ATOM   1052 C CE2 . PHE B 1 4   ? -6.946  36.420 1.387  1.00 29.29 ? 4   PHE B CE2 1 
ATOM   1053 C CZ  . PHE B 1 4   ? -6.415  37.270 2.323  1.00 27.67 ? 4   PHE B CZ  1 
ATOM   1054 N N   . SER B 1 5   ? -7.938  33.298 3.563  1.00 31.18 ? 5   SER B N   1 
ATOM   1055 C CA  . SER B 1 5   ? -9.277  33.795 3.250  1.00 32.53 ? 5   SER B CA  1 
ATOM   1056 C C   . SER B 1 5   ? -9.387  35.212 3.804  1.00 31.70 ? 5   SER B C   1 
ATOM   1057 O O   . SER B 1 5   ? -8.745  35.567 4.780  1.00 29.27 ? 5   SER B O   1 
ATOM   1058 C CB  . SER B 1 5   ? -10.384 32.899 3.806  1.00 34.46 ? 5   SER B CB  1 
ATOM   1059 O OG  . SER B 1 5   ? -10.371 32.950 5.196  1.00 33.70 ? 5   SER B OG  1 
ATOM   1060 N N   . GLU B 1 6   ? -10.216 36.025 3.161  1.00 33.34 ? 6   GLU B N   1 
ATOM   1061 C CA  . GLU B 1 6   ? -10.482 37.391 3.666  1.00 32.40 ? 6   GLU B CA  1 
ATOM   1062 C C   . GLU B 1 6   ? -11.115 37.350 5.051  1.00 32.94 ? 6   GLU B C   1 
ATOM   1063 O O   . GLU B 1 6   ? -10.745 38.149 5.902  1.00 31.37 ? 6   GLU B O   1 
ATOM   1064 C CB  . GLU B 1 6   ? -11.322 38.197 2.648  1.00 33.44 ? 6   GLU B CB  1 
ATOM   1065 C CG  . GLU B 1 6   ? -10.647 38.305 1.281  1.00 33.39 ? 6   GLU B CG  1 
ATOM   1066 C CD  . GLU B 1 6   ? -11.361 39.262 0.306  1.00 34.41 ? 6   GLU B CD  1 
ATOM   1067 O OE1 . GLU B 1 6   ? -12.330 39.931 0.725  1.00 34.84 ? 6   GLU B OE1 1 
ATOM   1068 O OE2 . GLU B 1 6   ? -10.938 39.347 -0.871 1.00 34.27 ? 6   GLU B OE2 1 
ATOM   1069 N N   . SER B 1 7   ? -12.033 36.410 5.310  1.00 35.48 ? 7   SER B N   1 
ATOM   1070 C CA  . SER B 1 7   ? -12.627 36.290 6.647  1.00 36.58 ? 7   SER B CA  1 
ATOM   1071 C C   . SER B 1 7   ? -11.618 35.950 7.763  1.00 34.60 ? 7   SER B C   1 
ATOM   1072 O O   . SER B 1 7   ? -11.685 36.523 8.837  1.00 32.77 ? 7   SER B O   1 
ATOM   1073 C CB  . SER B 1 7   ? -13.802 35.292 6.690  1.00 40.41 ? 7   SER B CB  1 
ATOM   1074 O OG  . SER B 1 7   ? -13.397 34.090 6.057  1.00 43.06 ? 7   SER B OG  1 
ATOM   1075 N N   . ALA B 1 8   ? -10.689 35.042 7.508  1.00 34.07 ? 8   ALA B N   1 
ATOM   1076 C CA  . ALA B 1 8   ? -9.620  34.763 8.484  1.00 32.80 ? 8   ALA B CA  1 
ATOM   1077 C C   . ALA B 1 8   ? -8.771  36.018 8.721  1.00 31.04 ? 8   ALA B C   1 
ATOM   1078 O O   . ALA B 1 8   ? -8.436  36.357 9.872  1.00 29.99 ? 8   ALA B O   1 
ATOM   1079 C CB  . ALA B 1 8   ? -8.747  33.624 8.025  1.00 32.87 ? 8   ALA B CB  1 
ATOM   1080 N N   . LEU B 1 9   ? -8.449  36.728 7.655  1.00 30.43 ? 9   LEU B N   1 
ATOM   1081 C CA  . LEU B 1 9   ? -7.732  37.982 7.815  1.00 28.98 ? 9   LEU B CA  1 
ATOM   1082 C C   . LEU B 1 9   ? -8.493  38.949 8.704  1.00 30.09 ? 9   LEU B C   1 
ATOM   1083 O O   . LEU B 1 9   ? -7.919  39.534 9.638  1.00 29.43 ? 9   LEU B O   1 
ATOM   1084 C CB  . LEU B 1 9   ? -7.394  38.629 6.470  1.00 28.45 ? 9   LEU B CB  1 
ATOM   1085 C CG  . LEU B 1 9   ? -6.615  39.964 6.548  1.00 27.62 ? 9   LEU B CG  1 
ATOM   1086 C CD1 . LEU B 1 9   ? -5.379  39.878 7.426  1.00 26.60 ? 9   LEU B CD1 1 
ATOM   1087 C CD2 . LEU B 1 9   ? -6.200  40.436 5.162  1.00 28.25 ? 9   LEU B CD2 1 
ATOM   1088 N N   . GLU B 1 10  ? -9.781  39.112 8.424  1.00 33.04 ? 10  GLU B N   1 
ATOM   1089 C CA  . GLU B 1 10  ? -10.652 39.991 9.220  1.00 34.66 ? 10  GLU B CA  1 
ATOM   1090 C C   . GLU B 1 10  ? -10.593 39.684 10.702 1.00 34.81 ? 10  GLU B C   1 
ATOM   1091 O O   . GLU B 1 10  ? -10.488 40.610 11.522 1.00 33.66 ? 10  GLU B O   1 
ATOM   1092 C CB  . GLU B 1 10  ? -12.115 39.929 8.732  1.00 38.33 ? 10  GLU B CB  1 
ATOM   1093 C CG  . GLU B 1 10  ? -12.299 40.670 7.407  1.00 40.28 ? 10  GLU B CG  1 
ATOM   1094 C CD  . GLU B 1 10  ? -13.597 40.320 6.696  1.00 43.72 ? 10  GLU B CD  1 
ATOM   1095 O OE1 . GLU B 1 10  ? -14.444 39.628 7.273  1.00 44.94 ? 10  GLU B OE1 1 
ATOM   1096 O OE2 . GLU B 1 10  ? -13.742 40.728 5.527  1.00 47.00 ? 10  GLU B OE2 1 
ATOM   1097 N N   . LYS B 1 11  ? -10.667 38.391 11.052 1.00 36.12 ? 11  LYS B N   1 
ATOM   1098 C CA  . LYS B 1 11  ? -10.587 38.008 12.455 1.00 37.35 ? 11  LYS B CA  1 
ATOM   1099 C C   . LYS B 1 11  ? -9.213  38.345 13.025 1.00 35.25 ? 11  LYS B C   1 
ATOM   1100 O O   . LYS B 1 11  ? -9.111  38.869 14.126 1.00 34.46 ? 11  LYS B O   1 
ATOM   1101 C CB  . LYS B 1 11  ? -10.927 36.526 12.701 1.00 39.81 ? 11  LYS B CB  1 
ATOM   1102 C CG  . LYS B 1 11  ? -11.189 36.256 14.188 1.00 42.55 ? 11  LYS B CG  1 
ATOM   1103 C CD  . LYS B 1 11  ? -11.229 34.776 14.525 1.00 45.99 ? 11  LYS B CD  1 
ATOM   1104 N N   . LYS B 1 12  ? -8.154  38.050 12.274 1.00 35.25 ? 12  LYS B N   1 
ATOM   1105 C CA  . LYS B 1 12  ? -6.789  38.319 12.757 1.00 33.32 ? 12  LYS B CA  1 
ATOM   1106 C C   . LYS B 1 12  ? -6.547  39.802 12.987 1.00 32.46 ? 12  LYS B C   1 
ATOM   1107 O O   . LYS B 1 12  ? -5.954  40.158 13.985 1.00 31.76 ? 12  LYS B O   1 
ATOM   1108 C CB  . LYS B 1 12  ? -5.754  37.793 11.816 1.00 33.79 ? 12  LYS B CB  1 
ATOM   1109 C CG  . LYS B 1 12  ? -5.688  36.315 11.820 1.00 35.56 ? 12  LYS B CG  1 
ATOM   1110 C CD  . LYS B 1 12  ? -5.009  35.837 10.562 1.00 37.41 ? 12  LYS B CD  1 
ATOM   1111 C CE  . LYS B 1 12  ? -5.242  34.354 10.390 1.00 39.28 ? 12  LYS B CE  1 
ATOM   1112 N NZ  . LYS B 1 12  ? -4.327  33.577 11.241 1.00 41.21 ? 12  LYS B NZ  1 
ATOM   1113 N N   . LEU B 1 13  ? -7.028  40.647 12.074 1.00 32.00 ? 13  LEU B N   1 
ATOM   1114 C CA  . LEU B 1 13  ? -6.929  42.090 12.236 1.00 31.08 ? 13  LEU B CA  1 
ATOM   1115 C C   . LEU B 1 13  ? -7.696  42.613 13.430 1.00 32.32 ? 13  LEU B C   1 
ATOM   1116 O O   . LEU B 1 13  ? -7.231  43.548 14.095 1.00 31.46 ? 13  LEU B O   1 
ATOM   1117 C CB  . LEU B 1 13  ? -7.403  42.805 10.988 1.00 31.22 ? 13  LEU B CB  1 
ATOM   1118 C CG  . LEU B 1 13  ? -6.483  42.637 9.789  1.00 29.73 ? 13  LEU B CG  1 
ATOM   1119 C CD1 . LEU B 1 13  ? -7.225  43.120 8.546  1.00 30.99 ? 13  LEU B CD1 1 
ATOM   1120 C CD2 . LEU B 1 13  ? -5.130  43.355 9.943  1.00 27.99 ? 13  LEU B CD2 1 
ATOM   1121 N N   . SER B 1 14  ? -8.849  42.013 13.728 1.00 34.62 ? 14  SER B N   1 
ATOM   1122 C CA  . SER B 1 14  ? -9.614  42.413 14.921 1.00 36.39 ? 14  SER B CA  1 
ATOM   1123 C C   . SER B 1 14  ? -8.911  41.977 16.190 1.00 36.66 ? 14  SER B C   1 
ATOM   1124 O O   . SER B 1 14  ? -9.286  42.424 17.268 1.00 36.09 ? 14  SER B O   1 
ATOM   1125 C CB  . SER B 1 14  ? -11.020 41.824 14.919 1.00 38.09 ? 14  SER B CB  1 
ATOM   1126 O OG  . SER B 1 14  ? -10.934 40.446 15.202 1.00 38.78 ? 14  SER B OG  1 
ATOM   1127 N N   . GLU B 1 15  ? -7.911  41.087 16.077 1.00 37.05 ? 15  GLU B N   1 
ATOM   1128 C CA  . GLU B 1 15  ? -7.144  40.628 17.257 1.00 38.06 ? 15  GLU B CA  1 
ATOM   1129 C C   . GLU B 1 15  ? -5.803  41.400 17.460 1.00 36.53 ? 15  GLU B C   1 
ATOM   1130 O O   . GLU B 1 15  ? -5.081  41.171 18.411 1.00 35.93 ? 15  GLU B O   1 
ATOM   1131 C CB  . GLU B 1 15  ? -6.947  39.097 17.211 1.00 39.28 ? 15  GLU B CB  1 
ATOM   1132 C CG  . GLU B 1 15  ? -8.255  38.384 17.533 1.00 44.55 ? 15  GLU B CG  1 
ATOM   1133 C CD  . GLU B 1 15  ? -8.391  36.962 17.011 1.00 48.40 ? 15  GLU B CD  1 
ATOM   1134 O OE1 . GLU B 1 15  ? -7.521  36.480 16.223 1.00 48.91 ? 15  GLU B OE1 1 
ATOM   1135 O OE2 . GLU B 1 15  ? -9.435  36.339 17.371 1.00 55.28 ? 15  GLU B OE2 1 
ATOM   1136 N N   . LEU B 1 16  ? -5.509  42.349 16.586 1.00 34.97 ? 16  LEU B N   1 
ATOM   1137 C CA  . LEU B 1 16  ? -4.374  43.247 16.817 1.00 33.80 ? 16  LEU B CA  1 
ATOM   1138 C C   . LEU B 1 16  ? -4.507  43.949 18.185 1.00 34.74 ? 16  LEU B C   1 
ATOM   1139 O O   . LEU B 1 16  ? -5.589  44.264 18.624 1.00 35.93 ? 16  LEU B O   1 
ATOM   1140 C CB  . LEU B 1 16  ? -4.290  44.304 15.702 1.00 32.22 ? 16  LEU B CB  1 
ATOM   1141 C CG  . LEU B 1 16  ? -3.848  43.764 14.330 1.00 31.86 ? 16  LEU B CG  1 
ATOM   1142 C CD1 . LEU B 1 16  ? -4.083  44.824 13.256 1.00 32.51 ? 16  LEU B CD1 1 
ATOM   1143 C CD2 . LEU B 1 16  ? -2.398  43.334 14.339 1.00 30.50 ? 16  LEU B CD2 1 
ATOM   1144 N N   . SER B 1 17  ? -3.371  44.179 18.821 1.00 33.96 ? 17  SER B N   1 
ATOM   1145 C CA  . SER B 1 17  ? -3.257  44.908 20.092 1.00 34.06 ? 17  SER B CA  1 
ATOM   1146 C C   . SER B 1 17  ? -3.561  46.410 19.961 1.00 33.16 ? 17  SER B C   1 
ATOM   1147 O O   . SER B 1 17  ? -3.505  46.996 18.869 1.00 30.93 ? 17  SER B O   1 
ATOM   1148 C CB  . SER B 1 17  ? -1.814  44.776 20.545 1.00 34.83 ? 17  SER B CB  1 
ATOM   1149 O OG  . SER B 1 17  ? -0.926  45.173 19.444 1.00 37.34 ? 17  SER B OG  1 
ATOM   1150 N N   . ASN B 1 18  ? -3.874  47.016 21.099 1.00 33.90 ? 18  ASN B N   1 
ATOM   1151 C CA  . ASN B 1 18  ? -3.866  48.463 21.280 1.00 35.90 ? 18  ASN B CA  1 
ATOM   1152 C C   . ASN B 1 18  ? -2.537  49.005 20.895 1.00 32.88 ? 18  ASN B C   1 
ATOM   1153 O O   . ASN B 1 18  ? -1.529  48.521 21.403 1.00 33.25 ? 18  ASN B O   1 
ATOM   1154 C CB  . ASN B 1 18  ? -4.054  48.846 22.769 1.00 39.27 ? 18  ASN B CB  1 
ATOM   1155 C CG  . ASN B 1 18  ? -5.467  48.673 23.227 1.00 43.57 ? 18  ASN B CG  1 
ATOM   1156 O OD1 . ASN B 1 18  ? -6.306  48.033 22.531 1.00 47.58 ? 18  ASN B OD1 1 
ATOM   1157 N ND2 . ASN B 1 18  ? -5.775  49.248 24.364 1.00 44.65 ? 18  ASN B ND2 1 
ATOM   1158 N N   . SER B 1 19  ? -2.529  50.052 20.085 1.00 31.22 ? 19  SER B N   1 
ATOM   1159 C CA  . SER B 1 19  ? -1.278  50.595 19.536 1.00 30.38 ? 19  SER B CA  1 
ATOM   1160 C C   . SER B 1 19  ? -0.378  51.146 20.672 1.00 30.61 ? 19  SER B C   1 
ATOM   1161 O O   . SER B 1 19  ? 0.832   51.081 20.616 1.00 28.88 ? 19  SER B O   1 
ATOM   1162 C CB  . SER B 1 19  ? -1.581  51.676 18.471 1.00 30.62 ? 19  SER B CB  1 
ATOM   1163 O OG  . SER B 1 19  ? -2.463  52.679 18.939 1.00 30.87 ? 19  SER B OG  1 
ATOM   1164 N N   . GLN B 1 20  ? -1.004  51.665 21.718 1.00 33.19 ? 20  GLN B N   1 
ATOM   1165 C CA  . GLN B 1 20  ? -0.263  52.093 22.883 1.00 35.13 ? 20  GLN B CA  1 
ATOM   1166 C C   . GLN B 1 20  ? 0.556   50.944 23.548 1.00 32.38 ? 20  GLN B C   1 
ATOM   1167 O O   . GLN B 1 20  ? 1.520   51.201 24.216 1.00 31.20 ? 20  GLN B O   1 
ATOM   1168 C CB  . GLN B 1 20  ? -1.205  52.750 23.874 1.00 39.13 ? 20  GLN B CB  1 
ATOM   1169 C CG  . GLN B 1 20  ? -2.044  51.752 24.645 1.00 42.69 ? 20  GLN B CG  1 
ATOM   1170 C CD  . GLN B 1 20  ? -3.207  52.397 25.397 1.00 46.70 ? 20  GLN B CD  1 
ATOM   1171 O OE1 . GLN B 1 20  ? -4.310  51.838 25.441 1.00 49.59 ? 20  GLN B OE1 1 
ATOM   1172 N NE2 . GLN B 1 20  ? -2.971  53.567 25.979 1.00 47.62 ? 20  GLN B NE2 1 
ATOM   1173 N N   . HIS B 1 21  ? 0.202   49.682 23.334 1.00 32.21 ? 21  HIS B N   1 
ATOM   1174 C CA  . HIS B 1 21  ? 0.946   48.579 23.978 1.00 32.07 ? 21  HIS B CA  1 
ATOM   1175 C C   . HIS B 1 21  ? 1.773   47.761 23.007 1.00 31.11 ? 21  HIS B C   1 
ATOM   1176 O O   . HIS B 1 21  ? 2.428   46.782 23.409 1.00 31.98 ? 21  HIS B O   1 
ATOM   1177 C CB  . HIS B 1 21  ? -0.042  47.641 24.647 1.00 33.20 ? 21  HIS B CB  1 
ATOM   1178 C CG  . HIS B 1 21  ? -0.912  48.297 25.681 1.00 35.15 ? 21  HIS B CG  1 
ATOM   1179 N ND1 . HIS B 1 21  ? -0.437  49.185 26.579 1.00 37.31 ? 21  HIS B ND1 1 
ATOM   1180 C CD2 . HIS B 1 21  ? -2.258  48.115 25.981 1.00 36.86 ? 21  HIS B CD2 1 
ATOM   1181 C CE1 . HIS B 1 21  ? -1.439  49.567 27.407 1.00 39.15 ? 21  HIS B CE1 1 
ATOM   1182 N NE2 . HIS B 1 21  ? -2.549  48.907 27.046 1.00 39.18 ? 21  HIS B NE2 1 
ATOM   1183 N N   . SER B 1 22  ? 1.727   48.124 21.732 1.00 30.01 ? 22  SER B N   1 
ATOM   1184 C CA  A SER B 1 22  ? 2.366   47.331 20.692 0.70 29.49 ? 22  SER B CA  1 
ATOM   1185 C CA  B SER B 1 22  ? 2.370   47.374 20.660 0.30 28.61 ? 22  SER B CA  1 
ATOM   1186 C C   . SER B 1 22  ? 3.903   47.404 20.786 1.00 28.25 ? 22  SER B C   1 
ATOM   1187 O O   . SER B 1 22  ? 4.491   48.389 21.294 1.00 27.35 ? 22  SER B O   1 
ATOM   1188 C CB  A SER B 1 22  ? 1.934   47.836 19.316 0.70 31.16 ? 22  SER B CB  1 
ATOM   1189 C CB  B SER B 1 22  ? 1.976   47.964 19.288 0.30 28.73 ? 22  SER B CB  1 
ATOM   1190 O OG  A SER B 1 22  ? 2.399   49.159 19.126 0.70 33.33 ? 22  SER B OG  1 
ATOM   1191 O OG  B SER B 1 22  ? 0.567   47.977 19.070 0.30 28.61 ? 22  SER B OG  1 
ATOM   1192 N N   . VAL B 1 23  ? 4.531   46.345 20.312 1.00 26.66 ? 23  VAL B N   1 
ATOM   1193 C CA  . VAL B 1 23  ? 5.984   46.258 20.201 1.00 25.87 ? 23  VAL B CA  1 
ATOM   1194 C C   . VAL B 1 23  ? 6.576   47.591 19.621 1.00 25.92 ? 23  VAL B C   1 
ATOM   1195 O O   . VAL B 1 23  ? 7.479   48.197 20.245 1.00 24.23 ? 23  VAL B O   1 
ATOM   1196 C CB  . VAL B 1 23  ? 6.333   44.998 19.381 1.00 25.67 ? 23  VAL B CB  1 
ATOM   1197 C CG1 . VAL B 1 23  ? 7.730   45.075 18.739 1.00 26.73 ? 23  VAL B CG1 1 
ATOM   1198 C CG2 . VAL B 1 23  ? 6.199   43.770 20.285 1.00 27.04 ? 23  VAL B CG2 1 
ATOM   1199 N N   . GLN B 1 24  ? 6.021   48.074 18.491 1.00 24.27 ? 24  GLN B N   1 
ATOM   1200 C CA  . GLN B 1 24  ? 6.606   49.220 17.815 1.00 24.75 ? 24  GLN B CA  1 
ATOM   1201 C C   . GLN B 1 24  ? 6.496   50.505 18.635 1.00 26.26 ? 24  GLN B C   1 
ATOM   1202 O O   . GLN B 1 24  ? 7.397   51.360 18.537 1.00 26.88 ? 24  GLN B O   1 
ATOM   1203 C CB  . GLN B 1 24  ? 6.092   49.368 16.358 1.00 24.76 ? 24  GLN B CB  1 
ATOM   1204 C CG  . GLN B 1 24  ? 6.745   48.372 15.385 1.00 23.70 ? 24  GLN B CG  1 
ATOM   1205 C CD  . GLN B 1 24  ? 6.125   48.380 14.011 1.00 24.30 ? 24  GLN B CD  1 
ATOM   1206 O OE1 . GLN B 1 24  ? 6.067   49.408 13.374 1.00 27.18 ? 24  GLN B OE1 1 
ATOM   1207 N NE2 . GLN B 1 24  ? 5.647   47.225 13.541 1.00 24.28 ? 24  GLN B NE2 1 
ATOM   1208 N N   . THR B 1 25  ? 5.465   50.629 19.498 1.00 26.75 ? 25  THR B N   1 
ATOM   1209 C CA  . THR B 1 25  ? 5.389   51.770 20.438 1.00 28.70 ? 25  THR B CA  1 
ATOM   1210 C C   . THR B 1 25  ? 6.405   51.630 21.580 1.00 29.28 ? 25  THR B C   1 
ATOM   1211 O O   . THR B 1 25  ? 7.179   52.567 21.861 1.00 29.50 ? 25  THR B O   1 
ATOM   1212 C CB  . THR B 1 25  ? 3.960   51.971 21.007 1.00 29.33 ? 25  THR B CB  1 
ATOM   1213 O OG1 . THR B 1 25  ? 3.077   52.294 19.927 1.00 28.46 ? 25  THR B OG1 1 
ATOM   1214 C CG2 . THR B 1 25  ? 3.937   53.087 22.068 1.00 30.80 ? 25  THR B CG2 1 
ATOM   1215 N N   . LEU B 1 26  ? 6.451   50.458 22.196 1.00 28.10 ? 26  LEU B N   1 
ATOM   1216 C CA  . LEU B 1 26  ? 7.383   50.258 23.303 1.00 29.98 ? 26  LEU B CA  1 
ATOM   1217 C C   . LEU B 1 26  ? 8.816   50.494 22.826 1.00 29.50 ? 26  LEU B C   1 
ATOM   1218 O O   . LEU B 1 26  ? 9.623   51.067 23.568 1.00 29.93 ? 26  LEU B O   1 
ATOM   1219 C CB  . LEU B 1 26  ? 7.261   48.874 23.924 1.00 28.90 ? 26  LEU B CB  1 
ATOM   1220 C CG  . LEU B 1 26  ? 8.119   48.644 25.172 1.00 29.46 ? 26  LEU B CG  1 
ATOM   1221 C CD1 . LEU B 1 26  ? 8.018   49.750 26.193 1.00 31.22 ? 26  LEU B CD1 1 
ATOM   1222 C CD2 . LEU B 1 26  ? 7.646   47.347 25.811 1.00 29.51 ? 26  LEU B CD2 1 
ATOM   1223 N N   . SER B 1 27  ? 9.070   50.127 21.578 1.00 28.13 ? 27  SER B N   1 
ATOM   1224 C CA  . SER B 1 27  ? 10.402  50.263 20.972 1.00 30.12 ? 27  SER B CA  1 
ATOM   1225 C C   . SER B 1 27  ? 10.844  51.722 20.869 1.00 31.60 ? 27  SER B C   1 
ATOM   1226 O O   . SER B 1 27  ? 11.960  52.055 21.195 1.00 30.87 ? 27  SER B O   1 
ATOM   1227 C CB  . SER B 1 27  ? 10.427  49.676 19.590 1.00 29.69 ? 27  SER B CB  1 
ATOM   1228 O OG  . SER B 1 27  ? 11.751  49.672 19.094 1.00 32.19 ? 27  SER B OG  1 
ATOM   1229 N N   . LEU B 1 28  ? 9.947   52.564 20.402 1.00 32.56 ? 28  LEU B N   1 
ATOM   1230 C CA  . LEU B 1 28  ? 10.199  54.011 20.344 1.00 35.80 ? 28  LEU B CA  1 
ATOM   1231 C C   . LEU B 1 28  ? 10.635  54.526 21.719 1.00 36.75 ? 28  LEU B C   1 
ATOM   1232 O O   . LEU B 1 28  ? 11.622  55.261 21.849 1.00 39.25 ? 28  LEU B O   1 
ATOM   1233 C CB  . LEU B 1 28  ? 8.918   54.722 19.877 1.00 37.37 ? 28  LEU B CB  1 
ATOM   1234 C CG  . LEU B 1 28  ? 9.135   55.903 18.945 1.00 41.98 ? 28  LEU B CG  1 
ATOM   1235 C CD1 . LEU B 1 28  ? 9.336   55.428 17.524 1.00 40.52 ? 28  LEU B CD1 1 
ATOM   1236 C CD2 . LEU B 1 28  ? 7.978   56.913 19.036 1.00 44.59 ? 28  LEU B CD2 1 
ATOM   1237 N N   . TRP B 1 29  ? 9.879   54.129 22.740 1.00 35.67 ? 29  TRP B N   1 
ATOM   1238 C CA  . TRP B 1 29  ? 10.114  54.516 24.132 1.00 36.03 ? 29  TRP B CA  1 
ATOM   1239 C C   . TRP B 1 29  ? 11.449  54.062 24.622 1.00 35.79 ? 29  TRP B C   1 
ATOM   1240 O O   . TRP B 1 29  ? 12.194  54.843 25.208 1.00 36.43 ? 29  TRP B O   1 
ATOM   1241 C CB  . TRP B 1 29  ? 9.008   53.937 25.037 1.00 35.30 ? 29  TRP B CB  1 
ATOM   1242 C CG  . TRP B 1 29  ? 8.974   54.502 26.432 1.00 37.24 ? 29  TRP B CG  1 
ATOM   1243 C CD1 . TRP B 1 29  ? 8.455   55.729 26.832 1.00 38.70 ? 29  TRP B CD1 1 
ATOM   1244 C CD2 . TRP B 1 29  ? 9.431   53.862 27.665 1.00 37.01 ? 29  TRP B CD2 1 
ATOM   1245 N NE1 . TRP B 1 29  ? 8.605   55.900 28.185 1.00 39.80 ? 29  TRP B NE1 1 
ATOM   1246 C CE2 . TRP B 1 29  ? 9.164   54.815 28.745 1.00 39.09 ? 29  TRP B CE2 1 
ATOM   1247 C CE3 . TRP B 1 29  ? 10.027  52.647 27.969 1.00 36.64 ? 29  TRP B CE3 1 
ATOM   1248 C CZ2 . TRP B 1 29  ? 9.485   54.544 30.064 1.00 39.93 ? 29  TRP B CZ2 1 
ATOM   1249 C CZ3 . TRP B 1 29  ? 10.342  52.366 29.305 1.00 37.34 ? 29  TRP B CZ3 1 
ATOM   1250 C CH2 . TRP B 1 29  ? 10.077  53.302 30.332 1.00 39.97 ? 29  TRP B CH2 1 
ATOM   1251 N N   . LEU B 1 30  ? 11.768  52.794 24.387 1.00 34.18 ? 30  LEU B N   1 
ATOM   1252 C CA  . LEU B 1 30  ? 13.061  52.279 24.787 1.00 34.86 ? 30  LEU B CA  1 
ATOM   1253 C C   . LEU B 1 30  ? 14.229  52.992 24.063 1.00 36.54 ? 30  LEU B C   1 
ATOM   1254 O O   . LEU B 1 30  ? 15.239  53.287 24.680 1.00 36.24 ? 30  LEU B O   1 
ATOM   1255 C CB  . LEU B 1 30  ? 13.146  50.784 24.559 1.00 33.03 ? 30  LEU B CB  1 
ATOM   1256 C CG  . LEU B 1 30  ? 12.145  49.930 25.389 1.00 33.26 ? 30  LEU B CG  1 
ATOM   1257 C CD1 . LEU B 1 30  ? 12.388  48.465 25.123 1.00 32.74 ? 30  LEU B CD1 1 
ATOM   1258 C CD2 . LEU B 1 30  ? 12.280  50.200 26.872 1.00 34.92 ? 30  LEU B CD2 1 
ATOM   1259 N N   . ILE B 1 31  ? 14.083  53.230 22.757 1.00 36.36 ? 31  ILE B N   1 
ATOM   1260 C CA  . ILE B 1 31  ? 15.126  53.910 22.000 1.00 38.37 ? 31  ILE B CA  1 
ATOM   1261 C C   . ILE B 1 31  ? 15.329  55.331 22.535 1.00 40.12 ? 31  ILE B C   1 
ATOM   1262 O O   . ILE B 1 31  ? 16.437  55.782 22.648 1.00 41.01 ? 31  ILE B O   1 
ATOM   1263 C CB  . ILE B 1 31  ? 14.827  53.914 20.492 1.00 37.32 ? 31  ILE B CB  1 
ATOM   1264 C CG1 . ILE B 1 31  ? 15.143  52.528 19.934 1.00 36.71 ? 31  ILE B CG1 1 
ATOM   1265 C CG2 . ILE B 1 31  ? 15.648  55.005 19.790 1.00 40.00 ? 31  ILE B CG2 1 
ATOM   1266 C CD1 . ILE B 1 31  ? 14.469  52.184 18.624 1.00 36.05 ? 31  ILE B CD1 1 
ATOM   1267 N N   . HIS B 1 32  ? 14.231  56.005 22.850 1.00 42.01 ? 32  HIS B N   1 
ATOM   1268 C CA  . HIS B 1 32  ? 14.270  57.353 23.352 1.00 45.40 ? 32  HIS B CA  1 
ATOM   1269 C C   . HIS B 1 32  ? 15.006  57.381 24.662 1.00 46.38 ? 32  HIS B C   1 
ATOM   1270 O O   . HIS B 1 32  ? 15.684  58.351 24.971 1.00 50.72 ? 32  HIS B O   1 
ATOM   1271 C CB  . HIS B 1 32  ? 12.839  57.891 23.506 1.00 46.95 ? 32  HIS B CB  1 
ATOM   1272 C CG  . HIS B 1 32  ? 12.773  59.226 24.200 1.00 50.34 ? 32  HIS B CG  1 
ATOM   1273 N ND1 . HIS B 1 32  ? 13.373  60.326 23.705 1.00 53.66 ? 32  HIS B ND1 1 
ATOM   1274 C CD2 . HIS B 1 32  ? 12.172  59.613 25.398 1.00 52.53 ? 32  HIS B CD2 1 
ATOM   1275 C CE1 . HIS B 1 32  ? 13.172  61.373 24.544 1.00 54.71 ? 32  HIS B CE1 1 
ATOM   1276 N NE2 . HIS B 1 32  ? 12.437  60.943 25.575 1.00 54.09 ? 32  HIS B NE2 1 
ATOM   1277 N N   . HIS B 1 33  ? 14.874  56.310 25.442 1.00 43.97 ? 33  HIS B N   1 
ATOM   1278 C CA  . HIS B 1 33  ? 15.579  56.171 26.694 1.00 44.71 ? 33  HIS B CA  1 
ATOM   1279 C C   . HIS B 1 33  ? 16.838  55.339 26.589 1.00 44.67 ? 33  HIS B C   1 
ATOM   1280 O O   . HIS B 1 33  ? 17.217  54.685 27.560 1.00 46.20 ? 33  HIS B O   1 
ATOM   1281 C CB  . HIS B 1 33  ? 14.633  55.594 27.745 1.00 43.51 ? 33  HIS B CB  1 
ATOM   1282 C CG  . HIS B 1 33  ? 13.560  56.565 28.197 1.00 45.87 ? 33  HIS B CG  1 
ATOM   1283 N ND1 . HIS B 1 33  ? 13.850  57.763 28.751 1.00 47.58 ? 33  HIS B ND1 1 
ATOM   1284 C CD2 . HIS B 1 33  ? 12.166  56.483 28.163 1.00 45.69 ? 33  HIS B CD2 1 
ATOM   1285 C CE1 . HIS B 1 33  ? 12.711  58.409 29.062 1.00 48.82 ? 33  HIS B CE1 1 
ATOM   1286 N NE2 . HIS B 1 33  ? 11.682  57.633 28.706 1.00 48.06 ? 33  HIS B NE2 1 
ATOM   1287 N N   . ARG B 1 34  ? 17.512  55.363 25.433 1.00 43.62 ? 34  ARG B N   1 
ATOM   1288 C CA  . ARG B 1 34  ? 18.731  54.541 25.224 1.00 43.03 ? 34  ARG B CA  1 
ATOM   1289 C C   . ARG B 1 34  ? 19.872  54.795 26.197 1.00 45.66 ? 34  ARG B C   1 
ATOM   1290 O O   . ARG B 1 34  ? 20.714  53.906 26.397 1.00 44.59 ? 34  ARG B O   1 
ATOM   1291 C CB  . ARG B 1 34  ? 19.299  54.716 23.804 1.00 43.58 ? 34  ARG B CB  1 
ATOM   1292 C CG  . ARG B 1 34  ? 19.637  56.139 23.403 1.00 45.80 ? 34  ARG B CG  1 
ATOM   1293 C CD  . ARG B 1 34  ? 19.815  56.264 21.900 1.00 46.14 ? 34  ARG B CD  1 
ATOM   1294 N NE  . ARG B 1 34  ? 19.983  57.659 21.476 1.00 48.67 ? 34  ARG B NE  1 
ATOM   1295 C CZ  . ARG B 1 34  ? 18.976  58.501 21.244 1.00 50.40 ? 34  ARG B CZ  1 
ATOM   1296 N NH1 . ARG B 1 34  ? 19.249  59.733 20.864 1.00 53.61 ? 34  ARG B NH1 1 
ATOM   1297 N NH2 . ARG B 1 34  ? 17.690  58.138 21.398 1.00 48.27 ? 34  ARG B NH2 1 
ATOM   1298 N N   . LYS B 1 35  ? 19.915  55.993 26.781 1.00 48.07 ? 35  LYS B N   1 
ATOM   1299 C CA  . LYS B 1 35  ? 20.916  56.277 27.831 1.00 51.44 ? 35  LYS B CA  1 
ATOM   1300 C C   . LYS B 1 35  ? 20.733  55.319 29.038 1.00 51.37 ? 35  LYS B C   1 
ATOM   1301 O O   . LYS B 1 35  ? 21.552  55.318 29.953 1.00 51.92 ? 35  LYS B O   1 
ATOM   1302 C CB  . LYS B 1 35  ? 20.936  57.783 28.226 1.00 54.58 ? 35  LYS B CB  1 
ATOM   1303 C CG  . LYS B 1 35  ? 20.159  58.223 29.465 1.00 56.18 ? 35  LYS B CG  1 
ATOM   1304 C CD  . LYS B 1 35  ? 20.181  59.758 29.670 1.00 58.79 ? 35  LYS B CD  1 
ATOM   1305 C CE  . LYS B 1 35  ? 20.294  60.182 31.154 1.00 61.47 ? 35  LYS B CE  1 
ATOM   1306 N N   . HIS B 1 36  ? 19.684  54.475 29.002 1.00 48.01 ? 36  HIS B N   1 
ATOM   1307 C CA  . HIS B 1 36  ? 19.428  53.497 30.073 1.00 47.55 ? 36  HIS B CA  1 
ATOM   1308 C C   . HIS B 1 36  ? 19.449  52.058 29.572 1.00 45.30 ? 36  HIS B C   1 
ATOM   1309 O O   . HIS B 1 36  ? 18.855  51.177 30.187 1.00 44.25 ? 36  HIS B O   1 
ATOM   1310 C CB  . HIS B 1 36  ? 18.067  53.784 30.740 1.00 47.28 ? 36  HIS B CB  1 
ATOM   1311 C CG  . HIS B 1 36  ? 17.913  55.213 31.315 1.00 49.54 ? 36  HIS B CG  1 
ATOM   1312 N ND1 . HIS B 1 36  ? 18.263  55.536 32.583 1.00 51.39 ? 36  HIS B ND1 1 
ATOM   1313 C CD2 . HIS B 1 36  ? 17.361  56.381 30.757 1.00 49.86 ? 36  HIS B CD2 1 
ATOM   1314 C CE1 . HIS B 1 36  ? 17.981  56.843 32.815 1.00 52.95 ? 36  HIS B CE1 1 
ATOM   1315 N NE2 . HIS B 1 36  ? 17.430  57.359 31.709 1.00 52.20 ? 36  HIS B NE2 1 
ATOM   1316 N N   . ALA B 1 37  ? 20.140  51.796 28.462 1.00 45.00 ? 37  ALA B N   1 
ATOM   1317 C CA  . ALA B 1 37  ? 20.034  50.495 27.787 1.00 43.17 ? 37  ALA B CA  1 
ATOM   1318 C C   . ALA B 1 37  ? 20.409  49.338 28.698 1.00 43.32 ? 37  ALA B C   1 
ATOM   1319 O O   . ALA B 1 37  ? 19.862  48.251 28.566 1.00 41.84 ? 37  ALA B O   1 
ATOM   1320 C CB  . ALA B 1 37  ? 20.894  50.463 26.543 1.00 43.42 ? 37  ALA B CB  1 
ATOM   1321 N N   . GLY B 1 38  ? 21.326  49.580 29.634 1.00 43.74 ? 38  GLY B N   1 
ATOM   1322 C CA  . GLY B 1 38  ? 21.872  48.507 30.454 1.00 44.31 ? 38  GLY B CA  1 
ATOM   1323 C C   . GLY B 1 38  ? 20.800  47.953 31.372 1.00 43.08 ? 38  GLY B C   1 
ATOM   1324 O O   . GLY B 1 38  ? 20.459  46.764 31.289 1.00 41.55 ? 38  GLY B O   1 
ATOM   1325 N N   . PRO B 1 39  ? 20.251  48.817 32.234 1.00 43.70 ? 39  PRO B N   1 
ATOM   1326 C CA  . PRO B 1 39  ? 19.103  48.479 33.063 1.00 42.88 ? 39  PRO B CA  1 
ATOM   1327 C C   . PRO B 1 39  ? 17.902  47.971 32.265 1.00 40.53 ? 39  PRO B C   1 
ATOM   1328 O O   . PRO B 1 39  ? 17.256  47.018 32.698 1.00 38.69 ? 39  PRO B O   1 
ATOM   1329 C CB  . PRO B 1 39  ? 18.799  49.795 33.772 1.00 44.54 ? 39  PRO B CB  1 
ATOM   1330 C CG  . PRO B 1 39  ? 20.159  50.385 33.952 1.00 46.65 ? 39  PRO B CG  1 
ATOM   1331 C CD  . PRO B 1 39  ? 20.849  50.103 32.651 1.00 45.49 ? 39  PRO B CD  1 
ATOM   1332 N N   . ILE B 1 40  ? 17.640  48.561 31.099 1.00 39.33 ? 40  ILE B N   1 
ATOM   1333 C CA  . ILE B 1 40  ? 16.522  48.122 30.260 1.00 36.93 ? 40  ILE B CA  1 
ATOM   1334 C C   . ILE B 1 40  ? 16.627  46.646 29.880 1.00 35.40 ? 40  ILE B C   1 
ATOM   1335 O O   . ILE B 1 40  ? 15.657  45.870 29.998 1.00 34.35 ? 40  ILE B O   1 
ATOM   1336 C CB  . ILE B 1 40  ? 16.409  48.970 28.978 1.00 36.47 ? 40  ILE B CB  1 
ATOM   1337 C CG1 . ILE B 1 40  ? 15.786  50.323 29.327 1.00 37.76 ? 40  ILE B CG1 1 
ATOM   1338 C CG2 . ILE B 1 40  ? 15.574  48.249 27.917 1.00 34.47 ? 40  ILE B CG2 1 
ATOM   1339 C CD1 . ILE B 1 40  ? 15.863  51.378 28.229 1.00 37.40 ? 40  ILE B CD1 1 
ATOM   1340 N N   . VAL B 1 41  ? 17.808  46.257 29.439 1.00 34.96 ? 41  VAL B N   1 
ATOM   1341 C CA  . VAL B 1 41  ? 18.038  44.885 29.014 1.00 33.71 ? 41  VAL B CA  1 
ATOM   1342 C C   . VAL B 1 41  ? 17.922  43.903 30.205 1.00 34.45 ? 41  VAL B C   1 
ATOM   1343 O O   . VAL B 1 41  ? 17.369  42.785 30.055 1.00 32.56 ? 41  VAL B O   1 
ATOM   1344 C CB  . VAL B 1 41  ? 19.383  44.776 28.250 1.00 33.77 ? 41  VAL B CB  1 
ATOM   1345 C CG1 . VAL B 1 41  ? 19.826  43.331 28.068 1.00 33.30 ? 41  VAL B CG1 1 
ATOM   1346 C CG2 . VAL B 1 41  ? 19.300  45.521 26.910 1.00 32.97 ? 41  VAL B CG2 1 
ATOM   1347 N N   . SER B 1 42  ? 18.413  44.307 31.379 1.00 36.81 ? 42  SER B N   1 
ATOM   1348 C CA  . SER B 1 42  ? 18.290  43.482 32.588 1.00 38.14 ? 42  SER B CA  1 
ATOM   1349 C C   . SER B 1 42  ? 16.860  43.203 32.951 1.00 36.68 ? 42  SER B C   1 
ATOM   1350 O O   . SER B 1 42  ? 16.508  42.085 33.267 1.00 36.29 ? 42  SER B O   1 
ATOM   1351 C CB  . SER B 1 42  ? 18.933  44.155 33.791 1.00 41.19 ? 42  SER B CB  1 
ATOM   1352 O OG  . SER B 1 42  ? 20.295  44.272 33.545 1.00 44.75 ? 42  SER B OG  1 
ATOM   1353 N N   . VAL B 1 43  ? 16.048  44.245 32.940 1.00 36.37 ? 43  VAL B N   1 
ATOM   1354 C CA  . VAL B 1 43  ? 14.638  44.096 33.226 1.00 36.03 ? 43  VAL B CA  1 
ATOM   1355 C C   . VAL B 1 43  ? 14.000  43.210 32.142 1.00 34.14 ? 43  VAL B C   1 
ATOM   1356 O O   . VAL B 1 43  ? 13.236  42.283 32.453 1.00 33.45 ? 43  VAL B O   1 
ATOM   1357 C CB  . VAL B 1 43  ? 13.956  45.462 33.316 1.00 36.73 ? 43  VAL B CB  1 
ATOM   1358 C CG1 . VAL B 1 43  ? 12.427  45.347 33.385 1.00 37.37 ? 43  VAL B CG1 1 
ATOM   1359 C CG2 . VAL B 1 43  ? 14.471  46.195 34.539 1.00 38.34 ? 43  VAL B CG2 1 
ATOM   1360 N N   . TRP B 1 44  ? 14.327  43.491 30.874 1.00 32.13 ? 44  TRP B N   1 
ATOM   1361 C CA  . TRP B 1 44  ? 13.786  42.733 29.773 1.00 30.18 ? 44  TRP B CA  1 
ATOM   1362 C C   . TRP B 1 44  ? 14.072  41.266 29.973 1.00 30.93 ? 44  TRP B C   1 
ATOM   1363 O O   . TRP B 1 44  ? 13.156  40.436 29.911 1.00 30.46 ? 44  TRP B O   1 
ATOM   1364 C CB  . TRP B 1 44  ? 14.344  43.271 28.455 1.00 29.13 ? 44  TRP B CB  1 
ATOM   1365 C CG  . TRP B 1 44  ? 14.010  42.479 27.247 1.00 27.26 ? 44  TRP B CG  1 
ATOM   1366 C CD1 . TRP B 1 44  ? 12.938  42.665 26.377 1.00 26.03 ? 44  TRP B CD1 1 
ATOM   1367 C CD2 . TRP B 1 44  ? 14.756  41.350 26.712 1.00 27.21 ? 44  TRP B CD2 1 
ATOM   1368 N NE1 . TRP B 1 44  ? 12.978  41.754 25.369 1.00 25.55 ? 44  TRP B NE1 1 
ATOM   1369 C CE2 . TRP B 1 44  ? 14.043  40.925 25.509 1.00 26.16 ? 44  TRP B CE2 1 
ATOM   1370 C CE3 . TRP B 1 44  ? 15.919  40.676 27.085 1.00 27.77 ? 44  TRP B CE3 1 
ATOM   1371 C CZ2 . TRP B 1 44  ? 14.483  39.850 24.725 1.00 26.12 ? 44  TRP B CZ2 1 
ATOM   1372 C CZ3 . TRP B 1 44  ? 16.352  39.580 26.293 1.00 28.37 ? 44  TRP B CZ3 1 
ATOM   1373 C CH2 . TRP B 1 44  ? 15.654  39.183 25.143 1.00 26.52 ? 44  TRP B CH2 1 
ATOM   1374 N N   . HIS B 1 45  ? 15.330  40.951 30.289 1.00 32.08 ? 45  HIS B N   1 
ATOM   1375 C CA  . HIS B 1 45  ? 15.782  39.590 30.470 1.00 33.74 ? 45  HIS B CA  1 
ATOM   1376 C C   . HIS B 1 45  ? 15.087  38.862 31.617 1.00 35.66 ? 45  HIS B C   1 
ATOM   1377 O O   . HIS B 1 45  ? 14.672  37.713 31.471 1.00 34.19 ? 45  HIS B O   1 
ATOM   1378 C CB  . HIS B 1 45  ? 17.286  39.582 30.713 1.00 36.18 ? 45  HIS B CB  1 
ATOM   1379 C CG  . HIS B 1 45  ? 17.940  38.225 30.506 1.00 37.78 ? 45  HIS B CG  1 
ATOM   1380 N ND1 . HIS B 1 45  ? 19.206  37.957 30.904 1.00 39.60 ? 45  HIS B ND1 1 
ATOM   1381 C CD2 . HIS B 1 45  ? 17.480  37.069 29.878 1.00 38.13 ? 45  HIS B CD2 1 
ATOM   1382 C CE1 . HIS B 1 45  ? 19.532  36.698 30.569 1.00 39.33 ? 45  HIS B CE1 1 
ATOM   1383 N NE2 . HIS B 1 45  ? 18.479  36.146 29.962 1.00 39.65 ? 45  HIS B NE2 1 
ATOM   1384 N N   . ARG B 1 46  ? 14.961  39.527 32.764 1.00 37.38 ? 46  ARG B N   1 
ATOM   1385 C CA  . ARG B 1 46  ? 14.284  38.929 33.920 1.00 39.75 ? 46  ARG B CA  1 
ATOM   1386 C C   . ARG B 1 46  ? 12.807  38.689 33.652 1.00 38.07 ? 46  ARG B C   1 
ATOM   1387 O O   . ARG B 1 46  ? 12.273  37.634 34.005 1.00 37.69 ? 46  ARG B O   1 
ATOM   1388 C CB  . ARG B 1 46  ? 14.463  39.792 35.185 1.00 42.96 ? 46  ARG B CB  1 
ATOM   1389 C CG  . ARG B 1 46  ? 13.764  39.233 36.432 1.00 46.68 ? 46  ARG B CG  1 
ATOM   1390 C CD  . ARG B 1 46  ? 14.165  39.982 37.732 1.00 50.55 ? 46  ARG B CD  1 
ATOM   1391 N NE  . ARG B 1 46  ? 13.899  41.431 37.624 1.00 52.72 ? 46  ARG B NE  1 
ATOM   1392 C CZ  . ARG B 1 46  ? 14.806  42.404 37.431 1.00 53.14 ? 46  ARG B CZ  1 
ATOM   1393 N NH1 . ARG B 1 46  ? 16.113  42.147 37.346 1.00 54.20 ? 46  ARG B NH1 1 
ATOM   1394 N NH2 . ARG B 1 46  ? 14.385  43.670 37.323 1.00 52.92 ? 46  ARG B NH2 1 
ATOM   1395 N N   . GLU B 1 47  ? 12.147  39.661 33.022 1.00 36.64 ? 47  GLU B N   1 
ATOM   1396 C CA  . GLU B 1 47  ? 10.724  39.513 32.688 1.00 35.72 ? 47  GLU B CA  1 
ATOM   1397 C C   . GLU B 1 47  ? 10.493  38.425 31.633 1.00 33.96 ? 47  GLU B C   1 
ATOM   1398 O O   . GLU B 1 47  ? 9.587   37.604 31.770 1.00 34.24 ? 47  GLU B O   1 
ATOM   1399 C CB  . GLU B 1 47  ? 10.097  40.855 32.275 1.00 34.75 ? 47  GLU B CB  1 
ATOM   1400 C CG  . GLU B 1 47  ? 10.133  41.892 33.386 1.00 36.36 ? 47  GLU B CG  1 
ATOM   1401 C CD  . GLU B 1 47  ? 9.500   41.395 34.671 1.00 38.17 ? 47  GLU B CD  1 
ATOM   1402 O OE1 . GLU B 1 47  ? 8.263   41.245 34.680 1.00 39.23 ? 47  GLU B OE1 1 
ATOM   1403 O OE2 . GLU B 1 47  ? 10.232  41.126 35.653 1.00 38.84 ? 47  GLU B OE2 1 
ATOM   1404 N N   . LEU B 1 48  ? 11.319  38.386 30.607 1.00 33.22 ? 48  LEU B N   1 
ATOM   1405 C CA  . LEU B 1 48  ? 11.290  37.229 29.674 1.00 32.74 ? 48  LEU B CA  1 
ATOM   1406 C C   . LEU B 1 48  ? 11.267  35.885 30.431 1.00 33.75 ? 48  LEU B C   1 
ATOM   1407 O O   . LEU B 1 48  ? 10.491  34.994 30.097 1.00 32.71 ? 48  LEU B O   1 
ATOM   1408 C CB  . LEU B 1 48  ? 12.477  37.249 28.729 1.00 31.20 ? 48  LEU B CB  1 
ATOM   1409 C CG  . LEU B 1 48  ? 12.701  35.986 27.905 1.00 31.68 ? 48  LEU B CG  1 
ATOM   1410 C CD1 . LEU B 1 48  ? 11.490  35.709 27.024 1.00 31.53 ? 48  LEU B CD1 1 
ATOM   1411 C CD2 . LEU B 1 48  ? 13.946  36.204 27.062 1.00 31.92 ? 48  LEU B CD2 1 
ATOM   1412 N N   . ARG B 1 49  ? 12.103  35.764 31.462 1.00 35.62 ? 49  ARG B N   1 
ATOM   1413 C CA  . ARG B 1 49  ? 12.248  34.503 32.167 1.00 38.30 ? 49  ARG B CA  1 
ATOM   1414 C C   . ARG B 1 49  ? 11.047  34.161 33.047 1.00 37.60 ? 49  ARG B C   1 
ATOM   1415 O O   . ARG B 1 49  ? 10.916  33.031 33.518 1.00 38.03 ? 49  ARG B O   1 
ATOM   1416 C CB  . ARG B 1 49  ? 13.537  34.508 32.987 1.00 42.45 ? 49  ARG B CB  1 
ATOM   1417 C CG  . ARG B 1 49  ? 14.809  34.397 32.149 1.00 45.40 ? 49  ARG B CG  1 
ATOM   1418 C CD  . ARG B 1 49  ? 16.048  34.055 33.009 1.00 50.68 ? 49  ARG B CD  1 
ATOM   1419 N NE  . ARG B 1 49  ? 16.955  33.140 32.293 1.00 55.36 ? 49  ARG B NE  1 
ATOM   1420 C CZ  . ARG B 1 49  ? 16.702  31.841 32.046 1.00 58.64 ? 49  ARG B CZ  1 
ATOM   1421 N NH1 . ARG B 1 49  ? 17.579  31.107 31.379 1.00 57.44 ? 49  ARG B NH1 1 
ATOM   1422 N NH2 . ARG B 1 49  ? 15.573  31.267 32.468 1.00 60.93 ? 49  ARG B NH2 1 
ATOM   1423 N N   . LYS B 1 50  ? 10.187  35.143 33.274 1.00 35.75 ? 50  LYS B N   1 
ATOM   1424 C CA  . LYS B 1 50  ? 8.943   34.974 34.066 1.00 36.84 ? 50  LYS B CA  1 
ATOM   1425 C C   . LYS B 1 50  ? 7.672   34.990 33.209 1.00 35.63 ? 50  LYS B C   1 
ATOM   1426 O O   . LYS B 1 50  ? 6.567   34.795 33.704 1.00 36.06 ? 50  LYS B O   1 
ATOM   1427 C CB  . LYS B 1 50  ? 8.856   36.062 35.120 1.00 37.39 ? 50  LYS B CB  1 
ATOM   1428 C CG  . LYS B 1 50  ? 9.957   35.920 36.153 1.00 39.18 ? 50  LYS B CG  1 
ATOM   1429 C CD  . LYS B 1 50  ? 9.966   37.027 37.206 1.00 40.06 ? 50  LYS B CD  1 
ATOM   1430 C CE  . LYS B 1 50  ? 8.649   37.177 37.941 1.00 40.74 ? 50  LYS B CE  1 
ATOM   1431 N NZ  . LYS B 1 50  ? 8.875   37.719 39.309 1.00 42.20 ? 50  LYS B NZ  1 
ATOM   1432 N N   . ALA B 1 51  ? 7.841   35.224 31.918 1.00 34.38 ? 51  ALA B N   1 
ATOM   1433 C CA  . ALA B 1 51  ? 6.722   35.416 31.047 1.00 33.63 ? 51  ALA B CA  1 
ATOM   1434 C C   . ALA B 1 51  ? 6.097   34.065 30.683 1.00 35.00 ? 51  ALA B C   1 
ATOM   1435 O O   . ALA B 1 51  ? 6.796   33.062 30.502 1.00 34.96 ? 51  ALA B O   1 
ATOM   1436 C CB  . ALA B 1 51  ? 7.151   36.167 29.799 1.00 31.92 ? 51  ALA B CB  1 
ATOM   1437 N N   . LYS B 1 52  ? 4.779   34.060 30.563 1.00 35.13 ? 52  LYS B N   1 
ATOM   1438 C CA  . LYS B 1 52  ? 4.072   32.929 30.006 1.00 37.21 ? 52  LYS B CA  1 
ATOM   1439 C C   . LYS B 1 52  ? 4.693   32.437 28.677 1.00 36.00 ? 52  LYS B C   1 
ATOM   1440 O O   . LYS B 1 52  ? 5.166   33.216 27.874 1.00 34.48 ? 52  LYS B O   1 
ATOM   1441 C CB  . LYS B 1 52  ? 2.589   33.299 29.830 1.00 38.78 ? 52  LYS B CB  1 
ATOM   1442 C CG  . LYS B 1 52  ? 1.818   33.342 31.157 1.00 41.69 ? 52  LYS B CG  1 
ATOM   1443 C CD  . LYS B 1 52  ? 0.352   33.745 30.986 1.00 43.11 ? 52  LYS B CD  1 
ATOM   1444 C CE  . LYS B 1 52  ? 0.204   35.093 30.275 1.00 42.93 ? 52  LYS B CE  1 
ATOM   1445 N N   . SER B 1 53  ? 4.714   31.127 28.489 1.00 38.03 ? 53  SER B N   1 
ATOM   1446 C CA  . SER B 1 53  ? 5.168   30.501 27.262 1.00 38.19 ? 53  SER B CA  1 
ATOM   1447 C C   . SER B 1 53  ? 4.533   31.028 25.983 1.00 37.61 ? 53  SER B C   1 
ATOM   1448 O O   . SER B 1 53  ? 5.141   30.942 24.900 1.00 36.50 ? 53  SER B O   1 
ATOM   1449 C CB  . SER B 1 53  ? 4.923   29.002 27.327 1.00 40.08 ? 53  SER B CB  1 
ATOM   1450 O OG  . SER B 1 53  ? 5.602   28.448 28.410 1.00 41.66 ? 53  SER B OG  1 
ATOM   1451 N N   . ASN B 1 54  ? 3.317   31.554 26.090 1.00 38.23 ? 54  ASN B N   1 
ATOM   1452 C CA  . ASN B 1 54  ? 2.657   32.138 24.919 1.00 37.31 ? 54  ASN B CA  1 
ATOM   1453 C C   . ASN B 1 54  ? 3.000   33.612 24.688 1.00 36.09 ? 54  ASN B C   1 
ATOM   1454 O O   . ASN B 1 54  ? 2.503   34.219 23.744 1.00 35.94 ? 54  ASN B O   1 
ATOM   1455 C CB  . ASN B 1 54  ? 1.139   31.908 24.977 1.00 38.46 ? 54  ASN B CB  1 
ATOM   1456 C CG  . ASN B 1 54  ? 0.459   32.682 26.093 1.00 38.49 ? 54  ASN B CG  1 
ATOM   1457 O OD1 . ASN B 1 54  ? 1.088   33.419 26.844 1.00 37.84 ? 54  ASN B OD1 1 
ATOM   1458 N ND2 . ASN B 1 54  ? -0.816  32.540 26.173 1.00 38.04 ? 54  ASN B ND2 1 
ATOM   1459 N N   . ARG B 1 55  ? 3.859   34.191 25.536 1.00 35.29 ? 55  ARG B N   1 
ATOM   1460 C CA  . ARG B 1 55  ? 4.282   35.572 25.347 1.00 33.77 ? 55  ARG B CA  1 
ATOM   1461 C C   . ARG B 1 55  ? 5.793   35.718 25.184 1.00 31.24 ? 55  ARG B C   1 
ATOM   1462 O O   . ARG B 1 55  ? 6.225   36.789 24.793 1.00 28.76 ? 55  ARG B O   1 
ATOM   1463 C CB  . ARG B 1 55  ? 3.808   36.484 26.506 1.00 36.08 ? 55  ARG B CB  1 
ATOM   1464 C CG  . ARG B 1 55  ? 2.302   36.533 26.694 1.00 39.15 ? 55  ARG B CG  1 
ATOM   1465 C CD  . ARG B 1 55  ? 1.890   37.389 27.881 1.00 42.17 ? 55  ARG B CD  1 
ATOM   1466 N NE  . ARG B 1 55  ? 2.293   38.766 27.649 1.00 42.65 ? 55  ARG B NE  1 
ATOM   1467 C CZ  . ARG B 1 55  ? 3.268   39.435 28.295 1.00 43.29 ? 55  ARG B CZ  1 
ATOM   1468 N NH1 . ARG B 1 55  ? 3.969   38.902 29.298 1.00 41.73 ? 55  ARG B NH1 1 
ATOM   1469 N NH2 . ARG B 1 55  ? 3.518   40.696 27.930 1.00 43.21 ? 55  ARG B NH2 1 
ATOM   1470 N N   . LYS B 1 56  ? 6.582   34.661 25.455 1.00 31.03 ? 56  LYS B N   1 
ATOM   1471 C CA  . LYS B 1 56  ? 8.071   34.764 25.446 1.00 30.24 ? 56  LYS B CA  1 
ATOM   1472 C C   . LYS B 1 56  ? 8.613   35.207 24.100 1.00 29.19 ? 56  LYS B C   1 
ATOM   1473 O O   . LYS B 1 56  ? 9.515   36.045 24.034 1.00 30.44 ? 56  LYS B O   1 
ATOM   1474 C CB  . LYS B 1 56  ? 8.778   33.437 25.869 1.00 30.85 ? 56  LYS B CB  1 
ATOM   1475 C CG  . LYS B 1 56  ? 8.670   33.090 27.356 1.00 31.62 ? 56  LYS B CG  1 
ATOM   1476 C CD  . LYS B 1 56  ? 9.260   31.706 27.670 1.00 32.92 ? 56  LYS B CD  1 
ATOM   1477 C CE  . LYS B 1 56  ? 9.023   31.253 29.105 1.00 34.34 ? 56  LYS B CE  1 
ATOM   1478 N NZ  . LYS B 1 56  ? 9.342   32.299 30.127 1.00 33.99 ? 56  LYS B NZ  1 
ATOM   1479 N N   . LEU B 1 57  ? 8.052   34.687 23.016 1.00 29.35 ? 57  LEU B N   1 
ATOM   1480 C CA  . LEU B 1 57  ? 8.522   35.045 21.681 1.00 28.05 ? 57  LEU B CA  1 
ATOM   1481 C C   . LEU B 1 57  ? 8.361   36.548 21.404 1.00 25.98 ? 57  LEU B C   1 
ATOM   1482 O O   . LEU B 1 57  ? 9.211   37.170 20.722 1.00 23.33 ? 57  LEU B O   1 
ATOM   1483 C CB  . LEU B 1 57  ? 7.806   34.215 20.605 1.00 29.54 ? 57  LEU B CB  1 
ATOM   1484 C CG  . LEU B 1 57  ? 8.121   34.559 19.143 1.00 29.62 ? 57  LEU B CG  1 
ATOM   1485 C CD1 . LEU B 1 57  ? 9.574   34.292 18.846 1.00 30.21 ? 57  LEU B CD1 1 
ATOM   1486 C CD2 . LEU B 1 57  ? 7.229   33.791 18.164 1.00 31.00 ? 57  LEU B CD2 1 
ATOM   1487 N N   . THR B 1 58  ? 7.277   37.129 21.917 1.00 25.20 ? 58  THR B N   1 
ATOM   1488 C CA  . THR B 1 58  ? 7.007   38.549 21.702 1.00 24.75 ? 58  THR B CA  1 
ATOM   1489 C C   . THR B 1 58  ? 8.182   39.379 22.264 1.00 24.81 ? 58  THR B C   1 
ATOM   1490 O O   . THR B 1 58  ? 8.471   40.462 21.760 1.00 25.62 ? 58  THR B O   1 
ATOM   1491 C CB  . THR B 1 58  ? 5.635   39.003 22.332 1.00 26.22 ? 58  THR B CB  1 
ATOM   1492 O OG1 . THR B 1 58  ? 4.552   38.170 21.856 1.00 27.07 ? 58  THR B OG1 1 
ATOM   1493 C CG2 . THR B 1 58  ? 5.313   40.458 21.950 1.00 25.86 ? 58  THR B CG2 1 
ATOM   1494 N N   . PHE B 1 59  ? 8.842   38.877 23.317 1.00 24.74 ? 59  PHE B N   1 
ATOM   1495 C CA  . PHE B 1 59  ? 10.042  39.565 23.893 1.00 24.79 ? 59  PHE B CA  1 
ATOM   1496 C C   . PHE B 1 59  ? 11.168  39.678 22.872 1.00 24.19 ? 59  PHE B C   1 
ATOM   1497 O O   . PHE B 1 59  ? 11.837  40.693 22.802 1.00 22.45 ? 59  PHE B O   1 
ATOM   1498 C CB  . PHE B 1 59  ? 10.522  38.864 25.170 1.00 26.06 ? 59  PHE B CB  1 
ATOM   1499 C CG  . PHE B 1 59  ? 9.731   39.225 26.407 1.00 26.94 ? 59  PHE B CG  1 
ATOM   1500 C CD1 . PHE B 1 59  ? 8.478   38.692 26.620 1.00 27.58 ? 59  PHE B CD1 1 
ATOM   1501 C CD2 . PHE B 1 59  ? 10.264  40.087 27.371 1.00 28.20 ? 59  PHE B CD2 1 
ATOM   1502 C CE1 . PHE B 1 59  ? 7.740   39.012 27.770 1.00 29.03 ? 59  PHE B CE1 1 
ATOM   1503 C CE2 . PHE B 1 59  ? 9.536   40.406 28.520 1.00 29.40 ? 59  PHE B CE2 1 
ATOM   1504 C CZ  . PHE B 1 59  ? 8.264   39.859 28.714 1.00 29.31 ? 59  PHE B CZ  1 
ATOM   1505 N N   . LEU B 1 60  ? 11.361  38.616 22.078 1.00 24.95 ? 60  LEU B N   1 
ATOM   1506 C CA  . LEU B 1 60  ? 12.358  38.640 21.069 1.00 25.17 ? 60  LEU B CA  1 
ATOM   1507 C C   . LEU B 1 60  ? 11.949  39.496 19.851 1.00 25.44 ? 60  LEU B C   1 
ATOM   1508 O O   . LEU B 1 60  ? 12.801  40.127 19.231 1.00 24.70 ? 60  LEU B O   1 
ATOM   1509 C CB  . LEU B 1 60  ? 12.794  37.210 20.681 1.00 26.29 ? 60  LEU B CB  1 
ATOM   1510 C CG  . LEU B 1 60  ? 13.794  36.616 21.676 1.00 27.27 ? 60  LEU B CG  1 
ATOM   1511 C CD1 . LEU B 1 60  ? 14.085  35.174 21.332 1.00 29.44 ? 60  LEU B CD1 1 
ATOM   1512 C CD2 . LEU B 1 60  ? 15.083  37.444 21.718 1.00 27.76 ? 60  LEU B CD2 1 
ATOM   1513 N N   . TYR B 1 61  ? 10.651  39.549 19.551 1.00 25.42 ? 61  TYR B N   1 
ATOM   1514 C CA  . TYR B 1 61  ? 10.138  40.483 18.566 1.00 25.55 ? 61  TYR B CA  1 
ATOM   1515 C C   . TYR B 1 61  ? 10.394  41.920 18.996 1.00 24.30 ? 61  TYR B C   1 
ATOM   1516 O O   . TYR B 1 61  ? 10.734  42.731 18.166 1.00 24.05 ? 61  TYR B O   1 
ATOM   1517 C CB  . TYR B 1 61  ? 8.637   40.193 18.251 1.00 27.05 ? 61  TYR B CB  1 
ATOM   1518 C CG  . TYR B 1 61  ? 8.447   38.940 17.397 1.00 30.11 ? 61  TYR B CG  1 
ATOM   1519 C CD1 . TYR B 1 61  ? 9.345   38.646 16.382 1.00 33.42 ? 61  TYR B CD1 1 
ATOM   1520 C CD2 . TYR B 1 61  ? 7.349   38.112 17.543 1.00 34.17 ? 61  TYR B CD2 1 
ATOM   1521 C CE1 . TYR B 1 61  ? 9.199   37.547 15.563 1.00 37.99 ? 61  TYR B CE1 1 
ATOM   1522 C CE2 . TYR B 1 61  ? 7.179   36.987 16.713 1.00 37.61 ? 61  TYR B CE2 1 
ATOM   1523 C CZ  . TYR B 1 61  ? 8.124   36.712 15.733 1.00 38.79 ? 61  TYR B CZ  1 
ATOM   1524 O OH  . TYR B 1 61  ? 8.035   35.667 14.857 1.00 42.85 ? 61  TYR B OH  1 
ATOM   1525 N N   . LEU B 1 62  ? 10.260  42.225 20.292 1.00 24.97 ? 62  LEU B N   1 
ATOM   1526 C CA  . LEU B 1 62  ? 10.610  43.551 20.794 1.00 25.37 ? 62  LEU B CA  1 
ATOM   1527 C C   . LEU B 1 62  ? 12.131  43.814 20.658 1.00 26.06 ? 62  LEU B C   1 
ATOM   1528 O O   . LEU B 1 62  ? 12.561  44.872 20.186 1.00 25.60 ? 62  LEU B O   1 
ATOM   1529 C CB  . LEU B 1 62  ? 10.229  43.673 22.255 1.00 26.21 ? 62  LEU B CB  1 
ATOM   1530 C CG  . LEU B 1 62  ? 10.640  44.955 22.969 1.00 26.88 ? 62  LEU B CG  1 
ATOM   1531 C CD1 . LEU B 1 62  ? 9.988   46.202 22.405 1.00 27.28 ? 62  LEU B CD1 1 
ATOM   1532 C CD2 . LEU B 1 62  ? 10.256  44.820 24.413 1.00 28.30 ? 62  LEU B CD2 1 
ATOM   1533 N N   . ALA B 1 63  ? 12.936  42.854 21.110 1.00 26.23 ? 63  ALA B N   1 
ATOM   1534 C CA  . ALA B 1 63  ? 14.400  42.978 20.991 1.00 26.43 ? 63  ALA B CA  1 
ATOM   1535 C C   . ALA B 1 63  ? 14.767  43.216 19.529 1.00 25.98 ? 63  ALA B C   1 
ATOM   1536 O O   . ALA B 1 63  ? 15.607  44.047 19.206 1.00 26.55 ? 63  ALA B O   1 
ATOM   1537 C CB  . ALA B 1 63  ? 15.065  41.763 21.521 1.00 26.32 ? 63  ALA B CB  1 
ATOM   1538 N N   . ASN B 1 64  ? 14.082  42.528 18.627 1.00 25.83 ? 64  ASN B N   1 
ATOM   1539 C CA  . ASN B 1 64  ? 14.343  42.732 17.231 1.00 26.47 ? 64  ASN B CA  1 
ATOM   1540 C C   . ASN B 1 64  ? 14.089  44.180 16.771 1.00 26.12 ? 64  ASN B C   1 
ATOM   1541 O O   . ASN B 1 64  ? 14.944  44.798 16.138 1.00 26.94 ? 64  ASN B O   1 
ATOM   1542 C CB  . ASN B 1 64  ? 13.517  41.781 16.393 1.00 26.12 ? 64  ASN B CB  1 
ATOM   1543 C CG  . ASN B 1 64  ? 13.631  42.087 14.910 1.00 26.51 ? 64  ASN B CG  1 
ATOM   1544 O OD1 . ASN B 1 64  ? 14.739  42.069 14.312 1.00 26.53 ? 64  ASN B OD1 1 
ATOM   1545 N ND2 . ASN B 1 64  ? 12.510  42.387 14.307 1.00 25.50 ? 64  ASN B ND2 1 
ATOM   1546 N N   . ASP B 1 65  ? 12.903  44.702 17.065 1.00 25.54 ? 65  ASP B N   1 
ATOM   1547 C CA  . ASP B 1 65  ? 12.571  46.084 16.681 1.00 26.14 ? 65  ASP B CA  1 
ATOM   1548 C C   . ASP B 1 65  ? 13.524  47.130 17.300 1.00 26.86 ? 65  ASP B C   1 
ATOM   1549 O O   . ASP B 1 65  ? 13.941  48.108 16.634 1.00 26.03 ? 65  ASP B O   1 
ATOM   1550 C CB  . ASP B 1 65  ? 11.130  46.415 17.092 1.00 26.39 ? 65  ASP B CB  1 
ATOM   1551 C CG  . ASP B 1 65  ? 10.567  47.545 16.289 1.00 29.74 ? 65  ASP B CG  1 
ATOM   1552 O OD1 . ASP B 1 65  ? 10.737  48.724 16.674 1.00 30.57 ? 65  ASP B OD1 1 
ATOM   1553 O OD2 . ASP B 1 65  ? 10.006  47.255 15.226 1.00 30.22 ? 65  ASP B OD2 1 
ATOM   1554 N N   . VAL B 1 66  ? 13.832  46.950 18.592 1.00 26.87 ? 66  VAL B N   1 
ATOM   1555 C CA  . VAL B 1 66  ? 14.678  47.876 19.312 1.00 28.61 ? 66  VAL B CA  1 
ATOM   1556 C C   . VAL B 1 66  ? 16.100  47.920 18.722 1.00 30.07 ? 66  VAL B C   1 
ATOM   1557 O O   . VAL B 1 66  ? 16.656  49.011 18.436 1.00 29.35 ? 66  VAL B O   1 
ATOM   1558 C CB  . VAL B 1 66  ? 14.786  47.506 20.812 1.00 30.13 ? 66  VAL B CB  1 
ATOM   1559 C CG1 . VAL B 1 66  ? 15.874  48.331 21.507 1.00 31.94 ? 66  VAL B CG1 1 
ATOM   1560 C CG2 . VAL B 1 66  ? 13.435  47.719 21.503 1.00 30.33 ? 66  VAL B CG2 1 
ATOM   1561 N N   . ILE B 1 67  ? 16.676  46.742 18.529 1.00 29.68 ? 67  ILE B N   1 
ATOM   1562 C CA  . ILE B 1 67  ? 18.032  46.647 18.067 1.00 31.28 ? 67  ILE B CA  1 
ATOM   1563 C C   . ILE B 1 67  ? 18.151  47.222 16.653 1.00 32.43 ? 67  ILE B C   1 
ATOM   1564 O O   . ILE B 1 67  ? 18.985  48.128 16.420 1.00 36.23 ? 67  ILE B O   1 
ATOM   1565 C CB  . ILE B 1 67  ? 18.549  45.208 18.136 1.00 30.79 ? 67  ILE B CB  1 
ATOM   1566 C CG1 . ILE B 1 67  ? 18.664  44.770 19.585 1.00 31.36 ? 67  ILE B CG1 1 
ATOM   1567 C CG2 . ILE B 1 67  ? 19.924  45.111 17.503 1.00 32.83 ? 67  ILE B CG2 1 
ATOM   1568 C CD1 . ILE B 1 67  ? 18.830  43.275 19.763 1.00 31.34 ? 67  ILE B CD1 1 
ATOM   1569 N N   . GLN B 1 68  ? 17.309  46.770 15.723 1.00 31.10 ? 68  GLN B N   1 
ATOM   1570 C CA  . GLN B 1 68  ? 17.402  47.261 14.346 1.00 31.50 ? 68  GLN B CA  1 
ATOM   1571 C C   . GLN B 1 68  ? 17.266  48.739 14.284 1.00 32.39 ? 68  GLN B C   1 
ATOM   1572 O O   . GLN B 1 68  ? 18.131  49.421 13.722 1.00 34.97 ? 68  GLN B O   1 
ATOM   1573 C CB  . GLN B 1 68  ? 16.340  46.638 13.438 1.00 30.44 ? 68  GLN B CB  1 
ATOM   1574 C CG  . GLN B 1 68  ? 16.616  45.187 13.137 1.00 30.43 ? 68  GLN B CG  1 
ATOM   1575 C CD  . GLN B 1 68  ? 15.908  44.692 11.890 1.00 30.15 ? 68  GLN B CD  1 
ATOM   1576 O OE1 . GLN B 1 68  ? 16.064  45.246 10.816 1.00 32.89 ? 68  GLN B OE1 1 
ATOM   1577 N NE2 . GLN B 1 68  ? 15.138  43.648 12.031 1.00 28.82 ? 68  GLN B NE2 1 
ATOM   1578 N N   . ASN B 1 69  ? 16.206  49.254 14.892 1.00 31.85 ? 69  ASN B N   1 
ATOM   1579 C CA  . ASN B 1 69  ? 15.932  50.680 14.805 1.00 32.75 ? 69  ASN B CA  1 
ATOM   1580 C C   . ASN B 1 69  ? 16.782  51.591 15.685 1.00 34.27 ? 69  ASN B C   1 
ATOM   1581 O O   . ASN B 1 69  ? 16.759  52.810 15.508 1.00 35.91 ? 69  ASN B O   1 
ATOM   1582 C CB  . ASN B 1 69  ? 14.480  50.927 15.126 1.00 33.10 ? 69  ASN B CB  1 
ATOM   1583 C CG  . ASN B 1 69  ? 13.565  50.440 14.049 1.00 32.94 ? 69  ASN B CG  1 
ATOM   1584 O OD1 . ASN B 1 69  ? 13.945  50.328 12.888 1.00 33.42 ? 69  ASN B OD1 1 
ATOM   1585 N ND2 . ASN B 1 69  ? 12.337  50.160 14.424 1.00 33.46 ? 69  ASN B ND2 1 
ATOM   1586 N N   . SER B 1 70  ? 17.485  51.020 16.659 1.00 34.17 ? 70  SER B N   1 
ATOM   1587 C CA  . SER B 1 70  ? 18.413  51.778 17.490 1.00 36.78 ? 70  SER B CA  1 
ATOM   1588 C C   . SER B 1 70  ? 19.737  52.091 16.797 1.00 38.88 ? 70  SER B C   1 
ATOM   1589 O O   . SER B 1 70  ? 20.386  53.045 17.179 1.00 39.35 ? 70  SER B O   1 
ATOM   1590 C CB  . SER B 1 70  ? 18.740  51.053 18.803 1.00 36.34 ? 70  SER B CB  1 
ATOM   1591 O OG  . SER B 1 70  ? 19.566  49.943 18.536 1.00 36.06 ? 70  SER B OG  1 
ATOM   1592 N N   . LYS B 1 71  ? 20.127  51.279 15.809 1.00 40.35 ? 71  LYS B N   1 
ATOM   1593 C CA  . LYS B 1 71  ? 21.420  51.433 15.129 1.00 43.83 ? 71  LYS B CA  1 
ATOM   1594 C C   . LYS B 1 71  ? 21.619  52.878 14.702 1.00 44.58 ? 71  LYS B C   1 
ATOM   1595 O O   . LYS B 1 71  ? 22.642  53.488 15.039 1.00 47.89 ? 71  LYS B O   1 
ATOM   1596 C CB  . LYS B 1 71  ? 21.502  50.560 13.895 1.00 46.83 ? 71  LYS B CB  1 
ATOM   1597 C CG  . LYS B 1 71  ? 21.372  49.073 14.146 1.00 49.53 ? 71  LYS B CG  1 
ATOM   1598 C CD  . LYS B 1 71  ? 22.675  48.474 14.640 1.00 54.23 ? 71  LYS B CD  1 
ATOM   1599 C CE  . LYS B 1 71  ? 22.585  46.952 14.539 1.00 55.43 ? 71  LYS B CE  1 
ATOM   1600 N NZ  . LYS B 1 71  ? 23.784  46.260 15.076 1.00 54.85 ? 71  LYS B NZ  1 
ATOM   1601 N N   . ARG B 1 72  ? 20.635  53.438 13.993 1.00 41.58 ? 72  ARG B N   1 
ATOM   1602 C CA  . ARG B 1 72  ? 20.687  54.857 13.545 1.00 44.36 ? 72  ARG B CA  1 
ATOM   1603 C C   . ARG B 1 72  ? 20.822  55.915 14.674 1.00 46.04 ? 72  ARG B C   1 
ATOM   1604 O O   . ARG B 1 72  ? 21.093  57.088 14.398 1.00 47.11 ? 72  ARG B O   1 
ATOM   1605 C CB  . ARG B 1 72  ? 19.474  55.208 12.687 1.00 43.98 ? 72  ARG B CB  1 
ATOM   1606 C CG  . ARG B 1 72  ? 18.137  55.103 13.419 1.00 42.97 ? 72  ARG B CG  1 
ATOM   1607 C CD  . ARG B 1 72  ? 16.977  54.915 12.476 1.00 41.38 ? 72  ARG B CD  1 
ATOM   1608 N NE  . ARG B 1 72  ? 16.701  56.144 11.734 1.00 43.90 ? 72  ARG B NE  1 
ATOM   1609 C CZ  . ARG B 1 72  ? 16.078  57.226 12.219 1.00 46.62 ? 72  ARG B CZ  1 
ATOM   1610 N NH1 . ARG B 1 72  ? 15.915  58.278 11.435 1.00 48.74 ? 72  ARG B NH1 1 
ATOM   1611 N NH2 . ARG B 1 72  ? 15.629  57.287 13.479 1.00 47.51 ? 72  ARG B NH2 1 
ATOM   1612 N N   . LYS B 1 73  ? 20.641  55.504 15.929 1.00 44.01 ? 73  LYS B N   1 
ATOM   1613 C CA  . LYS B 1 73  ? 20.768  56.426 17.061 1.00 46.51 ? 73  LYS B CA  1 
ATOM   1614 C C   . LYS B 1 73  ? 22.062  56.249 17.836 1.00 47.72 ? 73  LYS B C   1 
ATOM   1615 O O   . LYS B 1 73  ? 22.666  57.219 18.310 1.00 51.47 ? 73  LYS B O   1 
ATOM   1616 C CB  . LYS B 1 73  ? 19.575  56.234 17.986 1.00 44.69 ? 73  LYS B CB  1 
ATOM   1617 C CG  . LYS B 1 73  ? 18.276  56.643 17.336 1.00 43.77 ? 73  LYS B CG  1 
ATOM   1618 C CD  . LYS B 1 73  ? 18.173  58.150 17.285 1.00 46.67 ? 73  LYS B CD  1 
ATOM   1619 C CE  . LYS B 1 73  ? 16.865  58.609 16.673 1.00 46.57 ? 73  LYS B CE  1 
ATOM   1620 N NZ  . LYS B 1 73  ? 16.790  60.095 16.841 1.00 49.46 ? 73  LYS B NZ  1 
ATOM   1621 N N   . GLY B 1 74  ? 22.495  55.009 17.971 1.00 46.68 ? 74  GLY B N   1 
ATOM   1622 C CA  . GLY B 1 74  ? 23.676  54.704 18.764 1.00 48.10 ? 74  GLY B CA  1 
ATOM   1623 C C   . GLY B 1 74  ? 23.833  53.207 18.921 1.00 46.34 ? 74  GLY B C   1 
ATOM   1624 O O   . GLY B 1 74  ? 22.962  52.446 18.493 1.00 43.54 ? 74  GLY B O   1 
ATOM   1625 N N   . PRO B 1 75  ? 24.958  52.779 19.512 1.00 48.26 ? 75  PRO B N   1 
ATOM   1626 C CA  . PRO B 1 75  ? 25.273  51.359 19.642 1.00 47.11 ? 75  PRO B CA  1 
ATOM   1627 C C   . PRO B 1 75  ? 24.880  50.728 20.984 1.00 46.28 ? 75  PRO B C   1 
ATOM   1628 O O   . PRO B 1 75  ? 25.163  49.549 21.197 1.00 47.83 ? 75  PRO B O   1 
ATOM   1629 C CB  . PRO B 1 75  ? 26.794  51.357 19.501 1.00 48.97 ? 75  PRO B CB  1 
ATOM   1630 C CG  . PRO B 1 75  ? 27.205  52.626 20.165 1.00 50.73 ? 75  PRO B CG  1 
ATOM   1631 C CD  . PRO B 1 75  ? 26.119  53.626 19.868 1.00 50.11 ? 75  PRO B CD  1 
ATOM   1632 N N   . GLU B 1 76  ? 24.239  51.488 21.874 1.00 45.63 ? 76  GLU B N   1 
ATOM   1633 C CA  . GLU B 1 76  ? 23.954  51.008 23.222 1.00 44.25 ? 76  GLU B CA  1 
ATOM   1634 C C   . GLU B 1 76  ? 23.175  49.702 23.194 1.00 41.48 ? 76  GLU B C   1 
ATOM   1635 O O   . GLU B 1 76  ? 23.590  48.711 23.800 1.00 41.12 ? 76  GLU B O   1 
ATOM   1636 C CB  . GLU B 1 76  ? 23.175  52.038 24.045 1.00 45.47 ? 76  GLU B CB  1 
ATOM   1637 C CG  . GLU B 1 76  ? 23.854  53.406 24.182 1.00 48.74 ? 76  GLU B CG  1 
ATOM   1638 C CD  . GLU B 1 76  ? 23.520  54.360 23.033 1.00 50.02 ? 76  GLU B CD  1 
ATOM   1639 O OE1 . GLU B 1 76  ? 23.036  53.898 21.962 1.00 47.32 ? 76  GLU B OE1 1 
ATOM   1640 O OE2 . GLU B 1 76  ? 23.743  55.581 23.193 1.00 53.05 ? 76  GLU B OE2 1 
ATOM   1641 N N   . PHE B 1 77  ? 22.047  49.689 22.491 1.00 38.90 ? 77  PHE B N   1 
ATOM   1642 C CA  . PHE B 1 77  ? 21.200  48.502 22.482 1.00 36.23 ? 77  PHE B CA  1 
ATOM   1643 C C   . PHE B 1 77  ? 21.863  47.314 21.813 1.00 35.78 ? 77  PHE B C   1 
ATOM   1644 O O   . PHE B 1 77  ? 21.717  46.196 22.270 1.00 33.77 ? 77  PHE B O   1 
ATOM   1645 C CB  . PHE B 1 77  ? 19.823  48.804 21.900 1.00 34.48 ? 77  PHE B CB  1 
ATOM   1646 C CG  . PHE B 1 77  ? 18.910  49.469 22.886 1.00 33.99 ? 77  PHE B CG  1 
ATOM   1647 C CD1 . PHE B 1 77  ? 18.553  48.817 24.056 1.00 33.62 ? 77  PHE B CD1 1 
ATOM   1648 C CD2 . PHE B 1 77  ? 18.402  50.736 22.659 1.00 34.99 ? 77  PHE B CD2 1 
ATOM   1649 C CE1 . PHE B 1 77  ? 17.728  49.419 24.991 1.00 33.73 ? 77  PHE B CE1 1 
ATOM   1650 C CE2 . PHE B 1 77  ? 17.570  51.354 23.604 1.00 35.62 ? 77  PHE B CE2 1 
ATOM   1651 C CZ  . PHE B 1 77  ? 17.219  50.682 24.759 1.00 34.64 ? 77  PHE B CZ  1 
ATOM   1652 N N   . THR B 1 78  ? 22.645  47.553 20.771 1.00 37.50 ? 78  THR B N   1 
ATOM   1653 C CA  . THR B 1 78  ? 23.392  46.455 20.137 1.00 38.79 ? 78  THR B CA  1 
ATOM   1654 C C   . THR B 1 78  ? 24.401  45.830 21.102 1.00 41.23 ? 78  THR B C   1 
ATOM   1655 O O   . THR B 1 78  ? 24.528  44.603 21.178 1.00 40.80 ? 78  THR B O   1 
ATOM   1656 C CB  . THR B 1 78  ? 24.172  46.945 18.903 1.00 39.70 ? 78  THR B CB  1 
ATOM   1657 O OG1 . THR B 1 78  ? 23.261  47.513 17.979 1.00 36.31 ? 78  THR B OG1 1 
ATOM   1658 C CG2 . THR B 1 78  ? 24.952  45.781 18.219 1.00 40.46 ? 78  THR B CG2 1 
ATOM   1659 N N   . ARG B 1 79  ? 25.135  46.682 21.807 1.00 43.89 ? 79  ARG B N   1 
ATOM   1660 C CA  . ARG B 1 79  ? 26.132  46.217 22.774 1.00 47.45 ? 79  ARG B CA  1 
ATOM   1661 C C   . ARG B 1 79  ? 25.442  45.474 23.952 1.00 44.52 ? 79  ARG B C   1 
ATOM   1662 O O   . ARG B 1 79  ? 25.756  44.319 24.240 1.00 43.67 ? 79  ARG B O   1 
ATOM   1663 C CB  . ARG B 1 79  ? 27.015  47.393 23.264 1.00 51.47 ? 79  ARG B CB  1 
ATOM   1664 C CG  . ARG B 1 79  ? 28.274  46.947 24.040 1.00 57.26 ? 79  ARG B CG  1 
ATOM   1665 C CD  . ARG B 1 79  ? 29.032  48.063 24.800 1.00 61.71 ? 79  ARG B CD  1 
ATOM   1666 N NE  . ARG B 1 79  ? 28.139  48.817 25.700 1.00 64.22 ? 79  ARG B NE  1 
ATOM   1667 C CZ  . ARG B 1 79  ? 27.635  50.036 25.459 1.00 64.99 ? 79  ARG B CZ  1 
ATOM   1668 N NH1 . ARG B 1 79  ? 27.948  50.716 24.350 1.00 64.92 ? 79  ARG B NH1 1 
ATOM   1669 N NH2 . ARG B 1 79  ? 26.810  50.585 26.347 1.00 65.04 ? 79  ARG B NH2 1 
ATOM   1670 N N   . GLU B 1 80  ? 24.482  46.127 24.587 1.00 42.85 ? 80  GLU B N   1 
ATOM   1671 C CA  . GLU B 1 80  ? 23.850  45.584 25.798 1.00 42.47 ? 80  GLU B CA  1 
ATOM   1672 C C   . GLU B 1 80  ? 23.068  44.311 25.570 1.00 39.89 ? 80  GLU B C   1 
ATOM   1673 O O   . GLU B 1 80  ? 23.120  43.413 26.387 1.00 39.62 ? 80  GLU B O   1 
ATOM   1674 C CB  . GLU B 1 80  ? 22.912  46.603 26.414 1.00 43.41 ? 80  GLU B CB  1 
ATOM   1675 C CG  . GLU B 1 80  ? 23.588  47.872 26.894 1.00 46.84 ? 80  GLU B CG  1 
ATOM   1676 C CD  . GLU B 1 80  ? 24.673  47.629 27.926 1.00 51.09 ? 80  GLU B CD  1 
ATOM   1677 O OE1 . GLU B 1 80  ? 24.574  46.675 28.748 1.00 52.74 ? 80  GLU B OE1 1 
ATOM   1678 O OE2 . GLU B 1 80  ? 25.654  48.403 27.899 1.00 56.36 ? 80  GLU B OE2 1 
ATOM   1679 N N   . PHE B 1 81  ? 22.333  44.230 24.459 1.00 38.41 ? 81  PHE B N   1 
ATOM   1680 C CA  . PHE B 1 81  ? 21.575  43.016 24.171 1.00 37.00 ? 81  PHE B CA  1 
ATOM   1681 C C   . PHE B 1 81  ? 22.516  41.872 23.869 1.00 37.66 ? 81  PHE B C   1 
ATOM   1682 O O   . PHE B 1 81  ? 22.182  40.713 24.060 1.00 37.60 ? 81  PHE B O   1 
ATOM   1683 C CB  . PHE B 1 81  ? 20.586  43.208 22.997 1.00 34.12 ? 81  PHE B CB  1 
ATOM   1684 C CG  . PHE B 1 81  ? 19.203  43.577 23.428 1.00 32.27 ? 81  PHE B CG  1 
ATOM   1685 C CD1 . PHE B 1 81  ? 18.391  42.632 24.056 1.00 31.30 ? 81  PHE B CD1 1 
ATOM   1686 C CD2 . PHE B 1 81  ? 18.699  44.849 23.198 1.00 32.29 ? 81  PHE B CD2 1 
ATOM   1687 C CE1 . PHE B 1 81  ? 17.117  42.949 24.457 1.00 30.83 ? 81  PHE B CE1 1 
ATOM   1688 C CE2 . PHE B 1 81  ? 17.414  45.176 23.595 1.00 30.90 ? 81  PHE B CE2 1 
ATOM   1689 C CZ  . PHE B 1 81  ? 16.624  44.232 24.233 1.00 30.45 ? 81  PHE B CZ  1 
ATOM   1690 N N   . GLU B 1 82  ? 23.699  42.199 23.396 1.00 38.67 ? 82  GLU B N   1 
ATOM   1691 C CA  . GLU B 1 82  ? 24.621  41.174 22.999 1.00 41.32 ? 82  GLU B CA  1 
ATOM   1692 C C   . GLU B 1 82  ? 24.947  40.188 24.134 1.00 42.02 ? 82  GLU B C   1 
ATOM   1693 O O   . GLU B 1 82  ? 25.001  38.971 23.946 1.00 42.25 ? 82  GLU B O   1 
ATOM   1694 C CB  . GLU B 1 82  ? 25.901  41.825 22.500 1.00 45.09 ? 82  GLU B CB  1 
ATOM   1695 C CG  . GLU B 1 82  ? 26.649  40.923 21.581 1.00 47.77 ? 82  GLU B CG  1 
ATOM   1696 C CD  . GLU B 1 82  ? 28.122  41.144 21.672 1.00 53.21 ? 82  GLU B CD  1 
ATOM   1697 O OE1 . GLU B 1 82  ? 28.712  41.431 20.616 1.00 57.73 ? 82  GLU B OE1 1 
ATOM   1698 O OE2 . GLU B 1 82  ? 28.673  41.029 22.794 1.00 55.14 ? 82  GLU B OE2 1 
ATOM   1699 N N   . SER B 1 83  ? 25.176  40.712 25.320 1.00 43.04 ? 83  SER B N   1 
ATOM   1700 C CA  . SER B 1 83  ? 25.517  39.859 26.456 1.00 44.72 ? 83  SER B CA  1 
ATOM   1701 C C   . SER B 1 83  ? 24.389  38.938 26.947 1.00 42.21 ? 83  SER B C   1 
ATOM   1702 O O   . SER B 1 83  ? 24.666  38.060 27.722 1.00 43.11 ? 83  SER B O   1 
ATOM   1703 C CB  . SER B 1 83  ? 26.055  40.728 27.599 1.00 47.60 ? 83  SER B CB  1 
ATOM   1704 O OG  . SER B 1 83  ? 25.465  42.023 27.532 1.00 49.94 ? 83  SER B OG  1 
ATOM   1705 N N   . VAL B 1 84  ? 23.136  39.112 26.491 1.00 39.17 ? 84  VAL B N   1 
ATOM   1706 C CA  . VAL B 1 84  ? 22.002  38.268 26.980 1.00 37.37 ? 84  VAL B CA  1 
ATOM   1707 C C   . VAL B 1 84  ? 21.294  37.389 25.921 1.00 35.89 ? 84  VAL B C   1 
ATOM   1708 O O   . VAL B 1 84  ? 20.552  36.467 26.266 1.00 34.85 ? 84  VAL B O   1 
ATOM   1709 C CB  . VAL B 1 84  ? 20.913  39.119 27.705 1.00 36.61 ? 84  VAL B CB  1 
ATOM   1710 C CG1 . VAL B 1 84  ? 21.542  39.924 28.827 1.00 38.38 ? 84  VAL B CG1 1 
ATOM   1711 C CG2 . VAL B 1 84  ? 20.145  40.032 26.761 1.00 34.59 ? 84  VAL B CG2 1 
ATOM   1712 N N   . LEU B 1 85  ? 21.540  37.660 24.650 1.00 35.05 ? 85  LEU B N   1 
ATOM   1713 C CA  . LEU B 1 85  ? 20.785  37.009 23.577 1.00 34.20 ? 85  LEU B CA  1 
ATOM   1714 C C   . LEU B 1 85  ? 21.045  35.517 23.440 1.00 35.32 ? 85  LEU B C   1 
ATOM   1715 O O   . LEU B 1 85  ? 20.177  34.807 23.013 1.00 36.16 ? 85  LEU B O   1 
ATOM   1716 C CB  . LEU B 1 85  ? 20.999  37.724 22.232 1.00 33.06 ? 85  LEU B CB  1 
ATOM   1717 C CG  . LEU B 1 85  ? 20.287  39.052 22.103 1.00 32.51 ? 85  LEU B CG  1 
ATOM   1718 C CD1 . LEU B 1 85  ? 20.739  39.808 20.874 1.00 32.40 ? 85  LEU B CD1 1 
ATOM   1719 C CD2 . LEU B 1 85  ? 18.763  38.898 22.091 1.00 32.10 ? 85  LEU B CD2 1 
ATOM   1720 N N   . VAL B 1 86  ? 22.213  35.027 23.826 1.00 38.70 ? 86  VAL B N   1 
ATOM   1721 C CA  . VAL B 1 86  ? 22.451  33.566 23.809 1.00 40.55 ? 86  VAL B CA  1 
ATOM   1722 C C   . VAL B 1 86  ? 21.543  32.834 24.809 1.00 40.28 ? 86  VAL B C   1 
ATOM   1723 O O   . VAL B 1 86  ? 20.907  31.847 24.452 1.00 39.88 ? 86  VAL B O   1 
ATOM   1724 C CB  . VAL B 1 86  ? 23.917  33.191 24.107 1.00 43.52 ? 86  VAL B CB  1 
ATOM   1725 C CG1 . VAL B 1 86  ? 24.054  31.679 24.344 1.00 45.59 ? 86  VAL B CG1 1 
ATOM   1726 C CG2 . VAL B 1 86  ? 24.820  33.643 22.973 1.00 44.38 ? 86  VAL B CG2 1 
ATOM   1727 N N   . ASP B 1 87  ? 21.490  33.301 26.053 1.00 41.06 ? 87  ASP B N   1 
ATOM   1728 C CA  . ASP B 1 87  ? 20.530  32.722 26.983 1.00 42.22 ? 87  ASP B CA  1 
ATOM   1729 C C   . ASP B 1 87  ? 19.077  33.008 26.561 1.00 39.39 ? 87  ASP B C   1 
ATOM   1730 O O   . ASP B 1 87  ? 18.198  32.165 26.693 1.00 38.85 ? 87  ASP B O   1 
ATOM   1731 C CB  . ASP B 1 87  ? 20.710  33.229 28.388 1.00 44.98 ? 87  ASP B CB  1 
ATOM   1732 C CG  . ASP B 1 87  ? 19.609  32.674 29.324 1.00 47.64 ? 87  ASP B CG  1 
ATOM   1733 O OD1 . ASP B 1 87  ? 19.589  31.442 29.549 1.00 47.94 ? 87  ASP B OD1 1 
ATOM   1734 O OD2 . ASP B 1 87  ? 18.715  33.445 29.764 1.00 46.76 ? 87  ASP B OD2 1 
ATOM   1735 N N   . ALA B 1 88  ? 18.823  34.205 26.043 1.00 37.04 ? 88  ALA B N   1 
ATOM   1736 C CA  . ALA B 1 88  ? 17.487  34.539 25.608 1.00 33.89 ? 88  ALA B CA  1 
ATOM   1737 C C   . ALA B 1 88  ? 16.999  33.596 24.536 1.00 33.82 ? 88  ALA B C   1 
ATOM   1738 O O   . ALA B 1 88  ? 15.885  33.058 24.660 1.00 34.01 ? 88  ALA B O   1 
ATOM   1739 C CB  . ALA B 1 88  ? 17.416  35.971 25.144 1.00 32.90 ? 88  ALA B CB  1 
ATOM   1740 N N   . PHE B 1 89  ? 17.809  33.346 23.495 1.00 33.26 ? 89  PHE B N   1 
ATOM   1741 C CA  . PHE B 1 89  ? 17.361  32.434 22.425 1.00 33.85 ? 89  PHE B CA  1 
ATOM   1742 C C   . PHE B 1 89  ? 17.233  30.995 22.933 1.00 35.34 ? 89  PHE B C   1 
ATOM   1743 O O   . PHE B 1 89  ? 16.302  30.296 22.564 1.00 35.56 ? 89  PHE B O   1 
ATOM   1744 C CB  . PHE B 1 89  ? 18.264  32.480 21.143 1.00 33.80 ? 89  PHE B CB  1 
ATOM   1745 C CG  . PHE B 1 89  ? 17.891  33.594 20.189 1.00 31.76 ? 89  PHE B CG  1 
ATOM   1746 C CD1 . PHE B 1 89  ? 18.234  34.917 20.473 1.00 31.80 ? 89  PHE B CD1 1 
ATOM   1747 C CD2 . PHE B 1 89  ? 17.187  33.330 19.040 1.00 30.83 ? 89  PHE B CD2 1 
ATOM   1748 C CE1 . PHE B 1 89  ? 17.885  35.942 19.616 1.00 30.37 ? 89  PHE B CE1 1 
ATOM   1749 C CE2 . PHE B 1 89  ? 16.854  34.342 18.158 1.00 29.94 ? 89  PHE B CE2 1 
ATOM   1750 C CZ  . PHE B 1 89  ? 17.177  35.652 18.458 1.00 30.13 ? 89  PHE B CZ  1 
ATOM   1751 N N   . SER B 1 90  ? 18.180  30.564 23.745 1.00 37.18 ? 90  SER B N   1 
ATOM   1752 C CA  . SER B 1 90  ? 18.129  29.210 24.308 1.00 40.20 ? 90  SER B CA  1 
ATOM   1753 C C   . SER B 1 90  ? 16.882  29.081 25.179 1.00 40.09 ? 90  SER B C   1 
ATOM   1754 O O   . SER B 1 90  ? 16.149  28.111 25.069 1.00 41.54 ? 90  SER B O   1 
ATOM   1755 C CB  . SER B 1 90  ? 19.395  28.914 25.107 1.00 41.88 ? 90  SER B CB  1 
ATOM   1756 O OG  . SER B 1 90  ? 19.172  27.874 26.043 1.00 45.04 ? 90  SER B OG  1 
ATOM   1757 N N   . HIS B 1 91  ? 16.621  30.086 26.006 1.00 39.52 ? 91  HIS B N   1 
ATOM   1758 C CA  . HIS B 1 91  ? 15.461  30.057 26.877 1.00 39.52 ? 91  HIS B CA  1 
ATOM   1759 C C   . HIS B 1 91  ? 14.145  30.024 26.117 1.00 38.28 ? 91  HIS B C   1 
ATOM   1760 O O   . HIS B 1 91  ? 13.254  29.253 26.449 1.00 38.22 ? 91  HIS B O   1 
ATOM   1761 C CB  . HIS B 1 91  ? 15.504  31.211 27.880 1.00 39.06 ? 91  HIS B CB  1 
ATOM   1762 C CG  . HIS B 1 91  ? 14.277  31.277 28.759 1.00 39.13 ? 91  HIS B CG  1 
ATOM   1763 N ND1 . HIS B 1 91  ? 14.128  30.502 29.858 1.00 41.08 ? 91  HIS B ND1 1 
ATOM   1764 C CD2 . HIS B 1 91  ? 13.099  32.010 28.632 1.00 37.57 ? 91  HIS B CD2 1 
ATOM   1765 C CE1 . HIS B 1 91  ? 12.925  30.762 30.421 1.00 40.55 ? 91  HIS B CE1 1 
ATOM   1766 N NE2 . HIS B 1 91  ? 12.296  31.659 29.655 1.00 38.30 ? 91  HIS B NE2 1 
ATOM   1767 N N   . VAL B 1 92  ? 14.005  30.834 25.080 1.00 37.85 ? 92  VAL B N   1 
ATOM   1768 C CA  . VAL B 1 92  ? 12.737  30.890 24.333 1.00 37.58 ? 92  VAL B CA  1 
ATOM   1769 C C   . VAL B 1 92  ? 12.502  29.601 23.522 1.00 39.83 ? 92  VAL B C   1 
ATOM   1770 O O   . VAL B 1 92  ? 11.374  29.084 23.463 1.00 37.98 ? 92  VAL B O   1 
ATOM   1771 C CB  . VAL B 1 92  ? 12.682  32.130 23.407 1.00 35.84 ? 92  VAL B CB  1 
ATOM   1772 C CG1 . VAL B 1 92  ? 11.447  32.117 22.524 1.00 36.16 ? 92  VAL B CG1 1 
ATOM   1773 C CG2 . VAL B 1 92  ? 12.721  33.425 24.221 1.00 35.02 ? 92  VAL B CG2 1 
ATOM   1774 N N   . ALA B 1 93  ? 13.563  29.103 22.873 1.00 40.69 ? 93  ALA B N   1 
ATOM   1775 C CA  . ALA B 1 93  ? 13.478  27.822 22.166 1.00 42.99 ? 93  ALA B CA  1 
ATOM   1776 C C   . ALA B 1 93  ? 13.099  26.652 23.118 1.00 45.58 ? 93  ALA B C   1 
ATOM   1777 O O   . ALA B 1 93  ? 12.308  25.800 22.758 1.00 45.95 ? 93  ALA B O   1 
ATOM   1778 C CB  . ALA B 1 93  ? 14.800  27.522 21.454 1.00 43.31 ? 93  ALA B CB  1 
ATOM   1779 N N   . ARG B 1 94  ? 13.693  26.620 24.311 1.00 47.60 ? 94  ARG B N   1 
ATOM   1780 C CA  . ARG B 1 94  ? 13.422  25.557 25.288 1.00 50.83 ? 94  ARG B CA  1 
ATOM   1781 C C   . ARG B 1 94  ? 12.034  25.732 25.908 1.00 51.54 ? 94  ARG B C   1 
ATOM   1782 O O   . ARG B 1 94  ? 11.315  24.768 26.048 1.00 53.33 ? 94  ARG B O   1 
ATOM   1783 C CB  . ARG B 1 94  ? 14.467  25.537 26.421 1.00 52.41 ? 94  ARG B CB  1 
ATOM   1784 C CG  . ARG B 1 94  ? 15.827  24.965 26.058 1.00 54.48 ? 94  ARG B CG  1 
ATOM   1785 C CD  . ARG B 1 94  ? 16.775  24.839 27.256 1.00 57.65 ? 94  ARG B CD  1 
ATOM   1786 N NE  . ARG B 1 94  ? 17.483  26.083 27.615 1.00 57.25 ? 94  ARG B NE  1 
ATOM   1787 C CZ  . ARG B 1 94  ? 17.249  26.860 28.689 1.00 57.10 ? 94  ARG B CZ  1 
ATOM   1788 N NH1 . ARG B 1 94  ? 16.297  26.579 29.579 1.00 58.35 ? 94  ARG B NH1 1 
ATOM   1789 N NH2 . ARG B 1 94  ? 17.981  27.958 28.863 1.00 55.55 ? 94  ARG B NH2 1 
ATOM   1790 N N   . GLU B 1 95  ? 11.661  26.963 26.277 1.00 50.61 ? 95  GLU B N   1 
ATOM   1791 C CA  . GLU B 1 95  ? 10.528  27.172 27.208 1.00 50.74 ? 95  GLU B CA  1 
ATOM   1792 C C   . GLU B 1 95  ? 9.326   27.871 26.625 1.00 48.14 ? 95  GLU B C   1 
ATOM   1793 O O   . GLU B 1 95  ? 8.376   28.066 27.352 1.00 48.76 ? 95  GLU B O   1 
ATOM   1794 C CB  . GLU B 1 95  ? 10.958  27.979 28.445 1.00 50.82 ? 95  GLU B CB  1 
ATOM   1795 C CG  . GLU B 1 95  ? 12.215  27.496 29.134 1.00 54.64 ? 95  GLU B CG  1 
ATOM   1796 C CD  . GLU B 1 95  ? 11.990  26.290 30.034 1.00 58.06 ? 95  GLU B CD  1 
ATOM   1797 O OE1 . GLU B 1 95  ? 10.900  25.669 29.979 1.00 57.53 ? 95  GLU B OE1 1 
ATOM   1798 O OE2 . GLU B 1 95  ? 12.928  25.978 30.803 1.00 61.42 ? 95  GLU B OE2 1 
ATOM   1799 N N   . ALA B 1 96  ? 9.348   28.283 25.351 1.00 45.76 ? 96  ALA B N   1 
ATOM   1800 C CA  . ALA B 1 96  ? 8.143   28.922 24.753 1.00 43.21 ? 96  ALA B CA  1 
ATOM   1801 C C   . ALA B 1 96  ? 7.292   27.907 24.028 1.00 43.53 ? 96  ALA B C   1 
ATOM   1802 O O   . ALA B 1 96  ? 7.740   26.787 23.732 1.00 45.30 ? 96  ALA B O   1 
ATOM   1803 C CB  . ALA B 1 96  ? 8.511   30.070 23.812 1.00 40.92 ? 96  ALA B CB  1 
ATOM   1804 N N   . ASP B 1 97  ? 6.069   28.301 23.717 1.00 42.89 ? 97  ASP B N   1 
ATOM   1805 C CA  . ASP B 1 97  ? 5.163   27.425 22.992 1.00 46.13 ? 97  ASP B CA  1 
ATOM   1806 C C   . ASP B 1 97  ? 5.812   26.908 21.693 1.00 48.10 ? 97  ASP B C   1 
ATOM   1807 O O   . ASP B 1 97  ? 6.599   27.630 21.026 1.00 45.97 ? 97  ASP B O   1 
ATOM   1808 C CB  . ASP B 1 97  ? 3.844   28.129 22.669 1.00 44.61 ? 97  ASP B CB  1 
ATOM   1809 C CG  . ASP B 1 97  ? 2.901   28.255 23.888 1.00 45.12 ? 97  ASP B CG  1 
ATOM   1810 O OD1 . ASP B 1 97  ? 3.186   27.748 25.002 1.00 45.15 ? 97  ASP B OD1 1 
ATOM   1811 O OD2 . ASP B 1 97  ? 1.853   28.893 23.706 1.00 44.30 ? 97  ASP B OD2 1 
ATOM   1812 N N   . GLU B 1 98  ? 5.463   25.666 21.347 1.00 51.39 ? 98  GLU B N   1 
ATOM   1813 C CA  . GLU B 1 98  ? 6.021   24.973 20.183 1.00 53.67 ? 98  GLU B CA  1 
ATOM   1814 C C   . GLU B 1 98  ? 5.837   25.820 18.937 1.00 53.76 ? 98  GLU B C   1 
ATOM   1815 O O   . GLU B 1 98  ? 4.875   26.604 18.839 1.00 55.07 ? 98  GLU B O   1 
ATOM   1816 C CB  . GLU B 1 98  ? 5.353   23.594 20.002 1.00 56.13 ? 98  GLU B CB  1 
ATOM   1817 N N   . GLY B 1 99  ? 6.764   25.683 17.985 1.00 56.03 ? 99  GLY B N   1 
ATOM   1818 C CA  . GLY B 1 99  ? 6.694   26.418 16.710 1.00 52.65 ? 99  GLY B CA  1 
ATOM   1819 C C   . GLY B 1 99  ? 7.255   27.835 16.777 1.00 50.63 ? 99  GLY B C   1 
ATOM   1820 O O   . GLY B 1 99  ? 6.881   28.719 15.963 1.00 48.70 ? 99  GLY B O   1 
ATOM   1821 N N   . CYS B 1 100 ? 8.142   28.077 17.739 1.00 46.95 ? 100 CYS B N   1 
ATOM   1822 C CA  . CYS B 1 100 ? 8.874   29.322 17.742 1.00 43.67 ? 100 CYS B CA  1 
ATOM   1823 C C   . CYS B 1 100 ? 10.180  29.181 16.926 1.00 42.60 ? 100 CYS B C   1 
ATOM   1824 O O   . CYS B 1 100 ? 10.756  30.181 16.517 1.00 40.91 ? 100 CYS B O   1 
ATOM   1825 C CB  . CYS B 1 100 ? 9.138   29.778 19.166 1.00 43.36 ? 100 CYS B CB  1 
ATOM   1826 S SG  . CYS B 1 100 ? 10.157  28.657 20.119 1.00 49.92 ? 100 CYS B SG  1 
ATOM   1827 N N   . LYS B 1 101 ? 10.618  27.958 16.641 1.00 44.14 ? 101 LYS B N   1 
ATOM   1828 C CA  . LYS B 1 101 ? 11.931  27.750 16.016 1.00 44.27 ? 101 LYS B CA  1 
ATOM   1829 C C   . LYS B 1 101 ? 12.006  28.388 14.616 1.00 42.61 ? 101 LYS B C   1 
ATOM   1830 O O   . LYS B 1 101 ? 13.008  29.051 14.304 1.00 40.62 ? 101 LYS B O   1 
ATOM   1831 C CB  . LYS B 1 101 ? 12.332  26.252 15.985 1.00 46.98 ? 101 LYS B CB  1 
ATOM   1832 C CG  . LYS B 1 101 ? 13.179  25.768 17.181 1.00 47.74 ? 101 LYS B CG  1 
ATOM   1833 N N   . LYS B 1 102 ? 10.962  28.195 13.792 1.00 40.94 ? 102 LYS B N   1 
ATOM   1834 C CA  . LYS B 1 102 ? 10.921  28.756 12.409 1.00 39.12 ? 102 LYS B CA  1 
ATOM   1835 C C   . LYS B 1 102 ? 10.941  30.270 12.442 1.00 35.44 ? 102 LYS B C   1 
ATOM   1836 O O   . LYS B 1 102 ? 11.753  30.863 11.754 1.00 36.62 ? 102 LYS B O   1 
ATOM   1837 C CB  . LYS B 1 102 ? 9.685   28.300 11.589 1.00 38.80 ? 102 LYS B CB  1 
ATOM   1838 N N   . PRO B 1 103 ? 10.046  30.906 13.233 1.00 33.73 ? 103 PRO B N   1 
ATOM   1839 C CA  . PRO B 1 103 ? 10.078  32.384 13.380 1.00 30.84 ? 103 PRO B CA  1 
ATOM   1840 C C   . PRO B 1 103 ? 11.442  32.979 13.896 1.00 29.92 ? 103 PRO B C   1 
ATOM   1841 O O   . PRO B 1 103 ? 11.881  34.056 13.440 1.00 26.81 ? 103 PRO B O   1 
ATOM   1842 C CB  . PRO B 1 103 ? 8.997   32.665 14.404 1.00 31.20 ? 103 PRO B CB  1 
ATOM   1843 C CG  . PRO B 1 103 ? 8.070   31.529 14.317 1.00 33.99 ? 103 PRO B CG  1 
ATOM   1844 C CD  . PRO B 1 103 ? 8.876   30.317 13.919 1.00 34.93 ? 103 PRO B CD  1 
ATOM   1845 N N   . LEU B 1 104 ? 12.070  32.275 14.828 1.00 30.67 ? 104 LEU B N   1 
ATOM   1846 C CA  . LEU B 1 104 ? 13.372  32.699 15.383 1.00 31.98 ? 104 LEU B CA  1 
ATOM   1847 C C   . LEU B 1 104 ? 14.481  32.538 14.342 1.00 32.33 ? 104 LEU B C   1 
ATOM   1848 O O   . LEU B 1 104 ? 15.291  33.424 14.153 1.00 30.34 ? 104 LEU B O   1 
ATOM   1849 C CB  . LEU B 1 104 ? 13.701  31.913 16.654 1.00 32.60 ? 104 LEU B CB  1 
ATOM   1850 C CG  . LEU B 1 104 ? 12.832  32.318 17.855 1.00 32.52 ? 104 LEU B CG  1 
ATOM   1851 C CD1 . LEU B 1 104 ? 13.189  31.538 19.103 1.00 35.29 ? 104 LEU B CD1 1 
ATOM   1852 C CD2 . LEU B 1 104 ? 12.944  33.808 18.098 1.00 31.53 ? 104 LEU B CD2 1 
ATOM   1853 N N   . GLU B 1 105 ? 14.486  31.404 13.666 1.00 34.04 ? 105 GLU B N   1 
ATOM   1854 C CA  . GLU B 1 105 ? 15.426  31.171 12.577 1.00 37.24 ? 105 GLU B CA  1 
ATOM   1855 C C   . GLU B 1 105 ? 15.349  32.290 11.527 1.00 35.47 ? 105 GLU B C   1 
ATOM   1856 O O   . GLU B 1 105 ? 16.378  32.793 11.099 1.00 36.04 ? 105 GLU B O   1 
ATOM   1857 C CB  . GLU B 1 105 ? 15.153  29.839 11.944 1.00 41.32 ? 105 GLU B CB  1 
ATOM   1858 C CG  . GLU B 1 105 ? 16.058  29.474 10.794 1.00 46.62 ? 105 GLU B CG  1 
ATOM   1859 C CD  . GLU B 1 105 ? 15.611  28.176 10.156 1.00 52.20 ? 105 GLU B CD  1 
ATOM   1860 O OE1 . GLU B 1 105 ? 15.592  27.127 10.869 1.00 59.45 ? 105 GLU B OE1 1 
ATOM   1861 O OE2 . GLU B 1 105 ? 15.260  28.205 8.950  1.00 54.65 ? 105 GLU B OE2 1 
ATOM   1862 N N   . ARG B 1 106 ? 14.136  32.679 11.144 1.00 33.65 ? 106 ARG B N   1 
ATOM   1863 C CA  . ARG B 1 106 ? 13.955  33.772 10.213 1.00 33.78 ? 106 ARG B CA  1 
ATOM   1864 C C   . ARG B 1 106 ? 14.467  35.104 10.741 1.00 31.41 ? 106 ARG B C   1 
ATOM   1865 O O   . ARG B 1 106 ? 15.095  35.858 10.013 1.00 29.18 ? 106 ARG B O   1 
ATOM   1866 C CB  . ARG B 1 106 ? 12.509  33.989 9.848  1.00 33.54 ? 106 ARG B CB  1 
ATOM   1867 C CG  . ARG B 1 106 ? 12.366  35.304 9.084  1.00 34.37 ? 106 ARG B CG  1 
ATOM   1868 C CD  . ARG B 1 106 ? 11.088  35.466 8.350  1.00 33.97 ? 106 ARG B CD  1 
ATOM   1869 N NE  . ARG B 1 106 ? 10.815  34.360 7.435  1.00 34.86 ? 106 ARG B NE  1 
ATOM   1870 C CZ  . ARG B 1 106 ? 9.781   34.336 6.603  1.00 33.66 ? 106 ARG B CZ  1 
ATOM   1871 N NH1 . ARG B 1 106 ? 8.930   35.373 6.528  1.00 31.22 ? 106 ARG B NH1 1 
ATOM   1872 N NH2 . ARG B 1 106 ? 9.596   33.265 5.872  1.00 34.48 ? 106 ARG B NH2 1 
ATOM   1873 N N   . LEU B 1 107 ? 14.136  35.380 11.990 1.00 30.81 ? 107 LEU B N   1 
ATOM   1874 C CA  . LEU B 1 107 ? 14.586  36.546 12.682 1.00 31.16 ? 107 LEU B CA  1 
ATOM   1875 C C   . LEU B 1 107 ? 16.126  36.638 12.596 1.00 30.34 ? 107 LEU B C   1 
ATOM   1876 O O   . LEU B 1 107 ? 16.667  37.686 12.259 1.00 29.17 ? 107 LEU B O   1 
ATOM   1877 C CB  . LEU B 1 107 ? 14.113  36.457 14.117 1.00 33.45 ? 107 LEU B CB  1 
ATOM   1878 C CG  . LEU B 1 107 ? 14.037  37.773 14.868 1.00 35.13 ? 107 LEU B CG  1 
ATOM   1879 C CD1 . LEU B 1 107 ? 13.075  37.689 16.063 1.00 36.52 ? 107 LEU B CD1 1 
ATOM   1880 C CD2 . LEU B 1 107 ? 15.421  38.134 15.329 1.00 37.48 ? 107 LEU B CD2 1 
ATOM   1881 N N   . LEU B 1 108 ? 16.805  35.521 12.866 1.00 29.64 ? 108 LEU B N   1 
ATOM   1882 C CA  . LEU B 1 108 ? 18.274  35.482 12.810 1.00 29.69 ? 108 LEU B CA  1 
ATOM   1883 C C   . LEU B 1 108 ? 18.796  35.691 11.396 1.00 29.89 ? 108 LEU B C   1 
ATOM   1884 O O   . LEU B 1 108 ? 19.796  36.373 11.217 1.00 30.88 ? 108 LEU B O   1 
ATOM   1885 C CB  . LEU B 1 108 ? 18.822  34.190 13.397 1.00 31.12 ? 108 LEU B CB  1 
ATOM   1886 C CG  . LEU B 1 108 ? 18.576  34.138 14.906 1.00 30.64 ? 108 LEU B CG  1 
ATOM   1887 C CD1 . LEU B 1 108 ? 18.989  32.793 15.416 1.00 32.62 ? 108 LEU B CD1 1 
ATOM   1888 C CD2 . LEU B 1 108 ? 19.311  35.254 15.666 1.00 30.82 ? 108 LEU B CD2 1 
ATOM   1889 N N   . ASN B 1 109 ? 18.109  35.131 10.395 1.00 28.54 ? 109 ASN B N   1 
ATOM   1890 C CA  . ASN B 1 109 ? 18.452  35.396 8.998  1.00 28.20 ? 109 ASN B CA  1 
ATOM   1891 C C   . ASN B 1 109 ? 18.415  36.880 8.608  1.00 27.45 ? 109 ASN B C   1 
ATOM   1892 O O   . ASN B 1 109 ? 19.329  37.390 7.932  1.00 26.23 ? 109 ASN B O   1 
ATOM   1893 C CB  . ASN B 1 109 ? 17.577  34.577 8.068  1.00 28.16 ? 109 ASN B CB  1 
ATOM   1894 C CG  . ASN B 1 109 ? 17.975  33.120 8.060  1.00 30.04 ? 109 ASN B CG  1 
ATOM   1895 O OD1 . ASN B 1 109 ? 19.005  32.762 8.604  1.00 30.64 ? 109 ASN B OD1 1 
ATOM   1896 N ND2 . ASN B 1 109 ? 17.169  32.279 7.438  1.00 30.83 ? 109 ASN B ND2 1 
ATOM   1897 N N   . ILE B 1 110 ? 17.367  37.558 9.035  1.00 27.25 ? 110 ILE B N   1 
ATOM   1898 C CA  . ILE B 1 110 ? 17.215  38.985 8.787  1.00 27.90 ? 110 ILE B CA  1 
ATOM   1899 C C   . ILE B 1 110 ? 18.347  39.810 9.452  1.00 27.73 ? 110 ILE B C   1 
ATOM   1900 O O   . ILE B 1 110 ? 18.849  40.759 8.844  1.00 27.70 ? 110 ILE B O   1 
ATOM   1901 C CB  . ILE B 1 110 ? 15.812  39.455 9.210  1.00 28.41 ? 110 ILE B CB  1 
ATOM   1902 C CG1 . ILE B 1 110 ? 14.771  38.880 8.202  1.00 29.56 ? 110 ILE B CG1 1 
ATOM   1903 C CG2 . ILE B 1 110 ? 15.732  40.984 9.270  1.00 28.23 ? 110 ILE B CG2 1 
ATOM   1904 C CD1 . ILE B 1 110 ? 13.323  38.933 8.693  1.00 29.17 ? 110 ILE B CD1 1 
ATOM   1905 N N   . TRP B 1 111 ? 18.726  39.430 10.671 1.00 26.79 ? 111 TRP B N   1 
ATOM   1906 C CA  . TRP B 1 111 ? 19.797  40.047 11.404 1.00 27.87 ? 111 TRP B CA  1 
ATOM   1907 C C   . TRP B 1 111 ? 21.110  39.905 10.670 1.00 29.45 ? 111 TRP B C   1 
ATOM   1908 O O   . TRP B 1 111 ? 21.880  40.856 10.576 1.00 29.30 ? 111 TRP B O   1 
ATOM   1909 C CB  . TRP B 1 111 ? 19.908  39.403 12.766 1.00 28.00 ? 111 TRP B CB  1 
ATOM   1910 C CG  . TRP B 1 111 ? 18.963  39.952 13.779 1.00 27.05 ? 111 TRP B CG  1 
ATOM   1911 C CD1 . TRP B 1 111 ? 17.897  40.814 13.566 1.00 25.90 ? 111 TRP B CD1 1 
ATOM   1912 C CD2 . TRP B 1 111 ? 18.956  39.665 15.207 1.00 27.17 ? 111 TRP B CD2 1 
ATOM   1913 N NE1 . TRP B 1 111 ? 17.270  41.095 14.734 1.00 25.82 ? 111 TRP B NE1 1 
ATOM   1914 C CE2 . TRP B 1 111 ? 17.879  40.450 15.772 1.00 26.90 ? 111 TRP B CE2 1 
ATOM   1915 C CE3 . TRP B 1 111 ? 19.726  38.884 16.041 1.00 28.79 ? 111 TRP B CE3 1 
ATOM   1916 C CZ2 . TRP B 1 111 ? 17.578  40.417 17.128 1.00 26.92 ? 111 TRP B CZ2 1 
ATOM   1917 C CZ3 . TRP B 1 111 ? 19.440  38.875 17.407 1.00 29.58 ? 111 TRP B CZ3 1 
ATOM   1918 C CH2 . TRP B 1 111 ? 18.369  39.613 17.935 1.00 27.89 ? 111 TRP B CH2 1 
ATOM   1919 N N   . GLN B 1 112 ? 21.343  38.702 10.144 1.00 30.18 ? 112 GLN B N   1 
ATOM   1920 C CA  . GLN B 1 112 ? 22.505  38.383 9.349  1.00 31.91 ? 112 GLN B CA  1 
ATOM   1921 C C   . GLN B 1 112 ? 22.471  39.185 8.061  1.00 32.13 ? 112 GLN B C   1 
ATOM   1922 O O   . GLN B 1 112 ? 23.470  39.819 7.699  1.00 33.49 ? 112 GLN B O   1 
ATOM   1923 C CB  . GLN B 1 112 ? 22.538  36.885 9.069  1.00 33.59 ? 112 GLN B CB  1 
ATOM   1924 C CG  . GLN B 1 112 ? 23.596  36.454 8.096  1.00 37.71 ? 112 GLN B CG  1 
ATOM   1925 C CD  . GLN B 1 112 ? 23.962  34.989 8.171  1.00 40.28 ? 112 GLN B CD  1 
ATOM   1926 O OE1 . GLN B 1 112 ? 23.922  34.297 7.181  1.00 44.82 ? 112 GLN B OE1 1 
ATOM   1927 N NE2 . GLN B 1 112 ? 24.359  34.535 9.320  1.00 42.69 ? 112 GLN B NE2 1 
ATOM   1928 N N   . GLU B 1 113 ? 21.334  39.206 7.387  1.00 29.74 ? 113 GLU B N   1 
ATOM   1929 C CA  . GLU B 1 113 ? 21.211  39.947 6.115  1.00 31.01 ? 113 GLU B CA  1 
ATOM   1930 C C   . GLU B 1 113 ? 21.431  41.456 6.229  1.00 31.40 ? 113 GLU B C   1 
ATOM   1931 O O   . GLU B 1 113 ? 22.031  42.092 5.331  1.00 31.60 ? 113 GLU B O   1 
ATOM   1932 C CB  . GLU B 1 113 ? 19.870  39.700 5.448  1.00 29.02 ? 113 GLU B CB  1 
ATOM   1933 C CG  . GLU B 1 113 ? 19.730  38.264 4.980  1.00 29.76 ? 113 GLU B CG  1 
ATOM   1934 C CD  . GLU B 1 113 ? 18.253  37.799 4.846  1.00 28.79 ? 113 GLU B CD  1 
ATOM   1935 O OE1 . GLU B 1 113 ? 17.348  38.660 4.879  1.00 26.72 ? 113 GLU B OE1 1 
ATOM   1936 O OE2 . GLU B 1 113 ? 18.009  36.567 4.732  1.00 28.22 ? 113 GLU B OE2 1 
ATOM   1937 N N   . ARG B 1 114 ? 20.988  42.013 7.336  1.00 30.46 ? 114 ARG B N   1 
ATOM   1938 C CA  . ARG B 1 114 ? 21.056  43.433 7.535  1.00 31.79 ? 114 ARG B CA  1 
ATOM   1939 C C   . ARG B 1 114 ? 22.219  43.830 8.433  1.00 32.88 ? 114 ARG B C   1 
ATOM   1940 O O   . ARG B 1 114 ? 22.223  44.913 8.951  1.00 33.56 ? 114 ARG B O   1 
ATOM   1941 C CB  . ARG B 1 114 ? 19.728  43.895 8.159  1.00 31.52 ? 114 ARG B CB  1 
ATOM   1942 C CG  . ARG B 1 114 ? 18.565  43.751 7.245  1.00 31.54 ? 114 ARG B CG  1 
ATOM   1943 C CD  . ARG B 1 114 ? 17.293  44.229 7.943  1.00 33.80 ? 114 ARG B CD  1 
ATOM   1944 N NE  . ARG B 1 114 ? 16.135  43.960 7.120  1.00 34.68 ? 114 ARG B NE  1 
ATOM   1945 C CZ  . ARG B 1 114 ? 14.864  43.972 7.532  1.00 37.36 ? 114 ARG B CZ  1 
ATOM   1946 N NH1 . ARG B 1 114 ? 14.542  44.248 8.791  1.00 36.65 ? 114 ARG B NH1 1 
ATOM   1947 N NH2 . ARG B 1 114 ? 13.895  43.656 6.666  1.00 38.00 ? 114 ARG B NH2 1 
ATOM   1948 N N   . SER B 1 115 ? 23.187  42.921 8.621  1.00 33.60 ? 115 SER B N   1 
ATOM   1949 C CA  . SER B 1 115 ? 24.326  43.082 9.518  1.00 34.36 ? 115 SER B CA  1 
ATOM   1950 C C   . SER B 1 115 ? 24.009  43.634 10.906 1.00 33.43 ? 115 SER B C   1 
ATOM   1951 O O   . SER B 1 115 ? 24.741  44.468 11.417 1.00 32.76 ? 115 SER B O   1 
ATOM   1952 C CB  . SER B 1 115 ? 25.385  43.946 8.846  1.00 36.53 ? 115 SER B CB  1 
ATOM   1953 O OG  . SER B 1 115 ? 25.661  43.458 7.557  1.00 37.62 ? 115 SER B OG  1 
ATOM   1954 N N   . VAL B 1 116 ? 22.937  43.134 11.526 1.00 31.74 ? 116 VAL B N   1 
ATOM   1955 C CA  . VAL B 1 116 ? 22.584  43.552 12.843 1.00 31.29 ? 116 VAL B CA  1 
ATOM   1956 C C   . VAL B 1 116 ? 23.660  43.005 13.794 1.00 32.95 ? 116 VAL B C   1 
ATOM   1957 O O   . VAL B 1 116 ? 24.045  43.681 14.736 1.00 32.50 ? 116 VAL B O   1 
ATOM   1958 C CB  . VAL B 1 116 ? 21.153  43.112 13.220 1.00 29.57 ? 116 VAL B CB  1 
ATOM   1959 C CG1 . VAL B 1 116 ? 20.886  43.275 14.704 1.00 29.35 ? 116 VAL B CG1 1 
ATOM   1960 C CG2 . VAL B 1 116 ? 20.117  43.923 12.420 1.00 29.18 ? 116 VAL B CG2 1 
ATOM   1961 N N   . TYR B 1 117 ? 24.115  41.774 13.546 1.00 34.05 ? 117 TYR B N   1 
ATOM   1962 C CA  . TYR B 1 117 ? 25.303  41.212 14.226 1.00 37.28 ? 117 TYR B CA  1 
ATOM   1963 C C   . TYR B 1 117 ? 26.122  40.410 13.199 1.00 39.00 ? 117 TYR B C   1 
ATOM   1964 O O   . TYR B 1 117 ? 25.619  40.099 12.111 1.00 38.18 ? 117 TYR B O   1 
ATOM   1965 C CB  . TYR B 1 117 ? 24.902  40.303 15.410 1.00 36.75 ? 117 TYR B CB  1 
ATOM   1966 C CG  . TYR B 1 117 ? 24.324  41.014 16.620 1.00 35.41 ? 117 TYR B CG  1 
ATOM   1967 C CD1 . TYR B 1 117 ? 25.145  41.684 17.530 1.00 37.24 ? 117 TYR B CD1 1 
ATOM   1968 C CD2 . TYR B 1 117 ? 22.985  40.975 16.884 1.00 34.16 ? 117 TYR B CD2 1 
ATOM   1969 C CE1 . TYR B 1 117 ? 24.610  42.309 18.664 1.00 36.50 ? 117 TYR B CE1 1 
ATOM   1970 C CE2 . TYR B 1 117 ? 22.438  41.608 18.006 1.00 33.92 ? 117 TYR B CE2 1 
ATOM   1971 C CZ  . TYR B 1 117 ? 23.242  42.276 18.883 1.00 34.71 ? 117 TYR B CZ  1 
ATOM   1972 O OH  . TYR B 1 117 ? 22.688  42.896 19.981 1.00 35.47 ? 117 TYR B OH  1 
ATOM   1973 N N   . GLY B 1 118 ? 27.362  40.069 13.551 1.00 42.70 ? 118 GLY B N   1 
ATOM   1974 C CA  . GLY B 1 118 ? 28.228  39.287 12.670 1.00 44.29 ? 118 GLY B CA  1 
ATOM   1975 C C   . GLY B 1 118 ? 27.731  37.854 12.486 1.00 44.62 ? 118 GLY B C   1 
ATOM   1976 O O   . GLY B 1 118 ? 26.934  37.350 13.283 1.00 43.85 ? 118 GLY B O   1 
ATOM   1977 N N   . GLY B 1 119 ? 28.215  37.202 11.438 1.00 44.55 ? 119 GLY B N   1 
ATOM   1978 C CA  . GLY B 1 119 ? 27.851  35.824 11.129 1.00 44.82 ? 119 GLY B CA  1 
ATOM   1979 C C   . GLY B 1 119 ? 28.223  34.841 12.230 1.00 45.35 ? 119 GLY B C   1 
ATOM   1980 O O   . GLY B 1 119 ? 27.493  33.881 12.489 1.00 43.72 ? 119 GLY B O   1 
ATOM   1981 N N   . GLU B 1 120 ? 29.355  35.092 12.884 1.00 47.13 ? 120 GLU B N   1 
ATOM   1982 C CA  . GLU B 1 120 ? 29.856  34.224 13.914 1.00 49.60 ? 120 GLU B CA  1 
ATOM   1983 C C   . GLU B 1 120 ? 28.854  34.231 15.074 1.00 47.03 ? 120 GLU B C   1 
ATOM   1984 O O   . GLU B 1 120 ? 28.494  33.201 15.598 1.00 46.92 ? 120 GLU B O   1 
ATOM   1985 C CB  . GLU B 1 120 ? 31.282  34.657 14.355 1.00 53.92 ? 120 GLU B CB  1 
ATOM   1986 C CG  . GLU B 1 120 ? 31.867  33.823 15.514 1.00 58.41 ? 120 GLU B CG  1 
ATOM   1987 C CD  . GLU B 1 120 ? 33.355  34.075 15.804 1.00 61.99 ? 120 GLU B CD  1 
ATOM   1988 O OE1 . GLU B 1 120 ? 33.680  35.124 16.381 1.00 61.82 ? 120 GLU B OE1 1 
ATOM   1989 O OE2 . GLU B 1 120 ? 34.204  33.210 15.484 1.00 66.56 ? 120 GLU B OE2 1 
ATOM   1990 N N   . PHE B 1 121 ? 28.389  35.401 15.440 1.00 44.71 ? 121 PHE B N   1 
ATOM   1991 C CA  . PHE B 1 121 ? 27.482  35.530 16.572 1.00 43.88 ? 121 PHE B CA  1 
ATOM   1992 C C   . PHE B 1 121 ? 26.076  35.022 16.242 1.00 40.37 ? 121 PHE B C   1 
ATOM   1993 O O   . PHE B 1 121 ? 25.485  34.365 17.057 1.00 39.79 ? 121 PHE B O   1 
ATOM   1994 C CB  . PHE B 1 121 ? 27.429  36.973 17.037 1.00 43.62 ? 121 PHE B CB  1 
ATOM   1995 C CG  . PHE B 1 121 ? 26.580  37.182 18.240 1.00 43.29 ? 121 PHE B CG  1 
ATOM   1996 C CD1 . PHE B 1 121 ? 26.879  36.539 19.446 1.00 44.55 ? 121 PHE B CD1 1 
ATOM   1997 C CD2 . PHE B 1 121 ? 25.497  38.048 18.191 1.00 41.54 ? 121 PHE B CD2 1 
ATOM   1998 C CE1 . PHE B 1 121 ? 26.094  36.757 20.566 1.00 44.37 ? 121 PHE B CE1 1 
ATOM   1999 C CE2 . PHE B 1 121 ? 24.708  38.269 19.317 1.00 41.76 ? 121 PHE B CE2 1 
ATOM   2000 C CZ  . PHE B 1 121 ? 25.013  37.626 20.506 1.00 42.75 ? 121 PHE B CZ  1 
ATOM   2001 N N   . ILE B 1 122 ? 25.579  35.318 15.045 1.00 38.28 ? 122 ILE B N   1 
ATOM   2002 C CA  . ILE B 1 122 ? 24.356  34.708 14.539 1.00 37.02 ? 122 ILE B CA  1 
ATOM   2003 C C   . ILE B 1 122 ? 24.415  33.168 14.573 1.00 37.08 ? 122 ILE B C   1 
ATOM   2004 O O   . ILE B 1 122 ? 23.435  32.533 14.940 1.00 35.61 ? 122 ILE B O   1 
ATOM   2005 C CB  . ILE B 1 122 ? 24.025  35.156 13.086 1.00 38.00 ? 122 ILE B CB  1 
ATOM   2006 C CG1 . ILE B 1 122 ? 23.811  36.675 12.988 1.00 37.21 ? 122 ILE B CG1 1 
ATOM   2007 C CG2 . ILE B 1 122 ? 22.790  34.433 12.515 1.00 36.67 ? 122 ILE B CG2 1 
ATOM   2008 C CD1 . ILE B 1 122 ? 22.685  37.220 13.797 1.00 36.29 ? 122 ILE B CD1 1 
ATOM   2009 N N   . GLN B 1 123 ? 25.541  32.574 14.191 1.00 38.72 ? 123 GLN B N   1 
ATOM   2010 C CA  . GLN B 1 123 ? 25.698  31.121 14.264 1.00 39.95 ? 123 GLN B CA  1 
ATOM   2011 C C   . GLN B 1 123 ? 25.621  30.618 15.708 1.00 40.32 ? 123 GLN B C   1 
ATOM   2012 O O   . GLN B 1 123 ? 25.049  29.555 15.949 1.00 39.88 ? 123 GLN B O   1 
ATOM   2013 C CB  . GLN B 1 123 ? 27.014  30.638 13.612 1.00 42.75 ? 123 GLN B CB  1 
ATOM   2014 C CG  . GLN B 1 123 ? 27.014  30.672 12.105 1.00 42.92 ? 123 GLN B CG  1 
ATOM   2015 C CD  . GLN B 1 123 ? 25.882  29.850 11.451 1.00 42.60 ? 123 GLN B CD  1 
ATOM   2016 O OE1 . GLN B 1 123 ? 25.069  30.384 10.693 1.00 40.18 ? 123 GLN B OE1 1 
ATOM   2017 N NE2 . GLN B 1 123 ? 25.867  28.542 11.702 1.00 43.99 ? 123 GLN B NE2 1 
ATOM   2018 N N   . GLN B 1 124 ? 26.189  31.374 16.663 1.00 40.85 ? 124 GLN B N   1 
ATOM   2019 C CA  . GLN B 1 124 ? 26.089  31.010 18.078 1.00 41.57 ? 124 GLN B CA  1 
ATOM   2020 C C   . GLN B 1 124 ? 24.630  31.096 18.535 1.00 39.53 ? 124 GLN B C   1 
ATOM   2021 O O   . GLN B 1 124 ? 24.182  30.279 19.304 1.00 39.91 ? 124 GLN B O   1 
ATOM   2022 C CB  . GLN B 1 124 ? 26.919  31.917 18.982 1.00 42.56 ? 124 GLN B CB  1 
ATOM   2023 C CG  . GLN B 1 124 ? 28.367  32.102 18.592 1.00 45.29 ? 124 GLN B CG  1 
ATOM   2024 C CD  . GLN B 1 124 ? 29.167  32.848 19.633 1.00 46.75 ? 124 GLN B CD  1 
ATOM   2025 O OE1 . GLN B 1 124 ? 28.615  33.591 20.467 1.00 46.95 ? 124 GLN B OE1 1 
ATOM   2026 N NE2 . GLN B 1 124 ? 30.488  32.624 19.625 1.00 50.13 ? 124 GLN B NE2 1 
ATOM   2027 N N   . LEU B 1 125 ? 23.894  32.090 18.074 1.00 38.00 ? 125 LEU B N   1 
ATOM   2028 C CA  . LEU B 1 125 ? 22.465  32.191 18.437 1.00 36.22 ? 125 LEU B CA  1 
ATOM   2029 C C   . LEU B 1 125 ? 21.628  31.032 17.859 1.00 37.12 ? 125 LEU B C   1 
ATOM   2030 O O   . LEU B 1 125 ? 20.806  30.435 18.587 1.00 36.37 ? 125 LEU B O   1 
ATOM   2031 C CB  . LEU B 1 125 ? 21.885  33.521 17.987 1.00 34.12 ? 125 LEU B CB  1 
ATOM   2032 C CG  . LEU B 1 125 ? 22.472  34.752 18.654 1.00 33.50 ? 125 LEU B CG  1 
ATOM   2033 C CD1 . LEU B 1 125 ? 21.837  35.987 18.072 1.00 31.42 ? 125 LEU B CD1 1 
ATOM   2034 C CD2 . LEU B 1 125 ? 22.289  34.684 20.179 1.00 33.86 ? 125 LEU B CD2 1 
ATOM   2035 N N   . LYS B 1 126 ? 21.834  30.721 16.573 1.00 38.35 ? 126 LYS B N   1 
ATOM   2036 C CA  . LYS B 1 126 ? 21.263  29.510 15.941 1.00 39.91 ? 126 LYS B CA  1 
ATOM   2037 C C   . LYS B 1 126 ? 21.607  28.231 16.722 1.00 43.40 ? 126 LYS B C   1 
ATOM   2038 O O   . LYS B 1 126 ? 20.727  27.391 16.977 1.00 43.88 ? 126 LYS B O   1 
ATOM   2039 C CB  . LYS B 1 126 ? 21.703  29.384 14.459 1.00 40.66 ? 126 LYS B CB  1 
ATOM   2040 C CG  . LYS B 1 126 ? 21.049  30.420 13.539 1.00 38.89 ? 126 LYS B CG  1 
ATOM   2041 C CD  . LYS B 1 126 ? 21.342  30.248 12.040 1.00 39.96 ? 126 LYS B CD  1 
ATOM   2042 C CE  . LYS B 1 126 ? 20.612  31.325 11.234 1.00 38.28 ? 126 LYS B CE  1 
ATOM   2043 N NZ  . LYS B 1 126 ? 20.630  31.050 9.777  1.00 39.49 ? 126 LYS B NZ  1 
ATOM   2044 N N   . LEU B 1 127 ? 22.872  28.083 17.108 1.00 45.40 ? 127 LEU B N   1 
ATOM   2045 C CA  . LEU B 1 127 ? 23.315  26.911 17.889 1.00 48.01 ? 127 LEU B CA  1 
ATOM   2046 C C   . LEU B 1 127 ? 22.655  26.840 19.296 1.00 49.22 ? 127 LEU B C   1 
ATOM   2047 O O   . LEU B 1 127 ? 22.424  25.742 19.842 1.00 51.69 ? 127 LEU B O   1 
ATOM   2048 C CB  . LEU B 1 127 ? 24.847  26.905 18.007 1.00 49.73 ? 127 LEU B CB  1 
ATOM   2049 C CG  . LEU B 1 127 ? 25.505  25.789 18.839 1.00 53.03 ? 127 LEU B CG  1 
ATOM   2050 C CD1 . LEU B 1 127 ? 25.025  24.430 18.352 1.00 55.03 ? 127 LEU B CD1 1 
ATOM   2051 C CD2 . LEU B 1 127 ? 27.037  25.869 18.781 1.00 54.77 ? 127 LEU B CD2 1 
ATOM   2052 N N   . SER B 1 128 ? 22.346  27.993 19.886 1.00 48.19 ? 128 SER B N   1 
ATOM   2053 C CA  . SER B 1 128 ? 21.798  28.009 21.243 1.00 49.32 ? 128 SER B CA  1 
ATOM   2054 C C   . SER B 1 128 ? 20.386  27.389 21.281 1.00 50.60 ? 128 SER B C   1 
ATOM   2055 O O   . SER B 1 128 ? 19.981  26.863 22.302 1.00 52.73 ? 128 SER B O   1 
ATOM   2056 C CB  . SER B 1 128 ? 21.816  29.409 21.846 1.00 47.04 ? 128 SER B CB  1 
ATOM   2057 O OG  . SER B 1 128 ? 20.820  30.222 21.264 1.00 48.12 ? 128 SER B OG  1 
ATOM   2058 N N   . MET B 1 129 ? 19.688  27.376 20.159 1.00 50.69 ? 129 MET B N   1 
ATOM   2059 C CA  . MET B 1 129 ? 18.355  26.758 20.087 1.00 53.33 ? 129 MET B CA  1 
ATOM   2060 C C   . MET B 1 129 ? 18.346  25.219 19.927 1.00 57.58 ? 129 MET B C   1 
ATOM   2061 O O   . MET B 1 129 ? 17.491  24.568 20.513 1.00 59.10 ? 129 MET B O   1 
ATOM   2062 C CB  . MET B 1 129 ? 17.570  27.390 18.954 1.00 52.36 ? 129 MET B CB  1 
ATOM   2063 C CG  . MET B 1 129 ? 17.526  28.904 19.053 1.00 51.04 ? 129 MET B CG  1 
ATOM   2064 S SD  . MET B 1 129 ? 16.367  29.686 17.916 1.00 50.54 ? 129 MET B SD  1 
ATOM   2065 C CE  . MET B 1 129 ? 16.935  29.125 16.311 1.00 48.73 ? 129 MET B CE  1 
ATOM   2066 N N   . GLU B 1 130 ? 19.266  24.653 19.128 1.00 57.93 ? 130 GLU B N   1 
ATOM   2067 C CA  . GLU B 1 130 ? 19.447  23.179 19.031 1.00 61.02 ? 130 GLU B CA  1 
ATOM   2068 C C   . GLU B 1 130 ? 20.351  22.690 20.159 1.00 62.28 ? 130 GLU B C   1 
ATOM   2069 O O   . GLU B 1 130 ? 20.061  22.914 21.334 1.00 61.23 ? 130 GLU B O   1 
ATOM   2070 C CB  . GLU B 1 130 ? 20.050  22.750 17.669 1.00 60.10 ? 130 GLU B CB  1 
HETATM 2071 S S   . SO4 C 2 .   ? 7.480   32.257 3.031  1.00 34.98 ? 201 SO4 A S   1 
HETATM 2072 O O1  . SO4 C 2 .   ? 8.871   31.838 3.076  1.00 38.41 ? 201 SO4 A O1  1 
HETATM 2073 O O2  . SO4 C 2 .   ? 7.102   32.365 1.630  1.00 38.18 ? 201 SO4 A O2  1 
HETATM 2074 O O3  . SO4 C 2 .   ? 6.677   31.192 3.622  1.00 34.37 ? 201 SO4 A O3  1 
HETATM 2075 O O4  . SO4 C 2 .   ? 7.275   33.574 3.611  1.00 34.30 ? 201 SO4 A O4  1 
HETATM 2076 S S   . SO4 D 2 .   ? 13.583  32.498 5.803  1.00 31.84 ? 202 SO4 A S   1 
HETATM 2077 O O1  . SO4 D 2 .   ? 14.066  31.397 4.997  1.00 31.98 ? 202 SO4 A O1  1 
HETATM 2078 O O2  . SO4 D 2 .   ? 12.939  33.469 4.899  1.00 31.67 ? 202 SO4 A O2  1 
HETATM 2079 O O3  . SO4 D 2 .   ? 12.679  32.033 6.878  1.00 33.63 ? 202 SO4 A O3  1 
HETATM 2080 O O4  . SO4 D 2 .   ? 14.690  33.256 6.431  1.00 34.06 ? 202 SO4 A O4  1 
HETATM 2081 S S   . SO4 E 2 .   ? 14.182  60.885 13.660 1.00 55.50 ? 203 SO4 A S   1 
HETATM 2082 O O1  . SO4 E 2 .   ? 14.218  60.452 12.248 1.00 56.88 ? 203 SO4 A O1  1 
HETATM 2083 O O2  . SO4 E 2 .   ? 12.793  60.648 14.155 1.00 50.98 ? 203 SO4 A O2  1 
HETATM 2084 O O3  . SO4 E 2 .   ? 15.231  60.128 14.386 1.00 50.09 ? 203 SO4 A O3  1 
HETATM 2085 O O4  . SO4 E 2 .   ? 14.457  62.333 13.709 1.00 53.76 ? 203 SO4 A O4  1 
HETATM 2086 X UNK . UNX F 3 .   ? 10.599  44.669 11.321 1.00 33.61 ? 204 UNX A UNK 1 
HETATM 2087 X UNK . UNX G 3 .   ? -0.648  31.724 -0.671 1.00 20.44 ? 205 UNX A UNK 1 
HETATM 2088 X UNK . UNX H 3 .   ? 0.169   63.104 18.477 1.00 38.59 ? 206 UNX A UNK 1 
HETATM 2089 X UNK . UNX I 3 .   ? 14.745  59.885 32.009 1.00 47.74 ? 207 UNX A UNK 1 
HETATM 2090 X UNK . UNX J 3 .   ? 11.043  50.293 11.205 1.00 32.62 ? 208 UNX A UNK 1 
HETATM 2091 X UNK . UNX K 3 .   ? -7.773  43.273 -4.880 1.00 29.75 ? 209 UNX A UNK 1 
HETATM 2092 S S   . SO4 L 2 .   ? 14.984  60.170 20.147 1.00 61.06 ? 201 SO4 B S   1 
HETATM 2093 O O1  . SO4 L 2 .   ? 15.185  58.707 20.066 1.00 60.60 ? 201 SO4 B O1  1 
HETATM 2094 O O2  . SO4 L 2 .   ? 14.718  60.798 18.816 1.00 54.50 ? 201 SO4 B O2  1 
HETATM 2095 O O3  . SO4 L 2 .   ? 13.810  60.389 21.009 1.00 51.79 ? 201 SO4 B O3  1 
HETATM 2096 O O4  . SO4 L 2 .   ? 16.229  60.760 20.681 1.00 53.19 ? 201 SO4 B O4  1 
HETATM 2097 S S   . SO4 M 2 .   ? 2.298   43.635 19.049 1.00 39.34 ? 202 SO4 B S   1 
HETATM 2098 O O1  . SO4 M 2 .   ? 2.885   42.634 18.162 1.00 47.47 ? 202 SO4 B O1  1 
HETATM 2099 O O2  . SO4 M 2 .   ? 0.819   43.554 19.012 1.00 41.65 ? 202 SO4 B O2  1 
HETATM 2100 O O3  . SO4 M 2 .   ? 2.827   43.248 20.378 1.00 46.59 ? 202 SO4 B O3  1 
HETATM 2101 O O4  . SO4 M 2 .   ? 2.682   44.989 18.631 1.00 42.42 ? 202 SO4 B O4  1 
HETATM 2102 S S   . SO4 N 2 .   ? -4.049  32.817 28.205 1.00 63.94 ? 203 SO4 B S   1 
HETATM 2103 O O1  . SO4 N 2 .   ? -2.682  32.318 28.453 1.00 62.63 ? 203 SO4 B O1  1 
HETATM 2104 O O2  . SO4 N 2 .   ? -4.769  31.951 27.234 1.00 62.46 ? 203 SO4 B O2  1 
HETATM 2105 O O3  . SO4 N 2 .   ? -4.816  32.840 29.467 1.00 58.91 ? 203 SO4 B O3  1 
HETATM 2106 O O4  . SO4 N 2 .   ? -3.947  34.189 27.658 1.00 65.57 ? 203 SO4 B O4  1 
HETATM 2107 X UNK . UNX O 3 .   ? 15.799  28.469 32.417 1.00 42.80 ? 204 UNX B UNK 1 
HETATM 2108 X UNK . UNX P 3 .   ? -4.322  29.985 0.512  1.00 26.38 ? 205 UNX B UNK 1 
HETATM 2109 X UNK . UNX Q 3 .   ? -2.805  30.980 11.018 1.00 33.89 ? 206 UNX B UNK 1 
HETATM 2110 X UNK . UNX R 3 .   ? 21.121  52.300 21.054 1.00 34.20 ? 207 UNX B UNK 1 
HETATM 2111 O O   . HOH S 4 .   ? -7.132  36.376 -2.312 1.00 22.23 ? 301 HOH A O   1 
HETATM 2112 O O   . HOH S 4 .   ? -3.979  38.045 -5.613 1.00 19.84 ? 302 HOH A O   1 
HETATM 2113 O O   . HOH S 4 .   ? 7.393   44.220 -1.122 1.00 22.78 ? 303 HOH A O   1 
HETATM 2114 O O   . HOH S 4 .   ? 13.199  42.297 3.491  1.00 21.59 ? 304 HOH A O   1 
HETATM 2115 O O   . HOH S 4 .   ? -0.872  49.980 -5.351 1.00 32.37 ? 305 HOH A O   1 
HETATM 2116 O O   . HOH S 4 .   ? 3.771   47.899 25.972 1.00 25.24 ? 306 HOH A O   1 
HETATM 2117 O O   . HOH S 4 .   ? 1.642   33.483 -1.570 1.00 21.48 ? 307 HOH A O   1 
HETATM 2118 O O   . HOH S 4 .   ? 10.699  37.839 5.394  1.00 30.30 ? 308 HOH A O   1 
HETATM 2119 O O   . HOH S 4 .   ? 11.436  42.430 -3.523 1.00 31.67 ? 309 HOH A O   1 
HETATM 2120 O O   . HOH S 4 .   ? -1.735  56.155 -1.443 1.00 36.38 ? 310 HOH A O   1 
HETATM 2121 O O   . HOH S 4 .   ? -5.677  46.195 -2.903 1.00 28.30 ? 311 HOH A O   1 
HETATM 2122 O O   . HOH S 4 .   ? 5.905   40.973 -1.278 1.00 25.98 ? 312 HOH A O   1 
HETATM 2123 O O   . HOH S 4 .   ? 2.609   33.603 11.231 1.00 30.79 ? 313 HOH A O   1 
HETATM 2124 O O   . HOH S 4 .   ? 10.381  37.984 10.760 1.00 39.00 ? 314 HOH A O   1 
HETATM 2125 O O   . HOH S 4 .   ? -2.830  56.021 17.981 1.00 36.14 ? 315 HOH A O   1 
HETATM 2126 O O   . HOH S 4 .   ? 10.046  44.727 -3.126 1.00 45.05 ? 316 HOH A O   1 
HETATM 2127 O O   . HOH S 4 .   ? -1.234  44.605 -9.375 1.00 40.48 ? 317 HOH A O   1 
HETATM 2128 O O   . HOH S 4 .   ? -4.409  56.416 -0.678 1.00 27.34 ? 318 HOH A O   1 
HETATM 2129 O O   . HOH S 4 .   ? 5.779   32.482 22.742 1.00 28.29 ? 319 HOH A O   1 
HETATM 2130 O O   . HOH S 4 .   ? -3.536  47.501 -3.958 1.00 31.27 ? 320 HOH A O   1 
HETATM 2131 O O   . HOH S 4 .   ? -12.307 57.454 19.421 1.00 40.10 ? 321 HOH A O   1 
HETATM 2132 O O   . HOH S 4 .   ? 5.759   52.523 25.818 1.00 27.26 ? 322 HOH A O   1 
HETATM 2133 O O   . HOH S 4 .   ? 7.081   36.398 -4.429 1.00 33.49 ? 323 HOH A O   1 
HETATM 2134 O O   . HOH S 4 .   ? -10.633 53.218 20.850 1.00 32.76 ? 324 HOH A O   1 
HETATM 2135 O O   . HOH S 4 .   ? -11.521 58.134 16.337 1.00 37.10 ? 325 HOH A O   1 
HETATM 2136 O O   . HOH S 4 .   ? -0.961  44.181 23.606 1.00 37.81 ? 326 HOH A O   1 
HETATM 2137 O O   . HOH S 4 .   ? 9.216   34.594 -3.587 1.00 43.45 ? 327 HOH A O   1 
HETATM 2138 O O   . HOH S 4 .   ? -7.140  48.338 -2.431 1.00 38.36 ? 328 HOH A O   1 
HETATM 2139 O O   . HOH S 4 .   ? -10.748 48.304 0.661  1.00 35.09 ? 329 HOH A O   1 
HETATM 2140 O O   . HOH S 4 .   ? 0.735   32.791 21.514 1.00 32.55 ? 330 HOH A O   1 
HETATM 2141 O O   . HOH S 4 .   ? 7.539   39.907 9.212  1.00 37.16 ? 331 HOH A O   1 
HETATM 2142 O O   . HOH S 4 .   ? -2.770  40.403 -5.700 1.00 27.28 ? 332 HOH A O   1 
HETATM 2143 O O   . HOH S 4 .   ? 5.706   34.646 15.021 1.00 42.31 ? 333 HOH A O   1 
HETATM 2144 O O   . HOH S 4 .   ? 4.653   31.586 0.220  1.00 39.96 ? 334 HOH A O   1 
HETATM 2145 O O   . HOH S 4 .   ? -6.814  54.870 -1.134 1.00 32.31 ? 335 HOH A O   1 
HETATM 2146 O O   . HOH S 4 .   ? -3.927  52.150 21.812 1.00 30.76 ? 336 HOH A O   1 
HETATM 2147 O O   A HOH S 4 .   ? 13.091  52.861 38.482 0.50 19.39 ? 337 HOH A O   1 
HETATM 2148 O O   B HOH S 4 .   ? 11.224  52.307 38.999 0.50 23.45 ? 337 HOH A O   1 
HETATM 2149 O O   . HOH S 4 .   ? 4.398   32.677 -2.306 1.00 38.69 ? 338 HOH A O   1 
HETATM 2150 O O   . HOH S 4 .   ? 2.912   37.265 -7.158 1.00 37.46 ? 339 HOH A O   1 
HETATM 2151 O O   . HOH S 4 .   ? 15.763  43.458 2.748  1.00 33.56 ? 340 HOH A O   1 
HETATM 2152 O O   . HOH S 4 .   ? -2.475  56.063 22.036 1.00 44.52 ? 341 HOH A O   1 
HETATM 2153 O O   . HOH S 4 .   ? -4.300  54.474 22.986 1.00 39.70 ? 342 HOH A O   1 
HETATM 2154 O O   . HOH S 4 .   ? 0.140   40.162 -5.369 1.00 31.38 ? 343 HOH A O   1 
HETATM 2155 O O   . HOH S 4 .   ? -11.432 46.461 11.854 1.00 33.90 ? 344 HOH A O   1 
HETATM 2156 O O   . HOH S 4 .   ? 7.263   54.547 14.631 1.00 42.23 ? 345 HOH A O   1 
HETATM 2157 O O   . HOH T 4 .   ? 4.182   46.413 16.818 1.00 22.48 ? 301 HOH B O   1 
HETATM 2158 O O   . HOH T 4 .   ? -4.310  53.824 17.457 1.00 27.05 ? 302 HOH B O   1 
HETATM 2159 O O   . HOH T 4 .   ? 22.406  49.737 18.804 1.00 32.95 ? 303 HOH B O   1 
HETATM 2160 O O   . HOH T 4 .   ? 25.847  39.615 9.429  1.00 23.30 ? 304 HOH B O   1 
HETATM 2161 O O   . HOH T 4 .   ? 10.351  35.969 12.518 1.00 31.37 ? 305 HOH B O   1 
HETATM 2162 O O   . HOH T 4 .   ? 23.754  35.541 26.863 1.00 40.47 ? 306 HOH B O   1 
HETATM 2163 O O   . HOH T 4 .   ? 9.063   24.363 17.083 1.00 42.88 ? 307 HOH B O   1 
HETATM 2164 O O   . HOH T 4 .   ? 1.767   44.413 22.337 1.00 38.95 ? 308 HOH B O   1 
HETATM 2165 O O   . HOH T 4 .   ? 5.245   42.369 16.912 1.00 28.84 ? 309 HOH B O   1 
HETATM 2166 O O   . HOH T 4 .   ? 25.638  28.722 21.067 1.00 34.64 ? 310 HOH B O   1 
HETATM 2167 O O   . HOH T 4 .   ? 16.690  41.130 5.266  1.00 28.21 ? 311 HOH B O   1 
HETATM 2168 O O   . HOH T 4 .   ? 29.959  38.798 9.387  1.00 34.44 ? 312 HOH B O   1 
HETATM 2169 O O   . HOH T 4 .   ? -10.830 43.335 11.285 1.00 41.49 ? 313 HOH B O   1 
HETATM 2170 O O   . HOH T 4 .   ? 13.379  36.023 35.803 1.00 34.12 ? 314 HOH B O   1 
HETATM 2171 O O   . HOH T 4 .   ? -1.815  34.595 12.004 1.00 38.95 ? 315 HOH B O   1 
HETATM 2172 O O   . HOH T 4 .   ? -9.683  37.078 -1.622 1.00 27.66 ? 316 HOH B O   1 
HETATM 2173 O O   . HOH T 4 .   ? 9.556   38.111 8.056  1.00 27.29 ? 317 HOH B O   1 
HETATM 2174 O O   . HOH T 4 .   ? 17.802  47.147 10.082 1.00 40.49 ? 318 HOH B O   1 
HETATM 2175 O O   . HOH T 4 .   ? 15.225  55.035 15.350 1.00 29.44 ? 319 HOH B O   1 
HETATM 2176 O O   . HOH T 4 .   ? 23.769  43.802 5.678  1.00 31.77 ? 320 HOH B O   1 
HETATM 2177 O O   . HOH T 4 .   ? 7.040   38.649 32.790 1.00 35.38 ? 321 HOH B O   1 
HETATM 2178 O O   . HOH T 4 .   ? 28.578  40.567 15.811 1.00 35.14 ? 322 HOH B O   1 
HETATM 2179 O O   . HOH T 4 .   ? 6.736   39.192 35.640 1.00 41.65 ? 323 HOH B O   1 
HETATM 2180 O O   . HOH T 4 .   ? 6.379   30.373 20.920 1.00 39.37 ? 324 HOH B O   1 
HETATM 2181 O O   . HOH T 4 .   ? 9.366   51.092 16.406 1.00 29.07 ? 325 HOH B O   1 
HETATM 2182 O O   . HOH T 4 .   ? 8.604   45.029 14.448 1.00 29.10 ? 326 HOH B O   1 
HETATM 2183 O O   . HOH T 4 .   ? -1.236  54.948 19.831 1.00 32.14 ? 327 HOH B O   1 
HETATM 2184 O O   . HOH T 4 .   ? 30.155  30.897 15.667 1.00 36.37 ? 328 HOH B O   1 
HETATM 2185 O O   . HOH T 4 .   ? 12.675  42.665 10.810 1.00 29.86 ? 329 HOH B O   1 
HETATM 2186 O O   . HOH T 4 .   ? 6.234   30.439 31.352 1.00 43.38 ? 330 HOH B O   1 
HETATM 2187 O O   . HOH T 4 .   ? 1.249   30.207 28.113 1.00 31.84 ? 331 HOH B O   1 
HETATM 2188 O O   . HOH T 4 .   ? 9.748   42.720 15.584 1.00 29.24 ? 332 HOH B O   1 
HETATM 2189 O O   . HOH T 4 .   ? 5.948   44.566 15.551 1.00 33.37 ? 333 HOH B O   1 
HETATM 2190 O O   . HOH T 4 .   ? 6.484   34.554 5.995  1.00 26.71 ? 334 HOH B O   1 
HETATM 2191 O O   . HOH T 4 .   ? -1.068  42.765 17.690 1.00 29.90 ? 335 HOH B O   1 
HETATM 2192 O O   . HOH T 4 .   ? 24.745  36.312 24.684 1.00 45.75 ? 336 HOH B O   1 
HETATM 2193 O O   . HOH T 4 .   ? 20.646  30.156 7.210  1.00 28.90 ? 337 HOH B O   1 
HETATM 2194 O O   . HOH T 4 .   ? 9.162   31.085 33.041 1.00 35.71 ? 338 HOH B O   1 
HETATM 2195 O O   . HOH T 4 .   ? 1.228   27.954 26.748 1.00 34.67 ? 339 HOH B O   1 
HETATM 2196 O O   . HOH T 4 .   ? 12.569  56.903 19.986 1.00 37.11 ? 340 HOH B O   1 
HETATM 2197 O O   . HOH T 4 .   ? 18.013  47.763 7.547  1.00 47.77 ? 341 HOH B O   1 
HETATM 2198 O O   . HOH T 4 .   ? 4.032   50.299 25.124 1.00 33.55 ? 342 HOH B O   1 
HETATM 2199 O O   . HOH T 4 .   ? 10.508  30.995 5.641  1.00 40.13 ? 343 HOH B O   1 
HETATM 2200 O O   . HOH T 4 .   ? 23.052  57.812 21.516 1.00 42.88 ? 344 HOH B O   1 
HETATM 2201 O O   . HOH T 4 .   ? -3.596  39.029 14.936 1.00 35.97 ? 345 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 3   ? 0.9760 0.7338 0.6584 -0.0053 -0.0890 -0.2635 3   SER A N   
2    C CA  . SER A 3   ? 0.9692 0.7605 0.6569 -0.0090 -0.1076 -0.2781 3   SER A CA  
3    C C   . SER A 3   ? 0.9330 0.7521 0.6181 0.0046  -0.1099 -0.2583 3   SER A C   
4    O O   . SER A 3   ? 0.9251 0.7364 0.5944 0.0179  -0.0981 -0.2380 3   SER A O   
5    C CB  . SER A 3   ? 0.9971 0.7847 0.6562 -0.0013 -0.1198 -0.3031 3   SER A CB  
6    N N   . PHE A 4   ? 0.9072 0.7587 0.6094 0.0006  -0.1251 -0.2654 4   PHE A N   
7    C CA  . PHE A 4   ? 0.8744 0.7472 0.5690 0.0159  -0.1314 -0.2501 4   PHE A CA  
8    C C   . PHE A 4   ? 0.9013 0.7715 0.5505 0.0370  -0.1412 -0.2537 4   PHE A C   
9    O O   . PHE A 4   ? 0.9201 0.7898 0.5540 0.0384  -0.1519 -0.2761 4   PHE A O   
10   C CB  . PHE A 4   ? 0.8489 0.7593 0.5765 0.0081  -0.1468 -0.2605 4   PHE A CB  
11   C CG  . PHE A 4   ? 0.8323 0.7619 0.5479 0.0276  -0.1587 -0.2495 4   PHE A CG  
12   C CD1 . PHE A 4   ? 0.7988 0.7264 0.5220 0.0313  -0.1487 -0.2247 4   PHE A CD1 
13   C CD2 . PHE A 4   ? 0.8590 0.8055 0.5527 0.0434  -0.1809 -0.2647 4   PHE A CD2 
14   C CE1 . PHE A 4   ? 0.7923 0.7295 0.5002 0.0497  -0.1600 -0.2146 4   PHE A CE1 
15   C CE2 . PHE A 4   ? 0.8579 0.8141 0.5347 0.0638  -0.1932 -0.2537 4   PHE A CE2 
16   C CZ  . PHE A 4   ? 0.8204 0.7693 0.5035 0.0666  -0.1822 -0.2282 4   PHE A CZ  
17   N N   . SER A 5   ? 0.8877 0.7535 0.5124 0.0523  -0.1365 -0.2315 5   SER A N   
18   C CA  . SER A 5   ? 0.9127 0.7783 0.4917 0.0720  -0.1492 -0.2327 5   SER A CA  
19   C C   . SER A 5   ? 0.8901 0.7553 0.4572 0.0828  -0.1487 -0.2081 5   SER A C   
20   O O   . SER A 5   ? 0.8456 0.7038 0.4290 0.0767  -0.1320 -0.1879 5   SER A O   
21   C CB  . SER A 5   ? 0.9489 0.7911 0.4858 0.0799  -0.1384 -0.2344 5   SER A CB  
22   O OG  . SER A 5   ? 0.9460 0.7718 0.4703 0.0822  -0.1160 -0.2100 5   SER A OG  
23   N N   . GLU A 6   ? 0.9122 0.7833 0.4498 0.0997  -0.1685 -0.2111 6   GLU A N   
24   C CA  . GLU A 6   ? 0.9119 0.7742 0.4293 0.1124  -0.1707 -0.1886 6   GLU A CA  
25   C C   . GLU A 6   ? 0.9068 0.7377 0.3886 0.1134  -0.1473 -0.1633 6   GLU A C   
26   O O   . GLU A 6   ? 0.8967 0.7188 0.3833 0.1117  -0.1377 -0.1424 6   GLU A O   
27   C CB  . GLU A 6   ? 0.9601 0.8285 0.4436 0.1342  -0.1988 -0.1977 6   GLU A CB  
28   C CG  . GLU A 6   ? 0.9541 0.8632 0.4811 0.1329  -0.2220 -0.2235 6   GLU A CG  
29   C CD  . GLU A 6   ? 0.9984 0.9196 0.4978 0.1583  -0.2529 -0.2340 6   GLU A CD  
30   O OE1 . GLU A 6   ? 1.0329 0.9253 0.4815 0.1780  -0.2571 -0.2146 6   GLU A OE1 
31   O OE2 . GLU A 6   ? 1.0187 0.9782 0.5471 0.1584  -0.2735 -0.2629 6   GLU A OE2 
32   N N   . SER A 7   ? 0.9322 0.7489 0.3799 0.1152  -0.1374 -0.1671 7   SER A N   
33   C CA  . SER A 7   ? 0.9413 0.7352 0.3580 0.1138  -0.1126 -0.1464 7   SER A CA  
34   C C   . SER A 7   ? 0.8812 0.6794 0.3412 0.0980  -0.0902 -0.1375 7   SER A C   
35   O O   . SER A 7   ? 0.8731 0.6617 0.3278 0.0943  -0.0737 -0.1169 7   SER A O   
36   C CB  . SER A 7   ? 0.9892 0.7730 0.3616 0.1198  -0.1068 -0.1561 7   SER A CB  
37   O OG  . SER A 7   ? 0.9841 0.7804 0.3849 0.1136  -0.1084 -0.1797 7   SER A OG  
38   N N   . ALA A 8   ? 0.8437 0.6548 0.3455 0.0885  -0.0902 -0.1532 8   ALA A N   
39   C CA  . ALA A 8   ? 0.7920 0.6061 0.3343 0.0762  -0.0729 -0.1446 8   ALA A CA  
40   C C   . ALA A 8   ? 0.7521 0.5734 0.3206 0.0720  -0.0749 -0.1287 8   ALA A C   
41   O O   . ALA A 8   ? 0.7072 0.5266 0.2908 0.0660  -0.0581 -0.1127 8   ALA A O   
42   C CB  . ALA A 8   ? 0.7913 0.6103 0.3670 0.0670  -0.0754 -0.1636 8   ALA A CB  
43   N N   . LEU A 9   ? 0.7459 0.5787 0.3216 0.0760  -0.0960 -0.1353 9   LEU A N   
44   C CA  . LEU A 9   ? 0.7168 0.5580 0.3166 0.0745  -0.0997 -0.1232 9   LEU A CA  
45   C C   . LEU A 9   ? 0.7278 0.5488 0.2929 0.0820  -0.0927 -0.1012 9   LEU A C   
46   O O   . LEU A 9   ? 0.7070 0.5260 0.2891 0.0759  -0.0814 -0.0863 9   LEU A O   
47   C CB  . LEU A 9   ? 0.7201 0.5830 0.3354 0.0798  -0.1248 -0.1383 9   LEU A CB  
48   C CG  . LEU A 9   ? 0.6971 0.5704 0.3339 0.0825  -0.1311 -0.1281 9   LEU A CG  
49   C CD1 . LEU A 9   ? 0.6570 0.5359 0.3343 0.0668  -0.1134 -0.1184 9   LEU A CD1 
50   C CD2 . LEU A 9   ? 0.7028 0.6059 0.3588 0.0889  -0.1561 -0.1485 9   LEU A CD2 
51   N N   . GLU A 10  ? 0.7830 0.5867 0.2965 0.0943  -0.0990 -0.0996 10  GLU A N   
52   C CA  . GLU A 10  ? 0.8246 0.6007 0.2957 0.0994  -0.0914 -0.0774 10  GLU A CA  
53   C C   . GLU A 10  ? 0.8063 0.5761 0.2822 0.0855  -0.0621 -0.0637 10  GLU A C   
54   O O   . GLU A 10  ? 0.7932 0.5504 0.2658 0.0805  -0.0518 -0.0458 10  GLU A O   
55   C CB  . GLU A 10  ? 0.9038 0.6586 0.3112 0.1140  -0.1012 -0.0781 10  GLU A CB  
56   C CG  . GLU A 10  ? 0.9446 0.7010 0.3381 0.1328  -0.1327 -0.0864 10  GLU A CG  
57   C CD  . GLU A 10  ? 1.0146 0.7612 0.3548 0.1490  -0.1484 -0.0970 10  GLU A CD  
58   O OE1 . GLU A 10  ? 1.0540 0.7922 0.3657 0.1453  -0.1343 -0.0987 10  GLU A OE1 
59   O OE2 . GLU A 10  ? 1.0527 0.8029 0.3795 0.1674  -0.1762 -0.1056 10  GLU A OE2 
60   N N   . LYS A 11  ? 0.8036 0.5837 0.2894 0.0798  -0.0495 -0.0744 11  LYS A N   
61   C CA  . LYS A 11  ? 0.7944 0.5767 0.2893 0.0694  -0.0232 -0.0664 11  LYS A CA  
62   C C   . LYS A 11  ? 0.7351 0.5304 0.2800 0.0602  -0.0184 -0.0599 11  LYS A C   
63   O O   . LYS A 11  ? 0.7303 0.5218 0.2771 0.0533  -0.0048 -0.0448 11  LYS A O   
64   C CB  . LYS A 11  ? 0.8079 0.5991 0.3044 0.0699  -0.0146 -0.0828 11  LYS A CB  
65   C CG  . LYS A 11  ? 0.8125 0.6097 0.3104 0.0634  0.0121  -0.0775 11  LYS A CG  
66   N N   . LYS A 12  ? 0.7062 0.5162 0.2898 0.0590  -0.0300 -0.0715 12  LYS A N   
67   C CA  . LYS A 12  ? 0.6549 0.4775 0.2837 0.0507  -0.0255 -0.0662 12  LYS A CA  
68   C C   . LYS A 12  ? 0.6451 0.4637 0.2757 0.0503  -0.0294 -0.0516 12  LYS A C   
69   O O   . LYS A 12  ? 0.6238 0.4466 0.2748 0.0431  -0.0175 -0.0414 12  LYS A O   
70   C CB  . LYS A 12  ? 0.6339 0.4693 0.2963 0.0476  -0.0374 -0.0808 12  LYS A CB  
71   C CG  . LYS A 12  ? 0.6378 0.4712 0.3041 0.0459  -0.0308 -0.0940 12  LYS A CG  
72   C CD  . LYS A 12  ? 0.6392 0.4770 0.3200 0.0425  -0.0460 -0.1118 12  LYS A CD  
73   C CE  . LYS A 12  ? 0.6551 0.4822 0.3340 0.0414  -0.0398 -0.1252 12  LYS A CE  
74   N NZ  . LYS A 12  ? 0.6334 0.4574 0.3385 0.0360  -0.0270 -0.1189 12  LYS A NZ  
75   N N   . LEU A 13  ? 0.6566 0.4664 0.2643 0.0598  -0.0475 -0.0520 13  LEU A N   
76   C CA  . LEU A 13  ? 0.6510 0.4509 0.2544 0.0630  -0.0535 -0.0393 13  LEU A CA  
77   C C   . LEU A 13  ? 0.6850 0.4610 0.2580 0.0578  -0.0361 -0.0210 13  LEU A C   
78   O O   . LEU A 13  ? 0.6559 0.4269 0.2413 0.0526  -0.0314 -0.0099 13  LEU A O   
79   C CB  . LEU A 13  ? 0.6792 0.4722 0.2582 0.0787  -0.0783 -0.0450 13  LEU A CB  
80   C CG  . LEU A 13  ? 0.6489 0.4717 0.2633 0.0820  -0.0971 -0.0649 13  LEU A CG  
81   C CD1 . LEU A 13  ? 0.6922 0.5125 0.2776 0.1003  -0.1223 -0.0745 13  LEU A CD1 
82   C CD2 . LEU A 13  ? 0.6099 0.4521 0.2703 0.0761  -0.0977 -0.0638 13  LEU A CD2 
83   N N   . SER A 14  ? 0.7400 0.5011 0.2718 0.0581  -0.0262 -0.0188 14  SER A N   
84   C CA  . SER A 14  ? 0.7875 0.5279 0.2884 0.0487  -0.0055 -0.0027 14  SER A CA  
85   C C   . SER A 14  ? 0.7725 0.5342 0.3141 0.0336  0.0158  -0.0005 14  SER A C   
86   O O   . SER A 14  ? 0.7939 0.5451 0.3274 0.0227  0.0305  0.0118  14  SER A O   
87   C CB  . SER A 14  ? 0.8441 0.5706 0.2947 0.0505  0.0032  -0.0032 14  SER A CB  
88   O OG  . SER A 14  ? 0.8248 0.5770 0.2962 0.0472  0.0151  -0.0168 14  SER A OG  
89   N N   . GLU A 15  ? 0.7403 0.5304 0.3252 0.0333  0.0160  -0.0130 15  GLU A N   
90   C CA  . GLU A 15  ? 0.7151 0.5267 0.3360 0.0236  0.0335  -0.0130 15  GLU A CA  
91   C C   . GLU A 15  ? 0.6609 0.4820 0.3203 0.0195  0.0292  -0.0084 15  GLU A C   
92   O O   . GLU A 15  ? 0.6396 0.4784 0.3271 0.0125  0.0418  -0.0078 15  GLU A O   
93   C CB  . GLU A 15  ? 0.7379 0.5682 0.3769 0.0275  0.0372  -0.0280 15  GLU A CB  
94   C CG  . GLU A 15  ? 0.8277 0.6552 0.4324 0.0291  0.0498  -0.0329 15  GLU A CG  
95   C CD  . GLU A 15  ? 0.8830 0.7158 0.4886 0.0383  0.0442  -0.0504 15  GLU A CD  
96   O OE1 . GLU A 15  ? 0.9401 0.7770 0.5736 0.0414  0.0318  -0.0586 15  GLU A OE1 
97   O OE2 . GLU A 15  ? 1.0044 0.8355 0.5799 0.0415  0.0530  -0.0565 15  GLU A OE2 
98   N N   . LEU A 16  ? 0.6446 0.4571 0.3060 0.0250  0.0110  -0.0065 16  LEU A N   
99   C CA  . LEU A 16  ? 0.5966 0.4192 0.2926 0.0217  0.0074  -0.0030 16  LEU A CA  
100  C C   . LEU A 16  ? 0.6027 0.4151 0.2930 0.0116  0.0208  0.0093  16  LEU A C   
101  O O   . LEU A 16  ? 0.6070 0.3949 0.2585 0.0082  0.0275  0.0179  16  LEU A O   
102  C CB  . LEU A 16  ? 0.5957 0.4131 0.2921 0.0312  -0.0144 -0.0055 16  LEU A CB  
103  C CG  . LEU A 16  ? 0.5794 0.4115 0.2878 0.0381  -0.0293 -0.0202 16  LEU A CG  
104  C CD1 . LEU A 16  ? 0.5849 0.4168 0.2916 0.0488  -0.0510 -0.0245 16  LEU A CD1 
105  C CD2 . LEU A 16  ? 0.5413 0.3970 0.2916 0.0308  -0.0235 -0.0268 16  LEU A CD2 
106  N N   . SER A 17  ? 0.5839 0.4140 0.3111 0.0060  0.0245  0.0097  17  SER A N   
107  C CA  . SER A 17  ? 0.5957 0.4205 0.3255 -0.0052 0.0359  0.0183  17  SER A CA  
108  C C   . SER A 17  ? 0.6264 0.4176 0.3287 -0.0038 0.0268  0.0276  17  SER A C   
109  O O   . SER A 17  ? 0.6198 0.4029 0.3190 0.0088  0.0074  0.0255  17  SER A O   
110  C CB  . SER A 17  ? 0.5685 0.4185 0.3426 -0.0077 0.0356  0.0149  17  SER A CB  
111  O OG  . SER A 17  ? 0.5907 0.4679 0.3912 -0.0062 0.0409  0.0069  17  SER A OG  
112  N N   . ASN A 18  ? 0.6342 0.4073 0.3194 -0.0172 0.0408  0.0366  18  ASN A N   
113  C CA  A ASN A 18  ? 0.6778 0.4158 0.3426 -0.0186 0.0343  0.0457  18  ASN A CA  
114  C CA  B ASN A 18  ? 0.6734 0.4109 0.3373 -0.0172 0.0329  0.0454  18  ASN A CA  
115  C C   . ASN A 18  ? 0.6258 0.3825 0.3316 -0.0125 0.0217  0.0396  18  ASN A C   
116  O O   . ASN A 18  ? 0.5513 0.3448 0.2986 -0.0168 0.0276  0.0326  18  ASN A O   
117  C CB  A ASN A 18  ? 0.7137 0.4344 0.3629 -0.0404 0.0558  0.0541  18  ASN A CB  
118  C CB  B ASN A 18  ? 0.7192 0.4276 0.3528 -0.0367 0.0522  0.0563  18  ASN A CB  
119  C CG  A ASN A 18  ? 0.7644 0.4773 0.3791 -0.0510 0.0744  0.0583  18  ASN A CG  
120  C CG  B ASN A 18  ? 0.6949 0.4281 0.3663 -0.0544 0.0673  0.0530  18  ASN A CG  
121  O OD1 A ASN A 18  ? 0.7722 0.5095 0.4026 -0.0680 0.0959  0.0550  18  ASN A OD1 
122  O OD1 B ASN A 18  ? 0.6652 0.4123 0.3698 -0.0511 0.0585  0.0484  18  ASN A OD1 
123  N ND2 A ASN A 18  ? 0.8172 0.4994 0.3849 -0.0402 0.0661  0.0638  18  ASN A ND2 
124  N ND2 B ASN A 18  ? 0.7305 0.4697 0.3947 -0.0740 0.0906  0.0545  18  ASN A ND2 
125  N N   . SER A 19  ? 0.6512 0.3821 0.3427 -0.0013 0.0045  0.0420  19  SER A N   
126  C CA  . SER A 19  ? 0.6328 0.3815 0.3601 0.0062  -0.0082 0.0349  19  SER A CA  
127  C C   . SER A 19  ? 0.5918 0.3611 0.3534 -0.0082 0.0045  0.0331  19  SER A C   
128  O O   . SER A 19  ? 0.5722 0.3771 0.3732 -0.0051 0.0011  0.0248  19  SER A O   
129  C CB  . SER A 19  ? 0.6680 0.3786 0.3676 0.0198  -0.0260 0.0380  19  SER A CB  
130  O OG  . SER A 19  ? 0.7550 0.4407 0.4142 0.0337  -0.0379 0.0408  19  SER A OG  
131  N N   . GLN A 20  ? 0.6050 0.3533 0.3507 -0.0251 0.0198  0.0402  20  GLN A N   
132  C CA  . GLN A 20  ? 0.5749 0.3427 0.3520 -0.0397 0.0308  0.0365  20  GLN A CA  
133  C C   . GLN A 20  ? 0.5276 0.3464 0.3443 -0.0426 0.0399  0.0283  20  GLN A C   
134  O O   . GLN A 20  ? 0.4940 0.3398 0.3448 -0.0441 0.0395  0.0217  20  GLN A O   
135  C CB  . GLN A 20  ? 0.6187 0.3562 0.3704 -0.0614 0.0479  0.0440  20  GLN A CB  
136  N N   . HIS A 21  ? 0.5377 0.3677 0.3475 -0.0416 0.0468  0.0281  21  HIS A N   
137  C CA  . HIS A 21  ? 0.5465 0.4194 0.3889 -0.0419 0.0550  0.0200  21  HIS A CA  
138  C C   . HIS A 21  ? 0.5086 0.3980 0.3649 -0.0269 0.0436  0.0150  21  HIS A C   
139  O O   . HIS A 21  ? 0.5050 0.4202 0.3797 -0.0247 0.0491  0.0094  21  HIS A O   
140  C CB  . HIS A 21  ? 0.6025 0.4802 0.4307 -0.0522 0.0735  0.0202  21  HIS A CB  
141  C CG  . HIS A 21  ? 0.6564 0.5225 0.4736 -0.0726 0.0891  0.0238  21  HIS A CG  
142  N ND1 . HIS A 21  ? 0.7349 0.5788 0.5162 -0.0843 0.1029  0.0300  21  HIS A ND1 
143  C CD2 . HIS A 21  ? 0.6707 0.5422 0.5071 -0.0852 0.0931  0.0215  21  HIS A CD2 
144  C CE1 . HIS A 21  ? 0.7478 0.5826 0.5257 -0.1059 0.1167  0.0321  21  HIS A CE1 
145  N NE2 . HIS A 21  ? 0.7242 0.5761 0.5370 -0.1063 0.1101  0.0261  21  HIS A NE2 
146  N N   . SER A 22  ? 0.4964 0.3713 0.3441 -0.0164 0.0275  0.0157  22  SER A N   
147  C CA  . SER A 22  ? 0.4640 0.3549 0.3256 -0.0060 0.0177  0.0096  22  SER A CA  
148  C C   . SER A 22  ? 0.4188 0.3375 0.3159 -0.0054 0.0165  0.0048  22  SER A C   
149  O O   . SER A 22  ? 0.3777 0.3029 0.2892 -0.0090 0.0174  0.0050  22  SER A O   
150  C CB  . SER A 22  ? 0.4838 0.3582 0.3294 0.0040  0.0008  0.0088  22  SER A CB  
151  O OG  . SER A 22  ? 0.4750 0.3472 0.3302 0.0072  -0.0081 0.0083  22  SER A OG  
152  N N   . VAL A 23  ? 0.3955 0.3274 0.3034 -0.0010 0.0142  0.0003  23  VAL A N   
153  C CA  . VAL A 23  ? 0.3500 0.3019 0.2831 0.0000  0.0131  -0.0026 23  VAL A CA  
154  C C   . VAL A 23  ? 0.3529 0.3092 0.2961 0.0016  0.0034  -0.0041 23  VAL A C   
155  O O   . VAL A 23  ? 0.3035 0.2746 0.2645 0.0005  0.0044  -0.0050 23  VAL A O   
156  C CB  . VAL A 23  ? 0.3555 0.3098 0.2901 0.0027  0.0115  -0.0063 23  VAL A CB  
157  C CG1 . VAL A 23  ? 0.3255 0.2927 0.2781 0.0023  0.0078  -0.0082 23  VAL A CG1 
158  C CG2 . VAL A 23  ? 0.3693 0.3250 0.3016 0.0043  0.0211  -0.0068 23  VAL A CG2 
159  N N   . GLN A 24  ? 0.3546 0.3004 0.2864 0.0060  -0.0070 -0.0061 24  GLN A N   
160  C CA  . GLN A 24  ? 0.3816 0.3344 0.3232 0.0105  -0.0173 -0.0105 24  GLN A CA  
161  C C   . GLN A 24  ? 0.3750 0.3183 0.3154 0.0101  -0.0171 -0.0076 24  GLN A C   
162  O O   . GLN A 24  ? 0.3707 0.3275 0.3278 0.0118  -0.0207 -0.0118 24  GLN A O   
163  C CB  . GLN A 24  ? 0.4320 0.3787 0.3616 0.0182  -0.0302 -0.0157 24  GLN A CB  
164  C CG  . GLN A 24  ? 0.5013 0.4596 0.4421 0.0265  -0.0429 -0.0236 24  GLN A CG  
165  C CD  . GLN A 24  ? 0.4897 0.4818 0.4600 0.0230  -0.0424 -0.0319 24  GLN A CD  
166  O OE1 . GLN A 24  ? 0.4652 0.4694 0.4496 0.0248  -0.0434 -0.0346 24  GLN A OE1 
167  N NE2 . GLN A 24  ? 0.4844 0.4894 0.4616 0.0169  -0.0403 -0.0363 24  GLN A NE2 
168  N N   . THR A 25  ? 0.3905 0.3092 0.3092 0.0066  -0.0122 -0.0012 25  THR A N   
169  C CA  . THR A 25  ? 0.3768 0.2816 0.2926 0.0026  -0.0106 0.0009  25  THR A CA  
170  C C   . THR A 25  ? 0.3419 0.2711 0.2839 -0.0052 -0.0013 -0.0014 25  THR A C   
171  O O   . THR A 25  ? 0.3214 0.2574 0.2770 -0.0043 -0.0054 -0.0057 25  THR A O   
172  C CB  . THR A 25  ? 0.4159 0.2847 0.2987 -0.0031 -0.0052 0.0090  25  THR A CB  
173  O OG1 . THR A 25  ? 0.4448 0.2875 0.2995 0.0084  -0.0182 0.0107  25  THR A OG1 
174  C CG2 . THR A 25  ? 0.4364 0.2871 0.3163 -0.0117 -0.0015 0.0107  25  THR A CG2 
175  N N   . LEU A 26  ? 0.3316 0.2757 0.2806 -0.0106 0.0095  -0.0003 26  LEU A N   
176  C CA  . LEU A 26  ? 0.3082 0.2793 0.2816 -0.0138 0.0154  -0.0041 26  LEU A CA  
177  C C   . LEU A 26  ? 0.2956 0.2858 0.2869 -0.0069 0.0075  -0.0085 26  LEU A C   
178  O O   . LEU A 26  ? 0.2681 0.2724 0.2743 -0.0080 0.0072  -0.0125 26  LEU A O   
179  C CB  . LEU A 26  ? 0.2904 0.2760 0.2676 -0.0150 0.0254  -0.0041 26  LEU A CB  
180  C CG  . LEU A 26  ? 0.2705 0.2851 0.2708 -0.0152 0.0302  -0.0091 26  LEU A CG  
181  C CD1 . LEU A 26  ? 0.2783 0.2969 0.2878 -0.0246 0.0325  -0.0129 26  LEU A CD1 
182  C CD2 . LEU A 26  ? 0.2782 0.3051 0.2797 -0.0140 0.0394  -0.0110 26  LEU A CD2 
183  N N   . SER A 27  ? 0.2912 0.2836 0.2808 -0.0013 0.0022  -0.0087 27  SER A N   
184  C CA  A SER A 27  ? 0.2728 0.2844 0.2770 0.0021  -0.0022 -0.0127 27  SER A CA  
185  C CA  B SER A 27  ? 0.2808 0.2922 0.2849 0.0021  -0.0023 -0.0127 27  SER A CA  
186  C C   . SER A 27  ? 0.2739 0.2894 0.2851 0.0051  -0.0098 -0.0181 27  SER A C   
187  O O   . SER A 27  ? 0.2631 0.2980 0.2881 0.0061  -0.0101 -0.0220 27  SER A O   
188  C CB  A SER A 27  ? 0.2779 0.2898 0.2784 0.0034  -0.0055 -0.0138 27  SER A CB  
189  C CB  B SER A 27  ? 0.2949 0.3065 0.2951 0.0035  -0.0056 -0.0138 27  SER A CB  
190  O OG  A SER A 27  ? 0.2615 0.2685 0.2577 0.0076  -0.0152 -0.0183 27  SER A OG  
191  O OG  B SER A 27  ? 0.2777 0.3075 0.2904 0.0041  -0.0095 -0.0191 27  SER A OG  
192  N N   . LEU A 28  ? 0.2991 0.2942 0.2978 0.0083  -0.0165 -0.0188 28  LEU A N   
193  C CA  . LEU A 28  ? 0.3222 0.3143 0.3240 0.0139  -0.0251 -0.0251 28  LEU A CA  
194  C C   . LEU A 28  ? 0.3150 0.3094 0.3252 0.0085  -0.0206 -0.0267 28  LEU A C   
195  O O   . LEU A 28  ? 0.2879 0.2955 0.3101 0.0125  -0.0253 -0.0343 28  LEU A O   
196  C CB  . LEU A 28  ? 0.3716 0.3308 0.3505 0.0201  -0.0338 -0.0238 28  LEU A CB  
197  C CG  . LEU A 28  ? 0.4169 0.3741 0.3869 0.0305  -0.0446 -0.0270 28  LEU A CG  
198  C CD1 . LEU A 28  ? 0.4747 0.3959 0.4193 0.0410  -0.0562 -0.0266 28  LEU A CD1 
199  C CD2 . LEU A 28  ? 0.4002 0.3929 0.3935 0.0365  -0.0506 -0.0384 28  LEU A CD2 
200  N N   . TRP A 29  ? 0.3139 0.2972 0.3180 -0.0010 -0.0116 -0.0214 29  TRP A N   
201  C CA  . TRP A 29  ? 0.2854 0.2725 0.2989 -0.0087 -0.0072 -0.0253 29  TRP A CA  
202  C C   . TRP A 29  ? 0.2443 0.2674 0.2794 -0.0070 -0.0051 -0.0299 29  TRP A C   
203  O O   . TRP A 29  ? 0.2365 0.2718 0.2832 -0.0065 -0.0080 -0.0373 29  TRP A O   
204  C CB  . TRP A 29  ? 0.3179 0.2886 0.3202 -0.0213 0.0033  -0.0201 29  TRP A CB  
205  C CG  . TRP A 29  ? 0.3040 0.2800 0.3170 -0.0336 0.0098  -0.0256 29  TRP A CG  
206  C CD1 . TRP A 29  ? 0.3345 0.2852 0.3401 -0.0412 0.0080  -0.0290 29  TRP A CD1 
207  C CD2 . TRP A 29  ? 0.2825 0.2922 0.3162 -0.0406 0.0190  -0.0305 29  TRP A CD2 
208  N NE1 . TRP A 29  ? 0.3198 0.2877 0.3417 -0.0552 0.0164  -0.0361 29  TRP A NE1 
209  C CE2 . TRP A 29  ? 0.2943 0.3014 0.3351 -0.0544 0.0227  -0.0381 29  TRP A CE2 
210  C CE3 . TRP A 29  ? 0.2638 0.3032 0.3096 -0.0355 0.0231  -0.0306 29  TRP A CE3 
211  C CZ2 . TRP A 29  ? 0.2915 0.3325 0.3549 -0.0633 0.0302  -0.0471 29  TRP A CZ2 
212  C CZ3 . TRP A 29  ? 0.2638 0.3347 0.3299 -0.0407 0.0292  -0.0389 29  TRP A CZ3 
213  C CH2 . TRP A 29  ? 0.2667 0.3419 0.3433 -0.0546 0.0326  -0.0478 29  TRP A CH2 
214  N N   . LEU A 30  ? 0.2236 0.2614 0.2611 -0.0042 -0.0015 -0.0258 30  LEU A N   
215  C CA  . LEU A 30  ? 0.2079 0.2725 0.2581 -0.0005 -0.0006 -0.0282 30  LEU A CA  
216  C C   . LEU A 30  ? 0.1926 0.2701 0.2480 0.0054  -0.0068 -0.0326 30  LEU A C   
217  O O   . LEU A 30  ? 0.1726 0.2699 0.2368 0.0078  -0.0077 -0.0374 30  LEU A O   
218  C CB  . LEU A 30  ? 0.2147 0.2830 0.2607 0.0016  0.0046  -0.0221 30  LEU A CB  
219  C CG  . LEU A 30  ? 0.2354 0.3010 0.2795 -0.0021 0.0120  -0.0204 30  LEU A CG  
220  C CD1 . LEU A 30  ? 0.2478 0.3125 0.2850 0.0036  0.0149  -0.0158 30  LEU A CD1 
221  C CD2 . LEU A 30  ? 0.2349 0.3215 0.2940 -0.0047 0.0149  -0.0273 30  LEU A CD2 
222  N N   . ILE A 31  ? 0.1926 0.2632 0.2425 0.0082  -0.0110 -0.0324 31  ILE A N   
223  C CA  . ILE A 31  ? 0.1823 0.2705 0.2390 0.0126  -0.0153 -0.0389 31  ILE A CA  
224  C C   . ILE A 31  ? 0.1856 0.2753 0.2487 0.0162  -0.0213 -0.0484 31  ILE A C   
225  O O   . ILE A 31  ? 0.1707 0.2809 0.2419 0.0195  -0.0228 -0.0556 31  ILE A O   
226  C CB  . ILE A 31  ? 0.1968 0.2820 0.2503 0.0146  -0.0192 -0.0403 31  ILE A CB  
227  C CG1 . ILE A 31  ? 0.1910 0.2769 0.2395 0.0093  -0.0131 -0.0337 31  ILE A CG1 
228  C CG2 . ILE A 31  ? 0.2088 0.3157 0.2726 0.0201  -0.0247 -0.0516 31  ILE A CG2 
229  C CD1 . ILE A 31  ? 0.2060 0.2856 0.2507 0.0097  -0.0176 -0.0360 31  ILE A CD1 
230  N N   . HIS A 32  ? 0.2042 0.2689 0.2606 0.0150  -0.0243 -0.0485 32  HIS A N   
231  C CA  . HIS A 32  ? 0.2242 0.2825 0.2838 0.0167  -0.0297 -0.0575 32  HIS A CA  
232  C C   . HIS A 32  ? 0.2191 0.2977 0.2903 0.0122  -0.0257 -0.0616 32  HIS A C   
233  O O   . HIS A 32  ? 0.2213 0.3123 0.3000 0.0163  -0.0302 -0.0719 32  HIS A O   
234  C CB  . HIS A 32  ? 0.2624 0.2824 0.3068 0.0128  -0.0314 -0.0543 32  HIS A CB  
235  C CG  . HIS A 32  ? 0.2849 0.2890 0.3289 0.0120  -0.0362 -0.0632 32  HIS A CG  
236  N ND1 . HIS A 32  ? 0.3182 0.3191 0.3623 0.0241  -0.0469 -0.0733 32  HIS A ND1 
237  C CD2 . HIS A 32  ? 0.3112 0.3029 0.3558 -0.0006 -0.0314 -0.0653 32  HIS A CD2 
238  C CE1 . HIS A 32  ? 0.3377 0.3186 0.3795 0.0205  -0.0498 -0.0811 32  HIS A CE1 
239  N NE2 . HIS A 32  ? 0.3368 0.3118 0.3791 0.0036  -0.0399 -0.0761 32  HIS A NE2 
240  N N   . HIS A 33  ? 0.2102 0.2956 0.2832 0.0058  -0.0181 -0.0553 33  HIS A N   
241  C CA  . HIS A 33  ? 0.2092 0.3168 0.2938 0.0035  -0.0160 -0.0607 33  HIS A CA  
242  C C   . HIS A 33  ? 0.1966 0.3296 0.2826 0.0105  -0.0150 -0.0583 33  HIS A C   
243  O O   . HIS A 33  ? 0.1691 0.3191 0.2603 0.0113  -0.0132 -0.0595 33  HIS A O   
244  C CB  . HIS A 33  ? 0.2172 0.3199 0.3040 -0.0065 -0.0089 -0.0582 33  HIS A CB  
245  C CG  . HIS A 33  ? 0.2379 0.3158 0.3216 -0.0173 -0.0081 -0.0621 33  HIS A CG  
246  N ND1 . HIS A 33  ? 0.2648 0.3415 0.3548 -0.0200 -0.0130 -0.0734 33  HIS A ND1 
247  C CD2 . HIS A 33  ? 0.2640 0.3125 0.3347 -0.0272 -0.0025 -0.0558 33  HIS A CD2 
248  C CE1 . HIS A 33  ? 0.2811 0.3254 0.3621 -0.0324 -0.0102 -0.0737 33  HIS A CE1 
249  N NE2 . HIS A 33  ? 0.2855 0.3121 0.3531 -0.0367 -0.0036 -0.0621 33  HIS A NE2 
250  N N   . ARG A 34  ? 0.1953 0.3318 0.2760 0.0157  -0.0165 -0.0565 34  ARG A N   
251  C CA  . ARG A 34  ? 0.1923 0.3456 0.2675 0.0198  -0.0136 -0.0520 34  ARG A CA  
252  C C   . ARG A 34  ? 0.2104 0.3864 0.2880 0.0249  -0.0159 -0.0584 34  ARG A C   
253  O O   . ARG A 34  ? 0.2235 0.4070 0.2913 0.0289  -0.0136 -0.0524 34  ARG A O   
254  C CB  . ARG A 34  ? 0.1938 0.3501 0.2655 0.0202  -0.0132 -0.0523 34  ARG A CB  
255  C CG  . ARG A 34  ? 0.2050 0.3731 0.2848 0.0245  -0.0189 -0.0655 34  ARG A CG  
256  C CD  . ARG A 34  ? 0.2104 0.3879 0.2910 0.0248  -0.0179 -0.0681 34  ARG A CD  
257  N NE  . ARG A 34  ? 0.2188 0.4078 0.3085 0.0322  -0.0248 -0.0829 34  ARG A NE  
258  C CZ  . ARG A 34  ? 0.2398 0.4109 0.3321 0.0379  -0.0335 -0.0887 34  ARG A CZ  
259  N NH1 . ARG A 34  ? 0.2632 0.4447 0.3624 0.0479  -0.0409 -0.1037 34  ARG A NH1 
260  N NH2 . ARG A 34  ? 0.2421 0.3832 0.3272 0.0348  -0.0348 -0.0800 34  ARG A NH2 
261  N N   . LYS A 35  ? 0.2014 0.3850 0.2890 0.0254  -0.0213 -0.0709 35  LYS A N   
262  C CA  . LYS A 35  ? 0.2222 0.4288 0.3133 0.0301  -0.0249 -0.0794 35  LYS A CA  
263  C C   . LYS A 35  ? 0.2114 0.4266 0.3058 0.0311  -0.0246 -0.0775 35  LYS A C   
264  O O   . LYS A 35  ? 0.2233 0.4605 0.3168 0.0387  -0.0288 -0.0829 35  LYS A O   
265  C CB  . LYS A 35  ? 0.2454 0.4551 0.3473 0.0290  -0.0311 -0.0951 35  LYS A CB  
266  C CG  . LYS A 35  ? 0.2822 0.4959 0.3813 0.0342  -0.0336 -0.1018 35  LYS A CG  
267  C CD  . LYS A 35  ? 0.3308 0.5400 0.4390 0.0345  -0.0409 -0.1184 35  LYS A CD  
268  C CE  . LYS A 35  ? 0.4038 0.6196 0.5104 0.0429  -0.0440 -0.1273 35  LYS A CE  
269  N NZ  . LYS A 35  ? 0.4632 0.6656 0.5756 0.0452  -0.0525 -0.1437 35  LYS A NZ  
270  N N   . HIS A 36  ? 0.1898 0.3902 0.2876 0.0250  -0.0202 -0.0714 36  HIS A N   
271  C CA  . HIS A 36  ? 0.1802 0.3911 0.2829 0.0271  -0.0186 -0.0704 36  HIS A CA  
272  C C   . HIS A 36  ? 0.1915 0.3918 0.2790 0.0337  -0.0150 -0.0569 36  HIS A C   
273  O O   . HIS A 36  ? 0.1641 0.3657 0.2554 0.0349  -0.0123 -0.0554 36  HIS A O   
274  C CB  . HIS A 36  ? 0.1648 0.3688 0.2809 0.0144  -0.0140 -0.0746 36  HIS A CB  
275  C CG  . HIS A 36  ? 0.1716 0.3762 0.2999 0.0043  -0.0164 -0.0877 36  HIS A CG  
276  N ND1 . HIS A 36  ? 0.1690 0.3962 0.3147 -0.0014 -0.0175 -0.1012 36  HIS A ND1 
277  C CD2 . HIS A 36  ? 0.1758 0.3585 0.2999 -0.0003 -0.0189 -0.0902 36  HIS A CD2 
278  C CE1 . HIS A 36  ? 0.1856 0.4017 0.3365 -0.0116 -0.0196 -0.1113 36  HIS A CE1 
279  N NE2 . HIS A 36  ? 0.1871 0.3740 0.3232 -0.0092 -0.0210 -0.1039 36  HIS A NE2 
280  N N   . ALA A 37  ? 0.2117 0.4018 0.2821 0.0372  -0.0141 -0.0482 37  ALA A N   
281  C CA  . ALA A 37  ? 0.2237 0.3945 0.2777 0.0394  -0.0096 -0.0353 37  ALA A CA  
282  C C   . ALA A 37  ? 0.2389 0.4126 0.2831 0.0522  -0.0118 -0.0318 37  ALA A C   
283  O O   . ALA A 37  ? 0.2570 0.4156 0.2955 0.0541  -0.0088 -0.0257 37  ALA A O   
284  C CB  . ALA A 37  ? 0.2374 0.3982 0.2761 0.0365  -0.0066 -0.0285 37  ALA A CB  
285  N N   . GLY A 38  ? 0.2384 0.4298 0.2777 0.0629  -0.0180 -0.0359 38  GLY A N   
286  C CA  . GLY A 38  ? 0.2570 0.4524 0.2855 0.0799  -0.0234 -0.0344 38  GLY A CA  
287  C C   . GLY A 38  ? 0.2489 0.4599 0.2999 0.0818  -0.0238 -0.0434 38  GLY A C   
288  O O   . GLY A 38  ? 0.2443 0.4422 0.2881 0.0887  -0.0221 -0.0383 38  GLY A O   
289  N N   . PRO A 39  ? 0.2253 0.4626 0.3031 0.0734  -0.0246 -0.0574 39  PRO A N   
290  C CA  . PRO A 39  ? 0.2296 0.4854 0.3304 0.0702  -0.0216 -0.0673 39  PRO A CA  
291  C C   . PRO A 39  ? 0.2226 0.4540 0.3215 0.0597  -0.0115 -0.0594 39  PRO A C   
292  O O   . PRO A 39  ? 0.2245 0.4634 0.3290 0.0648  -0.0087 -0.0622 39  PRO A O   
293  C CB  . PRO A 39  ? 0.2235 0.5037 0.3494 0.0568  -0.0222 -0.0826 39  PRO A CB  
294  C CG  . PRO A 39  ? 0.2362 0.5235 0.3530 0.0641  -0.0307 -0.0848 39  PRO A CG  
295  C CD  . PRO A 39  ? 0.2248 0.4808 0.3120 0.0691  -0.0292 -0.0675 39  PRO A CD  
296  N N   . ILE A 40  ? 0.2155 0.4203 0.3059 0.0474  -0.0069 -0.0509 40  ILE A N   
297  C CA  . ILE A 40  ? 0.2236 0.4030 0.3068 0.0399  0.0005  -0.0427 40  ILE A CA  
298  C C   . ILE A 40  ? 0.2400 0.4035 0.3053 0.0525  0.0007  -0.0342 40  ILE A C   
299  O O   . ILE A 40  ? 0.2451 0.4049 0.3114 0.0533  0.0054  -0.0347 40  ILE A O   
300  C CB  . ILE A 40  ? 0.2318 0.3878 0.3074 0.0287  0.0021  -0.0365 40  ILE A CB  
301  C CG1 . ILE A 40  ? 0.2239 0.3844 0.3135 0.0163  0.0026  -0.0447 40  ILE A CG1 
302  C CG2 . ILE A 40  ? 0.2477 0.3772 0.3105 0.0251  0.0071  -0.0275 40  ILE A CG2 
303  C CD1 . ILE A 40  ? 0.2352 0.3769 0.3184 0.0108  0.0004  -0.0422 40  ILE A CD1 
304  N N   . VAL A 41  ? 0.2478 0.4001 0.2943 0.0621  -0.0039 -0.0269 41  VAL A N   
305  C CA  . VAL A 41  ? 0.2616 0.3893 0.2854 0.0734  -0.0042 -0.0180 41  VAL A CA  
306  C C   . VAL A 41  ? 0.2763 0.4199 0.3035 0.0920  -0.0090 -0.0250 41  VAL A C   
307  O O   . VAL A 41  ? 0.2986 0.4265 0.3167 0.1000  -0.0074 -0.0231 41  VAL A O   
308  C CB  . VAL A 41  ? 0.2803 0.3883 0.2787 0.0761  -0.0064 -0.0078 41  VAL A CB  
309  C CG1 . VAL A 41  ? 0.3259 0.4032 0.2955 0.0891  -0.0080 0.0013  41  VAL A CG1 
310  C CG2 . VAL A 41  ? 0.2794 0.3741 0.2763 0.0582  -0.0006 -0.0029 41  VAL A CG2 
311  N N   . SER A 42  ? 0.2630 0.4401 0.3041 0.1005  -0.0157 -0.0354 42  SER A N   
312  C CA  . SER A 42  ? 0.2844 0.4876 0.3354 0.1193  -0.0215 -0.0467 42  SER A CA  
313  C C   . SER A 42  ? 0.2554 0.4763 0.3297 0.1120  -0.0132 -0.0565 42  SER A C   
314  O O   . SER A 42  ? 0.2791 0.5006 0.3504 0.1267  -0.0139 -0.0599 42  SER A O   
315  C CB  . SER A 42  ? 0.2884 0.5300 0.3534 0.1274  -0.0310 -0.0588 42  SER A CB  
316  O OG  . SER A 42  ? 0.3325 0.6021 0.4072 0.1482  -0.0383 -0.0711 42  SER A OG  
317  N N   . VAL A 43  ? 0.2198 0.4519 0.3137 0.0895  -0.0048 -0.0608 43  VAL A N   
318  C CA  . VAL A 43  ? 0.2097 0.4532 0.3195 0.0783  0.0057  -0.0677 43  VAL A CA  
319  C C   . VAL A 43  ? 0.2204 0.4282 0.3101 0.0777  0.0117  -0.0569 43  VAL A C   
320  O O   . VAL A 43  ? 0.2173 0.4340 0.3110 0.0834  0.0164  -0.0629 43  VAL A O   
321  C CB  . VAL A 43  ? 0.2040 0.4524 0.3286 0.0528  0.0136  -0.0706 43  VAL A CB  
322  C CG1 . VAL A 43  ? 0.1987 0.4467 0.3289 0.0382  0.0270  -0.0730 43  VAL A CG1 
323  C CG2 . VAL A 43  ? 0.2004 0.4888 0.3499 0.0499  0.0092  -0.0859 43  VAL A CG2 
324  N N   . TRP A 44  ? 0.2290 0.3999 0.2987 0.0704  0.0116  -0.0430 44  TRP A N   
325  C CA  . TRP A 44  ? 0.2518 0.3882 0.3018 0.0692  0.0157  -0.0340 44  TRP A CA  
326  C C   . TRP A 44  ? 0.2797 0.4083 0.3172 0.0903  0.0118  -0.0351 44  TRP A C   
327  O O   . TRP A 44  ? 0.3157 0.4384 0.3501 0.0930  0.0168  -0.0380 44  TRP A O   
328  C CB  . TRP A 44  ? 0.2525 0.3579 0.2854 0.0605  0.0137  -0.0218 44  TRP A CB  
329  C CG  . TRP A 44  ? 0.2652 0.3355 0.2776 0.0587  0.0160  -0.0138 44  TRP A CG  
330  C CD1 . TRP A 44  ? 0.2613 0.3172 0.2705 0.0460  0.0209  -0.0118 44  TRP A CD1 
331  C CD2 . TRP A 44  ? 0.2986 0.3401 0.2878 0.0692  0.0128  -0.0072 44  TRP A CD2 
332  N NE1 . TRP A 44  ? 0.2842 0.3110 0.2746 0.0474  0.0206  -0.0068 44  TRP A NE1 
333  C CE2 . TRP A 44  ? 0.3081 0.3227 0.2856 0.0597  0.0167  -0.0036 44  TRP A CE2 
334  C CE3 . TRP A 44  ? 0.3176 0.3498 0.2917 0.0853  0.0067  -0.0042 44  TRP A CE3 
335  C CZ2 . TRP A 44  ? 0.3524 0.3328 0.3071 0.0635  0.0157  0.0015  44  TRP A CZ2 
336  C CZ3 . TRP A 44  ? 0.3559 0.3471 0.3020 0.0899  0.0060  0.0035  44  TRP A CZ3 
337  C CH2 . TRP A 44  ? 0.3632 0.3294 0.3013 0.0777  0.0109  0.0058  44  TRP A CH2 
338  N N   . HIS A 45  ? 0.3085 0.4367 0.3368 0.1070  0.0024  -0.0337 45  HIS A N   
339  C CA  . HIS A 45  ? 0.3362 0.4447 0.3439 0.1302  -0.0039 -0.0324 45  HIS A CA  
340  C C   . HIS A 45  ? 0.3547 0.4951 0.3791 0.1471  -0.0048 -0.0481 45  HIS A C   
341  O O   . HIS A 45  ? 0.3563 0.4790 0.3682 0.1605  -0.0050 -0.0499 45  HIS A O   
342  C CB  . HIS A 45  ? 0.3639 0.4633 0.3537 0.1435  -0.0143 -0.0262 45  HIS A CB  
343  C CG  . HIS A 45  ? 0.4185 0.4815 0.3757 0.1669  -0.0219 -0.0204 45  HIS A CG  
344  N ND1 . HIS A 45  ? 0.4475 0.5044 0.3852 0.1867  -0.0330 -0.0174 45  HIS A ND1 
345  C CD2 . HIS A 45  ? 0.4612 0.4861 0.3979 0.1736  -0.0203 -0.0171 45  HIS A CD2 
346  C CE1 . HIS A 45  ? 0.5044 0.5183 0.4088 0.2068  -0.0387 -0.0117 45  HIS A CE1 
347  N NE2 . HIS A 45  ? 0.5045 0.4989 0.4097 0.1980  -0.0307 -0.0121 45  HIS A NE2 
348  N N   . ARG A 46  ? 0.3520 0.5422 0.4063 0.1461  -0.0052 -0.0616 46  ARG A N   
349  C CA  . ARG A 46  ? 0.3740 0.6087 0.4525 0.1588  -0.0044 -0.0807 46  ARG A CA  
350  C C   . ARG A 46  ? 0.3424 0.5798 0.4296 0.1427  0.0105  -0.0845 46  ARG A C   
351  O O   . ARG A 46  ? 0.3506 0.5963 0.4386 0.1575  0.0123  -0.0940 46  ARG A O   
352  C CB  . ARG A 46  ? 0.4044 0.6928 0.5149 0.1541  -0.0068 -0.0950 46  ARG A CB  
353  C CG  . ARG A 46  ? 0.4911 0.8298 0.6229 0.1790  -0.0150 -0.1162 46  ARG A CG  
354  C CD  . ARG A 46  ? 0.5258 0.9203 0.6930 0.1679  -0.0159 -0.1324 46  ARG A CD  
355  N NE  . ARG A 46  ? 0.5485 0.9494 0.7334 0.1316  0.0012  -0.1326 46  ARG A NE  
356  C CZ  . ARG A 46  ? 0.5432 0.9330 0.7295 0.1085  0.0040  -0.1257 46  ARG A CZ  
357  N NH1 . ARG A 46  ? 0.5489 0.9284 0.7241 0.1161  -0.0082 -0.1198 46  ARG A NH1 
358  N NH2 . ARG A 46  ? 0.5167 0.9044 0.7132 0.0781  0.0195  -0.1252 46  ARG A NH2 
359  N N   . GLU A 47  ? 0.3051 0.5323 0.3948 0.1145  0.0205  -0.0770 47  GLU A N   
360  C CA  . GLU A 47  ? 0.3033 0.5295 0.3952 0.0983  0.0347  -0.0788 47  GLU A CA  
361  C C   . GLU A 47  ? 0.3269 0.5114 0.3913 0.1061  0.0352  -0.0708 47  GLU A C   
362  O O   . GLU A 47  ? 0.3181 0.5086 0.3825 0.1056  0.0440  -0.0775 47  GLU A O   
363  C CB  . GLU A 47  ? 0.2905 0.5100 0.3861 0.0694  0.0430  -0.0721 47  GLU A CB  
364  C CG  . GLU A 47  ? 0.2890 0.5487 0.4127 0.0575  0.0449  -0.0829 47  GLU A CG  
365  C CD  . GLU A 47  ? 0.2943 0.6052 0.4447 0.0582  0.0532  -0.1026 47  GLU A CD  
366  O OE1 . GLU A 47  ? 0.3140 0.6264 0.4616 0.0512  0.0658  -0.1054 47  GLU A OE1 
367  O OE2 . GLU A 47  ? 0.3114 0.6639 0.4856 0.0669  0.0471  -0.1167 47  GLU A OE2 
368  N N   . LEU A 48  ? 0.3517 0.4949 0.3922 0.1120  0.0264  -0.0576 48  LEU A N   
369  C CA  . LEU A 48  ? 0.3736 0.4753 0.3877 0.1202  0.0251  -0.0519 48  LEU A CA  
370  C C   . LEU A 48  ? 0.4169 0.5281 0.4299 0.1456  0.0226  -0.0646 48  LEU A C   
371  O O   . LEU A 48  ? 0.4163 0.5133 0.4190 0.1481  0.0277  -0.0683 48  LEU A O   
372  C CB  . LEU A 48  ? 0.3743 0.4346 0.3643 0.1234  0.0160  -0.0379 48  LEU A CB  
373  C CG  . LEU A 48  ? 0.4028 0.4150 0.3631 0.1319  0.0134  -0.0328 48  LEU A CG  
374  C CD1 . LEU A 48  ? 0.3983 0.3931 0.3524 0.1156  0.0211  -0.0316 48  LEU A CD1 
375  C CD2 . LEU A 48  ? 0.4345 0.4082 0.3706 0.1320  0.0068  -0.0194 48  LEU A CD2 
376  N N   . ARG A 49  ? 0.4369 0.5707 0.4583 0.1671  0.0132  -0.0721 49  ARG A N   
377  C CA  . ARG A 49  ? 0.4839 0.6269 0.5036 0.1964  0.0078  -0.0856 49  ARG A CA  
378  C C   . ARG A 49  ? 0.4458 0.6419 0.4949 0.1932  0.0195  -0.1047 49  ARG A C   
379  O O   . ARG A 49  ? 0.4537 0.6532 0.4996 0.2108  0.0203  -0.1162 49  ARG A O   
380  C CB  . ARG A 49  ? 0.5565 0.7113 0.5756 0.2233  -0.0077 -0.0895 49  ARG A CB  
381  C CG  . ARG A 49  ? 0.6359 0.7310 0.6162 0.2318  -0.0187 -0.0712 49  ARG A CG  
382  C CD  . ARG A 49  ? 0.7151 0.8067 0.6806 0.2701  -0.0357 -0.0771 49  ARG A CD  
383  N NE  . ARG A 49  ? 0.8022 0.8237 0.7207 0.2778  -0.0440 -0.0581 49  ARG A NE  
384  C CZ  . ARG A 49  ? 0.8684 0.8361 0.7524 0.2962  -0.0494 -0.0549 49  ARG A CZ  
385  N NH1 . ARG A 49  ? 0.9390 0.8408 0.7787 0.2976  -0.0547 -0.0365 49  ARG A NH1 
386  N NH2 . ARG A 49  ? 0.8901 0.8671 0.7817 0.3124  -0.0487 -0.0703 49  ARG A NH2 
387  N N   . LYS A 50  ? 0.4089 0.6436 0.4843 0.1693  0.0296  -0.1082 50  LYS A N   
388  C CA  . LYS A 50  ? 0.3916 0.6755 0.4928 0.1597  0.0444  -0.1252 50  LYS A CA  
389  C C   . LYS A 50  ? 0.3668 0.6239 0.4506 0.1412  0.0581  -0.1185 50  LYS A C   
390  O O   . LYS A 50  ? 0.3456 0.6328 0.4401 0.1377  0.0707  -0.1316 50  LYS A O   
391  C CB  . LYS A 50  ? 0.3993 0.7292 0.5320 0.1370  0.0515  -0.1313 50  LYS A CB  
392  C CG  . LYS A 50  ? 0.4210 0.8074 0.5844 0.1545  0.0425  -0.1503 50  LYS A CG  
393  C CD  . LYS A 50  ? 0.4284 0.8356 0.6111 0.1347  0.0415  -0.1494 50  LYS A CD  
394  C CE  . LYS A 50  ? 0.4300 0.8625 0.6329 0.0979  0.0613  -0.1545 50  LYS A CE  
395  N N   . ALA A 51  ? 0.3436 0.5479 0.4011 0.1289  0.0559  -0.0994 51  ALA A N   
396  C CA  . ALA A 51  ? 0.3372 0.5190 0.3784 0.1092  0.0674  -0.0929 51  ALA A CA  
397  C C   . ALA A 51  ? 0.3521 0.5211 0.3771 0.1241  0.0699  -0.1007 51  ALA A C   
398  O O   . ALA A 51  ? 0.3640 0.5139 0.3780 0.1482  0.0593  -0.1038 51  ALA A O   
399  C CB  . ALA A 51  ? 0.3332 0.4686 0.3542 0.0944  0.0621  -0.0736 51  ALA A CB  
400  N N   . LYS A 52  ? 0.3607 0.5363 0.3803 0.1095  0.0840  -0.1038 52  LYS A N   
401  C CA  . LYS A 52  ? 0.3905 0.5524 0.3917 0.1217  0.0872  -0.1118 52  LYS A CA  
402  C C   . LYS A 52  ? 0.4108 0.5131 0.3829 0.1271  0.0749  -0.0999 52  LYS A C   
403  O O   . LYS A 52  ? 0.3829 0.4583 0.3473 0.1125  0.0696  -0.0845 52  LYS A O   
404  C CB  . LYS A 52  ? 0.3999 0.5735 0.3933 0.1014  0.1051  -0.1140 52  LYS A CB  
405  C CG  . LYS A 52  ? 0.4131 0.6458 0.4297 0.1023  0.1205  -0.1335 52  LYS A CG  
406  N N   . SER A 53  ? 0.4402 0.5244 0.3975 0.1478  0.0706  -0.1092 53  SER A N   
407  C CA  . SER A 53  ? 0.4740 0.5011 0.4041 0.1531  0.0594  -0.1012 53  SER A CA  
408  C C   . SER A 53  ? 0.4661 0.4647 0.3785 0.1291  0.0619  -0.0898 53  SER A C   
409  O O   . SER A 53  ? 0.4580 0.4180 0.3573 0.1233  0.0528  -0.0791 53  SER A O   
410  C CB  . SER A 53  ? 0.5122 0.5243 0.4281 0.1786  0.0560  -0.1161 53  SER A CB  
411  O OG  . SER A 53  ? 0.5382 0.5666 0.4489 0.1747  0.0680  -0.1275 53  SER A OG  
412  N N   . ASN A 54  ? 0.4587 0.4776 0.3703 0.1148  0.0741  -0.0921 54  ASN A N   
413  C CA  . ASN A 54  ? 0.4746 0.4692 0.3682 0.0948  0.0744  -0.0815 54  ASN A CA  
414  C C   . ASN A 54  ? 0.4481 0.4402 0.3501 0.0773  0.0707  -0.0664 54  ASN A C   
415  O O   . ASN A 54  ? 0.4525 0.4238 0.3402 0.0648  0.0676  -0.0588 54  ASN A O   
416  C CB  . ASN A 54  ? 0.4926 0.4995 0.3717 0.0870  0.0874  -0.0875 54  ASN A CB  
417  C CG  . ASN A 54  ? 0.4856 0.5332 0.3797 0.0748  0.1025  -0.0880 54  ASN A CG  
418  O OD1 . ASN A 54  ? 0.4769 0.5475 0.3955 0.0722  0.1028  -0.0859 54  ASN A OD1 
419  N ND2 . ASN A 54  ? 0.4950 0.5500 0.3720 0.0658  0.1155  -0.0912 54  ASN A ND2 
420  N N   . ARG A 55  ? 0.4256 0.4405 0.3504 0.0780  0.0702  -0.0639 55  ARG A N   
421  C CA  . ARG A 55  ? 0.4153 0.4283 0.3486 0.0631  0.0662  -0.0514 55  ARG A CA  
422  C C   . ARG A 55  ? 0.3752 0.3737 0.3133 0.0704  0.0547  -0.0460 55  ARG A C   
423  O O   . ARG A 55  ? 0.3598 0.3532 0.3023 0.0600  0.0501  -0.0369 55  ARG A O   
424  C CB  . ARG A 55  ? 0.4360 0.4862 0.3914 0.0549  0.0744  -0.0528 55  ARG A CB  
425  C CG  . ARG A 55  ? 0.5159 0.5898 0.4708 0.0468  0.0899  -0.0600 55  ARG A CG  
426  C CD  . ARG A 55  ? 0.5831 0.6361 0.5168 0.0283  0.0944  -0.0504 55  ARG A CD  
427  N NE  . ARG A 55  ? 0.6612 0.7378 0.5973 0.0138  0.1109  -0.0536 55  ARG A NE  
428  C CZ  . ARG A 55  ? 0.7237 0.7852 0.6338 0.0002  0.1202  -0.0484 55  ARG A CZ  
429  N NH1 . ARG A 55  ? 0.7838 0.8663 0.6956 -0.0157 0.1375  -0.0513 55  ARG A NH1 
430  N NH2 . ARG A 55  ? 0.7422 0.7681 0.6235 0.0017  0.1125  -0.0411 55  ARG A NH2 
431  N N   . LYS A 56  ? 0.3710 0.3623 0.3064 0.0892  0.0501  -0.0519 56  LYS A N   
432  C CA  . LYS A 56  ? 0.3625 0.3404 0.2989 0.0973  0.0405  -0.0459 56  LYS A CA  
433  C C   . LYS A 56  ? 0.3631 0.3087 0.2873 0.0831  0.0350  -0.0345 56  LYS A C   
434  O O   . LYS A 56  ? 0.3458 0.2948 0.2772 0.0773  0.0315  -0.0267 56  LYS A O   
435  C CB  . LYS A 56  ? 0.3832 0.3461 0.3092 0.1222  0.0347  -0.0530 56  LYS A CB  
436  C CG  . LYS A 56  ? 0.3769 0.3813 0.3227 0.1407  0.0354  -0.0644 56  LYS A CG  
437  C CD  . LYS A 56  ? 0.4081 0.3974 0.3415 0.1700  0.0282  -0.0740 56  LYS A CD  
438  C CE  . LYS A 56  ? 0.4060 0.4469 0.3624 0.1895  0.0306  -0.0919 56  LYS A CE  
439  N NZ  . LYS A 56  ? 0.3776 0.4642 0.3618 0.1879  0.0297  -0.0934 56  LYS A NZ  
440  N N   . LEU A 57  ? 0.3790 0.2975 0.2862 0.0772  0.0346  -0.0355 57  LEU A N   
441  C CA  . LEU A 57  ? 0.3821 0.2761 0.2813 0.0624  0.0298  -0.0281 57  LEU A CA  
442  C C   . LEU A 57  ? 0.3498 0.2647 0.2628 0.0474  0.0303  -0.0225 57  LEU A C   
443  O O   . LEU A 57  ? 0.3490 0.2591 0.2649 0.0387  0.0267  -0.0167 57  LEU A O   
444  C CB  . LEU A 57  ? 0.4130 0.2795 0.2941 0.0583  0.0284  -0.0338 57  LEU A CB  
445  C CG  . LEU A 57  ? 0.4118 0.2622 0.2891 0.0406  0.0241  -0.0307 57  LEU A CG  
446  C CD1 . LEU A 57  ? 0.4394 0.2688 0.3128 0.0367  0.0217  -0.0241 57  LEU A CD1 
447  C CD2 . LEU A 57  ? 0.4444 0.2739 0.3057 0.0380  0.0223  -0.0401 57  LEU A CD2 
448  N N   . THR A 58  ? 0.3374 0.2743 0.2571 0.0450  0.0355  -0.0247 58  THR A N   
449  C CA  . THR A 58  ? 0.3250 0.2754 0.2536 0.0328  0.0353  -0.0195 58  THR A CA  
450  C C   . THR A 58  ? 0.3098 0.2741 0.2547 0.0319  0.0328  -0.0147 58  THR A C   
451  O O   . THR A 58  ? 0.3070 0.2735 0.2571 0.0233  0.0291  -0.0107 58  THR A O   
452  C CB  . THR A 58  ? 0.3279 0.2932 0.2559 0.0293  0.0430  -0.0214 58  THR A CB  
453  O OG1 . THR A 58  ? 0.3556 0.3107 0.2664 0.0325  0.0465  -0.0270 58  THR A OG1 
454  C CG2 . THR A 58  ? 0.3261 0.2888 0.2519 0.0178  0.0402  -0.0158 58  THR A CG2 
455  N N   . PHE A 59  ? 0.3186 0.2926 0.2703 0.0431  0.0335  -0.0163 59  PHE A N   
456  C CA  . PHE A 59  ? 0.3104 0.2980 0.2744 0.0445  0.0302  -0.0128 59  PHE A CA  
457  C C   . PHE A 59  ? 0.3079 0.2758 0.2637 0.0394  0.0250  -0.0063 59  PHE A C   
458  O O   . PHE A 59  ? 0.2866 0.2655 0.2513 0.0336  0.0230  -0.0031 59  PHE A O   
459  C CB  . PHE A 59  ? 0.3328 0.3344 0.3023 0.0614  0.0297  -0.0175 59  PHE A CB  
460  C CG  . PHE A 59  ? 0.3262 0.3635 0.3145 0.0622  0.0358  -0.0258 59  PHE A CG  
461  C CD1 . PHE A 59  ? 0.3340 0.3770 0.3206 0.0592  0.0440  -0.0318 59  PHE A CD1 
462  C CD2 . PHE A 59  ? 0.3158 0.3820 0.3227 0.0643  0.0341  -0.0289 59  PHE A CD2 
463  C CE1 . PHE A 59  ? 0.3288 0.4056 0.3323 0.0554  0.0524  -0.0399 59  PHE A CE1 
464  C CE2 . PHE A 59  ? 0.3144 0.4157 0.3409 0.0613  0.0409  -0.0386 59  PHE A CE2 
465  C CZ  . PHE A 59  ? 0.3174 0.4240 0.3424 0.0552  0.0510  -0.0437 59  PHE A CZ  
466  N N   . LEU A 60  ? 0.3213 0.2605 0.2600 0.0401  0.0238  -0.0056 60  LEU A N   
467  C CA  . LEU A 60  ? 0.3464 0.2668 0.2764 0.0314  0.0216  -0.0004 60  LEU A CA  
468  C C   . LEU A 60  ? 0.3531 0.2795 0.2897 0.0162  0.0208  -0.0021 60  LEU A C   
469  O O   . LEU A 60  ? 0.3766 0.3087 0.3183 0.0070  0.0197  0.0000  60  LEU A O   
470  C CB  . LEU A 60  ? 0.3725 0.2557 0.2801 0.0356  0.0213  0.0000  60  LEU A CB  
471  C CG  . LEU A 60  ? 0.3988 0.2708 0.2952 0.0543  0.0192  0.0027  60  LEU A CG  
472  C CD1 . LEU A 60  ? 0.4440 0.2673 0.3114 0.0591  0.0179  0.0042  60  LEU A CD1 
473  C CD2 . LEU A 60  ? 0.4029 0.2855 0.3016 0.0549  0.0176  0.0100  60  LEU A CD2 
474  N N   . TYR A 61  ? 0.3492 0.2775 0.2853 0.0150  0.0207  -0.0070 61  TYR A N   
475  C CA  . TYR A 61  ? 0.3454 0.2815 0.2866 0.0049  0.0171  -0.0095 61  TYR A CA  
476  C C   . TYR A 61  ? 0.3345 0.2932 0.2909 0.0034  0.0155  -0.0071 61  TYR A C   
477  O O   . TYR A 61  ? 0.3170 0.2847 0.2809 -0.0031 0.0112  -0.0090 61  TYR A O   
478  C CB  . TYR A 61  ? 0.3509 0.2828 0.2832 0.0067  0.0167  -0.0139 61  TYR A CB  
479  C CG  . TYR A 61  ? 0.3701 0.2807 0.2871 0.0067  0.0161  -0.0195 61  TYR A CG  
480  C CD1 . TYR A 61  ? 0.3897 0.2835 0.3025 0.0000  0.0147  -0.0215 61  TYR A CD1 
481  C CD2 . TYR A 61  ? 0.3936 0.2997 0.2982 0.0113  0.0173  -0.0239 61  TYR A CD2 
482  C CE1 . TYR A 61  ? 0.4151 0.2871 0.3137 -0.0016 0.0135  -0.0286 61  TYR A CE1 
483  C CE2 . TYR A 61  ? 0.4229 0.3100 0.3128 0.0114  0.0156  -0.0313 61  TYR A CE2 
484  C CZ  . TYR A 61  ? 0.4228 0.2924 0.3108 0.0051  0.0132  -0.0341 61  TYR A CZ  
485  O OH  . TYR A 61  ? 0.4587 0.3075 0.3322 0.0040  0.0112  -0.0430 61  TYR A OH  
486  N N   . LEU A 62  ? 0.3278 0.2977 0.2900 0.0095  0.0187  -0.0054 62  LEU A N   
487  C CA  . LEU A 62  ? 0.2995 0.2876 0.2753 0.0079  0.0174  -0.0044 62  LEU A CA  
488  C C   . LEU A 62  ? 0.3070 0.3027 0.2895 0.0068  0.0155  -0.0026 62  LEU A C   
489  O O   . LEU A 62  ? 0.2815 0.2889 0.2730 0.0028  0.0122  -0.0040 62  LEU A O   
490  C CB  . LEU A 62  ? 0.2832 0.2838 0.2656 0.0123  0.0222  -0.0050 62  LEU A CB  
491  C CG  . LEU A 62  ? 0.2719 0.2896 0.2683 0.0096  0.0210  -0.0057 62  LEU A CG  
492  C CD1 . LEU A 62  ? 0.2600 0.2702 0.2533 0.0033  0.0174  -0.0057 62  LEU A CD1 
493  C CD2 . LEU A 62  ? 0.2711 0.3051 0.2765 0.0119  0.0268  -0.0091 62  LEU A CD2 
494  N N   . ALA A 63  ? 0.3022 0.2900 0.2777 0.0116  0.0177  0.0003  63  ALA A N   
495  C CA  . ALA A 63  ? 0.3087 0.2987 0.2831 0.0101  0.0173  0.0038  63  ALA A CA  
496  C C   . ALA A 63  ? 0.3115 0.2982 0.2849 -0.0024 0.0172  0.0025  63  ALA A C   
497  O O   . ALA A 63  ? 0.3207 0.3227 0.3014 -0.0072 0.0170  0.0018  63  ALA A O   
498  C CB  . ALA A 63  ? 0.3211 0.2931 0.2796 0.0189  0.0187  0.0084  63  ALA A CB  
499  N N   . ASN A 64  ? 0.3322 0.3027 0.2980 -0.0078 0.0174  0.0001  64  ASN A N   
500  C CA  . ASN A 64  ? 0.3425 0.3152 0.3109 -0.0216 0.0171  -0.0046 64  ASN A CA  
501  C C   . ASN A 64  ? 0.3205 0.3212 0.3070 -0.0228 0.0121  -0.0110 64  ASN A C   
502  O O   . ASN A 64  ? 0.3291 0.3481 0.3251 -0.0293 0.0129  -0.0141 64  ASN A O   
503  C CB  . ASN A 64  ? 0.3513 0.3057 0.3109 -0.0250 0.0159  -0.0091 64  ASN A CB  
504  C CG  . ASN A 64  ? 0.3726 0.3329 0.3376 -0.0401 0.0151  -0.0173 64  ASN A CG  
505  O OD1 . ASN A 64  ? 0.3524 0.3178 0.3197 -0.0521 0.0199  -0.0173 64  ASN A OD1 
506  N ND2 . ASN A 64  ? 0.3772 0.3385 0.3432 -0.0402 0.0093  -0.0254 64  ASN A ND2 
507  N N   . ASP A 65  ? 0.3058 0.3082 0.2945 -0.0154 0.0074  -0.0128 65  ASP A N   
508  C CA  . ASP A 65  ? 0.3224 0.3419 0.3223 -0.0127 0.0007  -0.0181 65  ASP A CA  
509  C C   . ASP A 65  ? 0.3065 0.3442 0.3178 -0.0107 0.0011  -0.0179 65  ASP A C   
510  O O   . ASP A 65  ? 0.2624 0.3195 0.2851 -0.0124 -0.0023 -0.0249 65  ASP A O   
511  C CB  . ASP A 65  ? 0.3643 0.3724 0.3564 -0.0057 -0.0018 -0.0163 65  ASP A CB  
512  C CG  . ASP A 65  ? 0.4574 0.4673 0.4487 -0.0028 -0.0106 -0.0219 65  ASP A CG  
513  O OD1 . ASP A 65  ? 0.4835 0.5048 0.4838 0.0009  -0.0154 -0.0247 65  ASP A OD1 
514  O OD2 . ASP A 65  ? 0.5311 0.5305 0.5115 -0.0029 -0.0138 -0.0247 65  ASP A OD2 
515  N N   . VAL A 66  ? 0.2752 0.3101 0.2846 -0.0060 0.0047  -0.0120 66  VAL A N   
516  C CA  . VAL A 66  ? 0.2640 0.3156 0.2826 -0.0033 0.0045  -0.0128 66  VAL A CA  
517  C C   . VAL A 66  ? 0.2593 0.3228 0.2791 -0.0090 0.0078  -0.0135 66  VAL A C   
518  O O   . VAL A 66  ? 0.2595 0.3429 0.2897 -0.0092 0.0057  -0.0196 66  VAL A O   
519  C CB  . VAL A 66  ? 0.2616 0.3119 0.2785 0.0025  0.0075  -0.0083 66  VAL A CB  
520  C CG1 . VAL A 66  ? 0.2631 0.3326 0.2890 0.0054  0.0061  -0.0110 66  VAL A CG1 
521  C CG2 . VAL A 66  ? 0.2885 0.3307 0.3048 0.0044  0.0075  -0.0085 66  VAL A CG2 
522  N N   . ILE A 67  ? 0.2713 0.3204 0.2779 -0.0139 0.0137  -0.0075 67  ILE A N   
523  C CA  . ILE A 67  ? 0.2808 0.3356 0.2825 -0.0221 0.0193  -0.0061 67  ILE A CA  
524  C C   . ILE A 67  ? 0.2737 0.3486 0.2881 -0.0328 0.0195  -0.0160 67  ILE A C   
525  O O   . ILE A 67  ? 0.2747 0.3738 0.2981 -0.0347 0.0208  -0.0212 67  ILE A O   
526  C CB  . ILE A 67  ? 0.3198 0.3452 0.2982 -0.0255 0.0255  0.0035  67  ILE A CB  
527  C CG1 . ILE A 67  ? 0.3138 0.3280 0.2824 -0.0103 0.0232  0.0102  67  ILE A CG1 
528  C CG2 . ILE A 67  ? 0.3513 0.3786 0.3189 -0.0366 0.0333  0.0066  67  ILE A CG2 
529  C CD1 . ILE A 67  ? 0.3531 0.3329 0.2967 -0.0072 0.0260  0.0187  67  ILE A CD1 
530  N N   . GLN A 68  ? 0.2789 0.3476 0.2953 -0.0386 0.0177  -0.0206 68  GLN A N   
531  C CA  . GLN A 68  ? 0.2784 0.3715 0.3095 -0.0485 0.0171  -0.0329 68  GLN A CA  
532  C C   . GLN A 68  ? 0.2651 0.3873 0.3152 -0.0379 0.0081  -0.0436 68  GLN A C   
533  O O   . GLN A 68  ? 0.2554 0.4088 0.3196 -0.0424 0.0097  -0.0538 68  GLN A O   
534  C CB  . GLN A 68  ? 0.2872 0.3696 0.3173 -0.0540 0.0139  -0.0379 68  GLN A CB  
535  C CG  . GLN A 68  ? 0.3253 0.3776 0.3370 -0.0663 0.0222  -0.0310 68  GLN A CG  
536  C CD  . GLN A 68  ? 0.3367 0.3918 0.3541 -0.0782 0.0203  -0.0423 68  GLN A CD  
537  O OE1 . GLN A 68  ? 0.3496 0.4323 0.3821 -0.0912 0.0226  -0.0537 68  GLN A OE1 
538  N NE2 . GLN A 68  ? 0.3544 0.3848 0.3607 -0.0738 0.0162  -0.0411 68  GLN A NE2 
539  N N   . ASN A 69  ? 0.2558 0.3670 0.3045 -0.0242 -0.0003 -0.0418 69  ASN A N   
540  C CA  . ASN A 69  ? 0.2482 0.3772 0.3096 -0.0130 -0.0102 -0.0517 69  ASN A CA  
541  C C   . ASN A 69  ? 0.2393 0.3804 0.3059 -0.0072 -0.0092 -0.0521 69  ASN A C   
542  O O   . ASN A 69  ? 0.2134 0.3681 0.2899 0.0026  -0.0174 -0.0618 69  ASN A O   
543  C CB  . ASN A 69  ? 0.2618 0.3687 0.3147 -0.0028 -0.0195 -0.0499 69  ASN A CB  
544  C CG  . ASN A 69  ? 0.2906 0.3913 0.3390 -0.0060 -0.0231 -0.0533 69  ASN A CG  
545  O OD1 . ASN A 69  ? 0.3082 0.4317 0.3684 -0.0116 -0.0246 -0.0643 69  ASN A OD1 
546  N ND2 . ASN A 69  ? 0.3094 0.3826 0.3415 -0.0029 -0.0243 -0.0458 69  ASN A ND2 
547  N N   . SER A 70  ? 0.2316 0.3657 0.2895 -0.0113 -0.0009 -0.0424 70  SER A N   
548  C CA  . SER A 70  ? 0.2194 0.3653 0.2803 -0.0059 -0.0005 -0.0436 70  SER A CA  
549  C C   . SER A 70  ? 0.2243 0.3994 0.2917 -0.0120 0.0051  -0.0509 70  SER A C   
550  O O   . SER A 70  ? 0.2119 0.4051 0.2858 -0.0059 0.0032  -0.0577 70  SER A O   
551  C CB  . SER A 70  ? 0.2167 0.3470 0.2647 -0.0049 0.0041  -0.0320 70  SER A CB  
552  O OG  . SER A 70  ? 0.2230 0.3476 0.2577 -0.0134 0.0130  -0.0244 70  SER A OG  
553  N N   . LYS A 71  ? 0.2426 0.4226 0.3079 -0.0254 0.0128  -0.0507 71  LYS A N   
554  C CA  . LYS A 71  ? 0.2684 0.4762 0.3367 -0.0363 0.0225  -0.0566 71  LYS A CA  
555  C C   . LYS A 71  ? 0.2336 0.4796 0.3237 -0.0286 0.0170  -0.0746 71  LYS A C   
556  O O   . LYS A 71  ? 0.2203 0.4893 0.3117 -0.0292 0.0224  -0.0795 71  LYS A O   
557  C CB  . LYS A 71  ? 0.3216 0.5312 0.3890 -0.0550 0.0313  -0.0578 71  LYS A CB  
558  C CG  . LYS A 71  ? 0.3804 0.5493 0.4250 -0.0633 0.0368  -0.0423 71  LYS A CG  
559  C CD  . LYS A 71  ? 0.4344 0.5866 0.4537 -0.0712 0.0485  -0.0293 71  LYS A CD  
560  C CE  . LYS A 71  ? 0.4930 0.6067 0.4906 -0.0841 0.0552  -0.0187 71  LYS A CE  
561  N NZ  . LYS A 71  ? 0.5206 0.5996 0.4847 -0.0822 0.0610  -0.0016 71  LYS A NZ  
562  N N   . ARG A 72  ? 0.2273 0.4788 0.3319 -0.0196 0.0053  -0.0850 72  ARG A N   
563  C CA  . ARG A 72  ? 0.2185 0.5032 0.3432 -0.0072 -0.0035 -0.1044 72  ARG A CA  
564  C C   . ARG A 72  ? 0.2115 0.4909 0.3342 0.0082  -0.0102 -0.1059 72  ARG A C   
565  O O   . ARG A 72  ? 0.1912 0.4977 0.3276 0.0192  -0.0159 -0.1223 72  ARG A O   
566  C CB  . ARG A 72  ? 0.2218 0.5061 0.3562 0.0019  -0.0171 -0.1139 72  ARG A CB  
567  C CG  . ARG A 72  ? 0.2208 0.4599 0.3391 0.0122  -0.0270 -0.1018 72  ARG A CG  
568  C CD  . ARG A 72  ? 0.2161 0.4499 0.3358 0.0185  -0.0386 -0.1078 72  ARG A CD  
569  N NE  . ARG A 72  ? 0.2142 0.4674 0.3459 0.0374  -0.0538 -0.1256 72  ARG A NE  
570  C CZ  . ARG A 72  ? 0.2290 0.4569 0.3504 0.0561  -0.0666 -0.1255 72  ARG A CZ  
571  N NH1 . ARG A 72  ? 0.2360 0.4231 0.3382 0.0551  -0.0642 -0.1093 72  ARG A NH1 
572  N NH2 . ARG A 72  ? 0.2384 0.4812 0.3681 0.0757  -0.0818 -0.1425 72  ARG A NH2 
573  N N   . LYS A 73  ? 0.2169 0.4644 0.3237 0.0086  -0.0091 -0.0908 73  LYS A N   
574  C CA  . LYS A 73  ? 0.2196 0.4597 0.3245 0.0200  -0.0150 -0.0925 73  LYS A CA  
575  C C   . LYS A 73  ? 0.2272 0.4808 0.3251 0.0152  -0.0057 -0.0893 73  LYS A C   
576  O O   . LYS A 73  ? 0.2165 0.4910 0.3205 0.0223  -0.0077 -0.1010 73  LYS A O   
577  C CB  . LYS A 73  ? 0.2050 0.4065 0.2995 0.0231  -0.0202 -0.0812 73  LYS A CB  
578  C CG  . LYS A 73  ? 0.2092 0.3906 0.3034 0.0307  -0.0309 -0.0837 73  LYS A CG  
579  C CD  . LYS A 73  ? 0.2238 0.4064 0.3240 0.0458  -0.0432 -0.0978 73  LYS A CD  
580  C CE  . LYS A 73  ? 0.2490 0.4078 0.3423 0.0547  -0.0546 -0.0987 73  LYS A CE  
581  N NZ  . LYS A 73  ? 0.2818 0.4348 0.3759 0.0729  -0.0689 -0.1125 73  LYS A NZ  
582  N N   . GLY A 74  ? 0.2521 0.4908 0.3342 0.0051  0.0033  -0.0739 74  GLY A N   
583  C CA  . GLY A 74  ? 0.2428 0.4892 0.3105 0.0010  0.0121  -0.0682 74  GLY A CA  
584  C C   . GLY A 74  ? 0.2587 0.4792 0.3047 -0.0070 0.0196  -0.0503 74  GLY A C   
585  O O   . GLY A 74  ? 0.2501 0.4480 0.2945 -0.0101 0.0185  -0.0432 74  GLY A O   
586  N N   . PRO A 75  ? 0.2775 0.4990 0.3034 -0.0090 0.0266  -0.0433 75  PRO A N   
587  C CA  . PRO A 75  ? 0.3030 0.4963 0.3016 -0.0155 0.0340  -0.0264 75  PRO A CA  
588  C C   . PRO A 75  ? 0.2935 0.4609 0.2814 -0.0039 0.0269  -0.0164 75  PRO A C   
589  O O   . PRO A 75  ? 0.3163 0.4566 0.2799 -0.0054 0.0309  -0.0032 75  PRO A O   
590  C CB  . PRO A 75  ? 0.3162 0.5219 0.2939 -0.0199 0.0432  -0.0242 75  PRO A CB  
591  C CG  . PRO A 75  ? 0.3113 0.5439 0.3023 -0.0061 0.0346  -0.0371 75  PRO A CG  
592  C CD  . PRO A 75  ? 0.2837 0.5309 0.3074 -0.0035 0.0272  -0.0515 75  PRO A CD  
593  N N   . GLU A 76  ? 0.2862 0.4614 0.2916 0.0069  0.0169  -0.0238 76  GLU A N   
594  C CA  . GLU A 76  ? 0.2825 0.4468 0.2832 0.0179  0.0106  -0.0194 76  GLU A CA  
595  C C   . GLU A 76  ? 0.2756 0.4116 0.2677 0.0173  0.0119  -0.0089 76  GLU A C   
596  O O   . GLU A 76  ? 0.2895 0.4115 0.2634 0.0250  0.0110  -0.0009 76  GLU A O   
597  C CB  . GLU A 76  ? 0.2727 0.4499 0.2969 0.0239  0.0018  -0.0311 76  GLU A CB  
598  C CG  . GLU A 76  ? 0.2859 0.4880 0.3193 0.0272  -0.0017 -0.0441 76  GLU A CG  
599  C CD  . GLU A 76  ? 0.2975 0.5092 0.3463 0.0229  -0.0019 -0.0543 76  GLU A CD  
600  O OE1 . GLU A 76  ? 0.2764 0.4788 0.3287 0.0167  0.0006  -0.0516 76  GLU A OE1 
601  O OE2 . GLU A 76  ? 0.3116 0.5412 0.3690 0.0278  -0.0063 -0.0670 76  GLU A OE2 
602  N N   . PHE A 77  ? 0.2633 0.3908 0.2670 0.0106  0.0126  -0.0102 77  PHE A N   
603  C CA  . PHE A 77  ? 0.2603 0.3632 0.2577 0.0115  0.0130  -0.0031 77  PHE A CA  
604  C C   . PHE A 77  ? 0.2984 0.3768 0.2714 0.0060  0.0196  0.0073  77  PHE A C   
605  O O   . PHE A 77  ? 0.3152 0.3710 0.2730 0.0135  0.0187  0.0146  77  PHE A O   
606  C CB  . PHE A 77  ? 0.2415 0.3409 0.2547 0.0076  0.0108  -0.0079 77  PHE A CB  
607  C CG  . PHE A 77  ? 0.2232 0.3302 0.2512 0.0136  0.0053  -0.0137 77  PHE A CG  
608  C CD1 . PHE A 77  ? 0.2255 0.3287 0.2523 0.0203  0.0047  -0.0116 77  PHE A CD1 
609  C CD2 . PHE A 77  ? 0.2234 0.3404 0.2657 0.0121  0.0012  -0.0224 77  PHE A CD2 
610  C CE1 . PHE A 77  ? 0.2064 0.3181 0.2475 0.0211  0.0023  -0.0180 77  PHE A CE1 
611  C CE2 . PHE A 77  ? 0.2134 0.3308 0.2653 0.0140  -0.0021 -0.0271 77  PHE A CE2 
612  C CZ  . PHE A 77  ? 0.2103 0.3265 0.2625 0.0164  -0.0005 -0.0250 77  PHE A CZ  
613  N N   . THR A 78  ? 0.2962 0.3785 0.2641 -0.0067 0.0266  0.0072  78  THR A N   
614  C CA  . THR A 78  ? 0.3359 0.3901 0.2754 -0.0162 0.0352  0.0180  78  THR A CA  
615  C C   . THR A 78  ? 0.3687 0.4070 0.2794 -0.0048 0.0343  0.0281  78  THR A C   
616  O O   . THR A 78  ? 0.3989 0.4012 0.2838 0.0001  0.0344  0.0385  78  THR A O   
617  C CB  . THR A 78  ? 0.3444 0.4145 0.2866 -0.0350 0.0449  0.0135  78  THR A CB  
618  O OG1 . THR A 78  ? 0.3103 0.3974 0.2801 -0.0415 0.0425  0.0021  78  THR A OG1 
619  C CG2 . THR A 78  ? 0.3980 0.4346 0.3071 -0.0497 0.0564  0.0253  78  THR A CG2 
620  N N   . ARG A 79  ? 0.3733 0.4374 0.2867 0.0017  0.0319  0.0240  79  ARG A N   
621  C CA  . ARG A 79  ? 0.4053 0.4590 0.2904 0.0152  0.0287  0.0319  79  ARG A CA  
622  C C   . ARG A 79  ? 0.3925 0.4361 0.2775 0.0356  0.0176  0.0329  79  ARG A C   
623  O O   . ARG A 79  ? 0.3932 0.4074 0.2470 0.0466  0.0153  0.0431  79  ARG A O   
624  C CB  . ARG A 79  ? 0.4169 0.5053 0.3083 0.0189  0.0269  0.0239  79  ARG A CB  
625  C CG  . ARG A 79  ? 0.4745 0.5580 0.3381 0.0364  0.0204  0.0294  79  ARG A CG  
626  C CD  . ARG A 79  ? 0.4932 0.6120 0.3619 0.0395  0.0186  0.0197  79  ARG A CD  
627  N NE  . ARG A 79  ? 0.4839 0.6352 0.3934 0.0441  0.0101  0.0031  79  ARG A NE  
628  C CZ  . ARG A 79  ? 0.4919 0.6722 0.4245 0.0374  0.0115  -0.0100 79  ARG A CZ  
629  N NH1 . ARG A 79  ? 0.4999 0.6907 0.4239 0.0264  0.0214  -0.0110 79  ARG A NH1 
630  N NH2 . ARG A 79  ? 0.5056 0.7044 0.4695 0.0419  0.0030  -0.0233 79  ARG A NH2 
631  N N   . GLU A 80  ? 0.3488 0.4168 0.2672 0.0409  0.0110  0.0217  80  GLU A N   
632  C CA  . GLU A 80  ? 0.3582 0.4279 0.2812 0.0590  0.0018  0.0191  80  GLU A CA  
633  C C   . GLU A 80  ? 0.3759 0.4152 0.2898 0.0623  0.0027  0.0250  80  GLU A C   
634  O O   . GLU A 80  ? 0.3816 0.4123 0.2840 0.0805  -0.0039 0.0264  80  GLU A O   
635  C CB  . GLU A 80  ? 0.3270 0.4315 0.2863 0.0604  -0.0033 0.0048  80  GLU A CB  
636  C CG  . GLU A 80  ? 0.3240 0.4585 0.2928 0.0611  -0.0069 -0.0040 80  GLU A CG  
637  C CD  . GLU A 80  ? 0.3535 0.4947 0.3023 0.0777  -0.0141 -0.0031 80  GLU A CD  
638  O OE1 . GLU A 80  ? 0.3849 0.5184 0.3252 0.0922  -0.0198 -0.0008 80  GLU A OE1 
639  O OE2 . GLU A 80  ? 0.4043 0.5579 0.3431 0.0778  -0.0145 -0.0048 80  GLU A OE2 
640  N N   . PHE A 81  ? 0.3627 0.3878 0.2818 0.0471  0.0095  0.0265  81  PHE A N   
641  C CA  . PHE A 81  ? 0.3921 0.3892 0.3038 0.0497  0.0102  0.0296  81  PHE A CA  
642  C C   . PHE A 81  ? 0.4522 0.4067 0.3246 0.0540  0.0118  0.0417  81  PHE A C   
643  O O   . PHE A 81  ? 0.4653 0.3933 0.3248 0.0648  0.0090  0.0439  81  PHE A O   
644  C CB  . PHE A 81  ? 0.3743 0.3681 0.3007 0.0326  0.0158  0.0264  81  PHE A CB  
645  C CG  . PHE A 81  ? 0.3371 0.3514 0.2906 0.0342  0.0132  0.0173  81  PHE A CG  
646  C CD1 . PHE A 81  ? 0.3667 0.3737 0.3208 0.0443  0.0114  0.0153  81  PHE A CD1 
647  C CD2 . PHE A 81  ? 0.3174 0.3561 0.2929 0.0258  0.0129  0.0104  81  PHE A CD2 
648  C CE1 . PHE A 81  ? 0.3330 0.3576 0.3084 0.0428  0.0116  0.0077  81  PHE A CE1 
649  C CE2 . PHE A 81  ? 0.2917 0.3412 0.2853 0.0254  0.0116  0.0040  81  PHE A CE2 
650  C CZ  . PHE A 81  ? 0.2984 0.3413 0.2914 0.0324  0.0119  0.0031  81  PHE A CZ  
651  N N   . GLU A 82  ? 0.4827 0.4278 0.3325 0.0463  0.0164  0.0495  82  GLU A N   
652  C CA  . GLU A 82  ? 0.5556 0.4512 0.3621 0.0451  0.0204  0.0629  82  GLU A CA  
653  C C   . GLU A 82  ? 0.5899 0.4586 0.3707 0.0727  0.0099  0.0677  82  GLU A C   
654  O O   . GLU A 82  ? 0.6248 0.4456 0.3772 0.0756  0.0105  0.0751  82  GLU A O   
655  C CB  . GLU A 82  ? 0.6150 0.5074 0.3978 0.0334  0.0279  0.0707  82  GLU A CB  
656  C CG  . GLU A 82  ? 0.7384 0.5714 0.4693 0.0287  0.0340  0.0867  82  GLU A CG  
657  C CD  . GLU A 82  ? 0.8195 0.6480 0.5321 0.0023  0.0491  0.0930  82  GLU A CD  
658  O OE1 . GLU A 82  ? 0.7980 0.6715 0.5312 -0.0037 0.0520  0.0859  82  GLU A OE1 
659  O OE2 . GLU A 82  ? 0.9505 0.7297 0.6275 -0.0133 0.0590  0.1041  82  GLU A OE2 
660  N N   . SER A 83  ? 0.5558 0.4549 0.3456 0.0935  -0.0004 0.0620  83  SER A N   
661  C CA  . SER A 83  ? 0.5884 0.4698 0.3545 0.1239  -0.0129 0.0640  83  SER A CA  
662  C C   . SER A 83  ? 0.5643 0.4468 0.3478 0.1391  -0.0188 0.0549  83  SER A C   
663  O O   . SER A 83  ? 0.5996 0.4635 0.3619 0.1663  -0.0295 0.0553  83  SER A O   
664  C CB  . SER A 83  ? 0.5824 0.5034 0.3555 0.1415  -0.0233 0.0575  83  SER A CB  
665  O OG  . SER A 83  ? 0.5283 0.5041 0.3517 0.1342  -0.0233 0.0419  83  SER A OG  
666  N N   . VAL A 84  ? 0.5100 0.4123 0.3282 0.1240  -0.0125 0.0464  84  VAL A N   
667  C CA  . VAL A 84  ? 0.5016 0.4092 0.3365 0.1365  -0.0160 0.0366  84  VAL A CA  
668  C C   . VAL A 84  ? 0.5210 0.3902 0.3458 0.1245  -0.0089 0.0398  84  VAL A C   
669  O O   . VAL A 84  ? 0.5187 0.3838 0.3484 0.1370  -0.0116 0.0326  84  VAL A O   
670  C CB  . VAL A 84  ? 0.4356 0.4009 0.3184 0.1328  -0.0155 0.0214  84  VAL A CB  
671  C CG1 . VAL A 84  ? 0.4202 0.4259 0.3159 0.1451  -0.0237 0.0144  84  VAL A CG1 
672  C CG2 . VAL A 84  ? 0.4023 0.3780 0.3055 0.1049  -0.0056 0.0211  84  VAL A CG2 
673  N N   . LEU A 85  ? 0.5354 0.3806 0.3479 0.0998  0.0002  0.0484  85  LEU A N   
674  C CA  . LEU A 85  ? 0.5337 0.3516 0.3439 0.0841  0.0068  0.0479  85  LEU A CA  
675  C C   . LEU A 85  ? 0.5856 0.3451 0.3579 0.0955  0.0043  0.0534  85  LEU A C   
676  O O   . LEU A 85  ? 0.5774 0.3210 0.3519 0.0938  0.0055  0.0477  85  LEU A O   
677  C CB  . LEU A 85  ? 0.5285 0.3468 0.3427 0.0538  0.0169  0.0514  85  LEU A CB  
678  C CG  . LEU A 85  ? 0.4854 0.3571 0.3379 0.0435  0.0184  0.0435  85  LEU A CG  
679  C CD1 . LEU A 85  ? 0.4959 0.3692 0.3490 0.0180  0.0269  0.0458  85  LEU A CD1 
680  C CD2 . LEU A 85  ? 0.4574 0.3525 0.3392 0.0437  0.0172  0.0327  85  LEU A CD2 
681  N N   . VAL A 86  ? 0.6359 0.3601 0.3703 0.1088  -0.0001 0.0640  86  VAL A N   
682  C CA  . VAL A 86  ? 0.7122 0.3715 0.4051 0.1222  -0.0039 0.0694  86  VAL A CA  
683  C C   . VAL A 86  ? 0.7128 0.3862 0.4206 0.1512  -0.0137 0.0561  86  VAL A C   
684  O O   . VAL A 86  ? 0.7283 0.3718 0.4285 0.1536  -0.0134 0.0509  86  VAL A O   
685  C CB  . VAL A 86  ? 0.7825 0.3954 0.4245 0.1347  -0.0084 0.0848  86  VAL A CB  
686  C CG1 . VAL A 86  ? 0.8577 0.4007 0.4542 0.1577  -0.0165 0.0891  86  VAL A CG1 
687  C CG2 . VAL A 86  ? 0.7998 0.3922 0.4225 0.1012  0.0052  0.0976  86  VAL A CG2 
688  N N   . ASP A 87  ? 0.6874 0.4104 0.4183 0.1719  -0.0218 0.0483  87  ASP A N   
689  C CA  . ASP A 87  ? 0.6802 0.4301 0.4311 0.1983  -0.0297 0.0329  87  ASP A CA  
690  C C   . ASP A 87  ? 0.6261 0.4069 0.4136 0.1824  -0.0211 0.0210  87  ASP A C   
691  O O   . ASP A 87  ? 0.6194 0.3910 0.4065 0.1959  -0.0229 0.0114  87  ASP A O   
692  C CB  . ASP A 87  ? 0.6690 0.4732 0.4414 0.2190  -0.0390 0.0249  87  ASP A CB  
693  C CG  . ASP A 87  ? 0.6610 0.5072 0.4633 0.2415  -0.0443 0.0054  87  ASP A CG  
694  O OD1 . ASP A 87  ? 0.6885 0.5100 0.4698 0.2713  -0.0542 0.0007  87  ASP A OD1 
695  O OD2 . ASP A 87  ? 0.6130 0.5153 0.4586 0.2283  -0.0377 -0.0056 87  ASP A OD2 
696  N N   . ALA A 88  ? 0.5675 0.3838 0.3836 0.1558  -0.0125 0.0211  88  ALA A N   
697  C CA  . ALA A 88  ? 0.5183 0.3592 0.3627 0.1399  -0.0048 0.0123  88  ALA A CA  
698  C C   . ALA A 88  ? 0.5437 0.3394 0.3685 0.1313  -0.0011 0.0130  88  ALA A C   
699  O O   . ALA A 88  ? 0.5315 0.3334 0.3652 0.1374  0.0000  0.0021  88  ALA A O   
700  C CB  . ALA A 88  ? 0.4864 0.3579 0.3541 0.1140  0.0017  0.0149  88  ALA A CB  
701  N N   . PHE A 89  ? 0.5543 0.3069 0.3531 0.1154  0.0016  0.0242  89  PHE A N   
702  C CA  . PHE A 89  ? 0.5901 0.2984 0.3703 0.1037  0.0052  0.0236  89  PHE A CA  
703  C C   . PHE A 89  ? 0.6301 0.3008 0.3861 0.1299  -0.0015 0.0186  89  PHE A C   
704  O O   . PHE A 89  ? 0.6394 0.3003 0.3967 0.1301  -0.0004 0.0089  89  PHE A O   
705  C CB  . PHE A 89  ? 0.6237 0.2925 0.3792 0.0799  0.0107  0.0356  89  PHE A CB  
706  C CG  . PHE A 89  ? 0.5870 0.2853 0.3674 0.0503  0.0184  0.0337  89  PHE A CG  
707  C CD1 . PHE A 89  ? 0.5384 0.2835 0.3434 0.0439  0.0200  0.0352  89  PHE A CD1 
708  C CD2 . PHE A 89  ? 0.6051 0.2863 0.3852 0.0307  0.0227  0.0279  89  PHE A CD2 
709  C CE1 . PHE A 89  ? 0.5089 0.2813 0.3365 0.0208  0.0251  0.0316  89  PHE A CE1 
710  C CE2 . PHE A 89  ? 0.5712 0.2848 0.3761 0.0072  0.0274  0.0235  89  PHE A CE2 
711  C CZ  . PHE A 89  ? 0.5141 0.2725 0.3420 0.0034  0.0284  0.0257  89  PHE A CZ  
712  N N   . SER A 90  ? 0.6664 0.3183 0.4000 0.1544  -0.0098 0.0237  90  SER A N   
713  C CA  . SER A 90  ? 0.7239 0.3382 0.4323 0.1847  -0.0187 0.0177  90  SER A CA  
714  C C   . SER A 90  ? 0.6958 0.3598 0.4376 0.2011  -0.0199 -0.0011 90  SER A C   
715  O O   . SER A 90  ? 0.7239 0.3667 0.4578 0.2098  -0.0205 -0.0111 90  SER A O   
716  C CB  . SER A 90  ? 0.7642 0.3592 0.4453 0.2127  -0.0299 0.0252  90  SER A CB  
717  O OG  . SER A 90  ? 0.8244 0.3808 0.4800 0.2455  -0.0402 0.0177  90  SER A OG  
718  N N   . HIS A 91  ? 0.6394 0.3700 0.4182 0.2023  -0.0187 -0.0064 91  HIS A N   
719  C CA  . HIS A 91  ? 0.6037 0.3884 0.4153 0.2158  -0.0177 -0.0242 91  HIS A CA  
720  C C   . HIS A 91  ? 0.5794 0.3725 0.4045 0.1964  -0.0075 -0.0314 91  HIS A C   
721  O O   . HIS A 91  ? 0.5769 0.3777 0.4057 0.2103  -0.0067 -0.0456 91  HIS A O   
722  C CB  . HIS A 91  ? 0.5531 0.4032 0.3998 0.2142  -0.0170 -0.0270 91  HIS A CB  
723  C CG  . HIS A 91  ? 0.5332 0.4420 0.4148 0.2222  -0.0129 -0.0454 91  HIS A CG  
724  N ND1 . HIS A 91  ? 0.5617 0.4841 0.4452 0.2535  -0.0193 -0.0608 91  HIS A ND1 
725  C CD2 . HIS A 91  ? 0.4910 0.4460 0.4045 0.2011  -0.0016 -0.0513 91  HIS A CD2 
726  C CE1 . HIS A 91  ? 0.5306 0.5103 0.4484 0.2495  -0.0105 -0.0763 91  HIS A CE1 
727  N NE2 . HIS A 91  ? 0.4919 0.4875 0.4253 0.2164  0.0006  -0.0690 91  HIS A NE2 
728  N N   . VAL A 92  ? 0.5462 0.3405 0.3782 0.1654  -0.0003 -0.0228 92  VAL A N   
729  C CA  . VAL A 92  ? 0.5279 0.3273 0.3682 0.1472  0.0071  -0.0281 92  VAL A CA  
730  C C   . VAL A 92  ? 0.5734 0.3212 0.3858 0.1521  0.0051  -0.0326 92  VAL A C   
731  O O   . VAL A 92  ? 0.5629 0.3197 0.3788 0.1591  0.0076  -0.0456 92  VAL A O   
732  C CB  . VAL A 92  ? 0.4919 0.3020 0.3437 0.1167  0.0124  -0.0192 92  VAL A CB  
733  C CG1 . VAL A 92  ? 0.4814 0.2919 0.3364 0.1006  0.0174  -0.0252 92  VAL A CG1 
734  C CG2 . VAL A 92  ? 0.4523 0.3127 0.3319 0.1137  0.0143  -0.0182 92  VAL A CG2 
735  N N   . ALA A 93  ? 0.6193 0.3119 0.4016 0.1492  0.0011  -0.0230 93  ALA A N   
736  C CA  . ALA A 93  ? 0.6713 0.3078 0.4250 0.1495  -0.0004 -0.0274 93  ALA A CA  
737  C C   . ALA A 93  ? 0.7170 0.3450 0.4610 0.1832  -0.0065 -0.0405 93  ALA A C   
738  O O   . ALA A 93  ? 0.7329 0.3439 0.4690 0.1860  -0.0059 -0.0524 93  ALA A O   
739  C CB  . ALA A 93  ? 0.7253 0.3000 0.4451 0.1387  -0.0021 -0.0138 93  ALA A CB  
740  N N   . ARG A 94  ? 0.7407 0.3830 0.4857 0.2102  -0.0134 -0.0402 94  ARG A N   
741  C CA  . ARG A 94  ? 0.7954 0.4385 0.5351 0.2472  -0.0208 -0.0557 94  ARG A CA  
742  C C   . ARG A 94  ? 0.7361 0.4486 0.5129 0.2520  -0.0139 -0.0734 94  ARG A C   
743  O O   . ARG A 94  ? 0.7547 0.4643 0.5272 0.2690  -0.0143 -0.0894 94  ARG A O   
744  C CB  . ARG A 94  ? 0.8556 0.4936 0.5834 0.2773  -0.0326 -0.0516 94  ARG A CB  
745  C CG  . ARG A 94  ? 0.9608 0.5146 0.6378 0.2825  -0.0408 -0.0363 94  ARG A CG  
746  C CD  . ARG A 94  ? 1.0306 0.5786 0.6907 0.3183  -0.0550 -0.0331 94  ARG A CD  
747  N NE  . ARG A 94  ? 1.0416 0.6336 0.7209 0.3083  -0.0540 -0.0225 94  ARG A NE  
748  C CZ  . ARG A 94  ? 1.0310 0.7038 0.7543 0.3148  -0.0536 -0.0329 94  ARG A CZ  
749  N NH1 . ARG A 94  ? 1.0453 0.7711 0.8012 0.3299  -0.0525 -0.0540 94  ARG A NH1 
750  N NH2 . ARG A 94  ? 1.0181 0.7203 0.7529 0.3047  -0.0535 -0.0230 94  ARG A NH2 
751  N N   . GLU A 95  ? 0.6619 0.4341 0.4724 0.2364  -0.0067 -0.0710 95  GLU A N   
752  C CA  . GLU A 95  ? 0.6238 0.4623 0.4670 0.2420  0.0008  -0.0872 95  GLU A CA  
753  C C   . GLU A 95  ? 0.5714 0.4358 0.4299 0.2129  0.0140  -0.0880 95  GLU A C   
754  O O   . GLU A 95  ? 0.5655 0.4719 0.4410 0.2162  0.0222  -0.1017 95  GLU A O   
755  C CB  . GLU A 95  ? 0.6004 0.4935 0.4714 0.2522  -0.0012 -0.0894 95  GLU A CB  
756  C CG  . GLU A 95  ? 0.6512 0.5342 0.5106 0.2894  -0.0157 -0.0947 95  GLU A CG  
757  C CD  . GLU A 95  ? 0.6995 0.5851 0.5548 0.3209  -0.0194 -0.1155 95  GLU A CD  
758  O OE1 . GLU A 95  ? 0.7611 0.6107 0.5918 0.3528  -0.0336 -0.1179 95  GLU A OE1 
759  O OE2 . GLU A 95  ? 0.6925 0.6136 0.5661 0.3144  -0.0080 -0.1296 95  GLU A OE2 
760  N N   . ALA A 96  ? 0.5456 0.3866 0.3969 0.1855  0.0162  -0.0745 96  ALA A N   
761  C CA  . ALA A 96  ? 0.5183 0.3800 0.3792 0.1625  0.0257  -0.0753 96  ALA A CA  
762  C C   . ALA A 96  ? 0.5503 0.3876 0.3926 0.1644  0.0274  -0.0859 96  ALA A C   
763  O O   . ALA A 96  ? 0.5840 0.3800 0.4043 0.1802  0.0209  -0.0919 96  ALA A O   
764  C CB  . ALA A 96  ? 0.4926 0.3450 0.3552 0.1354  0.0259  -0.0600 96  ALA A CB  
765  N N   . ASP A 97  ? 0.5530 0.4141 0.4014 0.1488  0.0360  -0.0887 97  ASP A N   
766  C CA  . ASP A 97  ? 0.5874 0.4324 0.4180 0.1485  0.0383  -0.0996 97  ASP A CA  
767  C C   . ASP A 97  ? 0.6189 0.4096 0.4277 0.1393  0.0299  -0.0957 97  ASP A C   
768  O O   . ASP A 97  ? 0.6018 0.3778 0.4127 0.1243  0.0259  -0.0824 97  ASP A O   
769  C CB  . ASP A 97  ? 0.5701 0.4451 0.4056 0.1303  0.0477  -0.0987 97  ASP A CB  
770  C CG  . ASP A 97  ? 0.5806 0.5042 0.4301 0.1375  0.0599  -0.1080 97  ASP A CG  
771  O OD1 . ASP A 97  ? 0.5812 0.5266 0.4444 0.1568  0.0606  -0.1166 97  ASP A OD1 
772  O OD2 . ASP A 97  ? 0.6044 0.5449 0.4496 0.1231  0.0689  -0.1073 97  ASP A OD2 
773  N N   . GLU A 98  ? 0.6620 0.4261 0.4508 0.1465  0.0281  -0.1087 98  GLU A N   
774  C CA  . GLU A 98  ? 0.7120 0.4235 0.4792 0.1361  0.0209  -0.1096 98  GLU A CA  
775  C C   . GLU A 98  ? 0.7056 0.4178 0.4774 0.1069  0.0199  -0.1004 98  GLU A C   
776  O O   . GLU A 98  ? 0.6648 0.4137 0.4492 0.0969  0.0243  -0.0970 98  GLU A O   
777  C CB  . GLU A 98  ? 0.7611 0.4563 0.5094 0.1462  0.0206  -0.1281 98  GLU A CB  
778  C CG  . GLU A 98  ? 0.7538 0.4805 0.5036 0.1345  0.0264  -0.1335 98  GLU A CG  
779  C CD  . GLU A 98  ? 0.8084 0.5177 0.5365 0.1436  0.0254  -0.1528 98  GLU A CD  
780  O OE1 . GLU A 98  ? 0.8709 0.5372 0.5827 0.1562  0.0191  -0.1625 98  GLU A OE1 
781  O OE2 . GLU A 98  ? 0.7922 0.5282 0.5161 0.1391  0.0310  -0.1586 98  GLU A OE2 
782  N N   . GLY A 99  ? 0.7397 0.4108 0.5007 0.0935  0.0143  -0.0970 99  GLY A N   
783  C CA  . GLY A 99  ? 0.7105 0.3861 0.4786 0.0667  0.0126  -0.0921 99  GLY A CA  
784  C C   . GLY A 99  ? 0.6840 0.3797 0.4707 0.0544  0.0140  -0.0762 99  GLY A C   
785  O O   . GLY A 99  ? 0.6371 0.3518 0.4354 0.0365  0.0129  -0.0737 99  GLY A O   
786  N N   . CYS A 100 ? 0.6679 0.3605 0.4570 0.0657  0.0152  -0.0668 100 CYS A N   
787  C CA  . CYS A 100 ? 0.6456 0.3525 0.4486 0.0543  0.0161  -0.0530 100 CYS A CA  
788  C C   . CYS A 100 ? 0.6580 0.3257 0.4483 0.0374  0.0149  -0.0473 100 CYS A C   
789  O O   . CYS A 100 ? 0.6269 0.3092 0.4290 0.0224  0.0166  -0.0385 100 CYS A O   
790  C CB  . CYS A 100 ? 0.6428 0.3684 0.4539 0.0731  0.0174  -0.0462 100 CYS A CB  
791  S SG  . CYS A 100 ? 0.7039 0.3838 0.4896 0.0979  0.0129  -0.0474 100 CYS A SG  
792  N N   . LYS A 101 ? 0.6981 0.3156 0.4635 0.0387  0.0129  -0.0532 101 LYS A N   
793  C CA  . LYS A 101 ? 0.7317 0.3031 0.4788 0.0219  0.0139  -0.0466 101 LYS A CA  
794  C C   . LYS A 101 ? 0.7039 0.2908 0.4654 -0.0101 0.0166  -0.0481 101 LYS A C   
795  O O   . LYS A 101 ? 0.7104 0.2997 0.4756 -0.0250 0.0207  -0.0377 101 LYS A O   
796  C CB  . LYS A 101 ? 0.7925 0.3008 0.5073 0.0280  0.0110  -0.0546 101 LYS A CB  
797  N N   . LYS A 102 ? 0.6887 0.2883 0.4578 -0.0197 0.0139  -0.0625 102 LYS A N   
798  C CA  . LYS A 102 ? 0.6761 0.2968 0.4619 -0.0480 0.0144  -0.0682 102 LYS A CA  
799  C C   . LYS A 102 ? 0.6220 0.2964 0.4349 -0.0497 0.0151  -0.0605 102 LYS A C   
800  O O   . LYS A 102 ? 0.6221 0.3116 0.4480 -0.0700 0.0180  -0.0583 102 LYS A O   
801  C CB  . LYS A 102 ? 0.6872 0.3134 0.4744 -0.0542 0.0085  -0.0873 102 LYS A CB  
802  N N   . PRO A 103 ? 0.5830 0.2868 0.4046 -0.0294 0.0132  -0.0573 103 PRO A N   
803  C CA  . PRO A 103 ? 0.5469 0.2948 0.3916 -0.0317 0.0136  -0.0500 103 PRO A CA  
804  C C   . PRO A 103 ? 0.5454 0.2886 0.3914 -0.0364 0.0188  -0.0367 103 PRO A C   
805  O O   . PRO A 103 ? 0.5299 0.2975 0.3918 -0.0507 0.0202  -0.0347 103 PRO A O   
806  C CB  . PRO A 103 ? 0.5173 0.2865 0.3651 -0.0100 0.0130  -0.0479 103 PRO A CB  
807  C CG  . PRO A 103 ? 0.5382 0.2904 0.3706 -0.0029 0.0106  -0.0598 103 PRO A CG  
808  C CD  . PRO A 103 ? 0.5856 0.2917 0.3997 -0.0098 0.0107  -0.0645 103 PRO A CD  
809  N N   . LEU A 104 ? 0.5753 0.2866 0.4023 -0.0230 0.0208  -0.0291 104 LEU A N   
810  C CA  . LEU A 104 ? 0.5996 0.3031 0.4211 -0.0229 0.0245  -0.0157 104 LEU A CA  
811  C C   . LEU A 104 ? 0.6456 0.3199 0.4541 -0.0477 0.0301  -0.0126 104 LEU A C   
812  O O   . LEU A 104 ? 0.6418 0.3304 0.4559 -0.0584 0.0348  -0.0045 104 LEU A O   
813  C CB  . LEU A 104 ? 0.6091 0.2897 0.4126 0.0036  0.0226  -0.0096 104 LEU A CB  
814  C CG  . LEU A 104 ? 0.5691 0.2947 0.3936 0.0230  0.0204  -0.0109 104 LEU A CG  
815  C CD1 . LEU A 104 ? 0.5860 0.3028 0.4002 0.0493  0.0178  -0.0076 104 LEU A CD1 
816  C CD2 . LEU A 104 ? 0.5204 0.2885 0.3688 0.0137  0.0219  -0.0060 104 LEU A CD2 
817  N N   . GLU A 105 ? 0.6883 0.3233 0.4795 -0.0584 0.0305  -0.0202 105 GLU A N   
818  C CA  . GLU A 105 ? 0.7363 0.3447 0.5168 -0.0888 0.0378  -0.0202 105 GLU A CA  
819  C C   . GLU A 105 ? 0.7015 0.3631 0.5145 -0.1116 0.0404  -0.0277 105 GLU A C   
820  O O   . GLU A 105 ? 0.6979 0.3687 0.5140 -0.1290 0.0483  -0.0214 105 GLU A O   
821  C CB  . GLU A 105 ? 0.7780 0.3375 0.5374 -0.0972 0.0367  -0.0310 105 GLU A CB  
822  C CG  . GLU A 105 ? 0.8374 0.3313 0.5571 -0.0782 0.0355  -0.0223 105 GLU A CG  
823  C CD  . GLU A 105 ? 0.9022 0.3451 0.5995 -0.0784 0.0319  -0.0352 105 GLU A CD  
824  O OE1 . GLU A 105 ? 0.8902 0.3570 0.6049 -0.0824 0.0276  -0.0521 105 GLU A OE1 
825  O OE2 . GLU A 105 ? 0.9599 0.3350 0.6185 -0.0716 0.0322  -0.0287 105 GLU A OE2 
826  N N   . ARG A 106 ? 0.6712 0.3683 0.5067 -0.1092 0.0332  -0.0416 106 ARG A N   
827  C CA  . ARG A 106 ? 0.6352 0.3848 0.5020 -0.1248 0.0317  -0.0523 106 ARG A CA  
828  C C   . ARG A 106 ? 0.5799 0.3672 0.4636 -0.1208 0.0343  -0.0426 106 ARG A C   
829  O O   . ARG A 106 ? 0.5556 0.3706 0.4557 -0.1398 0.0392  -0.0465 106 ARG A O   
830  C CB  . ARG A 106 ? 0.6315 0.4078 0.5113 -0.1117 0.0206  -0.0650 106 ARG A CB  
831  C CG  . ARG A 106 ? 0.5942 0.4270 0.5044 -0.1165 0.0144  -0.0754 106 ARG A CG  
832  C CD  . ARG A 106 ? 0.6337 0.4812 0.5584 -0.1460 0.0179  -0.0890 106 ARG A CD  
833  N NE  . ARG A 106 ? 0.6809 0.4979 0.5932 -0.1601 0.0169  -0.1023 106 ARG A NE  
834  C CZ  . ARG A 106 ? 0.6940 0.5273 0.6136 -0.1581 0.0059  -0.1202 106 ARG A CZ  
835  N NH1 . ARG A 106 ? 0.6521 0.5286 0.5881 -0.1420 -0.0053 -0.1256 106 ARG A NH1 
836  N NH2 . ARG A 106 ? 0.7414 0.5448 0.6490 -0.1722 0.0055  -0.1333 106 ARG A NH2 
837  N N   . LEU A 107 ? 0.5481 0.3386 0.4287 -0.0961 0.0313  -0.0321 107 LEU A N   
838  C CA  . LEU A 107 ? 0.5114 0.3356 0.4069 -0.0888 0.0320  -0.0241 107 LEU A CA  
839  C C   . LEU A 107 ? 0.5236 0.3344 0.4079 -0.1018 0.0416  -0.0142 107 LEU A C   
840  O O   . LEU A 107 ? 0.4871 0.3310 0.3873 -0.1091 0.0447  -0.0139 107 LEU A O   
841  C CB  . LEU A 107 ? 0.5055 0.3292 0.3968 -0.0622 0.0279  -0.0163 107 LEU A CB  
842  C CG  . LEU A 107 ? 0.4962 0.3471 0.3988 -0.0511 0.0279  -0.0080 107 LEU A CG  
843  C CD1 . LEU A 107 ? 0.4954 0.3516 0.3990 -0.0291 0.0237  -0.0063 107 LEU A CD1 
844  C CD2 . LEU A 107 ? 0.5239 0.3555 0.4102 -0.0531 0.0340  0.0035  107 LEU A CD2 
845  N N   . LEU A 108 ? 0.5767 0.3358 0.4299 -0.1038 0.0464  -0.0061 108 LEU A N   
846  C CA  . LEU A 108 ? 0.6144 0.3516 0.4476 -0.1164 0.0562  0.0054  108 LEU A CA  
847  C C   . LEU A 108 ? 0.6240 0.3700 0.4646 -0.1507 0.0660  -0.0025 108 LEU A C   
848  O O   . LEU A 108 ? 0.6138 0.3759 0.4557 -0.1634 0.0746  0.0023  108 LEU A O   
849  C CB  . LEU A 108 ? 0.6829 0.3530 0.4739 -0.1074 0.0573  0.0169  108 LEU A CB  
850  C CG  . LEU A 108 ? 0.6830 0.3531 0.4676 -0.0732 0.0493  0.0255  108 LEU A CG  
851  C CD1 . LEU A 108 ? 0.7454 0.3503 0.4881 -0.0588 0.0475  0.0343  108 LEU A CD1 
852  C CD2 . LEU A 108 ? 0.6582 0.3638 0.4528 -0.0680 0.0508  0.0336  108 LEU A CD2 
853  N N   . ASN A 109 ? 0.6314 0.3682 0.4765 -0.1661 0.0650  -0.0162 109 ASN A N   
854  C CA  . ASN A 109 ? 0.6395 0.3939 0.4983 -0.2011 0.0741  -0.0287 109 ASN A CA  
855  C C   . ASN A 109 ? 0.5863 0.4142 0.4855 -0.2039 0.0725  -0.0391 109 ASN A C   
856  O O   . ASN A 109 ? 0.5917 0.4429 0.5006 -0.2275 0.0833  -0.0431 109 ASN A O   
857  C CB  . ASN A 109 ? 0.6515 0.3894 0.5119 -0.2139 0.0702  -0.0451 109 ASN A CB  
858  C CG  . ASN A 109 ? 0.7195 0.3784 0.5369 -0.2194 0.0748  -0.0372 109 ASN A CG  
859  O OD1 . ASN A 109 ? 0.7673 0.3827 0.5527 -0.2240 0.0840  -0.0207 109 ASN A OD1 
860  N ND2 . ASN A 109 ? 0.7382 0.3768 0.5525 -0.2184 0.0678  -0.0494 109 ASN A ND2 
861  N N   . ILE A 110 ? 0.5467 0.4085 0.4667 -0.1788 0.0594  -0.0433 110 ILE A N   
862  C CA  . ILE A 110 ? 0.5027 0.4275 0.4568 -0.1749 0.0551  -0.0522 110 ILE A CA  
863  C C   . ILE A 110 ? 0.5000 0.4367 0.4513 -0.1708 0.0623  -0.0395 110 ILE A C   
864  O O   . ILE A 110 ? 0.4832 0.4617 0.4546 -0.1833 0.0677  -0.0473 110 ILE A O   
865  C CB  . ILE A 110 ? 0.4767 0.4223 0.4452 -0.1492 0.0391  -0.0581 110 ILE A CB  
866  C CG1 . ILE A 110 ? 0.4840 0.4376 0.4626 -0.1577 0.0317  -0.0767 110 ILE A CG1 
867  C CG2 . ILE A 110 ? 0.4272 0.4215 0.4201 -0.1367 0.0337  -0.0608 110 ILE A CG2 
868  C CD1 . ILE A 110 ? 0.4731 0.4293 0.4517 -0.1333 0.0174  -0.0796 110 ILE A CD1 
869  N N   . TRP A 111 ? 0.5117 0.4145 0.4384 -0.1525 0.0619  -0.0220 111 TRP A N   
870  C CA  . TRP A 111 ? 0.5101 0.4180 0.4277 -0.1477 0.0681  -0.0094 111 TRP A CA  
871  C C   . TRP A 111 ? 0.5379 0.4401 0.4434 -0.1757 0.0838  -0.0073 111 TRP A C   
872  O O   . TRP A 111 ? 0.5079 0.4461 0.4250 -0.1812 0.0897  -0.0088 111 TRP A O   
873  C CB  . TRP A 111 ? 0.5210 0.3876 0.4096 -0.1258 0.0650  0.0072  111 TRP A CB  
874  C CG  . TRP A 111 ? 0.4788 0.3667 0.3834 -0.0991 0.0532  0.0062  111 TRP A CG  
875  C CD1 . TRP A 111 ? 0.4466 0.3710 0.3800 -0.0930 0.0447  -0.0055 111 TRP A CD1 
876  C CD2 . TRP A 111 ? 0.4809 0.3547 0.3726 -0.0748 0.0482  0.0168  111 TRP A CD2 
877  N NE1 . TRP A 111 ? 0.4265 0.3567 0.3637 -0.0706 0.0373  -0.0017 111 TRP A NE1 
878  C CE2 . TRP A 111 ? 0.4380 0.3428 0.3541 -0.0595 0.0392  0.0102  111 TRP A CE2 
879  C CE3 . TRP A 111 ? 0.5136 0.3527 0.3755 -0.0641 0.0497  0.0298  111 TRP A CE3 
880  C CZ2 . TRP A 111 ? 0.4252 0.3311 0.3401 -0.0380 0.0339  0.0150  111 TRP A CZ2 
881  C CZ3 . TRP A 111 ? 0.4936 0.3377 0.3564 -0.0388 0.0419  0.0333  111 TRP A CZ3 
882  C CH2 . TRP A 111 ? 0.4579 0.3374 0.3489 -0.0278 0.0352  0.0253  111 TRP A CH2 
883  N N   . GLN A 112 ? 0.5768 0.4319 0.4571 -0.1943 0.0913  -0.0043 112 GLN A N   
884  C CA  . GLN A 112 ? 0.6277 0.4679 0.4902 -0.2258 0.1088  -0.0011 112 GLN A CA  
885  C C   . GLN A 112 ? 0.6053 0.5067 0.5056 -0.2510 0.1157  -0.0213 112 GLN A C   
886  O O   . GLN A 112 ? 0.5897 0.5159 0.4916 -0.2669 0.1286  -0.0208 112 GLN A O   
887  C CB  . GLN A 112 ? 0.6999 0.4714 0.5272 -0.2423 0.1147  0.0040  112 GLN A CB  
888  C CG  . GLN A 112 ? 0.7808 0.5297 0.5846 -0.2800 0.1354  0.0083  112 GLN A CG  
889  C CD  . GLN A 112 ? 0.8739 0.5351 0.6173 -0.2801 0.1412  0.0302  112 GLN A CD  
890  O OE1 . GLN A 112 ? 0.9423 0.5813 0.6531 -0.2889 0.1534  0.0457  112 GLN A OE1 
891  N NE2 . GLN A 112 ? 0.8929 0.5023 0.6181 -0.2681 0.1317  0.0312  112 GLN A NE2 
892  N N   . GLU A 113 ? 0.5907 0.5176 0.5205 -0.2537 0.1067  -0.0403 113 GLU A N   
893  C CA  . GLU A 113 ? 0.5769 0.5666 0.5461 -0.2751 0.1101  -0.0638 113 GLU A CA  
894  C C   . GLU A 113 ? 0.5195 0.5719 0.5179 -0.2600 0.1063  -0.0698 113 GLU A C   
895  O O   . GLU A 113 ? 0.5105 0.6110 0.5314 -0.2793 0.1159  -0.0836 113 GLU A O   
896  C CB  . GLU A 113 ? 0.5716 0.5770 0.5648 -0.2729 0.0963  -0.0835 113 GLU A CB  
897  C CG  . GLU A 113 ? 0.6279 0.5899 0.6040 -0.3009 0.1034  -0.0886 113 GLU A CG  
898  C CD  . GLU A 113 ? 0.6195 0.5886 0.6116 -0.2921 0.0870  -0.1057 113 GLU A CD  
899  O OE1 . GLU A 113 ? 0.5920 0.5983 0.6060 -0.2649 0.0707  -0.1123 113 GLU A OE1 
900  O OE2 . GLU A 113 ? 0.6780 0.6111 0.6570 -0.3116 0.0899  -0.1122 113 GLU A OE2 
901  N N   . ARG A 114 ? 0.4816 0.5329 0.4792 -0.2262 0.0929  -0.0607 114 ARG A N   
902  C CA  . ARG A 114 ? 0.4450 0.5480 0.4669 -0.2092 0.0875  -0.0662 114 ARG A CA  
903  C C   . ARG A 114 ? 0.4553 0.5465 0.4551 -0.2046 0.0966  -0.0493 114 ARG A C   
904  O O   . ARG A 114 ? 0.4255 0.5499 0.4399 -0.1869 0.0910  -0.0516 114 ARG A O   
905  C CB  . ARG A 114 ? 0.4118 0.5229 0.4472 -0.1769 0.0671  -0.0687 114 ARG A CB  
906  C CG  . ARG A 114 ? 0.4137 0.5480 0.4727 -0.1772 0.0555  -0.0881 114 ARG A CG  
907  C CD  . ARG A 114 ? 0.4105 0.5370 0.4701 -0.1474 0.0375  -0.0860 114 ARG A CD  
908  N NE  . ARG A 114 ? 0.4368 0.5649 0.5036 -0.1481 0.0272  -0.0993 114 ARG A NE  
909  C CZ  . ARG A 114 ? 0.4513 0.5682 0.5133 -0.1263 0.0128  -0.0986 114 ARG A CZ  
910  N NH1 . ARG A 114 ? 0.4670 0.5708 0.5194 -0.1039 0.0078  -0.0853 114 ARG A NH1 
911  N NH2 . ARG A 114 ? 0.4713 0.5899 0.5367 -0.1281 0.0038  -0.1116 114 ARG A NH2 
912  N N   . SER A 115 ? 0.5087 0.5506 0.4705 -0.2195 0.1099  -0.0328 115 SER A N   
913  C CA  . SER A 115 ? 0.5232 0.5518 0.4581 -0.2141 0.1180  -0.0161 115 SER A CA  
914  C C   . SER A 115 ? 0.4812 0.5119 0.4167 -0.1782 0.1031  -0.0082 115 SER A C   
915  O O   . SER A 115 ? 0.4664 0.5204 0.4023 -0.1694 0.1046  -0.0059 115 SER A O   
916  C CB  . SER A 115 ? 0.5225 0.6009 0.4718 -0.2346 0.1327  -0.0264 115 SER A CB  
917  O OG  . SER A 115 ? 0.5663 0.6414 0.5132 -0.2713 0.1488  -0.0335 115 SER A OG  
918  N N   . VAL A 116 ? 0.4660 0.4733 0.4013 -0.1590 0.0897  -0.0052 116 VAL A N   
919  C CA  . VAL A 116 ? 0.4386 0.4467 0.3754 -0.1288 0.0770  0.0009  116 VAL A CA  
920  C C   . VAL A 116 ? 0.4667 0.4426 0.3673 -0.1215 0.0818  0.0188  116 VAL A C   
921  O O   . VAL A 116 ? 0.4372 0.4325 0.3405 -0.1059 0.0777  0.0210  116 VAL A O   
922  C CB  . VAL A 116 ? 0.4233 0.4116 0.3643 -0.1135 0.0647  0.0001  116 VAL A CB  
923  C CG1 . VAL A 116 ? 0.3930 0.3791 0.3329 -0.0867 0.0548  0.0067  116 VAL A CG1 
924  C CG2 . VAL A 116 ? 0.3996 0.4208 0.3723 -0.1168 0.0577  -0.0172 116 VAL A CG2 
925  N N   . TYR A 117 ? 0.5121 0.4370 0.3771 -0.1325 0.0895  0.0306  117 TYR A N   
926  C CA  . TYR A 117 ? 0.5661 0.4523 0.3878 -0.1288 0.0952  0.0482  117 TYR A CA  
927  C C   . TYR A 117 ? 0.6308 0.4818 0.4232 -0.1599 0.1119  0.0540  117 TYR A C   
928  O O   . TYR A 117 ? 0.6181 0.4730 0.4266 -0.1810 0.1166  0.0433  117 TYR A O   
929  C CB  . TYR A 117 ? 0.5906 0.4316 0.3888 -0.1039 0.0840  0.0589  117 TYR A CB  
930  C CG  . TYR A 117 ? 0.5416 0.4120 0.3618 -0.0754 0.0700  0.0552  117 TYR A CG  
931  C CD1 . TYR A 117 ? 0.5411 0.4280 0.3546 -0.0611 0.0671  0.0598  117 TYR A CD1 
932  C CD2 . TYR A 117 ? 0.5168 0.3988 0.3633 -0.0641 0.0601  0.0462  117 TYR A CD2 
933  C CE1 . TYR A 117 ? 0.5022 0.4181 0.3386 -0.0376 0.0546  0.0542  117 TYR A CE1 
934  C CE2 . TYR A 117 ? 0.4778 0.3864 0.3443 -0.0418 0.0494  0.0423  117 TYR A CE2 
935  C CZ  . TYR A 117 ? 0.4702 0.3960 0.3330 -0.0295 0.0467  0.0458  117 TYR A CZ  
936  O OH  . TYR A 117 ? 0.4408 0.3935 0.3251 -0.0108 0.0368  0.0400  117 TYR A OH  
937  N N   . GLY A 118 ? 0.6964 0.5098 0.4433 -0.1627 0.1203  0.0707  118 GLY A N   
938  C CA  . GLY A 118 ? 0.7651 0.5328 0.4740 -0.1937 0.1380  0.0795  118 GLY A CA  
939  C C   . GLY A 118 ? 0.8219 0.5248 0.5065 -0.1966 0.1353  0.0848  118 GLY A C   
940  O O   . GLY A 118 ? 0.8209 0.5020 0.5022 -0.1677 0.1197  0.0877  118 GLY A O   
941  N N   . GLY A 119 ? 0.8727 0.5460 0.5407 -0.2326 0.1514  0.0844  119 GLY A N   
942  C CA  . GLY A 119 ? 0.9295 0.5371 0.5733 -0.2404 0.1504  0.0869  119 GLY A CA  
943  C C   . GLY A 119 ? 0.9889 0.5161 0.5739 -0.2162 0.1431  0.1081  119 GLY A C   
944  O O   . GLY A 119 ? 1.0022 0.4843 0.5751 -0.2031 0.1332  0.1080  119 GLY A O   
945  N N   . GLU A 120 ? 1.0254 0.5362 0.5725 -0.2094 0.1478  0.1250  120 GLU A N   
946  C CA  A GLU A 120 ? 1.0774 0.5208 0.5688 -0.1780 0.1370  0.1445  120 GLU A CA  
947  C CA  B GLU A 120 ? 1.0893 0.5368 0.5821 -0.1772 0.1369  0.1444  120 GLU A CA  
948  C C   . GLU A 120 ? 1.0357 0.4993 0.5537 -0.1335 0.1132  0.1376  120 GLU A C   
949  O O   . GLU A 120 ? 1.0584 0.4720 0.5583 -0.1174 0.1033  0.1389  120 GLU A O   
950  C CB  A GLU A 120 ? 1.1063 0.5433 0.5574 -0.1747 0.1438  0.1614  120 GLU A CB  
951  C CB  B GLU A 120 ? 1.1212 0.5793 0.5855 -0.1722 0.1425  0.1581  120 GLU A CB  
952  C CG  A GLU A 120 ? 1.1729 0.5688 0.5784 -0.2173 0.1691  0.1734  120 GLU A CG  
953  C CG  B GLU A 120 ? 1.0473 0.6012 0.5661 -0.1698 0.1424  0.1443  120 GLU A CG  
954  C CD  A GLU A 120 ? 1.1264 0.5984 0.5663 -0.2468 0.1870  0.1630  120 GLU A CD  
955  C CD  B GLU A 120 ? 1.0475 0.6427 0.5837 -0.2119 0.1650  0.1364  120 GLU A CD  
956  O OE1 A GLU A 120 ? 1.0241 0.5785 0.5310 -0.2424 0.1810  0.1424  120 GLU A OE1 
957  O OE1 B GLU A 120 ? 0.9992 0.6708 0.5808 -0.2094 0.1642  0.1227  120 GLU A OE1 
958  O OE2 A GLU A 120 ? 1.1667 0.6140 0.5641 -0.2751 0.2077  0.1751  120 GLU A OE2 
959  O OE2 B GLU A 120 ? 1.1011 0.6546 0.6070 -0.2476 0.1836  0.1421  120 GLU A OE2 
960  N N   . PHE A 121 ? 0.9525 0.4882 0.5133 -0.1156 0.1049  0.1288  121 PHE A N   
961  C CA  . PHE A 121 ? 0.8951 0.4584 0.4849 -0.0791 0.0855  0.1209  121 PHE A CA  
962  C C   . PHE A 121 ? 0.8680 0.4358 0.4898 -0.0813 0.0806  0.1064  121 PHE A C   
963  O O   . PHE A 121 ? 0.8735 0.4277 0.4958 -0.0537 0.0673  0.1039  121 PHE A O   
964  C CB  . PHE A 121 ? 0.8164 0.4579 0.4488 -0.0696 0.0815  0.1122  121 PHE A CB  
965  C CG  . PHE A 121 ? 0.7619 0.4339 0.4224 -0.0352 0.0637  0.1044  121 PHE A CG  
966  C CD1 . PHE A 121 ? 0.7874 0.4344 0.4197 -0.0028 0.0513  0.1126  121 PHE A CD1 
967  C CD2 . PHE A 121 ? 0.6923 0.4186 0.4063 -0.0354 0.0595  0.0883  121 PHE A CD2 
968  C CE1 . PHE A 121 ? 0.7330 0.4151 0.3952 0.0256  0.0368  0.1027  121 PHE A CE1 
969  C CE2 . PHE A 121 ? 0.6424 0.3957 0.3805 -0.0082 0.0461  0.0812  121 PHE A CE2 
970  C CZ  . PHE A 121 ? 0.6709 0.4048 0.3854 0.0207  0.0356  0.0876  121 PHE A CZ  
971  N N   . ILE A 122 ? 0.8409 0.4292 0.4880 -0.1135 0.0913  0.0956  122 ILE A N   
972  C CA  . ILE A 122 ? 0.8194 0.4087 0.4912 -0.1173 0.0867  0.0816  122 ILE A CA  
973  C C   . ILE A 122 ? 0.8822 0.3907 0.5099 -0.1125 0.0844  0.0884  122 ILE A C   
974  O O   . ILE A 122 ? 0.8608 0.3612 0.4985 -0.0963 0.0743  0.0798  122 ILE A O   
975  C CB  . ILE A 122 ? 0.7970 0.4249 0.5024 -0.1528 0.0974  0.0671  122 ILE A CB  
976  C CG1 . ILE A 122 ? 0.7450 0.4507 0.4931 -0.1525 0.0974  0.0586  122 ILE A CG1 
977  C CG2 . ILE A 122 ? 0.7780 0.4053 0.5049 -0.1546 0.0908  0.0521  122 ILE A CG2 
978  C CD1 . ILE A 122 ? 0.6813 0.4343 0.4721 -0.1329 0.0839  0.0455  122 ILE A CD1 
979  N N   . GLN A 123 ? 0.9525 0.3984 0.5279 -0.1247 0.0935  0.1041  123 GLN A N   
980  C CA  . GLN A 123 ? 1.0358 0.3956 0.5631 -0.1194 0.0908  0.1111  123 GLN A CA  
981  C C   . GLN A 123 ? 1.0574 0.3930 0.5644 -0.0712 0.0724  0.1171  123 GLN A C   
982  O O   . GLN A 123 ? 1.0948 0.3890 0.5883 -0.0552 0.0637  0.1126  123 GLN A O   
983  C CB  . GLN A 123 ? 1.1212 0.4131 0.5930 -0.1497 0.1072  0.1269  123 GLN A CB  
984  C CG  . GLN A 123 ? 1.1924 0.4055 0.6308 -0.1668 0.1108  0.1257  123 GLN A CG  
985  N N   . GLN A 124 ? 1.0497 0.4163 0.5574 -0.0476 0.0660  0.1244  124 GLN A N   
986  C CA  . GLN A 124 ? 1.0581 0.4178 0.5554 -0.0007 0.0475  0.1259  124 GLN A CA  
987  C C   . GLN A 124 ? 0.9789 0.3873 0.5263 0.0161  0.0377  0.1071  124 GLN A C   
988  O O   . GLN A 124 ? 0.9841 0.3686 0.5212 0.0457  0.0257  0.1029  124 GLN A O   
989  C CB  . GLN A 124 ? 1.0469 0.4454 0.5452 0.0182  0.0424  0.1330  124 GLN A CB  
990  C CG  . GLN A 124 ? 1.1362 0.4913 0.5800 0.0074  0.0509  0.1529  124 GLN A CG  
991  C CD  . GLN A 124 ? 1.1215 0.5252 0.5729 0.0278  0.0440  0.1558  124 GLN A CD  
992  O OE1 . GLN A 124 ? 1.1051 0.5459 0.5811 0.0611  0.0281  0.1470  124 GLN A OE1 
993  N NE2 . GLN A 124 ? 1.1496 0.5585 0.5831 0.0064  0.0566  0.1657  124 GLN A NE2 
994  N N   . LEU A 125 ? 0.9021 0.3783 0.5014 -0.0019 0.0429  0.0956  125 LEU A N   
995  C CA  . LEU A 125 ? 0.8612 0.3824 0.5051 0.0080  0.0364  0.0788  125 LEU A CA  
996  C C   . LEU A 125 ? 0.8879 0.3658 0.5209 0.0031  0.0360  0.0711  125 LEU A C   
997  O O   . LEU A 125 ? 0.8734 0.3533 0.5140 0.0277  0.0266  0.0620  125 LEU A O   
998  C CB  . LEU A 125 ? 0.7990 0.3898 0.4919 -0.0129 0.0422  0.0695  125 LEU A CB  
999  C CG  . LEU A 125 ? 0.7631 0.4035 0.4735 -0.0066 0.0414  0.0730  125 LEU A CG  
1000 C CD1 . LEU A 125 ? 0.7098 0.4107 0.4644 -0.0260 0.0462  0.0629  125 LEU A CD1 
1001 C CD2 . LEU A 125 ? 0.7520 0.4121 0.4703 0.0288  0.0287  0.0708  125 LEU A CD2 
1002 N N   . LYS A 126 ? 0.9310 0.3732 0.5475 -0.0297 0.0468  0.0728  126 LYS A N   
1003 C CA  . LYS A 126 ? 0.9814 0.3762 0.5837 -0.0378 0.0467  0.0645  126 LYS A CA  
1004 C C   . LYS A 126 ? 1.0429 0.3729 0.6012 -0.0057 0.0367  0.0707  126 LYS A C   
1005 O O   . LYS A 126 ? 1.0481 0.3761 0.6133 0.0169  0.0275  0.0595  126 LYS A O   
1006 C CB  . LYS A 126 ? 1.0309 0.3915 0.6170 -0.0811 0.0611  0.0659  126 LYS A CB  
1007 C CG  . LYS A 126 ? 0.9748 0.3891 0.6069 -0.1092 0.0662  0.0484  126 LYS A CG  
1008 N N   . LEU A 127 ? 1.1136 0.3926 0.6254 -0.0018 0.0381  0.0883  127 LEU A N   
1009 C CA  . LEU A 127 ? 1.1806 0.3906 0.6432 0.0320  0.0266  0.0955  127 LEU A CA  
1010 C C   . LEU A 127 ? 1.1387 0.3931 0.6267 0.0768  0.0107  0.0852  127 LEU A C   
1011 O O   . LEU A 127 ? 1.1620 0.3808 0.6329 0.1041  0.0004  0.0781  127 LEU A O   
1012 C CB  . LEU A 127 ? 1.2429 0.3990 0.6502 0.0324  0.0294  0.1179  127 LEU A CB  
1013 N N   . SER A 128 ? 1.0690 0.4030 0.5999 0.0832  0.0094  0.0821  128 SER A N   
1014 C CA  . SER A 128 ? 1.0357 0.4111 0.5879 0.1233  -0.0040 0.0726  128 SER A CA  
1015 C C   . SER A 128 ? 1.0396 0.4336 0.6195 0.1312  -0.0068 0.0534  128 SER A C   
1016 O O   . SER A 128 ? 1.0324 0.4388 0.6175 0.1657  -0.0174 0.0436  128 SER A O   
1017 C CB  . SER A 128 ? 0.9526 0.4038 0.5415 0.1265  -0.0045 0.0729  128 SER A CB  
1018 O OG  . SER A 128 ? 0.8810 0.3994 0.5233 0.1183  -0.0015 0.0586  128 SER A OG  
1019 N N   . MET A 129 ? 1.0530 0.4470 0.6472 0.1002  0.0025  0.0472  129 MET A N   
1020 C CA  . MET A 129 ? 1.0729 0.4728 0.6830 0.1057  0.0003  0.0298  129 MET A CA  
1021 C C   . MET A 129 ? 1.1806 0.4984 0.7457 0.1155  -0.0041 0.0279  129 MET A C   
1022 O O   . MET A 129 ? 1.2135 0.5300 0.7814 0.1392  -0.0110 0.0138  129 MET A O   
1023 C CB  . MET A 129 ? 1.0340 0.4699 0.6767 0.0714  0.0096  0.0224  129 MET A CB  
1024 C CG  . MET A 129 ? 0.9645 0.4742 0.6480 0.0620  0.0134  0.0240  129 MET A CG  
1025 S SD  . MET A 129 ? 0.9558 0.5106 0.6769 0.0293  0.0205  0.0134  129 MET A SD  
1026 C CE  . MET A 129 ? 0.9729 0.4709 0.6667 -0.0055 0.0283  0.0167  129 MET A CE  
1027 N N   . GLU A 130 ? 1.2747 0.5229 0.7967 0.0969  0.0003  0.0416  130 GLU A N   
1028 C CA  . GLU A 130 ? 1.3811 0.5378 0.8536 0.1013  -0.0029 0.0410  130 GLU A CA  
1029 C C   . GLU A 130 ? 1.4323 0.5716 0.8912 0.1499  -0.0182 0.0310  130 GLU A C   
1030 O O   . GLU A 130 ? 1.4499 0.5865 0.9174 0.1576  -0.0212 0.0135  130 GLU A O   
1031 C CB  . GLU A 130 ? 1.4459 0.5261 0.8637 0.0856  0.0020  0.0621  130 GLU A CB  
1032 N N   . ASP A 131 ? 1.4777 0.6091 0.9162 0.1839  -0.0285 0.0402  131 ASP A N   
1033 C CA  . ASP A 131 ? 1.4920 0.6220 0.9244 0.2346  -0.0445 0.0277  131 ASP A CA  
1034 C C   . ASP A 131 ? 1.3938 0.6270 0.8887 0.2479  -0.0452 0.0104  131 ASP A C   
1035 O O   . ASP A 131 ? 1.2927 0.5886 0.8165 0.2494  -0.0445 0.0148  131 ASP A O   
1036 C CB  . ASP A 131 ? 1.5396 0.6312 0.9297 0.2679  -0.0571 0.0420  131 ASP A CB  
1037 N N   . SER B 3   ? 0.5100 0.5437 0.5698 -0.2178 0.0186  -0.1574 3   SER B N   
1038 C CA  . SER B 3   ? 0.4617 0.5411 0.5309 -0.2085 0.0157  -0.1716 3   SER B CA  
1039 C C   . SER B 3   ? 0.3887 0.5196 0.4686 -0.1971 0.0219  -0.1588 3   SER B C   
1040 O O   . SER B 3   ? 0.3630 0.4983 0.4444 -0.2024 0.0275  -0.1433 3   SER B O   
1041 C CB  . SER B 3   ? 0.4995 0.5978 0.5746 -0.2339 0.0110  -0.1870 3   SER B CB  
1042 O OG  . SER B 3   ? 0.5844 0.6315 0.6496 -0.2576 0.0077  -0.1897 3   SER B OG  
1043 N N   . PHE B 4   ? 0.3388 0.5064 0.4242 -0.1800 0.0206  -0.1653 4   PHE B N   
1044 C CA  . PHE B 4   ? 0.2908 0.5047 0.3837 -0.1669 0.0251  -0.1555 4   PHE B CA  
1045 C C   . PHE B 4   ? 0.2802 0.5482 0.3849 -0.1831 0.0259  -0.1590 4   PHE B C   
1046 O O   . PHE B 4   ? 0.2880 0.5703 0.3970 -0.1982 0.0213  -0.1737 4   PHE B O   
1047 C CB  . PHE B 4   ? 0.2727 0.5021 0.3647 -0.1430 0.0230  -0.1596 4   PHE B CB  
1048 C CG  . PHE B 4   ? 0.2407 0.5102 0.3368 -0.1280 0.0266  -0.1495 4   PHE B CG  
1049 C CD1 . PHE B 4   ? 0.2338 0.4889 0.3246 -0.1142 0.0302  -0.1352 4   PHE B CD1 
1050 C CD2 . PHE B 4   ? 0.2343 0.5557 0.3382 -0.1277 0.0258  -0.1551 4   PHE B CD2 
1051 C CE1 . PHE B 4   ? 0.2231 0.5085 0.3145 -0.0998 0.0328  -0.1264 4   PHE B CE1 
1052 C CE2 . PHE B 4   ? 0.2177 0.5726 0.3226 -0.1115 0.0289  -0.1452 4   PHE B CE2 
1053 C CZ  . PHE B 4   ? 0.2063 0.5405 0.3041 -0.0974 0.0322  -0.1312 4   PHE B CZ  
1054 N N   . SER B 5   ? 0.2589 0.5577 0.3679 -0.1788 0.0314  -0.1460 5   SER B N   
1055 C CA  . SER B 5   ? 0.2511 0.6139 0.3709 -0.1832 0.0328  -0.1473 5   SER B CA  
1056 C C   . SER B 5   ? 0.2334 0.6198 0.3512 -0.1583 0.0376  -0.1341 5   SER B C   
1057 O O   . SER B 5   ? 0.2155 0.5711 0.3256 -0.1482 0.0406  -0.1229 5   SER B O   
1058 C CB  . SER B 5   ? 0.2673 0.6473 0.3945 -0.2145 0.0344  -0.1466 5   SER B CB  
1059 O OG  . SER B 5   ? 0.2642 0.6284 0.3877 -0.2166 0.0402  -0.1306 5   SER B OG  
1060 N N   . GLU B 6   ? 0.2341 0.6750 0.3575 -0.1473 0.0375  -0.1363 6   GLU B N   
1061 C CA  . GLU B 6   ? 0.2162 0.6796 0.3351 -0.1221 0.0412  -0.1249 6   GLU B CA  
1062 C C   . GLU B 6   ? 0.2195 0.6927 0.3391 -0.1290 0.0468  -0.1144 6   GLU B C   
1063 O O   . GLU B 6   ? 0.2083 0.6648 0.3186 -0.1109 0.0495  -0.1045 6   GLU B O   
1064 C CB  . GLU B 6   ? 0.2087 0.7299 0.3316 -0.1073 0.0397  -0.1294 6   GLU B CB  
1065 C CG  . GLU B 6   ? 0.2113 0.7252 0.3321 -0.0985 0.0346  -0.1380 6   GLU B CG  
1066 C CD  . GLU B 6   ? 0.2062 0.7738 0.3275 -0.0786 0.0332  -0.1392 6   GLU B CD  
1067 O OE1 . GLU B 6   ? 0.1980 0.8055 0.3199 -0.0680 0.0360  -0.1333 6   GLU B OE1 
1068 O OE2 . GLU B 6   ? 0.2038 0.7747 0.3236 -0.0718 0.0293  -0.1456 6   GLU B OE2 
1069 N N   . SER B 7   ? 0.2397 0.7390 0.3691 -0.1563 0.0482  -0.1164 7   SER B N   
1070 C CA  . SER B 7   ? 0.2490 0.7615 0.3791 -0.1650 0.0541  -0.1048 7   SER B CA  
1071 C C   . SER B 7   ? 0.2478 0.6991 0.3677 -0.1665 0.0563  -0.0952 7   SER B C   
1072 O O   . SER B 7   ? 0.2253 0.6803 0.3393 -0.1544 0.0607  -0.0845 7   SER B O   
1073 C CB  . SER B 7   ? 0.2790 0.8337 0.4224 -0.1988 0.0553  -0.1071 7   SER B CB  
1074 O OG  . SER B 7   ? 0.3242 0.8421 0.4696 -0.2243 0.0504  -0.1171 7   SER B OG  
1075 N N   . ALA B 8   ? 0.2602 0.6576 0.3766 -0.1789 0.0529  -0.0996 8   ALA B N   
1076 C CA  . ALA B 8   ? 0.2668 0.6070 0.3722 -0.1761 0.0543  -0.0907 8   ALA B CA  
1077 C C   . ALA B 8   ? 0.2526 0.5780 0.3484 -0.1444 0.0543  -0.0864 8   ALA B C   
1078 O O   . ALA B 8   ? 0.2473 0.5569 0.3352 -0.1357 0.0574  -0.0761 8   ALA B O   
1079 C CB  . ALA B 8   ? 0.2867 0.5737 0.3883 -0.1897 0.0497  -0.0978 8   ALA B CB  
1080 N N   . LEU B 9   ? 0.2429 0.5745 0.3386 -0.1280 0.0505  -0.0939 9   LEU B N   
1081 C CA  . LEU B 9   ? 0.2322 0.5506 0.3183 -0.1011 0.0499  -0.0892 9   LEU B CA  
1082 C C   . LEU B 9   ? 0.2379 0.5854 0.3199 -0.0868 0.0537  -0.0814 9   LEU B C   
1083 O O   . LEU B 9   ? 0.2411 0.5643 0.3126 -0.0738 0.0547  -0.0745 9   LEU B O   
1084 C CB  . LEU B 9   ? 0.2230 0.5485 0.3092 -0.0873 0.0457  -0.0963 9   LEU B CB  
1085 C CG  . LEU B 9   ? 0.2223 0.5298 0.2971 -0.0624 0.0443  -0.0903 9   LEU B CG  
1086 C CD1 . LEU B 9   ? 0.2282 0.4877 0.2947 -0.0611 0.0440  -0.0847 9   LEU B CD1 
1087 C CD2 . LEU B 9   ? 0.2287 0.5411 0.3033 -0.0528 0.0404  -0.0951 9   LEU B CD2 
1088 N N   . GLU B 10  ? 0.2547 0.6563 0.3442 -0.0882 0.0555  -0.0835 10  GLU B N   
1089 C CA  . GLU B 10  ? 0.2645 0.7025 0.3497 -0.0721 0.0592  -0.0775 10  GLU B CA  
1090 C C   . GLU B 10  ? 0.2721 0.6977 0.3525 -0.0778 0.0636  -0.0684 10  GLU B C   
1091 O O   . GLU B 10  ? 0.2628 0.6843 0.3314 -0.0564 0.0647  -0.0638 10  GLU B O   
1092 C CB  . GLU B 10  ? 0.2842 0.7913 0.3807 -0.0772 0.0609  -0.0813 10  GLU B CB  
1093 C CG  . GLU B 10  ? 0.3016 0.8302 0.3984 -0.0601 0.0567  -0.0883 10  GLU B CG  
1094 C CD  . GLU B 10  ? 0.3179 0.9144 0.4286 -0.0707 0.0570  -0.0945 10  GLU B CD  
1095 O OE1 . GLU B 10  ? 0.3184 0.9503 0.4387 -0.0908 0.0607  -0.0927 10  GLU B OE1 
1096 O OE2 . GLU B 10  ? 0.3525 0.9686 0.4644 -0.0600 0.0534  -0.1008 10  GLU B OE2 
1097 N N   . LYS B 11  ? 0.2888 0.7069 0.3765 -0.1061 0.0659  -0.0658 11  LYS B N   
1098 C CA  . LYS B 11  ? 0.3100 0.7164 0.3924 -0.1129 0.0704  -0.0551 11  LYS B CA  
1099 C C   . LYS B 11  ? 0.3069 0.6564 0.3758 -0.0986 0.0683  -0.0520 11  LYS B C   
1100 O O   . LYS B 11  ? 0.3008 0.6485 0.3600 -0.0857 0.0706  -0.0455 11  LYS B O   
1101 C CB  . LYS B 11  ? 0.3393 0.7432 0.4299 -0.1477 0.0729  -0.0507 11  LYS B CB  
1102 C CG  . LYS B 11  ? 0.3736 0.7840 0.4591 -0.1537 0.0791  -0.0367 11  LYS B CG  
1103 C CD  . LYS B 11  ? 0.4233 0.8121 0.5120 -0.1878 0.0810  -0.0293 11  LYS B CD  
1104 N N   . LYS B 12  ? 0.3213 0.6285 0.3895 -0.1006 0.0636  -0.0574 12  LYS B N   
1105 C CA  . LYS B 12  ? 0.3168 0.5752 0.3738 -0.0888 0.0611  -0.0547 12  LYS B CA  
1106 C C   . LYS B 12  ? 0.3090 0.5686 0.3557 -0.0621 0.0593  -0.0550 12  LYS B C   
1107 O O   . LYS B 12  ? 0.3106 0.5493 0.3468 -0.0531 0.0593  -0.0502 12  LYS B O   
1108 C CB  . LYS B 12  ? 0.3342 0.5569 0.3927 -0.0936 0.0564  -0.0611 12  LYS B CB  
1109 C CG  . LYS B 12  ? 0.3619 0.5647 0.4243 -0.1167 0.0569  -0.0609 12  LYS B CG  
1110 C CD  . LYS B 12  ? 0.3913 0.5732 0.4566 -0.1195 0.0518  -0.0714 12  LYS B CD  
1111 C CE  . LYS B 12  ? 0.4199 0.5844 0.4880 -0.1436 0.0513  -0.0742 12  LYS B CE  
1112 N NZ  . LYS B 12  ? 0.4635 0.5808 0.5214 -0.1458 0.0515  -0.0671 12  LYS B NZ  
1113 N N   . LEU B 13  ? 0.2949 0.5778 0.3430 -0.0498 0.0572  -0.0605 13  LEU B N   
1114 C CA  . LEU B 13  ? 0.2882 0.5687 0.3237 -0.0242 0.0548  -0.0606 13  LEU B CA  
1115 C C   . LEU B 13  ? 0.2990 0.6026 0.3263 -0.0120 0.0582  -0.0568 13  LEU B C   
1116 O O   . LEU B 13  ? 0.3003 0.5823 0.3127 0.0058  0.0558  -0.0562 13  LEU B O   
1117 C CB  . LEU B 13  ? 0.2823 0.5842 0.3196 -0.0130 0.0522  -0.0656 13  LEU B CB  
1118 C CG  . LEU B 13  ? 0.2700 0.5482 0.3111 -0.0182 0.0481  -0.0692 13  LEU B CG  
1119 C CD1 . LEU B 13  ? 0.2736 0.5852 0.3184 -0.0099 0.0466  -0.0733 13  LEU B CD1 
1120 C CD2 . LEU B 13  ? 0.2671 0.4996 0.2965 -0.0088 0.0439  -0.0666 13  LEU B CD2 
1121 N N   . SER B 14  ? 0.3103 0.6586 0.3465 -0.0222 0.0635  -0.0546 14  SER B N   
1122 C CA  . SER B 14  ? 0.3251 0.7035 0.3539 -0.0107 0.0676  -0.0504 14  SER B CA  
1123 C C   . SER B 14  ? 0.3403 0.6905 0.3621 -0.0165 0.0694  -0.0437 14  SER B C   
1124 O O   . SER B 14  ? 0.3306 0.6980 0.3426 -0.0035 0.0719  -0.0408 14  SER B O   
1125 C CB  . SER B 14  ? 0.3215 0.7626 0.3631 -0.0230 0.0732  -0.0481 14  SER B CB  
1126 O OG  . SER B 14  ? 0.3287 0.7639 0.3807 -0.0540 0.0766  -0.0421 14  SER B OG  
1127 N N   . GLU B 15  ? 0.3573 0.6672 0.3830 -0.0343 0.0681  -0.0414 15  GLU B N   
1128 C CA  . GLU B 15  ? 0.3822 0.6638 0.4001 -0.0385 0.0693  -0.0343 15  GLU B CA  
1129 C C   . GLU B 15  ? 0.3822 0.6183 0.3873 -0.0231 0.0633  -0.0376 15  GLU B C   
1130 O O   . GLU B 15  ? 0.3843 0.5988 0.3818 -0.0231 0.0632  -0.0330 15  GLU B O   
1131 C CB  . GLU B 15  ? 0.3993 0.6664 0.4266 -0.0663 0.0719  -0.0281 15  GLU B CB  
1132 C CG  . GLU B 15  ? 0.4481 0.7603 0.4841 -0.0838 0.0784  -0.0213 15  GLU B CG  
1133 C CD  . GLU B 15  ? 0.4968 0.7985 0.5436 -0.1143 0.0795  -0.0186 15  GLU B CD  
1134 O OE1 . GLU B 15  ? 0.5165 0.7771 0.5646 -0.1200 0.0749  -0.0241 15  GLU B OE1 
1135 O OE2 . GLU B 15  ? 0.5696 0.9074 0.6232 -0.1330 0.0848  -0.0113 15  GLU B OE2 
1136 N N   . LEU B 16  ? 0.3671 0.5921 0.3693 -0.0103 0.0581  -0.0449 16  LEU B N   
1137 C CA  . LEU B 16  ? 0.3692 0.5565 0.3583 0.0028  0.0520  -0.0478 16  LEU B CA  
1138 C C   . LEU B 16  ? 0.3855 0.5754 0.3588 0.0187  0.0520  -0.0474 16  LEU B C   
1139 O O   . LEU B 16  ? 0.3905 0.6142 0.3603 0.0287  0.0553  -0.0476 16  LEU B O   
1140 C CB  . LEU B 16  ? 0.3528 0.5324 0.3388 0.0146  0.0469  -0.0538 16  LEU B CB  
1141 C CG  . LEU B 16  ? 0.3464 0.5188 0.3451 0.0018  0.0455  -0.0552 16  LEU B CG  
1142 C CD1 . LEU B 16  ? 0.3549 0.5304 0.3498 0.0147  0.0419  -0.0587 16  LEU B CD1 
1143 C CD2 . LEU B 16  ? 0.3410 0.4778 0.3401 -0.0069 0.0424  -0.0540 16  LEU B CD2 
1144 N N   . SER B 17  ? 0.3898 0.5469 0.3535 0.0212  0.0478  -0.0477 17  SER B N   
1145 C CA  . SER B 17  ? 0.3982 0.5511 0.3447 0.0365  0.0458  -0.0498 17  SER B CA  
1146 C C   . SER B 17  ? 0.3945 0.5402 0.3252 0.0586  0.0403  -0.0586 17  SER B C   
1147 O O   . SER B 17  ? 0.3702 0.5033 0.3017 0.0614  0.0366  -0.0618 17  SER B O   
1148 C CB  . SER B 17  ? 0.4211 0.5392 0.3629 0.0311  0.0411  -0.0493 17  SER B CB  
1149 O OG  . SER B 17  ? 0.4609 0.5515 0.4060 0.0269  0.0353  -0.0528 17  SER B OG  
1150 N N   . ASN B 18  ? 0.4071 0.5595 0.3214 0.0752  0.0394  -0.0623 18  ASN B N   
1151 C CA  . ASN B 18  ? 0.4468 0.5776 0.3396 0.0977  0.0320  -0.0723 18  ASN B CA  
1152 C C   . ASN B 18  ? 0.4267 0.5086 0.3139 0.0912  0.0235  -0.0755 18  ASN B C   
1153 O O   . ASN B 18  ? 0.4352 0.5031 0.3249 0.0789  0.0221  -0.0733 18  ASN B O   
1154 C CB  . ASN B 18  ? 0.4928 0.6320 0.3673 0.1139  0.0313  -0.0772 18  ASN B CB  
1155 C CG  . ASN B 18  ? 0.5296 0.7214 0.4043 0.1268  0.0387  -0.0756 18  ASN B CG  
1156 O OD1 . ASN B 18  ? 0.5631 0.7898 0.4548 0.1183  0.0454  -0.0692 18  ASN B OD1 
1157 N ND2 . ASN B 18  ? 0.5463 0.7482 0.4019 0.1472  0.0373  -0.0821 18  ASN B ND2 
1158 N N   . SER B 19  ? 0.4170 0.4745 0.2947 0.1003  0.0176  -0.0800 19  SER B N   
1159 C CA  . SER B 19  ? 0.4223 0.4358 0.2961 0.0903  0.0097  -0.0808 19  SER B CA  
1160 C C   . SER B 19  ? 0.4405 0.4252 0.2972 0.0920  0.0023  -0.0876 19  SER B C   
1161 O O   . SER B 19  ? 0.4248 0.3877 0.2846 0.0766  -0.0021 -0.0865 19  SER B O   
1162 C CB  . SER B 19  ? 0.4357 0.4281 0.2995 0.1008  0.0050  -0.0823 19  SER B CB  
1163 O OG  . SER B 19  ? 0.4478 0.4358 0.2892 0.1271  0.0021  -0.0898 19  SER B OG  
1164 N N   . GLN B 20  ? 0.4775 0.4675 0.3161 0.1116  0.0011  -0.0953 20  GLN B N   
1165 C CA  . GLN B 20  ? 0.5144 0.4837 0.3365 0.1141  -0.0056 -0.1033 20  GLN B CA  
1166 C C   . GLN B 20  ? 0.4693 0.4553 0.3057 0.0967  -0.0021 -0.0972 20  GLN B C   
1167 O O   . GLN B 20  ? 0.4635 0.4307 0.2912 0.0920  -0.0087 -0.1021 20  GLN B O   
1168 C CB  . GLN B 20  ? 0.5691 0.5483 0.3691 0.1411  -0.0067 -0.1133 20  GLN B CB  
1169 C CG  . GLN B 20  ? 0.5929 0.6262 0.4028 0.1456  0.0037  -0.1079 20  GLN B CG  
1170 C CD  . GLN B 20  ? 0.6430 0.6984 0.4330 0.1756  0.0043  -0.1168 20  GLN B CD  
1171 O OE1 . GLN B 20  ? 0.6599 0.7644 0.4595 0.1820  0.0136  -0.1110 20  GLN B OE1 
1172 N NE2 . GLN B 20  ? 0.6755 0.6962 0.4374 0.1936  -0.0058 -0.1313 20  GLN B NE2 
1173 N N   . HIS B 21  ? 0.4490 0.4683 0.3062 0.0869  0.0076  -0.0865 21  HIS B N   
1174 C CA  . HIS B 21  ? 0.4402 0.4708 0.3075 0.0734  0.0107  -0.0796 21  HIS B CA  
1175 C C   . HIS B 21  ? 0.4239 0.4474 0.3106 0.0535  0.0121  -0.0717 21  HIS B C   
1176 O O   . HIS B 21  ? 0.4300 0.4602 0.3248 0.0438  0.0145  -0.0654 21  HIS B O   
1177 C CB  . HIS B 21  ? 0.4392 0.5099 0.3122 0.0767  0.0207  -0.0723 21  HIS B CB  
1178 C CG  . HIS B 21  ? 0.4639 0.5528 0.3187 0.0981  0.0208  -0.0791 21  HIS B CG  
1179 N ND1 . HIS B 21  ? 0.5042 0.5752 0.3379 0.1106  0.0128  -0.0903 21  HIS B ND1 
1180 C CD2 . HIS B 21  ? 0.4722 0.6012 0.3270 0.1093  0.0284  -0.0765 21  HIS B CD2 
1181 C CE1 . HIS B 21  ? 0.5237 0.6205 0.3431 0.1314  0.0150  -0.0954 21  HIS B CE1 
1182 N NE2 . HIS B 21  ? 0.5068 0.6418 0.3398 0.1306  0.0250  -0.0862 21  HIS B NE2 
1183 N N   . SER B 22  ? 0.4117 0.4235 0.3048 0.0493  0.0107  -0.0718 22  SER B N   
1184 C CA  A SER B 22  ? 0.3994 0.4102 0.3109 0.0329  0.0126  -0.0653 22  SER B CA  
1185 C CA  B SER B 22  ? 0.3886 0.3986 0.2998 0.0330  0.0124  -0.0655 22  SER B CA  
1186 C C   . SER B 22  ? 0.3900 0.3818 0.3012 0.0227  0.0060  -0.0658 22  SER B C   
1187 O O   . SER B 22  ? 0.3900 0.3623 0.2867 0.0253  -0.0019 -0.0724 22  SER B O   
1188 C CB  A SER B 22  ? 0.4206 0.4267 0.3367 0.0329  0.0122  -0.0656 22  SER B CB  
1189 C CB  B SER B 22  ? 0.3910 0.3945 0.3058 0.0334  0.0114  -0.0661 22  SER B CB  
1190 O OG  A SER B 22  ? 0.4627 0.4393 0.3641 0.0372  0.0037  -0.0709 22  SER B OG  
1191 O OG  B SER B 22  ? 0.3819 0.4075 0.2975 0.0437  0.0167  -0.0661 22  SER B OG  
1192 N N   . VAL B 23  ? 0.3625 0.3615 0.2888 0.0115  0.0090  -0.0596 23  VAL B N   
1193 C CA  . VAL B 23  ? 0.3542 0.3449 0.2837 0.0021  0.0038  -0.0590 23  VAL B CA  
1194 C C   . VAL B 23  ? 0.3640 0.3343 0.2865 -0.0020 -0.0045 -0.0637 23  VAL B C   
1195 O O   . VAL B 23  ? 0.3491 0.3088 0.2625 -0.0056 -0.0118 -0.0677 23  VAL B O   
1196 C CB  . VAL B 23  ? 0.3426 0.3437 0.2890 -0.0056 0.0087  -0.0528 23  VAL B CB  
1197 C CG1 . VAL B 23  ? 0.3549 0.3534 0.3072 -0.0142 0.0035  -0.0525 23  VAL B CG1 
1198 C CG2 . VAL B 23  ? 0.3561 0.3671 0.3039 -0.0035 0.0140  -0.0475 23  VAL B CG2 
1199 N N   . GLN B 24  ? 0.3442 0.3088 0.2691 -0.0021 -0.0037 -0.0628 24  GLN B N   
1200 C CA  . GLN B 24  ? 0.3595 0.3029 0.2778 -0.0084 -0.0110 -0.0638 24  GLN B CA  
1201 C C   . GLN B 24  ? 0.3952 0.3113 0.2912 -0.0020 -0.0187 -0.0713 24  GLN B C   
1202 O O   . GLN B 24  ? 0.4127 0.3076 0.3009 -0.0124 -0.0270 -0.0727 24  GLN B O   
1203 C CB  . GLN B 24  ? 0.3565 0.3019 0.2820 -0.0092 -0.0081 -0.0593 24  GLN B CB  
1204 C CG  . GLN B 24  ? 0.3300 0.2957 0.2748 -0.0196 -0.0044 -0.0538 24  GLN B CG  
1205 C CD  . GLN B 24  ? 0.3324 0.3062 0.2844 -0.0187 -0.0010 -0.0505 24  GLN B CD  
1206 O OE1 . GLN B 24  ? 0.3764 0.3358 0.3204 -0.0188 -0.0046 -0.0483 24  GLN B OE1 
1207 N NE2 . GLN B 24  ? 0.3203 0.3159 0.2860 -0.0180 0.0055  -0.0500 24  GLN B NE2 
1208 N N   . THR B 25  ? 0.4046 0.3221 0.2894 0.0140  -0.0167 -0.0766 25  THR B N   
1209 C CA  . THR B 25  ? 0.4460 0.3375 0.3068 0.0233  -0.0247 -0.0865 25  THR B CA  
1210 C C   . THR B 25  ? 0.4543 0.3471 0.3110 0.0166  -0.0298 -0.0912 25  THR B C   
1211 O O   . THR B 25  ? 0.4704 0.3369 0.3135 0.0094  -0.0400 -0.0977 25  THR B O   
1212 C CB  . THR B 25  ? 0.4554 0.3544 0.3044 0.0458  -0.0210 -0.0916 25  THR B CB  
1213 O OG1 . THR B 25  ? 0.4445 0.3419 0.2948 0.0531  -0.0180 -0.0882 25  THR B OG1 
1214 C CG2 . THR B 25  ? 0.4921 0.3641 0.3139 0.0582  -0.0300 -0.1042 25  THR B CG2 
1215 N N   . LEU B 26  ? 0.4258 0.3483 0.2936 0.0175  -0.0234 -0.0874 26  LEU B N   
1216 C CA  . LEU B 26  ? 0.4489 0.3777 0.3124 0.0138  -0.0279 -0.0910 26  LEU B CA  
1217 C C   . LEU B 26  ? 0.4431 0.3649 0.3126 -0.0050 -0.0350 -0.0899 26  LEU B C   
1218 O O   . LEU B 26  ? 0.4548 0.3686 0.3136 -0.0105 -0.0438 -0.0972 26  LEU B O   
1219 C CB  . LEU B 26  ? 0.4212 0.3813 0.2955 0.0176  -0.0194 -0.0838 26  LEU B CB  
1220 C CG  . LEU B 26  ? 0.4269 0.3976 0.2946 0.0178  -0.0236 -0.0867 26  LEU B CG  
1221 C CD1 . LEU B 26  ? 0.4615 0.4182 0.3063 0.0264  -0.0319 -0.1000 26  LEU B CD1 
1222 C CD2 . LEU B 26  ? 0.4169 0.4137 0.2906 0.0253  -0.0140 -0.0776 26  LEU B CD2 
1223 N N   . SER B 27  ? 0.4187 0.3456 0.3043 -0.0148 -0.0315 -0.0816 27  SER B N   
1224 C CA  . SER B 27  ? 0.4403 0.3697 0.3344 -0.0329 -0.0367 -0.0785 27  SER B CA  
1225 C C   . SER B 27  ? 0.4746 0.3725 0.3535 -0.0439 -0.0476 -0.0842 27  SER B C   
1226 O O   . SER B 27  ? 0.4652 0.3649 0.3425 -0.0580 -0.0552 -0.0867 27  SER B O   
1227 C CB  . SER B 27  ? 0.4248 0.3665 0.3367 -0.0384 -0.0306 -0.0693 27  SER B CB  
1228 O OG  . SER B 27  ? 0.4494 0.4033 0.3704 -0.0541 -0.0347 -0.0657 27  SER B OG  
1229 N N   . LEU B 28  ? 0.5001 0.3696 0.3673 -0.0374 -0.0484 -0.0857 28  LEU B N   
1230 C CA  . LEU B 28  ? 0.5615 0.3897 0.4088 -0.0457 -0.0593 -0.0911 28  LEU B CA  
1231 C C   . LEU B 28  ? 0.5835 0.3993 0.4134 -0.0461 -0.0686 -0.1040 28  LEU B C   
1232 O O   . LEU B 28  ? 0.6230 0.4224 0.4456 -0.0648 -0.0788 -0.1077 28  LEU B O   
1233 C CB  . LEU B 28  ? 0.5958 0.3951 0.4287 -0.0295 -0.0579 -0.0920 28  LEU B CB  
1234 C CG  . LEU B 28  ? 0.6713 0.4313 0.4924 -0.0406 -0.0649 -0.0880 28  LEU B CG  
1235 C CD1 . LEU B 28  ? 0.6391 0.4198 0.4805 -0.0506 -0.0583 -0.0736 28  LEU B CD1 
1236 C CD2 . LEU B 28  ? 0.7266 0.4459 0.5215 -0.0197 -0.0682 -0.0944 28  LEU B CD2 
1237 N N   . TRP B 29  ? 0.5684 0.3950 0.3917 -0.0261 -0.0650 -0.1108 29  TRP B N   
1238 C CA  . TRP B 29  ? 0.5809 0.4015 0.3865 -0.0212 -0.0728 -0.1243 29  TRP B CA  
1239 C C   . TRP B 29  ? 0.5660 0.4123 0.3816 -0.0376 -0.0768 -0.1242 29  TRP B C   
1240 O O   . TRP B 29  ? 0.5837 0.4143 0.3858 -0.0490 -0.0884 -0.1344 29  TRP B O   
1241 C CB  . TRP B 29  ? 0.5667 0.4069 0.3675 0.0040  -0.0653 -0.1278 29  TRP B CB  
1242 C CG  . TRP B 29  ? 0.6018 0.4335 0.3795 0.0149  -0.0732 -0.1434 29  TRP B CG  
1243 C CD1 . TRP B 29  ? 0.6428 0.4351 0.3922 0.0267  -0.0820 -0.1580 29  TRP B CD1 
1244 C CD2 . TRP B 29  ? 0.5883 0.4515 0.3663 0.0183  -0.0733 -0.1470 29  TRP B CD2 
1245 N NE1 . TRP B 29  ? 0.6603 0.4586 0.3933 0.0356  -0.0879 -0.1716 29  TRP B NE1 
1246 C CE2 . TRP B 29  ? 0.6312 0.4734 0.3806 0.0311  -0.0828 -0.1652 29  TRP B CE2 
1247 C CE3 . TRP B 29  ? 0.5639 0.4677 0.3602 0.0137  -0.0671 -0.1374 29  TRP B CE3 
1248 C CZ2 . TRP B 29  ? 0.6365 0.5028 0.3778 0.0379  -0.0856 -0.1731 29  TRP B CZ2 
1249 C CZ3 . TRP B 29  ? 0.5683 0.4945 0.3559 0.0212  -0.0697 -0.1437 29  TRP B CZ3 
1250 C CH2 . TRP B 29  ? 0.6158 0.5258 0.3771 0.0325  -0.0786 -0.1611 29  TRP B CH2 
1251 N N   . LEU B 30  ? 0.5248 0.4108 0.3630 -0.0386 -0.0679 -0.1133 30  LEU B N   
1252 C CA  . LEU B 30  ? 0.5200 0.4359 0.3684 -0.0510 -0.0712 -0.1120 30  LEU B CA  
1253 C C   . LEU B 30  ? 0.5422 0.4513 0.3947 -0.0773 -0.0799 -0.1107 30  LEU B C   
1254 O O   . LEU B 30  ? 0.5360 0.4555 0.3851 -0.0902 -0.0888 -0.1169 30  LEU B O   
1255 C CB  . LEU B 30  ? 0.4773 0.4309 0.3464 -0.0444 -0.0602 -0.1001 30  LEU B CB  
1256 C CG  . LEU B 30  ? 0.4773 0.4430 0.3434 -0.0229 -0.0515 -0.0986 30  LEU B CG  
1257 C CD1 . LEU B 30  ? 0.4550 0.4498 0.3391 -0.0196 -0.0424 -0.0864 30  LEU B CD1 
1258 C CD2 . LEU B 30  ? 0.5022 0.4731 0.3515 -0.0149 -0.0574 -0.1087 30  LEU B CD2 
1259 N N   . ILE B 31  ? 0.5416 0.4380 0.4018 -0.0857 -0.0770 -0.1020 31  ILE B N   
1260 C CA  . ILE B 31  ? 0.5670 0.4594 0.4312 -0.1120 -0.0842 -0.0980 31  ILE B CA  
1261 C C   . ILE B 31  ? 0.6113 0.4612 0.4515 -0.1250 -0.0980 -0.1096 31  ILE B C   
1262 O O   . ILE B 31  ? 0.6204 0.4767 0.4609 -0.1483 -0.1069 -0.1114 31  ILE B O   
1263 C CB  . ILE B 31  ? 0.5520 0.4391 0.4269 -0.1164 -0.0780 -0.0855 31  ILE B CB  
1264 C CG1 . ILE B 31  ? 0.5203 0.4545 0.4199 -0.1114 -0.0679 -0.0758 31  ILE B CG1 
1265 C CG2 . ILE B 31  ? 0.5935 0.4620 0.4642 -0.1441 -0.0869 -0.0814 31  ILE B CG2 
1266 C CD1 . ILE B 31  ? 0.5084 0.4428 0.4184 -0.1058 -0.0590 -0.0661 31  ILE B CD1 
1267 N N   . HIS B 32  ? 0.6565 0.4640 0.4753 -0.1091 -0.0996 -0.1177 32  HIS B N   
1268 C CA  . HIS B 32  ? 0.7253 0.4830 0.5167 -0.1169 -0.1130 -0.1305 32  HIS B CA  
1269 C C   . HIS B 32  ? 0.7351 0.5078 0.5193 -0.1221 -0.1218 -0.1442 32  HIS B C   
1270 O O   . HIS B 32  ? 0.8039 0.5500 0.5731 -0.1424 -0.1351 -0.1534 32  HIS B O   
1271 C CB  . HIS B 32  ? 0.7660 0.4824 0.5353 -0.0905 -0.1117 -0.1375 32  HIS B CB  
1272 C CG  . HIS B 32  ? 0.8387 0.4993 0.5747 -0.0917 -0.1261 -0.1542 32  HIS B CG  
1273 N ND1 . HIS B 32  ? 0.9001 0.5159 0.6227 -0.1162 -0.1374 -0.1540 32  HIS B ND1 
1274 C CD2 . HIS B 32  ? 0.8806 0.5228 0.5922 -0.0705 -0.1315 -0.1724 32  HIS B CD2 
1275 C CE1 . HIS B 32  ? 0.9412 0.5062 0.6311 -0.1114 -0.1502 -0.1724 32  HIS B CE1 
1276 N NE2 . HIS B 32  ? 0.9298 0.5124 0.6128 -0.0820 -0.1467 -0.1845 32  HIS B NE2 
1277 N N   . HIS B 33  ? 0.6871 0.5023 0.4811 -0.1044 -0.1147 -0.1453 33  HIS B N   
1278 C CA  . HIS B 33  ? 0.6900 0.5294 0.4792 -0.1063 -0.1216 -0.1566 33  HIS B CA  
1279 C C   . HIS B 33  ? 0.6636 0.5570 0.4764 -0.1216 -0.1203 -0.1480 33  HIS B C   
1280 O O   . HIS B 33  ? 0.6700 0.5999 0.4853 -0.1131 -0.1202 -0.1519 33  HIS B O   
1281 C CB  . HIS B 33  ? 0.6735 0.5252 0.4542 -0.0755 -0.1155 -0.1628 33  HIS B CB  
1282 C CG  . HIS B 33  ? 0.7288 0.5332 0.4808 -0.0586 -0.1203 -0.1768 33  HIS B CG  
1283 N ND1 . HIS B 33  ? 0.7719 0.5374 0.4985 -0.0670 -0.1353 -0.1942 33  HIS B ND1 
1284 C CD2 . HIS B 33  ? 0.7331 0.5254 0.4773 -0.0320 -0.1120 -0.1762 33  HIS B CD2 
1285 C CE1 . HIS B 33  ? 0.8083 0.5363 0.5104 -0.0439 -0.1366 -0.2048 33  HIS B CE1 
1286 N NE2 . HIS B 33  ? 0.7881 0.5361 0.5019 -0.0223 -0.1221 -0.1934 33  HIS B NE2 
1287 N N   . ARG B 34  ? 0.6419 0.5441 0.4711 -0.1427 -0.1193 -0.1360 34  ARG B N   
1288 C CA  . ARG B 34  ? 0.6077 0.5672 0.4601 -0.1547 -0.1175 -0.1273 34  ARG B CA  
1289 C C   . ARG B 34  ? 0.6331 0.6197 0.4819 -0.1698 -0.1292 -0.1377 34  ARG B C   
1290 O O   . ARG B 34  ? 0.5958 0.6375 0.4609 -0.1685 -0.1267 -0.1327 34  ARG B O   
1291 C CB  . ARG B 34  ? 0.6074 0.5731 0.4754 -0.1766 -0.1159 -0.1138 34  ARG B CB  
1292 C CG  . ARG B 34  ? 0.6534 0.5785 0.5080 -0.2058 -0.1275 -0.1166 34  ARG B CG  
1293 C CD  . ARG B 34  ? 0.6531 0.5788 0.5210 -0.2211 -0.1227 -0.1002 34  ARG B CD  
1294 N NE  . ARG B 34  ? 0.7068 0.5839 0.5584 -0.2483 -0.1332 -0.1002 34  ARG B NE  
1295 C CZ  . ARG B 34  ? 0.7574 0.5701 0.5874 -0.2413 -0.1351 -0.1024 34  ARG B CZ  
1296 N NH1 . ARG B 34  ? 0.8187 0.5854 0.6326 -0.2674 -0.1453 -0.1010 34  ARG B NH1 
1297 N NH2 . ARG B 34  ? 0.7389 0.5326 0.5622 -0.2082 -0.1270 -0.1057 34  ARG B NH2 
1298 N N   . LYS B 35  ? 0.6837 0.6322 0.5103 -0.1833 -0.1424 -0.1526 35  LYS B N   
1299 C CA  . LYS B 35  ? 0.7200 0.6938 0.5405 -0.1974 -0.1549 -0.1658 35  LYS B CA  
1300 C C   . LYS B 35  ? 0.7071 0.7179 0.5267 -0.1688 -0.1505 -0.1709 35  LYS B C   
1301 O O   . LYS B 35  ? 0.7040 0.7476 0.5209 -0.1750 -0.1591 -0.1804 35  LYS B O   
1302 C CB  . LYS B 35  ? 0.7875 0.7052 0.5809 -0.2179 -0.1713 -0.1830 35  LYS B CB  
1303 C CG  . LYS B 35  ? 0.8282 0.7129 0.5933 -0.1970 -0.1774 -0.2032 35  LYS B CG  
1304 C CD  . LYS B 35  ? 0.8930 0.7120 0.6287 -0.2177 -0.1945 -0.2205 35  LYS B CD  
1305 C CE  . LYS B 35  ? 0.9359 0.7515 0.6479 -0.2116 -0.2073 -0.2455 35  LYS B CE  
1306 N N   . HIS B 36  ? 0.6643 0.6729 0.4867 -0.1391 -0.1370 -0.1632 36  HIS B N   
1307 C CA  . HIS B 36  ? 0.6480 0.6894 0.4691 -0.1122 -0.1312 -0.1640 36  HIS B CA  
1308 C C   . HIS B 36  ? 0.5996 0.6784 0.4429 -0.0975 -0.1170 -0.1455 36  HIS B C   
1309 O O   . HIS B 36  ? 0.5828 0.6741 0.4243 -0.0730 -0.1087 -0.1413 36  HIS B O   
1310 C CB  . HIS B 36  ? 0.6639 0.6688 0.4635 -0.0888 -0.1287 -0.1728 36  HIS B CB  
1311 C CG  . HIS B 36  ? 0.7166 0.6769 0.4887 -0.0972 -0.1434 -0.1939 36  HIS B CG  
1312 N ND1 . HIS B 36  ? 0.7419 0.7134 0.4973 -0.0946 -0.1536 -0.2107 36  HIS B ND1 
1313 C CD2 . HIS B 36  ? 0.7461 0.6460 0.5023 -0.1055 -0.1492 -0.2009 36  HIS B CD2 
1314 C CE1 . HIS B 36  ? 0.7876 0.7068 0.5173 -0.1018 -0.1661 -0.2290 36  HIS B CE1 
1315 N NE2 . HIS B 36  ? 0.7934 0.6668 0.5229 -0.1079 -0.1634 -0.2225 36  HIS B NE2 
1316 N N   . ALA B 37  ? 0.5834 0.6798 0.4463 -0.1122 -0.1145 -0.1343 37  ALA B N   
1317 C CA  . ALA B 37  ? 0.5461 0.6667 0.4275 -0.0973 -0.1013 -0.1182 37  ALA B CA  
1318 C C   . ALA B 37  ? 0.5332 0.6955 0.4171 -0.0772 -0.0976 -0.1144 37  ALA B C   
1319 O O   . ALA B 37  ? 0.5115 0.6770 0.4009 -0.0574 -0.0864 -0.1037 37  ALA B O   
1320 C CB  . ALA B 37  ? 0.5363 0.6769 0.4365 -0.1158 -0.1010 -0.1092 37  ALA B CB  
1321 N N   . GLY B 38  ? 0.5301 0.7231 0.4085 -0.0826 -0.1075 -0.1229 38  GLY B N   
1322 C CA  . GLY B 38  ? 0.5215 0.7597 0.4021 -0.0637 -0.1051 -0.1179 38  GLY B CA  
1323 C C   . GLY B 38  ? 0.5158 0.7385 0.3825 -0.0381 -0.0979 -0.1163 38  GLY B C   
1324 O O   . GLY B 38  ? 0.4923 0.7219 0.3643 -0.0187 -0.0870 -0.1027 38  GLY B O   
1325 N N   . PRO B 39  ? 0.5371 0.7383 0.3850 -0.0383 -0.1042 -0.1301 39  PRO B N   
1326 C CA  . PRO B 39  ? 0.5362 0.7229 0.3698 -0.0158 -0.0974 -0.1293 39  PRO B CA  
1327 C C   . PRO B 39  ? 0.5144 0.6712 0.3541 -0.0067 -0.0843 -0.1176 39  PRO B C   
1328 O O   . PRO B 39  ? 0.4898 0.6527 0.3275 0.0122  -0.0745 -0.1070 39  PRO B O   
1329 C CB  . PRO B 39  ? 0.5721 0.7350 0.3851 -0.0223 -0.1086 -0.1495 39  PRO B CB  
1330 C CG  . PRO B 39  ? 0.5900 0.7776 0.4045 -0.0431 -0.1224 -0.1599 39  PRO B CG  
1331 C CD  . PRO B 39  ? 0.5646 0.7619 0.4018 -0.0592 -0.1196 -0.1482 39  PRO B CD  
1332 N N   . ILE B 40  ? 0.5066 0.6338 0.3536 -0.0213 -0.0841 -0.1183 40  ILE B N   
1333 C CA  . ILE B 40  ? 0.4822 0.5849 0.3359 -0.0141 -0.0725 -0.1083 40  ILE B CA  
1334 C C   . ILE B 40  ? 0.4512 0.5742 0.3195 -0.0035 -0.0617 -0.0915 40  ILE B C   
1335 O O   . ILE B 40  ? 0.4407 0.5563 0.3080 0.0104  -0.0516 -0.0826 40  ILE B O   
1336 C CB  . ILE B 40  ? 0.4841 0.5573 0.3441 -0.0318 -0.0748 -0.1105 40  ILE B CB  
1337 C CG1 . ILE B 40  ? 0.5191 0.5560 0.3595 -0.0352 -0.0826 -0.1254 40  ILE B CG1 
1338 C CG2 . ILE B 40  ? 0.4584 0.5202 0.3311 -0.0258 -0.0626 -0.0981 40  ILE B CG2 
1339 C CD1 . ILE B 40  ? 0.5253 0.5291 0.3664 -0.0546 -0.0880 -0.1284 40  ILE B CD1 
1340 N N   . VAL B 41  ? 0.4328 0.5817 0.3134 -0.0102 -0.0643 -0.0873 41  VAL B N   
1341 C CA  . VAL B 41  ? 0.4079 0.5726 0.3000 0.0013  -0.0557 -0.0731 41  VAL B CA  
1342 C C   . VAL B 41  ? 0.4156 0.5957 0.2976 0.0221  -0.0516 -0.0658 41  VAL B C   
1343 O O   . VAL B 41  ? 0.3939 0.5654 0.2778 0.0348  -0.0417 -0.0531 41  VAL B O   
1344 C CB  . VAL B 41  ? 0.3943 0.5881 0.3006 -0.0083 -0.0602 -0.0716 41  VAL B CB  
1345 C CG1 . VAL B 41  ? 0.3793 0.5933 0.2924 0.0090  -0.0536 -0.0593 41  VAL B CG1 
1346 C CG2 . VAL B 41  ? 0.3866 0.5627 0.3034 -0.0273 -0.0611 -0.0738 41  VAL B CG2 
1347 N N   . SER B 42  ? 0.4422 0.6437 0.3125 0.0250  -0.0592 -0.0731 42  SER B N   
1348 C CA  . SER B 42  ? 0.4575 0.6756 0.3158 0.0451  -0.0557 -0.0656 42  SER B CA  
1349 C C   . SER B 42  ? 0.4501 0.6437 0.2996 0.0546  -0.0464 -0.0596 42  SER B C   
1350 O O   . SER B 42  ? 0.4457 0.6404 0.2925 0.0684  -0.0379 -0.0449 42  SER B O   
1351 C CB  . SER B 42  ? 0.4913 0.7368 0.3367 0.0456  -0.0663 -0.0774 42  SER B CB  
1352 O OG  . SER B 42  ? 0.5229 0.8000 0.3772 0.0371  -0.0745 -0.0811 42  SER B OG  
1353 N N   . VAL B 43  ? 0.4553 0.6277 0.2989 0.0472  -0.0485 -0.0710 43  VAL B N   
1354 C CA  . VAL B 43  ? 0.4591 0.6146 0.2953 0.0557  -0.0399 -0.0666 43  VAL B CA  
1355 C C   . VAL B 43  ? 0.4368 0.5736 0.2868 0.0540  -0.0290 -0.0530 43  VAL B C   
1356 O O   . VAL B 43  ? 0.4293 0.5647 0.2769 0.0632  -0.0195 -0.0397 43  VAL B O   
1357 C CB  . VAL B 43  ? 0.4775 0.6140 0.3038 0.0505  -0.0454 -0.0832 43  VAL B CB  
1358 C CG1 . VAL B 43  ? 0.4917 0.6148 0.3131 0.0594  -0.0358 -0.0787 43  VAL B CG1 
1359 C CG2 . VAL B 43  ? 0.4980 0.6516 0.3072 0.0544  -0.0559 -0.0973 43  VAL B CG2 
1360 N N   . TRP B 44  ? 0.4109 0.5347 0.2749 0.0411  -0.0309 -0.0561 44  TRP B N   
1361 C CA  . TRP B 44  ? 0.3876 0.4949 0.2642 0.0388  -0.0221 -0.0463 44  TRP B CA  
1362 C C   . TRP B 44  ? 0.3940 0.5089 0.2720 0.0496  -0.0159 -0.0311 44  TRP B C   
1363 O O   . TRP B 44  ? 0.3925 0.4943 0.2704 0.0534  -0.0068 -0.0203 44  TRP B O   
1364 C CB  . TRP B 44  ? 0.3722 0.4721 0.2623 0.0246  -0.0264 -0.0521 44  TRP B CB  
1365 C CG  . TRP B 44  ? 0.3482 0.4359 0.2516 0.0226  -0.0189 -0.0439 44  TRP B CG  
1366 C CD1 . TRP B 44  ? 0.3375 0.4048 0.2464 0.0173  -0.0138 -0.0441 44  TRP B CD1 
1367 C CD2 . TRP B 44  ? 0.3419 0.4379 0.2539 0.0273  -0.0164 -0.0356 44  TRP B CD2 
1368 N NE1 . TRP B 44  ? 0.3291 0.3918 0.2496 0.0165  -0.0086 -0.0374 44  TRP B NE1 
1369 C CE2 . TRP B 44  ? 0.3316 0.4086 0.2537 0.0231  -0.0099 -0.0324 44  TRP B CE2 
1370 C CE3 . TRP B 44  ? 0.3420 0.4598 0.2532 0.0363  -0.0192 -0.0314 44  TRP B CE3 
1371 C CZ2 . TRP B 44  ? 0.3287 0.4050 0.2586 0.0277  -0.0068 -0.0265 44  TRP B CZ2 
1372 C CZ3 . TRP B 44  ? 0.3474 0.4644 0.2659 0.0431  -0.0156 -0.0244 44  TRP B CZ3 
1373 C CH2 . TRP B 44  ? 0.3285 0.4235 0.2556 0.0387  -0.0098 -0.0227 44  TRP B CH2 
1374 N N   . HIS B 45  ? 0.4015 0.5383 0.2791 0.0549  -0.0212 -0.0300 45  HIS B N   
1375 C CA  . HIS B 45  ? 0.4212 0.5634 0.2971 0.0684  -0.0168 -0.0160 45  HIS B CA  
1376 C C   . HIS B 45  ? 0.4510 0.5913 0.3125 0.0808  -0.0105 -0.0036 45  HIS B C   
1377 O O   . HIS B 45  ? 0.4387 0.5616 0.2987 0.0866  -0.0028 0.0105  45  HIS B O   
1378 C CB  . HIS B 45  ? 0.4414 0.6154 0.3178 0.0739  -0.0250 -0.0189 45  HIS B CB  
1379 C CG  . HIS B 45  ? 0.4605 0.6378 0.3370 0.0896  -0.0218 -0.0064 45  HIS B CG  
1380 N ND1 . HIS B 45  ? 0.4733 0.6836 0.3474 0.1012  -0.0277 -0.0056 45  HIS B ND1 
1381 C CD2 . HIS B 45  ? 0.4740 0.6231 0.3516 0.0961  -0.0138 0.0048  45  HIS B CD2 
1382 C CE1 . HIS B 45  ? 0.4733 0.6754 0.3454 0.1173  -0.0235 0.0058  45  HIS B CE1 
1383 N NE2 . HIS B 45  ? 0.4905 0.6521 0.3639 0.1136  -0.0153 0.0120  45  HIS B NE2 
1384 N N   . ARG B 46  ? 0.4710 0.6286 0.3205 0.0843  -0.0140 -0.0088 46  ARG B N   
1385 C CA  . ARG B 46  ? 0.5045 0.6665 0.3392 0.0959  -0.0078 0.0035  46  ARG B CA  
1386 C C   . ARG B 46  ? 0.4900 0.6301 0.3262 0.0901  0.0020  0.0105  46  ARG B C   
1387 O O   . ARG B 46  ? 0.4897 0.6222 0.3201 0.0951  0.0103  0.0280  46  ARG B O   
1388 C CB  . ARG B 46  ? 0.5406 0.7302 0.3614 0.1018  -0.0144 -0.0063 46  ARG B CB  
1389 C CG  . ARG B 46  ? 0.5894 0.7903 0.3938 0.1147  -0.0078 0.0070  46  ARG B CG  
1390 C CD  . ARG B 46  ? 0.6325 0.8665 0.4215 0.1238  -0.0157 -0.0035 46  ARG B CD  
1391 N NE  . ARG B 46  ? 0.6609 0.8923 0.4495 0.1146  -0.0232 -0.0265 46  ARG B NE  
1392 C CZ  . ARG B 46  ? 0.6637 0.9007 0.4548 0.1062  -0.0354 -0.0453 46  ARG B CZ  
1393 N NH1 . ARG B 46  ? 0.6692 0.9244 0.4654 0.1058  -0.0418 -0.0452 46  ARG B NH1 
1394 N NH2 . ARG B 46  ? 0.6662 0.8906 0.4536 0.0981  -0.0415 -0.0643 46  ARG B NH2 
1395 N N   . GLU B 47  ? 0.4728 0.6033 0.3160 0.0790  0.0009  -0.0022 47  GLU B N   
1396 C CA  . GLU B 47  ? 0.4647 0.5812 0.3111 0.0733  0.0098  0.0029  47  GLU B CA  
1397 C C   . GLU B 47  ? 0.4463 0.5396 0.3042 0.0665  0.0164  0.0142  47  GLU B C   
1398 O O   . GLU B 47  ? 0.4531 0.5387 0.3092 0.0646  0.0251  0.0277  47  GLU B O   
1399 C CB  . GLU B 47  ? 0.4529 0.5655 0.3017 0.0667  0.0063  -0.0137 47  GLU B CB  
1400 C CG  . GLU B 47  ? 0.4727 0.6028 0.3061 0.0748  -0.0002 -0.0261 47  GLU B CG  
1401 C CD  . GLU B 47  ? 0.4932 0.6444 0.3126 0.0866  0.0059  -0.0154 47  GLU B CD  
1402 O OE1 . GLU B 47  ? 0.5061 0.6590 0.3254 0.0864  0.0141  -0.0094 47  GLU B OE1 
1403 O OE2 . GLU B 47  ? 0.4989 0.6688 0.3078 0.0959  0.0028  -0.0120 47  GLU B OE2 
1404 N N   . LEU B 48  ? 0.4367 0.5200 0.3055 0.0623  0.0122  0.0087  48  LEU B N   
1405 C CA  . LEU B 48  ? 0.4354 0.4964 0.3121 0.0593  0.0172  0.0182  48  LEU B CA  
1406 C C   . LEU B 48  ? 0.4547 0.5078 0.3197 0.0684  0.0227  0.0369  48  LEU B C   
1407 O O   . LEU B 48  ? 0.4485 0.4798 0.3143 0.0625  0.0297  0.0475  48  LEU B O   
1408 C CB  . LEU B 48  ? 0.4129 0.4734 0.2991 0.0596  0.0111  0.0109  48  LEU B CB  
1409 C CG  . LEU B 48  ? 0.4248 0.4639 0.3148 0.0623  0.0145  0.0189  48  LEU B CG  
1410 C CD1 . LEU B 48  ? 0.4279 0.4443 0.3258 0.0498  0.0209  0.0198  48  LEU B CD1 
1411 C CD2 . LEU B 48  ? 0.4213 0.4713 0.3201 0.0649  0.0078  0.0099  48  LEU B CD2 
1412 N N   . ARG B 49  ? 0.4765 0.5471 0.3296 0.0820  0.0191  0.0413  49  ARG B N   
1413 C CA  . ARG B 49  ? 0.5180 0.5793 0.3576 0.0932  0.0234  0.0604  49  ARG B CA  
1414 C C   . ARG B 49  ? 0.5127 0.5734 0.3423 0.0898  0.0318  0.0748  49  ARG B C   
1415 O O   . ARG B 49  ? 0.5272 0.5723 0.3453 0.0945  0.0369  0.0940  49  ARG B O   
1416 C CB  . ARG B 49  ? 0.5658 0.6516 0.3955 0.1105  0.0166  0.0608  49  ARG B CB  
1417 C CG  . ARG B 49  ? 0.5997 0.6878 0.4373 0.1164  0.0099  0.0529  49  ARG B CG  
1418 C CD  . ARG B 49  ? 0.6621 0.7757 0.4878 0.1367  0.0044  0.0579  49  ARG B CD  
1419 N NE  . ARG B 49  ? 0.7248 0.8273 0.5512 0.1493  0.0027  0.0617  49  ARG B NE  
1420 C CZ  . ARG B 49  ? 0.7819 0.8466 0.5993 0.1575  0.0082  0.0764  49  ARG B CZ  
1421 N NH1 . ARG B 49  ? 0.7700 0.8258 0.5864 0.1719  0.0055  0.0767  49  ARG B NH1 
1422 N NH2 . ARG B 49  ? 0.8237 0.8594 0.6318 0.1512  0.0161  0.0908  49  ARG B NH2 
1423 N N   . LYS B 50  ? 0.4825 0.5606 0.3152 0.0823  0.0329  0.0660  50  LYS B N   
1424 C CA  . LYS B 50  ? 0.4955 0.5832 0.3207 0.0784  0.0413  0.0780  50  LYS B CA  
1425 C C   . LYS B 50  ? 0.4800 0.5563 0.3174 0.0613  0.0476  0.0770  50  LYS B C   
1426 O O   . LYS B 50  ? 0.4829 0.5703 0.3167 0.0554  0.0551  0.0874  50  LYS B O   
1427 C CB  . LYS B 50  ? 0.4936 0.6169 0.3099 0.0870  0.0379  0.0685  50  LYS B CB  
1428 C CG  . LYS B 50  ? 0.5151 0.6561 0.3173 0.1034  0.0327  0.0721  50  LYS B CG  
1429 C CD  . LYS B 50  ? 0.5180 0.6941 0.3097 0.1125  0.0277  0.0595  50  LYS B CD  
1430 C CE  . LYS B 50  ? 0.5230 0.7178 0.3070 0.1123  0.0355  0.0660  50  LYS B CE  
1431 N NZ  . LYS B 50  ? 0.5354 0.7661 0.3019 0.1277  0.0317  0.0616  50  LYS B NZ  
1432 N N   . ALA B 51  ? 0.4652 0.5238 0.3171 0.0535  0.0444  0.0648  51  ALA B N   
1433 C CA  . ALA B 51  ? 0.4534 0.5069 0.3175 0.0390  0.0487  0.0606  51  ALA B CA  
1434 C C   . ALA B 51  ? 0.4783 0.5074 0.3438 0.0268  0.0561  0.0770  51  ALA B C   
1435 O O   . ALA B 51  ? 0.4885 0.4905 0.3493 0.0296  0.0552  0.0854  51  ALA B O   
1436 C CB  . ALA B 51  ? 0.4298 0.4750 0.3077 0.0355  0.0425  0.0425  51  ALA B CB  
1437 N N   . LYS B 52  ? 0.4750 0.5138 0.3458 0.0136  0.0627  0.0808  52  LYS B N   
1438 C CA  . LYS B 52  ? 0.5077 0.5235 0.3826 -0.0035 0.0686  0.0927  52  LYS B CA  
1439 C C   . LYS B 52  ? 0.5014 0.4816 0.3848 -0.0073 0.0641  0.0843  52  LYS B C   
1440 O O   . LYS B 52  ? 0.4778 0.4612 0.3708 -0.0029 0.0585  0.0674  52  LYS B O   
1441 C CB  . LYS B 52  ? 0.5158 0.5577 0.4000 -0.0178 0.0748  0.0920  52  LYS B CB  
1442 C CG  . LYS B 52  ? 0.5447 0.6207 0.4186 -0.0167 0.0815  0.1060  52  LYS B CG  
1443 C CD  . LYS B 52  ? 0.5479 0.6586 0.4315 -0.0286 0.0876  0.1048  52  LYS B CD  
1444 C CE  . LYS B 52  ? 0.5370 0.6638 0.4303 -0.0201 0.0825  0.0816  52  LYS B CE  
1445 N N   . SER B 53  ? 0.5407 0.4860 0.4183 -0.0146 0.0664  0.0969  53  SER B N   
1446 C CA  . SER B 53  ? 0.5527 0.4626 0.4356 -0.0178 0.0626  0.0894  53  SER B CA  
1447 C C   . SER B 53  ? 0.5369 0.4542 0.4379 -0.0302 0.0619  0.0734  53  SER B C   
1448 O O   . SER B 53  ? 0.5265 0.4267 0.4336 -0.0272 0.0569  0.0613  53  SER B O   
1449 C CB  . SER B 53  ? 0.5945 0.4624 0.4659 -0.0278 0.0659  0.1060  53  SER B CB  
1450 O OG  . SER B 53  ? 0.6245 0.4810 0.4772 -0.0137 0.0661  0.1218  53  SER B OG  
1451 N N   . ASN B 54  ? 0.5327 0.4784 0.4414 -0.0426 0.0667  0.0734  54  ASN B N   
1452 C CA  . ASN B 54  ? 0.5114 0.4697 0.4365 -0.0522 0.0660  0.0588  54  ASN B CA  
1453 C C   . ASN B 54  ? 0.4851 0.4694 0.4167 -0.0393 0.0615  0.0432  54  ASN B C   
1454 O O   . ASN B 54  ? 0.4755 0.4712 0.4189 -0.0442 0.0606  0.0317  54  ASN B O   
1455 C CB  . ASN B 54  ? 0.5175 0.4952 0.4485 -0.0722 0.0730  0.0659  54  ASN B CB  
1456 C CG  . ASN B 54  ? 0.5048 0.5248 0.4325 -0.0676 0.0776  0.0717  54  ASN B CG  
1457 O OD1 . ASN B 54  ? 0.4952 0.5271 0.4152 -0.0498 0.0751  0.0693  54  ASN B OD1 
1458 N ND2 . ASN B 54  ? 0.4888 0.5342 0.4221 -0.0832 0.0838  0.0779  54  ASN B ND2 
1459 N N   . ARG B 55  ? 0.4752 0.4675 0.3980 -0.0234 0.0581  0.0428  55  ARG B N   
1460 C CA  . ARG B 55  ? 0.4490 0.4586 0.3753 -0.0133 0.0526  0.0282  55  ARG B CA  
1461 C C   . ARG B 55  ? 0.4217 0.4196 0.3457 -0.0021 0.0453  0.0223  55  ARG B C   
1462 O O   . ARG B 55  ? 0.3858 0.3928 0.3139 0.0019  0.0400  0.0102  55  ARG B O   
1463 C CB  . ARG B 55  ? 0.4715 0.5098 0.3896 -0.0054 0.0538  0.0285  55  ARG B CB  
1464 C CG  . ARG B 55  ? 0.5016 0.5631 0.4225 -0.0137 0.0610  0.0331  55  ARG B CG  
1465 C CD  . ARG B 55  ? 0.5334 0.6251 0.4438 -0.0020 0.0619  0.0326  55  ARG B CD  
1466 N NE  . ARG B 55  ? 0.5390 0.6334 0.4479 0.0095  0.0546  0.0154  55  ARG B NE  
1467 C CZ  . ARG B 55  ? 0.5514 0.6432 0.4501 0.0217  0.0478  0.0087  55  ARG B CZ  
1468 N NH1 . ARG B 55  ? 0.5349 0.6271 0.4235 0.0271  0.0475  0.0172  55  ARG B NH1 
1469 N NH2 . ARG B 55  ? 0.5518 0.6407 0.4492 0.0281  0.0408  -0.0068 55  ARG B NH2 
1470 N N   . LYS B 56  ? 0.4278 0.4065 0.3444 0.0027  0.0448  0.0311  56  LYS B N   
1471 C CA  . LYS B 56  ? 0.4196 0.3962 0.3331 0.0158  0.0380  0.0265  56  LYS B CA  
1472 C C   . LYS B 56  ? 0.4026 0.3778 0.3285 0.0140  0.0332  0.0131  56  LYS B C   
1473 O O   . LYS B 56  ? 0.4130 0.4026 0.3408 0.0196  0.0272  0.0050  56  LYS B O   
1474 C CB  . LYS B 56  ? 0.4383 0.3932 0.3403 0.0247  0.0384  0.0388  56  LYS B CB  
1475 C CG  . LYS B 56  ? 0.4513 0.4119 0.3379 0.0312  0.0415  0.0537  56  LYS B CG  
1476 C CD  . LYS B 56  ? 0.4818 0.4141 0.3548 0.0405  0.0422  0.0678  56  LYS B CD  
1477 C CE  . LYS B 56  ? 0.5040 0.4400 0.3605 0.0455  0.0464  0.0861  56  LYS B CE  
1478 N NZ  . LYS B 56  ? 0.4879 0.4627 0.3408 0.0549  0.0437  0.0823  56  LYS B NZ  
1479 N N   . LEU B 57  ? 0.4069 0.3672 0.3408 0.0048  0.0356  0.0107  57  LEU B N   
1480 C CA  . LEU B 57  ? 0.3863 0.3480 0.3314 0.0036  0.0317  -0.0010 57  LEU B CA  
1481 C C   . LEU B 57  ? 0.3506 0.3336 0.3027 0.0003  0.0289  -0.0103 57  LEU B C   
1482 O O   . LEU B 57  ? 0.3125 0.3037 0.2702 0.0023  0.0238  -0.0179 57  LEU B O   
1483 C CB  . LEU B 57  ? 0.4091 0.3527 0.3604 -0.0060 0.0347  -0.0029 57  LEU B CB  
1484 C CG  . LEU B 57  ? 0.4047 0.3533 0.3674 -0.0074 0.0314  -0.0151 57  LEU B CG  
1485 C CD1 . LEU B 57  ? 0.4130 0.3614 0.3735 0.0056  0.0264  -0.0181 57  LEU B CD1 
1486 C CD2 . LEU B 57  ? 0.4253 0.3593 0.3933 -0.0182 0.0341  -0.0184 57  LEU B CD2 
1487 N N   . THR B 58  ? 0.3382 0.3301 0.2889 -0.0042 0.0322  -0.0092 58  THR B N   
1488 C CA  . THR B 58  ? 0.3272 0.3326 0.2806 -0.0050 0.0293  -0.0179 58  THR B CA  
1489 C C   . THR B 58  ? 0.3277 0.3397 0.2751 0.0017  0.0222  -0.0221 58  THR B C   
1490 O O   . THR B 58  ? 0.3360 0.3514 0.2860 -0.0003 0.0174  -0.0300 58  THR B O   
1491 C CB  . THR B 58  ? 0.3433 0.3601 0.2929 -0.0063 0.0338  -0.0163 58  THR B CB  
1492 O OG1 . THR B 58  ? 0.3520 0.3681 0.3081 -0.0156 0.0402  -0.0117 58  THR B OG1 
1493 C CG2 . THR B 58  ? 0.3360 0.3603 0.2859 -0.0043 0.0302  -0.0262 58  THR B CG2 
1494 N N   . PHE B 59  ? 0.3291 0.3431 0.2677 0.0089  0.0214  -0.0162 59  PHE B N   
1495 C CA  . PHE B 59  ? 0.3278 0.3529 0.2612 0.0142  0.0140  -0.0206 59  PHE B CA  
1496 C C   . PHE B 59  ? 0.3161 0.3446 0.2584 0.0118  0.0089  -0.0255 59  PHE B C   
1497 O O   . PHE B 59  ? 0.2907 0.3286 0.2336 0.0082  0.0025  -0.0323 59  PHE B O   
1498 C CB  . PHE B 59  ? 0.3458 0.3763 0.2679 0.0241  0.0143  -0.0124 59  PHE B CB  
1499 C CG  . PHE B 59  ? 0.3581 0.3963 0.2689 0.0276  0.0166  -0.0100 59  PHE B CG  
1500 C CD1 . PHE B 59  ? 0.3680 0.4024 0.2775 0.0251  0.0246  -0.0021 59  PHE B CD1 
1501 C CD2 . PHE B 59  ? 0.3725 0.4253 0.2737 0.0331  0.0104  -0.0161 59  PHE B CD2 
1502 C CE1 . PHE B 59  ? 0.3853 0.4335 0.2840 0.0298  0.0272  0.0006  59  PHE B CE1 
1503 C CE2 . PHE B 59  ? 0.3883 0.4510 0.2775 0.0388  0.0123  -0.0150 59  PHE B CE2 
1504 C CZ  . PHE B 59  ? 0.3877 0.4498 0.2758 0.0380  0.0212  -0.0061 59  PHE B CZ  
1505 N N   . LEU B 60  ? 0.3262 0.3472 0.2746 0.0133  0.0118  -0.0221 60  LEU B N   
1506 C CA  . LEU B 60  ? 0.3233 0.3528 0.2801 0.0130  0.0079  -0.0265 60  LEU B CA  
1507 C C   . LEU B 60  ? 0.3233 0.3534 0.2899 0.0024  0.0074  -0.0330 60  LEU B C   
1508 O O   . LEU B 60  ? 0.3074 0.3512 0.2795 -0.0014 0.0026  -0.0369 60  LEU B O   
1509 C CB  . LEU B 60  ? 0.3404 0.3612 0.2970 0.0223  0.0102  -0.0223 60  LEU B CB  
1510 C CG  . LEU B 60  ? 0.3535 0.3821 0.3005 0.0360  0.0077  -0.0166 60  LEU B CG  
1511 C CD1 . LEU B 60  ? 0.3881 0.3996 0.3307 0.0480  0.0098  -0.0122 60  LEU B CD1 
1512 C CD2 . LEU B 60  ? 0.3482 0.4079 0.2987 0.0368  0.0004  -0.0217 60  LEU B CD2 
1513 N N   . TYR B 61  ? 0.3264 0.3449 0.2945 -0.0023 0.0121  -0.0333 61  TYR B N   
1514 C CA  . TYR B 61  ? 0.3255 0.3452 0.2999 -0.0100 0.0114  -0.0384 61  TYR B CA  
1515 C C   . TYR B 61  ? 0.3105 0.3333 0.2793 -0.0133 0.0057  -0.0421 61  TYR B C   
1516 O O   . TYR B 61  ? 0.3052 0.3306 0.2780 -0.0196 0.0022  -0.0450 61  TYR B O   
1517 C CB  . TYR B 61  ? 0.3462 0.3583 0.3230 -0.0130 0.0176  -0.0378 61  TYR B CB  
1518 C CG  . TYR B 61  ? 0.3847 0.3909 0.3683 -0.0142 0.0212  -0.0372 61  TYR B CG  
1519 C CD1 . TYR B 61  ? 0.4232 0.4336 0.4129 -0.0128 0.0187  -0.0406 61  TYR B CD1 
1520 C CD2 . TYR B 61  ? 0.4389 0.4367 0.4223 -0.0178 0.0267  -0.0341 61  TYR B CD2 
1521 C CE1 . TYR B 61  ? 0.4823 0.4851 0.4759 -0.0123 0.0209  -0.0427 61  TYR B CE1 
1522 C CE2 . TYR B 61  ? 0.4844 0.4722 0.4724 -0.0209 0.0287  -0.0355 61  TYR B CE2 
1523 C CZ  . TYR B 61  ? 0.4977 0.4861 0.4898 -0.0168 0.0254  -0.0408 61  TYR B CZ  
1524 O OH  . TYR B 61  ? 0.5520 0.5293 0.5466 -0.0176 0.0262  -0.0449 61  TYR B OH  
1525 N N   . LEU B 62  ? 0.3231 0.3444 0.2812 -0.0093 0.0044  -0.0420 62  LEU B N   
1526 C CA  . LEU B 62  ? 0.3314 0.3513 0.2811 -0.0122 -0.0025 -0.0476 62  LEU B CA  
1527 C C   . LEU B 62  ? 0.3350 0.3674 0.2877 -0.0179 -0.0094 -0.0489 62  LEU B C   
1528 O O   . LEU B 62  ? 0.3299 0.3601 0.2825 -0.0276 -0.0152 -0.0526 62  LEU B O   
1529 C CB  . LEU B 62  ? 0.3464 0.3661 0.2831 -0.0047 -0.0027 -0.0484 62  LEU B CB  
1530 C CG  . LEU B 62  ? 0.3602 0.3760 0.2848 -0.0064 -0.0112 -0.0565 62  LEU B CG  
1531 C CD1 . LEU B 62  ? 0.3731 0.3708 0.2927 -0.0098 -0.0141 -0.0627 62  LEU B CD1 
1532 C CD2 . LEU B 62  ? 0.3808 0.4018 0.2927 0.0037  -0.0104 -0.0571 62  LEU B CD2 
1533 N N   . ALA B 63  ? 0.3320 0.3783 0.2862 -0.0118 -0.0091 -0.0452 63  ALA B N   
1534 C CA  . ALA B 63  ? 0.3261 0.3937 0.2844 -0.0156 -0.0152 -0.0460 63  ALA B CA  
1535 C C   . ALA B 63  ? 0.3143 0.3884 0.2843 -0.0243 -0.0156 -0.0461 63  ALA B C   
1536 O O   . ALA B 63  ? 0.3164 0.4032 0.2891 -0.0356 -0.0217 -0.0478 63  ALA B O   
1537 C CB  . ALA B 63  ? 0.3201 0.4017 0.2780 -0.0033 -0.0136 -0.0412 63  ALA B CB  
1538 N N   . ASN B 64  ? 0.3129 0.3792 0.2893 -0.0207 -0.0093 -0.0440 64  ASN B N   
1539 C CA  . ASN B 64  ? 0.3147 0.3896 0.3011 -0.0273 -0.0093 -0.0441 64  ASN B CA  
1540 C C   . ASN B 64  ? 0.3138 0.3800 0.2985 -0.0407 -0.0130 -0.0455 64  ASN B C   
1541 O O   . ASN B 64  ? 0.3178 0.3986 0.3070 -0.0512 -0.0172 -0.0442 64  ASN B O   
1542 C CB  . ASN B 64  ? 0.3115 0.3777 0.3032 -0.0211 -0.0025 -0.0436 64  ASN B CB  
1543 C CG  . ASN B 64  ? 0.3099 0.3865 0.3108 -0.0271 -0.0023 -0.0443 64  ASN B CG  
1544 O OD1 . ASN B 64  ? 0.3001 0.4009 0.3070 -0.0286 -0.0049 -0.0436 64  ASN B OD1 
1545 N ND2 . ASN B 64  ? 0.3012 0.3645 0.3029 -0.0300 0.0007  -0.0452 64  ASN B ND2 
1546 N N   . ASP B 65  ? 0.3167 0.3596 0.2939 -0.0397 -0.0114 -0.0474 65  ASP B N   
1547 C CA  . ASP B 65  ? 0.3315 0.3587 0.3028 -0.0489 -0.0154 -0.0486 65  ASP B CA  
1548 C C   . ASP B 65  ? 0.3439 0.3692 0.3073 -0.0601 -0.0244 -0.0508 65  ASP B C   
1549 O O   . ASP B 65  ? 0.3353 0.3557 0.2977 -0.0736 -0.0292 -0.0490 65  ASP B O   
1550 C CB  . ASP B 65  ? 0.3452 0.3504 0.3071 -0.0411 -0.0125 -0.0513 65  ASP B CB  
1551 C CG  . ASP B 65  ? 0.3948 0.3832 0.3517 -0.0452 -0.0145 -0.0512 65  ASP B CG  
1552 O OD1 . ASP B 65  ? 0.4161 0.3852 0.3602 -0.0502 -0.0213 -0.0539 65  ASP B OD1 
1553 O OD2 . ASP B 65  ? 0.3966 0.3901 0.3612 -0.0435 -0.0098 -0.0485 65  ASP B OD2 
1554 N N   . VAL B 66  ? 0.3454 0.3736 0.3019 -0.0558 -0.0271 -0.0545 66  VAL B N   
1555 C CA  . VAL B 66  ? 0.3705 0.3979 0.3185 -0.0667 -0.0365 -0.0588 66  VAL B CA  
1556 C C   . VAL B 66  ? 0.3758 0.4322 0.3346 -0.0809 -0.0407 -0.0552 66  VAL B C   
1557 O O   . VAL B 66  ? 0.3694 0.4205 0.3250 -0.0991 -0.0479 -0.0553 66  VAL B O   
1558 C CB  . VAL B 66  ? 0.3907 0.4238 0.3302 -0.0571 -0.0382 -0.0635 66  VAL B CB  
1559 C CG1 . VAL B 66  ? 0.4134 0.4540 0.3460 -0.0701 -0.0489 -0.0692 66  VAL B CG1 
1560 C CG2 . VAL B 66  ? 0.4057 0.4143 0.3323 -0.0451 -0.0353 -0.0676 66  VAL B CG2 
1561 N N   . ILE B 67  ? 0.3568 0.4435 0.3271 -0.0725 -0.0365 -0.0515 67  ILE B N   
1562 C CA  . ILE B 67  ? 0.3614 0.4850 0.3421 -0.0817 -0.0398 -0.0483 67  ILE B CA  
1563 C C   . ILE B 67  ? 0.3724 0.4991 0.3605 -0.0954 -0.0394 -0.0430 67  ILE B C   
1564 O O   . ILE B 67  ? 0.4163 0.5547 0.4054 -0.1154 -0.0459 -0.0409 67  ILE B O   
1565 C CB  . ILE B 67  ? 0.3428 0.4956 0.3313 -0.0645 -0.0353 -0.0461 67  ILE B CB  
1566 C CG1 . ILE B 67  ? 0.3524 0.5068 0.3321 -0.0534 -0.0370 -0.0491 67  ILE B CG1 
1567 C CG2 . ILE B 67  ? 0.3498 0.5477 0.3497 -0.0713 -0.0382 -0.0430 67  ILE B CG2 
1568 C CD1 . ILE B 67  ? 0.3470 0.5145 0.3290 -0.0322 -0.0316 -0.0457 67  ILE B CD1 
1569 N N   . GLN B 68  ? 0.3575 0.4741 0.3501 -0.0867 -0.0322 -0.0405 68  GLN B N   
1570 C CA  . GLN B 68  ? 0.3581 0.4814 0.3572 -0.0975 -0.0312 -0.0345 68  GLN B CA  
1571 C C   . GLN B 68  ? 0.3814 0.4783 0.3706 -0.1159 -0.0373 -0.0326 68  GLN B C   
1572 O O   . GLN B 68  ? 0.4078 0.5206 0.4002 -0.1346 -0.0416 -0.0266 68  GLN B O   
1573 C CB  . GLN B 68  ? 0.3468 0.4599 0.3497 -0.0850 -0.0233 -0.0338 68  GLN B CB  
1574 C CG  . GLN B 68  ? 0.3353 0.4732 0.3477 -0.0695 -0.0181 -0.0353 68  GLN B CG  
1575 C CD  . GLN B 68  ? 0.3298 0.4677 0.3480 -0.0628 -0.0122 -0.0349 68  GLN B CD  
1576 O OE1 . GLN B 68  ? 0.3592 0.5089 0.3815 -0.0713 -0.0122 -0.0305 68  GLN B OE1 
1577 N NE2 . GLN B 68  ? 0.3171 0.4427 0.3351 -0.0488 -0.0073 -0.0393 68  GLN B NE2 
1578 N N   . ASN B 69  ? 0.3927 0.4492 0.3683 -0.1107 -0.0381 -0.0373 69  ASN B N   
1579 C CA  . ASN B 69  ? 0.4204 0.4417 0.3822 -0.1243 -0.0443 -0.0363 69  ASN B CA  
1580 C C   . ASN B 69  ? 0.4457 0.4586 0.3976 -0.1419 -0.0548 -0.0401 69  ASN B C   
1581 O O   . ASN B 69  ? 0.4812 0.4625 0.4204 -0.1571 -0.0613 -0.0384 69  ASN B O   
1582 C CB  . ASN B 69  ? 0.4417 0.4252 0.3907 -0.1091 -0.0418 -0.0411 69  ASN B CB  
1583 C CG  . ASN B 69  ? 0.4362 0.4229 0.3925 -0.0979 -0.0335 -0.0367 69  ASN B CG  
1584 O OD1 . ASN B 69  ? 0.4325 0.4384 0.3988 -0.1043 -0.0312 -0.0293 69  ASN B OD1 
1585 N ND2 . ASN B 69  ? 0.4495 0.4210 0.4005 -0.0814 -0.0292 -0.0414 69  ASN B ND2 
1586 N N   . SER B 70  ? 0.4350 0.4728 0.3904 -0.1396 -0.0570 -0.0455 70  SER B N   
1587 C CA  . SER B 70  ? 0.4699 0.5092 0.4180 -0.1577 -0.0675 -0.0504 70  SER B CA  
1588 C C   . SER B 70  ? 0.4811 0.5558 0.4404 -0.1824 -0.0717 -0.0425 70  SER B C   
1589 O O   . SER B 70  ? 0.4922 0.5590 0.4438 -0.2051 -0.0815 -0.0446 70  SER B O   
1590 C CB  . SER B 70  ? 0.4576 0.5177 0.4053 -0.1457 -0.0687 -0.0585 70  SER B CB  
1591 O OG  . SER B 70  ? 0.4316 0.5420 0.3965 -0.1398 -0.0643 -0.0536 70  SER B OG  
1592 N N   . LYS B 71  ? 0.4805 0.5954 0.4573 -0.1781 -0.0646 -0.0341 71  LYS B N   
1593 C CA  . LYS B 71  ? 0.5047 0.6661 0.4942 -0.1989 -0.0673 -0.0258 71  LYS B CA  
1594 C C   . LYS B 71  ? 0.5263 0.6608 0.5065 -0.2293 -0.0747 -0.0196 71  LYS B C   
1595 O O   . LYS B 71  ? 0.5622 0.7147 0.5425 -0.2546 -0.0833 -0.0191 71  LYS B O   
1596 C CB  . LYS B 71  ? 0.5257 0.7226 0.5308 -0.1877 -0.0581 -0.0177 71  LYS B CB  
1597 C CG  . LYS B 71  ? 0.5497 0.7695 0.5627 -0.1586 -0.0511 -0.0228 71  LYS B CG  
1598 C CD  . LYS B 71  ? 0.5877 0.8626 0.6100 -0.1574 -0.0540 -0.0242 71  LYS B CD  
1599 C CE  . LYS B 71  ? 0.5939 0.8892 0.6228 -0.1270 -0.0464 -0.0266 71  LYS B CE  
1600 N NZ  . LYS B 71  ? 0.5671 0.9145 0.6024 -0.1190 -0.0489 -0.0282 71  LYS B NZ  
1601 N N   . ARG B 72  ? 0.5062 0.5966 0.4770 -0.2275 -0.0721 -0.0148 72  ARG B N   
1602 C CA  . ARG B 72  ? 0.5586 0.6110 0.5158 -0.2543 -0.0792 -0.0072 72  ARG B CA  
1603 C C   . ARG B 72  ? 0.6010 0.6100 0.5382 -0.2710 -0.0916 -0.0168 72  ARG B C   
1604 O O   . ARG B 72  ? 0.6291 0.6066 0.5540 -0.2978 -0.0995 -0.0108 72  ARG B O   
1605 C CB  . ARG B 72  ? 0.5712 0.5810 0.5187 -0.2426 -0.0740 -0.0012 72  ARG B CB  
1606 C CG  . ARG B 72  ? 0.5780 0.5431 0.5116 -0.2160 -0.0723 -0.0131 72  ARG B CG  
1607 C CD  . ARG B 72  ? 0.5630 0.5132 0.4959 -0.1970 -0.0640 -0.0078 72  ARG B CD  
1608 N NE  . ARG B 72  ? 0.6139 0.5229 0.5311 -0.2100 -0.0679 0.0022  72  ARG B NE  
1609 C CZ  . ARG B 72  ? 0.6772 0.5246 0.5693 -0.2099 -0.0751 -0.0020 72  ARG B CZ  
1610 N NH1 . ARG B 72  ? 0.7215 0.5317 0.5987 -0.2214 -0.0786 0.0095  72  ARG B NH1 
1611 N NH2 . ARG B 72  ? 0.7012 0.5228 0.5810 -0.1974 -0.0793 -0.0175 72  ARG B NH2 
1612 N N   . LYS B 73  ? 0.5777 0.5839 0.5104 -0.2557 -0.0938 -0.0315 73  LYS B N   
1613 C CA  . LYS B 73  ? 0.6284 0.5973 0.5414 -0.2685 -0.1060 -0.0436 73  LYS B CA  
1614 C C   . LYS B 73  ? 0.6250 0.6413 0.5469 -0.2856 -0.1131 -0.0490 73  LYS B C   
1615 O O   . LYS B 73  ? 0.6820 0.6811 0.5924 -0.3130 -0.1252 -0.0539 73  LYS B O   
1616 C CB  . LYS B 73  ? 0.6227 0.5544 0.5208 -0.2388 -0.1042 -0.0570 73  LYS B CB  
1617 C CG  . LYS B 73  ? 0.6316 0.5139 0.5173 -0.2237 -0.0996 -0.0533 73  LYS B CG  
1618 C CD  . LYS B 73  ? 0.6975 0.5173 0.5581 -0.2426 -0.1106 -0.0542 73  LYS B CD  
1619 C CE  . LYS B 73  ? 0.7179 0.4883 0.5632 -0.2240 -0.1067 -0.0507 73  LYS B CE  
1620 N NZ  . LYS B 73  ? 0.7874 0.4886 0.6029 -0.2393 -0.1193 -0.0539 73  LYS B NZ  
1621 N N   . GLY B 74  ? 0.5857 0.6611 0.5267 -0.2693 -0.1062 -0.0486 74  GLY B N   
1622 C CA  . GLY B 74  ? 0.5834 0.7110 0.5330 -0.2790 -0.1122 -0.0541 74  GLY B CA  
1623 C C   . GLY B 74  ? 0.5384 0.7180 0.5043 -0.2500 -0.1029 -0.0537 74  GLY B C   
1624 O O   . GLY B 74  ? 0.5055 0.6740 0.4745 -0.2245 -0.0925 -0.0506 74  GLY B O   
1625 N N   . PRO B 75  ? 0.5404 0.7771 0.5160 -0.2541 -0.1070 -0.0566 75  PRO B N   
1626 C CA  . PRO B 75  ? 0.5045 0.7919 0.4936 -0.2261 -0.0992 -0.0551 75  PRO B CA  
1627 C C   . PRO B 75  ? 0.4997 0.7795 0.4792 -0.2008 -0.0993 -0.0655 75  PRO B C   
1628 O O   . PRO B 75  ? 0.5042 0.8210 0.4918 -0.1770 -0.0937 -0.0636 75  PRO B O   
1629 C CB  . PRO B 75  ? 0.4992 0.8583 0.5031 -0.2454 -0.1045 -0.0512 75  PRO B CB  
1630 C CG  . PRO B 75  ? 0.5305 0.8732 0.5235 -0.2786 -0.1180 -0.0584 75  PRO B CG  
1631 C CD  . PRO B 75  ? 0.5550 0.8179 0.5308 -0.2884 -0.1193 -0.0591 75  PRO B CD  
1632 N N   . GLU B 76  ? 0.5134 0.7456 0.4744 -0.2044 -0.1055 -0.0758 76  GLU B N   
1633 C CA  . GLU B 76  ? 0.4999 0.7307 0.4505 -0.1832 -0.1065 -0.0854 76  GLU B CA  
1634 C C   . GLU B 76  ? 0.4642 0.6933 0.4183 -0.1490 -0.0940 -0.0802 76  GLU B C   
1635 O O   . GLU B 76  ? 0.4466 0.7111 0.4044 -0.1302 -0.0916 -0.0793 76  GLU B O   
1636 C CB  . GLU B 76  ? 0.5417 0.7163 0.4696 -0.1884 -0.1139 -0.0979 76  GLU B CB  
1637 C CG  . GLU B 76  ? 0.5899 0.7526 0.5092 -0.2237 -0.1281 -0.1054 76  GLU B CG  
1638 C CD  . GLU B 76  ? 0.6215 0.7410 0.5378 -0.2449 -0.1289 -0.0986 76  GLU B CD  
1639 O OE1 . GLU B 76  ? 0.5849 0.7014 0.5115 -0.2350 -0.1183 -0.0866 76  GLU B OE1 
1640 O OE2 . GLU B 76  ? 0.6753 0.7623 0.5777 -0.2718 -0.1406 -0.1053 76  GLU B OE2 
1641 N N   . PHE B 77  ? 0.4460 0.6338 0.3980 -0.1413 -0.0864 -0.0762 77  PHE B N   
1642 C CA  . PHE B 77  ? 0.4139 0.5948 0.3677 -0.1129 -0.0752 -0.0719 77  PHE B CA  
1643 C C   . PHE B 77  ? 0.3888 0.6119 0.3588 -0.1012 -0.0688 -0.0633 77  PHE B C   
1644 O O   . PHE B 77  ? 0.3604 0.5925 0.3301 -0.0783 -0.0634 -0.0612 77  PHE B O   
1645 C CB  . PHE B 77  ? 0.4099 0.5418 0.3580 -0.1086 -0.0693 -0.0707 77  PHE B CB  
1646 C CG  . PHE B 77  ? 0.4230 0.5161 0.3521 -0.1040 -0.0727 -0.0800 77  PHE B CG  
1647 C CD1 . PHE B 77  ? 0.4194 0.5171 0.3408 -0.0847 -0.0704 -0.0834 77  PHE B CD1 
1648 C CD2 . PHE B 77  ? 0.4534 0.5054 0.3703 -0.1170 -0.0781 -0.0849 77  PHE B CD2 
1649 C CE1 . PHE B 77  ? 0.4366 0.5049 0.3398 -0.0785 -0.0733 -0.0926 77  PHE B CE1 
1650 C CE2 . PHE B 77  ? 0.4796 0.4971 0.3766 -0.1089 -0.0817 -0.0953 77  PHE B CE2 
1651 C CZ  . PHE B 77  ? 0.4655 0.4940 0.3564 -0.0893 -0.0790 -0.0994 77  PHE B CZ  
1652 N N   . THR B 78  ? 0.3973 0.6474 0.3799 -0.1164 -0.0700 -0.0582 78  THR B N   
1653 C CA  . THR B 78  ? 0.3937 0.6896 0.3903 -0.1031 -0.0649 -0.0517 78  THR B CA  
1654 C C   . THR B 78  ? 0.4094 0.7507 0.4064 -0.0918 -0.0688 -0.0538 78  THR B C   
1655 O O   . THR B 78  ? 0.3979 0.7554 0.3968 -0.0661 -0.0634 -0.0507 78  THR B O   
1656 C CB  . THR B 78  ? 0.3905 0.7175 0.4003 -0.1233 -0.0663 -0.0458 78  THR B CB  
1657 O OG1 . THR B 78  ? 0.3614 0.6483 0.3697 -0.1321 -0.0627 -0.0426 78  THR B OG1 
1658 C CG2 . THR B 78  ? 0.3787 0.7569 0.4015 -0.1053 -0.0611 -0.0407 78  THR B CG2 
1659 N N   . ARG B 79  ? 0.4374 0.7985 0.4317 -0.1109 -0.0788 -0.0591 79  ARG B N   
1660 C CA  . ARG B 79  ? 0.4662 0.8761 0.4606 -0.1017 -0.0839 -0.0618 79  ARG B CA  
1661 C C   . ARG B 79  ? 0.4415 0.8279 0.4219 -0.0750 -0.0808 -0.0642 79  ARG B C   
1662 O O   . ARG B 79  ? 0.4227 0.8329 0.4035 -0.0492 -0.0768 -0.0598 79  ARG B O   
1663 C CB  . ARG B 79  ? 0.5086 0.9441 0.5026 -0.1325 -0.0965 -0.0684 79  ARG B CB  
1664 C CG  . ARG B 79  ? 0.5579 1.0615 0.5561 -0.1260 -0.1024 -0.0705 79  ARG B CG  
1665 C CD  . ARG B 79  ? 0.6078 1.1340 0.6027 -0.1561 -0.1162 -0.0800 79  ARG B CD  
1666 N NE  . ARG B 79  ? 0.6653 1.1333 0.6414 -0.1621 -0.1210 -0.0906 79  ARG B NE  
1667 C CZ  . ARG B 79  ? 0.6942 1.1126 0.6623 -0.1889 -0.1262 -0.0957 79  ARG B CZ  
1668 N NH1 . ARG B 79  ? 0.6904 1.1084 0.6678 -0.2164 -0.1275 -0.0897 79  ARG B NH1 
1669 N NH2 . ARG B 79  ? 0.7179 1.0865 0.6668 -0.1868 -0.1302 -0.1065 79  ARG B NH2 
1670 N N   . GLU B 80  ? 0.4406 0.7798 0.4076 -0.0802 -0.0824 -0.0703 80  GLU B N   
1671 C CA  . GLU B 80  ? 0.4461 0.7685 0.3991 -0.0585 -0.0802 -0.0723 80  GLU B CA  
1672 C C   . GLU B 80  ? 0.4202 0.7227 0.3726 -0.0322 -0.0685 -0.0633 80  GLU B C   
1673 O O   . GLU B 80  ? 0.4157 0.7283 0.3612 -0.0106 -0.0661 -0.0597 80  GLU B O   
1674 C CB  . GLU B 80  ? 0.4780 0.7551 0.4161 -0.0686 -0.0839 -0.0814 80  GLU B CB  
1675 C CG  . GLU B 80  ? 0.5201 0.8065 0.4530 -0.0940 -0.0971 -0.0928 80  GLU B CG  
1676 C CD  . GLU B 80  ? 0.5572 0.8952 0.4885 -0.0904 -0.1046 -0.0971 80  GLU B CD  
1677 O OE1 . GLU B 80  ? 0.5753 0.9276 0.5009 -0.0644 -0.1005 -0.0938 80  GLU B OE1 
1678 O OE2 . GLU B 80  ? 0.6131 0.9795 0.5487 -0.1149 -0.1149 -0.1031 80  GLU B OE2 
1679 N N   . PHE B 81  ? 0.4091 0.6825 0.3677 -0.0346 -0.0616 -0.0594 81  PHE B N   
1680 C CA  . PHE B 81  ? 0.3984 0.6510 0.3565 -0.0131 -0.0513 -0.0519 81  PHE B CA  
1681 C C   . PHE B 81  ? 0.3929 0.6806 0.3573 0.0044  -0.0494 -0.0460 81  PHE B C   
1682 O O   . PHE B 81  ? 0.3981 0.6731 0.3571 0.0261  -0.0433 -0.0400 81  PHE B O   
1683 C CB  . PHE B 81  ? 0.3717 0.5894 0.3353 -0.0204 -0.0452 -0.0505 81  PHE B CB  
1684 C CG  . PHE B 81  ? 0.3658 0.5409 0.3192 -0.0206 -0.0420 -0.0527 81  PHE B CG  
1685 C CD1 . PHE B 81  ? 0.3618 0.5198 0.3076 -0.0030 -0.0352 -0.0480 81  PHE B CD1 
1686 C CD2 . PHE B 81  ? 0.3746 0.5271 0.3249 -0.0377 -0.0457 -0.0586 81  PHE B CD2 
1687 C CE1 . PHE B 81  ? 0.3688 0.4963 0.3062 -0.0028 -0.0318 -0.0494 81  PHE B CE1 
1688 C CE2 . PHE B 81  ? 0.3719 0.4899 0.3120 -0.0342 -0.0427 -0.0611 81  PHE B CE2 
1689 C CZ  . PHE B 81  ? 0.3710 0.4804 0.3056 -0.0169 -0.0356 -0.0567 81  PHE B CZ  
1690 N N   . GLU B 82  ? 0.3875 0.7194 0.3622 -0.0047 -0.0548 -0.0474 82  GLU B N   
1691 C CA  . GLU B 82  ? 0.4065 0.7762 0.3870 0.0142  -0.0532 -0.0429 82  GLU B CA  
1692 C C   . GLU B 82  ? 0.4153 0.7969 0.3841 0.0408  -0.0533 -0.0393 82  GLU B C   
1693 O O   . GLU B 82  ? 0.4209 0.7983 0.3858 0.0660  -0.0483 -0.0335 82  GLU B O   
1694 C CB  . GLU B 82  ? 0.4312 0.8575 0.4245 -0.0020 -0.0601 -0.0451 82  GLU B CB  
1695 C CG  . GLU B 82  ? 0.4503 0.9125 0.4522 0.0153  -0.0568 -0.0411 82  GLU B CG  
1696 C CD  . GLU B 82  ? 0.4920 1.0271 0.5025 0.0113  -0.0639 -0.0418 82  GLU B CD  
1697 O OE1 . GLU B 82  ? 0.5332 1.1032 0.5569 0.0000  -0.0641 -0.0406 82  GLU B OE1 
1698 O OE2 . GLU B 82  ? 0.5100 1.0710 0.5141 0.0194  -0.0691 -0.0432 82  GLU B OE2 
1699 N N   . SER B 83  ? 0.4264 0.8212 0.3877 0.0360  -0.0595 -0.0428 83  SER B N   
1700 C CA  . SER B 83  ? 0.4466 0.8567 0.3957 0.0611  -0.0600 -0.0383 83  SER B CA  
1701 C C   . SER B 83  ? 0.4363 0.7961 0.3713 0.0800  -0.0517 -0.0305 83  SER B C   
1702 O O   . SER B 83  ? 0.4487 0.8168 0.3724 0.1034  -0.0509 -0.0237 83  SER B O   
1703 C CB  . SER B 83  ? 0.4743 0.9155 0.4187 0.0496  -0.0695 -0.0454 83  SER B CB  
1704 O OG  . SER B 83  ? 0.5119 0.9277 0.4577 0.0208  -0.0731 -0.0541 83  SER B OG  
1705 N N   . VAL B 84  ? 0.4142 0.7245 0.3493 0.0701  -0.0456 -0.0304 84  VAL B N   
1706 C CA  . VAL B 84  ? 0.4105 0.6763 0.3330 0.0838  -0.0377 -0.0221 84  VAL B CA  
1707 C C   . VAL B 84  ? 0.4030 0.6318 0.3286 0.0894  -0.0295 -0.0170 84  VAL B C   
1708 O O   . VAL B 84  ? 0.4043 0.6002 0.3194 0.1015  -0.0233 -0.0084 84  VAL B O   
1709 C CB  . VAL B 84  ? 0.4115 0.6521 0.3272 0.0701  -0.0372 -0.0258 84  VAL B CB  
1710 C CG1 . VAL B 84  ? 0.4254 0.6980 0.3348 0.0659  -0.0459 -0.0327 84  VAL B CG1 
1711 C CG2 . VAL B 84  ? 0.3910 0.6071 0.3161 0.0487  -0.0360 -0.0327 84  VAL B CG2 
1712 N N   . LEU B 85  ? 0.3857 0.6209 0.3248 0.0799  -0.0298 -0.0220 85  LEU B N   
1713 C CA  . LEU B 85  ? 0.3853 0.5862 0.3279 0.0817  -0.0230 -0.0203 85  LEU B CA  
1714 C C   . LEU B 85  ? 0.4063 0.5952 0.3404 0.1072  -0.0197 -0.0137 85  LEU B C   
1715 O O   . LEU B 85  ? 0.4314 0.5805 0.3619 0.1097  -0.0140 -0.0108 85  LEU B O   
1716 C CB  . LEU B 85  ? 0.3611 0.5756 0.3194 0.0657  -0.0243 -0.0272 85  LEU B CB  
1717 C CG  . LEU B 85  ? 0.3563 0.5589 0.3197 0.0409  -0.0255 -0.0322 85  LEU B CG  
1718 C CD1 . LEU B 85  ? 0.3438 0.5662 0.3210 0.0252  -0.0279 -0.0365 85  LEU B CD1 
1719 C CD2 . LEU B 85  ? 0.3680 0.5248 0.3268 0.0379  -0.0188 -0.0305 85  LEU B CD2 
1720 N N   . VAL B 86  ? 0.4398 0.6615 0.3691 0.1265  -0.0237 -0.0114 86  VAL B N   
1721 C CA  . VAL B 86  ? 0.4738 0.6770 0.3899 0.1550  -0.0212 -0.0045 86  VAL B CA  
1722 C C   . VAL B 86  ? 0.4912 0.6492 0.3898 0.1621  -0.0165 0.0064  86  VAL B C   
1723 O O   . VAL B 86  ? 0.5040 0.6168 0.3942 0.1695  -0.0118 0.0112  86  VAL B O   
1724 C CB  . VAL B 86  ? 0.4965 0.7482 0.4088 0.1786  -0.0268 -0.0036 86  VAL B CB  
1725 C CG1 . VAL B 86  ? 0.5391 0.7614 0.4315 0.2114  -0.0247 0.0050  86  VAL B CG1 
1726 C CG2 . VAL B 86  ? 0.4866 0.7841 0.4153 0.1745  -0.0303 -0.0126 86  VAL B CG2 
1727 N N   . ASP B 87  ? 0.4988 0.6699 0.3913 0.1591  -0.0181 0.0106  87  ASP B N   
1728 C CA  . ASP B 87  ? 0.5313 0.6642 0.4084 0.1623  -0.0129 0.0223  87  ASP B CA  
1729 C C   . ASP B 87  ? 0.5062 0.6011 0.3891 0.1401  -0.0067 0.0211  87  ASP B C   
1730 O O   . ASP B 87  ? 0.5163 0.5700 0.3895 0.1416  -0.0008 0.0305  87  ASP B O   
1731 C CB  . ASP B 87  ? 0.5603 0.7191 0.4294 0.1638  -0.0157 0.0260  87  ASP B CB  
1732 C CG  . ASP B 87  ? 0.6114 0.7338 0.4649 0.1651  -0.0091 0.0395  87  ASP B CG  
1733 O OD1 . ASP B 87  ? 0.6296 0.7240 0.4678 0.1830  -0.0058 0.0529  87  ASP B OD1 
1734 O OD2 . ASP B 87  ? 0.6004 0.7200 0.4563 0.1479  -0.0070 0.0373  87  ASP B OD2 
1735 N N   . ALA B 88  ? 0.4666 0.5760 0.3646 0.1191  -0.0084 0.0100  88  ALA B N   
1736 C CA  . ALA B 88  ? 0.4347 0.5147 0.3382 0.1007  -0.0032 0.0081  88  ALA B CA  
1737 C C   . ALA B 88  ? 0.4445 0.4906 0.3499 0.1020  0.0013  0.0094  88  ALA B C   
1738 O O   . ALA B 88  ? 0.4600 0.4720 0.3599 0.0964  0.0072  0.0160  88  ALA B O   
1739 C CB  . ALA B 88  ? 0.4112 0.5104 0.3284 0.0813  -0.0067 -0.0036 88  ALA B CB  
1740 N N   . PHE B 89  ? 0.4317 0.4881 0.3438 0.1091  -0.0014 0.0030  89  PHE B N   
1741 C CA  . PHE B 89  ? 0.4502 0.4734 0.3625 0.1114  0.0019  0.0015  89  PHE B CA  
1742 C C   . PHE B 89  ? 0.4882 0.4731 0.3814 0.1284  0.0044  0.0125  89  PHE B C   
1743 O O   . PHE B 89  ? 0.5060 0.4500 0.3951 0.1220  0.0086  0.0150  89  PHE B O   
1744 C CB  . PHE B 89  ? 0.4384 0.4846 0.3609 0.1174  -0.0016 -0.0087 89  PHE B CB  
1745 C CG  . PHE B 89  ? 0.4016 0.4632 0.3416 0.0961  -0.0016 -0.0178 89  PHE B CG  
1746 C CD1 . PHE B 89  ? 0.3880 0.4831 0.3368 0.0828  -0.0051 -0.0207 89  PHE B CD1 
1747 C CD2 . PHE B 89  ? 0.3950 0.4357 0.3407 0.0893  0.0013  -0.0232 89  PHE B CD2 
1748 C CE1 . PHE B 89  ? 0.3628 0.4664 0.3246 0.0641  -0.0054 -0.0271 89  PHE B CE1 
1749 C CE2 . PHE B 89  ? 0.3740 0.4295 0.3340 0.0719  0.0013  -0.0300 89  PHE B CE2 
1750 C CZ  . PHE B 89  ? 0.3642 0.4488 0.3316 0.0595  -0.0018 -0.0309 89  PHE B CZ  
1751 N N   . SER B 90  ? 0.5111 0.5094 0.3922 0.1494  0.0014  0.0192  90  SER B N   
1752 C CA  . SER B 90  ? 0.5699 0.5284 0.4292 0.1678  0.0033  0.0319  90  SER B CA  
1753 C C   . SER B 90  ? 0.5808 0.5096 0.4327 0.1528  0.0092  0.0441  90  SER B C   
1754 O O   . SER B 90  ? 0.6186 0.4997 0.4598 0.1504  0.0131  0.0517  90  SER B O   
1755 C CB  . SER B 90  ? 0.5859 0.5719 0.4332 0.1947  -0.0013 0.0377  90  SER B CB  
1756 O OG  . SER B 90  ? 0.6457 0.5953 0.4700 0.2090  0.0010  0.0541  90  SER B OG  
1757 N N   . HIS B 91  ? 0.5618 0.5203 0.4194 0.1414  0.0097  0.0452  91  HIS B N   
1758 C CA  . HIS B 91  ? 0.5698 0.5109 0.4209 0.1286  0.0156  0.0564  91  HIS B CA  
1759 C C   . HIS B 91  ? 0.5603 0.4737 0.4202 0.1062  0.0208  0.0538  91  HIS B C   
1760 O O   . HIS B 91  ? 0.5737 0.4543 0.4240 0.0993  0.0262  0.0658  91  HIS B O   
1761 C CB  . HIS B 91  ? 0.5493 0.5311 0.4034 0.1238  0.0140  0.0549  91  HIS B CB  
1762 C CG  . HIS B 91  ? 0.5555 0.5276 0.4035 0.1119  0.0203  0.0652  91  HIS B CG  
1763 N ND1 . HIS B 91  ? 0.5901 0.5509 0.4198 0.1214  0.0237  0.0830  91  HIS B ND1 
1764 C CD2 . HIS B 91  ? 0.5318 0.5061 0.3895 0.0918  0.0243  0.0607  91  HIS B CD2 
1765 C CE1 . HIS B 91  ? 0.5838 0.5440 0.4128 0.1065  0.0297  0.0894  91  HIS B CE1 
1766 N NE2 . HIS B 91  ? 0.5468 0.5153 0.3928 0.0895  0.0300  0.0752  91  HIS B NE2 
1767 N N   . VAL B 92  ? 0.5442 0.4720 0.4219 0.0940  0.0194  0.0389  92  VAL B N   
1768 C CA  . VAL B 92  ? 0.5440 0.4528 0.4311 0.0734  0.0239  0.0353  92  VAL B CA  
1769 C C   . VAL B 92  ? 0.5890 0.4542 0.4700 0.0744  0.0253  0.0368  92  VAL B C   
1770 O O   . VAL B 92  ? 0.5754 0.4133 0.4544 0.0591  0.0301  0.0424  92  VAL B O   
1771 C CB  . VAL B 92  ? 0.5066 0.4423 0.4126 0.0620  0.0216  0.0198  92  VAL B CB  
1772 C CG1 . VAL B 92  ? 0.5130 0.4326 0.4283 0.0440  0.0257  0.0155  92  VAL B CG1 
1773 C CG2 . VAL B 92  ? 0.4842 0.4531 0.3934 0.0581  0.0198  0.0175  92  VAL B CG2 
1774 N N   . ALA B 93  ? 0.6025 0.4631 0.4802 0.0919  0.0205  0.0306  93  ALA B N   
1775 C CA  . ALA B 93  ? 0.6505 0.4651 0.5178 0.0975  0.0203  0.0302  93  ALA B CA  
1776 C C   . ALA B 93  ? 0.7056 0.4754 0.5507 0.1010  0.0232  0.0484  93  ALA B C   
1777 O O   . ALA B 93  ? 0.7272 0.4530 0.5655 0.0896  0.0254  0.0513  93  ALA B O   
1778 C CB  . ALA B 93  ? 0.6524 0.4759 0.5173 0.1215  0.0143  0.0205  93  ALA B CB  
1779 N N   . ARG B 94  ? 0.7312 0.5130 0.5642 0.1161  0.0229  0.0609  94  ARG B N   
1780 C CA  . ARG B 94  ? 0.7933 0.5350 0.6031 0.1212  0.0257  0.0811  94  ARG B CA  
1781 C C   . ARG B 94  ? 0.8027 0.5402 0.6154 0.0943  0.0329  0.0925  94  ARG B C   
1782 O O   . ARG B 94  ? 0.8444 0.5371 0.6444 0.0840  0.0362  0.1048  94  ARG B O   
1783 C CB  . ARG B 94  ? 0.8106 0.5740 0.6066 0.1466  0.0233  0.0917  94  ARG B CB  
1784 C CG  . ARG B 94  ? 0.8414 0.6019 0.6266 0.1784  0.0168  0.0867  94  ARG B CG  
1785 C CD  . ARG B 94  ? 0.8794 0.6619 0.6489 0.2041  0.0145  0.0993  94  ARG B CD  
1786 N NE  . ARG B 94  ? 0.8461 0.6976 0.6314 0.2065  0.0113  0.0905  94  ARG B NE  
1787 C CZ  . ARG B 94  ? 0.8320 0.7172 0.6201 0.1982  0.0130  0.0965  94  ARG B CZ  
1788 N NH1 . ARG B 94  ? 0.8585 0.7224 0.6360 0.1875  0.0189  0.1127  94  ARG B NH1 
1789 N NH2 . ARG B 94  ? 0.7889 0.7315 0.5903 0.1997  0.0084  0.0854  94  ARG B NH2 
1790 N N   . GLU B 95  ? 0.7700 0.5547 0.5983 0.0831  0.0349  0.0882  95  GLU B N   
1791 C CA  . GLU B 95  ? 0.7693 0.5621 0.5965 0.0655  0.0416  0.1015  95  GLU B CA  
1792 C C   . GLU B 95  ? 0.7250 0.5329 0.5708 0.0403  0.0454  0.0927  95  GLU B C   
1793 O O   . GLU B 95  ? 0.7287 0.5494 0.5743 0.0271  0.0510  0.1028  95  GLU B O   
1794 C CB  . GLU B 95  ? 0.7569 0.5930 0.5809 0.0767  0.0413  0.1065  95  GLU B CB  
1795 C CG  . GLU B 95  ? 0.8111 0.6469 0.6180 0.1039  0.0371  0.1143  95  GLU B CG  
1796 C CD  . GLU B 95  ? 0.8745 0.6741 0.6572 0.1094  0.0411  0.1388  95  GLU B CD  
1797 O OE1 . GLU B 95  ? 0.8798 0.6471 0.6589 0.0897  0.0469  0.1497  95  GLU B OE1 
1798 O OE2 . GLU B 95  ? 0.9203 0.7261 0.6873 0.1332  0.0382  0.1477  95  GLU B OE2 
1799 N N   . ALA B 96  ? 0.6884 0.5002 0.5500 0.0349  0.0424  0.0746  96  ALA B N   
1800 C CA  . ALA B 96  ? 0.6454 0.4725 0.5239 0.0124  0.0458  0.0668  96  ALA B CA  
1801 C C   . ALA B 96  ? 0.6624 0.4516 0.5399 -0.0050 0.0482  0.0687  96  ALA B C   
1802 O O   . ALA B 96  ? 0.7033 0.4495 0.5681 0.0012  0.0458  0.0717  96  ALA B O   
1803 C CB  . ALA B 96  ? 0.6008 0.4572 0.4966 0.0144  0.0416  0.0473  96  ALA B CB  
1804 N N   . ASP B 97  ? 0.6447 0.4500 0.5348 -0.0263 0.0524  0.0660  97  ASP B N   
1805 C CA  . ASP B 97  ? 0.6950 0.4710 0.5866 -0.0472 0.0541  0.0661  97  ASP B CA  
1806 C C   . ASP B 97  ? 0.7296 0.4760 0.6217 -0.0405 0.0479  0.0508  97  ASP B C   
1807 O O   . ASP B 97  ? 0.6928 0.4599 0.5939 -0.0262 0.0436  0.0363  97  ASP B O   
1808 C CB  . ASP B 97  ? 0.6586 0.4692 0.5672 -0.0682 0.0584  0.0614  97  ASP B CB  
1809 C CG  . ASP B 97  ? 0.6581 0.4923 0.5637 -0.0795 0.0657  0.0786  97  ASP B CG  
1810 O OD1 . ASP B 97  ? 0.6678 0.4899 0.5578 -0.0738 0.0680  0.0958  97  ASP B OD1 
1811 O OD2 . ASP B 97  ? 0.6316 0.5009 0.5504 -0.0928 0.0692  0.0747  97  ASP B OD2 
1812 N N   . GLU B 98  ? 0.7908 0.4894 0.6723 -0.0516 0.0474  0.0543  98  GLU B N   
1813 C CA  . GLU B 98  ? 0.8329 0.4962 0.7101 -0.0441 0.0411  0.0398  98  GLU B CA  
1814 C C   . GLU B 98  ? 0.8159 0.5129 0.7139 -0.0480 0.0390  0.0193  98  GLU B C   
1815 O O   . GLU B 98  ? 0.8151 0.5482 0.7290 -0.0648 0.0428  0.0175  98  GLU B O   
1816 C CB  . GLU B 98  ? 0.8880 0.4935 0.7509 -0.0627 0.0407  0.0455  98  GLU B CB  
1817 N N   . GLY B 99  ? 0.8478 0.5361 0.7447 -0.0306 0.0331  0.0044  99  GLY B N   
1818 C CA  . GLY B 99  ? 0.7887 0.5080 0.7034 -0.0324 0.0308  -0.0142 99  GLY B CA  
1819 C C   . GLY B 99  ? 0.7414 0.5125 0.6698 -0.0213 0.0311  -0.0173 99  GLY B C   
1820 O O   . GLY B 99  ? 0.7008 0.5044 0.6453 -0.0281 0.0311  -0.0276 99  GLY B O   
1821 N N   . CYS B 100 ? 0.6946 0.4733 0.6157 -0.0049 0.0308  -0.0082 100 CYS B N   
1822 C CA  . CYS B 100 ? 0.6353 0.4570 0.5668 0.0054  0.0292  -0.0127 100 CYS B CA  
1823 C C   . CYS B 100 ? 0.6207 0.4467 0.5510 0.0255  0.0235  -0.0232 100 CYS B C   
1824 O O   . CYS B 100 ? 0.5835 0.4459 0.5250 0.0299  0.0216  -0.0297 100 CYS B O   
1825 C CB  . CYS B 100 ? 0.6286 0.4644 0.5543 0.0110  0.0310  0.0002  100 CYS B CB  
1826 S SG  . CYS B 100 ? 0.7290 0.5349 0.6326 0.0319  0.0291  0.0122  100 CYS B SG  
1827 N N   . LYS B 101 ? 0.6571 0.4465 0.5734 0.0373  0.0208  -0.0252 101 LYS B N   
1828 C CA  . LYS B 101 ? 0.6572 0.4550 0.5698 0.0610  0.0156  -0.0342 101 LYS B CA  
1829 C C   . LYS B 101 ? 0.6209 0.4489 0.5492 0.0580  0.0138  -0.0498 101 LYS B C   
1830 O O   . LYS B 101 ? 0.5807 0.4465 0.5159 0.0700  0.0113  -0.0539 101 LYS B O   
1831 C CB  . LYS B 101 ? 0.7160 0.4627 0.6064 0.0778  0.0124  -0.0342 101 LYS B CB  
1832 C CG  . LYS B 101 ? 0.7354 0.4700 0.6083 0.0985  0.0115  -0.0205 101 LYS B CG  
1833 N N   . LYS B 102 ? 0.6022 0.4171 0.5360 0.0413  0.0149  -0.0576 102 LYS B N   
1834 C CA  . LYS B 102 ? 0.5649 0.4088 0.5125 0.0383  0.0134  -0.0719 102 LYS B CA  
1835 C C   . LYS B 102 ? 0.4972 0.3882 0.4612 0.0308  0.0152  -0.0689 102 LYS B C   
1836 O O   . LYS B 102 ? 0.4989 0.4223 0.4701 0.0393  0.0130  -0.0744 102 LYS B O   
1837 C CB  . LYS B 102 ? 0.5663 0.3910 0.5169 0.0201  0.0140  -0.0807 102 LYS B CB  
1838 N N   . PRO B 103 ? 0.4726 0.3674 0.4414 0.0150  0.0192  -0.0600 103 PRO B N   
1839 C CA  . PRO B 103 ? 0.4198 0.3518 0.4002 0.0096  0.0200  -0.0572 103 PRO B CA  
1840 C C   . PRO B 103 ? 0.4007 0.3559 0.3801 0.0227  0.0170  -0.0534 103 PRO B C   
1841 O O   . PRO B 103 ? 0.3478 0.3341 0.3364 0.0207  0.0153  -0.0557 103 PRO B O   
1842 C CB  . PRO B 103 ? 0.4268 0.3520 0.4064 -0.0034 0.0242  -0.0481 103 PRO B CB  
1843 C CG  . PRO B 103 ? 0.4741 0.3685 0.4486 -0.0127 0.0264  -0.0481 103 PRO B CG  
1844 C CD  . PRO B 103 ? 0.4990 0.3653 0.4626 0.0004  0.0228  -0.0528 103 PRO B CD  
1845 N N   . LEU B 104 ? 0.4191 0.3594 0.3866 0.0348  0.0161  -0.0470 104 LEU B N   
1846 C CA  . LEU B 104 ? 0.4279 0.3933 0.3937 0.0476  0.0127  -0.0437 104 LEU B CA  
1847 C C   . LEU B 104 ? 0.4239 0.4115 0.3930 0.0610  0.0090  -0.0520 104 LEU B C   
1848 O O   . LEU B 104 ? 0.3835 0.4083 0.3607 0.0612  0.0066  -0.0528 104 LEU B O   
1849 C CB  . LEU B 104 ? 0.4473 0.3928 0.3982 0.0592  0.0128  -0.0340 104 LEU B CB  
1850 C CG  . LEU B 104 ? 0.4497 0.3880 0.3978 0.0474  0.0163  -0.0242 104 LEU B CG  
1851 C CD1 . LEU B 104 ? 0.4956 0.4172 0.4279 0.0597  0.0166  -0.0130 104 LEU B CD1 
1852 C CD2 . LEU B 104 ? 0.4227 0.3947 0.3806 0.0389  0.0149  -0.0257 104 LEU B CD2 
1853 N N   . GLU B 105 ? 0.4556 0.4202 0.4175 0.0716  0.0084  -0.0585 105 GLU B N   
1854 C CA  . GLU B 105 ? 0.4879 0.4750 0.4517 0.0866  0.0052  -0.0681 105 GLU B CA  
1855 C C   . GLU B 105 ? 0.4475 0.4722 0.4279 0.0738  0.0054  -0.0732 105 GLU B C   
1856 O O   . GLU B 105 ? 0.4392 0.5043 0.4257 0.0803  0.0032  -0.0744 105 GLU B O   
1857 C CB  . GLU B 105 ? 0.5563 0.5055 0.5082 0.0972  0.0042  -0.0768 105 GLU B CB  
1858 C CG  . GLU B 105 ? 0.6164 0.5873 0.5674 0.1164  0.0007  -0.0888 105 GLU B CG  
1859 C CD  . GLU B 105 ? 0.7070 0.6322 0.6439 0.1250  -0.0011 -0.1000 105 GLU B CD  
1860 O OE1 . GLU B 105 ? 0.8205 0.6991 0.7391 0.1355  -0.0023 -0.0964 105 GLU B OE1 
1861 O OE2 . GLU B 105 ? 0.7331 0.6671 0.6760 0.1207  -0.0017 -0.1121 105 GLU B OE2 
1862 N N   . ARG B 106 ? 0.4260 0.4394 0.4128 0.0557  0.0083  -0.0747 106 ARG B N   
1863 C CA  . ARG B 106 ? 0.4129 0.4574 0.4131 0.0441  0.0087  -0.0773 106 ARG B CA  
1864 C C   . ARG B 106 ? 0.3711 0.4443 0.3780 0.0358  0.0078  -0.0691 106 ARG B C   
1865 O O   . ARG B 106 ? 0.3288 0.4359 0.3436 0.0334  0.0063  -0.0694 106 ARG B O   
1866 C CB  . ARG B 106 ? 0.4136 0.4425 0.4182 0.0279  0.0117  -0.0794 106 ARG B CB  
1867 C CG  . ARG B 106 ? 0.4097 0.4701 0.4258 0.0174  0.0120  -0.0786 106 ARG B CG  
1868 C CD  . ARG B 106 ? 0.4046 0.4603 0.4255 0.0065  0.0143  -0.0829 106 ARG B CD  
1869 N NE  . ARG B 106 ? 0.4201 0.4657 0.4387 0.0117  0.0137  -0.0944 106 ARG B NE  
1870 C CZ  . ARG B 106 ? 0.4030 0.4498 0.4259 0.0033  0.0148  -0.1009 106 ARG B CZ  
1871 N NH1 . ARG B 106 ? 0.3656 0.4252 0.3954 -0.0082 0.0169  -0.0962 106 ARG B NH1 
1872 N NH2 . ARG B 106 ? 0.4189 0.4533 0.4378 0.0077  0.0131  -0.1129 106 ARG B NH2 
1873 N N   . LEU B 107 ? 0.3700 0.4279 0.3727 0.0303  0.0086  -0.0618 107 LEU B N   
1874 C CA  . LEU B 107 ? 0.3671 0.4441 0.3726 0.0227  0.0066  -0.0556 107 LEU B CA  
1875 C C   . LEU B 107 ? 0.3443 0.4565 0.3517 0.0318  0.0026  -0.0552 107 LEU B C   
1876 O O   . LEU B 107 ? 0.3174 0.4585 0.3323 0.0222  0.0003  -0.0534 107 LEU B O   
1877 C CB  . LEU B 107 ? 0.4062 0.4610 0.4034 0.0215  0.0078  -0.0496 107 LEU B CB  
1878 C CG  . LEU B 107 ? 0.4243 0.4880 0.4223 0.0103  0.0060  -0.0458 107 LEU B CG  
1879 C CD1 . LEU B 107 ? 0.4524 0.4926 0.4424 0.0081  0.0088  -0.0415 107 LEU B CD1 
1880 C CD2 . LEU B 107 ? 0.4452 0.5359 0.4430 0.0143  0.0010  -0.0440 107 LEU B CD2 
1881 N N   . LEU B 108 ? 0.3388 0.4486 0.3388 0.0505  0.0016  -0.0564 108 LEU B N   
1882 C CA  . LEU B 108 ? 0.3258 0.4751 0.3271 0.0627  -0.0020 -0.0563 108 LEU B CA  
1883 C C   . LEU B 108 ? 0.3137 0.4976 0.3242 0.0636  -0.0026 -0.0614 108 LEU B C   
1884 O O   . LEU B 108 ? 0.3091 0.5371 0.3269 0.0601  -0.0052 -0.0588 108 LEU B O   
1885 C CB  . LEU B 108 ? 0.3524 0.4892 0.3408 0.0868  -0.0030 -0.0563 108 LEU B CB  
1886 C CG  . LEU B 108 ? 0.3564 0.4718 0.3359 0.0861  -0.0029 -0.0484 108 LEU B CG  
1887 C CD1 . LEU B 108 ? 0.3933 0.4887 0.3573 0.1107  -0.0036 -0.0468 108 LEU B CD1 
1888 C CD2 . LEU B 108 ? 0.3447 0.4964 0.3297 0.0768  -0.0065 -0.0440 108 LEU B CD2 
1889 N N   . ASN B 109 ? 0.3024 0.4693 0.3126 0.0667  -0.0002 -0.0685 109 ASN B N   
1890 C CA  . ASN B 109 ? 0.2840 0.4850 0.3025 0.0667  -0.0002 -0.0733 109 ASN B CA  
1891 C C   . ASN B 109 ? 0.2618 0.4891 0.2919 0.0442  -0.0001 -0.0667 109 ASN B C   
1892 O O   . ASN B 109 ? 0.2286 0.5017 0.2660 0.0423  -0.0015 -0.0645 109 ASN B O   
1893 C CB  . ASN B 109 ? 0.2933 0.4684 0.3083 0.0722  0.0016  -0.0833 109 ASN B CB  
1894 C CG  . ASN B 109 ? 0.3273 0.4844 0.3294 0.0974  0.0000  -0.0917 109 ASN B CG  
1895 O OD1 . ASN B 109 ? 0.3318 0.5039 0.3285 0.1137  -0.0022 -0.0896 109 ASN B OD1 
1896 N ND2 . ASN B 109 ? 0.3504 0.4747 0.3462 0.1011  0.0005  -0.1016 109 ASN B ND2 
1897 N N   . ILE B 110 ? 0.2689 0.4674 0.2991 0.0279  0.0012  -0.0630 110 ILE B N   
1898 C CA  . ILE B 110 ? 0.2708 0.4817 0.3076 0.0077  0.0007  -0.0563 110 ILE B CA  
1899 C C   . ILE B 110 ? 0.2585 0.4974 0.2977 -0.0007 -0.0034 -0.0493 110 ILE B C   
1900 O O   . ILE B 110 ? 0.2465 0.5136 0.2920 -0.0141 -0.0049 -0.0439 110 ILE B O   
1901 C CB  . ILE B 110 ? 0.2911 0.4634 0.3247 -0.0030 0.0027  -0.0552 110 ILE B CB  
1902 C CG1 . ILE B 110 ? 0.3096 0.4691 0.3444 0.0003  0.0062  -0.0619 110 ILE B CG1 
1903 C CG2 . ILE B 110 ? 0.2870 0.4629 0.3224 -0.0212 0.0008  -0.0479 110 ILE B CG2 
1904 C CD1 . ILE B 110 ? 0.3173 0.4421 0.3487 -0.0059 0.0088  -0.0623 110 ILE B CD1 
1905 N N   . TRP B 111 ? 0.2509 0.4824 0.2844 0.0060  -0.0053 -0.0489 111 TRP B N   
1906 C CA  . TRP B 111 ? 0.2548 0.5142 0.2898 -0.0007 -0.0100 -0.0442 111 TRP B CA  
1907 C C   . TRP B 111 ? 0.2540 0.5682 0.2965 0.0045  -0.0117 -0.0435 111 TRP B C   
1908 O O   . TRP B 111 ? 0.2387 0.5867 0.2876 -0.0118 -0.0150 -0.0380 111 TRP B O   
1909 C CB  . TRP B 111 ? 0.2646 0.5083 0.2908 0.0111  -0.0112 -0.0449 111 TRP B CB  
1910 C CG  . TRP B 111 ? 0.2672 0.4736 0.2867 0.0009  -0.0112 -0.0433 111 TRP B CG  
1911 C CD1 . TRP B 111 ? 0.2613 0.4419 0.2807 -0.0136 -0.0098 -0.0428 111 TRP B CD1 
1912 C CD2 . TRP B 111 ? 0.2764 0.4688 0.2868 0.0074  -0.0126 -0.0421 111 TRP B CD2 
1913 N NE1 . TRP B 111 ? 0.2719 0.4261 0.2830 -0.0162 -0.0104 -0.0423 111 TRP B NE1 
1914 C CE2 . TRP B 111 ? 0.2851 0.4461 0.2908 -0.0049 -0.0120 -0.0417 111 TRP B CE2 
1915 C CE3 . TRP B 111 ? 0.2947 0.4997 0.2993 0.0234  -0.0143 -0.0411 111 TRP B CE3 
1916 C CZ2 . TRP B 111 ? 0.2939 0.4387 0.2900 -0.0018 -0.0128 -0.0406 111 TRP B CZ2 
1917 C CZ3 . TRP B 111 ? 0.3137 0.5014 0.3087 0.0255  -0.0152 -0.0389 111 TRP B CZ3 
1918 C CH2 . TRP B 111 ? 0.3033 0.4619 0.2943 0.0127  -0.0142 -0.0388 111 TRP B CH2 
1919 N N   . GLN B 112 ? 0.2612 0.5838 0.3017 0.0276  -0.0097 -0.0494 112 GLN B N   
1920 C CA  . GLN B 112 ? 0.2630 0.6400 0.3091 0.0390  -0.0106 -0.0506 112 GLN B CA  
1921 C C   . GLN B 112 ? 0.2539 0.6571 0.3096 0.0234  -0.0090 -0.0473 112 GLN B C   
1922 O O   . GLN B 112 ? 0.2509 0.7064 0.3149 0.0134  -0.0109 -0.0413 112 GLN B O   
1923 C CB  . GLN B 112 ? 0.2905 0.6573 0.3281 0.0698  -0.0091 -0.0598 112 GLN B CB  
1924 C CG  . GLN B 112 ? 0.3231 0.7451 0.3644 0.0869  -0.0096 -0.0636 112 GLN B CG  
1925 C CD  . GLN B 112 ? 0.3626 0.7765 0.3912 0.1220  -0.0103 -0.0728 112 GLN B CD  
1926 O OE1 . GLN B 112 ? 0.4202 0.8373 0.4452 0.1388  -0.0092 -0.0818 112 GLN B OE1 
1927 N NE2 . GLN B 112 ? 0.3989 0.8034 0.4194 0.1343  -0.0126 -0.0707 112 GLN B NE2 
1928 N N   . GLU B 113 ? 0.2351 0.6052 0.2894 0.0198  -0.0057 -0.0501 113 GLU B N   
1929 C CA  . GLU B 113 ? 0.2411 0.6343 0.3026 0.0069  -0.0039 -0.0459 113 GLU B CA  
1930 C C   . GLU B 113 ? 0.2407 0.6449 0.3073 -0.0219 -0.0061 -0.0335 113 GLU B C   
1931 O O   . GLU B 113 ? 0.2271 0.6730 0.3005 -0.0332 -0.0060 -0.0260 113 GLU B O   
1932 C CB  . GLU B 113 ? 0.2294 0.5852 0.2878 0.0089  -0.0004 -0.0515 113 GLU B CB  
1933 C CG  . GLU B 113 ? 0.2426 0.5920 0.2958 0.0343  0.0009  -0.0645 113 GLU B CG  
1934 C CD  . GLU B 113 ? 0.2490 0.5479 0.2969 0.0349  0.0033  -0.0719 113 GLU B CD  
1935 O OE1 . GLU B 113 ? 0.2287 0.5079 0.2785 0.0177  0.0045  -0.0666 113 GLU B OE1 
1936 O OE2 . GLU B 113 ? 0.2508 0.5296 0.2916 0.0526  0.0034  -0.0831 113 GLU B OE2 
1937 N N   . ARG B 114 ? 0.2429 0.6100 0.3045 -0.0336 -0.0084 -0.0313 114 ARG B N   
1938 C CA  . ARG B 114 ? 0.2608 0.6239 0.3230 -0.0603 -0.0117 -0.0216 114 ARG B CA  
1939 C C   . ARG B 114 ? 0.2646 0.6556 0.3289 -0.0708 -0.0172 -0.0181 114 ARG B C   
1940 O O   . ARG B 114 ? 0.2794 0.6550 0.3407 -0.0924 -0.0214 -0.0129 114 ARG B O   
1941 C CB  . ARG B 114 ? 0.2804 0.5834 0.3336 -0.0657 -0.0114 -0.0231 114 ARG B CB  
1942 C CG  . ARG B 114 ? 0.2883 0.5697 0.3404 -0.0602 -0.0068 -0.0252 114 ARG B CG  
1943 C CD  . ARG B 114 ? 0.3370 0.5667 0.3804 -0.0641 -0.0067 -0.0265 114 ARG B CD  
1944 N NE  . ARG B 114 ? 0.3535 0.5676 0.3964 -0.0571 -0.0023 -0.0296 114 ARG B NE  
1945 C CZ  . ARG B 114 ? 0.4016 0.5792 0.4387 -0.0540 -0.0005 -0.0332 114 ARG B CZ  
1946 N NH1 . ARG B 114 ? 0.4040 0.5543 0.4340 -0.0560 -0.0024 -0.0341 114 ARG B NH1 
1947 N NH2 . ARG B 114 ? 0.4106 0.5839 0.4492 -0.0480 0.0032  -0.0365 114 ARG B NH2 
1948 N N   . SER B 115 ? 0.2591 0.6903 0.3271 -0.0539 -0.0177 -0.0219 115 SER B N   
1949 C CA  . SER B 115 ? 0.2564 0.7222 0.3268 -0.0591 -0.0230 -0.0202 115 SER B CA  
1950 C C   . SER B 115 ? 0.2597 0.6881 0.3223 -0.0701 -0.0275 -0.0214 115 SER B C   
1951 O O   . SER B 115 ? 0.2437 0.6928 0.3083 -0.0905 -0.0334 -0.0175 115 SER B O   
1952 C CB  . SER B 115 ? 0.2615 0.7842 0.3421 -0.0815 -0.0255 -0.0106 115 SER B CB  
1953 O OG  . SER B 115 ? 0.2601 0.8219 0.3472 -0.0699 -0.0209 -0.0095 115 SER B OG  
1954 N N   . VAL B 116 ? 0.2588 0.6349 0.3121 -0.0569 -0.0251 -0.0271 116 VAL B N   
1955 C CA  . VAL B 116 ? 0.2669 0.6105 0.3115 -0.0631 -0.0288 -0.0291 116 VAL B CA  
1956 C C   . VAL B 116 ? 0.2761 0.6551 0.3207 -0.0525 -0.0327 -0.0311 116 VAL B C   
1957 O O   . VAL B 116 ? 0.2701 0.6529 0.3117 -0.0659 -0.0387 -0.0312 116 VAL B O   
1958 C CB  . VAL B 116 ? 0.2671 0.5539 0.3024 -0.0515 -0.0244 -0.0334 116 VAL B CB  
1959 C CG1 . VAL B 116 ? 0.2759 0.5378 0.3013 -0.0512 -0.0276 -0.0360 116 VAL B CG1 
1960 C CG2 . VAL B 116 ? 0.2726 0.5288 0.3072 -0.0645 -0.0222 -0.0311 116 VAL B CG2 
1961 N N   . TYR B 117 ? 0.2814 0.6846 0.3276 -0.0269 -0.0298 -0.0333 117 TYR B N   
1962 C CA  . TYR B 117 ? 0.3071 0.7556 0.3537 -0.0128 -0.0334 -0.0341 117 TYR B CA  
1963 C C   . TYR B 117 ? 0.3103 0.8075 0.3637 0.0058  -0.0310 -0.0345 117 TYR B C   
1964 O O   . TYR B 117 ? 0.3032 0.7889 0.3583 0.0114  -0.0263 -0.0359 117 TYR B O   
1965 C CB  . TYR B 117 ? 0.3154 0.7314 0.3493 0.0092  -0.0327 -0.0371 117 TYR B CB  
1966 C CG  . TYR B 117 ? 0.3122 0.6945 0.3384 -0.0046 -0.0358 -0.0374 117 TYR B CG  
1967 C CD1 . TYR B 117 ? 0.3253 0.7377 0.3517 -0.0166 -0.0431 -0.0376 117 TYR B CD1 
1968 C CD2 . TYR B 117 ? 0.3183 0.6431 0.3364 -0.0044 -0.0319 -0.0385 117 TYR B CD2 
1969 C CE1 . TYR B 117 ? 0.3295 0.7108 0.3465 -0.0269 -0.0465 -0.0400 117 TYR B CE1 
1970 C CE2 . TYR B 117 ? 0.3273 0.6245 0.3369 -0.0140 -0.0346 -0.0397 117 TYR B CE2 
1971 C CZ  . TYR B 117 ? 0.3290 0.6525 0.3373 -0.0244 -0.0420 -0.0410 117 TYR B CZ  
1972 O OH  . TYR B 117 ? 0.3512 0.6473 0.3491 -0.0319 -0.0451 -0.0441 117 TYR B OH  
1973 N N   . GLY B 118 ? 0.3374 0.8913 0.3937 0.0172  -0.0346 -0.0343 118 GLY B N   
1974 C CA  . GLY B 118 ? 0.3383 0.9450 0.3993 0.0394  -0.0329 -0.0357 118 GLY B CA  
1975 C C   . GLY B 118 ? 0.3585 0.9293 0.4074 0.0757  -0.0287 -0.0423 118 GLY B C   
1976 O O   . GLY B 118 ? 0.3717 0.8856 0.4087 0.0849  -0.0276 -0.0440 118 GLY B O   
1977 N N   . GLY B 119 ? 0.3457 0.9502 0.3966 0.0957  -0.0266 -0.0459 119 GLY B N   
1978 C CA  . GLY B 119 ? 0.3648 0.9356 0.4024 0.1305  -0.0238 -0.0539 119 GLY B CA  
1979 C C   . GLY B 119 ? 0.3803 0.9392 0.4034 0.1598  -0.0262 -0.0551 119 GLY B C   
1980 O O   . GLY B 119 ? 0.3849 0.8833 0.3928 0.1784  -0.0244 -0.0587 119 GLY B O   
1981 N N   . GLU B 120 ? 0.3820 0.9994 0.4092 0.1626  -0.0306 -0.0513 120 GLU B N   
1982 C CA  . GLU B 120 ? 0.4179 1.0352 0.4313 0.1922  -0.0334 -0.0511 120 GLU B CA  
1983 C C   . GLU B 120 ? 0.4121 0.9597 0.4150 0.1831  -0.0329 -0.0475 120 GLU B C   
1984 O O   . GLU B 120 ? 0.4318 0.9335 0.4174 0.2079  -0.0319 -0.0477 120 GLU B O   
1985 C CB  . GLU B 120 ? 0.4403 1.1454 0.4629 0.1928  -0.0387 -0.0476 120 GLU B CB  
1986 C CG  . GLU B 120 ? 0.4997 1.2119 0.5075 0.2249  -0.0422 -0.0463 120 GLU B CG  
1987 C CD  . GLU B 120 ? 0.5096 1.3194 0.5263 0.2318  -0.0476 -0.0445 120 GLU B CD  
1988 O OE1 . GLU B 120 ? 0.4919 1.3362 0.5207 0.2004  -0.0515 -0.0406 120 GLU B OE1 
1989 O OE2 . GLU B 120 ? 0.5553 1.4080 0.5656 0.2694  -0.0485 -0.0476 120 GLU B OE2 
1990 N N   . PHE B 121 ? 0.3823 0.9216 0.3947 0.1475  -0.0336 -0.0439 121 PHE B N   
1991 C CA  . PHE B 121 ? 0.3936 0.8768 0.3967 0.1383  -0.0332 -0.0408 121 PHE B CA  
1992 C C   . PHE B 121 ? 0.3769 0.7851 0.3719 0.1388  -0.0275 -0.0424 121 PHE B C   
1993 O O   . PHE B 121 ? 0.3894 0.7519 0.3705 0.1501  -0.0261 -0.0398 121 PHE B O   
1994 C CB  . PHE B 121 ? 0.3823 0.8791 0.3959 0.1019  -0.0366 -0.0385 121 PHE B CB  
1995 C CG  . PHE B 121 ? 0.3974 0.8461 0.4012 0.0942  -0.0368 -0.0364 121 PHE B CG  
1996 C CD1 . PHE B 121 ? 0.4177 0.8662 0.4087 0.1147  -0.0388 -0.0337 121 PHE B CD1 
1997 C CD2 . PHE B 121 ? 0.3884 0.7953 0.3943 0.0681  -0.0351 -0.0368 121 PHE B CD2 
1998 C CE1 . PHE B 121 ? 0.4316 0.8408 0.4132 0.1077  -0.0387 -0.0314 121 PHE B CE1 
1999 C CE2 . PHE B 121 ? 0.4074 0.7753 0.4037 0.0627  -0.0352 -0.0356 121 PHE B CE2 
2000 C CZ  . PHE B 121 ? 0.4231 0.7936 0.4075 0.0817  -0.0368 -0.0329 121 PHE B CZ  
2001 N N   . ILE B 122 ? 0.3500 0.7506 0.3536 0.1264  -0.0245 -0.0460 122 ILE B N   
2002 C CA  . ILE B 122 ? 0.3567 0.6964 0.3534 0.1293  -0.0196 -0.0493 122 ILE B CA  
2003 C C   . ILE B 122 ? 0.3725 0.6838 0.3524 0.1636  -0.0187 -0.0524 122 ILE B C   
2004 O O   . ILE B 122 ? 0.3776 0.6293 0.3460 0.1663  -0.0160 -0.0515 122 ILE B O   
2005 C CB  . ILE B 122 ? 0.3622 0.7109 0.3705 0.1159  -0.0171 -0.0537 122 ILE B CB  
2006 C CG1 . ILE B 122 ? 0.3431 0.7063 0.3644 0.0815  -0.0178 -0.0493 122 ILE B CG1 
2007 C CG2 . ILE B 122 ? 0.3670 0.6578 0.3682 0.1200  -0.0128 -0.0589 122 ILE B CG2 
2008 C CD1 . ILE B 122 ? 0.3489 0.6634 0.3664 0.0639  -0.0168 -0.0465 122 ILE B CD1 
2009 N N   . GLN B 123 ? 0.3803 0.7332 0.3575 0.1897  -0.0212 -0.0558 123 GLN B N   
2010 C CA  . GLN B 123 ? 0.4125 0.7355 0.3699 0.2259  -0.0216 -0.0590 123 GLN B CA  
2011 C C   . GLN B 123 ? 0.4328 0.7244 0.3745 0.2371  -0.0227 -0.0506 123 GLN B C   
2012 O O   . GLN B 123 ? 0.4532 0.6852 0.3766 0.2531  -0.0213 -0.0499 123 GLN B O   
2013 C CB  . GLN B 123 ? 0.4289 0.8103 0.3851 0.2560  -0.0246 -0.0648 123 GLN B CB  
2014 C CG  . GLN B 123 ? 0.4218 0.8229 0.3860 0.2559  -0.0231 -0.0744 123 GLN B CG  
2015 C CD  . GLN B 123 ? 0.4456 0.7750 0.3980 0.2604  -0.0205 -0.0826 123 GLN B CD  
2016 O OE1 . GLN B 123 ? 0.4154 0.7327 0.3784 0.2365  -0.0177 -0.0856 123 GLN B OE1 
2017 N NE2 . GLN B 123 ? 0.4860 0.7695 0.4156 0.2916  -0.0222 -0.0866 123 GLN B NE2 
2018 N N   . GLN B 124 ? 0.4242 0.7554 0.3723 0.2276  -0.0254 -0.0440 124 GLN B N   
2019 C CA  . GLN B 124 ? 0.4462 0.7531 0.3799 0.2366  -0.0263 -0.0352 124 GLN B CA  
2020 C C   . GLN B 124 ? 0.4439 0.6846 0.3733 0.2156  -0.0219 -0.0310 124 GLN B C   
2021 O O   . GLN B 124 ? 0.4697 0.6649 0.3818 0.2281  -0.0204 -0.0243 124 GLN B O   
2022 C CB  . GLN B 124 ? 0.4364 0.8017 0.3786 0.2270  -0.0307 -0.0311 124 GLN B CB  
2023 C CG  . GLN B 124 ? 0.4412 0.8870 0.3926 0.2394  -0.0352 -0.0344 124 GLN B CG  
2024 C CD  . GLN B 124 ? 0.4396 0.9399 0.3966 0.2307  -0.0405 -0.0305 124 GLN B CD  
2025 O OE1 . GLN B 124 ? 0.4475 0.9302 0.4062 0.2068  -0.0411 -0.0275 124 GLN B OE1 
2026 N NE2 . GLN B 124 ? 0.4588 1.0283 0.4175 0.2520  -0.0449 -0.0313 124 GLN B NE2 
2027 N N   . LEU B 125 ? 0.4206 0.6580 0.3651 0.1843  -0.0197 -0.0338 125 LEU B N   
2028 C CA  . LEU B 125 ? 0.4178 0.5990 0.3591 0.1656  -0.0153 -0.0305 125 LEU B CA  
2029 C C   . LEU B 125 ? 0.4522 0.5756 0.3822 0.1754  -0.0116 -0.0324 125 LEU B C   
2030 O O   . LEU B 125 ? 0.4633 0.5382 0.3804 0.1754  -0.0088 -0.0255 125 LEU B O   
2031 C CB  . LEU B 125 ? 0.3821 0.5737 0.3404 0.1335  -0.0144 -0.0337 125 LEU B CB  
2032 C CG  . LEU B 125 ? 0.3573 0.5912 0.3243 0.1176  -0.0186 -0.0322 125 LEU B CG  
2033 C CD1 . LEU B 125 ? 0.3269 0.5599 0.3069 0.0883  -0.0179 -0.0353 125 LEU B CD1 
2034 C CD2 . LEU B 125 ? 0.3703 0.5907 0.3254 0.1210  -0.0194 -0.0254 125 LEU B CD2 
2035 N N   . LYS B 126 ? 0.4643 0.5942 0.3984 0.1823  -0.0118 -0.0418 126 LYS B N   
2036 C CA  . LYS B 126 ? 0.5058 0.5836 0.4267 0.1954  -0.0103 -0.0468 126 LYS B CA  
2037 C C   . LYS B 126 ? 0.5697 0.6128 0.4664 0.2244  -0.0118 -0.0408 126 LYS B C   
2038 O O   . LYS B 126 ? 0.6013 0.5824 0.4834 0.2237  -0.0097 -0.0372 126 LYS B O   
2039 C CB  . LYS B 126 ? 0.5051 0.6070 0.4325 0.2042  -0.0116 -0.0596 126 LYS B CB  
2040 C CG  . LYS B 126 ? 0.4708 0.5888 0.4177 0.1755  -0.0092 -0.0644 126 LYS B CG  
2041 C CD  . LYS B 126 ? 0.4754 0.6154 0.4274 0.1836  -0.0099 -0.0765 126 LYS B CD  
2042 C CE  . LYS B 126 ? 0.4437 0.5973 0.4134 0.1546  -0.0072 -0.0784 126 LYS B CE  
2043 N NZ  . LYS B 126 ? 0.4538 0.6202 0.4263 0.1614  -0.0073 -0.0901 126 LYS B NZ  
2044 N N   . LEU B 127 ? 0.5833 0.6668 0.4750 0.2492  -0.0157 -0.0389 127 LEU B N   
2045 C CA  . LEU B 127 ? 0.6344 0.6886 0.5009 0.2811  -0.0178 -0.0319 127 LEU B CA  
2046 C C   . LEU B 127 ? 0.6646 0.6842 0.5211 0.2715  -0.0153 -0.0167 127 LEU B C   
2047 O O   . LEU B 127 ? 0.7215 0.6878 0.5545 0.2884  -0.0150 -0.0085 127 LEU B O   
2048 C CB  . LEU B 127 ? 0.6353 0.7532 0.5007 0.3101  -0.0226 -0.0331 127 LEU B CB  
2049 C CG  . LEU B 127 ? 0.6921 0.7917 0.5308 0.3486  -0.0256 -0.0252 127 LEU B CG  
2050 C CD1 . LEU B 127 ? 0.7511 0.7743 0.5654 0.3686  -0.0257 -0.0286 127 LEU B CD1 
2051 C CD2 . LEU B 127 ? 0.6882 0.8639 0.5290 0.3775  -0.0306 -0.0285 127 LEU B CD2 
2052 N N   . SER B 128 ? 0.6370 0.6848 0.5091 0.2451  -0.0138 -0.0126 128 SER B N   
2053 C CA  . SER B 128 ? 0.6616 0.6876 0.5245 0.2379  -0.0116 0.0008  128 SER B CA  
2054 C C   . SER B 128 ? 0.7040 0.6606 0.5577 0.2234  -0.0064 0.0062  128 SER B C   
2055 O O   . SER B 128 ? 0.7469 0.6716 0.5848 0.2264  -0.0043 0.0196  128 SER B O   
2056 C CB  . SER B 128 ? 0.6118 0.6840 0.4915 0.2149  -0.0121 0.0013  128 SER B CB  
2057 O OG  . SER B 128 ? 0.6232 0.6862 0.5186 0.1846  -0.0089 -0.0042 128 SER B OG  
2058 N N   . MET B 129 ? 0.7093 0.6449 0.5717 0.2088  -0.0045 -0.0034 129 MET B N   
2059 C CA  . MET B 129 ? 0.7655 0.6401 0.6205 0.1928  -0.0002 0.0002  129 MET B CA  
2060 C C   . MET B 129 ? 0.8481 0.6614 0.6780 0.2132  -0.0015 0.0027  129 MET B C   
2061 O O   . MET B 129 ? 0.8887 0.6516 0.7051 0.2042  0.0015  0.0139  129 MET B O   
2062 C CB  . MET B 129 ? 0.7452 0.6248 0.6193 0.1683  0.0017  -0.0117 129 MET B CB  
2063 C CG  . MET B 129 ? 0.7044 0.6347 0.5999 0.1486  0.0024  -0.0139 129 MET B CG  
2064 S SD  . MET B 129 ? 0.6915 0.6221 0.6064 0.1193  0.0055  -0.0239 129 MET B SD  
2065 C CE  . MET B 129 ? 0.6670 0.6005 0.5837 0.1332  0.0024  -0.0389 129 MET B CE  
2066 N N   . GLU B 130 ? 0.8538 0.6707 0.6765 0.2398  -0.0062 -0.0077 130 GLU B N   
2067 C CA  . GLU B 130 ? 0.9228 0.6789 0.7168 0.2658  -0.0091 -0.0065 130 GLU B CA  
2068 C C   . GLU B 130 ? 0.9447 0.7031 0.7184 0.2959  -0.0113 0.0073  130 GLU B C   
2069 O O   . GLU B 130 ? 0.9320 0.6910 0.7031 0.2869  -0.0084 0.0231  130 GLU B O   
2070 C CB  . GLU B 130 ? 0.9107 0.6700 0.7026 0.2861  -0.0137 -0.0255 130 GLU B CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  HIS 33  33  33  HIS HIS A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  HIS 36  36  36  HIS HIS A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  TRP 44  44  44  TRP TRP A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 CYS 100 100 100 CYS CYS A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 MET 129 129 129 MET MET A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 SER 132 132 ?   ?   ?   A . n 
A 1 133 LYS 133 133 ?   ?   ?   A . n 
A 1 134 SER 134 134 ?   ?   ?   A . n 
A 1 135 PRO 135 135 ?   ?   ?   A . n 
B 1 1   GLY 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   PHE 4   4   4   PHE PHE B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   GLU 6   6   6   GLU GLU B . n 
B 1 7   SER 7   7   7   SER SER B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  GLU 10  10  10  GLU GLU B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  LYS 12  12  12  LYS LYS B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  SER 14  14  14  SER SER B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  LEU 16  16  16  LEU LEU B . n 
B 1 17  SER 17  17  17  SER SER B . n 
B 1 18  ASN 18  18  18  ASN ASN B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  GLN 20  20  20  GLN GLN B . n 
B 1 21  HIS 21  21  21  HIS HIS B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  VAL 23  23  23  VAL VAL B . n 
B 1 24  GLN 24  24  24  GLN GLN B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  LEU 26  26  26  LEU LEU B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  TRP 29  29  29  TRP TRP B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  HIS 32  32  32  HIS HIS B . n 
B 1 33  HIS 33  33  33  HIS HIS B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  HIS 36  36  36  HIS HIS B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  ILE 40  40  40  ILE ILE B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  TRP 44  44  44  TRP TRP B . n 
B 1 45  HIS 45  45  45  HIS HIS B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  LYS 50  50  50  LYS LYS B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ASN 54  54  54  ASN ASN B . n 
B 1 55  ARG 55  55  55  ARG ARG B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  TYR 61  61  61  TYR TYR B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  SER 70  70  70  SER SER B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  PRO 75  75  75  PRO PRO B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  PHE 77  77  77  PHE PHE B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  HIS 91  91  91  HIS HIS B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 CYS 100 100 100 CYS CYS B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 TRP 111 111 111 TRP TRP B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 GLU 113 113 113 GLU GLU B . n 
B 1 114 ARG 114 114 114 ARG ARG B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 TYR 117 117 117 TYR TYR B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 ILE 122 122 122 ILE ILE B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 MET 129 129 129 MET MET B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ASP 131 131 ?   ?   ?   B . n 
B 1 132 SER 132 132 ?   ?   ?   B . n 
B 1 133 LYS 133 133 ?   ?   ?   B . n 
B 1 134 SER 134 134 ?   ?   ?   B . n 
B 1 135 PRO 135 135 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  201 1   SO4 SO4 A . 
D 2 SO4 1  202 2   SO4 SO4 A . 
E 2 SO4 1  203 4   SO4 SO4 A . 
F 3 UNX 1  204 1   UNX UNX A . 
G 3 UNX 1  205 2   UNX UNX A . 
H 3 UNX 1  206 4   UNX UNX A . 
I 3 UNX 1  207 5   UNX UNX A . 
J 3 UNX 1  208 8   UNX UNX A . 
K 3 UNX 1  209 10  UNX UNX A . 
L 2 SO4 1  201 3   SO4 SO4 B . 
M 2 SO4 1  202 5   SO4 SO4 B . 
N 2 SO4 1  203 6   SO4 SO4 B . 
O 3 UNX 1  204 3   UNX UNX B . 
P 3 UNX 1  205 6   UNX UNX B . 
Q 3 UNX 1  206 7   UNX UNX B . 
R 3 UNX 1  207 9   UNX UNX B . 
S 4 HOH 1  301 4   HOH HOH A . 
S 4 HOH 2  302 6   HOH HOH A . 
S 4 HOH 3  303 9   HOH HOH A . 
S 4 HOH 4  304 11  HOH HOH A . 
S 4 HOH 5  305 12  HOH HOH A . 
S 4 HOH 6  306 13  HOH HOH A . 
S 4 HOH 7  307 16  HOH HOH A . 
S 4 HOH 8  308 18  HOH HOH A . 
S 4 HOH 9  309 20  HOH HOH A . 
S 4 HOH 10 310 21  HOH HOH A . 
S 4 HOH 11 311 22  HOH HOH A . 
S 4 HOH 12 312 24  HOH HOH A . 
S 4 HOH 13 313 34  HOH HOH A . 
S 4 HOH 14 314 37  HOH HOH A . 
S 4 HOH 15 315 38  HOH HOH A . 
S 4 HOH 16 316 39  HOH HOH A . 
S 4 HOH 17 317 42  HOH HOH A . 
S 4 HOH 18 318 45  HOH HOH A . 
S 4 HOH 19 319 48  HOH HOH A . 
S 4 HOH 20 320 52  HOH HOH A . 
S 4 HOH 21 321 56  HOH HOH A . 
S 4 HOH 22 322 64  HOH HOH A . 
S 4 HOH 23 323 66  HOH HOH A . 
S 4 HOH 24 324 70  HOH HOH A . 
S 4 HOH 25 325 72  HOH HOH A . 
S 4 HOH 26 326 75  HOH HOH A . 
S 4 HOH 27 327 76  HOH HOH A . 
S 4 HOH 28 328 78  HOH HOH A . 
S 4 HOH 29 329 82  HOH HOH A . 
S 4 HOH 30 330 83  HOH HOH A . 
S 4 HOH 31 331 85  HOH HOH A . 
S 4 HOH 32 332 90  HOH HOH A . 
S 4 HOH 33 333 102 HOH HOH A . 
S 4 HOH 34 334 105 HOH HOH A . 
S 4 HOH 35 335 112 HOH HOH A . 
S 4 HOH 36 336 117 HOH HOH A . 
S 4 HOH 37 337 118 HOH HOH A . 
S 4 HOH 38 338 119 HOH HOH A . 
S 4 HOH 39 339 120 HOH HOH A . 
S 4 HOH 40 340 121 HOH HOH A . 
S 4 HOH 41 341 125 HOH HOH A . 
S 4 HOH 42 342 126 HOH HOH A . 
S 4 HOH 43 343 127 HOH HOH A . 
S 4 HOH 44 344 129 HOH HOH A . 
S 4 HOH 45 345 132 HOH HOH A . 
T 4 HOH 1  301 10  HOH HOH B . 
T 4 HOH 2  302 14  HOH HOH B . 
T 4 HOH 3  303 23  HOH HOH B . 
T 4 HOH 4  304 29  HOH HOH B . 
T 4 HOH 5  305 30  HOH HOH B . 
T 4 HOH 6  306 32  HOH HOH B . 
T 4 HOH 7  307 33  HOH HOH B . 
T 4 HOH 8  308 35  HOH HOH B . 
T 4 HOH 9  309 36  HOH HOH B . 
T 4 HOH 10 310 43  HOH HOH B . 
T 4 HOH 11 311 46  HOH HOH B . 
T 4 HOH 12 312 47  HOH HOH B . 
T 4 HOH 13 313 50  HOH HOH B . 
T 4 HOH 14 314 53  HOH HOH B . 
T 4 HOH 15 315 54  HOH HOH B . 
T 4 HOH 16 316 55  HOH HOH B . 
T 4 HOH 17 317 58  HOH HOH B . 
T 4 HOH 18 318 59  HOH HOH B . 
T 4 HOH 19 319 61  HOH HOH B . 
T 4 HOH 20 320 62  HOH HOH B . 
T 4 HOH 21 321 68  HOH HOH B . 
T 4 HOH 22 322 71  HOH HOH B . 
T 4 HOH 23 323 77  HOH HOH B . 
T 4 HOH 24 324 80  HOH HOH B . 
T 4 HOH 25 325 88  HOH HOH B . 
T 4 HOH 26 326 93  HOH HOH B . 
T 4 HOH 27 327 94  HOH HOH B . 
T 4 HOH 28 328 100 HOH HOH B . 
T 4 HOH 29 329 101 HOH HOH B . 
T 4 HOH 30 330 103 HOH HOH B . 
T 4 HOH 31 331 106 HOH HOH B . 
T 4 HOH 32 332 107 HOH HOH B . 
T 4 HOH 33 333 108 HOH HOH B . 
T 4 HOH 34 334 109 HOH HOH B . 
T 4 HOH 35 335 110 HOH HOH B . 
T 4 HOH 36 336 113 HOH HOH B . 
T 4 HOH 37 337 114 HOH HOH B . 
T 4 HOH 38 338 115 HOH HOH B . 
T 4 HOH 39 339 116 HOH HOH B . 
T 4 HOH 40 340 122 HOH HOH B . 
T 4 HOH 41 341 123 HOH HOH B . 
T 4 HOH 42 342 124 HOH HOH B . 
T 4 HOH 43 343 128 HOH HOH B . 
T 4 HOH 44 344 130 HOH HOH B . 
T 4 HOH 45 345 131 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6490  ? 
1 MORE         -117  ? 
1 'SSA (A^2)'  11110 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-10-17 
2 'Structure model' 1 1 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 1.9453  49.3398 9.2591  0.1317 0.0793 0.0819 0.0109  0.0196  0.0015  1.9957 2.2223 4.1523 -0.3501 
0.2250 1.7416  0.0281  0.0007 -0.0288 0.0743  0.1948  -0.0052 0.0476 -0.5390 -0.0698 
'X-RAY DIFFRACTION' 2 ? refined 12.9542 40.7848 20.1199 0.1205 0.1677 0.0860 -0.0024 -0.0006 -0.0377 2.4197 0.4835 4.1636 -0.5749 
0.4671 -0.0697 -0.1363 0.0799 0.0564  -0.2070 -0.0818 -0.0408 0.2166 0.0648  0.3804  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3 A 131 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 3 B 130 ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 PHASER      .        ?                program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      5.7.0027 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.11     'August 3, 2011' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             45 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             45 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.409 
_pdbx_validate_rmsd_bond.bond_target_value         1.354 
_pdbx_validate_rmsd_bond.bond_deviation            0.055 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.009 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 33  ? ? -98.33 31.65  
2 1 GLU A 130 ? ? -38.01 -70.42 
3 1 HIS B 33  ? ? -97.79 31.24  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 3   ? OG  ? A SER 3   OG  
2  1 Y 1 A LYS 11  ? CD  ? A LYS 11  CD  
3  1 Y 1 A LYS 11  ? CE  ? A LYS 11  CE  
4  1 Y 1 A LYS 11  ? NZ  ? A LYS 11  NZ  
5  1 Y 1 A GLN 20  ? CG  ? A GLN 20  CG  
6  1 Y 1 A GLN 20  ? CD  ? A GLN 20  CD  
7  1 Y 1 A GLN 20  ? OE1 ? A GLN 20  OE1 
8  1 Y 1 A GLN 20  ? NE2 ? A GLN 20  NE2 
9  1 Y 1 A LYS 50  ? NZ  ? A LYS 50  NZ  
10 1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
11 1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
12 1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
13 1 Y 1 A LYS 101 ? CG  ? A LYS 101 CG  
14 1 Y 1 A LYS 101 ? CD  ? A LYS 101 CD  
15 1 Y 1 A LYS 101 ? CE  ? A LYS 101 CE  
16 1 Y 1 A LYS 101 ? NZ  ? A LYS 101 NZ  
17 1 Y 1 A LYS 102 ? CG  ? A LYS 102 CG  
18 1 Y 1 A LYS 102 ? CD  ? A LYS 102 CD  
19 1 Y 1 A LYS 102 ? CE  ? A LYS 102 CE  
20 1 Y 1 A LYS 102 ? NZ  ? A LYS 102 NZ  
21 1 Y 1 A GLN 123 ? CD  ? A GLN 123 CD  
22 1 Y 1 A GLN 123 ? OE1 ? A GLN 123 OE1 
23 1 Y 1 A GLN 123 ? NE2 ? A GLN 123 NE2 
24 1 Y 1 A LYS 126 ? CD  ? A LYS 126 CD  
25 1 Y 1 A LYS 126 ? CE  ? A LYS 126 CE  
26 1 Y 1 A LYS 126 ? NZ  ? A LYS 126 NZ  
27 1 Y 1 A LEU 127 ? CG  ? A LEU 127 CG  
28 1 Y 1 A LEU 127 ? CD1 ? A LEU 127 CD1 
29 1 Y 1 A LEU 127 ? CD2 ? A LEU 127 CD2 
30 1 Y 1 A GLU 130 ? CG  ? A GLU 130 CG  
31 1 Y 1 A GLU 130 ? CD  ? A GLU 130 CD  
32 1 Y 1 A GLU 130 ? OE1 ? A GLU 130 OE1 
33 1 Y 1 A GLU 130 ? OE2 ? A GLU 130 OE2 
34 1 Y 1 A ASP 131 ? CG  ? A ASP 131 CG  
35 1 Y 1 A ASP 131 ? OD1 ? A ASP 131 OD1 
36 1 Y 1 A ASP 131 ? OD2 ? A ASP 131 OD2 
37 1 Y 1 B LYS 11  ? CE  ? B LYS 11  CE  
38 1 Y 1 B LYS 11  ? NZ  ? B LYS 11  NZ  
39 1 Y 1 B LYS 35  ? NZ  ? B LYS 35  NZ  
40 1 Y 1 B LYS 52  ? NZ  ? B LYS 52  NZ  
41 1 Y 1 B GLU 98  ? CG  ? B GLU 98  CG  
42 1 Y 1 B GLU 98  ? CD  ? B GLU 98  CD  
43 1 Y 1 B GLU 98  ? OE1 ? B GLU 98  OE1 
44 1 Y 1 B GLU 98  ? OE2 ? B GLU 98  OE2 
45 1 Y 1 B LYS 101 ? CD  ? B LYS 101 CD  
46 1 Y 1 B LYS 101 ? CE  ? B LYS 101 CE  
47 1 Y 1 B LYS 101 ? NZ  ? B LYS 101 NZ  
48 1 Y 1 B LYS 102 ? CG  ? B LYS 102 CG  
49 1 Y 1 B LYS 102 ? CD  ? B LYS 102 CD  
50 1 Y 1 B LYS 102 ? CE  ? B LYS 102 CE  
51 1 Y 1 B LYS 102 ? NZ  ? B LYS 102 NZ  
52 1 Y 1 B GLU 130 ? CG  ? B GLU 130 CG  
53 1 Y 1 B GLU 130 ? CD  ? B GLU 130 CD  
54 1 Y 1 B GLU 130 ? OE1 ? B GLU 130 OE1 
55 1 Y 1 B GLU 130 ? OE2 ? B GLU 130 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A SER 132 ? A SER 132 
4  1 Y 1 A LYS 133 ? A LYS 133 
5  1 Y 1 A SER 134 ? A SER 134 
6  1 Y 1 A PRO 135 ? A PRO 135 
7  1 Y 1 B GLY 1   ? B GLY 1   
8  1 Y 1 B SER 2   ? B SER 2   
9  1 Y 1 B ASP 131 ? B ASP 131 
10 1 Y 1 B SER 132 ? B SER 132 
11 1 Y 1 B LYS 133 ? B LYS 133 
12 1 Y 1 B SER 134 ? B SER 134 
13 1 Y 1 B PRO 135 ? B PRO 135 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'         SO4 
3 'UNKNOWN ATOM OR ION' UNX 
4 water                 HOH 
#