data_4HI7
# 
_entry.id   4HI7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HI7         
RCSB  RCSB075497   
WWPDB D_1000075497 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          EFI-501819 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4HI7 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-10-11 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vetting, M.W.'                    1  
'Toro, R.'                         2  
'Bhosle, R.'                       3  
'Al Obaidi, N.F.'                  4  
'Morisco, L.L.'                    5  
'Wasserman, S.R.'                  6  
'Sojitra, S.'                      7  
'Washington, E.'                   8  
'Scott Glenn, A.'                  9  
'Chowdhury, S.'                    10 
'Evans, B.'                        11 
'Hammonds, J.'                     12 
'Hillerich, B.'                    13 
'Love, J.'                         14 
'Seidel, R.D.'                     15 
'Imker, H.J.'                      16 
'Armstrong, R.N.'                  17 
'Gerlt, J.A.'                      18 
'Almo, S.C.'                       19 
'Enzyme Function Initiative (EFI)' 20 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of glutathione transferase homolog from drosophilia mojavensis, TARGET EFI-501819, with bound glutathione' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vetting, M.W.'                    1  
primary 'Toro, R.'                         2  
primary 'Bhosle, R.'                       3  
primary 'Al Obaidi, N.F.'                  4  
primary 'Morisco, L.L.'                    5  
primary 'Wasserman, S.R.'                  6  
primary 'Sojitra, S.'                      7  
primary 'Washington, E.'                   8  
primary 'Scott Glenn, A.'                  9  
primary 'Chowdhury, S.'                    10 
primary 'Evans, B.'                        11 
primary 'Hammonds, J.'                     12 
primary 'Hillerich, B.'                    13 
primary 'Love, J.'                         14 
primary 'Seidel, R.D.'                     15 
primary 'Imker, H.J.'                      16 
primary 'Armstrong, R.N.'                  17 
primary 'Gerlt, J.A.'                      18 
primary 'Almo, S.C.'                       19 
primary 'Enzyme Function Initiative (EFI)' 20 
# 
_cell.length_a           50.700 
_cell.length_b           50.700 
_cell.length_c           289.473 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4HI7 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.entry_id                         4HI7 
_symmetry.Int_Tables_number                152 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man GI20122     25556.354 2   ? ? ? ? 
2 non-polymer syn GLUTATHIONE 307.323   2   ? ? ? ? 
3 water       nat water       18.015    670 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GLUTATHIONE TRANSFERASE HOMOLOG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVKPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLEDGDANIADSHAIMAYLVSKYG
KDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIA
DFSLISSISSLVAFVPVDAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVGAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVKPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLEDGDANIADSHAIMAYLVSKYG
KDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIA
DFSLISSISSLVAFVPVDAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVGAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         EFI-501819 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   LYS n 
1 4   PRO n 
1 5   ILE n 
1 6   LEU n 
1 7   TYR n 
1 8   GLY n 
1 9   ILE n 
1 10  ASP n 
1 11  ALA n 
1 12  SER n 
1 13  PRO n 
1 14  PRO n 
1 15  VAL n 
1 16  ARG n 
1 17  ALA n 
1 18  VAL n 
1 19  LYS n 
1 20  LEU n 
1 21  THR n 
1 22  LEU n 
1 23  ALA n 
1 24  ALA n 
1 25  LEU n 
1 26  GLN n 
1 27  LEU n 
1 28  PRO n 
1 29  TYR n 
1 30  ASP n 
1 31  TYR n 
1 32  LYS n 
1 33  ILE n 
1 34  VAL n 
1 35  ASN n 
1 36  LEU n 
1 37  MET n 
1 38  ASN n 
1 39  LYS n 
1 40  GLU n 
1 41  GLN n 
1 42  HIS n 
1 43  SER n 
1 44  GLU n 
1 45  GLU n 
1 46  TYR n 
1 47  LEU n 
1 48  LYS n 
1 49  LYS n 
1 50  ASN n 
1 51  PRO n 
1 52  GLN n 
1 53  HIS n 
1 54  THR n 
1 55  VAL n 
1 56  PRO n 
1 57  LEU n 
1 58  LEU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  ASP n 
1 63  ALA n 
1 64  ASN n 
1 65  ILE n 
1 66  ALA n 
1 67  ASP n 
1 68  SER n 
1 69  HIS n 
1 70  ALA n 
1 71  ILE n 
1 72  MET n 
1 73  ALA n 
1 74  TYR n 
1 75  LEU n 
1 76  VAL n 
1 77  SER n 
1 78  LYS n 
1 79  TYR n 
1 80  GLY n 
1 81  LYS n 
1 82  ASP n 
1 83  ASP n 
1 84  SER n 
1 85  LEU n 
1 86  TYR n 
1 87  PRO n 
1 88  LYS n 
1 89  ASP n 
1 90  LEU n 
1 91  VAL n 
1 92  LYS n 
1 93  ARG n 
1 94  ALA n 
1 95  LEU n 
1 96  VAL n 
1 97  ASP n 
1 98  ASN n 
1 99  ARG n 
1 100 MET n 
1 101 TYR n 
1 102 PHE n 
1 103 GLU n 
1 104 SER n 
1 105 GLY n 
1 106 VAL n 
1 107 VAL n 
1 108 PHE n 
1 109 ALA n 
1 110 ASN n 
1 111 ALA n 
1 112 LEU n 
1 113 ARG n 
1 114 SER n 
1 115 LEU n 
1 116 ALA n 
1 117 LYS n 
1 118 MET n 
1 119 ILE n 
1 120 LEU n 
1 121 PHE n 
1 122 LEU n 
1 123 GLY n 
1 124 LYS n 
1 125 THR n 
1 126 GLU n 
1 127 VAL n 
1 128 PRO n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 ILE n 
1 133 ASP n 
1 134 ALA n 
1 135 ILE n 
1 136 THR n 
1 137 GLU n 
1 138 ALA n 
1 139 TYR n 
1 140 ASP n 
1 141 PHE n 
1 142 VAL n 
1 143 GLU n 
1 144 ALA n 
1 145 PHE n 
1 146 PHE n 
1 147 LYS n 
1 148 ASP n 
1 149 GLN n 
1 150 THR n 
1 151 TYR n 
1 152 VAL n 
1 153 ALA n 
1 154 GLY n 
1 155 ASN n 
1 156 GLN n 
1 157 LEU n 
1 158 THR n 
1 159 ILE n 
1 160 ALA n 
1 161 ASP n 
1 162 PHE n 
1 163 SER n 
1 164 LEU n 
1 165 ILE n 
1 166 SER n 
1 167 SER n 
1 168 ILE n 
1 169 SER n 
1 170 SER n 
1 171 LEU n 
1 172 VAL n 
1 173 ALA n 
1 174 PHE n 
1 175 VAL n 
1 176 PRO n 
1 177 VAL n 
1 178 ASP n 
1 179 ALA n 
1 180 ALA n 
1 181 LYS n 
1 182 TYR n 
1 183 PRO n 
1 184 LYS n 
1 185 LEU n 
1 186 SER n 
1 187 ALA n 
1 188 TRP n 
1 189 ILE n 
1 190 LYS n 
1 191 ARG n 
1 192 LEU n 
1 193 GLU n 
1 194 GLN n 
1 195 LEU n 
1 196 PRO n 
1 197 TYR n 
1 198 TYR n 
1 199 ALA n 
1 200 GLU n 
1 201 ASN n 
1 202 SER n 
1 203 THR n 
1 204 GLY n 
1 205 ALA n 
1 206 GLN n 
1 207 GLN n 
1 208 PHE n 
1 209 VAL n 
1 210 ALA n 
1 211 ALA n 
1 212 VAL n 
1 213 LYS n 
1 214 SER n 
1 215 LYS n 
1 216 PRO n 
1 217 PHE n 
1 218 THR n 
1 219 VAL n 
1 220 VAL n 
1 221 GLY n 
1 222 ALA n 
1 223 GLU n 
1 224 ASN n 
1 225 LEU n 
1 226 TYR n 
1 227 PHE n 
1 228 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GI20122, Dmoj\GI20122, Dmoj_GI20122' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila mojavensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7230 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B4KM86_DROMO 
_struct_ref.pdbx_db_accession          B4KM86 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVKPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLEDGDANIADSHAIMAYLVSKYG
KDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIA
DFSLISSISSLVAFVPVDAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4HI7 A 1 ? 221 ? B4KM86 1 ? 221 ? 1 221 
2 1 4HI7 B 1 ? 221 ? B4KM86 1 ? 221 ? 1 221 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4HI7 ALA A 222 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 222 1  
1 4HI7 GLU A 223 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 223 2  
1 4HI7 ASN A 224 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 224 3  
1 4HI7 LEU A 225 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 225 4  
1 4HI7 TYR A 226 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 226 5  
1 4HI7 PHE A 227 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 227 6  
1 4HI7 GLN A 228 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 228 7  
2 4HI7 ALA B 222 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 222 8  
2 4HI7 GLU B 223 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 223 9  
2 4HI7 ASN B 224 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 224 10 
2 4HI7 LEU B 225 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 225 11 
2 4HI7 TYR B 226 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 226 12 
2 4HI7 PHE B 227 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 227 13 
2 4HI7 GLN B 228 ? UNP B4KM86 ? ? 'EXPRESSION TAG' 228 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'      75.067  
GSH non-polymer         . GLUTATHIONE     ? 'C10 H17 N3 O6 S' 307.323 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER           ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4HI7 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'sitting drop vapor diffution' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;Protein (10 mM Hepes pH 7.5, 100 mM NaCl), Reservoir (0.2 M NaCl, 0.1 M Tris-CL pH 6.5, 30% PEG3000), Cryoprotection (reservoir + 20% ethylene glycol), sitting drop vapor diffution, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2012-08-13 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     4HI7 
_reflns.d_resolution_high            1.250 
_reflns.d_resolution_low             96.491 
_reflns.number_all                   116694 
_reflns.number_obs                   116694 
_reflns.pdbx_netI_over_sigmaI        10.800 
_reflns.pdbx_Rsym_value              0.073 
_reflns.pdbx_redundancy              4.700 
_reflns.percent_possible_obs         96.100 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.B_iso_Wilson_estimate        8.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.250 1.320 ? 55616 ? 0.457 1.700  0.457 ? 3.500 ? 15979 91.600 1 1 
1.320 1.400 ? 60178 ? 0.348 2.200  0.348 ? 3.800 ? 15675 94.500 2 1 
1.400 1.490 ? 60351 ? 0.259 3.000  0.259 ? 4.100 ? 14857 95.400 3 1 
1.490 1.610 ? 60132 ? 0.179 4.200  0.179 ? 4.300 ? 14029 96.600 4 1 
1.610 1.770 ? 59030 ? 0.132 5.500  0.132 ? 4.500 ? 13062 97.300 5 1 
1.770 1.980 ? 56965 ? 0.102 6.700  0.102 ? 4.800 ? 11915 97.700 6 1 
1.980 2.280 ? 53567 ? 0.083 7.700  0.083 ? 5.000 ? 10609 97.800 7 1 
2.280 2.800 ? 51170 ? 0.071 8.800  0.071 ? 5.600 ? 9105  98.200 8 1 
2.800 3.950 ? 51136 ? 0.053 11.300 0.053 ? 7.100 ? 7245  99.500 9 1 
# 
_refine.entry_id                                 4HI7 
_refine.ls_d_res_high                            1.2500 
_refine.ls_d_res_low                             30.1040 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.8900 
_refine.ls_number_reflns_obs                     116521 
_refine.ls_number_reflns_all                     116521 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.2013 
_refine.ls_R_factor_obs                          0.2013 
_refine.ls_R_factor_R_work                       0.1999 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2278 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_number_reflns_R_free                  5870 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               14.1348 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1600 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 2IL3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8451 
_refine.B_iso_max                                62.010 
_refine.B_iso_min                                2.450 
_refine.pdbx_overall_phase_error                 22.7200 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.130 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3461 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             670 
_refine_hist.number_atoms_total               4171 
_refine_hist.d_res_high                       1.2500 
_refine_hist.d_res_low                        30.1040 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           3651 0.011  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          4968 1.407  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     561  0.090  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      637  0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1380 15.399 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.2500 1.2642 30 89.0000  3403 . 0.3121 0.3383 . 196 . 3599 . . 'X-RAY DIFFRACTION' 
1.2642 1.2791 30 91.0000  3382 . 0.3070 0.3330 . 187 . 3569 . . 'X-RAY DIFFRACTION' 
1.2791 1.2947 30 92.0000  3514 . 0.3064 0.3093 . 190 . 3704 . . 'X-RAY DIFFRACTION' 
1.2947 1.3111 30 93.0000  3500 . 0.2847 0.3101 . 200 . 3700 . . 'X-RAY DIFFRACTION' 
1.3111 1.3283 30 93.0000  3555 . 0.2680 0.2883 . 178 . 3733 . . 'X-RAY DIFFRACTION' 
1.3283 1.3465 30 94.0000  3527 . 0.2574 0.2771 . 182 . 3709 . . 'X-RAY DIFFRACTION' 
1.3465 1.3657 30 95.0000  3565 . 0.2505 0.2539 . 235 . 3800 . . 'X-RAY DIFFRACTION' 
1.3657 1.3861 30 95.0000  3553 . 0.2501 0.2602 . 212 . 3765 . . 'X-RAY DIFFRACTION' 
1.3861 1.4078 30 95.0000  3664 . 0.2524 0.2834 . 185 . 3849 . . 'X-RAY DIFFRACTION' 
1.4078 1.4309 30 95.0000  3543 . 0.2450 0.2854 . 184 . 3727 . . 'X-RAY DIFFRACTION' 
1.4309 1.4555 30 95.0000  3659 . 0.2436 0.2597 . 175 . 3834 . . 'X-RAY DIFFRACTION' 
1.4555 1.4820 30 96.0000  3609 . 0.2354 0.2570 . 207 . 3816 . . 'X-RAY DIFFRACTION' 
1.4820 1.5105 30 96.0000  3661 . 0.2259 0.2581 . 184 . 3845 . . 'X-RAY DIFFRACTION' 
1.5105 1.5413 30 96.0000  3718 . 0.2205 0.2362 . 200 . 3918 . . 'X-RAY DIFFRACTION' 
1.5413 1.5749 30 96.0000  3663 . 0.2182 0.2572 . 175 . 3838 . . 'X-RAY DIFFRACTION' 
1.5749 1.6115 30 97.0000  3651 . 0.2090 0.2485 . 190 . 3841 . . 'X-RAY DIFFRACTION' 
1.6115 1.6518 30 96.0000  3744 . 0.2085 0.2105 . 167 . 3911 . . 'X-RAY DIFFRACTION' 
1.6518 1.6964 30 97.0000  3738 . 0.2117 0.2527 . 201 . 3939 . . 'X-RAY DIFFRACTION' 
1.6964 1.7464 30 97.0000  3734 . 0.2112 0.2324 . 195 . 3929 . . 'X-RAY DIFFRACTION' 
1.7464 1.8027 30 98.0000  3752 . 0.2180 0.2494 . 188 . 3940 . . 'X-RAY DIFFRACTION' 
1.8027 1.8671 30 98.0000  3749 . 0.2040 0.2440 . 211 . 3960 . . 'X-RAY DIFFRACTION' 
1.8671 1.9419 30 98.0000  3751 . 0.1979 0.2449 . 196 . 3947 . . 'X-RAY DIFFRACTION' 
1.9419 2.0303 30 97.0000  3773 . 0.1951 0.2306 . 192 . 3965 . . 'X-RAY DIFFRACTION' 
2.0303 2.1373 30 98.0000  3740 . 0.1881 0.2163 . 200 . 3940 . . 'X-RAY DIFFRACTION' 
2.1373 2.2711 30 98.0000  3785 . 0.1829 0.2021 . 187 . 3972 . . 'X-RAY DIFFRACTION' 
2.2711 2.4464 30 97.0000  3813 . 0.1820 0.2112 . 202 . 4015 . . 'X-RAY DIFFRACTION' 
2.4464 2.6925 30 98.0000  3861 . 0.1836 0.2279 . 193 . 4054 . . 'X-RAY DIFFRACTION' 
2.6925 3.0817 30 99.0000  3863 . 0.1814 0.2159 . 231 . 4094 . . 'X-RAY DIFFRACTION' 
3.0817 3.8814 30 100.0000 4020 . 0.1521 0.1884 . 210 . 4230 . . 'X-RAY DIFFRACTION' 
3.8814 30.104 30 98.0000  4161 . 0.1545 0.1595 . 217 . 4378 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4HI7 
_struct.title                     
'Crystal structure of glutathione transferase homolog from drosophilia mojavensis, TARGET EFI-501819, with bound glutathione' 
_struct.pdbx_descriptor           GI20122 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HI7 
_struct_keywords.text            
'GST, glutathione S-transferase, enzyme function initiative, EFI, Structural Genomics, UNKNOWN FUNCTION' 
_struct_keywords.pdbx_keywords   'UNKNOWN FUNCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 12  ? GLN A 26  ? SER A 12  GLN A 26  1 ? 15 
HELX_P HELX_P2  2  LYS A 39  ? HIS A 42  ? LYS A 39  HIS A 42  5 ? 4  
HELX_P HELX_P3  3  SER A 43  ? ASN A 50  ? SER A 43  ASN A 50  1 ? 8  
HELX_P HELX_P4  4  ASP A 67  ? GLY A 80  ? ASP A 67  GLY A 80  1 ? 14 
HELX_P HELX_P5  5  ASP A 89  ? VAL A 106 ? ASP A 89  VAL A 106 1 ? 18 
HELX_P HELX_P6  6  ALA A 111 ? PHE A 121 ? ALA A 111 PHE A 121 1 ? 11 
HELX_P HELX_P7  7  GLN A 129 ? PHE A 146 ? GLN A 129 PHE A 146 1 ? 18 
HELX_P HELX_P8  8  THR A 158 ? VAL A 172 ? THR A 158 VAL A 172 1 ? 15 
HELX_P HELX_P9  9  TYR A 182 ? GLU A 193 ? TYR A 182 GLU A 193 1 ? 12 
HELX_P HELX_P10 10 TYR A 198 ? SER A 214 ? TYR A 198 SER A 214 1 ? 17 
HELX_P HELX_P11 11 SER B 12  ? LEU B 25  ? SER B 12  LEU B 25  1 ? 14 
HELX_P HELX_P12 12 ASN B 35  ? HIS B 42  ? ASN B 35  HIS B 42  5 ? 8  
HELX_P HELX_P13 13 SER B 43  ? ASN B 50  ? SER B 43  ASN B 50  1 ? 8  
HELX_P HELX_P14 14 ASP B 67  ? GLY B 80  ? ASP B 67  GLY B 80  1 ? 14 
HELX_P HELX_P15 15 ASP B 89  ? VAL B 106 ? ASP B 89  VAL B 106 1 ? 18 
HELX_P HELX_P16 16 ALA B 111 ? PHE B 121 ? ALA B 111 PHE B 121 1 ? 11 
HELX_P HELX_P17 17 PRO B 128 ? PHE B 146 ? PRO B 128 PHE B 146 1 ? 19 
HELX_P HELX_P18 18 THR B 158 ? VAL B 172 ? THR B 158 VAL B 172 1 ? 15 
HELX_P HELX_P19 19 TYR B 182 ? GLU B 193 ? TYR B 182 GLU B 193 1 ? 12 
HELX_P HELX_P20 20 TYR B 198 ? SER B 214 ? TYR B 198 SER B 214 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 55 A . ? VAL 55 A PRO 56 A ? PRO 56 A 1 5.00 
2 VAL 55 B . ? VAL 55 B PRO 56 B ? PRO 56 B 1 4.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 30  ? ILE A 33  ? ASP A 30  ILE A 33  
A 2 ILE A 5   ? GLY A 8   ? ILE A 5   GLY A 8   
A 3 LEU A 57  ? ASP A 60  ? LEU A 57  ASP A 60  
A 4 ALA A 63  ? ALA A 66  ? ALA A 63  ALA A 66  
B 1 GLU A 126 ? PRO A 128 ? GLU A 126 PRO A 128 
B 2 THR A 218 ? VAL A 220 ? THR A 218 VAL A 220 
C 1 ASP B 30  ? ILE B 33  ? ASP B 30  ILE B 33  
C 2 ILE B 5   ? GLY B 8   ? ILE B 5   GLY B 8   
C 3 LEU B 57  ? ASP B 60  ? LEU B 57  ASP B 60  
C 4 ALA B 63  ? ALA B 66  ? ALA B 63  ALA B 66  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 32  ? O LYS A 32  N LEU A 6   ? N LEU A 6   
A 2 3 N TYR A 7   ? N TYR A 7   O LEU A 57  ? O LEU A 57  
A 3 4 N LEU A 58  ? N LEU A 58  O ILE A 65  ? O ILE A 65  
B 1 2 N VAL A 127 ? N VAL A 127 O THR A 218 ? O THR A 218 
C 1 2 O LYS B 32  ? O LYS B 32  N LEU B 6   ? N LEU B 6   
C 2 3 N ILE B 5   ? N ILE B 5   O GLU B 59  ? O GLU B 59  
C 3 4 N LEU B 58  ? N LEU B 58  O ILE B 65  ? O ILE B 65  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE GSH A 301' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE GSH B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 SER A 12  ? SER A 12  . ? 1_555 ? 
2  AC1 19 PRO A 14  ? PRO A 14  . ? 1_555 ? 
3  AC1 19 LEU A 36  ? LEU A 36  . ? 1_555 ? 
4  AC1 19 GLN A 41  ? GLN A 41  . ? 1_555 ? 
5  AC1 19 HIS A 53  ? HIS A 53  . ? 1_555 ? 
6  AC1 19 THR A 54  ? THR A 54  . ? 1_555 ? 
7  AC1 19 VAL A 55  ? VAL A 55  . ? 1_555 ? 
8  AC1 19 PRO A 56  ? PRO A 56  . ? 1_555 ? 
9  AC1 19 ASP A 67  ? ASP A 67  . ? 1_555 ? 
10 AC1 19 SER A 68  ? SER A 68  . ? 1_555 ? 
11 AC1 19 HIS A 69  ? HIS A 69  . ? 1_555 ? 
12 AC1 19 PHE A 108 ? PHE A 108 . ? 1_555 ? 
13 AC1 19 ARG A 113 ? ARG A 113 . ? 1_555 ? 
14 AC1 19 HOH E .   ? HOH A 410 . ? 1_555 ? 
15 AC1 19 HOH E .   ? HOH A 422 . ? 1_555 ? 
16 AC1 19 HOH E .   ? HOH A 426 . ? 1_555 ? 
17 AC1 19 HOH E .   ? HOH A 438 . ? 1_555 ? 
18 AC1 19 HOH E .   ? HOH A 466 . ? 1_555 ? 
19 AC1 19 HOH E .   ? HOH A 563 . ? 1_555 ? 
20 AC2 17 SER B 12  ? SER B 12  . ? 1_555 ? 
21 AC2 17 PRO B 14  ? PRO B 14  . ? 1_555 ? 
22 AC2 17 GLN B 41  ? GLN B 41  . ? 1_555 ? 
23 AC2 17 HIS B 53  ? HIS B 53  . ? 1_555 ? 
24 AC2 17 THR B 54  ? THR B 54  . ? 1_555 ? 
25 AC2 17 VAL B 55  ? VAL B 55  . ? 1_555 ? 
26 AC2 17 PRO B 56  ? PRO B 56  . ? 1_555 ? 
27 AC2 17 ASP B 67  ? ASP B 67  . ? 1_555 ? 
28 AC2 17 SER B 68  ? SER B 68  . ? 1_555 ? 
29 AC2 17 HIS B 69  ? HIS B 69  . ? 1_555 ? 
30 AC2 17 PHE B 108 ? PHE B 108 . ? 1_555 ? 
31 AC2 17 HOH F .   ? HOH B 404 . ? 1_555 ? 
32 AC2 17 HOH F .   ? HOH B 421 . ? 1_555 ? 
33 AC2 17 HOH F .   ? HOH B 422 . ? 1_555 ? 
34 AC2 17 HOH F .   ? HOH B 441 . ? 1_555 ? 
35 AC2 17 HOH F .   ? HOH B 456 . ? 1_555 ? 
36 AC2 17 HOH F .   ? HOH B 545 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4HI7 
_atom_sites.fract_transf_matrix[1][1]   0.019724 
_atom_sites.fract_transf_matrix[1][2]   0.011388 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022775 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003455 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 3   ? 4.421  29.009  6.789  1.00 14.05 ? 3   LYS A N   1 
ATOM   2    C CA  . LYS A 1 3   ? 5.536  28.057  6.788  1.00 11.96 ? 3   LYS A CA  1 
ATOM   3    C C   . LYS A 1 3   ? 6.410  28.165  8.033  1.00 9.76  ? 3   LYS A C   1 
ATOM   4    O O   . LYS A 1 3   ? 6.716  29.275  8.496  1.00 12.68 ? 3   LYS A O   1 
ATOM   5    C CB  . LYS A 1 3   ? 6.478  28.256  5.582  1.00 12.65 ? 3   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 3   ? 5.962  27.823  4.207  1.00 16.24 ? 3   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 3   ? 7.160  27.772  3.242  1.00 17.51 ? 3   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 3   ? 6.767  27.577  1.788  1.00 21.59 ? 3   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 3   ? 6.265  28.846  1.235  1.00 23.09 ? 3   LYS A NZ  1 
ATOM   10   N N   . PRO A 1 4   ? 6.830  27.006  8.557  1.00 10.08 ? 4   PRO A N   1 
ATOM   11   C CA  . PRO A 1 4   ? 7.855  27.024  9.587  1.00 10.63 ? 4   PRO A CA  1 
ATOM   12   C C   . PRO A 1 4   ? 9.141  27.685  9.045  1.00 7.37  ? 4   PRO A C   1 
ATOM   13   O O   . PRO A 1 4   ? 9.396  27.709  7.823  1.00 6.80  ? 4   PRO A O   1 
ATOM   14   C CB  . PRO A 1 4   ? 8.078  25.530  9.880  1.00 12.15 ? 4   PRO A CB  1 
ATOM   15   C CG  . PRO A 1 4   ? 6.836  24.834  9.383  1.00 12.27 ? 4   PRO A CG  1 
ATOM   16   C CD  . PRO A 1 4   ? 6.466  25.619  8.170  1.00 10.09 ? 4   PRO A CD  1 
ATOM   17   N N   . ILE A 1 5   ? 9.955  28.183  9.963  1.00 9.57  ? 5   ILE A N   1 
ATOM   18   C CA  . ILE A 1 5   ? 11.248 28.744  9.631  1.00 6.10  ? 5   ILE A CA  1 
ATOM   19   C C   . ILE A 1 5   ? 12.340 27.959  10.355 1.00 7.41  ? 5   ILE A C   1 
ATOM   20   O O   . ILE A 1 5   ? 12.274 27.734  11.573 1.00 6.53  ? 5   ILE A O   1 
ATOM   21   C CB  . ILE A 1 5   ? 11.310 30.233  10.018 1.00 9.43  ? 5   ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 5   ? 10.193 31.042  9.353  1.00 10.13 ? 5   ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 5   ? 12.656 30.821  9.636  1.00 8.69  ? 5   ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 5   ? 9.978  32.400  9.979  1.00 14.56 ? 5   ILE A CD1 1 
ATOM   25   N N   . LEU A 1 6   ? 13.348 27.544  9.606  1.00 5.68  ? 6   LEU A N   1 
ATOM   26   C CA  . LEU A 1 6   ? 14.452 26.807  10.184 1.00 6.02  ? 6   LEU A CA  1 
ATOM   27   C C   . LEU A 1 6   ? 15.695 27.645  10.087 1.00 6.94  ? 6   LEU A C   1 
ATOM   28   O O   . LEU A 1 6   ? 16.001 28.180  9.011  1.00 7.03  ? 6   LEU A O   1 
ATOM   29   C CB  . LEU A 1 6   ? 14.648 25.491  9.442  1.00 5.73  ? 6   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 6   ? 15.866 24.671  9.868  1.00 6.19  ? 6   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 6   ? 15.704 24.118  11.257 1.00 6.73  ? 6   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 6   ? 16.114 23.519  8.875  1.00 5.72  ? 6   LEU A CD2 1 
ATOM   33   N N   . TYR A 1 7   ? 16.384 27.779  11.213 1.00 7.23  ? 7   TYR A N   1 
ATOM   34   C CA  . TYR A 1 7   ? 17.646 28.513  11.256 1.00 7.00  ? 7   TYR A CA  1 
ATOM   35   C C   . TYR A 1 7   ? 18.791 27.519  11.306 1.00 6.17  ? 7   TYR A C   1 
ATOM   36   O O   . TYR A 1 7   ? 18.817 26.656  12.192 1.00 6.49  ? 7   TYR A O   1 
ATOM   37   C CB  . TYR A 1 7   ? 17.722 29.402  12.508 1.00 6.56  ? 7   TYR A CB  1 
ATOM   38   C CG  . TYR A 1 7   ? 16.711 30.498  12.496 1.00 6.37  ? 7   TYR A CG  1 
ATOM   39   C CD1 . TYR A 1 7   ? 15.384 30.253  12.844 1.00 7.60  ? 7   TYR A CD1 1 
ATOM   40   C CD2 . TYR A 1 7   ? 17.050 31.784  12.121 1.00 7.01  ? 7   TYR A CD2 1 
ATOM   41   C CE1 . TYR A 1 7   ? 14.413 31.244  12.800 1.00 9.19  ? 7   TYR A CE1 1 
ATOM   42   C CE2 . TYR A 1 7   ? 16.053 32.824  12.080 1.00 8.39  ? 7   TYR A CE2 1 
ATOM   43   C CZ  . TYR A 1 7   ? 14.745 32.522  12.430 1.00 10.63 ? 7   TYR A CZ  1 
ATOM   44   O OH  . TYR A 1 7   ? 13.751 33.482  12.403 1.00 12.12 ? 7   TYR A OH  1 
ATOM   45   N N   . GLY A 1 8   ? 19.789 27.658  10.420 1.00 6.34  ? 8   GLY A N   1 
ATOM   46   C CA  . GLY A 1 8   ? 20.876 26.696  10.399 1.00 7.40  ? 8   GLY A CA  1 
ATOM   47   C C   . GLY A 1 8   ? 21.928 26.987  9.343  1.00 6.67  ? 8   GLY A C   1 
ATOM   48   O O   . GLY A 1 8   ? 21.943 28.039  8.722  1.00 7.32  ? 8   GLY A O   1 
ATOM   49   N N   . ILE A 1 9   ? 22.806 26.008  9.145  1.00 5.96  ? 9   ILE A N   1 
ATOM   50   C CA  . ILE A 1 9   ? 23.731 26.014  8.015  1.00 8.62  ? 9   ILE A CA  1 
ATOM   51   C C   . ILE A 1 9   ? 23.956 24.571  7.642  1.00 8.00  ? 9   ILE A C   1 
ATOM   52   O O   . ILE A 1 9   ? 23.868 23.720  8.516  1.00 6.70  ? 9   ILE A O   1 
ATOM   53   C CB  . ILE A 1 9   ? 25.041 26.760  8.366  1.00 9.97  ? 9   ILE A CB  1 
ATOM   54   C CG1 . ILE A 1 9   ? 25.887 26.971  7.116  1.00 12.94 ? 9   ILE A CG1 1 
ATOM   55   C CG2 . ILE A 1 9   ? 25.767 26.062  9.512  1.00 11.82 ? 9   ILE A CG2 1 
ATOM   56   C CD1 . ILE A 1 9   ? 26.750 28.238  7.192  1.00 16.38 ? 9   ILE A CD1 1 
ATOM   57   N N   . ASP A 1 10  ? 24.170 24.269  6.362  1.00 8.32  ? 10  ASP A N   1 
ATOM   58   C CA  . ASP A 1 10  ? 24.105 22.855  5.927  1.00 6.50  ? 10  ASP A CA  1 
ATOM   59   C C   . ASP A 1 10  ? 25.263 22.047  6.493  1.00 7.20  ? 10  ASP A C   1 
ATOM   60   O O   . ASP A 1 10  ? 25.174 20.839  6.654  1.00 7.40  ? 10  ASP A O   1 
ATOM   61   C CB  . ASP A 1 10  ? 24.101 22.718  4.398  1.00 7.61  ? 10  ASP A CB  1 
ATOM   62   C CG  . ASP A 1 10  ? 22.783 23.154  3.758  1.00 7.12  ? 10  ASP A CG  1 
ATOM   63   O OD1 . ASP A 1 10  ? 21.832 23.443  4.495  1.00 8.92  ? 10  ASP A OD1 1 
ATOM   64   O OD2 . ASP A 1 10  ? 22.705 23.183  2.505  1.00 9.45  ? 10  ASP A OD2 1 
ATOM   65   N N   . ALA A 1 11  ? 26.381 22.698  6.782  1.00 7.22  ? 11  ALA A N   1 
ATOM   66   C CA  . ALA A 1 11  ? 27.487 21.926  7.314  1.00 7.12  ? 11  ALA A CA  1 
ATOM   67   C C   . ALA A 1 11  ? 27.223 21.360  8.711  1.00 5.97  ? 11  ALA A C   1 
ATOM   68   O O   . ALA A 1 11  ? 27.896 20.411  9.105  1.00 5.89  ? 11  ALA A O   1 
ATOM   69   C CB  . ALA A 1 11  ? 28.723 22.783  7.358  1.00 9.72  ? 11  ALA A CB  1 
ATOM   70   N N   . SER A 1 12  ? 26.288 21.961  9.465  1.00 7.19  ? 12  SER A N   1 
ATOM   71   C CA  . SER A 1 12  ? 25.989 21.510  10.828 1.00 6.44  ? 12  SER A CA  1 
ATOM   72   C C   . SER A 1 12  ? 25.242 20.165  10.844 1.00 7.08  ? 12  SER A C   1 
ATOM   73   O O   . SER A 1 12  ? 24.171 20.031  10.262 1.00 6.28  ? 12  SER A O   1 
ATOM   74   C CB  . SER A 1 12  ? 25.138 22.572  11.529 1.00 7.46  ? 12  SER A CB  1 
ATOM   75   O OG  . SER A 1 12  ? 24.539 22.039  12.715 1.00 8.25  ? 12  SER A OG  1 
ATOM   76   N N   . PRO A 1 13  ? 25.786 19.161  11.537 1.00 6.43  ? 13  PRO A N   1 
ATOM   77   C CA  . PRO A 1 13  ? 25.063 17.876  11.603 1.00 6.54  ? 13  PRO A CA  1 
ATOM   78   C C   . PRO A 1 13  ? 23.598 17.977  12.127 1.00 5.84  ? 13  PRO A C   1 
ATOM   79   O O   . PRO A 1 13  ? 22.681 17.477  11.468 1.00 4.33  ? 13  PRO A O   1 
ATOM   80   C CB  . PRO A 1 13  ? 25.967 17.010  12.507 1.00 7.11  ? 13  PRO A CB  1 
ATOM   81   C CG  . PRO A 1 13  ? 27.330 17.663  12.410 1.00 6.98  ? 13  PRO A CG  1 
ATOM   82   C CD  . PRO A 1 13  ? 27.135 19.116  12.128 1.00 6.53  ? 13  PRO A CD  1 
ATOM   83   N N   . PRO A 1 14  ? 23.367 18.618  13.290 1.00 3.59  ? 14  PRO A N   1 
ATOM   84   C CA  . PRO A 1 14  ? 21.971 18.585  13.771 1.00 3.66  ? 14  PRO A CA  1 
ATOM   85   C C   . PRO A 1 14  ? 21.040 19.365  12.861 1.00 4.06  ? 14  PRO A C   1 
ATOM   86   O O   . PRO A 1 14  ? 19.844 19.063  12.819 1.00 4.35  ? 14  PRO A O   1 
ATOM   87   C CB  . PRO A 1 14  ? 22.094 19.176  15.188 1.00 3.94  ? 14  PRO A CB  1 
ATOM   88   C CG  . PRO A 1 14  ? 23.367 19.973  15.168 1.00 6.58  ? 14  PRO A CG  1 
ATOM   89   C CD  . PRO A 1 14  ? 24.291 19.156  14.307 1.00 5.17  ? 14  PRO A CD  1 
ATOM   90   N N   . VAL A 1 15  ? 21.541 20.405  12.171 1.00 3.51  ? 15  VAL A N   1 
ATOM   91   C CA  . VAL A 1 15  ? 20.726 21.021  11.155 1.00 4.55  ? 15  VAL A CA  1 
ATOM   92   C C   . VAL A 1 15  ? 20.306 20.032  10.070 1.00 3.10  ? 15  VAL A C   1 
ATOM   93   O O   . VAL A 1 15  ? 19.110 19.978  9.692  1.00 3.66  ? 15  VAL A O   1 
ATOM   94   C CB  . VAL A 1 15  ? 21.410 22.257  10.565 1.00 5.02  ? 15  VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 15  ? 20.584 22.815  9.413  1.00 6.33  ? 15  VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 15  ? 21.598 23.305  11.675 1.00 4.99  ? 15  VAL A CG2 1 
ATOM   97   N N   . ARG A 1 16  ? 21.275 19.251  9.610  1.00 4.72  ? 16  ARG A N   1 
ATOM   98   C CA  . ARG A 1 16  ? 20.974 18.288  8.571  1.00 3.56  ? 16  ARG A CA  1 
ATOM   99   C C   . ARG A 1 16  ? 19.983 17.193  9.006  1.00 2.80  ? 16  ARG A C   1 
ATOM   100  O O   . ARG A 1 16  ? 19.079 16.797  8.197  1.00 4.74  ? 16  ARG A O   1 
ATOM   101  C CB  . ARG A 1 16  ? 22.249 17.650  8.041  1.00 4.24  ? 16  ARG A CB  1 
ATOM   102  C CG  . ARG A 1 16  ? 22.915 18.547  7.059  1.00 5.04  ? 16  ARG A CG  1 
ATOM   103  C CD  . ARG A 1 16  ? 24.221 17.889  6.572  1.00 3.96  ? 16  ARG A CD  1 
ATOM   104  N NE  . ARG A 1 16  ? 25.398 18.185  7.424  1.00 6.99  ? 16  ARG A NE  1 
ATOM   105  C CZ  . ARG A 1 16  ? 26.156 17.263  8.033  1.00 6.73  ? 16  ARG A CZ  1 
ATOM   106  N NH1 . ARG A 1 16  ? 27.211 17.665  8.741  1.00 6.59  ? 16  ARG A NH1 1 
ATOM   107  N NH2 . ARG A 1 16  ? 25.870 15.967  7.968  1.00 7.16  ? 16  ARG A NH2 1 
ATOM   108  N N   . ALA A 1 17  ? 20.037 16.783  10.270 1.00 2.45  ? 17  ALA A N   1 
ATOM   109  C CA  . ALA A 1 17  ? 18.999 15.845  10.763 1.00 3.51  ? 17  ALA A CA  1 
ATOM   110  C C   . ALA A 1 17  ? 17.615 16.482  10.586 1.00 4.10  ? 17  ALA A C   1 
ATOM   111  O O   . ALA A 1 17  ? 16.668 15.820  10.129 1.00 3.84  ? 17  ALA A O   1 
ATOM   112  C CB  . ALA A 1 17  ? 19.238 15.486  12.204 1.00 2.74  ? 17  ALA A CB  1 
ATOM   113  N N   . VAL A 1 18  ? 17.469 17.742  10.947 1.00 4.61  ? 18  VAL A N   1 
ATOM   114  C CA  . VAL A 1 18  ? 16.188 18.397  10.770 1.00 2.47  ? 18  VAL A CA  1 
ATOM   115  C C   . VAL A 1 18  ? 15.800 18.525  9.286  1.00 4.21  ? 18  VAL A C   1 
ATOM   116  O O   . VAL A 1 18  ? 14.645 18.309  8.920  1.00 3.40  ? 18  VAL A O   1 
ATOM   117  C CB  . VAL A 1 18  ? 16.125 19.765  11.501 1.00 3.74  ? 18  VAL A CB  1 
ATOM   118  C CG1 . VAL A 1 18  ? 14.806 20.419  11.260 1.00 4.98  ? 18  VAL A CG1 1 
ATOM   119  C CG2 . VAL A 1 18  ? 16.341 19.584  12.996 1.00 3.37  ? 18  VAL A CG2 1 
ATOM   120  N N   A LYS A 1 19  ? 16.764 18.881  8.440  0.13 4.42  ? 19  LYS A N   1 
ATOM   121  N N   B LYS A 1 19  ? 16.744 18.901  8.426  0.87 4.64  ? 19  LYS A N   1 
ATOM   122  C CA  A LYS A 1 19  ? 16.489 19.018  7.013  0.13 4.70  ? 19  LYS A CA  1 
ATOM   123  C CA  B LYS A 1 19  ? 16.460 18.999  7.006  0.87 3.97  ? 19  LYS A CA  1 
ATOM   124  C C   A LYS A 1 19  ? 16.012 17.712  6.395  0.13 4.67  ? 19  LYS A C   1 
ATOM   125  C C   B LYS A 1 19  ? 15.976 17.699  6.425  0.87 4.47  ? 19  LYS A C   1 
ATOM   126  O O   A LYS A 1 19  ? 15.136 17.725  5.533  0.13 5.05  ? 19  LYS A O   1 
ATOM   127  O O   B LYS A 1 19  ? 15.089 17.713  5.603  0.87 5.33  ? 19  LYS A O   1 
ATOM   128  C CB  A LYS A 1 19  ? 17.705 19.564  6.256  0.13 5.66  ? 19  LYS A CB  1 
ATOM   129  C CB  B LYS A 1 19  ? 17.659 19.519  6.217  0.87 5.40  ? 19  LYS A CB  1 
ATOM   130  C CG  A LYS A 1 19  ? 18.039 21.009  6.597  0.13 6.27  ? 19  LYS A CG  1 
ATOM   131  C CG  B LYS A 1 19  ? 18.021 20.965  6.560  0.87 6.21  ? 19  LYS A CG  1 
ATOM   132  C CD  A LYS A 1 19  ? 19.127 21.578  5.695  0.13 6.91  ? 19  LYS A CD  1 
ATOM   133  C CD  B LYS A 1 19  ? 19.066 21.564  5.624  0.87 6.77  ? 19  LYS A CD  1 
ATOM   134  C CE  A LYS A 1 19  ? 18.547 22.176  4.429  0.13 8.31  ? 19  LYS A CE  1 
ATOM   135  C CE  B LYS A 1 19  ? 18.474 22.397  4.501  0.87 9.10  ? 19  LYS A CE  1 
ATOM   136  N NZ  A LYS A 1 19  ? 17.498 23.177  4.760  0.13 8.71  ? 19  LYS A NZ  1 
ATOM   137  N NZ  B LYS A 1 19  ? 19.431 22.738  3.421  0.87 9.46  ? 19  LYS A NZ  1 
ATOM   138  N N   . LEU A 1 20  ? 16.587 16.594  6.835  1.00 4.84  ? 20  LEU A N   1 
ATOM   139  C CA  . LEU A 1 20  ? 16.140 15.305  6.381  1.00 5.59  ? 20  LEU A CA  1 
ATOM   140  C C   . LEU A 1 20  ? 14.683 15.083  6.796  1.00 3.93  ? 20  LEU A C   1 
ATOM   141  O O   . LEU A 1 20  ? 13.878 14.539  6.028  1.00 4.78  ? 20  LEU A O   1 
ATOM   142  C CB  . LEU A 1 20  ? 17.006 14.185  6.961  1.00 4.72  ? 20  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 20  ? 18.395 13.926  6.351  1.00 4.50  ? 20  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 20  ? 19.140 12.961  7.243  1.00 5.45  ? 20  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 20  ? 18.370 13.446  4.897  1.00 4.10  ? 20  LEU A CD2 1 
ATOM   146  N N   . THR A 1 21  ? 14.371 15.439  8.041  1.00 2.58  ? 21  THR A N   1 
ATOM   147  C CA  . THR A 1 21  ? 13.007 15.244  8.573  1.00 2.58  ? 21  THR A CA  1 
ATOM   148  C C   . THR A 1 21  ? 11.963 16.035  7.796  1.00 4.27  ? 21  THR A C   1 
ATOM   149  O O   . THR A 1 21  ? 10.882 15.534  7.471  1.00 5.65  ? 21  THR A O   1 
ATOM   150  C CB  . THR A 1 21  ? 12.981 15.581  10.083 1.00 2.72  ? 21  THR A CB  1 
ATOM   151  O OG1 . THR A 1 21  ? 13.999 14.793  10.737 1.00 3.75  ? 21  THR A OG1 1 
ATOM   152  C CG2 . THR A 1 21  ? 11.600 15.257  10.669 1.00 3.81  ? 21  THR A CG2 1 
ATOM   153  N N   . LEU A 1 22  ? 12.291 17.303  7.554  1.00 3.93  ? 22  LEU A N   1 
ATOM   154  C CA  . LEU A 1 22  ? 11.402 18.173  6.778  1.00 3.57  ? 22  LEU A CA  1 
ATOM   155  C C   . LEU A 1 22  ? 11.156 17.578  5.392  1.00 3.85  ? 22  LEU A C   1 
ATOM   156  O O   . LEU A 1 22  ? 10.020 17.623  4.891  1.00 6.08  ? 22  LEU A O   1 
ATOM   157  C CB  . LEU A 1 22  ? 11.954 19.611  6.703  1.00 3.78  ? 22  LEU A CB  1 
ATOM   158  C CG  . LEU A 1 22  ? 11.895 20.281  8.069  1.00 3.63  ? 22  LEU A CG  1 
ATOM   159  C CD1 . LEU A 1 22  ? 12.878 21.442  8.165  1.00 5.09  ? 22  LEU A CD1 1 
ATOM   160  C CD2 . LEU A 1 22  ? 10.479 20.773  8.294  1.00 6.19  ? 22  LEU A CD2 1 
ATOM   161  N N   . ALA A 1 23  ? 12.214 17.019  4.774  1.00 3.77  ? 23  ALA A N   1 
ATOM   162  C CA  . ALA A 1 23  ? 12.069 16.441  3.447  1.00 4.09  ? 23  ALA A CA  1 
ATOM   163  C C   . ALA A 1 23  ? 11.210 15.175  3.495  1.00 5.01  ? 23  ALA A C   1 
ATOM   164  O O   . ALA A 1 23  ? 10.377 14.936  2.625  1.00 4.50  ? 23  ALA A O   1 
ATOM   165  C CB  . ALA A 1 23  ? 13.443 16.123  2.837  1.00 6.10  ? 23  ALA A CB  1 
ATOM   166  N N   . ALA A 1 24  ? 11.413 14.384  4.544  1.00 4.88  ? 24  ALA A N   1 
ATOM   167  C CA  . ALA A 1 24  ? 10.665 13.149  4.682  1.00 3.08  ? 24  ALA A CA  1 
ATOM   168  C C   . ALA A 1 24  ? 9.174  13.443  4.838  1.00 5.37  ? 24  ALA A C   1 
ATOM   169  O O   . ALA A 1 24  ? 8.311  12.690  4.358  1.00 5.53  ? 24  ALA A O   1 
ATOM   170  C CB  . ALA A 1 24  ? 11.175 12.383  5.880  1.00 4.39  ? 24  ALA A CB  1 
ATOM   171  N N   . LEU A 1 25  ? 8.883  14.545  5.523  1.00 5.02  ? 25  LEU A N   1 
ATOM   172  C CA  . LEU A 1 25  ? 7.518  14.943  5.804  1.00 3.90  ? 25  LEU A CA  1 
ATOM   173  C C   . LEU A 1 25  ? 6.892  15.747  4.649  1.00 4.43  ? 25  LEU A C   1 
ATOM   174  O O   . LEU A 1 25  ? 5.705  16.045  4.706  1.00 5.57  ? 25  LEU A O   1 
ATOM   175  C CB  . LEU A 1 25  ? 7.533  15.804  7.072  1.00 5.52  ? 25  LEU A CB  1 
ATOM   176  C CG  . LEU A 1 25  ? 7.812  15.075  8.385  1.00 6.13  ? 25  LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 25  ? 8.003  16.080  9.502  1.00 8.23  ? 25  LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 25  ? 6.710  14.081  8.714  1.00 7.24  ? 25  LEU A CD2 1 
ATOM   179  N N   . GLN A 1 26  ? 7.699  16.141  3.662  1.00 4.35  ? 26  GLN A N   1 
ATOM   180  C CA  . GLN A 1 26  ? 7.233  17.028  2.565  1.00 4.75  ? 26  GLN A CA  1 
ATOM   181  C C   . GLN A 1 26  ? 6.638  18.318  3.096  1.00 6.28  ? 26  GLN A C   1 
ATOM   182  O O   . GLN A 1 26  ? 5.592  18.795  2.634  1.00 5.83  ? 26  GLN A O   1 
ATOM   183  C CB  . GLN A 1 26  ? 6.260  16.299  1.630  1.00 5.47  ? 26  GLN A CB  1 
ATOM   184  C CG  . GLN A 1 26  ? 6.953  15.136  0.932  1.00 7.20  ? 26  GLN A CG  1 
ATOM   185  C CD  . GLN A 1 26  ? 5.985  14.307  0.122  1.00 5.28  ? 26  GLN A CD  1 
ATOM   186  O OE1 . GLN A 1 26  ? 5.199  13.560  0.687  1.00 8.38  ? 26  GLN A OE1 1 
ATOM   187  N NE2 . GLN A 1 26  ? 6.051  14.428  -1.206 1.00 5.59  ? 26  GLN A NE2 1 
ATOM   188  N N   . LEU A 1 27  ? 7.287  18.859  4.118  1.00 5.00  ? 27  LEU A N   1 
ATOM   189  C CA  . LEU A 1 27  ? 6.803  20.067  4.760  1.00 5.52  ? 27  LEU A CA  1 
ATOM   190  C C   . LEU A 1 27  ? 7.613  21.273  4.281  1.00 6.72  ? 27  LEU A C   1 
ATOM   191  O O   . LEU A 1 27  ? 8.791  21.411  4.573  1.00 6.66  ? 27  LEU A O   1 
ATOM   192  C CB  . LEU A 1 27  ? 6.897  19.891  6.274  1.00 6.33  ? 27  LEU A CB  1 
ATOM   193  C CG  . LEU A 1 27  ? 6.501  21.127  7.069  1.00 9.88  ? 27  LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 27  ? 5.075  21.445  6.795  1.00 12.65 ? 27  LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 27  ? 6.688  20.874  8.550  1.00 10.30 ? 27  LEU A CD2 1 
ATOM   196  N N   . PRO A 1 28  ? 6.992  22.162  3.507  1.00 8.28  ? 28  PRO A N   1 
ATOM   197  C CA  . PRO A 1 28  ? 7.746  23.335  3.044  1.00 9.07  ? 28  PRO A CA  1 
ATOM   198  C C   . PRO A 1 28  ? 8.090  24.294  4.197  1.00 8.44  ? 28  PRO A C   1 
ATOM   199  O O   . PRO A 1 28  ? 7.314  24.421  5.159  1.00 8.80  ? 28  PRO A O   1 
ATOM   200  C CB  . PRO A 1 28  ? 6.791  24.002  2.041  1.00 11.36 ? 28  PRO A CB  1 
ATOM   201  C CG  . PRO A 1 28  ? 5.887  22.881  1.587  1.00 15.22 ? 28  PRO A CG  1 
ATOM   202  C CD  . PRO A 1 28  ? 5.698  22.015  2.819  1.00 11.50 ? 28  PRO A CD  1 
ATOM   203  N N   . TYR A 1 29  ? 9.249  24.938  4.089  1.00 7.32  ? 29  TYR A N   1 
ATOM   204  C CA  . TYR A 1 29  ? 9.779  25.749  5.171  1.00 7.44  ? 29  TYR A CA  1 
ATOM   205  C C   . TYR A 1 29  ? 10.664 26.820  4.575  1.00 8.05  ? 29  TYR A C   1 
ATOM   206  O O   . TYR A 1 29  ? 11.178 26.686  3.452  1.00 8.24  ? 29  TYR A O   1 
ATOM   207  C CB  . TYR A 1 29  ? 10.502 24.879  6.217  1.00 6.52  ? 29  TYR A CB  1 
ATOM   208  C CG  . TYR A 1 29  ? 11.769 24.219  5.746  1.00 6.40  ? 29  TYR A CG  1 
ATOM   209  C CD1 . TYR A 1 29  ? 11.707 23.014  5.061  1.00 5.88  ? 29  TYR A CD1 1 
ATOM   210  C CD2 . TYR A 1 29  ? 13.021 24.760  6.028  1.00 6.01  ? 29  TYR A CD2 1 
ATOM   211  C CE1 . TYR A 1 29  ? 12.840 22.375  4.640  1.00 7.51  ? 29  TYR A CE1 1 
ATOM   212  C CE2 . TYR A 1 29  ? 14.183 24.114  5.628  1.00 6.91  ? 29  TYR A CE2 1 
ATOM   213  C CZ  . TYR A 1 29  ? 14.091 22.912  4.928  1.00 6.97  ? 29  TYR A CZ  1 
ATOM   214  O OH  . TYR A 1 29  ? 15.287 22.292  4.551  1.00 8.90  ? 29  TYR A OH  1 
ATOM   215  N N   . ASP A 1 30  ? 10.792 27.909  5.318  1.00 8.63  ? 30  ASP A N   1 
ATOM   216  C CA  . ASP A 1 30  ? 11.778 28.932  5.000  1.00 9.25  ? 30  ASP A CA  1 
ATOM   217  C C   . ASP A 1 30  ? 13.089 28.642  5.718  1.00 8.58  ? 30  ASP A C   1 
ATOM   218  O O   . ASP A 1 30  ? 13.093 28.408  6.908  1.00 8.15  ? 30  ASP A O   1 
ATOM   219  C CB  . ASP A 1 30  ? 11.285 30.333  5.428  1.00 10.42 ? 30  ASP A CB  1 
ATOM   220  C CG  . ASP A 1 30  ? 10.045 30.780  4.686  1.00 13.34 ? 30  ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 30  ? 9.925  30.483  3.478  1.00 15.91 ? 30  ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 30  ? 9.201  31.479  5.304  1.00 13.18 ? 30  ASP A OD2 1 
ATOM   223  N N   . TYR A 1 31  ? 14.200 28.661  5.000  1.00 9.04  ? 31  TYR A N   1 
ATOM   224  C CA  . TYR A 1 31  ? 15.504 28.350  5.593  1.00 8.15  ? 31  TYR A CA  1 
ATOM   225  C C   . TYR A 1 31  ? 16.337 29.605  5.704  1.00 9.01  ? 31  TYR A C   1 
ATOM   226  O O   . TYR A 1 31  ? 16.550 30.269  4.705  1.00 9.85  ? 31  TYR A O   1 
ATOM   227  C CB  . TYR A 1 31  ? 16.205 27.302  4.714  1.00 8.90  ? 31  TYR A CB  1 
ATOM   228  C CG  . TYR A 1 31  ? 17.506 26.705  5.219  1.00 7.24  ? 31  TYR A CG  1 
ATOM   229  C CD1 . TYR A 1 31  ? 17.692 26.400  6.566  1.00 7.45  ? 31  TYR A CD1 1 
ATOM   230  C CD2 . TYR A 1 31  ? 18.532 26.377  4.322  1.00 10.88 ? 31  TYR A CD2 1 
ATOM   231  C CE1 . TYR A 1 31  ? 18.850 25.825  7.013  1.00 9.45  ? 31  TYR A CE1 1 
ATOM   232  C CE2 . TYR A 1 31  ? 19.705 25.772  4.763  1.00 9.95  ? 31  TYR A CE2 1 
ATOM   233  C CZ  . TYR A 1 31  ? 19.858 25.507  6.112  1.00 8.14  ? 31  TYR A CZ  1 
ATOM   234  O OH  . TYR A 1 31  ? 21.018 24.934  6.558  1.00 8.94  ? 31  TYR A OH  1 
ATOM   235  N N   . LYS A 1 32  ? 16.807 29.932  6.903  1.00 8.93  ? 32  LYS A N   1 
ATOM   236  C CA  . LYS A 1 32  ? 17.541 31.165  7.121  1.00 11.93 ? 32  LYS A CA  1 
ATOM   237  C C   . LYS A 1 32  ? 18.914 30.738  7.554  1.00 9.46  ? 32  LYS A C   1 
ATOM   238  O O   . LYS A 1 32  ? 19.073 30.042  8.570  1.00 9.11  ? 32  LYS A O   1 
ATOM   239  C CB  . LYS A 1 32  ? 16.843 31.991  8.211  1.00 11.10 ? 32  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 32  ? 15.408 32.433  7.866  1.00 18.51 ? 32  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 32  ? 15.360 33.560  6.847  1.00 26.03 ? 32  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 32  ? 13.916 33.934  6.519  1.00 30.58 ? 32  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 32  ? 13.095 34.269  7.736  1.00 31.12 ? 32  LYS A NZ  1 
ATOM   244  N N   A ILE A 1 33  ? 19.919 31.169  6.800  0.49 10.48 ? 33  ILE A N   1 
ATOM   245  N N   B ILE A 1 33  ? 19.924 31.140  6.790  0.51 10.57 ? 33  ILE A N   1 
ATOM   246  C CA  A ILE A 1 33  ? 21.276 30.718  7.039  0.49 11.43 ? 33  ILE A CA  1 
ATOM   247  C CA  B ILE A 1 33  ? 21.271 30.658  7.034  0.51 11.45 ? 33  ILE A CA  1 
ATOM   248  C C   A ILE A 1 33  ? 21.900 31.518  8.164  0.49 10.34 ? 33  ILE A C   1 
ATOM   249  C C   B ILE A 1 33  ? 21.931 31.490  8.125  0.51 10.34 ? 33  ILE A C   1 
ATOM   250  O O   A ILE A 1 33  ? 21.911 32.746  8.129  0.49 11.33 ? 33  ILE A O   1 
ATOM   251  O O   B ILE A 1 33  ? 21.996 32.718  8.023  0.51 11.35 ? 33  ILE A O   1 
ATOM   252  C CB  A ILE A 1 33  ? 22.157 30.864  5.787  0.49 12.84 ? 33  ILE A CB  1 
ATOM   253  C CB  B ILE A 1 33  ? 22.148 30.724  5.763  0.51 12.82 ? 33  ILE A CB  1 
ATOM   254  C CG1 A ILE A 1 33  ? 21.500 30.185  4.592  0.49 13.38 ? 33  ILE A CG1 1 
ATOM   255  C CG1 B ILE A 1 33  ? 21.522 29.940  4.605  0.51 13.86 ? 33  ILE A CG1 1 
ATOM   256  C CG2 A ILE A 1 33  ? 23.556 30.290  6.041  0.49 13.65 ? 33  ILE A CG2 1 
ATOM   257  C CG2 B ILE A 1 33  ? 23.563 30.229  6.055  0.51 13.84 ? 33  ILE A CG2 1 
ATOM   258  C CD1 A ILE A 1 33  ? 21.331 28.712  4.804  0.49 11.36 ? 33  ILE A CD1 1 
ATOM   259  C CD1 B ILE A 1 33  ? 22.330 30.014  3.299  0.51 11.17 ? 33  ILE A CD1 1 
ATOM   260  N N   . VAL A 1 34  ? 22.400 30.830  9.174  1.00 9.71  ? 34  VAL A N   1 
ATOM   261  C CA  . VAL A 1 34  ? 23.132 31.479  10.243 1.00 13.64 ? 34  VAL A CA  1 
ATOM   262  C C   . VAL A 1 34  ? 24.556 30.949  10.138 1.00 11.94 ? 34  VAL A C   1 
ATOM   263  O O   . VAL A 1 34  ? 24.821 29.780  10.436 1.00 10.62 ? 34  VAL A O   1 
ATOM   264  C CB  . VAL A 1 34  ? 22.493 31.191  11.624 1.00 11.37 ? 34  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 34  ? 23.223 31.974  12.723 1.00 14.88 ? 34  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 34  ? 20.975 31.547  11.604 1.00 15.34 ? 34  VAL A CG2 1 
ATOM   267  N N   . ASN A 1 35  ? 25.467 31.791  9.670  1.00 15.36 ? 35  ASN A N   1 
ATOM   268  C CA  . ASN A 1 35  ? 26.843 31.371  9.461  1.00 15.72 ? 35  ASN A CA  1 
ATOM   269  C C   . ASN A 1 35  ? 27.638 31.418  10.754 1.00 13.58 ? 35  ASN A C   1 
ATOM   270  O O   . ASN A 1 35  ? 27.964 32.503  11.241 1.00 13.50 ? 35  ASN A O   1 
ATOM   271  C CB  . ASN A 1 35  ? 27.538 32.239  8.411  1.00 17.74 ? 35  ASN A CB  1 
ATOM   272  C CG  . ASN A 1 35  ? 28.877 31.675  8.011  1.00 20.00 ? 35  ASN A CG  1 
ATOM   273  O OD1 . ASN A 1 35  ? 29.811 31.664  8.808  1.00 21.92 ? 35  ASN A OD1 1 
ATOM   274  N ND2 . ASN A 1 35  ? 28.980 31.203  6.770  1.00 21.75 ? 35  ASN A ND2 1 
ATOM   275  N N   . LEU A 1 36  ? 28.021 30.253  11.254 1.00 13.31 ? 36  LEU A N   1 
ATOM   276  C CA  . LEU A 1 36  ? 28.710 30.132  12.531 1.00 12.95 ? 36  LEU A CA  1 
ATOM   277  C C   . LEU A 1 36  ? 30.168 30.586  12.447 1.00 15.45 ? 36  LEU A C   1 
ATOM   278  O O   . LEU A 1 36  ? 30.742 31.062  13.429 1.00 17.59 ? 36  LEU A O   1 
ATOM   279  C CB  . LEU A 1 36  ? 28.616 28.684  13.034 1.00 13.10 ? 36  LEU A CB  1 
ATOM   280  C CG  . LEU A 1 36  ? 27.222 28.050  13.169 1.00 13.46 ? 36  LEU A CG  1 
ATOM   281  C CD1 . LEU A 1 36  ? 27.329 26.632  13.675 1.00 14.64 ? 36  LEU A CD1 1 
ATOM   282  C CD2 . LEU A 1 36  ? 26.285 28.837  14.088 1.00 12.01 ? 36  LEU A CD2 1 
ATOM   283  N N   . MET A 1 37  ? 30.764 30.453  11.269 1.00 15.75 ? 37  MET A N   1 
ATOM   284  C CA  . MET A 1 37  ? 32.164 30.832  11.104 1.00 18.12 ? 37  MET A CA  1 
ATOM   285  C C   . MET A 1 37  ? 32.306 32.346  11.244 1.00 19.00 ? 37  MET A C   1 
ATOM   286  O O   . MET A 1 37  ? 33.350 32.860  11.675 1.00 23.47 ? 37  MET A O   1 
ATOM   287  C CB  . MET A 1 37  ? 32.700 30.340  9.760  1.00 22.07 ? 37  MET A CB  1 
ATOM   288  C CG  . MET A 1 37  ? 32.781 28.821  9.665  1.00 23.31 ? 37  MET A CG  1 
ATOM   289  S SD  . MET A 1 37  ? 33.979 28.129  10.832 1.00 47.63 ? 37  MET A SD  1 
ATOM   290  C CE  . MET A 1 37  ? 33.581 26.379  10.662 1.00 35.48 ? 37  MET A CE  1 
ATOM   291  N N   . ASN A 1 38  ? 31.236 33.049  10.888 1.00 18.75 ? 38  ASN A N   1 
ATOM   292  C CA  . ASN A 1 38  ? 31.167 34.501  10.996 1.00 19.57 ? 38  ASN A CA  1 
ATOM   293  C C   . ASN A 1 38  ? 30.464 34.970  12.266 1.00 16.90 ? 38  ASN A C   1 
ATOM   294  O O   . ASN A 1 38  ? 30.193 36.162  12.428 1.00 16.38 ? 38  ASN A O   1 
ATOM   295  C CB  . ASN A 1 38  ? 30.477 35.081  9.768  1.00 22.24 ? 38  ASN A CB  1 
ATOM   296  C CG  . ASN A 1 38  ? 31.225 34.777  8.500  1.00 28.71 ? 38  ASN A CG  1 
ATOM   297  O OD1 . ASN A 1 38  ? 32.455 34.858  8.463  1.00 30.57 ? 38  ASN A OD1 1 
ATOM   298  N ND2 . ASN A 1 38  ? 30.495 34.414  7.448  1.00 28.89 ? 38  ASN A ND2 1 
ATOM   299  N N   . LYS A 1 39  ? 30.162 34.017  13.153 1.00 16.70 ? 39  LYS A N   1 
ATOM   300  C CA  . LYS A 1 39  ? 29.655 34.305  14.503 1.00 14.09 ? 39  LYS A CA  1 
ATOM   301  C C   . LYS A 1 39  ? 28.261 34.943  14.480 1.00 13.93 ? 39  LYS A C   1 
ATOM   302  O O   . LYS A 1 39  ? 27.861 35.636  15.419 1.00 14.27 ? 39  LYS A O   1 
ATOM   303  C CB  . LYS A 1 39  ? 30.657 35.143  15.323 1.00 23.12 ? 39  LYS A CB  1 
ATOM   304  C CG  . LYS A 1 39  ? 32.054 34.540  15.376 1.00 25.22 ? 39  LYS A CG  1 
ATOM   305  C CD  . LYS A 1 39  ? 32.761 34.798  16.706 1.00 28.50 ? 39  LYS A CD  1 
ATOM   306  C CE  . LYS A 1 39  ? 33.479 36.120  16.724 1.00 31.51 ? 39  LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 39  ? 34.365 36.245  17.919 1.00 33.79 ? 39  LYS A NZ  1 
ATOM   308  N N   . GLU A 1 40  ? 27.512 34.673  13.414 1.00 15.90 ? 40  GLU A N   1 
ATOM   309  C CA  . GLU A 1 40  ? 26.143 35.175  13.278 1.00 14.89 ? 40  GLU A CA  1 
ATOM   310  C C   . GLU A 1 40  ? 25.182 34.673  14.370 1.00 14.30 ? 40  GLU A C   1 
ATOM   311  O O   . GLU A 1 40  ? 24.120 35.254  14.578 1.00 14.41 ? 40  GLU A O   1 
ATOM   312  C CB  . GLU A 1 40  ? 25.608 34.909  11.857 1.00 14.95 ? 40  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 40  ? 26.322 35.766  10.805 1.00 15.77 ? 40  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 40  ? 25.953 35.426  9.369  1.00 17.18 ? 40  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 40  ? 25.035 34.608  9.140  1.00 16.65 ? 40  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 40  ? 26.585 36.007  8.459  1.00 20.50 ? 40  GLU A OE2 1 
ATOM   317  N N   . GLN A 1 41  ? 25.527 33.586  15.060 1.00 11.96 ? 41  GLN A N   1 
ATOM   318  C CA  . GLN A 1 41  ? 24.664 33.109  16.136 1.00 14.67 ? 41  GLN A CA  1 
ATOM   319  C C   . GLN A 1 41  ? 24.778 34.053  17.337 1.00 16.32 ? 41  GLN A C   1 
ATOM   320  O O   . GLN A 1 41  ? 23.971 33.991  18.253 1.00 12.07 ? 41  GLN A O   1 
ATOM   321  C CB  . GLN A 1 41  ? 24.986 31.651  16.515 1.00 12.65 ? 41  GLN A CB  1 
ATOM   322  C CG  . GLN A 1 41  ? 26.278 31.455  17.318 1.00 11.54 ? 41  GLN A CG  1 
ATOM   323  C CD  . GLN A 1 41  ? 27.554 31.420  16.473 1.00 11.90 ? 41  GLN A CD  1 
ATOM   324  O OE1 . GLN A 1 41  ? 27.676 32.116  15.445 1.00 12.88 ? 41  GLN A OE1 1 
ATOM   325  N NE2 . GLN A 1 41  ? 28.540 30.648  16.930 1.00 11.20 ? 41  GLN A NE2 1 
ATOM   326  N N   . HIS A 1 42  ? 25.763 34.954  17.320 1.00 13.09 ? 42  HIS A N   1 
ATOM   327  C CA  . HIS A 1 42  ? 25.978 35.891  18.433 1.00 14.29 ? 42  HIS A CA  1 
ATOM   328  C C   . HIS A 1 42  ? 25.401 37.294  18.184 1.00 16.38 ? 42  HIS A C   1 
ATOM   329  O O   . HIS A 1 42  ? 25.633 38.205  18.982 1.00 16.28 ? 42  HIS A O   1 
ATOM   330  C CB  . HIS A 1 42  ? 27.469 35.983  18.820 1.00 14.56 ? 42  HIS A CB  1 
ATOM   331  C CG  . HIS A 1 42  ? 28.031 34.696  19.346 1.00 16.73 ? 42  HIS A CG  1 
ATOM   332  N ND1 . HIS A 1 42  ? 27.804 34.255  20.632 1.00 17.68 ? 42  HIS A ND1 1 
ATOM   333  C CD2 . HIS A 1 42  ? 28.819 33.763  18.763 1.00 16.56 ? 42  HIS A CD2 1 
ATOM   334  C CE1 . HIS A 1 42  ? 28.424 33.100  20.816 1.00 18.91 ? 42  HIS A CE1 1 
ATOM   335  N NE2 . HIS A 1 42  ? 29.042 32.780  19.693 1.00 16.83 ? 42  HIS A NE2 1 
ATOM   336  N N   . SER A 1 43  ? 24.633 37.451  17.101 1.00 15.00 ? 43  SER A N   1 
ATOM   337  C CA  . SER A 1 43  ? 23.999 38.737  16.780 1.00 17.25 ? 43  SER A CA  1 
ATOM   338  C C   . SER A 1 43  ? 22.924 39.021  17.814 1.00 16.41 ? 43  SER A C   1 
ATOM   339  O O   . SER A 1 43  ? 22.377 38.079  18.400 1.00 15.51 ? 43  SER A O   1 
ATOM   340  C CB  . SER A 1 43  ? 23.382 38.699  15.381 1.00 16.86 ? 43  SER A CB  1 
ATOM   341  O OG  . SER A 1 43  ? 22.254 37.841  15.340 1.00 15.66 ? 43  SER A OG  1 
ATOM   342  N N   . GLU A 1 44  ? 22.635 40.303  18.053 1.00 19.39 ? 44  GLU A N   1 
ATOM   343  C CA  . GLU A 1 44  ? 21.623 40.682  19.037 1.00 19.97 ? 44  GLU A CA  1 
ATOM   344  C C   . GLU A 1 44  ? 20.289 40.041  18.686 1.00 20.17 ? 44  GLU A C   1 
ATOM   345  O O   . GLU A 1 44  ? 19.570 39.573  19.565 1.00 20.86 ? 44  GLU A O   1 
ATOM   346  C CB  . GLU A 1 44  ? 21.480 42.204  19.153 1.00 24.55 ? 44  GLU A CB  1 
ATOM   347  C CG  . GLU A 1 44  ? 22.680 42.893  19.783 1.00 31.84 ? 44  GLU A CG  1 
ATOM   348  C CD  . GLU A 1 44  ? 23.053 42.317  21.145 1.00 36.02 ? 44  GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 44  ? 22.157 41.808  21.854 1.00 37.44 ? 44  GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 44  ? 24.251 42.386  21.511 1.00 37.45 ? 44  GLU A OE2 1 
ATOM   351  N N   . GLU A 1 45  ? 19.979 39.999  17.399 1.00 18.65 ? 45  GLU A N   1 
ATOM   352  C CA  . GLU A 1 45  ? 18.729 39.401  16.964 1.00 20.89 ? 45  GLU A CA  1 
ATOM   353  C C   . GLU A 1 45  ? 18.693 37.880  17.168 1.00 19.92 ? 45  GLU A C   1 
ATOM   354  O O   . GLU A 1 45  ? 17.704 37.360  17.651 1.00 16.50 ? 45  GLU A O   1 
ATOM   355  C CB  . GLU A 1 45  ? 18.407 39.798  15.516 1.00 27.87 ? 45  GLU A CB  1 
ATOM   356  C CG  . GLU A 1 45  ? 17.067 39.262  14.983 1.00 32.54 ? 45  GLU A CG  1 
ATOM   357  C CD  . GLU A 1 45  ? 15.840 39.774  15.754 1.00 37.13 ? 45  GLU A CD  1 
ATOM   358  O OE1 . GLU A 1 45  ? 15.598 41.011  15.766 1.00 39.55 ? 45  GLU A OE1 1 
ATOM   359  O OE2 . GLU A 1 45  ? 15.110 38.927  16.336 1.00 37.48 ? 45  GLU A OE2 1 
ATOM   360  N N   . TYR A 1 46  ? 19.765 37.173  16.836 1.00 14.47 ? 46  TYR A N   1 
ATOM   361  C CA  . TYR A 1 46  ? 19.720 35.731  17.048 1.00 14.36 ? 46  TYR A CA  1 
ATOM   362  C C   . TYR A 1 46  ? 19.776 35.349  18.531 1.00 13.03 ? 46  TYR A C   1 
ATOM   363  O O   . TYR A 1 46  ? 19.178 34.350  18.937 1.00 12.38 ? 46  TYR A O   1 
ATOM   364  C CB  . TYR A 1 46  ? 20.810 34.990  16.262 1.00 12.34 ? 46  TYR A CB  1 
ATOM   365  C CG  . TYR A 1 46  ? 20.495 33.526  16.180 1.00 12.96 ? 46  TYR A CG  1 
ATOM   366  C CD1 . TYR A 1 46  ? 19.447 33.088  15.382 1.00 10.68 ? 46  TYR A CD1 1 
ATOM   367  C CD2 . TYR A 1 46  ? 21.194 32.594  16.933 1.00 11.38 ? 46  TYR A CD2 1 
ATOM   368  C CE1 . TYR A 1 46  ? 19.120 31.761  15.312 1.00 11.14 ? 46  TYR A CE1 1 
ATOM   369  C CE2 . TYR A 1 46  ? 20.868 31.255  16.864 1.00 9.54  ? 46  TYR A CE2 1 
ATOM   370  C CZ  . TYR A 1 46  ? 19.824 30.850  16.047 1.00 11.68 ? 46  TYR A CZ  1 
ATOM   371  O OH  . TYR A 1 46  ? 19.459 29.528  15.953 1.00 10.26 ? 46  TYR A OH  1 
ATOM   372  N N   . LEU A 1 47  ? 20.530 36.088  19.333 1.00 14.18 ? 47  LEU A N   1 
ATOM   373  C CA  . LEU A 1 47  ? 20.580 35.790  20.757 1.00 16.19 ? 47  LEU A CA  1 
ATOM   374  C C   . LEU A 1 47  ? 19.198 35.951  21.396 1.00 20.35 ? 47  LEU A C   1 
ATOM   375  O O   . LEU A 1 47  ? 18.834 35.201  22.314 1.00 19.91 ? 47  LEU A O   1 
ATOM   376  C CB  . LEU A 1 47  ? 21.611 36.677  21.451 1.00 17.68 ? 47  LEU A CB  1 
ATOM   377  C CG  . LEU A 1 47  ? 23.062 36.239  21.194 1.00 19.79 ? 47  LEU A CG  1 
ATOM   378  C CD1 . LEU A 1 47  ? 24.073 37.230  21.725 1.00 21.86 ? 47  LEU A CD1 1 
ATOM   379  C CD2 . LEU A 1 47  ? 23.315 34.859  21.795 1.00 18.69 ? 47  LEU A CD2 1 
ATOM   380  N N   . LYS A 1 48  ? 18.425 36.904  20.885 1.00 22.37 ? 48  LYS A N   1 
ATOM   381  C CA  . LYS A 1 48  ? 17.048 37.114  21.327 1.00 25.36 ? 48  LYS A CA  1 
ATOM   382  C C   . LYS A 1 48  ? 16.202 35.870  21.050 1.00 22.97 ? 48  LYS A C   1 
ATOM   383  O O   . LYS A 1 48  ? 15.394 35.450  21.888 1.00 23.81 ? 48  LYS A O   1 
ATOM   384  C CB  . LYS A 1 48  ? 16.455 38.335  20.613 1.00 28.79 ? 48  LYS A CB  1 
ATOM   385  C CG  . LYS A 1 48  ? 15.948 39.445  21.522 1.00 33.72 ? 48  LYS A CG  1 
ATOM   386  C CD  . LYS A 1 48  ? 15.713 40.740  20.740 1.00 36.12 ? 48  LYS A CD  1 
ATOM   387  C CE  . LYS A 1 48  ? 14.611 41.578  21.386 1.00 38.34 ? 48  LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 48  ? 14.293 42.838  20.645 1.00 40.06 ? 48  LYS A NZ  1 
ATOM   389  N N   . LYS A 1 49  ? 16.390 35.281  19.871 1.00 19.01 ? 49  LYS A N   1 
ATOM   390  C CA  . LYS A 1 49  ? 15.641 34.077  19.487 1.00 16.53 ? 49  LYS A CA  1 
ATOM   391  C C   . LYS A 1 49  ? 16.097 32.829  20.245 1.00 14.21 ? 49  LYS A C   1 
ATOM   392  O O   . LYS A 1 49  ? 15.312 31.889  20.509 1.00 13.92 ? 49  LYS A O   1 
ATOM   393  C CB  . LYS A 1 49  ? 15.776 33.818  17.986 1.00 15.53 ? 49  LYS A CB  1 
ATOM   394  C CG  . LYS A 1 49  ? 14.949 34.768  17.129 1.00 16.50 ? 49  LYS A CG  1 
ATOM   395  C CD  . LYS A 1 49  ? 15.145 34.482  15.639 1.00 16.35 ? 49  LYS A CD  1 
ATOM   396  C CE  . LYS A 1 49  ? 14.554 35.585  14.743 1.00 17.27 ? 49  LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 49  ? 13.116 35.837  15.053 1.00 19.58 ? 49  LYS A NZ  1 
ATOM   398  N N   . ASN A 1 50  ? 17.375 32.795  20.572 1.00 15.50 ? 50  ASN A N   1 
ATOM   399  C CA  . ASN A 1 50  ? 17.951 31.606  21.175 1.00 12.74 ? 50  ASN A CA  1 
ATOM   400  C C   . ASN A 1 50  ? 19.187 32.000  21.962 1.00 13.76 ? 50  ASN A C   1 
ATOM   401  O O   . ASN A 1 50  ? 20.290 32.052  21.404 1.00 12.42 ? 50  ASN A O   1 
ATOM   402  C CB  . ASN A 1 50  ? 18.329 30.592  20.099 1.00 11.42 ? 50  ASN A CB  1 
ATOM   403  C CG  . ASN A 1 50  ? 18.975 29.359  20.690 1.00 12.06 ? 50  ASN A CG  1 
ATOM   404  O OD1 . ASN A 1 50  ? 19.090 29.251  21.917 1.00 12.60 ? 50  ASN A OD1 1 
ATOM   405  N ND2 . ASN A 1 50  ? 19.315 28.388  19.841 1.00 11.32 ? 50  ASN A ND2 1 
ATOM   406  N N   . PRO A 1 51  ? 19.022 32.247  23.274 1.00 13.09 ? 51  PRO A N   1 
ATOM   407  C CA  . PRO A 1 51  ? 20.163 32.665  24.099 1.00 14.28 ? 51  PRO A CA  1 
ATOM   408  C C   . PRO A 1 51  ? 21.318 31.664  24.173 1.00 13.45 ? 51  PRO A C   1 
ATOM   409  O O   . PRO A 1 51  ? 22.405 32.092  24.574 1.00 14.21 ? 51  PRO A O   1 
ATOM   410  C CB  . PRO A 1 51  ? 19.542 32.889  25.493 1.00 16.95 ? 51  PRO A CB  1 
ATOM   411  C CG  . PRO A 1 51  ? 18.068 33.163  25.201 1.00 17.48 ? 51  PRO A CG  1 
ATOM   412  C CD  . PRO A 1 51  ? 17.749 32.270  24.026 1.00 13.92 ? 51  PRO A CD  1 
ATOM   413  N N   . GLN A 1 52  ? 21.107 30.405  23.775 1.00 12.28 ? 52  GLN A N   1 
ATOM   414  C CA  . GLN A 1 52  ? 22.184 29.397  23.762 1.00 10.77 ? 52  GLN A CA  1 
ATOM   415  C C   . GLN A 1 52  ? 23.080 29.541  22.539 1.00 13.05 ? 52  GLN A C   1 
ATOM   416  O O   . GLN A 1 52  ? 24.085 28.826  22.407 1.00 13.05 ? 52  GLN A O   1 
ATOM   417  C CB  . GLN A 1 52  ? 21.645 27.966  23.762 1.00 13.96 ? 52  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 52  ? 21.022 27.527  25.039 1.00 14.52 ? 52  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 52  ? 20.414 26.154  24.880 1.00 13.56 ? 52  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 52  ? 19.177 25.978  24.920 1.00 16.75 ? 52  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 52  ? 21.276 25.177  24.599 1.00 15.44 ? 52  GLN A NE2 1 
ATOM   422  N N   . HIS A 1 53  ? 22.698 30.458  21.651 1.00 13.95 ? 53  HIS A N   1 
ATOM   423  C CA  . HIS A 1 53  ? 23.358 30.665  20.360 1.00 12.73 ? 53  HIS A CA  1 
ATOM   424  C C   . HIS A 1 53  ? 23.687 29.370  19.599 1.00 10.08 ? 53  HIS A C   1 
ATOM   425  O O   . HIS A 1 53  ? 24.805 29.174  19.125 1.00 11.67 ? 53  HIS A O   1 
ATOM   426  C CB  . HIS A 1 53  ? 24.574 31.597  20.494 1.00 13.72 ? 53  HIS A CB  1 
ATOM   427  C CG  . HIS A 1 53  ? 25.517 31.233  21.603 1.00 15.36 ? 53  HIS A CG  1 
ATOM   428  N ND1 . HIS A 1 53  ? 26.585 30.379  21.418 1.00 14.03 ? 53  HIS A ND1 1 
ATOM   429  C CD2 . HIS A 1 53  ? 25.557 31.610  22.904 1.00 16.72 ? 53  HIS A CD2 1 
ATOM   430  C CE1 . HIS A 1 53  ? 27.249 30.255  22.558 1.00 17.42 ? 53  HIS A CE1 1 
ATOM   431  N NE2 . HIS A 1 53  ? 26.642 30.986  23.473 1.00 16.31 ? 53  HIS A NE2 1 
ATOM   432  N N   . THR A 1 54  ? 22.690 28.499  19.479 1.00 9.44  ? 54  THR A N   1 
ATOM   433  C CA  . THR A 1 54  ? 22.885 27.264  18.762 1.00 9.77  ? 54  THR A CA  1 
ATOM   434  C C   . THR A 1 54  ? 21.973 27.186  17.558 1.00 7.54  ? 54  THR A C   1 
ATOM   435  O O   . THR A 1 54  ? 20.925 27.809  17.527 1.00 8.24  ? 54  THR A O   1 
ATOM   436  C CB  . THR A 1 54  ? 22.605 26.045  19.661 1.00 9.92  ? 54  THR A CB  1 
ATOM   437  O OG1 . THR A 1 54  ? 21.318 26.200  20.291 1.00 9.57  ? 54  THR A OG1 1 
ATOM   438  C CG2 . THR A 1 54  ? 23.652 25.891  20.731 1.00 10.24 ? 54  THR A CG2 1 
ATOM   439  N N   . VAL A 1 55  ? 22.336 26.348  16.586 1.00 7.78  ? 55  VAL A N   1 
ATOM   440  C CA  . VAL A 1 55  ? 21.425 25.924  15.515 1.00 6.55  ? 55  VAL A CA  1 
ATOM   441  C C   . VAL A 1 55  ? 21.392 24.404  15.537 1.00 6.63  ? 55  VAL A C   1 
ATOM   442  O O   . VAL A 1 55  ? 22.390 23.803  15.933 1.00 6.11  ? 55  VAL A O   1 
ATOM   443  C CB  . VAL A 1 55  ? 21.894 26.414  14.127 1.00 8.15  ? 55  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 55  ? 21.792 27.920  14.048 1.00 10.10 ? 55  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 55  ? 23.307 25.961  13.823 1.00 6.86  ? 55  VAL A CG2 1 
ATOM   446  N N   . PRO A 1 56  ? 20.277 23.769  15.108 1.00 5.54  ? 56  PRO A N   1 
ATOM   447  C CA  . PRO A 1 56  ? 19.082 24.385  14.508 1.00 6.21  ? 56  PRO A CA  1 
ATOM   448  C C   . PRO A 1 56  ? 18.165 25.052  15.518 1.00 5.22  ? 56  PRO A C   1 
ATOM   449  O O   . PRO A 1 56  ? 18.180 24.740  16.709 1.00 6.19  ? 56  PRO A O   1 
ATOM   450  C CB  . PRO A 1 56  ? 18.379 23.193  13.854 1.00 5.27  ? 56  PRO A CB  1 
ATOM   451  C CG  . PRO A 1 56  ? 18.819 22.022  14.648 1.00 5.08  ? 56  PRO A CG  1 
ATOM   452  C CD  . PRO A 1 56  ? 20.232 22.295  15.035 1.00 3.63  ? 56  PRO A CD  1 
ATOM   453  N N   . LEU A 1 57  ? 17.380 26.005  15.019 1.00 5.67  ? 57  LEU A N   1 
ATOM   454  C CA  . LEU A 1 57  ? 16.249 26.568  15.735 1.00 6.75  ? 57  LEU A CA  1 
ATOM   455  C C   . LEU A 1 57  ? 15.066 26.547  14.758 1.00 5.82  ? 57  LEU A C   1 
ATOM   456  O O   . LEU A 1 57  ? 15.242 26.842  13.574 1.00 6.08  ? 57  LEU A O   1 
ATOM   457  C CB  . LEU A 1 57  ? 16.540 28.001  16.137 1.00 6.33  ? 57  LEU A CB  1 
ATOM   458  C CG  . LEU A 1 57  ? 15.348 28.741  16.726 1.00 7.22  ? 57  LEU A CG  1 
ATOM   459  C CD1 . LEU A 1 57  ? 14.951 28.188  18.096 1.00 9.21  ? 57  LEU A CD1 1 
ATOM   460  C CD2 . LEU A 1 57  ? 15.651 30.252  16.798 1.00 8.84  ? 57  LEU A CD2 1 
ATOM   461  N N   . LEU A 1 58  ? 13.889 26.129  15.232 1.00 5.65  ? 58  LEU A N   1 
ATOM   462  C CA  . LEU A 1 58  ? 12.646 26.177  14.458 1.00 6.05  ? 58  LEU A CA  1 
ATOM   463  C C   . LEU A 1 58  ? 11.667 27.182  15.039 1.00 6.52  ? 58  LEU A C   1 
ATOM   464  O O   . LEU A 1 58  ? 11.430 27.202  16.239 1.00 7.37  ? 58  LEU A O   1 
ATOM   465  C CB  . LEU A 1 58  ? 11.961 24.799  14.435 1.00 6.96  ? 58  LEU A CB  1 
ATOM   466  C CG  . LEU A 1 58  ? 10.827 24.654  13.404 1.00 5.85  ? 58  LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 58  ? 11.339 24.413  11.994 1.00 9.42  ? 58  LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 58  ? 9.764  23.589  13.808 1.00 11.90 ? 58  LEU A CD2 1 
ATOM   469  N N   . GLU A 1 59  ? 11.100 28.009  14.191 1.00 6.78  ? 59  GLU A N   1 
ATOM   470  C CA  . GLU A 1 59  ? 10.005 28.847  14.611 1.00 7.65  ? 59  GLU A CA  1 
ATOM   471  C C   . GLU A 1 59  ? 8.819  28.309  13.841 1.00 7.37  ? 59  GLU A C   1 
ATOM   472  O O   . GLU A 1 59  ? 8.888  28.119  12.636 1.00 8.69  ? 59  GLU A O   1 
ATOM   473  C CB  . GLU A 1 59  ? 10.268 30.328  14.280 1.00 7.98  ? 59  GLU A CB  1 
ATOM   474  C CG  . GLU A 1 59  ? 11.257 31.022  15.239 1.00 13.50 ? 59  GLU A CG  1 
ATOM   475  C CD  . GLU A 1 59  ? 11.640 32.434  14.794 1.00 16.15 ? 59  GLU A CD  1 
ATOM   476  O OE1 . GLU A 1 59  ? 11.378 32.795  13.629 1.00 14.57 ? 59  GLU A OE1 1 
ATOM   477  O OE2 . GLU A 1 59  ? 12.229 33.174  15.614 1.00 17.35 ? 59  GLU A OE2 1 
ATOM   478  N N   . ASP A 1 60  ? 7.694  28.128  14.512 1.00 8.27  ? 60  ASP A N   1 
ATOM   479  C CA  . ASP A 1 60  ? 6.495  27.681  13.839 1.00 8.28  ? 60  ASP A CA  1 
ATOM   480  C C   . ASP A 1 60  ? 5.302  28.462  14.366 1.00 10.57 ? 60  ASP A C   1 
ATOM   481  O O   . ASP A 1 60  ? 4.890  28.236  15.495 1.00 10.24 ? 60  ASP A O   1 
ATOM   482  C CB  . ASP A 1 60  ? 6.338  26.194  14.102 1.00 11.58 ? 60  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 60  ? 5.244  25.578  13.286 1.00 14.17 ? 60  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 60  ? 4.673  26.255  12.407 1.00 15.77 ? 60  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 60  ? 4.936  24.404  13.523 1.00 10.42 ? 60  ASP A OD2 1 
ATOM   486  N N   . GLY A 1 61  ? 4.786  29.404  13.579 1.00 11.96 ? 61  GLY A N   1 
ATOM   487  C CA  . GLY A 1 61  ? 3.788  30.339  14.075 1.00 15.91 ? 61  GLY A CA  1 
ATOM   488  C C   . GLY A 1 61  ? 4.430  31.103  15.216 1.00 14.64 ? 61  GLY A C   1 
ATOM   489  O O   . GLY A 1 61  ? 5.582  31.544  15.091 1.00 14.88 ? 61  GLY A O   1 
ATOM   490  N N   . ASP A 1 62  ? 3.744  31.205  16.347 1.00 13.64 ? 62  ASP A N   1 
ATOM   491  C CA  . ASP A 1 62  ? 4.339  31.907  17.477 1.00 16.62 ? 62  ASP A CA  1 
ATOM   492  C C   . ASP A 1 62  ? 5.219  30.993  18.364 1.00 17.66 ? 62  ASP A C   1 
ATOM   493  O O   . ASP A 1 62  ? 5.739  31.451  19.391 1.00 20.14 ? 62  ASP A O   1 
ATOM   494  C CB  . ASP A 1 62  ? 3.262  32.636  18.302 1.00 20.78 ? 62  ASP A CB  1 
ATOM   495  C CG  . ASP A 1 62  ? 2.388  33.592  17.462 1.00 21.94 ? 62  ASP A CG  1 
ATOM   496  O OD1 . ASP A 1 62  ? 2.847  34.163  16.430 1.00 19.16 ? 62  ASP A OD1 1 
ATOM   497  O OD2 . ASP A 1 62  ? 1.214  33.780  17.855 1.00 23.80 ? 62  ASP A OD2 1 
ATOM   498  N N   . ALA A 1 63  ? 5.414  29.730  17.960 1.00 14.54 ? 63  ALA A N   1 
ATOM   499  C CA  . ALA A 1 63  ? 6.195  28.759  18.747 1.00 13.38 ? 63  ALA A CA  1 
ATOM   500  C C   . ALA A 1 63  ? 7.686  28.730  18.395 1.00 10.39 ? 63  ALA A C   1 
ATOM   501  O O   . ALA A 1 63  ? 8.086  29.019  17.264 1.00 11.11 ? 63  ALA A O   1 
ATOM   502  C CB  . ALA A 1 63  ? 5.629  27.356  18.585 1.00 13.23 ? 63  ALA A CB  1 
ATOM   503  N N   . ASN A 1 64  ? 8.497  28.317  19.356 1.00 11.21 ? 64  ASN A N   1 
ATOM   504  C CA  . ASN A 1 64  ? 9.938  28.311  19.193 1.00 9.17  ? 64  ASN A CA  1 
ATOM   505  C C   . ASN A 1 64  ? 10.417 26.965  19.731 1.00 9.06  ? 64  ASN A C   1 
ATOM   506  O O   . ASN A 1 64  ? 10.019 26.601  20.834 1.00 12.64 ? 64  ASN A O   1 
ATOM   507  C CB  . ASN A 1 64  ? 10.458 29.512  20.012 1.00 12.79 ? 64  ASN A CB  1 
ATOM   508  C CG  . ASN A 1 64  ? 11.962 29.545  20.184 1.00 17.14 ? 64  ASN A CG  1 
ATOM   509  O OD1 . ASN A 1 64  ? 12.548 28.686  20.848 1.00 14.63 ? 64  ASN A OD1 1 
ATOM   510  N ND2 . ASN A 1 64  ? 12.590 30.593  19.661 1.00 19.57 ? 64  ASN A ND2 1 
ATOM   511  N N   . ILE A 1 65  ? 11.197 26.209  18.950 1.00 9.32  ? 65  ILE A N   1 
ATOM   512  C CA  . ILE A 1 65  ? 11.730 24.914  19.400 1.00 6.80  ? 65  ILE A CA  1 
ATOM   513  C C   . ILE A 1 65  ? 13.176 24.819  18.987 1.00 5.77  ? 65  ILE A C   1 
ATOM   514  O O   . ILE A 1 65  ? 13.499 24.953  17.802 1.00 5.72  ? 65  ILE A O   1 
ATOM   515  C CB  . ILE A 1 65  ? 10.974 23.699  18.812 1.00 9.38  ? 65  ILE A CB  1 
ATOM   516  C CG1 . ILE A 1 65  ? 9.459  23.778  19.083 1.00 14.65 ? 65  ILE A CG1 1 
ATOM   517  C CG2 . ILE A 1 65  ? 11.559 22.369  19.344 1.00 7.63  ? 65  ILE A CG2 1 
ATOM   518  C CD1 . ILE A 1 65  ? 8.648  24.271  17.918 1.00 17.06 ? 65  ILE A CD1 1 
ATOM   519  N N   . ALA A 1 66  ? 14.035 24.582  19.961 1.00 7.75  ? 66  ALA A N   1 
ATOM   520  C CA  . ALA A 1 66  ? 15.451 24.368  19.687 1.00 7.60  ? 66  ALA A CA  1 
ATOM   521  C C   . ALA A 1 66  ? 15.765 22.930  20.030 1.00 6.17  ? 66  ALA A C   1 
ATOM   522  O O   . ALA A 1 66  ? 14.967 22.283  20.720 1.00 5.96  ? 66  ALA A O   1 
ATOM   523  C CB  . ALA A 1 66  ? 16.322 25.277  20.514 1.00 10.72 ? 66  ALA A CB  1 
ATOM   524  N N   . ASP A 1 67  ? 16.952 22.486  19.595 1.00 6.47  ? 67  ASP A N   1 
ATOM   525  C CA  . ASP A 1 67  ? 17.503 21.110  19.691 1.00 4.03  ? 67  ASP A CA  1 
ATOM   526  C C   . ASP A 1 67  ? 16.964 20.224  18.588 1.00 3.76  ? 67  ASP A C   1 
ATOM   527  O O   . ASP A 1 67  ? 15.746 20.016  18.516 1.00 3.76  ? 67  ASP A O   1 
ATOM   528  C CB  . ASP A 1 67  ? 17.288 20.449  21.046 1.00 4.65  ? 67  ASP A CB  1 
ATOM   529  C CG  . ASP A 1 67  ? 18.100 19.182  21.152 1.00 4.35  ? 67  ASP A CG  1 
ATOM   530  O OD1 . ASP A 1 67  ? 17.679 18.127  20.621 1.00 5.66  ? 67  ASP A OD1 1 
ATOM   531  O OD2 . ASP A 1 67  ? 19.231 19.241  21.700 1.00 6.96  ? 67  ASP A OD2 1 
ATOM   532  N N   . SER A 1 68  ? 17.847 19.696  17.742 1.00 4.07  ? 68  SER A N   1 
ATOM   533  C CA  . SER A 1 68  ? 17.429 18.921  16.564 1.00 3.88  ? 68  SER A CA  1 
ATOM   534  C C   . SER A 1 68  ? 16.487 17.792  16.944 1.00 4.03  ? 68  SER A C   1 
ATOM   535  O O   . SER A 1 68  ? 15.549 17.494  16.208 1.00 3.39  ? 68  SER A O   1 
ATOM   536  C CB  . SER A 1 68  ? 18.640 18.326  15.843 1.00 5.09  ? 68  SER A CB  1 
ATOM   537  O OG  . SER A 1 68  ? 19.348 17.439  16.689 1.00 4.40  ? 68  SER A OG  1 
ATOM   538  N N   . HIS A 1 69  ? 16.717 17.168  18.099 1.00 4.49  ? 69  HIS A N   1 
ATOM   539  C CA  . HIS A 1 69  ? 15.955 15.967  18.442 1.00 3.05  ? 69  HIS A CA  1 
ATOM   540  C C   . HIS A 1 69  ? 14.560 16.366  18.904 1.00 4.43  ? 69  HIS A C   1 
ATOM   541  O O   . HIS A 1 69  ? 13.546 15.720  18.569 1.00 4.77  ? 69  HIS A O   1 
ATOM   542  C CB  . HIS A 1 69  ? 16.648 15.132  19.531 1.00 5.14  ? 69  HIS A CB  1 
ATOM   543  C CG  . HIS A 1 69  ? 18.120 14.989  19.329 1.00 4.04  ? 69  HIS A CG  1 
ATOM   544  N ND1 . HIS A 1 69  ? 19.036 15.919  19.782 1.00 3.81  ? 69  HIS A ND1 1 
ATOM   545  C CD2 . HIS A 1 69  ? 18.846 14.011  18.711 1.00 4.43  ? 69  HIS A CD2 1 
ATOM   546  C CE1 . HIS A 1 69  ? 20.260 15.530  19.448 1.00 5.08  ? 69  HIS A CE1 1 
ATOM   547  N NE2 . HIS A 1 69  ? 20.176 14.382  18.795 1.00 4.93  ? 69  HIS A NE2 1 
ATOM   548  N N   . ALA A 1 70  ? 14.497 17.462  19.652 1.00 3.24  ? 70  ALA A N   1 
ATOM   549  C CA  . ALA A 1 70  ? 13.206 18.030  20.055 1.00 3.41  ? 70  ALA A CA  1 
ATOM   550  C C   . ALA A 1 70  ? 12.445 18.485  18.830 1.00 3.51  ? 70  ALA A C   1 
ATOM   551  O O   . ALA A 1 70  ? 11.216 18.293  18.754 1.00 3.81  ? 70  ALA A O   1 
ATOM   552  C CB  . ALA A 1 70  ? 13.376 19.244  21.035 1.00 4.22  ? 70  ALA A CB  1 
ATOM   553  N N   . ILE A 1 71  ? 13.120 19.203  17.926 1.00 3.72  ? 71  ILE A N   1 
ATOM   554  C CA  . ILE A 1 71  ? 12.497 19.682  16.702 1.00 4.53  ? 71  ILE A CA  1 
ATOM   555  C C   . ILE A 1 71  ? 11.931 18.538  15.856 1.00 3.69  ? 71  ILE A C   1 
ATOM   556  O O   . ILE A 1 71  ? 10.775 18.583  15.407 1.00 4.46  ? 71  ILE A O   1 
ATOM   557  C CB  . ILE A 1 71  ? 13.491 20.501  15.855 1.00 3.94  ? 71  ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 71  ? 13.838 21.831  16.538 1.00 5.25  ? 71  ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 71  ? 12.921 20.744  14.457 1.00 4.18  ? 71  ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 71  ? 15.126 22.496  15.971 1.00 6.39  ? 71  ILE A CD1 1 
ATOM   561  N N   . MET A 1 72  ? 12.710 17.480  15.675 1.00 3.82  ? 72  MET A N   1 
ATOM   562  C CA  . MET A 1 72  ? 12.261 16.358  14.849 1.00 4.16  ? 72  MET A CA  1 
ATOM   563  C C   . MET A 1 72  ? 11.056 15.640  15.432 1.00 3.77  ? 72  MET A C   1 
ATOM   564  O O   . MET A 1 72  ? 10.130 15.341  14.691 1.00 3.73  ? 72  MET A O   1 
ATOM   565  C CB  . MET A 1 72  ? 13.386 15.340  14.633 1.00 3.34  ? 72  MET A CB  1 
ATOM   566  C CG  . MET A 1 72  ? 14.533 15.818  13.730 1.00 6.01  ? 72  MET A CG  1 
ATOM   567  S SD  . MET A 1 72  ? 15.768 14.565  13.325 1.00 4.46  ? 72  MET A SD  1 
ATOM   568  C CE  . MET A 1 72  ? 16.633 14.473  14.876 1.00 6.40  ? 72  MET A CE  1 
ATOM   569  N N   . ALA A 1 73  ? 11.075 15.371  16.744 1.00 3.80  ? 73  ALA A N   1 
ATOM   570  C CA  . ALA A 1 73  ? 9.928  14.761  17.383 1.00 4.47  ? 73  ALA A CA  1 
ATOM   571  C C   . ALA A 1 73  ? 8.690  15.614  17.219 1.00 4.64  ? 73  ALA A C   1 
ATOM   572  O O   . ALA A 1 73  ? 7.599  15.112  16.937 1.00 3.98  ? 73  ALA A O   1 
ATOM   573  C CB  . ALA A 1 73  ? 10.199 14.529  18.849 1.00 4.95  ? 73  ALA A CB  1 
ATOM   574  N N   . TYR A 1 74  ? 8.820  16.905  17.433 1.00 3.85  ? 74  TYR A N   1 
ATOM   575  C CA  . TYR A 1 74  ? 7.727  17.854  17.258 1.00 4.34  ? 74  TYR A CA  1 
ATOM   576  C C   . TYR A 1 74  ? 7.196  17.805  15.824 1.00 4.47  ? 74  TYR A C   1 
ATOM   577  O O   . TYR A 1 74  ? 5.989  17.724  15.613 1.00 4.83  ? 74  TYR A O   1 
ATOM   578  C CB  . TYR A 1 74  ? 8.227  19.254  17.599 1.00 4.36  ? 74  TYR A CB  1 
ATOM   579  C CG  . TYR A 1 74  ? 7.278  20.365  17.176 1.00 5.65  ? 74  TYR A CG  1 
ATOM   580  C CD1 . TYR A 1 74  ? 6.162  20.712  17.963 1.00 6.09  ? 74  TYR A CD1 1 
ATOM   581  C CD2 . TYR A 1 74  ? 7.484  21.083  15.993 1.00 5.36  ? 74  TYR A CD2 1 
ATOM   582  C CE1 . TYR A 1 74  ? 5.293  21.726  17.584 1.00 6.97  ? 74  TYR A CE1 1 
ATOM   583  C CE2 . TYR A 1 74  ? 6.596  22.105  15.607 1.00 6.77  ? 74  TYR A CE2 1 
ATOM   584  C CZ  . TYR A 1 74  ? 5.515  22.400  16.407 1.00 6.14  ? 74  TYR A CZ  1 
ATOM   585  O OH  . TYR A 1 74  ? 4.620  23.404  16.039 1.00 8.72  ? 74  TYR A OH  1 
ATOM   586  N N   . LEU A 1 75  ? 8.077  17.924  14.835 1.00 4.37  ? 75  LEU A N   1 
ATOM   587  C CA  . LEU A 1 75  ? 7.667  17.895  13.434 1.00 4.67  ? 75  LEU A CA  1 
ATOM   588  C C   . LEU A 1 75  ? 6.874  16.656  13.042 1.00 4.79  ? 75  LEU A C   1 
ATOM   589  O O   . LEU A 1 75  ? 5.836  16.783  12.400 1.00 5.23  ? 75  LEU A O   1 
ATOM   590  C CB  . LEU A 1 75  ? 8.887  18.078  12.502 1.00 4.91  ? 75  LEU A CB  1 
ATOM   591  C CG  . LEU A 1 75  ? 9.558  19.455  12.510 1.00 6.06  ? 75  LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 75  ? 10.850 19.441  11.686 1.00 7.03  ? 75  LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 75  ? 8.636  20.551  11.964 1.00 6.09  ? 75  LEU A CD2 1 
ATOM   594  N N   . VAL A 1 76  ? 7.360  15.477  13.402 1.00 4.49  ? 76  VAL A N   1 
ATOM   595  C CA  . VAL A 1 76  ? 6.630  14.278  13.052 1.00 6.14  ? 76  VAL A CA  1 
ATOM   596  C C   . VAL A 1 76  ? 5.290  14.270  13.786 1.00 4.96  ? 76  VAL A C   1 
ATOM   597  O O   . VAL A 1 76  ? 4.236  13.975  13.182 1.00 5.79  ? 76  VAL A O   1 
ATOM   598  C CB  . VAL A 1 76  ? 7.447  12.997  13.345 1.00 6.65  ? 76  VAL A CB  1 
ATOM   599  C CG1 . VAL A 1 76  ? 6.630  11.760  13.021 1.00 5.25  ? 76  VAL A CG1 1 
ATOM   600  C CG2 . VAL A 1 76  ? 8.751  12.997  12.541 1.00 5.83  ? 76  VAL A CG2 1 
ATOM   601  N N   . SER A 1 77  ? 5.293  14.584  15.090 1.00 4.90  ? 77  SER A N   1 
ATOM   602  C CA  . SER A 1 77  ? 4.045  14.505  15.874 1.00 5.38  ? 77  SER A CA  1 
ATOM   603  C C   . SER A 1 77  ? 3.011  15.526  15.427 1.00 5.65  ? 77  SER A C   1 
ATOM   604  O O   . SER A 1 77  ? 1.804  15.279  15.581 1.00 6.13  ? 77  SER A O   1 
ATOM   605  C CB  . SER A 1 77  ? 4.315  14.626  17.382 1.00 5.24  ? 77  SER A CB  1 
ATOM   606  O OG  . SER A 1 77  ? 5.255  13.626  17.769 1.00 4.99  ? 77  SER A OG  1 
ATOM   607  N N   . LYS A 1 78  ? 3.454  16.658  14.881 1.00 5.65  ? 78  LYS A N   1 
ATOM   608  C CA  . LYS A 1 78  ? 2.554  17.749  14.496 1.00 6.61  ? 78  LYS A CA  1 
ATOM   609  C C   . LYS A 1 78  ? 2.078  17.605  13.060 1.00 7.12  ? 78  LYS A C   1 
ATOM   610  O O   . LYS A 1 78  ? 0.918  17.918  12.756 1.00 8.22  ? 78  LYS A O   1 
ATOM   611  C CB  . LYS A 1 78  ? 3.246  19.109  14.655 1.00 7.07  ? 78  LYS A CB  1 
ATOM   612  C CG  . LYS A 1 78  ? 2.356  20.342  14.401 1.00 11.66 ? 78  LYS A CG  1 
ATOM   613  C CD  . LYS A 1 78  ? 1.679  20.725  15.698 1.00 13.11 ? 78  LYS A CD  1 
ATOM   614  C CE  . LYS A 1 78  ? 0.946  22.028  15.556 1.00 16.12 ? 78  LYS A CE  1 
ATOM   615  N NZ  . LYS A 1 78  ? 0.084  22.263  16.745 1.00 15.81 ? 78  LYS A NZ  1 
ATOM   616  N N   . TYR A 1 79  ? 2.957  17.137  12.188 1.00 6.35  ? 79  TYR A N   1 
ATOM   617  C CA  . TYR A 1 79  ? 2.746  17.199  10.756 1.00 6.78  ? 79  TYR A CA  1 
ATOM   618  C C   . TYR A 1 79  ? 2.806  15.868  10.033 1.00 7.81  ? 79  TYR A C   1 
ATOM   619  O O   . TYR A 1 79  ? 2.492  15.838  8.834  1.00 11.24 ? 79  TYR A O   1 
ATOM   620  C CB  . TYR A 1 79  ? 3.764  18.131  10.090 1.00 7.39  ? 79  TYR A CB  1 
ATOM   621  C CG  . TYR A 1 79  ? 3.668  19.560  10.507 1.00 7.48  ? 79  TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 79  ? 2.668  20.353  10.007 1.00 8.96  ? 79  TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 79  ? 4.591  20.125  11.366 1.00 7.85  ? 79  TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 79  ? 2.563  21.696  10.370 1.00 12.80 ? 79  TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 79  ? 4.498  21.446  11.747 1.00 8.43  ? 79  TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 79  ? 3.483  22.232  11.243 1.00 10.66 ? 79  TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 79  ? 3.371  23.557  11.592 1.00 13.28 ? 79  TYR A OH  1 
ATOM   628  N N   . GLY A 1 80  ? 3.209  14.800  10.694 1.00 7.64  ? 80  GLY A N   1 
ATOM   629  C CA  . GLY A 1 80  ? 3.238  13.531  10.015 1.00 7.99  ? 80  GLY A CA  1 
ATOM   630  C C   . GLY A 1 80  ? 1.865  13.007  9.652  1.00 9.12  ? 80  GLY A C   1 
ATOM   631  O O   . GLY A 1 80  ? 0.879  13.104  10.408 1.00 12.93 ? 80  GLY A O   1 
ATOM   632  N N   . LYS A 1 81  ? 1.773  12.403  8.487  1.00 9.99  ? 81  LYS A N   1 
ATOM   633  C CA  . LYS A 1 81  ? 0.498  11.846  8.124  1.00 11.38 ? 81  LYS A CA  1 
ATOM   634  C C   . LYS A 1 81  ? 0.243  10.537  8.848  1.00 10.24 ? 81  LYS A C   1 
ATOM   635  O O   . LYS A 1 81  ? -0.917 10.149  9.018  1.00 12.01 ? 81  LYS A O   1 
ATOM   636  C CB  . LYS A 1 81  ? 0.352  11.759  6.614  1.00 16.83 ? 81  LYS A CB  1 
ATOM   637  C CG  . LYS A 1 81  ? -0.006 13.136  6.009  1.00 18.14 ? 81  LYS A CG  1 
ATOM   638  C CD  . LYS A 1 81  ? -1.250 13.757  6.711  1.00 29.77 ? 81  LYS A CD  1 
ATOM   639  C CE  . LYS A 1 81  ? -1.813 14.989  5.978  1.00 30.54 ? 81  LYS A CE  1 
ATOM   640  N NZ  . LYS A 1 81  ? -3.321 15.095  6.087  1.00 31.52 ? 81  LYS A NZ  1 
ATOM   641  N N   . ASP A 1 82  ? 1.313  9.883   9.308  1.00 7.72  ? 82  ASP A N   1 
ATOM   642  C CA  . ASP A 1 82  ? 1.214  8.762   10.244 1.00 10.66 ? 82  ASP A CA  1 
ATOM   643  C C   . ASP A 1 82  ? 2.407  8.871   11.159 1.00 8.45  ? 82  ASP A C   1 
ATOM   644  O O   . ASP A 1 82  ? 3.236  9.788   10.977 1.00 7.40  ? 82  ASP A O   1 
ATOM   645  C CB  . ASP A 1 82  ? 1.201  7.408   9.522  1.00 15.66 ? 82  ASP A CB  1 
ATOM   646  C CG  . ASP A 1 82  ? 2.433  7.188   8.653  1.00 19.77 ? 82  ASP A CG  1 
ATOM   647  O OD1 . ASP A 1 82  ? 3.573  7.419   9.100  1.00 18.49 ? 82  ASP A OD1 1 
ATOM   648  O OD2 . ASP A 1 82  ? 2.262  6.740   7.498  1.00 26.30 ? 82  ASP A OD2 1 
ATOM   649  N N   . ASP A 1 83  ? 2.523  7.978   12.130 1.00 8.82  ? 83  ASP A N   1 
ATOM   650  C CA  . ASP A 1 83  ? 3.624  8.071   13.089 1.00 5.95  ? 83  ASP A CA  1 
ATOM   651  C C   . ASP A 1 83  ? 4.869  7.235   12.798 1.00 5.83  ? 83  ASP A C   1 
ATOM   652  O O   . ASP A 1 83  ? 5.672  7.023   13.688 1.00 6.76  ? 83  ASP A O   1 
ATOM   653  C CB  . ASP A 1 83  ? 3.140  7.744   14.495 1.00 6.80  ? 83  ASP A CB  1 
ATOM   654  C CG  . ASP A 1 83  ? 2.726  6.302   14.640 1.00 8.01  ? 83  ASP A CG  1 
ATOM   655  O OD1 . ASP A 1 83  ? 2.719  5.578   13.617 1.00 10.45 ? 83  ASP A OD1 1 
ATOM   656  O OD2 . ASP A 1 83  ? 2.400  5.885   15.778 1.00 9.77  ? 83  ASP A OD2 1 
ATOM   657  N N   . SER A 1 84  ? 5.028  6.793   11.556 1.00 6.02  ? 84  SER A N   1 
ATOM   658  C CA  . SER A 1 84  ? 6.083  5.821   11.283 1.00 8.20  ? 84  SER A CA  1 
ATOM   659  C C   . SER A 1 84  ? 7.460  6.324   11.699 1.00 6.34  ? 84  SER A C   1 
ATOM   660  O O   . SER A 1 84  ? 8.293  5.552   12.179 1.00 7.94  ? 84  SER A O   1 
ATOM   661  C CB  . SER A 1 84  ? 6.109  5.403   9.810  1.00 12.49 ? 84  SER A CB  1 
ATOM   662  O OG  . SER A 1 84  ? 6.769  6.354   9.009  1.00 17.13 ? 84  SER A OG  1 
ATOM   663  N N   . LEU A 1 85  ? 7.733  7.603   11.488 1.00 5.75  ? 85  LEU A N   1 
ATOM   664  C CA  . LEU A 1 85  ? 9.040  8.140   11.813 1.00 6.31  ? 85  LEU A CA  1 
ATOM   665  C C   . LEU A 1 85  ? 9.242  8.422   13.306 1.00 6.89  ? 85  LEU A C   1 
ATOM   666  O O   . LEU A 1 85  ? 10.357 8.686   13.740 1.00 5.70  ? 85  LEU A O   1 
ATOM   667  C CB  . LEU A 1 85  ? 9.299  9.441   11.050 1.00 5.24  ? 85  LEU A CB  1 
ATOM   668  C CG  . LEU A 1 85  ? 9.416  9.385   9.533  1.00 5.16  ? 85  LEU A CG  1 
ATOM   669  C CD1 . LEU A 1 85  ? 9.299  10.810  8.949  1.00 8.92  ? 85  LEU A CD1 1 
ATOM   670  C CD2 . LEU A 1 85  ? 10.716 8.703   9.119  1.00 9.88  ? 85  LEU A CD2 1 
ATOM   671  N N   . TYR A 1 86  ? 8.164  8.420   14.080 1.00 4.35  ? 86  TYR A N   1 
ATOM   672  C CA  . TYR A 1 86  ? 8.283  8.599   15.515 1.00 4.07  ? 86  TYR A CA  1 
ATOM   673  C C   . TYR A 1 86  ? 7.055  8.015   16.164 1.00 5.67  ? 86  TYR A C   1 
ATOM   674  O O   . TYR A 1 86  ? 6.107  8.683   16.494 1.00 4.52  ? 86  TYR A O   1 
ATOM   675  C CB  . TYR A 1 86  ? 8.509  10.090  15.841 1.00 3.84  ? 86  TYR A CB  1 
ATOM   676  C CG  . TYR A 1 86  ? 8.837  10.391  17.301 1.00 4.70  ? 86  TYR A CG  1 
ATOM   677  C CD1 . TYR A 1 86  ? 9.889  9.746   17.922 1.00 3.78  ? 86  TYR A CD1 1 
ATOM   678  C CD2 . TYR A 1 86  ? 8.094  11.323  18.029 1.00 3.71  ? 86  TYR A CD2 1 
ATOM   679  C CE1 . TYR A 1 86  ? 10.214 9.993   19.247 1.00 4.64  ? 86  TYR A CE1 1 
ATOM   680  C CE2 . TYR A 1 86  ? 8.359  11.569  19.357 1.00 3.63  ? 86  TYR A CE2 1 
ATOM   681  C CZ  . TYR A 1 86  ? 9.446  10.930  19.962 1.00 3.42  ? 86  TYR A CZ  1 
ATOM   682  O OH  . TYR A 1 86  ? 9.715  11.175  21.281 1.00 4.31  ? 86  TYR A OH  1 
ATOM   683  N N   . PRO A 1 87  ? 7.044  6.694   16.299 1.00 5.43  ? 87  PRO A N   1 
ATOM   684  C CA  . PRO A 1 87  ? 5.840  5.949   16.686 1.00 6.19  ? 87  PRO A CA  1 
ATOM   685  C C   . PRO A 1 87  ? 5.260  6.410   18.019 1.00 5.58  ? 87  PRO A C   1 
ATOM   686  O O   . PRO A 1 87  ? 6.032  6.748   18.944 1.00 5.33  ? 87  PRO A O   1 
ATOM   687  C CB  . PRO A 1 87  ? 6.339  4.504   16.787 1.00 6.76  ? 87  PRO A CB  1 
ATOM   688  C CG  . PRO A 1 87  ? 7.527  4.451   15.896 1.00 12.51 ? 87  PRO A CG  1 
ATOM   689  C CD  . PRO A 1 87  ? 8.172  5.800   15.980 1.00 9.25  ? 87  PRO A CD  1 
ATOM   690  N N   . LYS A 1 88  ? 3.929  6.424   18.107 1.00 6.01  ? 88  LYS A N   1 
ATOM   691  C CA  . LYS A 1 88  ? 3.246  6.745   19.338 1.00 5.62  ? 88  LYS A CA  1 
ATOM   692  C C   . LYS A 1 88  ? 3.280  5.627   20.368 1.00 5.80  ? 88  LYS A C   1 
ATOM   693  O O   . LYS A 1 88  ? 3.219  5.908   21.573 1.00 6.29  ? 88  LYS A O   1 
ATOM   694  C CB  . LYS A 1 88  ? 1.790  7.129   19.037 1.00 7.18  ? 88  LYS A CB  1 
ATOM   695  C CG  . LYS A 1 88  ? 1.683  8.487   18.315 1.00 7.76  ? 88  LYS A CG  1 
ATOM   696  C CD  . LYS A 1 88  ? 0.293  8.979   18.055 1.00 9.55  ? 88  LYS A CD  1 
ATOM   697  C CE  . LYS A 1 88  ? -0.179 8.444   16.724 1.00 11.75 ? 88  LYS A CE  1 
ATOM   698  N NZ  . LYS A 1 88  ? -1.560 8.920   16.357 1.00 11.28 ? 88  LYS A NZ  1 
ATOM   699  N N   . ASP A 1 89  ? 3.380  4.360   19.942 1.00 6.68  ? 89  ASP A N   1 
ATOM   700  C CA  . ASP A 1 89  ? 3.546  3.221   20.862 1.00 8.48  ? 89  ASP A CA  1 
ATOM   701  C C   . ASP A 1 89  ? 4.678  3.537   21.827 1.00 5.78  ? 89  ASP A C   1 
ATOM   702  O O   . ASP A 1 89  ? 5.764  3.922   21.396 1.00 7.90  ? 89  ASP A O   1 
ATOM   703  C CB  . ASP A 1 89  ? 3.840  1.925   20.099 1.00 9.16  ? 89  ASP A CB  1 
ATOM   704  C CG  . ASP A 1 89  ? 4.102  0.765   21.033 1.00 9.70  ? 89  ASP A CG  1 
ATOM   705  O OD1 . ASP A 1 89  ? 3.105  0.092   21.387 1.00 12.59 ? 89  ASP A OD1 1 
ATOM   706  O OD2 . ASP A 1 89  ? 5.267  0.539   21.445 1.00 8.70  ? 89  ASP A OD2 1 
ATOM   707  N N   . LEU A 1 90  ? 4.426  3.422   23.130 1.00 7.07  ? 90  LEU A N   1 
ATOM   708  C CA  . LEU A 1 90  ? 5.414  3.945   24.099 1.00 5.69  ? 90  LEU A CA  1 
ATOM   709  C C   . LEU A 1 90  ? 6.721  3.163   24.103 1.00 7.06  ? 90  LEU A C   1 
ATOM   710  O O   . LEU A 1 90  ? 7.792  3.756   24.334 1.00 5.27  ? 90  LEU A O   1 
ATOM   711  C CB  . LEU A 1 90  ? 4.814  3.981   25.514 1.00 8.87  ? 90  LEU A CB  1 
ATOM   712  C CG  . LEU A 1 90  ? 3.625  4.921   25.703 1.00 6.43  ? 90  LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 90  ? 3.147  4.939   27.148 1.00 7.31  ? 90  LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 90  ? 4.036  6.349   25.262 1.00 8.53  ? 90  LEU A CD2 1 
ATOM   715  N N   . VAL A 1 91  ? 6.662  1.842   23.897 1.00 6.30  ? 91  VAL A N   1 
ATOM   716  C CA  . VAL A 1 91  ? 7.863  1.011   23.853 1.00 8.29  ? 91  VAL A CA  1 
ATOM   717  C C   . VAL A 1 91  ? 8.680  1.370   22.607 1.00 5.50  ? 91  VAL A C   1 
ATOM   718  O O   . VAL A 1 91  ? 9.885  1.581   22.667 1.00 6.28  ? 91  VAL A O   1 
ATOM   719  C CB  . VAL A 1 91  ? 7.560  -0.520  23.911 1.00 8.35  ? 91  VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 91  ? 8.845  -1.325  23.716 1.00 11.08 ? 91  VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 91  ? 6.915  -0.894  25.248 1.00 10.83 ? 91  VAL A CG2 1 
ATOM   722  N N   . LYS A 1 92  ? 8.019  1.468   21.458 1.00 6.43  ? 92  LYS A N   1 
ATOM   723  C CA  . LYS A 1 92  ? 8.715  1.866   20.233 1.00 8.23  ? 92  LYS A CA  1 
ATOM   724  C C   . LYS A 1 92  ? 9.268  3.263   20.341 1.00 5.77  ? 92  LYS A C   1 
ATOM   725  O O   . LYS A 1 92  ? 10.406 3.533   19.914 1.00 6.62  ? 92  LYS A O   1 
ATOM   726  C CB  . LYS A 1 92  ? 7.796  1.749   19.022 1.00 6.32  ? 92  LYS A CB  1 
ATOM   727  C CG  . LYS A 1 92  ? 7.529  0.288   18.662 1.00 9.72  ? 92  LYS A CG  1 
ATOM   728  C CD  . LYS A 1 92  ? 6.528  0.103   17.506 1.00 11.87 ? 92  LYS A CD  1 
ATOM   729  C CE  . LYS A 1 92  ? 6.373  -1.396  17.191 1.00 17.39 ? 92  LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 92  ? 5.803  -1.645  15.830 1.00 20.58 ? 92  LYS A NZ  1 
ATOM   731  N N   . ARG A 1 93  ? 8.474  4.168   20.907 1.00 6.10  ? 93  ARG A N   1 
ATOM   732  C CA  . ARG A 1 93  ? 8.954  5.530   21.089 1.00 4.71  ? 93  ARG A CA  1 
ATOM   733  C C   . ARG A 1 93  ? 10.174 5.600   22.005 1.00 3.96  ? 93  ARG A C   1 
ATOM   734  O O   . ARG A 1 93  ? 11.107 6.358   21.753 1.00 3.98  ? 93  ARG A O   1 
ATOM   735  C CB  . ARG A 1 93  ? 7.854  6.459   21.608 1.00 5.12  ? 93  ARG A CB  1 
ATOM   736  C CG  . ARG A 1 93  ? 8.283  7.898   21.677 1.00 4.70  ? 93  ARG A CG  1 
ATOM   737  C CD  . ARG A 1 93  ? 7.163  8.876   21.866 1.00 5.85  ? 93  ARG A CD  1 
ATOM   738  N NE  . ARG A 1 93  ? 6.408  9.003   20.620 1.00 4.36  ? 93  ARG A NE  1 
ATOM   739  C CZ  . ARG A 1 93  ? 5.510  9.954   20.344 1.00 4.50  ? 93  ARG A CZ  1 
ATOM   740  N NH1 . ARG A 1 93  ? 5.274  10.944  21.190 1.00 6.04  ? 93  ARG A NH1 1 
ATOM   741  N NH2 . ARG A 1 93  ? 4.937  9.930   19.160 1.00 4.74  ? 93  ARG A NH2 1 
ATOM   742  N N   . ALA A 1 94  ? 10.156 4.847   23.093 1.00 4.20  ? 94  ALA A N   1 
ATOM   743  C CA  . ALA A 1 94  ? 11.297 4.799   24.001 1.00 4.53  ? 94  ALA A CA  1 
ATOM   744  C C   . ALA A 1 94  ? 12.580 4.369   23.306 1.00 6.73  ? 94  ALA A C   1 
ATOM   745  O O   . ALA A 1 94  ? 13.668 4.838   23.664 1.00 5.11  ? 94  ALA A O   1 
ATOM   746  C CB  . ALA A 1 94  ? 10.982 3.837   25.166 1.00 5.65  ? 94  ALA A CB  1 
ATOM   747  N N   . LEU A 1 95  ? 12.474 3.481   22.327 1.00 5.41  ? 95  LEU A N   1 
ATOM   748  C CA  . LEU A 1 95  ? 13.702 3.079   21.630 1.00 6.60  ? 95  LEU A CA  1 
ATOM   749  C C   . LEU A 1 95  ? 14.217 4.204   20.735 1.00 6.15  ? 95  LEU A C   1 
ATOM   750  O O   . LEU A 1 95  ? 15.422 4.470   20.683 1.00 6.44  ? 95  LEU A O   1 
ATOM   751  C CB  . LEU A 1 95  ? 13.513 1.791   20.827 1.00 6.71  ? 95  LEU A CB  1 
ATOM   752  C CG  . LEU A 1 95  ? 14.774 1.230   20.154 1.00 8.89  ? 95  LEU A CG  1 
ATOM   753  C CD1 . LEU A 1 95  ? 15.866 0.972   21.174 1.00 10.28 ? 95  LEU A CD1 1 
ATOM   754  C CD2 . LEU A 1 95  ? 14.458 -0.020  19.352 1.00 11.43 ? 95  LEU A CD2 1 
ATOM   755  N N   . VAL A 1 96  ? 13.295 4.856   20.027 1.00 4.58  ? 96  VAL A N   1 
ATOM   756  C CA  . VAL A 1 96  ? 13.700 6.003   19.228 1.00 5.44  ? 96  VAL A CA  1 
ATOM   757  C C   . VAL A 1 96  ? 14.326 7.100   20.133 1.00 3.24  ? 96  VAL A C   1 
ATOM   758  O O   . VAL A 1 96  ? 15.404 7.656   19.836 1.00 4.45  ? 96  VAL A O   1 
ATOM   759  C CB  . VAL A 1 96  ? 12.557 6.575   18.386 1.00 5.62  ? 96  VAL A CB  1 
ATOM   760  C CG1 . VAL A 1 96  ? 13.063 7.730   17.576 1.00 4.79  ? 96  VAL A CG1 1 
ATOM   761  C CG2 . VAL A 1 96  ? 11.967 5.525   17.475 1.00 6.92  ? 96  VAL A CG2 1 
ATOM   762  N N   . ASP A 1 97  ? 13.690 7.368   21.264 1.00 3.26  ? 97  ASP A N   1 
ATOM   763  C CA  . ASP A 1 97  ? 14.218 8.369   22.194 1.00 4.40  ? 97  ASP A CA  1 
ATOM   764  C C   . ASP A 1 97  ? 15.594 7.967   22.664 1.00 4.13  ? 97  ASP A C   1 
ATOM   765  O O   . ASP A 1 97  ? 16.503 8.772   22.694 1.00 5.50  ? 97  ASP A O   1 
ATOM   766  C CB  . ASP A 1 97  ? 13.329 8.516   23.428 1.00 3.35  ? 97  ASP A CB  1 
ATOM   767  C CG  . ASP A 1 97  ? 12.028 9.271   23.158 1.00 5.26  ? 97  ASP A CG  1 
ATOM   768  O OD1 . ASP A 1 97  ? 11.924 9.908   22.097 1.00 4.70  ? 97  ASP A OD1 1 
ATOM   769  O OD2 . ASP A 1 97  ? 11.120 9.191   24.041 1.00 5.46  ? 97  ASP A OD2 1 
ATOM   770  N N   . ASN A 1 98  ? 15.738 6.697   23.040 1.00 5.47  ? 98  ASN A N   1 
ATOM   771  C CA  . ASN A 1 98  ? 17.005 6.192   23.537 1.00 4.80  ? 98  ASN A CA  1 
ATOM   772  C C   . ASN A 1 98  ? 18.073 6.474   22.505 1.00 3.60  ? 98  ASN A C   1 
ATOM   773  O O   . ASN A 1 98  ? 19.187 6.946   22.846 1.00 5.53  ? 98  ASN A O   1 
ATOM   774  C CB  . ASN A 1 98  ? 16.964 4.676   23.812 1.00 7.22  ? 98  ASN A CB  1 
ATOM   775  C CG  . ASN A 1 98  ? 18.345 4.104   24.088 1.00 8.49  ? 98  ASN A CG  1 
ATOM   776  O OD1 . ASN A 1 98  ? 19.105 3.771   23.162 1.00 11.45 ? 98  ASN A OD1 1 
ATOM   777  N ND2 . ASN A 1 98  ? 18.692 4.012   25.356 1.00 11.79 ? 98  ASN A ND2 1 
ATOM   778  N N   . ARG A 1 99  ? 17.820 6.176   21.241 1.00 3.54  ? 99  ARG A N   1 
ATOM   779  C CA  . ARG A 1 99  ? 18.885 6.310   20.248 1.00 4.84  ? 99  ARG A CA  1 
ATOM   780  C C   . ARG A 1 99  ? 19.183 7.775   20.007 1.00 4.07  ? 99  ARG A C   1 
ATOM   781  O O   . ARG A 1 99  ? 20.341 8.096   19.739 1.00 4.63  ? 99  ARG A O   1 
ATOM   782  C CB  . ARG A 1 99  ? 18.530 5.599   18.933 1.00 5.57  ? 99  ARG A CB  1 
ATOM   783  C CG  . ARG A 1 99  ? 18.187 4.140   19.089 1.00 11.38 ? 99  ARG A CG  1 
ATOM   784  C CD  . ARG A 1 99  ? 19.318 3.373   19.658 1.00 11.80 ? 99  ARG A CD  1 
ATOM   785  N NE  . ARG A 1 99  ? 19.149 1.942   19.439 1.00 9.94  ? 99  ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 99  ? 19.329 1.021   20.383 1.00 7.77  ? 99  ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 99  ? 19.616 1.355   21.625 1.00 6.53  ? 99  ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 99  ? 19.211 -0.260  20.079 1.00 8.82  ? 99  ARG A NH2 1 
ATOM   789  N N   . MET A 1 100 ? 18.193 8.663   20.113 1.00 3.49  ? 100 MET A N   1 
ATOM   790  C CA  . MET A 1 100 ? 18.466 10.096  19.935 1.00 3.40  ? 100 MET A CA  1 
ATOM   791  C C   . MET A 1 100 ? 19.236 10.690  21.124 1.00 3.55  ? 100 MET A C   1 
ATOM   792  O O   . MET A 1 100 ? 20.138 11.535  20.943 1.00 3.88  ? 100 MET A O   1 
ATOM   793  C CB  . MET A 1 100 ? 17.202 10.913  19.698 1.00 2.96  ? 100 MET A CB  1 
ATOM   794  C CG  . MET A 1 100 ? 16.615 10.636  18.331 1.00 4.30  ? 100 MET A CG  1 
ATOM   795  S SD  . MET A 1 100 ? 15.419 11.860  17.780 1.00 5.32  ? 100 MET A SD  1 
ATOM   796  C CE  . MET A 1 100 ? 14.119 11.685  19.002 1.00 6.68  ? 100 MET A CE  1 
ATOM   797  N N   . TYR A 1 101 ? 18.925 10.238  22.335 1.00 5.21  ? 101 TYR A N   1 
ATOM   798  C CA  . TYR A 1 101 ? 19.693 10.667  23.509 1.00 3.73  ? 101 TYR A CA  1 
ATOM   799  C C   . TYR A 1 101 ? 21.120 10.196  23.432 1.00 6.14  ? 101 TYR A C   1 
ATOM   800  O O   . TYR A 1 101 ? 22.030 10.930  23.815 1.00 4.99  ? 101 TYR A O   1 
ATOM   801  C CB  . TYR A 1 101 ? 19.031 10.293  24.853 1.00 4.59  ? 101 TYR A CB  1 
ATOM   802  C CG  . TYR A 1 101 ? 17.908 11.222  25.187 1.00 3.56  ? 101 TYR A CG  1 
ATOM   803  C CD1 . TYR A 1 101 ? 18.167 12.510  25.666 1.00 5.49  ? 101 TYR A CD1 1 
ATOM   804  C CD2 . TYR A 1 101 ? 16.582 10.865  24.968 1.00 6.08  ? 101 TYR A CD2 1 
ATOM   805  C CE1 . TYR A 1 101 ? 17.158 13.380  25.937 1.00 5.08  ? 101 TYR A CE1 1 
ATOM   806  C CE2 . TYR A 1 101 ? 15.554 11.795  25.232 1.00 4.00  ? 101 TYR A CE2 1 
ATOM   807  C CZ  . TYR A 1 101 ? 15.866 13.035  25.732 1.00 4.70  ? 101 TYR A CZ  1 
ATOM   808  O OH  . TYR A 1 101 ? 14.856 13.939  26.000 1.00 5.91  ? 101 TYR A OH  1 
ATOM   809  N N   . PHE A 1 102 ? 21.298 8.968   22.946 1.00 4.94  ? 102 PHE A N   1 
ATOM   810  C CA  . PHE A 1 102 ? 22.630 8.430   22.693 1.00 6.56  ? 102 PHE A CA  1 
ATOM   811  C C   . PHE A 1 102 ? 23.375 9.323   21.714 1.00 4.21  ? 102 PHE A C   1 
ATOM   812  O O   . PHE A 1 102 ? 24.556 9.677   21.943 1.00 4.57  ? 102 PHE A O   1 
ATOM   813  C CB  . PHE A 1 102 ? 22.524 7.012   22.132 1.00 5.09  ? 102 PHE A CB  1 
ATOM   814  C CG  . PHE A 1 102 ? 23.828 6.449   21.592 1.00 6.77  ? 102 PHE A CG  1 
ATOM   815  C CD1 . PHE A 1 102 ? 24.759 5.863   22.430 1.00 9.42  ? 102 PHE A CD1 1 
ATOM   816  C CD2 . PHE A 1 102 ? 24.115 6.505   20.232 1.00 6.46  ? 102 PHE A CD2 1 
ATOM   817  C CE1 . PHE A 1 102 ? 25.969 5.361   21.907 1.00 7.13  ? 102 PHE A CE1 1 
ATOM   818  C CE2 . PHE A 1 102 ? 25.287 6.007   19.734 1.00 8.49  ? 102 PHE A CE2 1 
ATOM   819  C CZ  . PHE A 1 102 ? 26.200 5.441   20.574 1.00 7.95  ? 102 PHE A CZ  1 
ATOM   820  N N   . GLU A 1 103 ? 22.750 9.661   20.590 1.00 4.08  ? 103 GLU A N   1 
ATOM   821  C CA  . GLU A 1 103 ? 23.388 10.584  19.631 1.00 4.97  ? 103 GLU A CA  1 
ATOM   822  C C   . GLU A 1 103 ? 23.809 11.903  20.267 1.00 5.67  ? 103 GLU A C   1 
ATOM   823  O O   . GLU A 1 103 ? 24.900 12.415  20.007 1.00 4.63  ? 103 GLU A O   1 
ATOM   824  C CB  . GLU A 1 103 ? 22.433 10.870  18.450 1.00 4.32  ? 103 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 103 ? 23.078 11.433  17.196 1.00 4.05  ? 103 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 103 ? 23.329 12.910  17.220 1.00 5.81  ? 103 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 103 ? 22.677 13.594  18.028 1.00 5.97  ? 103 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 103 ? 24.194 13.359  16.416 1.00 5.96  ? 103 GLU A OE2 1 
ATOM   829  N N   . SER A 1 104 ? 22.905 12.478  21.060 1.00 4.37  ? 104 SER A N   1 
ATOM   830  C CA  . SER A 1 104 ? 23.170 13.803  21.591 1.00 4.50  ? 104 SER A CA  1 
ATOM   831  C C   . SER A 1 104 ? 24.409 13.842  22.470 1.00 5.07  ? 104 SER A C   1 
ATOM   832  O O   . SER A 1 104 ? 25.176 14.788  22.445 1.00 5.48  ? 104 SER A O   1 
ATOM   833  C CB  . SER A 1 104 ? 21.959 14.287  22.396 1.00 5.71  ? 104 SER A CB  1 
ATOM   834  O OG  . SER A 1 104 ? 21.776 13.535  23.597 1.00 9.48  ? 104 SER A OG  1 
ATOM   835  N N   . GLY A 1 105 ? 24.623 12.805  23.255 1.00 4.61  ? 105 GLY A N   1 
ATOM   836  C CA  . GLY A 1 105 ? 25.708 12.778  24.213 1.00 5.81  ? 105 GLY A CA  1 
ATOM   837  C C   . GLY A 1 105 ? 26.941 12.007  23.761 1.00 5.69  ? 105 GLY A C   1 
ATOM   838  O O   . GLY A 1 105 ? 27.996 12.603  23.562 1.00 6.90  ? 105 GLY A O   1 
ATOM   839  N N   . VAL A 1 106 ? 26.812 10.706  23.583 1.00 5.45  ? 106 VAL A N   1 
ATOM   840  C CA  . VAL A 1 106 ? 27.959 9.882   23.243 1.00 4.45  ? 106 VAL A CA  1 
ATOM   841  C C   . VAL A 1 106 ? 28.525 10.253  21.858 1.00 7.94  ? 106 VAL A C   1 
ATOM   842  O O   . VAL A 1 106 ? 29.745 10.319  21.674 1.00 8.01  ? 106 VAL A O   1 
ATOM   843  C CB  . VAL A 1 106 ? 27.571 8.398   23.268 1.00 6.02  ? 106 VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 106 ? 28.716 7.523   22.759 1.00 6.22  ? 106 VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 106 ? 27.204 7.960   24.674 1.00 6.92  ? 106 VAL A CG2 1 
ATOM   846  N N   . VAL A 1 107 ? 27.666 10.544  20.888 1.00 4.04  ? 107 VAL A N   1 
ATOM   847  C CA  . VAL A 1 107 ? 28.119 10.818  19.553 1.00 4.51  ? 107 VAL A CA  1 
ATOM   848  C C   . VAL A 1 107 ? 28.418 12.297  19.356 1.00 4.06  ? 107 VAL A C   1 
ATOM   849  O O   . VAL A 1 107 ? 29.586 12.658  19.126 1.00 6.78  ? 107 VAL A O   1 
ATOM   850  C CB  . VAL A 1 107 ? 27.144 10.324  18.485 1.00 5.69  ? 107 VAL A CB  1 
ATOM   851  C CG1 . VAL A 1 107 ? 27.733 10.558  17.090 1.00 7.75  ? 107 VAL A CG1 1 
ATOM   852  C CG2 . VAL A 1 107 ? 26.885 8.823   18.693 1.00 6.30  ? 107 VAL A CG2 1 
ATOM   853  N N   . PHE A 1 108 ? 27.393 13.132  19.427 1.00 5.43  ? 108 PHE A N   1 
ATOM   854  C CA  . PHE A 1 108 ? 27.600 14.532  19.137 1.00 5.65  ? 108 PHE A CA  1 
ATOM   855  C C   . PHE A 1 108 ? 28.440 15.278  20.183 1.00 5.27  ? 108 PHE A C   1 
ATOM   856  O O   . PHE A 1 108 ? 29.505 15.822  19.847 1.00 5.65  ? 108 PHE A O   1 
ATOM   857  C CB  . PHE A 1 108 ? 26.262 15.230  18.901 1.00 4.94  ? 108 PHE A CB  1 
ATOM   858  C CG  . PHE A 1 108 ? 26.409 16.656  18.483 1.00 5.75  ? 108 PHE A CG  1 
ATOM   859  C CD1 . PHE A 1 108 ? 26.735 16.945  17.163 1.00 6.03  ? 108 PHE A CD1 1 
ATOM   860  C CD2 . PHE A 1 108 ? 26.355 17.698  19.412 1.00 7.35  ? 108 PHE A CD2 1 
ATOM   861  C CE1 . PHE A 1 108 ? 26.933 18.264  16.767 1.00 8.64  ? 108 PHE A CE1 1 
ATOM   862  C CE2 . PHE A 1 108 ? 26.574 19.011  19.018 1.00 8.67  ? 108 PHE A CE2 1 
ATOM   863  C CZ  . PHE A 1 108 ? 26.846 19.300  17.693 1.00 9.35  ? 108 PHE A CZ  1 
ATOM   864  N N   . ALA A 1 109 ? 28.046 15.298  21.452 1.00 5.20  ? 109 ALA A N   1 
ATOM   865  C CA  . ALA A 1 109 ? 28.808 16.107  22.423 1.00 6.99  ? 109 ALA A CA  1 
ATOM   866  C C   . ALA A 1 109 ? 30.184 15.512  22.650 1.00 6.03  ? 109 ALA A C   1 
ATOM   867  O O   . ALA A 1 109 ? 31.203 16.237  22.665 1.00 7.71  ? 109 ALA A O   1 
ATOM   868  C CB  . ALA A 1 109 ? 28.094 16.240  23.765 1.00 6.54  ? 109 ALA A CB  1 
ATOM   869  N N   . ASN A 1 110 ? 30.263 14.195  22.787 1.00 5.62  ? 110 ASN A N   1 
ATOM   870  C CA  . ASN A 1 110 ? 31.508 13.560  23.206 1.00 8.40  ? 110 ASN A CA  1 
ATOM   871  C C   . ASN A 1 110 ? 32.508 13.371  22.079 1.00 7.78  ? 110 ASN A C   1 
ATOM   872  O O   . ASN A 1 110 ? 33.719 13.600  22.268 1.00 10.02 ? 110 ASN A O   1 
ATOM   873  C CB  . ASN A 1 110 ? 31.271 12.238  23.923 1.00 7.18  ? 110 ASN A CB  1 
ATOM   874  C CG  . ASN A 1 110 ? 32.517 11.743  24.642 1.00 10.47 ? 110 ASN A CG  1 
ATOM   875  O OD1 . ASN A 1 110 ? 33.073 12.423  25.515 1.00 12.24 ? 110 ASN A OD1 1 
ATOM   876  N ND2 . ASN A 1 110 ? 32.926 10.526  24.311 1.00 8.52  ? 110 ASN A ND2 1 
ATOM   877  N N   . ALA A 1 111 ? 32.021 12.949  20.914 1.00 5.68  ? 111 ALA A N   1 
ATOM   878  C CA  . ALA A 1 111 ? 32.902 12.584  19.813 1.00 6.11  ? 111 ALA A CA  1 
ATOM   879  C C   . ALA A 1 111 ? 33.027 13.624  18.704 1.00 6.09  ? 111 ALA A C   1 
ATOM   880  O O   . ALA A 1 111 ? 34.122 13.831  18.182 1.00 8.79  ? 111 ALA A O   1 
ATOM   881  C CB  . ALA A 1 111 ? 32.486 11.244  19.244 1.00 8.13  ? 111 ALA A CB  1 
ATOM   882  N N   A LEU A 1 112 ? 31.923 14.272  18.352 0.43 6.33  ? 112 LEU A N   1 
ATOM   883  N N   B LEU A 1 112 ? 31.937 14.296  18.362 0.57 6.13  ? 112 LEU A N   1 
ATOM   884  C CA  A LEU A 1 112 ? 31.923 15.129  17.177 0.43 7.31  ? 112 LEU A CA  1 
ATOM   885  C CA  B LEU A 1 112 ? 31.952 15.118  17.163 0.57 5.46  ? 112 LEU A CA  1 
ATOM   886  C C   A LEU A 1 112 ? 32.256 16.559  17.526 0.43 8.08  ? 112 LEU A C   1 
ATOM   887  C C   B LEU A 1 112 ? 32.194 16.588  17.453 0.57 7.90  ? 112 LEU A C   1 
ATOM   888  O O   A LEU A 1 112 ? 33.253 17.109  17.047 0.43 8.11  ? 112 LEU A O   1 
ATOM   889  O O   B LEU A 1 112 ? 33.098 17.199  16.877 0.57 7.60  ? 112 LEU A O   1 
ATOM   890  C CB  A LEU A 1 112 ? 30.571 15.076  16.450 0.43 6.86  ? 112 LEU A CB  1 
ATOM   891  C CB  B LEU A 1 112 ? 30.662 14.922  16.355 0.57 7.19  ? 112 LEU A CB  1 
ATOM   892  C CG  A LEU A 1 112 ? 30.531 15.609  15.010 0.43 6.72  ? 112 LEU A CG  1 
ATOM   893  C CG  B LEU A 1 112 ? 30.437 15.718  15.064 0.57 6.69  ? 112 LEU A CG  1 
ATOM   894  C CD1 A LEU A 1 112 ? 29.450 14.928  14.181 0.43 5.84  ? 112 LEU A CD1 1 
ATOM   895  C CD1 B LEU A 1 112 ? 31.523 15.491  14.033 0.57 7.33  ? 112 LEU A CD1 1 
ATOM   896  C CD2 A LEU A 1 112 ? 30.266 17.089  15.008 0.43 7.52  ? 112 LEU A CD2 1 
ATOM   897  C CD2 B LEU A 1 112 ? 29.092 15.339  14.482 0.57 6.50  ? 112 LEU A CD2 1 
ATOM   898  N N   . ARG A 1 113 ? 31.430 17.144  18.381 1.00 9.08  ? 113 ARG A N   1 
ATOM   899  C CA  . ARG A 1 113 ? 31.478 18.569  18.620 1.00 9.65  ? 113 ARG A CA  1 
ATOM   900  C C   . ARG A 1 113 ? 32.795 18.972  19.255 1.00 11.02 ? 113 ARG A C   1 
ATOM   901  O O   . ARG A 1 113 ? 33.361 20.003  18.913 1.00 9.92  ? 113 ARG A O   1 
ATOM   902  C CB  . ARG A 1 113 ? 30.260 19.075  19.434 1.00 10.07 ? 113 ARG A CB  1 
ATOM   903  C CG  . ARG A 1 113 ? 30.339 20.575  19.725 1.00 11.38 ? 113 ARG A CG  1 
ATOM   904  C CD  . ARG A 1 113 ? 29.145 21.171  20.524 1.00 15.28 ? 113 ARG A CD  1 
ATOM   905  N NE  . ARG A 1 113 ? 29.523 22.434  21.175 1.00 19.91 ? 113 ARG A NE  1 
ATOM   906  C CZ  . ARG A 1 113 ? 28.896 23.609  21.068 1.00 25.36 ? 113 ARG A CZ  1 
ATOM   907  N NH1 . ARG A 1 113 ? 27.791 23.771  20.331 1.00 25.14 ? 113 ARG A NH1 1 
ATOM   908  N NH2 . ARG A 1 113 ? 29.389 24.659  21.716 1.00 25.11 ? 113 ARG A NH2 1 
ATOM   909  N N   . SER A 1 114 ? 33.263 18.126  20.161 1.00 11.28 ? 114 SER A N   1 
ATOM   910  C CA  . SER A 1 114 ? 34.547 18.284  20.822 1.00 11.52 ? 114 SER A CA  1 
ATOM   911  C C   . SER A 1 114 ? 35.685 18.473  19.822 1.00 12.60 ? 114 SER A C   1 
ATOM   912  O O   . SER A 1 114 ? 36.439 19.442  19.881 1.00 12.30 ? 114 SER A O   1 
ATOM   913  C CB  . SER A 1 114 ? 34.824 17.044  21.678 1.00 11.54 ? 114 SER A CB  1 
ATOM   914  O OG  . SER A 1 114 ? 34.637 15.834  20.923 1.00 12.49 ? 114 SER A OG  1 
ATOM   915  N N   . LEU A 1 115 ? 35.799 17.529  18.901 1.00 10.19 ? 115 LEU A N   1 
ATOM   916  C CA  . LEU A 1 115 ? 36.884 17.524  17.956 1.00 13.81 ? 115 LEU A CA  1 
ATOM   917  C C   . LEU A 1 115 ? 36.708 18.654  16.939 1.00 10.78 ? 115 LEU A C   1 
ATOM   918  O O   . LEU A 1 115 ? 37.644 19.386  16.625 1.00 12.68 ? 115 LEU A O   1 
ATOM   919  C CB  . LEU A 1 115 ? 36.937 16.160  17.307 1.00 15.40 ? 115 LEU A CB  1 
ATOM   920  C CG  . LEU A 1 115 ? 38.098 15.834  16.419 1.00 16.89 ? 115 LEU A CG  1 
ATOM   921  C CD1 . LEU A 1 115 ? 39.378 16.183  17.129 1.00 14.15 ? 115 LEU A CD1 1 
ATOM   922  C CD2 . LEU A 1 115 ? 38.011 14.350  16.148 1.00 19.91 ? 115 LEU A CD2 1 
ATOM   923  N N   . ALA A 1 116 ? 35.488 18.828  16.461 1.00 8.96  ? 116 ALA A N   1 
ATOM   924  C CA  . ALA A 1 116 ? 35.222 19.839  15.449 1.00 11.17 ? 116 ALA A CA  1 
ATOM   925  C C   . ALA A 1 116 ? 35.443 21.261  15.974 1.00 13.65 ? 116 ALA A C   1 
ATOM   926  O O   . ALA A 1 116 ? 35.955 22.091  15.253 1.00 13.74 ? 116 ALA A O   1 
ATOM   927  C CB  . ALA A 1 116 ? 33.812 19.675  14.887 1.00 11.55 ? 116 ALA A CB  1 
ATOM   928  N N   . LYS A 1 117 ? 35.057 21.528  17.223 1.00 13.64 ? 117 LYS A N   1 
ATOM   929  C CA  . LYS A 1 117 ? 35.286 22.842  17.790 1.00 14.47 ? 117 LYS A CA  1 
ATOM   930  C C   . LYS A 1 117 ? 36.782 23.106  17.848 1.00 14.88 ? 117 LYS A C   1 
ATOM   931  O O   . LYS A 1 117 ? 37.226 24.214  17.506 1.00 13.79 ? 117 LYS A O   1 
ATOM   932  C CB  . LYS A 1 117 ? 34.658 22.996  19.178 1.00 15.31 ? 117 LYS A CB  1 
ATOM   933  C CG  . LYS A 1 117 ? 34.695 24.432  19.690 1.00 22.86 ? 117 LYS A CG  1 
ATOM   934  C CD  . LYS A 1 117 ? 33.791 24.647  20.903 1.00 25.15 ? 117 LYS A CD  1 
ATOM   935  C CE  . LYS A 1 117 ? 34.603 24.896  22.166 1.00 25.84 ? 117 LYS A CE  1 
ATOM   936  N NZ  . LYS A 1 117 ? 33.745 25.259  23.330 1.00 25.42 ? 117 LYS A NZ  1 
ATOM   937  N N   . MET A 1 118 ? 37.556 22.098  18.276 1.00 12.12 ? 118 MET A N   1 
ATOM   938  C CA  . MET A 1 118 ? 39.027 22.218  18.402 1.00 13.89 ? 118 MET A CA  1 
ATOM   939  C C   . MET A 1 118 ? 39.692 22.625  17.096 1.00 13.58 ? 118 MET A C   1 
ATOM   940  O O   . MET A 1 118 ? 40.490 23.565  17.065 1.00 12.74 ? 118 MET A O   1 
ATOM   941  C CB  . MET A 1 118 ? 39.665 20.873  18.834 1.00 16.03 ? 118 MET A CB  1 
ATOM   942  C CG  . MET A 1 118 ? 39.668 20.557  20.329 1.00 17.47 ? 118 MET A CG  1 
ATOM   943  S SD  . MET A 1 118 ? 40.235 18.861  20.690 1.00 30.34 ? 118 MET A SD  1 
ATOM   944  C CE  . MET A 1 118 ? 41.701 18.781  19.673 1.00 18.55 ? 118 MET A CE  1 
ATOM   945  N N   . ILE A 1 119 ? 39.350 21.892  16.034 1.00 10.97 ? 119 ILE A N   1 
ATOM   946  C CA  . ILE A 1 119 ? 39.994 21.958  14.721 1.00 12.84 ? 119 ILE A CA  1 
ATOM   947  C C   . ILE A 1 119 ? 39.467 23.129  13.902 1.00 13.47 ? 119 ILE A C   1 
ATOM   948  O O   . ILE A 1 119 ? 40.232 23.850  13.242 1.00 14.29 ? 119 ILE A O   1 
ATOM   949  C CB  . ILE A 1 119 ? 39.622 20.697  13.894 1.00 20.77 ? 119 ILE A CB  1 
ATOM   950  C CG1 . ILE A 1 119 ? 40.068 19.422  14.597 1.00 20.63 ? 119 ILE A CG1 1 
ATOM   951  C CG2 . ILE A 1 119 ? 40.194 20.761  12.501 1.00 23.74 ? 119 ILE A CG2 1 
ATOM   952  C CD1 . ILE A 1 119 ? 41.465 19.472  15.016 1.00 14.92 ? 119 ILE A CD1 1 
ATOM   953  N N   . LEU A 1 120 ? 38.149 23.279  13.915 1.00 12.96 ? 120 LEU A N   1 
ATOM   954  C CA  . LEU A 1 120 ? 37.484 24.238  13.033 1.00 16.51 ? 120 LEU A CA  1 
ATOM   955  C C   . LEU A 1 120 ? 37.376 25.645  13.606 1.00 16.48 ? 120 LEU A C   1 
ATOM   956  O O   . LEU A 1 120 ? 37.350 26.617  12.853 1.00 17.67 ? 120 LEU A O   1 
ATOM   957  C CB  . LEU A 1 120 ? 36.108 23.733  12.603 1.00 16.79 ? 120 LEU A CB  1 
ATOM   958  C CG  . LEU A 1 120 ? 36.108 22.398  11.880 1.00 13.21 ? 120 LEU A CG  1 
ATOM   959  C CD1 . LEU A 1 120 ? 34.661 22.016  11.542 1.00 15.48 ? 120 LEU A CD1 1 
ATOM   960  C CD2 . LEU A 1 120 ? 36.949 22.496  10.614 1.00 12.66 ? 120 LEU A CD2 1 
ATOM   961  N N   . PHE A 1 121 ? 37.304 25.757  14.925 1.00 16.47 ? 121 PHE A N   1 
ATOM   962  C CA  . PHE A 1 121 ? 36.973 27.035  15.534 1.00 19.80 ? 121 PHE A CA  1 
ATOM   963  C C   . PHE A 1 121 ? 38.099 27.577  16.402 1.00 22.84 ? 121 PHE A C   1 
ATOM   964  O O   . PHE A 1 121 ? 38.299 28.785  16.469 1.00 24.81 ? 121 PHE A O   1 
ATOM   965  C CB  . PHE A 1 121 ? 35.677 26.940  16.344 1.00 21.99 ? 121 PHE A CB  1 
ATOM   966  C CG  . PHE A 1 121 ? 34.448 26.688  15.507 1.00 24.05 ? 121 PHE A CG  1 
ATOM   967  C CD1 . PHE A 1 121 ? 33.799 27.731  14.857 1.00 27.70 ? 121 PHE A CD1 1 
ATOM   968  C CD2 . PHE A 1 121 ? 33.941 25.404  15.378 1.00 22.61 ? 121 PHE A CD2 1 
ATOM   969  C CE1 . PHE A 1 121 ? 32.660 27.492  14.081 1.00 27.21 ? 121 PHE A CE1 1 
ATOM   970  C CE2 . PHE A 1 121 ? 32.808 25.158  14.608 1.00 23.82 ? 121 PHE A CE2 1 
ATOM   971  C CZ  . PHE A 1 121 ? 32.167 26.201  13.961 1.00 25.72 ? 121 PHE A CZ  1 
ATOM   972  N N   . LEU A 1 122 ? 38.851 26.681  17.035 1.00 21.73 ? 122 LEU A N   1 
ATOM   973  C CA  . LEU A 1 122 ? 39.836 27.074  18.044 1.00 22.13 ? 122 LEU A CA  1 
ATOM   974  C C   . LEU A 1 122 ? 41.289 27.027  17.579 1.00 21.63 ? 122 LEU A C   1 
ATOM   975  O O   . LEU A 1 122 ? 42.198 27.349  18.340 1.00 23.28 ? 122 LEU A O   1 
ATOM   976  C CB  . LEU A 1 122 ? 39.657 26.235  19.307 1.00 21.75 ? 122 LEU A CB  1 
ATOM   977  C CG  . LEU A 1 122 ? 38.275 26.423  19.923 1.00 24.75 ? 122 LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 122 ? 37.968 25.370  20.999 1.00 25.24 ? 122 LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 122 ? 38.078 27.832  20.459 1.00 27.35 ? 122 LEU A CD2 1 
ATOM   980  N N   . GLY A 1 123 ? 41.510 26.604  16.341 1.00 18.70 ? 123 GLY A N   1 
ATOM   981  C CA  . GLY A 1 123 ? 42.849 26.635  15.767 1.00 18.45 ? 123 GLY A CA  1 
ATOM   982  C C   . GLY A 1 123 ? 43.861 25.666  16.347 1.00 19.64 ? 123 GLY A C   1 
ATOM   983  O O   . GLY A 1 123 ? 45.069 25.887  16.231 1.00 25.08 ? 123 GLY A O   1 
ATOM   984  N N   . LYS A 1 124 ? 43.381 24.590  16.956 1.00 18.79 ? 124 LYS A N   1 
ATOM   985  C CA  . LYS A 1 124 ? 44.256 23.550  17.470 1.00 19.78 ? 124 LYS A CA  1 
ATOM   986  C C   . LYS A 1 124 ? 44.621 22.608  16.332 1.00 18.10 ? 124 LYS A C   1 
ATOM   987  O O   . LYS A 1 124 ? 43.795 22.354  15.440 1.00 15.61 ? 124 LYS A O   1 
ATOM   988  C CB  . LYS A 1 124 ? 43.554 22.757  18.579 1.00 21.07 ? 124 LYS A CB  1 
ATOM   989  C CG  . LYS A 1 124 ? 42.788 23.603  19.604 1.00 24.39 ? 124 LYS A CG  1 
ATOM   990  C CD  . LYS A 1 124 ? 43.700 24.560  20.374 1.00 27.21 ? 124 LYS A CD  1 
ATOM   991  C CE  . LYS A 1 124 ? 42.952 25.122  21.581 1.00 29.65 ? 124 LYS A CE  1 
ATOM   992  N NZ  . LYS A 1 124 ? 43.754 26.082  22.377 1.00 33.35 ? 124 LYS A NZ  1 
ATOM   993  N N   . THR A 1 125 ? 45.853 22.096  16.358 1.00 22.38 ? 125 THR A N   1 
ATOM   994  C CA  . THR A 1 125 ? 46.288 21.085  15.398 1.00 15.76 ? 125 THR A CA  1 
ATOM   995  C C   . THR A 1 125 ? 46.701 19.763  16.050 1.00 15.18 ? 125 THR A C   1 
ATOM   996  O O   . THR A 1 125 ? 47.006 18.789  15.353 1.00 20.12 ? 125 THR A O   1 
ATOM   997  C CB  . THR A 1 125 ? 47.462 21.576  14.547 1.00 20.48 ? 125 THR A CB  1 
ATOM   998  O OG1 . THR A 1 125 ? 48.678 21.511  15.308 1.00 23.77 ? 125 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 125 ? 47.219 23.004  14.091 1.00 20.11 ? 125 THR A CG2 1 
ATOM   1000 N N   . GLU A 1 126 ? 46.700 19.740  17.381 1.00 17.38 ? 126 GLU A N   1 
ATOM   1001 C CA  . GLU A 1 126 ? 47.119 18.566  18.131 1.00 15.51 ? 126 GLU A CA  1 
ATOM   1002 C C   . GLU A 1 126 ? 45.887 17.941  18.765 1.00 15.16 ? 126 GLU A C   1 
ATOM   1003 O O   . GLU A 1 126 ? 45.271 18.553  19.636 1.00 16.98 ? 126 GLU A O   1 
ATOM   1004 C CB  . GLU A 1 126 ? 48.126 18.987  19.211 1.00 14.16 ? 126 GLU A CB  1 
ATOM   1005 C CG  . GLU A 1 126 ? 49.371 19.612  18.607 1.00 12.44 ? 126 GLU A CG  1 
ATOM   1006 C CD  . GLU A 1 126 ? 50.328 20.234  19.622 1.00 13.41 ? 126 GLU A CD  1 
ATOM   1007 O OE1 . GLU A 1 126 ? 50.310 19.867  20.826 1.00 13.13 ? 126 GLU A OE1 1 
ATOM   1008 O OE2 . GLU A 1 126 ? 51.115 21.096  19.190 1.00 14.29 ? 126 GLU A OE2 1 
ATOM   1009 N N   . VAL A 1 127 ? 45.544 16.725  18.339 1.00 10.57 ? 127 VAL A N   1 
ATOM   1010 C CA  . VAL A 1 127 ? 44.343 16.060  18.828 1.00 14.99 ? 127 VAL A CA  1 
ATOM   1011 C C   . VAL A 1 127 ? 44.769 14.886  19.704 1.00 13.32 ? 127 VAL A C   1 
ATOM   1012 O O   . VAL A 1 127 ? 45.517 14.015  19.251 1.00 14.95 ? 127 VAL A O   1 
ATOM   1013 C CB  . VAL A 1 127 ? 43.473 15.530  17.652 1.00 17.88 ? 127 VAL A CB  1 
ATOM   1014 C CG1 . VAL A 1 127 ? 42.360 14.653  18.146 1.00 17.66 ? 127 VAL A CG1 1 
ATOM   1015 C CG2 . VAL A 1 127 ? 42.908 16.679  16.835 1.00 20.35 ? 127 VAL A CG2 1 
ATOM   1016 N N   . PRO A 1 128 ? 44.326 14.872  20.970 1.00 10.93 ? 128 PRO A N   1 
ATOM   1017 C CA  . PRO A 1 128 ? 44.638 13.720  21.824 1.00 10.48 ? 128 PRO A CA  1 
ATOM   1018 C C   . PRO A 1 128 ? 43.975 12.444  21.271 1.00 10.10 ? 128 PRO A C   1 
ATOM   1019 O O   . PRO A 1 128 ? 42.859 12.511  20.739 1.00 10.21 ? 128 PRO A O   1 
ATOM   1020 C CB  . PRO A 1 128 ? 44.026 14.119  23.176 1.00 18.23 ? 128 PRO A CB  1 
ATOM   1021 C CG  . PRO A 1 128 ? 44.076 15.656  23.153 1.00 18.35 ? 128 PRO A CG  1 
ATOM   1022 C CD  . PRO A 1 128 ? 43.701 15.978  21.724 1.00 15.48 ? 128 PRO A CD  1 
ATOM   1023 N N   . GLN A 1 129 ? 44.677 11.306  21.414 1.00 10.46 ? 129 GLN A N   1 
ATOM   1024 C CA  . GLN A 1 129 ? 44.205 10.001  20.946 1.00 10.31 ? 129 GLN A CA  1 
ATOM   1025 C C   . GLN A 1 129 ? 42.811 9.683   21.519 1.00 9.89  ? 129 GLN A C   1 
ATOM   1026 O O   . GLN A 1 129 ? 41.997 9.027   20.881 1.00 9.98  ? 129 GLN A O   1 
ATOM   1027 C CB  . GLN A 1 129 ? 45.228 8.918   21.305 1.00 11.11 ? 129 GLN A CB  1 
ATOM   1028 C CG  . GLN A 1 129 ? 44.743 7.497   21.026 1.00 11.09 ? 129 GLN A CG  1 
ATOM   1029 C CD  . GLN A 1 129 ? 44.538 7.233   19.550 1.00 16.28 ? 129 GLN A CD  1 
ATOM   1030 O OE1 . GLN A 1 129 ? 45.239 7.788   18.703 1.00 14.77 ? 129 GLN A OE1 1 
ATOM   1031 N NE2 . GLN A 1 129 ? 43.519 6.430   19.227 1.00 16.36 ? 129 GLN A NE2 1 
ATOM   1032 N N   . GLU A 1 130 ? 42.555 10.168  22.726 1.00 10.07 ? 130 GLU A N   1 
ATOM   1033 C CA  . GLU A 1 130 ? 41.243 10.059  23.360 1.00 9.82  ? 130 GLU A CA  1 
ATOM   1034 C C   . GLU A 1 130 ? 40.072 10.569  22.483 1.00 9.18  ? 130 GLU A C   1 
ATOM   1035 O O   . GLU A 1 130 ? 38.940 10.038  22.518 1.00 8.90  ? 130 GLU A O   1 
ATOM   1036 C CB  . GLU A 1 130 ? 41.265 10.807  24.704 1.00 12.29 ? 130 GLU A CB  1 
ATOM   1037 C CG  . GLU A 1 130 ? 42.138 10.131  25.790 1.00 18.14 ? 130 GLU A CG  1 
ATOM   1038 C CD  . GLU A 1 130 ? 43.630 10.493  25.758 1.00 22.62 ? 130 GLU A CD  1 
ATOM   1039 O OE1 . GLU A 1 130 ? 44.197 10.841  24.702 1.00 20.94 ? 130 GLU A OE1 1 
ATOM   1040 O OE2 . GLU A 1 130 ? 44.263 10.401  26.831 1.00 28.25 ? 130 GLU A OE2 1 
ATOM   1041 N N   . ARG A 1 131 ? 40.334 11.592  21.669 1.00 9.04  ? 131 ARG A N   1 
ATOM   1042 C CA  . ARG A 1 131 ? 39.245 12.096  20.806 1.00 8.64  ? 131 ARG A CA  1 
ATOM   1043 C C   . ARG A 1 131 ? 38.968 11.102  19.673 1.00 8.34  ? 131 ARG A C   1 
ATOM   1044 O O   . ARG A 1 131 ? 37.830 10.949  19.227 1.00 10.13 ? 131 ARG A O   1 
ATOM   1045 C CB  . ARG A 1 131 ? 39.561 13.482  20.244 1.00 8.76  ? 131 ARG A CB  1 
ATOM   1046 C CG  . ARG A 1 131 ? 39.811 14.549  21.314 1.00 14.62 ? 131 ARG A CG  1 
ATOM   1047 C CD  . ARG A 1 131 ? 38.514 15.304  21.695 1.00 17.52 ? 131 ARG A CD  1 
ATOM   1048 N NE  . ARG A 1 131 ? 37.408 14.433  22.091 1.00 16.36 ? 131 ARG A NE  1 
ATOM   1049 C CZ  . ARG A 1 131 ? 37.269 13.887  23.298 1.00 13.79 ? 131 ARG A CZ  1 
ATOM   1050 N NH1 . ARG A 1 131 ? 36.221 13.122  23.557 1.00 13.18 ? 131 ARG A NH1 1 
ATOM   1051 N NH2 . ARG A 1 131 ? 38.186 14.103  24.242 1.00 15.17 ? 131 ARG A NH2 1 
ATOM   1052 N N   . ILE A 1 132 ? 40.006 10.414  19.209 1.00 9.41  ? 132 ILE A N   1 
ATOM   1053 C CA  . ILE A 1 132 ? 39.819 9.368   18.209 1.00 9.07  ? 132 ILE A CA  1 
ATOM   1054 C C   . ILE A 1 132 ? 39.164 8.130   18.827 1.00 10.57 ? 132 ILE A C   1 
ATOM   1055 O O   . ILE A 1 132 ? 38.263 7.541   18.237 1.00 9.20  ? 132 ILE A O   1 
ATOM   1056 C CB  . ILE A 1 132 ? 41.171 8.963   17.545 1.00 9.58  ? 132 ILE A CB  1 
ATOM   1057 C CG1 . ILE A 1 132 ? 41.819 10.163  16.852 1.00 11.20 ? 132 ILE A CG1 1 
ATOM   1058 C CG2 . ILE A 1 132 ? 40.959 7.827   16.518 1.00 12.91 ? 132 ILE A CG2 1 
ATOM   1059 C CD1 . ILE A 1 132 ? 40.898 10.896  15.895 1.00 10.45 ? 132 ILE A CD1 1 
ATOM   1060 N N   . ASP A 1 133 ? 39.601 7.753   20.024 1.00 10.52 ? 133 ASP A N   1 
ATOM   1061 C CA  . ASP A 1 133 ? 38.946 6.691   20.766 1.00 11.18 ? 133 ASP A CA  1 
ATOM   1062 C C   . ASP A 1 133 ? 37.439 6.934   20.942 1.00 8.31  ? 133 ASP A C   1 
ATOM   1063 O O   . ASP A 1 133 ? 36.638 5.993   20.851 1.00 8.50  ? 133 ASP A O   1 
ATOM   1064 C CB  . ASP A 1 133 ? 39.613 6.476   22.127 1.00 10.26 ? 133 ASP A CB  1 
ATOM   1065 C CG  . ASP A 1 133 ? 41.056 6.002   22.011 1.00 16.08 ? 133 ASP A CG  1 
ATOM   1066 O OD1 . ASP A 1 133 ? 41.464 5.522   20.939 1.00 16.46 ? 133 ASP A OD1 1 
ATOM   1067 O OD2 . ASP A 1 133 ? 41.778 6.115   23.011 1.00 18.10 ? 133 ASP A OD2 1 
ATOM   1068 N N   . ALA A 1 134 ? 37.047 8.194   21.184 1.00 8.16  ? 134 ALA A N   1 
ATOM   1069 C CA  . ALA A 1 134 ? 35.622 8.538   21.362 1.00 7.93  ? 134 ALA A CA  1 
ATOM   1070 C C   . ALA A 1 134 ? 34.799 8.252   20.088 1.00 8.55  ? 134 ALA A C   1 
ATOM   1071 O O   . ALA A 1 134 ? 33.595 7.904   20.145 1.00 7.53  ? 134 ALA A O   1 
ATOM   1072 C CB  . ALA A 1 134 ? 35.500 9.983   21.773 1.00 10.17 ? 134 ALA A CB  1 
ATOM   1073 N N   . ILE A 1 135 ? 35.437 8.386   18.930 1.00 7.78  ? 135 ILE A N   1 
ATOM   1074 C CA  . ILE A 1 135 ? 34.784 8.057   17.654 1.00 9.08  ? 135 ILE A CA  1 
ATOM   1075 C C   . ILE A 1 135 ? 34.652 6.544   17.454 1.00 7.43  ? 135 ILE A C   1 
ATOM   1076 O O   . ILE A 1 135 ? 33.559 6.033   17.136 1.00 7.87  ? 135 ILE A O   1 
ATOM   1077 C CB  . ILE A 1 135 ? 35.521 8.700   16.465 1.00 8.28  ? 135 ILE A CB  1 
ATOM   1078 C CG1 . ILE A 1 135 ? 35.533 10.209  16.637 1.00 9.98  ? 135 ILE A CG1 1 
ATOM   1079 C CG2 . ILE A 1 135 ? 34.908 8.327   15.117 1.00 8.51  ? 135 ILE A CG2 1 
ATOM   1080 C CD1 . ILE A 1 135 ? 36.349 10.911  15.579 1.00 11.64 ? 135 ILE A CD1 1 
ATOM   1081 N N   . THR A 1 136 ? 35.712 5.788   17.682 1.00 8.99  ? 136 THR A N   1 
ATOM   1082 C CA  . THR A 1 136 ? 35.572 4.354   17.470 1.00 12.25 ? 136 THR A CA  1 
ATOM   1083 C C   . THR A 1 136 ? 34.611 3.713   18.474 1.00 7.80  ? 136 THR A C   1 
ATOM   1084 O O   . THR A 1 136 ? 33.837 2.816   18.106 1.00 8.17  ? 136 THR A O   1 
ATOM   1085 C CB  . THR A 1 136 ? 36.930 3.653   17.443 1.00 16.28 ? 136 THR A CB  1 
ATOM   1086 O OG1 . THR A 1 136 ? 37.590 3.912   18.664 1.00 16.77 ? 136 THR A OG1 1 
ATOM   1087 C CG2 . THR A 1 136 ? 37.787 4.222   16.330 1.00 19.29 ? 136 THR A CG2 1 
ATOM   1088 N N   . GLU A 1 137 ? 34.631 4.189   19.723 1.00 8.25  ? 137 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 137 ? 33.633 3.786   20.707 1.00 9.06  ? 137 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 137 ? 32.216 3.986   20.192 1.00 8.11  ? 137 GLU A C   1 
ATOM   1091 O O   . GLU A 1 137 ? 31.395 3.081   20.311 1.00 8.44  ? 137 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 137 ? 33.823 4.506   22.051 1.00 8.42  ? 137 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 137 ? 35.086 4.092   22.830 1.00 9.35  ? 137 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 137 ? 35.421 5.042   23.973 1.00 13.89 ? 137 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 137 ? 34.606 5.948   24.279 1.00 16.69 ? 137 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 137 ? 36.505 4.894   24.572 1.00 17.15 ? 137 GLU A OE2 1 
ATOM   1097 N N   . ALA A 1 138 ? 31.935 5.156   19.614 1.00 7.23  ? 138 ALA A N   1 
ATOM   1098 C CA  . ALA A 1 138 ? 30.635 5.420   19.019 1.00 7.27  ? 138 ALA A CA  1 
ATOM   1099 C C   . ALA A 1 138 ? 30.297 4.445   17.904 1.00 7.03  ? 138 ALA A C   1 
ATOM   1100 O O   . ALA A 1 138 ? 29.171 3.978   17.856 1.00 7.40  ? 138 ALA A O   1 
ATOM   1101 C CB  . ALA A 1 138 ? 30.537 6.841   18.504 1.00 7.78  ? 138 ALA A CB  1 
ATOM   1102 N N   . TYR A 1 139 ? 31.233 4.197   16.991 1.00 7.15  ? 139 TYR A N   1 
ATOM   1103 C CA  . TYR A 1 139 ? 30.986 3.256   15.906 1.00 7.33  ? 139 TYR A CA  1 
ATOM   1104 C C   . TYR A 1 139 ? 30.704 1.872   16.486 1.00 7.45  ? 139 TYR A C   1 
ATOM   1105 O O   . TYR A 1 139 ? 29.814 1.157   16.023 1.00 7.51  ? 139 TYR A O   1 
ATOM   1106 C CB  . TYR A 1 139 ? 32.148 3.174   14.913 1.00 8.12  ? 139 TYR A CB  1 
ATOM   1107 C CG  . TYR A 1 139 ? 32.449 4.399   14.087 1.00 7.72  ? 139 TYR A CG  1 
ATOM   1108 C CD1 . TYR A 1 139 ? 31.616 5.534   14.071 1.00 8.56  ? 139 TYR A CD1 1 
ATOM   1109 C CD2 . TYR A 1 139 ? 33.585 4.424   13.310 1.00 9.43  ? 139 TYR A CD2 1 
ATOM   1110 C CE1 . TYR A 1 139 ? 31.922 6.653   13.289 1.00 8.82  ? 139 TYR A CE1 1 
ATOM   1111 C CE2 . TYR A 1 139 ? 33.896 5.549   12.532 1.00 8.81  ? 139 TYR A CE2 1 
ATOM   1112 C CZ  . TYR A 1 139 ? 33.059 6.646   12.514 1.00 9.17  ? 139 TYR A CZ  1 
ATOM   1113 O OH  . TYR A 1 139 ? 33.415 7.766   11.747 1.00 9.77  ? 139 TYR A OH  1 
ATOM   1114 N N   . ASP A 1 140 ? 31.461 1.471   17.509 1.00 8.44  ? 140 ASP A N   1 
ATOM   1115 C CA  . ASP A 1 140 ? 31.219 0.161   18.123 1.00 7.89  ? 140 ASP A CA  1 
ATOM   1116 C C   . ASP A 1 140 ? 29.806 0.078   18.700 1.00 8.96  ? 140 ASP A C   1 
ATOM   1117 O O   . ASP A 1 140 ? 29.131 -0.919  18.525 1.00 9.19  ? 140 ASP A O   1 
ATOM   1118 C CB  . ASP A 1 140 ? 32.268 -0.155  19.219 1.00 8.28  ? 140 ASP A CB  1 
ATOM   1119 C CG  . ASP A 1 140 ? 33.695 -0.392  18.684 1.00 12.25 ? 140 ASP A CG  1 
ATOM   1120 O OD1 . ASP A 1 140 ? 33.914 -0.785  17.525 1.00 8.94  ? 140 ASP A OD1 1 
ATOM   1121 O OD2 . ASP A 1 140 ? 34.607 -0.171  19.488 1.00 11.65 ? 140 ASP A OD2 1 
ATOM   1122 N N   . PHE A 1 141 ? 29.389 1.106   19.402 1.00 7.44  ? 141 PHE A N   1 
ATOM   1123 C CA  . PHE A 1 141 ? 28.057 1.120   19.986 1.00 7.55  ? 141 PHE A CA  1 
ATOM   1124 C C   . PHE A 1 141 ? 26.975 0.989   18.902 1.00 7.24  ? 141 PHE A C   1 
ATOM   1125 O O   . PHE A 1 141 ? 26.036 0.179   19.030 1.00 7.36  ? 141 PHE A O   1 
ATOM   1126 C CB  . PHE A 1 141 ? 27.810 2.388   20.791 1.00 7.35  ? 141 PHE A CB  1 
ATOM   1127 C CG  . PHE A 1 141 ? 28.443 2.415   22.160 1.00 8.84  ? 141 PHE A CG  1 
ATOM   1128 C CD1 . PHE A 1 141 ? 28.244 1.381   23.066 1.00 14.10 ? 141 PHE A CD1 1 
ATOM   1129 C CD2 . PHE A 1 141 ? 29.241 3.496   22.543 1.00 8.70  ? 141 PHE A CD2 1 
ATOM   1130 C CE1 . PHE A 1 141 ? 28.813 1.440   24.328 1.00 14.74 ? 141 PHE A CE1 1 
ATOM   1131 C CE2 . PHE A 1 141 ? 29.816 3.550   23.793 1.00 9.85  ? 141 PHE A CE2 1 
ATOM   1132 C CZ  . PHE A 1 141 ? 29.589 2.518   24.689 1.00 12.29 ? 141 PHE A CZ  1 
ATOM   1133 N N   . VAL A 1 142 ? 27.137 1.731   17.813 1.00 8.73  ? 142 VAL A N   1 
ATOM   1134 C CA  . VAL A 1 142 ? 26.096 1.798   16.782 1.00 7.15  ? 142 VAL A CA  1 
ATOM   1135 C C   . VAL A 1 142 ? 26.048 0.462   16.024 1.00 9.22  ? 142 VAL A C   1 
ATOM   1136 O O   . VAL A 1 142 ? 24.965 -0.054  15.761 1.00 7.47  ? 142 VAL A O   1 
ATOM   1137 C CB  . VAL A 1 142 ? 26.301 3.005   15.823 1.00 7.17  ? 142 VAL A CB  1 
ATOM   1138 C CG1 . VAL A 1 142 ? 25.243 3.006   14.707 1.00 8.45  ? 142 VAL A CG1 1 
ATOM   1139 C CG2 . VAL A 1 142 ? 26.234 4.302   16.572 1.00 7.10  ? 142 VAL A CG2 1 
ATOM   1140 N N   . GLU A 1 143 ? 27.208 -0.139  15.736 1.00 9.02  ? 143 GLU A N   1 
ATOM   1141 C CA  . GLU A 1 143 ? 27.251 -1.433  15.056 1.00 8.38  ? 143 GLU A CA  1 
ATOM   1142 C C   . GLU A 1 143 ? 26.419 -2.447  15.837 1.00 8.03  ? 143 GLU A C   1 
ATOM   1143 O O   . GLU A 1 143 ? 25.714 -3.277  15.248 1.00 9.98  ? 143 GLU A O   1 
ATOM   1144 C CB  . GLU A 1 143 ? 28.707 -1.887  14.923 1.00 8.44  ? 143 GLU A CB  1 
ATOM   1145 C CG  . GLU A 1 143 ? 28.867 -3.228  14.224 1.00 9.09  ? 143 GLU A CG  1 
ATOM   1146 C CD  . GLU A 1 143 ? 28.653 -3.186  12.704 1.00 9.35  ? 143 GLU A CD  1 
ATOM   1147 O OE1 . GLU A 1 143 ? 28.601 -2.064  12.156 1.00 9.22  ? 143 GLU A OE1 1 
ATOM   1148 O OE2 . GLU A 1 143 ? 28.558 -4.261  12.070 1.00 9.99  ? 143 GLU A OE2 1 
ATOM   1149 N N   . ALA A 1 144 ? 26.474 -2.338  17.161 1.00 9.19  ? 144 ALA A N   1 
ATOM   1150 C CA  . ALA A 1 144 ? 25.753 -3.228  18.064 1.00 10.26 ? 144 ALA A CA  1 
ATOM   1151 C C   . ALA A 1 144 ? 24.245 -3.012  18.139 1.00 10.46 ? 144 ALA A C   1 
ATOM   1152 O O   . ALA A 1 144 ? 23.520 -3.915  18.585 1.00 14.19 ? 144 ALA A O   1 
ATOM   1153 C CB  . ALA A 1 144 ? 26.362 -3.194  19.449 1.00 11.25 ? 144 ALA A CB  1 
ATOM   1154 N N   . PHE A 1 145 ? 23.777 -1.819  17.765 1.00 9.04  ? 145 PHE A N   1 
ATOM   1155 C CA  . PHE A 1 145 ? 22.355 -1.561  17.765 1.00 12.13 ? 145 PHE A CA  1 
ATOM   1156 C C   . PHE A 1 145 ? 21.616 -2.486  16.807 1.00 12.76 ? 145 PHE A C   1 
ATOM   1157 O O   . PHE A 1 145 ? 20.471 -2.897  17.072 1.00 12.51 ? 145 PHE A O   1 
ATOM   1158 C CB  . PHE A 1 145 ? 22.087 -0.133  17.302 1.00 8.22  ? 145 PHE A CB  1 
ATOM   1159 C CG  . PHE A 1 145 ? 22.512 0.942   18.275 1.00 11.16 ? 145 PHE A CG  1 
ATOM   1160 C CD1 . PHE A 1 145 ? 22.793 0.662   19.608 1.00 10.28 ? 145 PHE A CD1 1 
ATOM   1161 C CD2 . PHE A 1 145 ? 22.608 2.253   17.844 1.00 10.95 ? 145 PHE A CD2 1 
ATOM   1162 C CE1 . PHE A 1 145 ? 23.160 1.666   20.482 1.00 11.62 ? 145 PHE A CE1 1 
ATOM   1163 C CE2 . PHE A 1 145 ? 22.980 3.261   18.706 1.00 8.83  ? 145 PHE A CE2 1 
ATOM   1164 C CZ  . PHE A 1 145 ? 23.250 2.974   20.033 1.00 8.53  ? 145 PHE A CZ  1 
ATOM   1165 N N   . PHE A 1 146 ? 22.209 -2.740  15.652 1.00 11.56 ? 146 PHE A N   1 
ATOM   1166 C CA  . PHE A 1 146 ? 21.445 -3.389  14.580 1.00 11.38 ? 146 PHE A CA  1 
ATOM   1167 C C   . PHE A 1 146 ? 20.904 -4.769  14.913 1.00 11.66 ? 146 PHE A C   1 
ATOM   1168 O O   . PHE A 1 146 ? 19.698 -5.034  14.715 1.00 15.40 ? 146 PHE A O   1 
ATOM   1169 C CB  . PHE A 1 146 ? 22.218 -3.367  13.259 1.00 11.05 ? 146 PHE A CB  1 
ATOM   1170 C CG  . PHE A 1 146 ? 22.490 -1.976  12.783 1.00 8.74  ? 146 PHE A CG  1 
ATOM   1171 C CD1 . PHE A 1 146 ? 21.473 -1.193  12.258 1.00 8.93  ? 146 PHE A CD1 1 
ATOM   1172 C CD2 . PHE A 1 146 ? 23.736 -1.415  12.941 1.00 13.15 ? 146 PHE A CD2 1 
ATOM   1173 C CE1 . PHE A 1 146 ? 21.710 0.135   11.872 1.00 9.24  ? 146 PHE A CE1 1 
ATOM   1174 C CE2 . PHE A 1 146 ? 23.991 -0.128  12.550 1.00 10.83 ? 146 PHE A CE2 1 
ATOM   1175 C CZ  . PHE A 1 146 ? 22.974 0.650   12.007 1.00 8.99  ? 146 PHE A CZ  1 
ATOM   1176 N N   . LYS A 1 147 ? 21.778 -5.639  15.421 1.00 19.38 ? 147 LYS A N   1 
ATOM   1177 C CA  . LYS A 1 147 ? 21.458 -7.068  15.528 1.00 20.24 ? 147 LYS A CA  1 
ATOM   1178 C C   . LYS A 1 147 ? 20.971 -7.569  14.178 1.00 21.48 ? 147 LYS A C   1 
ATOM   1179 O O   . LYS A 1 147 ? 21.700 -7.493  13.189 1.00 22.72 ? 147 LYS A O   1 
ATOM   1180 C CB  . LYS A 1 147 ? 20.418 -7.326  16.618 1.00 21.78 ? 147 LYS A CB  1 
ATOM   1181 C CG  . LYS A 1 147 ? 20.980 -7.177  18.021 1.00 26.50 ? 147 LYS A CG  1 
ATOM   1182 C CD  . LYS A 1 147 ? 20.242 -6.097  18.796 1.00 28.81 ? 147 LYS A CD  1 
ATOM   1183 C CE  . LYS A 1 147 ? 18.960 -6.626  19.432 1.00 31.14 ? 147 LYS A CE  1 
ATOM   1184 N NZ  . LYS A 1 147 ? 18.107 -5.511  19.966 1.00 32.19 ? 147 LYS A NZ  1 
ATOM   1185 N N   . ASP A 1 148 ? 19.721 -8.027  14.124 1.00 18.30 ? 148 ASP A N   1 
ATOM   1186 C CA  . ASP A 1 148 ? 19.161 -8.502  12.863 1.00 21.73 ? 148 ASP A CA  1 
ATOM   1187 C C   . ASP A 1 148 ? 18.329 -7.431  12.145 1.00 20.49 ? 148 ASP A C   1 
ATOM   1188 O O   . ASP A 1 148 ? 17.793 -7.675  11.061 1.00 23.17 ? 148 ASP A O   1 
ATOM   1189 C CB  . ASP A 1 148 ? 18.319 -9.753  13.101 1.00 28.25 ? 148 ASP A CB  1 
ATOM   1190 C CG  . ASP A 1 148 ? 17.158 -9.502  14.055 1.00 34.85 ? 148 ASP A CG  1 
ATOM   1191 O OD1 . ASP A 1 148 ? 17.232 -8.540  14.873 1.00 34.54 ? 148 ASP A OD1 1 
ATOM   1192 O OD2 . ASP A 1 148 ? 16.170 -10.276 13.986 1.00 40.35 ? 148 ASP A OD2 1 
ATOM   1193 N N   . GLN A 1 149 ? 18.241 -6.246  12.736 1.00 18.19 ? 149 GLN A N   1 
ATOM   1194 C CA  . GLN A 1 149 ? 17.418 -5.184  12.166 1.00 16.19 ? 149 GLN A CA  1 
ATOM   1195 C C   . GLN A 1 149 ? 18.223 -4.261  11.266 1.00 13.14 ? 149 GLN A C   1 
ATOM   1196 O O   . GLN A 1 149 ? 19.454 -4.217  11.343 1.00 17.72 ? 149 GLN A O   1 
ATOM   1197 C CB  . GLN A 1 149 ? 16.724 -4.417  13.285 1.00 17.82 ? 149 GLN A CB  1 
ATOM   1198 C CG  . GLN A 1 149 ? 15.659 -5.276  13.979 1.00 21.49 ? 149 GLN A CG  1 
ATOM   1199 C CD  . GLN A 1 149 ? 14.960 -4.550  15.114 1.00 21.45 ? 149 GLN A CD  1 
ATOM   1200 O OE1 . GLN A 1 149 ? 15.527 -3.626  15.717 1.00 18.67 ? 149 GLN A OE1 1 
ATOM   1201 N NE2 . GLN A 1 149 ? 13.717 -4.954  15.409 1.00 21.96 ? 149 GLN A NE2 1 
ATOM   1202 N N   . THR A 1 150 ? 17.530 -3.515  10.409 1.00 14.54 ? 150 THR A N   1 
ATOM   1203 C CA  . THR A 1 150 ? 18.208 -2.730  9.396  1.00 15.99 ? 150 THR A CA  1 
ATOM   1204 C C   . THR A 1 150 ? 18.269 -1.250  9.744  1.00 11.11 ? 150 THR A C   1 
ATOM   1205 O O   . THR A 1 150 ? 18.883 -0.478  9.007  1.00 13.45 ? 150 THR A O   1 
ATOM   1206 C CB  . THR A 1 150 ? 17.530 -2.874  8.024  1.00 17.67 ? 150 THR A CB  1 
ATOM   1207 O OG1 . THR A 1 150 ? 16.113 -2.793  8.193  1.00 19.20 ? 150 THR A OG1 1 
ATOM   1208 C CG2 . THR A 1 150 ? 17.885 -4.206  7.392  1.00 18.61 ? 150 THR A CG2 1 
ATOM   1209 N N   . TYR A 1 151 ? 17.571 -0.836  10.813 1.00 9.44  ? 151 TYR A N   1 
ATOM   1210 C CA  . TYR A 1 151 ? 17.617 0.558   11.256 1.00 7.63  ? 151 TYR A CA  1 
ATOM   1211 C C   . TYR A 1 151 ? 18.079 0.620   12.698 1.00 7.53  ? 151 TYR A C   1 
ATOM   1212 O O   . TYR A 1 151 ? 18.234 -0.420  13.360 1.00 11.88 ? 151 TYR A O   1 
ATOM   1213 C CB  . TYR A 1 151 ? 16.283 1.289   11.031 1.00 7.29  ? 151 TYR A CB  1 
ATOM   1214 C CG  . TYR A 1 151 ? 15.914 1.336   9.566  1.00 7.65  ? 151 TYR A CG  1 
ATOM   1215 C CD1 . TYR A 1 151 ? 16.426 2.341   8.721  1.00 6.95  ? 151 TYR A CD1 1 
ATOM   1216 C CD2 . TYR A 1 151 ? 15.081 0.370   9.021  1.00 9.31  ? 151 TYR A CD2 1 
ATOM   1217 C CE1 . TYR A 1 151 ? 16.071 2.375   7.356  1.00 8.26  ? 151 TYR A CE1 1 
ATOM   1218 C CE2 . TYR A 1 151 ? 14.732 0.392   7.676  1.00 13.52 ? 151 TYR A CE2 1 
ATOM   1219 C CZ  . TYR A 1 151 ? 15.231 1.387   6.846  1.00 10.08 ? 151 TYR A CZ  1 
ATOM   1220 O OH  . TYR A 1 151 ? 14.875 1.398   5.507  1.00 10.67 ? 151 TYR A OH  1 
ATOM   1221 N N   . VAL A 1 152 ? 18.372 1.831   13.178 1.00 6.60  ? 152 VAL A N   1 
ATOM   1222 C CA  . VAL A 1 152 ? 18.907 1.927   14.530 1.00 6.84  ? 152 VAL A CA  1 
ATOM   1223 C C   . VAL A 1 152 ? 17.871 1.719   15.638 1.00 7.81  ? 152 VAL A C   1 
ATOM   1224 O O   . VAL A 1 152 ? 18.214 1.349   16.762 1.00 8.15  ? 152 VAL A O   1 
ATOM   1225 C CB  . VAL A 1 152 ? 19.633 3.238   14.783 1.00 6.16  ? 152 VAL A CB  1 
ATOM   1226 C CG1 . VAL A 1 152 ? 20.787 3.405   13.807 1.00 6.63  ? 152 VAL A CG1 1 
ATOM   1227 C CG2 . VAL A 1 152 ? 18.686 4.431   14.739 1.00 6.69  ? 152 VAL A CG2 1 
ATOM   1228 N N   . ALA A 1 153 ? 16.617 1.992   15.341 1.00 7.17  ? 153 ALA A N   1 
ATOM   1229 C CA  . ALA A 1 153 ? 15.568 1.988   16.365 1.00 7.87  ? 153 ALA A CA  1 
ATOM   1230 C C   . ALA A 1 153 ? 14.382 1.167   15.862 1.00 11.71 ? 153 ALA A C   1 
ATOM   1231 O O   . ALA A 1 153 ? 13.235 1.608   15.884 1.00 15.00 ? 153 ALA A O   1 
ATOM   1232 C CB  . ALA A 1 153 ? 15.145 3.451   16.775 1.00 8.03  ? 153 ALA A CB  1 
ATOM   1233 N N   . GLY A 1 154 ? 14.685 -0.038  15.380 1.00 9.65  ? 154 GLY A N   1 
ATOM   1234 C CA  . GLY A 1 154 ? 13.649 -0.954  14.916 1.00 14.03 ? 154 GLY A CA  1 
ATOM   1235 C C   . GLY A 1 154 ? 13.753 -1.308  13.435 1.00 11.21 ? 154 GLY A C   1 
ATOM   1236 O O   . GLY A 1 154 ? 14.822 -1.157  12.823 1.00 11.03 ? 154 GLY A O   1 
ATOM   1237 N N   . ASN A 1 155 ? 12.660 -1.818  12.866 1.00 12.41 ? 155 ASN A N   1 
ATOM   1238 C CA  . ASN A 1 155 ? 12.679 -2.337  11.500 1.00 13.06 ? 155 ASN A CA  1 
ATOM   1239 C C   . ASN A 1 155 ? 12.252 -1.308  10.446 1.00 12.33 ? 155 ASN A C   1 
ATOM   1240 O O   . ASN A 1 155 ? 12.278 -1.604  9.248  1.00 16.27 ? 155 ASN A O   1 
ATOM   1241 C CB  . ASN A 1 155 ? 11.845 -3.624  11.386 1.00 23.25 ? 155 ASN A CB  1 
ATOM   1242 C CG  . ASN A 1 155 ? 10.427 -3.466  11.938 1.00 26.93 ? 155 ASN A CG  1 
ATOM   1243 O OD1 . ASN A 1 155 ? 9.737  -2.477  11.658 1.00 28.53 ? 155 ASN A OD1 1 
ATOM   1244 N ND2 . ASN A 1 155 ? 9.979  -4.461  12.722 1.00 30.87 ? 155 ASN A ND2 1 
ATOM   1245 N N   . GLN A 1 156 ? 11.864 -0.113  10.899 1.00 11.24 ? 156 GLN A N   1 
ATOM   1246 C CA  . GLN A 1 156 ? 11.516 1.000   10.007 1.00 10.59 ? 156 GLN A CA  1 
ATOM   1247 C C   . GLN A 1 156 ? 12.377 2.231   10.270 1.00 8.67  ? 156 GLN A C   1 
ATOM   1248 O O   . GLN A 1 156 ? 12.832 2.455   11.394 1.00 7.97  ? 156 GLN A O   1 
ATOM   1249 C CB  . GLN A 1 156 ? 10.059 1.421   10.186 1.00 12.54 ? 156 GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 156 ? 9.063  0.314   10.074 1.00 22.33 ? 156 GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 156 ? 7.684  0.896   10.049 1.00 28.11 ? 156 GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 156 ? 7.507  2.063   9.667  1.00 28.37 ? 156 GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 156 ? 6.698  0.120   10.483 1.00 32.25 ? 156 GLN A NE2 1 
ATOM   1254 N N   . LEU A 1 157 ? 12.517 3.064   9.236  1.00 8.76  ? 157 LEU A N   1 
ATOM   1255 C CA  . LEU A 1 157 ? 13.229 4.341   9.288  1.00 6.74  ? 157 LEU A CA  1 
ATOM   1256 C C   . LEU A 1 157 ? 12.585 5.225   10.330 1.00 6.34  ? 157 LEU A C   1 
ATOM   1257 O O   . LEU A 1 157 ? 11.372 5.315   10.363 1.00 7.19  ? 157 LEU A O   1 
ATOM   1258 C CB  . LEU A 1 157 ? 13.095 4.995   7.923  1.00 6.95  ? 157 LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 157 ? 13.805 6.346   7.804  1.00 6.75  ? 157 LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 157 ? 15.358 6.232   7.851  1.00 5.87  ? 157 LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 157 ? 13.359 6.975   6.496  1.00 8.21  ? 157 LEU A CD2 1 
ATOM   1262 N N   . THR A 1 158 ? 13.360 5.853   11.211 1.00 5.37  ? 158 THR A N   1 
ATOM   1263 C CA  . THR A 1 158 ? 12.766 6.807   12.168 1.00 3.96  ? 158 THR A CA  1 
ATOM   1264 C C   . THR A 1 158 ? 13.672 8.028   12.266 1.00 3.63  ? 158 THR A C   1 
ATOM   1265 O O   . THR A 1 158 ? 14.770 8.055   11.711 1.00 4.17  ? 158 THR A O   1 
ATOM   1266 C CB  . THR A 1 158 ? 12.578 6.214   13.588 1.00 5.42  ? 158 THR A CB  1 
ATOM   1267 O OG1 . THR A 1 158 ? 13.862 5.897   14.160 1.00 5.10  ? 158 THR A OG1 1 
ATOM   1268 C CG2 . THR A 1 158 ? 11.738 4.980   13.570 1.00 6.02  ? 158 THR A CG2 1 
ATOM   1269 N N   . ILE A 1 159 ? 13.238 9.027   13.025 1.00 4.61  ? 159 ILE A N   1 
ATOM   1270 C CA  . ILE A 1 159 ? 14.067 10.200  13.220 1.00 4.55  ? 159 ILE A CA  1 
ATOM   1271 C C   . ILE A 1 159 ? 15.374 9.877   13.931 1.00 4.09  ? 159 ILE A C   1 
ATOM   1272 O O   . ILE A 1 159 ? 16.351 10.638  13.833 1.00 3.98  ? 159 ILE A O   1 
ATOM   1273 C CB  . ILE A 1 159 ? 13.321 11.326  13.915 1.00 4.94  ? 159 ILE A CB  1 
ATOM   1274 C CG1 . ILE A 1 159 ? 12.729 10.858  15.246 1.00 3.95  ? 159 ILE A CG1 1 
ATOM   1275 C CG2 . ILE A 1 159 ? 12.289 11.844  12.960 1.00 5.54  ? 159 ILE A CG2 1 
ATOM   1276 C CD1 . ILE A 1 159 ? 12.154 12.045  16.052 1.00 2.87  ? 159 ILE A CD1 1 
ATOM   1277 N N   . ALA A 1 160 ? 15.431 8.761   14.650 1.00 2.89  ? 160 ALA A N   1 
ATOM   1278 C CA  . ALA A 1 160 ? 16.742 8.360   15.192 1.00 3.47  ? 160 ALA A CA  1 
ATOM   1279 C C   . ALA A 1 160 ? 17.769 8.030   14.117 1.00 3.26  ? 160 ALA A C   1 
ATOM   1280 O O   . ALA A 1 160 ? 18.957 8.296   14.296 1.00 3.36  ? 160 ALA A O   1 
ATOM   1281 C CB  . ALA A 1 160 ? 16.584 7.181   16.147 1.00 5.31  ? 160 ALA A CB  1 
ATOM   1282 N N   . ASP A 1 161 ? 17.334 7.510   12.986 1.00 3.40  ? 161 ASP A N   1 
ATOM   1283 C CA  . ASP A 1 161 ? 18.244 7.313   11.862 1.00 4.12  ? 161 ASP A CA  1 
ATOM   1284 C C   . ASP A 1 161 ? 18.771 8.628   11.298 1.00 4.94  ? 161 ASP A C   1 
ATOM   1285 O O   . ASP A 1 161 ? 19.977 8.753   10.979 1.00 3.62  ? 161 ASP A O   1 
ATOM   1286 C CB  . ASP A 1 161 ? 17.604 6.472   10.761 1.00 5.21  ? 161 ASP A CB  1 
ATOM   1287 C CG  . ASP A 1 161 ? 17.227 5.104   11.239 1.00 5.96  ? 161 ASP A CG  1 
ATOM   1288 O OD1 . ASP A 1 161 ? 18.113 4.235   11.402 1.00 4.50  ? 161 ASP A OD1 1 
ATOM   1289 O OD2 . ASP A 1 161 ? 16.018 4.892   11.474 1.00 4.54  ? 161 ASP A OD2 1 
ATOM   1290 N N   . PHE A 1 162 ? 17.874 9.595   11.169 1.00 4.61  ? 162 PHE A N   1 
ATOM   1291 C CA  . PHE A 1 162 ? 18.285 10.903  10.679 1.00 5.00  ? 162 PHE A CA  1 
ATOM   1292 C C   . PHE A 1 162 ? 19.282 11.545  11.625 1.00 3.01  ? 162 PHE A C   1 
ATOM   1293 O O   . PHE A 1 162 ? 20.278 12.115  11.190 1.00 4.89  ? 162 PHE A O   1 
ATOM   1294 C CB  . PHE A 1 162 ? 17.084 11.814  10.514 1.00 3.72  ? 162 PHE A CB  1 
ATOM   1295 C CG  . PHE A 1 162 ? 16.047 11.324  9.516  1.00 3.61  ? 162 PHE A CG  1 
ATOM   1296 C CD1 . PHE A 1 162 ? 16.386 10.590  8.406  1.00 3.26  ? 162 PHE A CD1 1 
ATOM   1297 C CD2 . PHE A 1 162 ? 14.740 11.773  9.633  1.00 3.85  ? 162 PHE A CD2 1 
ATOM   1298 C CE1 . PHE A 1 162 ? 15.446 10.197  7.489  1.00 4.54  ? 162 PHE A CE1 1 
ATOM   1299 C CE2 . PHE A 1 162 ? 13.776 11.382  8.708  1.00 5.45  ? 162 PHE A CE2 1 
ATOM   1300 C CZ  . PHE A 1 162 ? 14.129 10.600  7.627  1.00 4.66  ? 162 PHE A CZ  1 
ATOM   1301 N N   . SER A 1 163 ? 19.027 11.456  12.931 1.00 4.71  ? 163 SER A N   1 
ATOM   1302 C CA  . SER A 1 163 ? 19.966 11.987  13.928 1.00 5.92  ? 163 SER A CA  1 
ATOM   1303 C C   . SER A 1 163 ? 21.342 11.338  13.786 1.00 3.77  ? 163 SER A C   1 
ATOM   1304 O O   . SER A 1 163 ? 22.362 12.029  13.637 1.00 4.01  ? 163 SER A O   1 
ATOM   1305 C CB  . SER A 1 163 ? 19.421 11.810  15.356 1.00 5.23  ? 163 SER A CB  1 
ATOM   1306 O OG  . SER A 1 163 ? 20.203 12.498  16.316 1.00 6.16  ? 163 SER A OG  1 
ATOM   1307 N N   . LEU A 1 164 ? 21.393 10.014  13.832 1.00 3.98  ? 164 LEU A N   1 
ATOM   1308 C CA  . LEU A 1 164 ? 22.687 9.340   13.824 1.00 4.62  ? 164 LEU A CA  1 
ATOM   1309 C C   . LEU A 1 164 ? 23.379 9.485   12.480 1.00 4.70  ? 164 LEU A C   1 
ATOM   1310 O O   . LEU A 1 164 ? 24.622 9.585   12.458 1.00 4.13  ? 164 LEU A O   1 
ATOM   1311 C CB  . LEU A 1 164 ? 22.537 7.882   14.260 1.00 3.93  ? 164 LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 164 ? 22.494 7.812   15.772 1.00 4.32  ? 164 LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 164 ? 21.812 6.546   16.237 1.00 7.19  ? 164 LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 164 ? 23.863 8.001   16.394 1.00 6.93  ? 164 LEU A CD2 1 
ATOM   1315 N N   . ILE A 1 165 ? 22.671 9.488   11.351 1.00 4.91  ? 165 ILE A N   1 
ATOM   1316 C CA  . ILE A 1 165 ? 23.388 9.578   10.090 1.00 4.57  ? 165 ILE A CA  1 
ATOM   1317 C C   . ILE A 1 165 ? 24.016 10.977  9.976  1.00 3.97  ? 165 ILE A C   1 
ATOM   1318 O O   . ILE A 1 165 ? 25.130 11.128  9.420  1.00 5.06  ? 165 ILE A O   1 
ATOM   1319 C CB  . ILE A 1 165 ? 22.526 9.230   8.842  1.00 5.26  ? 165 ILE A CB  1 
ATOM   1320 C CG1 . ILE A 1 165 ? 23.372 9.083   7.592  1.00 5.09  ? 165 ILE A CG1 1 
ATOM   1321 C CG2 . ILE A 1 165 ? 21.460 10.290  8.531  1.00 4.87  ? 165 ILE A CG2 1 
ATOM   1322 C CD1 . ILE A 1 165 ? 24.371 7.967   7.704  1.00 7.02  ? 165 ILE A CD1 1 
ATOM   1323 N N   . SER A 1 166 ? 23.336 12.023  10.462 1.00 4.10  ? 166 SER A N   1 
ATOM   1324 C CA  . SER A 1 166 ? 23.851 13.363  10.341 1.00 7.07  ? 166 SER A CA  1 
ATOM   1325 C C   . SER A 1 166 ? 25.225 13.466  11.002 1.00 4.75  ? 166 SER A C   1 
ATOM   1326 O O   . SER A 1 166 ? 26.147 14.089  10.450 1.00 5.15  ? 166 SER A O   1 
ATOM   1327 C CB  . SER A 1 166 ? 22.814 14.331  10.926 1.00 3.70  ? 166 SER A CB  1 
ATOM   1328 O OG  . SER A 1 166 ? 22.786 14.330  12.329 1.00 3.86  ? 166 SER A OG  1 
ATOM   1329 N N   . SER A 1 167 ? 25.382 12.867  12.176 1.00 6.50  ? 167 SER A N   1 
ATOM   1330 C CA  . SER A 1 167 ? 26.690 12.911  12.858 1.00 4.44  ? 167 SER A CA  1 
ATOM   1331 C C   . SER A 1 167 ? 27.694 11.873  12.371 1.00 4.74  ? 167 SER A C   1 
ATOM   1332 O O   . SER A 1 167 ? 28.846 12.202  12.195 1.00 5.46  ? 167 SER A O   1 
ATOM   1333 C CB  . SER A 1 167 ? 26.549 12.871  14.374 1.00 8.35  ? 167 SER A CB  1 
ATOM   1334 O OG  . SER A 1 167 ? 25.607 11.905  14.771 1.00 6.80  ? 167 SER A OG  1 
ATOM   1335 N N   . ILE A 1 168 ? 27.258 10.660  12.092 1.00 4.72  ? 168 ILE A N   1 
ATOM   1336 C CA  . ILE A 1 168 ? 28.187 9.637   11.598 1.00 7.34  ? 168 ILE A CA  1 
ATOM   1337 C C   . ILE A 1 168 ? 28.789 10.046  10.249 1.00 6.98  ? 168 ILE A C   1 
ATOM   1338 O O   . ILE A 1 168 ? 30.017 9.904   10.017 1.00 7.74  ? 168 ILE A O   1 
ATOM   1339 C CB  . ILE A 1 168 ? 27.484 8.252   11.496 1.00 7.21  ? 168 ILE A CB  1 
ATOM   1340 C CG1 . ILE A 1 168 ? 27.160 7.713   12.899 1.00 11.63 ? 168 ILE A CG1 1 
ATOM   1341 C CG2 . ILE A 1 168 ? 28.326 7.209   10.692 1.00 6.33  ? 168 ILE A CG2 1 
ATOM   1342 C CD1 . ILE A 1 168 ? 28.393 7.391   13.733 1.00 14.77 ? 168 ILE A CD1 1 
ATOM   1343 N N   . SER A 1 169 ? 27.948 10.606  9.374  1.00 5.09  ? 169 SER A N   1 
ATOM   1344 C CA  . SER A 1 169 ? 28.382 11.112  8.067  1.00 5.48  ? 169 SER A CA  1 
ATOM   1345 C C   . SER A 1 169 ? 29.371 12.291  8.197  1.00 6.49  ? 169 SER A C   1 
ATOM   1346 O O   . SER A 1 169 ? 30.034 12.689  7.230  1.00 8.06  ? 169 SER A O   1 
ATOM   1347 C CB  . SER A 1 169 ? 27.178 11.450  7.179  1.00 7.05  ? 169 SER A CB  1 
ATOM   1348 O OG  . SER A 1 169 ? 26.540 12.627  7.613  1.00 5.76  ? 169 SER A OG  1 
ATOM   1349 N N   . SER A 1 170 ? 29.443 12.866  9.393  1.00 6.26  ? 170 SER A N   1 
ATOM   1350 C CA  . SER A 1 170 ? 30.389 13.939  9.630  1.00 7.26  ? 170 SER A CA  1 
ATOM   1351 C C   . SER A 1 170 ? 31.650 13.366  10.239 1.00 7.25  ? 170 SER A C   1 
ATOM   1352 O O   . SER A 1 170 ? 32.773 13.803  9.947  1.00 8.14  ? 170 SER A O   1 
ATOM   1353 C CB  . SER A 1 170 ? 29.773 14.999  10.563 1.00 5.63  ? 170 SER A CB  1 
ATOM   1354 O OG  . SER A 1 170 ? 28.534 15.466  10.066 1.00 7.24  ? 170 SER A OG  1 
ATOM   1355 N N   . LEU A 1 171 ? 31.471 12.380  11.106 1.00 6.98  ? 171 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 171 ? 32.623 11.766  11.797 1.00 6.37  ? 171 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 171 ? 33.613 11.082  10.865 1.00 8.59  ? 171 LEU A C   1 
ATOM   1358 O O   . LEU A 1 171 ? 34.797 10.896  11.198 1.00 8.32  ? 171 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 171 ? 32.169 10.783  12.886 1.00 6.35  ? 171 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 171 ? 31.632 11.442  14.165 1.00 6.44  ? 171 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 171 ? 30.952 10.415  15.071 1.00 7.27  ? 171 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 171 ? 32.754 12.205  14.896 1.00 7.25  ? 171 LEU A CD2 1 
ATOM   1363 N N   . VAL A 1 172 ? 33.106 10.684  9.697  1.00 9.28  ? 172 VAL A N   1 
ATOM   1364 C CA  . VAL A 1 172 ? 33.985 10.028  8.731  1.00 7.44  ? 172 VAL A CA  1 
ATOM   1365 C C   . VAL A 1 172 ? 35.054 10.988  8.236  1.00 7.77  ? 172 VAL A C   1 
ATOM   1366 O O   . VAL A 1 172 ? 36.085 10.544  7.699  1.00 10.20 ? 172 VAL A O   1 
ATOM   1367 C CB  . VAL A 1 172 ? 33.244 9.453   7.519  1.00 14.95 ? 172 VAL A CB  1 
ATOM   1368 C CG1 . VAL A 1 172 ? 32.341 8.294   7.935  1.00 11.78 ? 172 VAL A CG1 1 
ATOM   1369 C CG2 . VAL A 1 172 ? 32.487 10.531  6.793  1.00 14.54 ? 172 VAL A CG2 1 
ATOM   1370 N N   . ALA A 1 173 ? 34.834 12.293  8.431  1.00 9.08  ? 173 ALA A N   1 
ATOM   1371 C CA  . ALA A 1 173 ? 35.885 13.269  8.149  1.00 5.89  ? 173 ALA A CA  1 
ATOM   1372 C C   . ALA A 1 173 ? 37.147 12.933  8.936  1.00 7.81  ? 173 ALA A C   1 
ATOM   1373 O O   . ALA A 1 173 ? 38.273 13.204  8.501  1.00 11.60 ? 173 ALA A O   1 
ATOM   1374 C CB  . ALA A 1 173 ? 35.433 14.673  8.480  1.00 7.11  ? 173 ALA A CB  1 
ATOM   1375 N N   . PHE A 1 174 ? 36.944 12.376  10.132 1.00 11.27 ? 174 PHE A N   1 
ATOM   1376 C CA  . PHE A 1 174 ? 38.070 12.092  11.032 1.00 9.82  ? 174 PHE A CA  1 
ATOM   1377 C C   . PHE A 1 174 ? 38.519 10.645  10.962 1.00 10.09 ? 174 PHE A C   1 
ATOM   1378 O O   . PHE A 1 174 ? 39.708 10.347  10.984 1.00 13.26 ? 174 PHE A O   1 
ATOM   1379 C CB  . PHE A 1 174 ? 37.699 12.422  12.486 1.00 11.05 ? 174 PHE A CB  1 
ATOM   1380 C CG  . PHE A 1 174 ? 37.232 13.827  12.684 1.00 10.31 ? 174 PHE A CG  1 
ATOM   1381 C CD1 . PHE A 1 174 ? 38.163 14.869  12.670 1.00 12.64 ? 174 PHE A CD1 1 
ATOM   1382 C CD2 . PHE A 1 174 ? 35.876 14.126  12.879 1.00 12.09 ? 174 PHE A CD2 1 
ATOM   1383 C CE1 . PHE A 1 174 ? 37.758 16.189  12.837 1.00 12.14 ? 174 PHE A CE1 1 
ATOM   1384 C CE2 . PHE A 1 174 ? 35.469 15.455  13.063 1.00 13.23 ? 174 PHE A CE2 1 
ATOM   1385 C CZ  . PHE A 1 174 ? 36.428 16.474  13.039 1.00 11.56 ? 174 PHE A CZ  1 
ATOM   1386 N N   . VAL A 1 175 ? 37.546 9.753   10.945 1.00 13.72 ? 175 VAL A N   1 
ATOM   1387 C CA  . VAL A 1 175 ? 37.761 8.318   10.924 1.00 10.74 ? 175 VAL A CA  1 
ATOM   1388 C C   . VAL A 1 175 ? 36.781 7.698   9.940  1.00 11.01 ? 175 VAL A C   1 
ATOM   1389 O O   . VAL A 1 175 ? 35.625 7.536   10.249 1.00 10.22 ? 175 VAL A O   1 
ATOM   1390 C CB  . VAL A 1 175 ? 37.535 7.693   12.312 1.00 10.90 ? 175 VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 175 ? 37.735 6.200   12.225 1.00 12.43 ? 175 VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 175 ? 38.521 8.276   13.355 1.00 12.28 ? 175 VAL A CG2 1 
ATOM   1393 N N   . PRO A 1 176 ? 37.240 7.369   8.721  1.00 12.33 ? 176 PRO A N   1 
ATOM   1394 C CA  . PRO A 1 176 ? 36.365 6.673   7.776  1.00 15.25 ? 176 PRO A CA  1 
ATOM   1395 C C   . PRO A 1 176 ? 35.881 5.370   8.396  1.00 14.77 ? 176 PRO A C   1 
ATOM   1396 O O   . PRO A 1 176 ? 36.609 4.759   9.186  1.00 15.41 ? 176 PRO A O   1 
ATOM   1397 C CB  . PRO A 1 176 ? 37.277 6.394   6.577  1.00 16.08 ? 176 PRO A CB  1 
ATOM   1398 C CG  . PRO A 1 176 ? 38.351 7.437   6.674  1.00 14.44 ? 176 PRO A CG  1 
ATOM   1399 C CD  . PRO A 1 176 ? 38.571 7.634   8.147  1.00 13.15 ? 176 PRO A CD  1 
ATOM   1400 N N   . VAL A 1 177 ? 34.652 4.977   8.073  1.00 12.99 ? 177 VAL A N   1 
ATOM   1401 C CA  . VAL A 1 177 ? 34.106 3.728   8.593  1.00 15.11 ? 177 VAL A CA  1 
ATOM   1402 C C   . VAL A 1 177 ? 34.771 2.583   7.850  1.00 16.55 ? 177 VAL A C   1 
ATOM   1403 O O   . VAL A 1 177 ? 34.685 2.497   6.626  1.00 18.86 ? 177 VAL A O   1 
ATOM   1404 C CB  . VAL A 1 177 ? 32.571 3.645   8.427  1.00 14.24 ? 177 VAL A CB  1 
ATOM   1405 C CG1 . VAL A 1 177 ? 32.024 2.214   8.775  1.00 12.52 ? 177 VAL A CG1 1 
ATOM   1406 C CG2 . VAL A 1 177 ? 31.879 4.714   9.274  1.00 15.15 ? 177 VAL A CG2 1 
ATOM   1407 N N   . ASP A 1 178 ? 35.459 1.725   8.595  1.00 15.44 ? 178 ASP A N   1 
ATOM   1408 C CA  . ASP A 1 178 ? 36.015 0.491   8.040  1.00 17.81 ? 178 ASP A CA  1 
ATOM   1409 C C   . ASP A 1 178 ? 34.856 -0.481  7.756  1.00 15.43 ? 178 ASP A C   1 
ATOM   1410 O O   . ASP A 1 178 ? 34.308 -1.052  8.681  1.00 15.30 ? 178 ASP A O   1 
ATOM   1411 C CB  . ASP A 1 178 ? 36.971 -0.117  9.082  1.00 19.40 ? 178 ASP A CB  1 
ATOM   1412 C CG  . ASP A 1 178 ? 37.587 -1.451  8.656  1.00 24.55 ? 178 ASP A CG  1 
ATOM   1413 O OD1 . ASP A 1 178 ? 37.181 -2.058  7.637  1.00 26.56 ? 178 ASP A OD1 1 
ATOM   1414 O OD2 . ASP A 1 178 ? 38.490 -1.897  9.394  1.00 26.19 ? 178 ASP A OD2 1 
ATOM   1415 N N   . ALA A 1 179 ? 34.508 -0.695  6.488  1.00 16.28 ? 179 ALA A N   1 
ATOM   1416 C CA  . ALA A 1 179 ? 33.372 -1.571  6.153  1.00 17.59 ? 179 ALA A CA  1 
ATOM   1417 C C   . ALA A 1 179 ? 33.573 -3.032  6.560  1.00 16.89 ? 179 ALA A C   1 
ATOM   1418 O O   . ALA A 1 179 ? 32.606 -3.749  6.767  1.00 15.54 ? 179 ALA A O   1 
ATOM   1419 C CB  . ALA A 1 179 ? 33.003 -1.468  4.670  1.00 20.63 ? 179 ALA A CB  1 
ATOM   1420 N N   . ALA A 1 180 ? 34.821 -3.484  6.644  1.00 16.68 ? 180 ALA A N   1 
ATOM   1421 C CA  . ALA A 1 180 ? 35.099 -4.848  7.106  1.00 19.51 ? 180 ALA A CA  1 
ATOM   1422 C C   . ALA A 1 180 ? 34.825 -4.981  8.606  1.00 19.82 ? 180 ALA A C   1 
ATOM   1423 O O   . ALA A 1 180 ? 34.307 -6.014  9.067  1.00 14.15 ? 180 ALA A O   1 
ATOM   1424 C CB  . ALA A 1 180 ? 36.533 -5.271  6.785  1.00 21.51 ? 180 ALA A CB  1 
ATOM   1425 N N   . LYS A 1 181 ? 35.175 -3.940  9.365  1.00 15.79 ? 181 LYS A N   1 
ATOM   1426 C CA  . LYS A 1 181 ? 35.007 -3.983  10.804 1.00 13.22 ? 181 LYS A CA  1 
ATOM   1427 C C   . LYS A 1 181 ? 33.570 -3.651  11.172 1.00 12.29 ? 181 LYS A C   1 
ATOM   1428 O O   . LYS A 1 181 ? 33.028 -4.174  12.146 1.00 13.74 ? 181 LYS A O   1 
ATOM   1429 C CB  . LYS A 1 181 ? 35.919 -2.978  11.495 1.00 15.70 ? 181 LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 181 ? 35.715 -2.924  13.016 1.00 17.35 ? 181 LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 181 ? 36.920 -2.344  13.744 1.00 21.25 ? 181 LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 181 ? 36.711 -2.338  15.257 1.00 21.28 ? 181 LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 181 ? 36.630 -3.727  15.790 1.00 25.94 ? 181 LYS A NZ  1 
ATOM   1434 N N   . TYR A 1 182 ? 32.944 -2.777  10.387 1.00 11.73 ? 182 TYR A N   1 
ATOM   1435 C CA  . TYR A 1 182 ? 31.593 -2.311  10.690 1.00 10.87 ? 182 TYR A CA  1 
ATOM   1436 C C   . TYR A 1 182 ? 30.677 -2.597  9.531  1.00 10.80 ? 182 TYR A C   1 
ATOM   1437 O O   . TYR A 1 182 ? 30.200 -1.656  8.888  1.00 10.32 ? 182 TYR A O   1 
ATOM   1438 C CB  . TYR A 1 182 ? 31.594 -0.801  10.969 1.00 10.19 ? 182 TYR A CB  1 
ATOM   1439 C CG  . TYR A 1 182 ? 32.482 -0.426  12.128 1.00 10.30 ? 182 TYR A CG  1 
ATOM   1440 C CD1 . TYR A 1 182 ? 32.097 -0.734  13.432 1.00 10.12 ? 182 TYR A CD1 1 
ATOM   1441 C CD2 . TYR A 1 182 ? 33.726 0.193   11.931 1.00 10.67 ? 182 TYR A CD2 1 
ATOM   1442 C CE1 . TYR A 1 182 ? 32.882 -0.412  14.502 1.00 10.30 ? 182 TYR A CE1 1 
ATOM   1443 C CE2 . TYR A 1 182 ? 34.519 0.514   13.010 1.00 10.84 ? 182 TYR A CE2 1 
ATOM   1444 C CZ  . TYR A 1 182 ? 34.110 0.186   14.295 1.00 10.67 ? 182 TYR A CZ  1 
ATOM   1445 O OH  . TYR A 1 182 ? 34.881 0.521   15.397 1.00 10.91 ? 182 TYR A OH  1 
ATOM   1446 N N   . PRO A 1 183 ? 30.396 -3.888  9.263  1.00 11.32 ? 183 PRO A N   1 
ATOM   1447 C CA  . PRO A 1 183 ? 29.555 -4.179  8.090  1.00 11.58 ? 183 PRO A CA  1 
ATOM   1448 C C   . PRO A 1 183 ? 28.094 -3.684  8.211  1.00 12.87 ? 183 PRO A C   1 
ATOM   1449 O O   . PRO A 1 183 ? 27.538 -3.182  7.227  1.00 10.38 ? 183 PRO A O   1 
ATOM   1450 C CB  . PRO A 1 183 ? 29.636 -5.714  7.971  1.00 13.49 ? 183 PRO A CB  1 
ATOM   1451 C CG  . PRO A 1 183 ? 30.036 -6.174  9.346  1.00 14.16 ? 183 PRO A CG  1 
ATOM   1452 C CD  . PRO A 1 183 ? 30.975 -5.118  9.844  1.00 12.02 ? 183 PRO A CD  1 
ATOM   1453 N N   . LYS A 1 184 ? 27.480 -3.793  9.388  1.00 10.53 ? 184 LYS A N   1 
ATOM   1454 C CA  . LYS A 1 184 ? 26.106 -3.341  9.546  1.00 10.89 ? 184 LYS A CA  1 
ATOM   1455 C C   . LYS A 1 184 ? 25.997 -1.803  9.484  1.00 8.74  ? 184 LYS A C   1 
ATOM   1456 O O   . LYS A 1 184 ? 25.052 -1.250  8.881  1.00 8.81  ? 184 LYS A O   1 
ATOM   1457 C CB  . LYS A 1 184 ? 25.483 -3.917  10.835 1.00 9.54  ? 184 LYS A CB  1 
ATOM   1458 C CG  . LYS A 1 184 ? 25.408 -5.449  10.782 1.00 12.31 ? 184 LYS A CG  1 
ATOM   1459 C CD  . LYS A 1 184 ? 24.899 -6.063  12.085 1.00 13.37 ? 184 LYS A CD  1 
ATOM   1460 C CE  . LYS A 1 184 ? 24.880 -7.595  12.009 1.00 21.51 ? 184 LYS A CE  1 
ATOM   1461 N NZ  . LYS A 1 184 ? 24.467 -8.163  13.327 1.00 24.80 ? 184 LYS A NZ  1 
ATOM   1462 N N   . LEU A 1 185 ? 26.929 -1.099  10.126 1.00 8.63  ? 185 LEU A N   1 
ATOM   1463 C CA  . LEU A 1 185 ? 26.937 0.361   10.060 1.00 8.06  ? 185 LEU A CA  1 
ATOM   1464 C C   . LEU A 1 185 ? 27.112 0.800   8.605  1.00 8.21  ? 185 LEU A C   1 
ATOM   1465 O O   . LEU A 1 185 ? 26.417 1.711   8.135  1.00 7.72  ? 185 LEU A O   1 
ATOM   1466 C CB  . LEU A 1 185 ? 28.092 0.904   10.908 1.00 13.08 ? 185 LEU A CB  1 
ATOM   1467 C CG  . LEU A 1 185 ? 28.261 2.411   11.041 1.00 13.81 ? 185 LEU A CG  1 
ATOM   1468 C CD1 . LEU A 1 185 ? 27.041 2.945   11.703 1.00 14.45 ? 185 LEU A CD1 1 
ATOM   1469 C CD2 . LEU A 1 185 ? 29.501 2.711   11.876 1.00 15.25 ? 185 LEU A CD2 1 
ATOM   1470 N N   A SER A 1 186 ? 28.033 0.152   7.904  0.53 8.94  ? 186 SER A N   1 
ATOM   1471 N N   B SER A 1 186 ? 28.043 0.163   7.900  0.47 8.95  ? 186 SER A N   1 
ATOM   1472 C CA  A SER A 1 186 ? 28.268 0.447   6.499  0.53 9.60  ? 186 SER A CA  1 
ATOM   1473 C CA  B SER A 1 186 ? 28.262 0.467   6.489  0.47 9.70  ? 186 SER A CA  1 
ATOM   1474 C C   A SER A 1 186 ? 27.022 0.220   5.628  0.53 10.26 ? 186 SER A C   1 
ATOM   1475 C C   B SER A 1 186 ? 26.997 0.240   5.643  0.47 10.33 ? 186 SER A C   1 
ATOM   1476 O O   A SER A 1 186 ? 26.665 1.063   4.797  0.53 10.64 ? 186 SER A O   1 
ATOM   1477 O O   B SER A 1 186 ? 26.608 1.093   4.835  0.47 9.93  ? 186 SER A O   1 
ATOM   1478 C CB  A SER A 1 186 ? 29.460 -0.357  5.994  0.53 10.52 ? 186 SER A CB  1 
ATOM   1479 C CB  B SER A 1 186 ? 29.440 -0.330  5.921  0.47 10.71 ? 186 SER A CB  1 
ATOM   1480 O OG  A SER A 1 186 ? 30.612 0.048   6.698  0.53 10.28 ? 186 SER A OG  1 
ATOM   1481 O OG  B SER A 1 186 ? 29.715 0.094   4.592  0.47 11.14 ? 186 SER A OG  1 
ATOM   1482 N N   . ALA A 1 187 ? 26.330 -0.890  5.859  1.00 10.56 ? 187 ALA A N   1 
ATOM   1483 C CA  . ALA A 1 187 ? 25.121 -1.227  5.089  1.00 11.50 ? 187 ALA A CA  1 
ATOM   1484 C C   . ALA A 1 187 ? 23.980 -0.272  5.372  1.00 8.50  ? 187 ALA A C   1 
ATOM   1485 O O   . ALA A 1 187 ? 23.204 0.095   4.485  1.00 8.93  ? 187 ALA A O   1 
ATOM   1486 C CB  . ALA A 1 187 ? 24.699 -2.666  5.377  1.00 11.29 ? 187 ALA A CB  1 
ATOM   1487 N N   . TRP A 1 188 ? 23.880 0.139   6.625  1.00 7.95  ? 188 TRP A N   1 
ATOM   1488 C CA  . TRP A 1 188 ? 22.905 1.164   7.027  1.00 7.18  ? 188 TRP A CA  1 
ATOM   1489 C C   . TRP A 1 188 ? 23.135 2.547   6.359  1.00 6.87  ? 188 TRP A C   1 
ATOM   1490 O O   . TRP A 1 188 ? 22.191 3.199   5.879  1.00 6.53  ? 188 TRP A O   1 
ATOM   1491 C CB  . TRP A 1 188 ? 22.874 1.246   8.550  1.00 6.86  ? 188 TRP A CB  1 
ATOM   1492 C CG  . TRP A 1 188 ? 22.167 2.417   9.156  1.00 6.47  ? 188 TRP A CG  1 
ATOM   1493 C CD1 . TRP A 1 188 ? 20.839 2.565   9.355  1.00 5.85  ? 188 TRP A CD1 1 
ATOM   1494 C CD2 . TRP A 1 188 ? 22.779 3.575   9.723  1.00 6.17  ? 188 TRP A CD2 1 
ATOM   1495 N NE1 . TRP A 1 188 ? 20.561 3.746   9.994  1.00 6.16  ? 188 TRP A NE1 1 
ATOM   1496 C CE2 . TRP A 1 188 ? 21.754 4.391   10.237 1.00 5.10  ? 188 TRP A CE2 1 
ATOM   1497 C CE3 . TRP A 1 188 ? 24.117 3.996   9.840  1.00 6.90  ? 188 TRP A CE3 1 
ATOM   1498 C CZ2 . TRP A 1 188 ? 22.000 5.618   10.847 1.00 7.03  ? 188 TRP A CZ2 1 
ATOM   1499 C CZ3 . TRP A 1 188 ? 24.371 5.195   10.446 1.00 6.14  ? 188 TRP A CZ3 1 
ATOM   1500 C CH2 . TRP A 1 188 ? 23.317 5.991   10.954 1.00 5.11  ? 188 TRP A CH2 1 
ATOM   1501 N N   . ILE A 1 189 ? 24.382 2.998   6.339  1.00 8.17  ? 189 ILE A N   1 
ATOM   1502 C CA  . ILE A 1 189 ? 24.731 4.201   5.590  1.00 6.94  ? 189 ILE A CA  1 
ATOM   1503 C C   . ILE A 1 189 ? 24.287 4.073   4.126  1.00 7.25  ? 189 ILE A C   1 
ATOM   1504 O O   . ILE A 1 189 ? 23.658 4.998   3.571  1.00 7.45  ? 189 ILE A O   1 
ATOM   1505 C CB  . ILE A 1 189 ? 26.240 4.497   5.669  1.00 8.04  ? 189 ILE A CB  1 
ATOM   1506 C CG1 . ILE A 1 189 ? 26.629 4.851   7.098  1.00 8.85  ? 189 ILE A CG1 1 
ATOM   1507 C CG2 . ILE A 1 189 ? 26.633 5.606   4.696  1.00 8.05  ? 189 ILE A CG2 1 
ATOM   1508 C CD1 . ILE A 1 189 ? 28.121 4.952   7.325  1.00 10.61 ? 189 ILE A CD1 1 
ATOM   1509 N N   . LYS A 1 190 ? 24.585 2.935   3.498  1.00 7.96  ? 190 LYS A N   1 
ATOM   1510 C CA  . LYS A 1 190 ? 24.203 2.716   2.118  1.00 8.43  ? 190 LYS A CA  1 
ATOM   1511 C C   . LYS A 1 190 ? 22.718 2.680   1.915  1.00 9.55  ? 190 LYS A C   1 
ATOM   1512 O O   . LYS A 1 190 ? 22.253 3.128   0.882  1.00 8.67  ? 190 LYS A O   1 
ATOM   1513 C CB  . LYS A 1 190 ? 24.875 1.441   1.588  1.00 11.89 ? 190 LYS A CB  1 
ATOM   1514 C CG  . LYS A 1 190 ? 26.364 1.610   1.352  1.00 16.89 ? 190 LYS A CG  1 
ATOM   1515 C CD  . LYS A 1 190 ? 26.627 1.845   -0.137 1.00 22.98 ? 190 LYS A CD  1 
ATOM   1516 C CE  . LYS A 1 190 ? 27.952 2.586   -0.399 1.00 24.40 ? 190 LYS A CE  1 
ATOM   1517 N NZ  . LYS A 1 190 ? 28.065 3.003   -1.850 1.00 23.45 ? 190 LYS A NZ  1 
ATOM   1518 N N   . ARG A 1 191 ? 21.990 2.162   2.898  1.00 8.39  ? 191 ARG A N   1 
ATOM   1519 C CA  . ARG A 1 191 ? 20.525 2.156   2.858  1.00 7.53  ? 191 ARG A CA  1 
ATOM   1520 C C   . ARG A 1 191 ? 19.959 3.562   2.869  1.00 8.16  ? 191 ARG A C   1 
ATOM   1521 O O   . ARG A 1 191 ? 19.110 3.903   2.042  1.00 8.26  ? 191 ARG A O   1 
ATOM   1522 C CB  . ARG A 1 191 ? 20.031 1.342   4.070  1.00 12.40 ? 191 ARG A CB  1 
ATOM   1523 C CG  . ARG A 1 191 ? 18.553 1.069   4.206  1.00 13.15 ? 191 ARG A CG  1 
ATOM   1524 C CD  . ARG A 1 191 ? 18.348 0.059   5.366  1.00 14.57 ? 191 ARG A CD  1 
ATOM   1525 N NE  . ARG A 1 191 ? 18.968 -1.246  5.062  1.00 16.25 ? 191 ARG A NE  1 
ATOM   1526 C CZ  . ARG A 1 191 ? 19.933 -1.879  5.755  1.00 17.16 ? 191 ARG A CZ  1 
ATOM   1527 N NH1 . ARG A 1 191 ? 20.442 -1.400  6.901  1.00 12.57 ? 191 ARG A NH1 1 
ATOM   1528 N NH2 . ARG A 1 191 ? 20.372 -3.056  5.299  1.00 23.03 ? 191 ARG A NH2 1 
ATOM   1529 N N   . LEU A 1 192 ? 20.425 4.386   3.803  1.00 7.00  ? 192 LEU A N   1 
ATOM   1530 C CA  . LEU A 1 192 ? 19.930 5.753   3.866  1.00 5.85  ? 192 LEU A CA  1 
ATOM   1531 C C   . LEU A 1 192 ? 20.303 6.583   2.645  1.00 7.57  ? 192 LEU A C   1 
ATOM   1532 O O   . LEU A 1 192 ? 19.548 7.457   2.245  1.00 6.26  ? 192 LEU A O   1 
ATOM   1533 C CB  . LEU A 1 192 ? 20.445 6.432   5.130  1.00 6.28  ? 192 LEU A CB  1 
ATOM   1534 C CG  . LEU A 1 192 ? 20.054 5.752   6.449  1.00 8.26  ? 192 LEU A CG  1 
ATOM   1535 C CD1 . LEU A 1 192 ? 20.606 6.526   7.637  1.00 7.19  ? 192 LEU A CD1 1 
ATOM   1536 C CD2 . LEU A 1 192 ? 18.540 5.629   6.569  1.00 9.42  ? 192 LEU A CD2 1 
ATOM   1537 N N   . GLU A 1 193 ? 21.474 6.294   2.075  1.00 9.28  ? 193 GLU A N   1 
ATOM   1538 C CA  . GLU A 1 193 ? 21.932 6.959   0.861  1.00 7.61  ? 193 GLU A CA  1 
ATOM   1539 C C   . GLU A 1 193 ? 20.982 6.830   -0.328 1.00 8.96  ? 193 GLU A C   1 
ATOM   1540 O O   . GLU A 1 193 ? 21.065 7.616   -1.282 1.00 9.04  ? 193 GLU A O   1 
ATOM   1541 C CB  . GLU A 1 193 ? 23.360 6.520   0.504  1.00 7.88  ? 193 GLU A CB  1 
ATOM   1542 C CG  . GLU A 1 193 ? 24.385 7.257   1.357  1.00 9.54  ? 193 GLU A CG  1 
ATOM   1543 C CD  . GLU A 1 193 ? 25.822 6.815   1.140  1.00 11.21 ? 193 GLU A CD  1 
ATOM   1544 O OE1 . GLU A 1 193 ? 26.066 5.780   0.492  1.00 12.76 ? 193 GLU A OE1 1 
ATOM   1545 O OE2 . GLU A 1 193 ? 26.734 7.520   1.630  1.00 10.67 ? 193 GLU A OE2 1 
ATOM   1546 N N   . GLN A 1 194 ? 20.100 5.821   -0.271 1.00 8.98  ? 194 GLN A N   1 
ATOM   1547 C CA  . GLN A 1 194 ? 19.087 5.574   -1.309 1.00 9.51  ? 194 GLN A CA  1 
ATOM   1548 C C   . GLN A 1 194 ? 17.852 6.473   -1.191 1.00 8.27  ? 194 GLN A C   1 
ATOM   1549 O O   . GLN A 1 194 ? 17.031 6.513   -2.111 1.00 7.91  ? 194 GLN A O   1 
ATOM   1550 C CB  . GLN A 1 194 ? 18.625 4.104   -1.283 1.00 8.13  ? 194 GLN A CB  1 
ATOM   1551 C CG  . GLN A 1 194 ? 19.701 3.045   -1.537 1.00 9.94  ? 194 GLN A CG  1 
ATOM   1552 C CD  . GLN A 1 194 ? 19.224 1.630   -1.279 1.00 15.81 ? 194 GLN A CD  1 
ATOM   1553 O OE1 . GLN A 1 194 ? 19.853 0.883   -0.524 1.00 19.34 ? 194 GLN A OE1 1 
ATOM   1554 N NE2 . GLN A 1 194 ? 18.137 1.247   -1.922 1.00 18.03 ? 194 GLN A NE2 1 
ATOM   1555 N N   . LEU A 1 195 ? 17.685 7.146   -0.053 1.00 9.24  ? 195 LEU A N   1 
ATOM   1556 C CA  . LEU A 1 195 ? 16.479 7.955   0.131  1.00 9.30  ? 195 LEU A CA  1 
ATOM   1557 C C   . LEU A 1 195 ? 16.460 9.064   -0.912 1.00 7.69  ? 195 LEU A C   1 
ATOM   1558 O O   . LEU A 1 195 ? 17.497 9.635   -1.215 1.00 6.48  ? 195 LEU A O   1 
ATOM   1559 C CB  . LEU A 1 195 ? 16.412 8.544   1.542  1.00 7.28  ? 195 LEU A CB  1 
ATOM   1560 C CG  . LEU A 1 195 ? 16.085 7.543   2.661  1.00 7.42  ? 195 LEU A CG  1 
ATOM   1561 C CD1 . LEU A 1 195 ? 16.472 8.092   4.050  1.00 7.53  ? 195 LEU A CD1 1 
ATOM   1562 C CD2 . LEU A 1 195 ? 14.611 7.189   2.610  1.00 9.39  ? 195 LEU A CD2 1 
ATOM   1563 N N   . PRO A 1 196 ? 15.271 9.382   -1.461 1.00 6.23  ? 196 PRO A N   1 
ATOM   1564 C CA  . PRO A 1 196 ? 15.236 10.365  -2.548 1.00 6.65  ? 196 PRO A CA  1 
ATOM   1565 C C   . PRO A 1 196 ? 15.745 11.725  -2.091 1.00 7.25  ? 196 PRO A C   1 
ATOM   1566 O O   . PRO A 1 196 ? 16.250 12.494  -2.916 1.00 7.12  ? 196 PRO A O   1 
ATOM   1567 C CB  . PRO A 1 196 ? 13.749 10.432  -2.930 1.00 8.48  ? 196 PRO A CB  1 
ATOM   1568 C CG  . PRO A 1 196 ? 13.019 9.783   -1.796 1.00 12.37 ? 196 PRO A CG  1 
ATOM   1569 C CD  . PRO A 1 196 ? 13.949 8.786   -1.196 1.00 8.26  ? 196 PRO A CD  1 
ATOM   1570 N N   . TYR A 1 197 ? 15.639 12.001  -0.792 1.00 4.92  ? 197 TYR A N   1 
ATOM   1571 C CA  . TYR A 1 197 ? 16.006 13.325  -0.272 1.00 4.46  ? 197 TYR A CA  1 
ATOM   1572 C C   . TYR A 1 197 ? 17.368 13.301  0.469  1.00 7.05  ? 197 TYR A C   1 
ATOM   1573 O O   . TYR A 1 197 ? 17.710 14.237  1.191  1.00 5.67  ? 197 TYR A O   1 
ATOM   1574 C CB  . TYR A 1 197 ? 14.858 13.845  0.622  1.00 5.22  ? 197 TYR A CB  1 
ATOM   1575 C CG  . TYR A 1 197 ? 14.441 12.827  1.637  1.00 4.64  ? 197 TYR A CG  1 
ATOM   1576 C CD1 . TYR A 1 197 ? 15.095 12.719  2.851  1.00 4.75  ? 197 TYR A CD1 1 
ATOM   1577 C CD2 . TYR A 1 197 ? 13.319 12.029  1.417  1.00 5.07  ? 197 TYR A CD2 1 
ATOM   1578 C CE1 . TYR A 1 197 ? 14.698 11.764  3.789  1.00 5.71  ? 197 TYR A CE1 1 
ATOM   1579 C CE2 . TYR A 1 197 ? 12.923 11.049  2.340  1.00 3.89  ? 197 TYR A CE2 1 
ATOM   1580 C CZ  . TYR A 1 197 ? 13.611 10.923  3.526  1.00 5.51  ? 197 TYR A CZ  1 
ATOM   1581 O OH  . TYR A 1 197 ? 13.252 9.994   4.463  1.00 6.54  ? 197 TYR A OH  1 
ATOM   1582 N N   . TYR A 1 198 ? 18.154 12.241  0.284  1.00 6.13  ? 198 TYR A N   1 
ATOM   1583 C CA  . TYR A 1 198 ? 19.435 12.129  0.998  1.00 6.37  ? 198 TYR A CA  1 
ATOM   1584 C C   . TYR A 1 198 ? 20.407 13.288  0.774  1.00 7.71  ? 198 TYR A C   1 
ATOM   1585 O O   . TYR A 1 198 ? 21.205 13.578  1.653  1.00 6.15  ? 198 TYR A O   1 
ATOM   1586 C CB  . TYR A 1 198 ? 20.119 10.770  0.749  1.00 6.39  ? 198 TYR A CB  1 
ATOM   1587 C CG  . TYR A 1 198 ? 21.270 10.554  1.728  1.00 6.13  ? 198 TYR A CG  1 
ATOM   1588 C CD1 . TYR A 1 198 ? 21.020 10.272  3.068  1.00 7.29  ? 198 TYR A CD1 1 
ATOM   1589 C CD2 . TYR A 1 198 ? 22.577 10.720  1.342  1.00 7.11  ? 198 TYR A CD2 1 
ATOM   1590 C CE1 . TYR A 1 198 ? 22.027 10.100  3.983  1.00 5.91  ? 198 TYR A CE1 1 
ATOM   1591 C CE2 . TYR A 1 198 ? 23.607 10.538  2.244  1.00 5.69  ? 198 TYR A CE2 1 
ATOM   1592 C CZ  . TYR A 1 198 ? 23.327 10.264  3.579  1.00 5.57  ? 198 TYR A CZ  1 
ATOM   1593 O OH  . TYR A 1 198 ? 24.384 10.110  4.487  1.00 9.61  ? 198 TYR A OH  1 
ATOM   1594 N N   . ALA A 1 199 ? 20.289 13.991  -0.363 1.00 7.24  ? 199 ALA A N   1 
ATOM   1595 C CA  . ALA A 1 199 ? 21.183 15.117  -0.602 1.00 6.88  ? 199 ALA A CA  1 
ATOM   1596 C C   . ALA A 1 199 ? 21.032 16.216  0.427  1.00 6.54  ? 199 ALA A C   1 
ATOM   1597 O O   . ALA A 1 199 ? 21.935 17.027  0.583  1.00 8.49  ? 199 ALA A O   1 
ATOM   1598 C CB  . ALA A 1 199 ? 21.060 15.650  -2.007 1.00 9.82  ? 199 ALA A CB  1 
ATOM   1599 N N   . GLU A 1 200 ? 19.899 16.260  1.131  1.00 5.77  ? 200 GLU A N   1 
ATOM   1600 C CA  . GLU A 1 200 ? 19.794 17.172  2.272  1.00 7.14  ? 200 GLU A CA  1 
ATOM   1601 C C   . GLU A 1 200 ? 20.754 16.900  3.407  1.00 5.70  ? 200 GLU A C   1 
ATOM   1602 O O   . GLU A 1 200 ? 20.976 17.741  4.276  1.00 7.95  ? 200 GLU A O   1 
ATOM   1603 C CB  . GLU A 1 200 ? 18.371 17.209  2.823  1.00 8.17  ? 200 GLU A CB  1 
ATOM   1604 C CG  . GLU A 1 200 ? 17.384 18.027  1.952  1.00 15.01 ? 200 GLU A CG  1 
ATOM   1605 C CD  . GLU A 1 200 ? 17.912 19.432  1.583  1.00 19.65 ? 200 GLU A CD  1 
ATOM   1606 O OE1 . GLU A 1 200 ? 18.828 19.965  2.256  1.00 23.64 ? 200 GLU A OE1 1 
ATOM   1607 O OE2 . GLU A 1 200 ? 17.405 20.015  0.603  1.00 24.98 ? 200 GLU A OE2 1 
ATOM   1608 N N   . ASN A 1 201 ? 21.320 15.703  3.409  1.00 6.02  ? 201 ASN A N   1 
ATOM   1609 C CA  . ASN A 1 201 ? 22.411 15.387  4.279  1.00 5.78  ? 201 ASN A CA  1 
ATOM   1610 C C   . ASN A 1 201 ? 23.773 15.372  3.563  1.00 5.69  ? 201 ASN A C   1 
ATOM   1611 O O   . ASN A 1 201 ? 24.775 15.891  4.082  1.00 7.09  ? 201 ASN A O   1 
ATOM   1612 C CB  . ASN A 1 201 ? 22.234 14.050  5.005  1.00 5.78  ? 201 ASN A CB  1 
ATOM   1613 C CG  . ASN A 1 201 ? 23.339 13.845  6.025  1.00 5.91  ? 201 ASN A CG  1 
ATOM   1614 O OD1 . ASN A 1 201 ? 23.466 14.628  6.959  1.00 5.49  ? 201 ASN A OD1 1 
ATOM   1615 N ND2 . ASN A 1 201 ? 24.166 12.826  5.830  1.00 6.55  ? 201 ASN A ND2 1 
ATOM   1616 N N   . SER A 1 202 ? 23.836 14.782  2.368  1.00 6.25  ? 202 SER A N   1 
ATOM   1617 C CA  . SER A 1 202 ? 25.172 14.541  1.770  1.00 6.09  ? 202 SER A CA  1 
ATOM   1618 C C   . SER A 1 202 ? 25.881 15.819  1.377  1.00 6.20  ? 202 SER A C   1 
ATOM   1619 O O   . SER A 1 202 ? 27.103 15.903  1.475  1.00 7.98  ? 202 SER A O   1 
ATOM   1620 C CB  . SER A 1 202 ? 25.057 13.598  0.571  1.00 8.02  ? 202 SER A CB  1 
ATOM   1621 O OG  . SER A 1 202 ? 24.292 14.155  -0.476 1.00 8.53  ? 202 SER A OG  1 
ATOM   1622 N N   . THR A 1 203 ? 25.115 16.821  0.963  1.00 7.40  ? 203 THR A N   1 
ATOM   1623 C CA  . THR A 1 203 ? 25.715 18.096  0.557  1.00 10.22 ? 203 THR A CA  1 
ATOM   1624 C C   . THR A 1 203 ? 26.485 18.760  1.716  1.00 8.84  ? 203 THR A C   1 
ATOM   1625 O O   . THR A 1 203 ? 27.656 19.119  1.610  1.00 6.69  ? 203 THR A O   1 
ATOM   1626 C CB  . THR A 1 203 ? 24.657 19.054  0.004  1.00 10.88 ? 203 THR A CB  1 
ATOM   1627 O OG1 . THR A 1 203 ? 24.142 18.500  -1.212 1.00 12.17 ? 203 THR A OG1 1 
ATOM   1628 C CG2 . THR A 1 203 ? 25.287 20.398  -0.296 1.00 13.56 ? 203 THR A CG2 1 
ATOM   1629 N N   . GLY A 1 204 ? 25.812 18.938  2.836  1.00 6.26  ? 204 GLY A N   1 
ATOM   1630 C CA  . GLY A 1 204 ? 26.423 19.522  4.001  1.00 6.35  ? 204 GLY A CA  1 
ATOM   1631 C C   . GLY A 1 204 ? 27.451 18.627  4.645  1.00 6.45  ? 204 GLY A C   1 
ATOM   1632 O O   . GLY A 1 204 ? 28.400 19.129  5.213  1.00 6.65  ? 204 GLY A O   1 
ATOM   1633 N N   . ALA A 1 205 ? 27.262 17.308  4.583  1.00 6.34  ? 205 ALA A N   1 
ATOM   1634 C CA  . ALA A 1 205 ? 28.282 16.387  5.104  1.00 6.68  ? 205 ALA A CA  1 
ATOM   1635 C C   . ALA A 1 205 ? 29.584 16.564  4.348  1.00 6.81  ? 205 ALA A C   1 
ATOM   1636 O O   . ALA A 1 205 ? 30.643 16.620  4.947  1.00 7.81  ? 205 ALA A O   1 
ATOM   1637 C CB  . ALA A 1 205 ? 27.811 14.960  5.050  1.00 6.97  ? 205 ALA A CB  1 
ATOM   1638 N N   . GLN A 1 206 ? 29.491 16.664  3.026  1.00 6.87  ? 206 GLN A N   1 
ATOM   1639 C CA  . GLN A 1 206 ? 30.689 16.931  2.217  1.00 7.23  ? 206 GLN A CA  1 
ATOM   1640 C C   . GLN A 1 206 ? 31.314 18.267  2.547  1.00 7.42  ? 206 GLN A C   1 
ATOM   1641 O O   . GLN A 1 206 ? 32.534 18.371  2.546  1.00 7.76  ? 206 GLN A O   1 
ATOM   1642 C CB  . GLN A 1 206 ? 30.364 16.823  0.723  1.00 9.65  ? 206 GLN A CB  1 
ATOM   1643 C CG  . GLN A 1 206 ? 30.058 15.401  0.308  1.00 14.23 ? 206 GLN A CG  1 
ATOM   1644 C CD  . GLN A 1 206 ? 29.672 15.255  -1.154 1.00 22.24 ? 206 GLN A CD  1 
ATOM   1645 O OE1 . GLN A 1 206 ? 28.710 14.550  -1.479 1.00 24.67 ? 206 GLN A OE1 1 
ATOM   1646 N NE2 . GLN A 1 206 ? 30.422 15.902  -2.045 1.00 25.05 ? 206 GLN A NE2 1 
ATOM   1647 N N   . GLN A 1 207 ? 30.503 19.284  2.825  1.00 7.26  ? 207 GLN A N   1 
ATOM   1648 C CA  . GLN A 1 207 ? 31.089 20.560  3.252  1.00 7.47  ? 207 GLN A CA  1 
ATOM   1649 C C   . GLN A 1 207 ? 31.808 20.423  4.594  1.00 7.88  ? 207 GLN A C   1 
ATOM   1650 O O   . GLN A 1 207 ? 32.886 20.986  4.790  1.00 7.89  ? 207 GLN A O   1 
ATOM   1651 C CB  . GLN A 1 207 ? 30.008 21.648  3.346  1.00 7.67  ? 207 GLN A CB  1 
ATOM   1652 C CG  . GLN A 1 207 ? 29.316 21.920  2.018  1.00 9.63  ? 207 GLN A CG  1 
ATOM   1653 C CD  . GLN A 1 207 ? 28.121 22.851  2.153  1.00 11.69 ? 207 GLN A CD  1 
ATOM   1654 O OE1 . GLN A 1 207 ? 27.435 22.869  3.178  1.00 13.14 ? 207 GLN A OE1 1 
ATOM   1655 N NE2 . GLN A 1 207 ? 27.853 23.617  1.103  1.00 18.26 ? 207 GLN A NE2 1 
ATOM   1656 N N   . PHE A 1 208 ? 31.233 19.653  5.519  1.00 7.40  ? 208 PHE A N   1 
ATOM   1657 C CA  . PHE A 1 208 ? 31.860 19.395  6.811  1.00 7.81  ? 208 PHE A CA  1 
ATOM   1658 C C   . PHE A 1 208 ? 33.205 18.704  6.601  1.00 8.75  ? 208 PHE A C   1 
ATOM   1659 O O   . PHE A 1 208 ? 34.242 19.136  7.132  1.00 8.04  ? 208 PHE A O   1 
ATOM   1660 C CB  . PHE A 1 208 ? 30.953 18.515  7.688  1.00 7.66  ? 208 PHE A CB  1 
ATOM   1661 C CG  . PHE A 1 208 ? 31.489 18.297  9.071  1.00 7.21  ? 208 PHE A CG  1 
ATOM   1662 C CD1 . PHE A 1 208 ? 32.414 17.294  9.328  1.00 7.38  ? 208 PHE A CD1 1 
ATOM   1663 C CD2 . PHE A 1 208 ? 31.143 19.147  10.110 1.00 11.39 ? 208 PHE A CD2 1 
ATOM   1664 C CE1 . PHE A 1 208 ? 32.904 17.098  10.587 1.00 7.49  ? 208 PHE A CE1 1 
ATOM   1665 C CE2 . PHE A 1 208 ? 31.672 18.968  11.379 1.00 11.33 ? 208 PHE A CE2 1 
ATOM   1666 C CZ  . PHE A 1 208 ? 32.565 17.932  11.611 1.00 8.68  ? 208 PHE A CZ  1 
ATOM   1667 N N   . VAL A 1 209 ? 33.204 17.642  5.798  1.00 7.93  ? 209 VAL A N   1 
ATOM   1668 C CA  . VAL A 1 209 ? 34.440 16.930  5.486  1.00 8.07  ? 209 VAL A CA  1 
ATOM   1669 C C   . VAL A 1 209 ? 35.478 17.873  4.878  1.00 8.46  ? 209 VAL A C   1 
ATOM   1670 O O   . VAL A 1 209 ? 36.657 17.819  5.255  1.00 8.82  ? 209 VAL A O   1 
ATOM   1671 C CB  . VAL A 1 209 ? 34.197 15.726  4.553  1.00 8.01  ? 209 VAL A CB  1 
ATOM   1672 C CG1 . VAL A 1 209 ? 35.525 15.111  4.100  1.00 12.09 ? 209 VAL A CG1 1 
ATOM   1673 C CG2 . VAL A 1 209 ? 33.319 14.679  5.224  1.00 10.90 ? 209 VAL A CG2 1 
ATOM   1674 N N   . ALA A 1 210 ? 35.072 18.728  3.938  1.00 8.43  ? 210 ALA A N   1 
ATOM   1675 C CA  . ALA A 1 210 ? 35.992 19.680  3.316  1.00 8.82  ? 210 ALA A CA  1 
ATOM   1676 C C   . ALA A 1 210 ? 36.578 20.678  4.318  1.00 9.01  ? 210 ALA A C   1 
ATOM   1677 O O   . ALA A 1 210 ? 37.751 21.075  4.253  1.00 9.45  ? 210 ALA A O   1 
ATOM   1678 C CB  . ALA A 1 210 ? 35.323 20.395  2.162  1.00 12.26 ? 210 ALA A CB  1 
ATOM   1679 N N   . ALA A 1 211 ? 35.747 21.092  5.263  1.00 8.72  ? 211 ALA A N   1 
ATOM   1680 C CA  . ALA A 1 211 ? 36.181 22.049  6.270  1.00 9.20  ? 211 ALA A CA  1 
ATOM   1681 C C   . ALA A 1 211 ? 37.254 21.422  7.144  1.00 9.42  ? 211 ALA A C   1 
ATOM   1682 O O   . ALA A 1 211 ? 38.276 22.053  7.447  1.00 10.22 ? 211 ALA A O   1 
ATOM   1683 C CB  . ALA A 1 211 ? 34.995 22.493  7.089  1.00 9.62  ? 211 ALA A CB  1 
ATOM   1684 N N   . VAL A 1 212 ? 37.039 20.160  7.493  1.00 10.14 ? 212 VAL A N   1 
ATOM   1685 C CA  . VAL A 1 212 ? 38.022 19.403  8.266  1.00 9.55  ? 212 VAL A CA  1 
ATOM   1686 C C   . VAL A 1 212 ? 39.342 19.149  7.501  1.00 9.71  ? 212 VAL A C   1 
ATOM   1687 O O   . VAL A 1 212 ? 40.444 19.280  8.062  1.00 10.10 ? 212 VAL A O   1 
ATOM   1688 C CB  . VAL A 1 212 ? 37.409 18.063  8.778  1.00 10.24 ? 212 VAL A CB  1 
ATOM   1689 C CG1 . VAL A 1 212 ? 38.479 17.219  9.418  1.00 11.07 ? 212 VAL A CG1 1 
ATOM   1690 C CG2 . VAL A 1 212 ? 36.251 18.328  9.757  1.00 10.51 ? 212 VAL A CG2 1 
ATOM   1691 N N   . LYS A 1 213 ? 39.239 18.802  6.223  1.00 9.72  ? 213 LYS A N   1 
ATOM   1692 C CA  . LYS A 1 213 ? 40.439 18.539  5.426  1.00 10.22 ? 213 LYS A CA  1 
ATOM   1693 C C   . LYS A 1 213 ? 41.229 19.812  5.251  1.00 10.60 ? 213 LYS A C   1 
ATOM   1694 O O   . LYS A 1 213 ? 42.430 19.740  5.053  1.00 11.11 ? 213 LYS A O   1 
ATOM   1695 C CB  . LYS A 1 213 ? 40.075 17.965  4.051  1.00 13.64 ? 213 LYS A CB  1 
ATOM   1696 C CG  . LYS A 1 213 ? 39.492 16.570  4.067  1.00 17.02 ? 213 LYS A CG  1 
ATOM   1697 C CD  . LYS A 1 213 ? 40.240 15.651  5.017  1.00 20.68 ? 213 LYS A CD  1 
ATOM   1698 C CE  . LYS A 1 213 ? 39.653 14.236  4.962  1.00 23.22 ? 213 LYS A CE  1 
ATOM   1699 N NZ  . LYS A 1 213 ? 40.041 13.434  6.156  1.00 24.24 ? 213 LYS A NZ  1 
ATOM   1700 N N   . SER A 1 214 ? 40.581 20.965  5.364  1.00 10.41 ? 214 SER A N   1 
ATOM   1701 C CA  . SER A 1 214 ? 41.288 22.237  5.209  1.00 11.39 ? 214 SER A CA  1 
ATOM   1702 C C   . SER A 1 214 ? 42.049 22.641  6.474  1.00 12.49 ? 214 SER A C   1 
ATOM   1703 O O   . SER A 1 214 ? 42.809 23.613  6.465  1.00 16.04 ? 214 SER A O   1 
ATOM   1704 C CB  . SER A 1 214 ? 40.335 23.359  4.809  1.00 13.90 ? 214 SER A CB  1 
ATOM   1705 O OG  . SER A 1 214 ? 39.569 23.793  5.909  1.00 15.31 ? 214 SER A OG  1 
ATOM   1706 N N   . LYS A 1 215 ? 41.820 21.917  7.560  1.00 11.76 ? 215 LYS A N   1 
ATOM   1707 C CA  . LYS A 1 215 ? 42.499 22.163  8.828  1.00 13.67 ? 215 LYS A CA  1 
ATOM   1708 C C   . LYS A 1 215 ? 43.250 20.901  9.264  1.00 14.93 ? 215 LYS A C   1 
ATOM   1709 O O   . LYS A 1 215 ? 42.791 20.140  10.119 1.00 15.96 ? 215 LYS A O   1 
ATOM   1710 C CB  . LYS A 1 215 ? 41.483 22.585  9.888  1.00 14.42 ? 215 LYS A CB  1 
ATOM   1711 C CG  . LYS A 1 215 ? 40.685 23.828  9.576  1.00 16.32 ? 215 LYS A CG  1 
ATOM   1712 C CD  . LYS A 1 215 ? 41.501 25.088  9.790  1.00 19.83 ? 215 LYS A CD  1 
ATOM   1713 C CE  . LYS A 1 215 ? 40.617 26.328  9.838  1.00 23.07 ? 215 LYS A CE  1 
ATOM   1714 N NZ  . LYS A 1 215 ? 41.443 27.548  10.143 1.00 23.90 ? 215 LYS A NZ  1 
ATOM   1715 N N   . PRO A 1 216 ? 44.422 20.683  8.666  1.00 15.83 ? 216 PRO A N   1 
ATOM   1716 C CA  . PRO A 1 216 ? 45.222 19.497  8.985  1.00 16.94 ? 216 PRO A CA  1 
ATOM   1717 C C   . PRO A 1 216 ? 45.598 19.424  10.468 1.00 14.71 ? 216 PRO A C   1 
ATOM   1718 O O   . PRO A 1 216 ? 45.824 20.445  11.139 1.00 14.86 ? 216 PRO A O   1 
ATOM   1719 C CB  . PRO A 1 216 ? 46.478 19.678  8.131  1.00 21.23 ? 216 PRO A CB  1 
ATOM   1720 C CG  . PRO A 1 216 ? 46.603 21.152  7.974  1.00 21.72 ? 216 PRO A CG  1 
ATOM   1721 C CD  . PRO A 1 216 ? 45.179 21.652  7.854  1.00 18.95 ? 216 PRO A CD  1 
ATOM   1722 N N   . PHE A 1 217 ? 45.675 18.197  10.960 1.00 13.62 ? 217 PHE A N   1 
ATOM   1723 C CA  . PHE A 1 217 ? 45.930 17.981  12.367 1.00 13.49 ? 217 PHE A CA  1 
ATOM   1724 C C   . PHE A 1 217 ? 46.652 16.681  12.537 1.00 15.59 ? 217 PHE A C   1 
ATOM   1725 O O   . PHE A 1 217 ? 46.696 15.836  11.621 1.00 14.50 ? 217 PHE A O   1 
ATOM   1726 C CB  . PHE A 1 217 ? 44.625 17.989  13.181 1.00 14.39 ? 217 PHE A CB  1 
ATOM   1727 C CG  . PHE A 1 217 ? 43.687 16.838  12.871 1.00 15.40 ? 217 PHE A CG  1 
ATOM   1728 C CD1 . PHE A 1 217 ? 43.836 15.598  13.487 1.00 16.65 ? 217 PHE A CD1 1 
ATOM   1729 C CD2 . PHE A 1 217 ? 42.627 17.021  11.989 1.00 18.94 ? 217 PHE A CD2 1 
ATOM   1730 C CE1 . PHE A 1 217 ? 42.967 14.550  13.192 1.00 19.49 ? 217 PHE A CE1 1 
ATOM   1731 C CE2 . PHE A 1 217 ? 41.773 15.989  11.689 1.00 19.30 ? 217 PHE A CE2 1 
ATOM   1732 C CZ  . PHE A 1 217 ? 41.926 14.754  12.293 1.00 20.27 ? 217 PHE A CZ  1 
ATOM   1733 N N   . THR A 1 218 ? 47.272 16.537  13.706 1.00 14.90 ? 218 THR A N   1 
ATOM   1734 C CA  . THR A 1 218 ? 47.962 15.312  14.031 1.00 12.92 ? 218 THR A CA  1 
ATOM   1735 C C   . THR A 1 218 ? 47.348 14.747  15.301 1.00 14.90 ? 218 THR A C   1 
ATOM   1736 O O   . THR A 1 218 ? 46.709 15.477  16.056 1.00 16.65 ? 218 THR A O   1 
ATOM   1737 C CB  . THR A 1 218 ? 49.480 15.547  14.212 1.00 21.13 ? 218 THR A CB  1 
ATOM   1738 O OG1 . THR A 1 218 ? 50.135 14.290  14.371 1.00 26.67 ? 218 THR A OG1 1 
ATOM   1739 C CG2 . THR A 1 218 ? 49.734 16.401  15.408 1.00 13.76 ? 218 THR A CG2 1 
ATOM   1740 N N   . VAL A 1 219 ? 47.498 13.443  15.506 1.00 14.06 ? 219 VAL A N   1 
ATOM   1741 C CA  . VAL A 1 219 ? 46.980 12.850  16.719 1.00 12.43 ? 219 VAL A CA  1 
ATOM   1742 C C   . VAL A 1 219 ? 48.161 12.492  17.621 1.00 13.37 ? 219 VAL A C   1 
ATOM   1743 O O   . VAL A 1 219 ? 49.213 12.024  17.151 1.00 14.66 ? 219 VAL A O   1 
ATOM   1744 C CB  . VAL A 1 219 ? 46.018 11.655  16.434 1.00 15.29 ? 219 VAL A CB  1 
ATOM   1745 C CG1 . VAL A 1 219 ? 45.511 11.079  17.726 1.00 12.67 ? 219 VAL A CG1 1 
ATOM   1746 C CG2 . VAL A 1 219 ? 44.820 12.090  15.570 1.00 17.72 ? 219 VAL A CG2 1 
ATOM   1747 N N   . VAL A 1 220 ? 47.983 12.788  18.907 1.00 13.17 ? 220 VAL A N   1 
ATOM   1748 C CA  . VAL A 1 220 ? 49.048 12.704  19.896 1.00 13.40 ? 220 VAL A CA  1 
ATOM   1749 C C   . VAL A 1 220 ? 48.628 11.732  20.977 1.00 13.25 ? 220 VAL A C   1 
ATOM   1750 O O   . VAL A 1 220 ? 47.496 11.779  21.468 1.00 12.77 ? 220 VAL A O   1 
ATOM   1751 C CB  . VAL A 1 220 ? 49.348 14.094  20.510 1.00 13.57 ? 220 VAL A CB  1 
ATOM   1752 C CG1 . VAL A 1 220 ? 50.418 13.996  21.579 1.00 14.11 ? 220 VAL A CG1 1 
ATOM   1753 C CG2 . VAL A 1 220 ? 49.775 15.096  19.429 1.00 13.76 ? 220 VAL A CG2 1 
ATOM   1754 N N   . GLY A 1 221 ? 49.515 10.812  21.323 1.00 13.68 ? 221 GLY A N   1 
ATOM   1755 C CA  . GLY A 1 221 ? 49.223 9.842   22.364 1.00 13.61 ? 221 GLY A CA  1 
ATOM   1756 C C   . GLY A 1 221 ? 49.343 8.416   21.858 1.00 16.03 ? 221 GLY A C   1 
ATOM   1757 O O   . GLY A 1 221 ? 48.909 8.102   20.749 1.00 17.80 ? 221 GLY A O   1 
ATOM   1758 N N   . ALA A 1 222 ? 49.935 7.547   22.675 1.00 18.90 ? 222 ALA A N   1 
ATOM   1759 C CA  . ALA A 1 222 ? 49.975 6.110   22.378 1.00 13.92 ? 222 ALA A CA  1 
ATOM   1760 C C   . ALA A 1 222 ? 48.565 5.482   22.332 1.00 18.95 ? 222 ALA A C   1 
ATOM   1761 O O   . ALA A 1 222 ? 47.674 5.887   23.091 1.00 18.03 ? 222 ALA A O   1 
ATOM   1762 C CB  . ALA A 1 222 ? 50.844 5.400   23.396 1.00 15.16 ? 222 ALA A CB  1 
ATOM   1763 N N   . MET B 1 1   ? -0.463 -6.533  36.684 1.00 25.47 ? 1   MET B N   1 
ATOM   1764 C CA  . MET B 1 1   ? 0.003  -5.320  37.355 1.00 27.06 ? 1   MET B CA  1 
ATOM   1765 C C   . MET B 1 1   ? 1.525  -5.254  37.369 1.00 25.83 ? 1   MET B C   1 
ATOM   1766 O O   . MET B 1 1   ? 2.171  -5.839  38.251 1.00 24.06 ? 1   MET B O   1 
ATOM   1767 C CB  . MET B 1 1   ? -0.535 -5.251  38.791 1.00 28.58 ? 1   MET B CB  1 
ATOM   1768 C CG  . MET B 1 1   ? -2.067 -5.165  38.888 1.00 30.86 ? 1   MET B CG  1 
ATOM   1769 S SD  . MET B 1 1   ? -2.752 -3.611  38.241 1.00 46.64 ? 1   MET B SD  1 
ATOM   1770 C CE  . MET B 1 1   ? -3.960 -4.203  37.047 1.00 38.10 ? 1   MET B CE  1 
ATOM   1771 N N   . VAL B 1 2   ? 2.087  -4.541  36.394 1.00 28.76 ? 2   VAL B N   1 
ATOM   1772 C CA  . VAL B 1 2   ? 3.541  -4.424  36.262 1.00 28.67 ? 2   VAL B CA  1 
ATOM   1773 C C   . VAL B 1 2   ? 4.188  -3.503  37.301 1.00 27.66 ? 2   VAL B C   1 
ATOM   1774 O O   . VAL B 1 2   ? 3.839  -2.324  37.436 1.00 28.44 ? 2   VAL B O   1 
ATOM   1775 C CB  . VAL B 1 2   ? 3.977  -3.967  34.840 1.00 26.33 ? 2   VAL B CB  1 
ATOM   1776 C CG1 . VAL B 1 2   ? 5.494  -3.797  34.779 1.00 26.30 ? 2   VAL B CG1 1 
ATOM   1777 C CG2 . VAL B 1 2   ? 3.513  -4.977  33.783 1.00 28.08 ? 2   VAL B CG2 1 
ATOM   1778 N N   . LYS B 1 3   ? 5.154  -4.061  38.015 1.00 25.28 ? 3   LYS B N   1 
ATOM   1779 C CA  . LYS B 1 3   ? 6.013  -3.296  38.898 1.00 19.86 ? 3   LYS B CA  1 
ATOM   1780 C C   . LYS B 1 3   ? 7.381  -3.269  38.229 1.00 19.26 ? 3   LYS B C   1 
ATOM   1781 O O   . LYS B 1 3   ? 8.001  -4.312  38.050 1.00 21.78 ? 3   LYS B O   1 
ATOM   1782 C CB  . LYS B 1 3   ? 6.100  -3.999  40.246 1.00 20.99 ? 3   LYS B CB  1 
ATOM   1783 C CG  . LYS B 1 3   ? 6.974  -3.294  41.272 1.00 21.17 ? 3   LYS B CG  1 
ATOM   1784 C CD  . LYS B 1 3   ? 6.550  -3.707  42.670 1.00 24.76 ? 3   LYS B CD  1 
ATOM   1785 C CE  . LYS B 1 3   ? 7.592  -3.375  43.720 1.00 25.58 ? 3   LYS B CE  1 
ATOM   1786 N NZ  . LYS B 1 3   ? 7.991  -4.600  44.468 1.00 29.60 ? 3   LYS B NZ  1 
ATOM   1787 N N   . PRO B 1 4   ? 7.854  -2.087  37.830 1.00 16.51 ? 4   PRO B N   1 
ATOM   1788 C CA  . PRO B 1 4   ? 9.105  -2.156  37.062 1.00 17.12 ? 4   PRO B CA  1 
ATOM   1789 C C   . PRO B 1 4   ? 10.337 -2.400  37.903 1.00 14.77 ? 4   PRO B C   1 
ATOM   1790 O O   . PRO B 1 4   ? 10.272 -2.280  39.123 1.00 16.12 ? 4   PRO B O   1 
ATOM   1791 C CB  . PRO B 1 4   ? 9.231  -0.765  36.450 1.00 16.45 ? 4   PRO B CB  1 
ATOM   1792 C CG  . PRO B 1 4   ? 8.300  0.114   37.247 1.00 17.24 ? 4   PRO B CG  1 
ATOM   1793 C CD  . PRO B 1 4   ? 7.214  -0.762  37.788 1.00 19.12 ? 4   PRO B CD  1 
ATOM   1794 N N   . ILE B 1 5   ? 11.445 -2.727  37.245 1.00 14.59 ? 5   ILE B N   1 
ATOM   1795 C CA  . ILE B 1 5   ? 12.735 -2.875  37.909 1.00 16.18 ? 5   ILE B CA  1 
ATOM   1796 C C   . ILE B 1 5   ? 13.717 -1.833  37.386 1.00 14.20 ? 5   ILE B C   1 
ATOM   1797 O O   . ILE B 1 5   ? 13.921 -1.726  36.172 1.00 15.40 ? 5   ILE B O   1 
ATOM   1798 C CB  . ILE B 1 5   ? 13.345 -4.263  37.630 1.00 15.46 ? 5   ILE B CB  1 
ATOM   1799 C CG1 . ILE B 1 5   ? 12.345 -5.369  37.954 1.00 18.64 ? 5   ILE B CG1 1 
ATOM   1800 C CG2 . ILE B 1 5   ? 14.649 -4.458  38.387 1.00 15.32 ? 5   ILE B CG2 1 
ATOM   1801 C CD1 . ILE B 1 5   ? 12.822 -6.729  37.532 1.00 20.51 ? 5   ILE B CD1 1 
ATOM   1802 N N   . LEU B 1 6   ? 14.320 -1.068  38.302 1.00 12.49 ? 6   LEU B N   1 
ATOM   1803 C CA  . LEU B 1 6   ? 15.342 -0.086  37.983 1.00 12.42 ? 6   LEU B CA  1 
ATOM   1804 C C   . LEU B 1 6   ? 16.705 -0.636  38.356 1.00 12.13 ? 6   LEU B C   1 
ATOM   1805 O O   . LEU B 1 6   ? 16.891 -1.095  39.493 1.00 14.10 ? 6   LEU B O   1 
ATOM   1806 C CB  . LEU B 1 6   ? 15.098 1.188   38.794 1.00 10.35 ? 6   LEU B CB  1 
ATOM   1807 C CG  . LEU B 1 6   ? 16.126 2.299   38.614 1.00 10.85 ? 6   LEU B CG  1 
ATOM   1808 C CD1 . LEU B 1 6   ? 16.145 2.772   37.168 1.00 10.02 ? 6   LEU B CD1 1 
ATOM   1809 C CD2 . LEU B 1 6   ? 15.850 3.434   39.598 1.00 10.04 ? 6   LEU B CD2 1 
ATOM   1810 N N   . TYR B 1 7   ? 17.647 -0.590  37.419 1.00 10.83 ? 7   TYR B N   1 
ATOM   1811 C CA  . TYR B 1 7   ? 19.031 -0.959  37.681 1.00 10.93 ? 7   TYR B CA  1 
ATOM   1812 C C   . TYR B 1 7   ? 19.869 0.286   37.792 1.00 11.65 ? 7   TYR B C   1 
ATOM   1813 O O   . TYR B 1 7   ? 19.759 1.165   36.943 1.00 9.83  ? 7   TYR B O   1 
ATOM   1814 C CB  . TYR B 1 7   ? 19.589 -1.870  36.568 1.00 11.58 ? 7   TYR B CB  1 
ATOM   1815 C CG  . TYR B 1 7   ? 18.825 -3.161  36.379 1.00 13.30 ? 7   TYR B CG  1 
ATOM   1816 C CD1 . TYR B 1 7   ? 17.616 -3.183  35.690 1.00 13.11 ? 7   TYR B CD1 1 
ATOM   1817 C CD2 . TYR B 1 7   ? 19.321 -4.358  36.875 1.00 16.69 ? 7   TYR B CD2 1 
ATOM   1818 C CE1 . TYR B 1 7   ? 16.904 -4.371  35.528 1.00 14.82 ? 7   TYR B CE1 1 
ATOM   1819 C CE2 . TYR B 1 7   ? 18.629 -5.535  36.707 1.00 17.92 ? 7   TYR B CE2 1 
ATOM   1820 C CZ  . TYR B 1 7   ? 17.428 -5.536  36.034 1.00 17.78 ? 7   TYR B CZ  1 
ATOM   1821 O OH  . TYR B 1 7   ? 16.760 -6.725  35.885 1.00 16.89 ? 7   TYR B OH  1 
ATOM   1822 N N   . GLY B 1 8   ? 20.710 0.358   38.824 1.00 11.06 ? 8   GLY B N   1 
ATOM   1823 C CA  . GLY B 1 8   ? 21.513 1.550   39.021 1.00 10.10 ? 8   GLY B CA  1 
ATOM   1824 C C   . GLY B 1 8   ? 22.237 1.554   40.353 1.00 11.31 ? 8   GLY B C   1 
ATOM   1825 O O   . GLY B 1 8   ? 22.382 0.530   41.027 1.00 9.79  ? 8   GLY B O   1 
ATOM   1826 N N   . ILE B 1 9   ? 22.712 2.735   40.711 1.00 9.95  ? 9   ILE B N   1 
ATOM   1827 C CA  . ILE B 1 9   ? 23.363 2.984   41.977 1.00 8.01  ? 9   ILE B CA  1 
ATOM   1828 C C   . ILE B 1 9   ? 23.073 4.452   42.273 1.00 7.01  ? 9   ILE B C   1 
ATOM   1829 O O   . ILE B 1 9   ? 23.020 5.302   41.356 1.00 8.07  ? 9   ILE B O   1 
ATOM   1830 C CB  . ILE B 1 9   ? 24.900 2.647   41.907 1.00 8.83  ? 9   ILE B CB  1 
ATOM   1831 C CG1 . ILE B 1 9   ? 25.553 2.610   43.286 1.00 8.66  ? 9   ILE B CG1 1 
ATOM   1832 C CG2 . ILE B 1 9   ? 25.627 3.557   40.921 1.00 11.46 ? 9   ILE B CG2 1 
ATOM   1833 C CD1 . ILE B 1 9   ? 26.778 1.732   43.329 1.00 12.08 ? 9   ILE B CD1 1 
ATOM   1834 N N   . ASP B 1 10  ? 22.865 4.751   43.548 1.00 7.10  ? 10  ASP B N   1 
ATOM   1835 C CA  . ASP B 1 10  ? 22.413 6.089   43.923 1.00 6.28  ? 10  ASP B CA  1 
ATOM   1836 C C   . ASP B 1 10  ? 23.396 7.221   43.575 1.00 6.38  ? 10  ASP B C   1 
ATOM   1837 O O   . ASP B 1 10  ? 22.981 8.343   43.276 1.00 7.15  ? 10  ASP B O   1 
ATOM   1838 C CB  . ASP B 1 10  ? 22.104 6.150   45.410 1.00 6.69  ? 10  ASP B CB  1 
ATOM   1839 C CG  . ASP B 1 10  ? 20.899 5.306   45.802 1.00 7.42  ? 10  ASP B CG  1 
ATOM   1840 O OD1 . ASP B 1 10  ? 20.128 4.866   44.920 1.00 8.37  ? 10  ASP B OD1 1 
ATOM   1841 O OD2 . ASP B 1 10  ? 20.704 5.131   47.021 1.00 9.37  ? 10  ASP B OD2 1 
ATOM   1842 N N   . ALA B 1 11  ? 24.694 6.948   43.608 1.00 5.69  ? 11  ALA B N   1 
ATOM   1843 C CA  . ALA B 1 11  ? 25.687 7.977   43.245 1.00 5.74  ? 11  ALA B CA  1 
ATOM   1844 C C   . ALA B 1 11  ? 25.539 8.503   41.810 1.00 5.82  ? 11  ALA B C   1 
ATOM   1845 O O   . ALA B 1 11  ? 25.993 9.603   41.502 1.00 5.40  ? 11  ALA B O   1 
ATOM   1846 C CB  . ALA B 1 11  ? 27.104 7.451   43.482 1.00 8.65  ? 11  ALA B CB  1 
ATOM   1847 N N   . SER B 1 12  ? 24.942 7.717   40.919 1.00 6.46  ? 12  SER B N   1 
ATOM   1848 C CA  . SER B 1 12  ? 24.887 8.045   39.500 1.00 6.51  ? 12  SER B CA  1 
ATOM   1849 C C   . SER B 1 12  ? 23.833 9.103   39.244 1.00 7.65  ? 12  SER B C   1 
ATOM   1850 O O   . SER B 1 12  ? 22.670 8.887   39.577 1.00 6.54  ? 12  SER B O   1 
ATOM   1851 C CB  . SER B 1 12  ? 24.528 6.796   38.700 1.00 8.99  ? 12  SER B CB  1 
ATOM   1852 O OG  . SER B 1 12  ? 24.204 7.154   37.371 1.00 9.30  ? 12  SER B OG  1 
ATOM   1853 N N   . PRO B 1 13  ? 24.212 10.247  38.655 1.00 6.59  ? 13  PRO B N   1 
ATOM   1854 C CA  . PRO B 1 13  ? 23.184 11.258  38.382 1.00 5.48  ? 13  PRO B CA  1 
ATOM   1855 C C   . PRO B 1 13  ? 21.979 10.788  37.567 1.00 6.28  ? 13  PRO B C   1 
ATOM   1856 O O   . PRO B 1 13  ? 20.878 11.062  37.993 1.00 4.60  ? 13  PRO B O   1 
ATOM   1857 C CB  . PRO B 1 13  ? 23.934 12.375  37.636 1.00 6.62  ? 13  PRO B CB  1 
ATOM   1858 C CG  . PRO B 1 13  ? 25.352 12.178  37.983 1.00 8.37  ? 13  PRO B CG  1 
ATOM   1859 C CD  . PRO B 1 13  ? 25.566 10.728  38.347 1.00 7.36  ? 13  PRO B CD  1 
ATOM   1860 N N   . PRO B 1 14  ? 22.166 10.139  36.406 1.00 5.31  ? 14  PRO B N   1 
ATOM   1861 C CA  . PRO B 1 14  ? 20.942 9.783   35.664 1.00 4.33  ? 14  PRO B CA  1 
ATOM   1862 C C   . PRO B 1 14  ? 20.083 8.776   36.391 1.00 4.51  ? 14  PRO B C   1 
ATOM   1863 O O   . PRO B 1 14  ? 18.886 8.806   36.215 1.00 4.78  ? 14  PRO B O   1 
ATOM   1864 C CB  . PRO B 1 14  ? 21.460 9.237   34.324 1.00 6.80  ? 14  PRO B CB  1 
ATOM   1865 C CG  . PRO B 1 14  ? 22.890 8.846   34.632 1.00 7.18  ? 14  PRO B CG  1 
ATOM   1866 C CD  . PRO B 1 14  ? 23.388 9.842   35.628 1.00 5.33  ? 14  PRO B CD  1 
ATOM   1867 N N   . VAL B 1 15  ? 20.675 7.934   37.231 1.00 6.09  ? 15  VAL B N   1 
ATOM   1868 C CA  . VAL B 1 15  ? 19.856 7.035   38.037 1.00 6.01  ? 15  VAL B CA  1 
ATOM   1869 C C   . VAL B 1 15  ? 18.979 7.864   38.989 1.00 5.22  ? 15  VAL B C   1 
ATOM   1870 O O   . VAL B 1 15  ? 17.786 7.604   39.140 1.00 5.34  ? 15  VAL B O   1 
ATOM   1871 C CB  . VAL B 1 15  ? 20.707 6.007   38.828 1.00 6.46  ? 15  VAL B CB  1 
ATOM   1872 C CG1 . VAL B 1 15  ? 19.843 5.250   39.816 1.00 8.49  ? 15  VAL B CG1 1 
ATOM   1873 C CG2 . VAL B 1 15  ? 21.424 5.080   37.864 1.00 8.24  ? 15  VAL B CG2 1 
ATOM   1874 N N   . ARG B 1 16  ? 19.556 8.894   39.603 1.00 4.39  ? 16  ARG B N   1 
ATOM   1875 C CA  . ARG B 1 16  ? 18.790 9.768   40.512 1.00 5.45  ? 16  ARG B CA  1 
ATOM   1876 C C   . ARG B 1 16  ? 17.668 10.525  39.828 1.00 5.13  ? 16  ARG B C   1 
ATOM   1877 O O   . ARG B 1 16  ? 16.618 10.724  40.423 1.00 6.12  ? 16  ARG B O   1 
ATOM   1878 C CB  . ARG B 1 16  ? 19.715 10.754  41.251 1.00 5.15  ? 16  ARG B CB  1 
ATOM   1879 C CG  . ARG B 1 16  ? 20.452 10.043  42.369 1.00 5.62  ? 16  ARG B CG  1 
ATOM   1880 C CD  . ARG B 1 16  ? 21.377 10.959  43.122 1.00 6.31  ? 16  ARG B CD  1 
ATOM   1881 N NE  . ARG B 1 16  ? 22.714 11.033  42.543 1.00 6.35  ? 16  ARG B NE  1 
ATOM   1882 C CZ  . ARG B 1 16  ? 23.247 12.139  42.026 1.00 5.82  ? 16  ARG B CZ  1 
ATOM   1883 N NH1 . ARG B 1 16  ? 24.498 12.128  41.599 1.00 6.12  ? 16  ARG B NH1 1 
ATOM   1884 N NH2 . ARG B 1 16  ? 22.564 13.278  41.974 1.00 6.21  ? 16  ARG B NH2 1 
ATOM   1885 N N   . ALA B 1 17  ? 17.857 10.885  38.562 1.00 4.59  ? 17  ALA B N   1 
ATOM   1886 C CA  . ALA B 1 17  ? 16.769 11.544  37.833 1.00 4.21  ? 17  ALA B CA  1 
ATOM   1887 C C   . ALA B 1 17  ? 15.558 10.597  37.745 1.00 5.74  ? 17  ALA B C   1 
ATOM   1888 O O   . ALA B 1 17  ? 14.417 11.005  37.957 1.00 5.67  ? 17  ALA B O   1 
ATOM   1889 C CB  . ALA B 1 17  ? 17.231 12.002  36.471 1.00 5.55  ? 17  ALA B CB  1 
ATOM   1890 N N   . VAL B 1 18  ? 15.812 9.334   37.454 1.00 4.86  ? 18  VAL B N   1 
ATOM   1891 C CA  . VAL B 1 18  ? 14.753 8.335   37.406 1.00 5.52  ? 18  VAL B CA  1 
ATOM   1892 C C   . VAL B 1 18  ? 14.170 8.069   38.809 1.00 5.57  ? 18  VAL B C   1 
ATOM   1893 O O   . VAL B 1 18  ? 12.966 7.925   38.948 1.00 6.55  ? 18  VAL B O   1 
ATOM   1894 C CB  . VAL B 1 18  ? 15.276 7.027   36.763 1.00 5.43  ? 18  VAL B CB  1 
ATOM   1895 C CG1 . VAL B 1 18  ? 14.206 5.962   36.791 1.00 6.64  ? 18  VAL B CG1 1 
ATOM   1896 C CG2 . VAL B 1 18  ? 15.673 7.274   35.334 1.00 5.15  ? 18  VAL B CG2 1 
ATOM   1897 N N   . LYS B 1 19  ? 15.002 8.013   39.852 1.00 5.87  ? 19  LYS B N   1 
ATOM   1898 C CA  . LYS B 1 19  ? 14.496 7.851   41.219 1.00 6.50  ? 19  LYS B CA  1 
ATOM   1899 C C   . LYS B 1 19  ? 13.530 8.983   41.605 1.00 5.14  ? 19  LYS B C   1 
ATOM   1900 O O   . LYS B 1 19  ? 12.443 8.728   42.180 1.00 7.77  ? 19  LYS B O   1 
ATOM   1901 C CB  . LYS B 1 19  ? 15.623 7.672   42.257 1.00 7.49  ? 19  LYS B CB  1 
ATOM   1902 C CG  . LYS B 1 19  ? 16.451 6.410   42.065 1.00 9.34  ? 19  LYS B CG  1 
ATOM   1903 C CD  . LYS B 1 19  ? 17.569 6.356   43.108 1.00 10.33 ? 19  LYS B CD  1 
ATOM   1904 C CE  . LYS B 1 19  ? 17.039 6.450   44.537 1.00 14.92 ? 19  LYS B CE  1 
ATOM   1905 N NZ  . LYS B 1 19  ? 17.558 5.355   45.393 1.00 12.99 ? 19  LYS B NZ  1 
ATOM   1906 N N   . LEU B 1 20  ? 13.885 10.218  41.263 1.00 5.83  ? 20  LEU B N   1 
ATOM   1907 C CA  . LEU B 1 20  ? 12.977 11.343  41.503 1.00 5.20  ? 20  LEU B CA  1 
ATOM   1908 C C   . LEU B 1 20  ? 11.646 11.175  40.782 1.00 5.62  ? 20  LEU B C   1 
ATOM   1909 O O   . LEU B 1 20  ? 10.594 11.473  41.336 1.00 7.45  ? 20  LEU B O   1 
ATOM   1910 C CB  . LEU B 1 20  ? 13.620 12.681  41.088 1.00 6.64  ? 20  LEU B CB  1 
ATOM   1911 C CG  . LEU B 1 20  ? 14.771 13.218  41.937 1.00 4.92  ? 20  LEU B CG  1 
ATOM   1912 C CD1 . LEU B 1 20  ? 15.470 14.352  41.209 1.00 8.27  ? 20  LEU B CD1 1 
ATOM   1913 C CD2 . LEU B 1 20  ? 14.258 13.640  43.303 1.00 5.72  ? 20  LEU B CD2 1 
ATOM   1914 N N   . THR B 1 21  ? 11.710 10.730  39.539 1.00 4.78  ? 21  THR B N   1 
ATOM   1915 C CA  . THR B 1 21  ? 10.524 10.571  38.735 1.00 5.58  ? 21  THR B CA  1 
ATOM   1916 C C   . THR B 1 21  ? 9.614  9.489   39.310 1.00 6.54  ? 21  THR B C   1 
ATOM   1917 O O   . THR B 1 21  ? 8.410  9.670   39.396 1.00 7.37  ? 21  THR B O   1 
ATOM   1918 C CB  . THR B 1 21  ? 10.909 10.240  37.272 1.00 5.44  ? 21  THR B CB  1 
ATOM   1919 O OG1 . THR B 1 21  ? 11.758 11.256  36.737 1.00 6.04  ? 21  THR B OG1 1 
ATOM   1920 C CG2 . THR B 1 21  ? 9.676  10.096  36.397 1.00 6.87  ? 21  THR B CG2 1 
ATOM   1921 N N   . LEU B 1 22  ? 10.190 8.351   39.674 1.00 7.46  ? 22  LEU B N   1 
ATOM   1922 C CA  . LEU B 1 22  ? 9.394  7.301   40.288 1.00 9.03  ? 22  LEU B CA  1 
ATOM   1923 C C   . LEU B 1 22  ? 8.712  7.767   41.583 1.00 8.90  ? 22  LEU B C   1 
ATOM   1924 O O   . LEU B 1 22  ? 7.556  7.384   41.866 1.00 10.71 ? 22  LEU B O   1 
ATOM   1925 C CB  . LEU B 1 22  ? 10.268 6.065   40.505 1.00 7.96  ? 22  LEU B CB  1 
ATOM   1926 C CG  . LEU B 1 22  ? 10.608 5.361   39.189 1.00 8.82  ? 22  LEU B CG  1 
ATOM   1927 C CD1 . LEU B 1 22  ? 11.871 4.516   39.367 1.00 8.38  ? 22  LEU B CD1 1 
ATOM   1928 C CD2 . LEU B 1 22  ? 9.415  4.481   38.778 1.00 9.25  ? 22  LEU B CD2 1 
ATOM   1929 N N   . ALA B 1 23  ? 9.423  8.605   42.342 1.00 10.38 ? 23  ALA B N   1 
ATOM   1930 C CA  . ALA B 1 23  ? 8.896  9.117   43.594 1.00 9.31  ? 23  ALA B CA  1 
ATOM   1931 C C   . ALA B 1 23  ? 7.788  10.112  43.310 1.00 9.75  ? 23  ALA B C   1 
ATOM   1932 O O   . ALA B 1 23  ? 6.791  10.141  44.014 1.00 11.29 ? 23  ALA B O   1 
ATOM   1933 C CB  . ALA B 1 23  ? 9.998  9.799   44.392 1.00 10.65 ? 23  ALA B CB  1 
ATOM   1934 N N   . ALA B 1 24  ? 7.958  10.938  42.284 1.00 10.28 ? 24  ALA B N   1 
ATOM   1935 C CA  . ALA B 1 24  ? 6.922  11.913  41.949 1.00 10.17 ? 24  ALA B CA  1 
ATOM   1936 C C   . ALA B 1 24  ? 5.644  11.223  41.490 1.00 11.13 ? 24  ALA B C   1 
ATOM   1937 O O   . ALA B 1 24  ? 4.531  11.723  41.710 1.00 11.91 ? 24  ALA B O   1 
ATOM   1938 C CB  . ALA B 1 24  ? 7.406  12.912  40.878 1.00 7.08  ? 24  ALA B CB  1 
ATOM   1939 N N   . LEU B 1 25  ? 5.806  10.087  40.830 1.00 12.83 ? 25  LEU B N   1 
ATOM   1940 C CA  . LEU B 1 25  ? 4.673  9.322   40.318 1.00 13.83 ? 25  LEU B CA  1 
ATOM   1941 C C   . LEU B 1 25  ? 4.091  8.425   41.390 1.00 15.77 ? 25  LEU B C   1 
ATOM   1942 O O   . LEU B 1 25  ? 3.073  7.793   41.162 1.00 16.16 ? 25  LEU B O   1 
ATOM   1943 C CB  . LEU B 1 25  ? 5.130  8.454   39.140 1.00 15.86 ? 25  LEU B CB  1 
ATOM   1944 C CG  . LEU B 1 25  ? 5.609  9.212   37.898 1.00 14.65 ? 25  LEU B CG  1 
ATOM   1945 C CD1 . LEU B 1 25  ? 6.276  8.271   36.900 1.00 14.10 ? 25  LEU B CD1 1 
ATOM   1946 C CD2 . LEU B 1 25  ? 4.429  9.896   37.242 1.00 13.05 ? 25  LEU B CD2 1 
ATOM   1947 N N   . GLN B 1 26  ? 4.749  8.358   42.546 1.00 17.32 ? 26  GLN B N   1 
ATOM   1948 C CA  . GLN B 1 26  ? 4.359  7.425   43.616 1.00 18.87 ? 26  GLN B CA  1 
ATOM   1949 C C   . GLN B 1 26  ? 4.161  6.012   43.072 1.00 16.84 ? 26  GLN B C   1 
ATOM   1950 O O   . GLN B 1 26  ? 3.222  5.301   43.450 1.00 18.30 ? 26  GLN B O   1 
ATOM   1951 C CB  . GLN B 1 26  ? 3.088  7.897   44.326 1.00 21.75 ? 26  GLN B CB  1 
ATOM   1952 C CG  . GLN B 1 26  ? 3.259  9.186   45.081 1.00 24.74 ? 26  GLN B CG  1 
ATOM   1953 C CD  . GLN B 1 26  ? 1.936  9.793   45.503 1.00 28.26 ? 26  GLN B CD  1 
ATOM   1954 O OE1 . GLN B 1 26  ? 0.971  9.077   45.775 1.00 31.70 ? 26  GLN B OE1 1 
ATOM   1955 N NE2 . GLN B 1 26  ? 1.884  11.118  45.555 1.00 27.35 ? 26  GLN B NE2 1 
ATOM   1956 N N   . LEU B 1 27  ? 5.036  5.618   42.157 1.00 15.15 ? 27  LEU B N   1 
ATOM   1957 C CA  . LEU B 1 27  ? 4.933  4.326   41.493 1.00 16.13 ? 27  LEU B CA  1 
ATOM   1958 C C   . LEU B 1 27  ? 5.853  3.338   42.188 1.00 17.79 ? 27  LEU B C   1 
ATOM   1959 O O   . LEU B 1 27  ? 7.057  3.573   42.257 1.00 16.63 ? 27  LEU B O   1 
ATOM   1960 C CB  . LEU B 1 27  ? 5.343  4.455   40.020 1.00 15.29 ? 27  LEU B CB  1 
ATOM   1961 C CG  . LEU B 1 27  ? 5.174  3.184   39.186 1.00 16.23 ? 27  LEU B CG  1 
ATOM   1962 C CD1 . LEU B 1 27  ? 3.708  2.774   39.116 1.00 18.39 ? 27  LEU B CD1 1 
ATOM   1963 C CD2 . LEU B 1 27  ? 5.708  3.404   37.783 1.00 15.86 ? 27  LEU B CD2 1 
ATOM   1964 N N   . PRO B 1 28  ? 5.297  2.237   42.727 1.00 19.83 ? 28  PRO B N   1 
ATOM   1965 C CA  . PRO B 1 28  ? 6.170  1.240   43.364 1.00 18.37 ? 28  PRO B CA  1 
ATOM   1966 C C   . PRO B 1 28  ? 7.075  0.567   42.343 1.00 16.78 ? 28  PRO B C   1 
ATOM   1967 O O   . PRO B 1 28  ? 6.679  0.431   41.180 1.00 17.78 ? 28  PRO B O   1 
ATOM   1968 C CB  . PRO B 1 28  ? 5.180  0.213   43.937 1.00 19.97 ? 28  PRO B CB  1 
ATOM   1969 C CG  . PRO B 1 28  ? 3.878  0.961   44.028 1.00 22.40 ? 28  PRO B CG  1 
ATOM   1970 C CD  . PRO B 1 28  ? 3.876  1.862   42.835 1.00 21.40 ? 28  PRO B CD  1 
ATOM   1971 N N   . TYR B 1 29  ? 8.267  0.156   42.761 1.00 18.17 ? 29  TYR B N   1 
ATOM   1972 C CA  . TYR B 1 29  ? 9.222  -0.467  41.849 1.00 18.01 ? 29  TYR B CA  1 
ATOM   1973 C C   . TYR B 1 29  ? 10.286 -1.231  42.629 1.00 17.41 ? 29  TYR B C   1 
ATOM   1974 O O   . TYR B 1 29  ? 10.492 -0.991  43.831 1.00 17.74 ? 29  TYR B O   1 
ATOM   1975 C CB  . TYR B 1 29  ? 9.881  0.587   40.936 1.00 15.13 ? 29  TYR B CB  1 
ATOM   1976 C CG  . TYR B 1 29  ? 10.822 1.570   41.622 1.00 14.38 ? 29  TYR B CG  1 
ATOM   1977 C CD1 . TYR B 1 29  ? 10.336 2.711   42.254 1.00 13.88 ? 29  TYR B CD1 1 
ATOM   1978 C CD2 . TYR B 1 29  ? 12.192 1.364   41.601 1.00 14.33 ? 29  TYR B CD2 1 
ATOM   1979 C CE1 . TYR B 1 29  ? 11.198 3.641   42.865 1.00 15.00 ? 29  TYR B CE1 1 
ATOM   1980 C CE2 . TYR B 1 29  ? 13.067 2.261   42.206 1.00 13.83 ? 29  TYR B CE2 1 
ATOM   1981 C CZ  . TYR B 1 29  ? 12.562 3.402   42.831 1.00 13.37 ? 29  TYR B CZ  1 
ATOM   1982 O OH  . TYR B 1 29  ? 13.438 4.297   43.420 1.00 13.07 ? 29  TYR B OH  1 
ATOM   1983 N N   . ASP B 1 30  ? 10.949 -2.168  41.963 1.00 17.90 ? 30  ASP B N   1 
ATOM   1984 C CA  . ASP B 1 30  ? 12.066 -2.882  42.556 1.00 18.71 ? 30  ASP B CA  1 
ATOM   1985 C C   . ASP B 1 30  ? 13.347 -2.203  42.087 1.00 17.62 ? 30  ASP B C   1 
ATOM   1986 O O   . ASP B 1 30  ? 13.425 -1.773  40.942 1.00 16.72 ? 30  ASP B O   1 
ATOM   1987 C CB  . ASP B 1 30  ? 12.046 -4.356  42.134 1.00 20.16 ? 30  ASP B CB  1 
ATOM   1988 C CG  . ASP B 1 30  ? 10.815 -5.105  42.638 1.00 24.59 ? 30  ASP B CG  1 
ATOM   1989 O OD1 . ASP B 1 30  ? 10.475 -4.967  43.822 1.00 24.46 ? 30  ASP B OD1 1 
ATOM   1990 O OD2 . ASP B 1 30  ? 10.182 -5.825  41.836 1.00 27.10 ? 30  ASP B OD2 1 
ATOM   1991 N N   . TYR B 1 31  ? 14.333 -2.101  42.974 1.00 18.09 ? 31  TYR B N   1 
ATOM   1992 C CA  . TYR B 1 31  ? 15.579 -1.401  42.671 1.00 18.18 ? 31  TYR B CA  1 
ATOM   1993 C C   . TYR B 1 31  ? 16.706 -2.392  42.832 1.00 18.09 ? 31  TYR B C   1 
ATOM   1994 O O   . TYR B 1 31  ? 16.905 -2.913  43.923 1.00 19.21 ? 31  TYR B O   1 
ATOM   1995 C CB  . TYR B 1 31  ? 15.784 -0.268  43.669 1.00 18.55 ? 31  TYR B CB  1 
ATOM   1996 C CG  . TYR B 1 31  ? 16.982 0.638   43.418 1.00 15.72 ? 31  TYR B CG  1 
ATOM   1997 C CD1 . TYR B 1 31  ? 17.459 0.871   42.131 1.00 15.33 ? 31  TYR B CD1 1 
ATOM   1998 C CD2 . TYR B 1 31  ? 17.625 1.268   44.474 1.00 15.93 ? 31  TYR B CD2 1 
ATOM   1999 C CE1 . TYR B 1 31  ? 18.559 1.722   41.902 1.00 15.44 ? 31  TYR B CE1 1 
ATOM   2000 C CE2 . TYR B 1 31  ? 18.712 2.113   44.266 1.00 15.76 ? 31  TYR B CE2 1 
ATOM   2001 C CZ  . TYR B 1 31  ? 19.166 2.347   42.978 1.00 14.59 ? 31  TYR B CZ  1 
ATOM   2002 O OH  . TYR B 1 31  ? 20.244 3.204   42.822 1.00 14.24 ? 31  TYR B OH  1 
ATOM   2003 N N   . LYS B 1 32  ? 17.444 -2.644  41.761 1.00 18.24 ? 32  LYS B N   1 
ATOM   2004 C CA  . LYS B 1 32  ? 18.539 -3.600  41.777 1.00 21.76 ? 32  LYS B CA  1 
ATOM   2005 C C   . LYS B 1 32  ? 19.876 -2.872  41.609 1.00 20.19 ? 32  LYS B C   1 
ATOM   2006 O O   . LYS B 1 32  ? 20.084 -2.147  40.623 1.00 17.33 ? 32  LYS B O   1 
ATOM   2007 C CB  . LYS B 1 32  ? 18.322 -4.642  40.672 1.00 25.39 ? 32  LYS B CB  1 
ATOM   2008 C CG  . LYS B 1 32  ? 19.209 -5.873  40.737 1.00 31.55 ? 32  LYS B CG  1 
ATOM   2009 C CD  . LYS B 1 32  ? 20.386 -5.759  39.772 1.00 33.79 ? 32  LYS B CD  1 
ATOM   2010 C CE  . LYS B 1 32  ? 21.050 -7.123  39.530 1.00 36.38 ? 32  LYS B CE  1 
ATOM   2011 N NZ  . LYS B 1 32  ? 22.029 -7.113  38.387 1.00 35.64 ? 32  LYS B NZ  1 
ATOM   2012 N N   . ILE B 1 33  ? 20.775 -3.047  42.578 1.00 19.21 ? 33  ILE B N   1 
ATOM   2013 C CA  . ILE B 1 33  ? 22.068 -2.371  42.544 1.00 18.89 ? 33  ILE B CA  1 
ATOM   2014 C C   . ILE B 1 33  ? 23.012 -2.958  41.507 1.00 19.26 ? 33  ILE B C   1 
ATOM   2015 O O   . ILE B 1 33  ? 23.252 -4.158  41.485 1.00 20.53 ? 33  ILE B O   1 
ATOM   2016 C CB  . ILE B 1 33  ? 22.766 -2.361  43.924 1.00 19.86 ? 33  ILE B CB  1 
ATOM   2017 C CG1 . ILE B 1 33  ? 21.884 -1.662  44.956 1.00 19.59 ? 33  ILE B CG1 1 
ATOM   2018 C CG2 . ILE B 1 33  ? 24.170 -1.761  43.816 1.00 19.79 ? 33  ILE B CG2 1 
ATOM   2019 C CD1 . ILE B 1 33  ? 21.322 -0.336  44.487 1.00 17.99 ? 33  ILE B CD1 1 
ATOM   2020 N N   . VAL B 1 34  ? 23.517 -2.097  40.635 1.00 18.28 ? 34  VAL B N   1 
ATOM   2021 C CA  . VAL B 1 34  ? 24.603 -2.434  39.741 1.00 18.68 ? 34  VAL B CA  1 
ATOM   2022 C C   . VAL B 1 34  ? 25.807 -1.644  40.188 1.00 18.68 ? 34  VAL B C   1 
ATOM   2023 O O   . VAL B 1 34  ? 25.963 -0.448  39.897 1.00 17.80 ? 34  VAL B O   1 
ATOM   2024 C CB  . VAL B 1 34  ? 24.267 -2.155  38.276 1.00 17.88 ? 34  VAL B CB  1 
ATOM   2025 C CG1 . VAL B 1 34  ? 25.456 -2.482  37.366 1.00 18.48 ? 34  VAL B CG1 1 
ATOM   2026 C CG2 . VAL B 1 34  ? 23.061 -2.946  37.880 1.00 18.09 ? 34  VAL B CG2 1 
ATOM   2027 N N   . ASN B 1 35  ? 26.665 -2.350  40.914 1.00 20.70 ? 35  ASN B N   1 
ATOM   2028 C CA  . ASN B 1 35  ? 27.824 -1.730  41.518 1.00 23.63 ? 35  ASN B CA  1 
ATOM   2029 C C   . ASN B 1 35  ? 28.870 -1.467  40.434 1.00 21.89 ? 35  ASN B C   1 
ATOM   2030 O O   . ASN B 1 35  ? 29.601 -2.369  40.007 1.00 22.78 ? 35  ASN B O   1 
ATOM   2031 C CB  . ASN B 1 35  ? 28.351 -2.603  42.668 1.00 27.19 ? 35  ASN B CB  1 
ATOM   2032 C CG  . ASN B 1 35  ? 29.241 -1.836  43.640 1.00 30.55 ? 35  ASN B CG  1 
ATOM   2033 O OD1 . ASN B 1 35  ? 30.121 -1.088  43.205 1.00 33.05 ? 35  ASN B OD1 1 
ATOM   2034 N ND2 . ASN B 1 35  ? 29.009 -2.006  44.969 1.00 23.27 ? 35  ASN B ND2 1 
ATOM   2035 N N   . LEU B 1 36  ? 28.961 -0.218  40.002 1.00 21.18 ? 36  LEU B N   1 
ATOM   2036 C CA  . LEU B 1 36  ? 29.857 0.142   38.912 1.00 22.34 ? 36  LEU B CA  1 
ATOM   2037 C C   . LEU B 1 36  ? 31.325 0.010   39.299 1.00 25.89 ? 36  LEU B C   1 
ATOM   2038 O O   . LEU B 1 36  ? 32.176 -0.228  38.443 1.00 26.15 ? 36  LEU B O   1 
ATOM   2039 C CB  . LEU B 1 36  ? 29.574 1.549   38.415 1.00 21.62 ? 36  LEU B CB  1 
ATOM   2040 C CG  . LEU B 1 36  ? 28.174 1.783   37.852 1.00 19.39 ? 36  LEU B CG  1 
ATOM   2041 C CD1 . LEU B 1 36  ? 27.941 3.254   37.565 1.00 17.99 ? 36  LEU B CD1 1 
ATOM   2042 C CD2 . LEU B 1 36  ? 27.961 0.961   36.589 1.00 17.74 ? 36  LEU B CD2 1 
ATOM   2043 N N   . MET B 1 37  ? 31.611 0.161   40.589 1.00 28.44 ? 37  MET B N   1 
ATOM   2044 C CA  . MET B 1 37  ? 32.968 -0.019  41.100 1.00 32.53 ? 37  MET B CA  1 
ATOM   2045 C C   . MET B 1 37  ? 33.426 -1.471  40.994 1.00 33.24 ? 37  MET B C   1 
ATOM   2046 O O   . MET B 1 37  ? 34.623 -1.759  40.857 1.00 36.30 ? 37  MET B O   1 
ATOM   2047 C CB  . MET B 1 37  ? 33.059 0.473   42.540 1.00 34.27 ? 37  MET B CB  1 
ATOM   2048 C CG  . MET B 1 37  ? 33.038 1.983   42.610 1.00 35.16 ? 37  MET B CG  1 
ATOM   2049 S SD  . MET B 1 37  ? 34.253 2.669   41.452 1.00 62.01 ? 37  MET B SD  1 
ATOM   2050 C CE  . MET B 1 37  ? 33.601 4.313   41.158 1.00 25.72 ? 37  MET B CE  1 
ATOM   2051 N N   . ASN B 1 38  ? 32.473 -2.391  41.059 1.00 31.02 ? 38  ASN B N   1 
ATOM   2052 C CA  . ASN B 1 38  ? 32.771 -3.803  40.872 1.00 31.93 ? 38  ASN B CA  1 
ATOM   2053 C C   . ASN B 1 38  ? 32.701 -4.142  39.380 1.00 31.89 ? 38  ASN B C   1 
ATOM   2054 O O   . ASN B 1 38  ? 32.628 -5.321  39.009 1.00 32.35 ? 38  ASN B O   1 
ATOM   2055 C CB  . ASN B 1 38  ? 31.787 -4.662  41.680 1.00 31.83 ? 38  ASN B CB  1 
ATOM   2056 C CG  . ASN B 1 38  ? 32.326 -6.057  41.990 1.00 32.83 ? 38  ASN B CG  1 
ATOM   2057 O OD1 . ASN B 1 38  ? 33.514 -6.236  42.275 1.00 34.07 ? 38  ASN B OD1 1 
ATOM   2058 N ND2 . ASN B 1 38  ? 31.441 -7.053  41.947 1.00 33.06 ? 38  ASN B ND2 1 
ATOM   2059 N N   . LYS B 1 39  ? 32.719 -3.094  38.543 1.00 29.73 ? 39  LYS B N   1 
ATOM   2060 C CA  . LYS B 1 39  ? 32.641 -3.215  37.083 1.00 29.41 ? 39  LYS B CA  1 
ATOM   2061 C C   . LYS B 1 39  ? 31.464 -4.105  36.676 1.00 27.91 ? 39  LYS B C   1 
ATOM   2062 O O   . LYS B 1 39  ? 31.535 -4.835  35.678 1.00 30.56 ? 39  LYS B O   1 
ATOM   2063 C CB  . LYS B 1 39  ? 33.958 -3.772  36.512 1.00 33.07 ? 39  LYS B CB  1 
ATOM   2064 C CG  . LYS B 1 39  ? 35.194 -2.874  36.722 1.00 35.69 ? 39  LYS B CG  1 
ATOM   2065 C CD  . LYS B 1 39  ? 35.340 -1.859  35.587 1.00 36.53 ? 39  LYS B CD  1 
ATOM   2066 C CE  . LYS B 1 39  ? 36.787 -1.740  35.093 1.00 38.91 ? 39  LYS B CE  1 
ATOM   2067 N NZ  . LYS B 1 39  ? 37.659 -0.879  35.961 1.00 39.94 ? 39  LYS B NZ  1 
ATOM   2068 N N   . GLU B 1 40  ? 30.395 -4.049  37.466 1.00 24.65 ? 40  GLU B N   1 
ATOM   2069 C CA  . GLU B 1 40  ? 29.255 -4.946  37.313 1.00 23.89 ? 40  GLU B CA  1 
ATOM   2070 C C   . GLU B 1 40  ? 28.423 -4.665  36.056 1.00 22.45 ? 40  GLU B C   1 
ATOM   2071 O O   . GLU B 1 40  ? 27.703 -5.551  35.600 1.00 22.97 ? 40  GLU B O   1 
ATOM   2072 C CB  . GLU B 1 40  ? 28.369 -4.930  38.574 1.00 23.75 ? 40  GLU B CB  1 
ATOM   2073 C CG  . GLU B 1 40  ? 29.000 -5.686  39.750 1.00 26.49 ? 40  GLU B CG  1 
ATOM   2074 C CD  . GLU B 1 40  ? 28.211 -5.583  41.056 1.00 29.49 ? 40  GLU B CD  1 
ATOM   2075 O OE1 . GLU B 1 40  ? 27.021 -5.183  41.024 1.00 26.90 ? 40  GLU B OE1 1 
ATOM   2076 O OE2 . GLU B 1 40  ? 28.798 -5.903  42.122 1.00 31.94 ? 40  GLU B OE2 1 
ATOM   2077 N N   . GLN B 1 41  ? 28.503 -3.450  35.500 1.00 20.68 ? 41  GLN B N   1 
ATOM   2078 C CA  . GLN B 1 41  ? 27.861 -3.168  34.210 1.00 20.02 ? 41  GLN B CA  1 
ATOM   2079 C C   . GLN B 1 41  ? 28.445 -4.013  33.062 1.00 21.20 ? 41  GLN B C   1 
ATOM   2080 O O   . GLN B 1 41  ? 27.790 -4.174  32.027 1.00 25.02 ? 41  GLN B O   1 
ATOM   2081 C CB  . GLN B 1 41  ? 27.908 -1.667  33.857 1.00 18.73 ? 41  GLN B CB  1 
ATOM   2082 C CG  . GLN B 1 41  ? 29.233 -1.124  33.280 1.00 20.26 ? 41  GLN B CG  1 
ATOM   2083 C CD  . GLN B 1 41  ? 30.236 -0.761  34.370 1.00 20.49 ? 41  GLN B CD  1 
ATOM   2084 O OE1 . GLN B 1 41  ? 30.265 -1.383  35.438 1.00 22.94 ? 41  GLN B OE1 1 
ATOM   2085 N NE2 . GLN B 1 41  ? 31.057 0.261   34.108 1.00 19.27 ? 41  GLN B NE2 1 
ATOM   2086 N N   . HIS B 1 42  ? 29.663 -4.542  33.233 1.00 22.54 ? 42  HIS B N   1 
ATOM   2087 C CA  . HIS B 1 42  ? 30.311 -5.349  32.187 1.00 23.75 ? 42  HIS B CA  1 
ATOM   2088 C C   . HIS B 1 42  ? 30.136 -6.855  32.363 1.00 30.34 ? 42  HIS B C   1 
ATOM   2089 O O   . HIS B 1 42  ? 30.750 -7.641  31.632 1.00 26.67 ? 42  HIS B O   1 
ATOM   2090 C CB  . HIS B 1 42  ? 31.803 -5.016  32.075 1.00 24.40 ? 42  HIS B CB  1 
ATOM   2091 C CG  . HIS B 1 42  ? 32.071 -3.628  31.594 1.00 26.86 ? 42  HIS B CG  1 
ATOM   2092 N ND1 . HIS B 1 42  ? 32.375 -2.590  32.451 1.00 27.26 ? 42  HIS B ND1 1 
ATOM   2093 C CD2 . HIS B 1 42  ? 32.068 -3.100  30.347 1.00 26.39 ? 42  HIS B CD2 1 
ATOM   2094 C CE1 . HIS B 1 42  ? 32.552 -1.482  31.750 1.00 25.29 ? 42  HIS B CE1 1 
ATOM   2095 N NE2 . HIS B 1 42  ? 32.367 -1.765  30.471 1.00 26.92 ? 42  HIS B NE2 1 
ATOM   2096 N N   . SER B 1 43  ? 29.299 -7.264  33.310 1.00 34.97 ? 43  SER B N   1 
ATOM   2097 C CA  . SER B 1 43  ? 29.031 -8.688  33.501 1.00 19.60 ? 43  SER B CA  1 
ATOM   2098 C C   . SER B 1 43  ? 28.309 -9.220  32.282 1.00 19.97 ? 43  SER B C   1 
ATOM   2099 O O   . SER B 1 43  ? 27.756 -8.449  31.495 1.00 22.82 ? 43  SER B O   1 
ATOM   2100 C CB  . SER B 1 43  ? 28.174 -8.942  34.743 1.00 23.06 ? 43  SER B CB  1 
ATOM   2101 O OG  . SER B 1 43  ? 26.836 -8.504  34.543 1.00 22.95 ? 43  SER B OG  1 
ATOM   2102 N N   . GLU B 1 44  ? 28.309 -10.536 32.119 1.00 38.55 ? 44  GLU B N   1 
ATOM   2103 C CA  . GLU B 1 44  ? 27.630 -11.144 30.990 1.00 34.04 ? 44  GLU B CA  1 
ATOM   2104 C C   . GLU B 1 44  ? 26.120 -11.016 31.169 1.00 29.39 ? 44  GLU B C   1 
ATOM   2105 O O   . GLU B 1 44  ? 25.388 -10.754 30.212 1.00 27.15 ? 44  GLU B O   1 
ATOM   2106 C CB  . GLU B 1 44  ? 28.024 -12.612 30.877 1.00 35.91 ? 44  GLU B CB  1 
ATOM   2107 C CG  . GLU B 1 44  ? 28.341 -13.066 29.468 1.00 37.30 ? 44  GLU B CG  1 
ATOM   2108 C CD  . GLU B 1 44  ? 28.620 -14.562 29.411 1.00 40.25 ? 44  GLU B CD  1 
ATOM   2109 O OE1 . GLU B 1 44  ? 29.699 -14.999 29.889 1.00 42.59 ? 44  GLU B OE1 1 
ATOM   2110 O OE2 . GLU B 1 44  ? 27.745 -15.303 28.910 1.00 40.05 ? 44  GLU B OE2 1 
ATOM   2111 N N   . GLU B 1 45  ? 25.661 -11.203 32.402 1.00 29.17 ? 45  GLU B N   1 
ATOM   2112 C CA  . GLU B 1 45  ? 24.241 -11.086 32.708 1.00 31.20 ? 45  GLU B CA  1 
ATOM   2113 C C   . GLU B 1 45  ? 23.678 -9.690  32.403 1.00 29.10 ? 45  GLU B C   1 
ATOM   2114 O O   . GLU B 1 45  ? 22.591 -9.562  31.837 1.00 28.20 ? 45  GLU B O   1 
ATOM   2115 C CB  . GLU B 1 45  ? 23.969 -11.490 34.161 1.00 36.04 ? 45  GLU B CB  1 
ATOM   2116 C CG  . GLU B 1 45  ? 24.054 -13.005 34.387 1.00 42.44 ? 45  GLU B CG  1 
ATOM   2117 C CD  . GLU B 1 45  ? 23.591 -13.438 35.774 1.00 47.51 ? 45  GLU B CD  1 
ATOM   2118 O OE1 . GLU B 1 45  ? 23.292 -12.554 36.614 1.00 48.30 ? 45  GLU B OE1 1 
ATOM   2119 O OE2 . GLU B 1 45  ? 23.524 -14.666 36.019 1.00 50.30 ? 45  GLU B OE2 1 
ATOM   2120 N N   . TYR B 1 46  ? 24.421 -8.647  32.761 1.00 23.48 ? 46  TYR B N   1 
ATOM   2121 C CA  . TYR B 1 46  ? 23.938 -7.280  32.521 1.00 22.06 ? 46  TYR B CA  1 
ATOM   2122 C C   . TYR B 1 46  ? 24.082 -6.836  31.059 1.00 21.47 ? 46  TYR B C   1 
ATOM   2123 O O   . TYR B 1 46  ? 23.227 -6.105  30.530 1.00 22.64 ? 46  TYR B O   1 
ATOM   2124 C CB  . TYR B 1 46  ? 24.632 -6.273  33.449 1.00 21.54 ? 46  TYR B CB  1 
ATOM   2125 C CG  . TYR B 1 46  ? 23.964 -4.905  33.423 1.00 20.35 ? 46  TYR B CG  1 
ATOM   2126 C CD1 . TYR B 1 46  ? 22.759 -4.682  34.075 1.00 20.11 ? 46  TYR B CD1 1 
ATOM   2127 C CD2 . TYR B 1 46  ? 24.532 -3.844  32.733 1.00 21.42 ? 46  TYR B CD2 1 
ATOM   2128 C CE1 . TYR B 1 46  ? 22.146 -3.428  34.062 1.00 19.19 ? 46  TYR B CE1 1 
ATOM   2129 C CE2 . TYR B 1 46  ? 23.919 -2.595  32.699 1.00 18.79 ? 46  TYR B CE2 1 
ATOM   2130 C CZ  . TYR B 1 46  ? 22.721 -2.389  33.368 1.00 18.58 ? 46  TYR B CZ  1 
ATOM   2131 O OH  . TYR B 1 46  ? 22.081 -1.149  33.352 1.00 17.90 ? 46  TYR B OH  1 
ATOM   2132 N N   . LEU B 1 47  ? 25.165 -7.249  30.408 1.00 21.93 ? 47  LEU B N   1 
ATOM   2133 C CA  . LEU B 1 47  ? 25.387 -6.883  29.010 1.00 23.39 ? 47  LEU B CA  1 
ATOM   2134 C C   . LEU B 1 47  ? 24.315 -7.462  28.110 1.00 24.37 ? 47  LEU B C   1 
ATOM   2135 O O   . LEU B 1 47  ? 24.056 -6.932  27.039 1.00 26.17 ? 47  LEU B O   1 
ATOM   2136 C CB  . LEU B 1 47  ? 26.761 -7.326  28.509 1.00 24.06 ? 47  LEU B CB  1 
ATOM   2137 C CG  . LEU B 1 47  ? 27.988 -6.548  28.983 1.00 23.59 ? 47  LEU B CG  1 
ATOM   2138 C CD1 . LEU B 1 47  ? 29.279 -7.239  28.548 1.00 23.56 ? 47  LEU B CD1 1 
ATOM   2139 C CD2 . LEU B 1 47  ? 27.948 -5.118  28.474 1.00 20.84 ? 47  LEU B CD2 1 
ATOM   2140 N N   . LYS B 1 48  ? 23.717 -8.572  28.523 1.00 24.92 ? 48  LYS B N   1 
ATOM   2141 C CA  . LYS B 1 48  ? 22.569 -9.087  27.796 1.00 26.68 ? 48  LYS B CA  1 
ATOM   2142 C C   . LYS B 1 48  ? 21.402 -8.101  27.891 1.00 26.68 ? 48  LYS B C   1 
ATOM   2143 O O   . LYS B 1 48  ? 20.752 -7.793  26.884 1.00 25.91 ? 48  LYS B O   1 
ATOM   2144 C CB  . LYS B 1 48  ? 22.160 -10.464 28.328 1.00 29.74 ? 48  LYS B CB  1 
ATOM   2145 C CG  . LYS B 1 48  ? 20.957 -11.063 27.599 1.00 32.32 ? 48  LYS B CG  1 
ATOM   2146 C CD  . LYS B 1 48  ? 20.513 -12.417 28.165 1.00 35.28 ? 48  LYS B CD  1 
ATOM   2147 C CE  . LYS B 1 48  ? 19.022 -12.642 27.904 1.00 35.40 ? 48  LYS B CE  1 
ATOM   2148 N NZ  . LYS B 1 48  ? 18.600 -12.127 26.565 1.00 34.14 ? 48  LYS B NZ  1 
ATOM   2149 N N   . LYS B 1 49  ? 21.158 -7.595  29.100 1.00 25.34 ? 49  LYS B N   1 
ATOM   2150 C CA  . LYS B 1 49  ? 20.086 -6.626  29.334 1.00 24.23 ? 49  LYS B CA  1 
ATOM   2151 C C   . LYS B 1 49  ? 20.362 -5.294  28.638 1.00 22.98 ? 49  LYS B C   1 
ATOM   2152 O O   . LYS B 1 49  ? 19.441 -4.631  28.166 1.00 24.07 ? 49  LYS B O   1 
ATOM   2153 C CB  . LYS B 1 49  ? 19.887 -6.385  30.838 1.00 24.81 ? 49  LYS B CB  1 
ATOM   2154 C CG  . LYS B 1 49  ? 19.533 -7.624  31.645 1.00 26.22 ? 49  LYS B CG  1 
ATOM   2155 C CD  . LYS B 1 49  ? 19.341 -7.268  33.114 1.00 27.64 ? 49  LYS B CD  1 
ATOM   2156 C CE  . LYS B 1 49  ? 18.931 -8.505  33.916 1.00 29.87 ? 49  LYS B CE  1 
ATOM   2157 N NZ  . LYS B 1 49  ? 17.565 -8.967  33.515 1.00 30.07 ? 49  LYS B NZ  1 
ATOM   2158 N N   . ASN B 1 50  ? 21.632 -4.900  28.593 1.00 22.38 ? 50  ASN B N   1 
ATOM   2159 C CA  . ASN B 1 50  ? 22.008 -3.593  28.056 1.00 18.99 ? 50  ASN B CA  1 
ATOM   2160 C C   . ASN B 1 50  ? 23.420 -3.589  27.461 1.00 19.16 ? 50  ASN B C   1 
ATOM   2161 O O   . ASN B 1 50  ? 24.404 -3.367  28.173 1.00 19.12 ? 50  ASN B O   1 
ATOM   2162 C CB  . ASN B 1 50  ? 21.887 -2.518  29.148 1.00 18.40 ? 50  ASN B CB  1 
ATOM   2163 C CG  . ASN B 1 50  ? 22.211 -1.120  28.635 1.00 17.95 ? 50  ASN B CG  1 
ATOM   2164 O OD1 . ASN B 1 50  ? 22.351 -0.910  27.431 1.00 18.50 ? 50  ASN B OD1 1 
ATOM   2165 N ND2 . ASN B 1 50  ? 22.343 -0.168  29.548 1.00 17.71 ? 50  ASN B ND2 1 
ATOM   2166 N N   . PRO B 1 51  ? 23.519 -3.813  26.142 1.00 19.42 ? 51  PRO B N   1 
ATOM   2167 C CA  . PRO B 1 51  ? 24.839 -3.898  25.505 1.00 20.88 ? 51  PRO B CA  1 
ATOM   2168 C C   . PRO B 1 51  ? 25.669 -2.614  25.605 1.00 20.48 ? 51  PRO B C   1 
ATOM   2169 O O   . PRO B 1 51  ? 26.870 -2.652  25.382 1.00 23.24 ? 51  PRO B O   1 
ATOM   2170 C CB  . PRO B 1 51  ? 24.499 -4.198  24.042 1.00 20.05 ? 51  PRO B CB  1 
ATOM   2171 C CG  . PRO B 1 51  ? 23.162 -4.883  24.104 1.00 21.78 ? 51  PRO B CG  1 
ATOM   2172 C CD  . PRO B 1 51  ? 22.434 -4.238  25.238 1.00 20.10 ? 51  PRO B CD  1 
ATOM   2173 N N   . GLN B 1 52  ? 25.055 -1.498  25.959 1.00 20.29 ? 52  GLN B N   1 
ATOM   2174 C CA  . GLN B 1 52  ? 25.828 -0.271  26.159 1.00 21.19 ? 52  GLN B CA  1 
ATOM   2175 C C   . GLN B 1 52  ? 26.492 -0.180  27.536 1.00 23.99 ? 52  GLN B C   1 
ATOM   2176 O O   . GLN B 1 52  ? 27.209 0.791   27.812 1.00 23.59 ? 52  GLN B O   1 
ATOM   2177 C CB  . GLN B 1 52  ? 24.957 0.960   25.971 1.00 20.17 ? 52  GLN B CB  1 
ATOM   2178 C CG  . GLN B 1 52  ? 24.316 1.078   24.619 1.00 25.78 ? 52  GLN B CG  1 
ATOM   2179 C CD  . GLN B 1 52  ? 23.472 2.316   24.548 1.00 26.98 ? 52  GLN B CD  1 
ATOM   2180 O OE1 . GLN B 1 52  ? 22.326 2.273   24.099 1.00 29.40 ? 52  GLN B OE1 1 
ATOM   2181 N NE2 . GLN B 1 52  ? 24.019 3.435   25.035 1.00 25.74 ? 52  GLN B NE2 1 
ATOM   2182 N N   . HIS B 1 53  ? 26.248 -1.179  28.386 1.00 18.44 ? 53  HIS B N   1 
ATOM   2183 C CA  . HIS B 1 53  ? 26.769 -1.235  29.759 1.00 18.49 ? 53  HIS B CA  1 
ATOM   2184 C C   . HIS B 1 53  ? 26.620 0.092   30.516 1.00 17.98 ? 53  HIS B C   1 
ATOM   2185 O O   . HIS B 1 53  ? 27.555 0.609   31.125 1.00 17.99 ? 53  HIS B O   1 
ATOM   2186 C CB  . HIS B 1 53  ? 28.207 -1.798  29.819 1.00 19.34 ? 53  HIS B CB  1 
ATOM   2187 C CG  . HIS B 1 53  ? 29.169 -1.125  28.895 1.00 20.15 ? 53  HIS B CG  1 
ATOM   2188 N ND1 . HIS B 1 53  ? 29.885 0.002   29.259 1.00 19.89 ? 53  HIS B ND1 1 
ATOM   2189 C CD2 . HIS B 1 53  ? 29.569 -1.426  27.639 1.00 21.84 ? 53  HIS B CD2 1 
ATOM   2190 C CE1 . HIS B 1 53  ? 30.661 0.371   28.258 1.00 20.36 ? 53  HIS B CE1 1 
ATOM   2191 N NE2 . HIS B 1 53  ? 30.486 -0.477  27.258 1.00 21.36 ? 53  HIS B NE2 1 
ATOM   2192 N N   . THR B 1 54  ? 25.411 0.640   30.476 1.00 17.63 ? 54  THR B N   1 
ATOM   2193 C CA  . THR B 1 54  ? 25.121 1.871   31.193 1.00 17.27 ? 54  THR B CA  1 
ATOM   2194 C C   . THR B 1 54  ? 23.999 1.671   32.204 1.00 17.14 ? 54  THR B C   1 
ATOM   2195 O O   . THR B 1 54  ? 23.183 0.751   32.066 1.00 17.28 ? 54  THR B O   1 
ATOM   2196 C CB  . THR B 1 54  ? 24.718 2.996   30.233 1.00 17.13 ? 54  THR B CB  1 
ATOM   2197 O OG1 . THR B 1 54  ? 23.677 2.522   29.364 1.00 19.37 ? 54  THR B OG1 1 
ATOM   2198 C CG2 . THR B 1 54  ? 25.917 3.427   29.391 1.00 20.49 ? 54  THR B CG2 1 
ATOM   2199 N N   . VAL B 1 55  ? 23.969 2.553   33.204 1.00 16.95 ? 55  VAL B N   1 
ATOM   2200 C CA  . VAL B 1 55  ? 22.849 2.665   34.127 1.00 16.82 ? 55  VAL B CA  1 
ATOM   2201 C C   . VAL B 1 55  ? 22.384 4.121   34.041 1.00 16.55 ? 55  VAL B C   1 
ATOM   2202 O O   . VAL B 1 55  ? 23.200 5.015   33.813 1.00 16.58 ? 55  VAL B O   1 
ATOM   2203 C CB  . VAL B 1 55  ? 23.254 2.272   35.575 1.00 17.08 ? 55  VAL B CB  1 
ATOM   2204 C CG1 . VAL B 1 55  ? 23.707 0.817   35.610 1.00 17.62 ? 55  VAL B CG1 1 
ATOM   2205 C CG2 . VAL B 1 55  ? 24.365 3.171   36.090 1.00 17.09 ? 55  VAL B CG2 1 
ATOM   2206 N N   . PRO B 1 56  ? 21.075 4.385   34.232 1.00 16.42 ? 56  PRO B N   1 
ATOM   2207 C CA  . PRO B 1 56  ? 20.001 3.454   34.605 1.00 7.73  ? 56  PRO B CA  1 
ATOM   2208 C C   . PRO B 1 56  ? 19.492 2.633   33.450 1.00 8.38  ? 56  PRO B C   1 
ATOM   2209 O O   . PRO B 1 56  ? 19.591 3.023   32.281 1.00 8.51  ? 56  PRO B O   1 
ATOM   2210 C CB  . PRO B 1 56  ? 18.883 4.384   35.040 1.00 7.86  ? 56  PRO B CB  1 
ATOM   2211 C CG  . PRO B 1 56  ? 19.104 5.609   34.217 1.00 5.39  ? 56  PRO B CG  1 
ATOM   2212 C CD  . PRO B 1 56  ? 20.594 5.781   34.210 1.00 6.09  ? 56  PRO B CD  1 
ATOM   2213 N N   . LEU B 1 57  ? 18.891 1.499   33.808 1.00 10.36 ? 57  LEU B N   1 
ATOM   2214 C CA  . LEU B 1 57  ? 18.100 0.686   32.893 1.00 8.51  ? 57  LEU B CA  1 
ATOM   2215 C C   . LEU B 1 57  ? 16.786 0.391   33.605 1.00 8.68  ? 57  LEU B C   1 
ATOM   2216 O O   . LEU B 1 57  ? 16.772 0.171   34.818 1.00 9.12  ? 57  LEU B O   1 
ATOM   2217 C CB  . LEU B 1 57  ? 18.826 -0.634  32.612 1.00 10.98 ? 57  LEU B CB  1 
ATOM   2218 C CG  . LEU B 1 57  ? 18.052 -1.734  31.873 1.00 13.62 ? 57  LEU B CG  1 
ATOM   2219 C CD1 . LEU B 1 57  ? 17.720 -1.238  30.475 1.00 11.47 ? 57  LEU B CD1 1 
ATOM   2220 C CD2 . LEU B 1 57  ? 18.879 -3.022  31.817 1.00 12.93 ? 57  LEU B CD2 1 
ATOM   2221 N N   . LEU B 1 58  ? 15.687 0.414   32.861 1.00 9.54  ? 58  LEU B N   1 
ATOM   2222 C CA  . LEU B 1 58  ? 14.374 0.062   33.397 1.00 8.88  ? 58  LEU B CA  1 
ATOM   2223 C C   . LEU B 1 58  ? 13.824 -1.150  32.670 1.00 9.70  ? 58  LEU B C   1 
ATOM   2224 O O   . LEU B 1 58  ? 13.737 -1.143  31.441 1.00 11.10 ? 58  LEU B O   1 
ATOM   2225 C CB  . LEU B 1 58  ? 13.360 1.208   33.189 1.00 10.20 ? 58  LEU B CB  1 
ATOM   2226 C CG  . LEU B 1 58  ? 12.001 1.031   33.886 1.00 11.10 ? 58  LEU B CG  1 
ATOM   2227 C CD1 . LEU B 1 58  ? 12.110 1.554   35.312 1.00 11.96 ? 58  LEU B CD1 1 
ATOM   2228 C CD2 . LEU B 1 58  ? 10.833 1.702   33.147 1.00 12.50 ? 58  LEU B CD2 1 
ATOM   2229 N N   . GLU B 1 59  ? 13.472 -2.184  33.418 1.00 11.18 ? 59  GLU B N   1 
ATOM   2230 C CA  . GLU B 1 59  ? 12.707 -3.280  32.877 1.00 13.85 ? 59  GLU B CA  1 
ATOM   2231 C C   . GLU B 1 59  ? 11.272 -3.114  33.322 1.00 14.59 ? 59  GLU B C   1 
ATOM   2232 O O   . GLU B 1 59  ? 10.992 -3.067  34.518 1.00 16.27 ? 59  GLU B O   1 
ATOM   2233 C CB  . GLU B 1 59  ? 13.287 -4.588  33.384 1.00 18.69 ? 59  GLU B CB  1 
ATOM   2234 C CG  . GLU B 1 59  ? 14.657 -4.901  32.809 1.00 22.09 ? 59  GLU B CG  1 
ATOM   2235 C CD  . GLU B 1 59  ? 15.177 -6.267  33.259 1.00 25.49 ? 59  GLU B CD  1 
ATOM   2236 O OE1 . GLU B 1 59  ? 14.771 -6.733  34.351 1.00 22.68 ? 59  GLU B OE1 1 
ATOM   2237 O OE2 . GLU B 1 59  ? 15.996 -6.872  32.525 1.00 28.72 ? 59  GLU B OE2 1 
ATOM   2238 N N   . ASP B 1 60  ? 10.371 -2.995  32.350 1.00 12.06 ? 60  ASP B N   1 
ATOM   2239 C CA  . ASP B 1 60  ? 8.951  -2.785  32.617 1.00 12.43 ? 60  ASP B CA  1 
ATOM   2240 C C   . ASP B 1 60  ? 8.151  -3.906  31.928 1.00 14.15 ? 60  ASP B C   1 
ATOM   2241 O O   . ASP B 1 60  ? 7.844  -3.832  30.737 1.00 13.38 ? 60  ASP B O   1 
ATOM   2242 C CB  . ASP B 1 60  ? 8.547  -1.390  32.118 1.00 13.87 ? 60  ASP B CB  1 
ATOM   2243 C CG  . ASP B 1 60  ? 7.126  -1.031  32.467 1.00 12.49 ? 60  ASP B CG  1 
ATOM   2244 O OD1 . ASP B 1 60  ? 6.811  -0.970  33.661 1.00 16.59 ? 60  ASP B OD1 1 
ATOM   2245 O OD2 . ASP B 1 60  ? 6.309  -0.816  31.547 1.00 15.71 ? 60  ASP B OD2 1 
ATOM   2246 N N   . GLY B 1 61  ? 7.822  -4.963  32.665 1.00 17.45 ? 61  GLY B N   1 
ATOM   2247 C CA  . GLY B 1 61  ? 7.298  -6.155  32.025 1.00 20.86 ? 61  GLY B CA  1 
ATOM   2248 C C   . GLY B 1 61  ? 8.329  -6.681  31.031 1.00 19.83 ? 61  GLY B C   1 
ATOM   2249 O O   . GLY B 1 61  ? 9.486  -6.953  31.396 1.00 20.29 ? 61  GLY B O   1 
ATOM   2250 N N   . ASP B 1 62  ? 7.923  -6.783  29.767 1.00 20.82 ? 62  ASP B N   1 
ATOM   2251 C CA  . ASP B 1 62  ? 8.792  -7.322  28.728 1.00 21.52 ? 62  ASP B CA  1 
ATOM   2252 C C   . ASP B 1 62  ? 9.633  -6.222  28.085 1.00 19.45 ? 62  ASP B C   1 
ATOM   2253 O O   . ASP B 1 62  ? 10.492 -6.487  27.252 1.00 19.74 ? 62  ASP B O   1 
ATOM   2254 C CB  . ASP B 1 62  ? 7.956  -8.033  27.658 1.00 22.94 ? 62  ASP B CB  1 
ATOM   2255 C CG  . ASP B 1 62  ? 7.268  -9.275  28.180 1.00 26.59 ? 62  ASP B CG  1 
ATOM   2256 O OD1 . ASP B 1 62  ? 7.841  -9.974  29.047 1.00 27.70 ? 62  ASP B OD1 1 
ATOM   2257 O OD2 . ASP B 1 62  ? 6.138  -9.549  27.719 1.00 30.23 ? 62  ASP B OD2 1 
ATOM   2258 N N   . ALA B 1 63  ? 9.363  -4.982  28.459 1.00 17.61 ? 63  ALA B N   1 
ATOM   2259 C CA  . ALA B 1 63  ? 10.098 -3.847  27.884 1.00 16.21 ? 63  ALA B CA  1 
ATOM   2260 C C   . ALA B 1 63  ? 11.434 -3.569  28.593 1.00 17.20 ? 63  ALA B C   1 
ATOM   2261 O O   . ALA B 1 63  ? 11.534 -3.682  29.812 1.00 17.89 ? 63  ALA B O   1 
ATOM   2262 C CB  . ALA B 1 63  ? 9.236  -2.596  27.884 1.00 17.16 ? 63  ALA B CB  1 
ATOM   2263 N N   . ASN B 1 64  ? 12.444 -3.171  27.828 1.00 14.99 ? 64  ASN B N   1 
ATOM   2264 C CA  . ASN B 1 64  ? 13.754 -2.843  28.372 1.00 17.70 ? 64  ASN B CA  1 
ATOM   2265 C C   . ASN B 1 64  ? 14.125 -1.473  27.847 1.00 13.54 ? 64  ASN B C   1 
ATOM   2266 O O   . ASN B 1 64  ? 14.341 -1.336  26.646 1.00 16.95 ? 64  ASN B O   1 
ATOM   2267 C CB  . ASN B 1 64  ? 14.760 -3.841  27.825 1.00 23.00 ? 64  ASN B CB  1 
ATOM   2268 C CG  . ASN B 1 64  ? 15.390 -4.690  28.902 1.00 29.32 ? 64  ASN B CG  1 
ATOM   2269 O OD1 . ASN B 1 64  ? 14.720 -5.499  29.563 1.00 30.38 ? 64  ASN B OD1 1 
ATOM   2270 N ND2 . ASN B 1 64  ? 16.703 -4.549  29.057 1.00 32.25 ? 64  ASN B ND2 1 
ATOM   2271 N N   . ILE B 1 65  ? 14.207 -0.459  28.714 1.00 12.92 ? 65  ILE B N   1 
ATOM   2272 C CA  . ILE B 1 65  ? 14.506 0.893   28.254 1.00 13.09 ? 65  ILE B CA  1 
ATOM   2273 C C   . ILE B 1 65  ? 15.742 1.395   28.965 1.00 9.88  ? 65  ILE B C   1 
ATOM   2274 O O   . ILE B 1 65  ? 15.793 1.393   30.200 1.00 9.71  ? 65  ILE B O   1 
ATOM   2275 C CB  . ILE B 1 65  ? 13.330 1.852   28.538 1.00 14.05 ? 65  ILE B CB  1 
ATOM   2276 C CG1 . ILE B 1 65  ? 12.045 1.370   27.860 1.00 17.36 ? 65  ILE B CG1 1 
ATOM   2277 C CG2 . ILE B 1 65  ? 13.632 3.256   28.029 1.00 10.94 ? 65  ILE B CG2 1 
ATOM   2278 C CD1 . ILE B 1 65  ? 10.954 0.960   28.826 1.00 18.86 ? 65  ILE B CD1 1 
ATOM   2279 N N   . ALA B 1 66  ? 16.745 1.795   28.197 1.00 10.41 ? 66  ALA B N   1 
ATOM   2280 C CA  . ALA B 1 66  ? 17.906 2.480   28.738 1.00 10.66 ? 66  ALA B CA  1 
ATOM   2281 C C   . ALA B 1 66  ? 17.807 3.969   28.419 1.00 7.92  ? 66  ALA B C   1 
ATOM   2282 O O   . ALA B 1 66  ? 16.954 4.391   27.613 1.00 8.49  ? 66  ALA B O   1 
ATOM   2283 C CB  . ALA B 1 66  ? 19.207 1.870   28.200 1.00 11.46 ? 66  ALA B CB  1 
ATOM   2284 N N   . ASP B 1 67  ? 18.659 4.745   29.084 1.00 6.10  ? 67  ASP B N   1 
ATOM   2285 C CA  . ASP B 1 67  ? 18.728 6.225   29.042 1.00 8.04  ? 67  ASP B CA  1 
ATOM   2286 C C   . ASP B 1 67  ? 17.711 6.891   29.961 1.00 6.33  ? 67  ASP B C   1 
ATOM   2287 O O   . ASP B 1 67  ? 16.516 6.769   29.754 1.00 6.01  ? 67  ASP B O   1 
ATOM   2288 C CB  . ASP B 1 67  ? 18.611 6.846   27.648 1.00 8.36  ? 67  ASP B CB  1 
ATOM   2289 C CG  . ASP B 1 67  ? 19.106 8.281   27.649 1.00 5.99  ? 67  ASP B CG  1 
ATOM   2290 O OD1 . ASP B 1 67  ? 18.331 9.185   28.049 1.00 6.40  ? 67  ASP B OD1 1 
ATOM   2291 O OD2 . ASP B 1 67  ? 20.277 8.505   27.283 1.00 6.87  ? 67  ASP B OD2 1 
ATOM   2292 N N   . SER B 1 68  ? 18.210 7.628   30.949 1.00 5.60  ? 68  SER B N   1 
ATOM   2293 C CA  . SER B 1 68  ? 17.353 8.226   31.963 1.00 4.89  ? 68  SER B CA  1 
ATOM   2294 C C   . SER B 1 68  ? 16.255 9.076   31.344 1.00 5.35  ? 68  SER B C   1 
ATOM   2295 O O   . SER B 1 68  ? 15.135 9.112   31.848 1.00 4.55  ? 68  SER B O   1 
ATOM   2296 C CB  . SER B 1 68  ? 18.173 9.073   32.927 1.00 4.50  ? 68  SER B CB  1 
ATOM   2297 O OG  . SER B 1 68  ? 18.730 10.208  32.289 1.00 4.65  ? 68  SER B OG  1 
ATOM   2298 N N   . HIS B 1 69  ? 16.550 9.732   30.231 1.00 3.27  ? 69  HIS B N   1 
ATOM   2299 C CA  . HIS B 1 69  ? 15.557 10.636  29.667 1.00 4.59  ? 69  HIS B CA  1 
ATOM   2300 C C   . HIS B 1 69  ? 14.493 9.852   28.945 1.00 3.57  ? 69  HIS B C   1 
ATOM   2301 O O   . HIS B 1 69  ? 13.282 10.188  29.037 1.00 3.32  ? 69  HIS B O   1 
ATOM   2302 C CB  . HIS B 1 69  ? 16.208 11.626  28.713 1.00 4.45  ? 69  HIS B CB  1 
ATOM   2303 C CG  . HIS B 1 69  ? 17.484 12.210  29.258 1.00 4.19  ? 69  HIS B CG  1 
ATOM   2304 N ND1 . HIS B 1 69  ? 18.706 11.606  29.055 1.00 5.02  ? 69  HIS B ND1 1 
ATOM   2305 C CD2 . HIS B 1 69  ? 17.708 13.284  30.040 1.00 4.62  ? 69  HIS B CD2 1 
ATOM   2306 C CE1 . HIS B 1 69  ? 19.640 12.301  29.688 1.00 6.74  ? 69  HIS B CE1 1 
ATOM   2307 N NE2 . HIS B 1 69  ? 19.074 13.341  30.262 1.00 4.54  ? 69  HIS B NE2 1 
ATOM   2308 N N   . ALA B 1 70  ? 14.888 8.825   28.213 1.00 4.07  ? 70  ALA B N   1 
ATOM   2309 C CA  . ALA B 1 70  ? 13.902 7.953   27.596 1.00 6.06  ? 70  ALA B CA  1 
ATOM   2310 C C   . ALA B 1 70  ? 13.005 7.260   28.643 1.00 4.54  ? 70  ALA B C   1 
ATOM   2311 O O   . ALA B 1 70  ? 11.791 7.105   28.457 1.00 5.76  ? 70  ALA B O   1 
ATOM   2312 C CB  . ALA B 1 70  ? 14.594 6.927   26.713 1.00 5.03  ? 70  ALA B CB  1 
ATOM   2313 N N   . ILE B 1 71  ? 13.635 6.810   29.723 1.00 5.36  ? 71  ILE B N   1 
ATOM   2314 C CA  . ILE B 1 71  ? 12.977 6.130   30.828 1.00 6.71  ? 71  ILE B CA  1 
ATOM   2315 C C   . ILE B 1 71  ? 11.981 7.062   31.495 1.00 4.94  ? 71  ILE B C   1 
ATOM   2316 O O   . ILE B 1 71  ? 10.813 6.700   31.723 1.00 5.46  ? 71  ILE B O   1 
ATOM   2317 C CB  . ILE B 1 71  ? 14.006 5.658   31.871 1.00 6.92  ? 71  ILE B CB  1 
ATOM   2318 C CG1 . ILE B 1 71  ? 14.875 4.543   31.280 1.00 7.69  ? 71  ILE B CG1 1 
ATOM   2319 C CG2 . ILE B 1 71  ? 13.319 5.133   33.132 1.00 5.85  ? 71  ILE B CG2 1 
ATOM   2320 C CD1 . ILE B 1 71  ? 16.004 4.103   32.189 1.00 7.79  ? 71  ILE B CD1 1 
ATOM   2321 N N   . MET B 1 72  ? 12.390 8.300   31.758 1.00 4.37  ? 72  MET B N   1 
ATOM   2322 C CA  . MET B 1 72  ? 11.500 9.230   32.451 1.00 4.50  ? 72  MET B CA  1 
ATOM   2323 C C   . MET B 1 72  ? 10.293 9.603   31.618 1.00 5.04  ? 72  MET B C   1 
ATOM   2324 O O   . MET B 1 72  ? 9.170  9.612   32.132 1.00 5.27  ? 72  MET B O   1 
ATOM   2325 C CB  . MET B 1 72  ? 12.239 10.496  32.863 1.00 5.37  ? 72  MET B CB  1 
ATOM   2326 C CG  . MET B 1 72  ? 13.130 10.307  34.052 1.00 4.05  ? 72  MET B CG  1 
ATOM   2327 S SD  . MET B 1 72  ? 13.927 11.860  34.567 1.00 5.64  ? 72  MET B SD  1 
ATOM   2328 C CE  . MET B 1 72  ? 15.063 12.204  33.221 1.00 7.49  ? 72  MET B CE  1 
ATOM   2329 N N   . ALA B 1 73  ? 10.495 9.855   30.325 1.00 4.93  ? 73  ALA B N   1 
ATOM   2330 C CA  . ALA B 1 73  ? 9.385  10.118  29.426 1.00 4.48  ? 73  ALA B CA  1 
ATOM   2331 C C   . ALA B 1 73  ? 8.431  8.928   29.371 1.00 5.73  ? 73  ALA B C   1 
ATOM   2332 O O   . ALA B 1 73  ? 7.223  9.080   29.436 1.00 6.64  ? 73  ALA B O   1 
ATOM   2333 C CB  . ALA B 1 73  ? 9.843  10.449  28.073 1.00 5.23  ? 73  ALA B CB  1 
ATOM   2334 N N   . TYR B 1 74  ? 8.987  7.728   29.230 1.00 5.53  ? 74  TYR B N   1 
ATOM   2335 C CA  . TYR B 1 74  ? 8.179  6.506   29.209 1.00 7.37  ? 74  TYR B CA  1 
ATOM   2336 C C   . TYR B 1 74  ? 7.355  6.312   30.490 1.00 8.27  ? 74  TYR B C   1 
ATOM   2337 O O   . TYR B 1 74  ? 6.151  6.064   30.433 1.00 7.77  ? 74  TYR B O   1 
ATOM   2338 C CB  . TYR B 1 74  ? 9.062  5.281   28.981 1.00 6.63  ? 74  TYR B CB  1 
ATOM   2339 C CG  . TYR B 1 74  ? 8.383  3.933   29.072 1.00 7.93  ? 74  TYR B CG  1 
ATOM   2340 C CD1 . TYR B 1 74  ? 7.804  3.362   27.952 1.00 8.33  ? 74  TYR B CD1 1 
ATOM   2341 C CD2 . TYR B 1 74  ? 8.385  3.209   30.250 1.00 10.13 ? 74  TYR B CD2 1 
ATOM   2342 C CE1 . TYR B 1 74  ? 7.207  2.100   28.007 1.00 9.40  ? 74  TYR B CE1 1 
ATOM   2343 C CE2 . TYR B 1 74  ? 7.806  1.962   30.310 1.00 9.09  ? 74  TYR B CE2 1 
ATOM   2344 C CZ  . TYR B 1 74  ? 7.208  1.433   29.181 1.00 10.61 ? 74  TYR B CZ  1 
ATOM   2345 O OH  . TYR B 1 74  ? 6.644  0.189   29.205 1.00 10.92 ? 74  TYR B OH  1 
ATOM   2346 N N   . LEU B 1 75  ? 7.999  6.466   31.647 1.00 6.70  ? 75  LEU B N   1 
ATOM   2347 C CA  . LEU B 1 75  ? 7.316  6.372   32.946 1.00 7.35  ? 75  LEU B CA  1 
ATOM   2348 C C   . LEU B 1 75  ? 6.134  7.328   33.076 1.00 7.68  ? 75  LEU B C   1 
ATOM   2349 O O   . LEU B 1 75  ? 5.051  6.935   33.506 1.00 8.66  ? 75  LEU B O   1 
ATOM   2350 C CB  . LEU B 1 75  ? 8.295  6.599   34.112 1.00 7.64  ? 75  LEU B CB  1 
ATOM   2351 C CG  . LEU B 1 75  ? 9.195  5.383   34.313 1.00 7.26  ? 75  LEU B CG  1 
ATOM   2352 C CD1 . LEU B 1 75  ? 10.293 5.689   35.321 1.00 10.72 ? 75  LEU B CD1 1 
ATOM   2353 C CD2 . LEU B 1 75  ? 8.419  4.144   34.734 1.00 10.33 ? 75  LEU B CD2 1 
ATOM   2354 N N   . VAL B 1 76  ? 6.325  8.587   32.726 1.00 7.01  ? 76  VAL B N   1 
ATOM   2355 C CA  . VAL B 1 76  ? 5.242  9.557   32.872 1.00 7.44  ? 76  VAL B CA  1 
ATOM   2356 C C   . VAL B 1 76  ? 4.120  9.226   31.887 1.00 8.12  ? 76  VAL B C   1 
ATOM   2357 O O   . VAL B 1 76  ? 2.949  9.245   32.241 1.00 9.41  ? 76  VAL B O   1 
ATOM   2358 C CB  . VAL B 1 76  ? 5.758  11.046  32.741 1.00 7.65  ? 76  VAL B CB  1 
ATOM   2359 C CG1 . VAL B 1 76  ? 4.628  12.015  32.884 1.00 8.90  ? 76  VAL B CG1 1 
ATOM   2360 C CG2 . VAL B 1 76  ? 6.753  11.340  33.825 1.00 7.68  ? 76  VAL B CG2 1 
ATOM   2361 N N   . SER B 1 77  ? 4.492  8.913   30.647 1.00 7.75  ? 77  SER B N   1 
ATOM   2362 C CA  . SER B 1 77  ? 3.503  8.678   29.596 1.00 8.49  ? 77  SER B CA  1 
ATOM   2363 C C   . SER B 1 77  ? 2.656  7.462   29.904 1.00 11.81 ? 77  SER B C   1 
ATOM   2364 O O   . SER B 1 77  ? 1.483  7.459   29.635 1.00 10.64 ? 77  SER B O   1 
ATOM   2365 C CB  . SER B 1 77  ? 4.178  8.502   28.236 1.00 9.18  ? 77  SER B CB  1 
ATOM   2366 O OG  . SER B 1 77  ? 4.777  9.709   27.821 1.00 9.66  ? 77  SER B OG  1 
ATOM   2367 N N   . LYS B 1 78  ? 3.249  6.436   30.487 1.00 9.73  ? 78  LYS B N   1 
ATOM   2368 C CA  . LYS B 1 78  ? 2.506  5.235   30.765 1.00 10.81 ? 78  LYS B CA  1 
ATOM   2369 C C   . LYS B 1 78  ? 1.748  5.278   32.102 1.00 13.01 ? 78  LYS B C   1 
ATOM   2370 O O   . LYS B 1 78  ? 0.583  4.852   32.194 1.00 12.94 ? 78  LYS B O   1 
ATOM   2371 C CB  . LYS B 1 78  ? 3.457  4.049   30.748 1.00 10.64 ? 78  LYS B CB  1 
ATOM   2372 C CG  . LYS B 1 78  ? 2.709  2.736   30.968 1.00 12.78 ? 78  LYS B CG  1 
ATOM   2373 C CD  . LYS B 1 78  ? 3.603  1.520   30.768 1.00 12.20 ? 78  LYS B CD  1 
ATOM   2374 C CE  . LYS B 1 78  ? 2.824  0.225   30.983 1.00 14.73 ? 78  LYS B CE  1 
ATOM   2375 N NZ  . LYS B 1 78  ? 3.650  -0.988  30.738 1.00 14.79 ? 78  LYS B NZ  1 
ATOM   2376 N N   . TYR B 1 79  ? 2.409  5.788   33.137 1.00 12.11 ? 79  TYR B N   1 
ATOM   2377 C CA  . TYR B 1 79  ? 1.932  5.658   34.511 1.00 12.89 ? 79  TYR B CA  1 
ATOM   2378 C C   . TYR B 1 79  ? 1.542  6.979   35.148 1.00 12.05 ? 79  TYR B C   1 
ATOM   2379 O O   . TYR B 1 79  ? 1.013  6.991   36.273 1.00 17.15 ? 79  TYR B O   1 
ATOM   2380 C CB  . TYR B 1 79  ? 2.994  4.991   35.396 1.00 15.13 ? 79  TYR B CB  1 
ATOM   2381 C CG  . TYR B 1 79  ? 3.343  3.572   35.037 1.00 13.95 ? 79  TYR B CG  1 
ATOM   2382 C CD1 . TYR B 1 79  ? 2.450  2.554   35.264 1.00 16.71 ? 79  TYR B CD1 1 
ATOM   2383 C CD2 . TYR B 1 79  ? 4.568  3.258   34.501 1.00 11.02 ? 79  TYR B CD2 1 
ATOM   2384 C CE1 . TYR B 1 79  ? 2.771  1.257   34.954 1.00 17.57 ? 79  TYR B CE1 1 
ATOM   2385 C CE2 . TYR B 1 79  ? 4.904  1.969   34.177 1.00 12.05 ? 79  TYR B CE2 1 
ATOM   2386 C CZ  . TYR B 1 79  ? 3.990  0.966   34.399 1.00 15.53 ? 79  TYR B CZ  1 
ATOM   2387 O OH  . TYR B 1 79  ? 4.291  -0.354  34.099 1.00 19.47 ? 79  TYR B OH  1 
ATOM   2388 N N   . GLY B 1 80  ? 1.793  8.092   34.470 1.00 12.13 ? 80  GLY B N   1 
ATOM   2389 C CA  . GLY B 1 80  ? 1.490  9.399   35.035 1.00 13.69 ? 80  GLY B CA  1 
ATOM   2390 C C   . GLY B 1 80  ? -0.006 9.646   35.089 1.00 18.89 ? 80  GLY B C   1 
ATOM   2391 O O   . GLY B 1 80  ? -0.686 9.502   34.080 1.00 17.75 ? 80  GLY B O   1 
ATOM   2392 N N   . LYS B 1 81  ? -0.510 10.025  36.258 1.00 24.62 ? 81  LYS B N   1 
ATOM   2393 C CA  . LYS B 1 81  ? -1.946 10.224  36.432 1.00 31.13 ? 81  LYS B CA  1 
ATOM   2394 C C   . LYS B 1 81  ? -2.342 11.675  36.156 1.00 32.20 ? 81  LYS B C   1 
ATOM   2395 O O   . LYS B 1 81  ? -3.495 12.070  36.303 1.00 37.63 ? 81  LYS B O   1 
ATOM   2396 C CB  . LYS B 1 81  ? -2.399 9.761   37.818 1.00 34.38 ? 81  LYS B CB  1 
ATOM   2397 C CG  . LYS B 1 81  ? -2.558 8.243   37.920 1.00 35.97 ? 81  LYS B CG  1 
ATOM   2398 C CD  . LYS B 1 81  ? -3.534 7.733   36.861 1.00 37.62 ? 81  LYS B CD  1 
ATOM   2399 C CE  . LYS B 1 81  ? -4.024 6.315   37.165 1.00 40.99 ? 81  LYS B CE  1 
ATOM   2400 N NZ  . LYS B 1 81  ? -3.026 5.260   36.786 1.00 41.18 ? 81  LYS B NZ  1 
ATOM   2401 N N   . ASP B 1 82  ? -1.367 12.477  35.769 1.00 25.77 ? 82  ASP B N   1 
ATOM   2402 C CA  . ASP B 1 82  ? -1.651 13.678  35.007 1.00 25.78 ? 82  ASP B CA  1 
ATOM   2403 C C   . ASP B 1 82  ? -0.431 13.809  34.124 1.00 22.19 ? 82  ASP B C   1 
ATOM   2404 O O   . ASP B 1 82  ? 0.452  12.934  34.176 1.00 19.28 ? 82  ASP B O   1 
ATOM   2405 C CB  . ASP B 1 82  ? -1.915 14.913  35.889 1.00 28.80 ? 82  ASP B CB  1 
ATOM   2406 C CG  . ASP B 1 82  ? -0.864 15.123  36.978 1.00 31.87 ? 82  ASP B CG  1 
ATOM   2407 O OD1 . ASP B 1 82  ? 0.320  15.323  36.632 1.00 32.33 ? 82  ASP B OD1 1 
ATOM   2408 O OD2 . ASP B 1 82  ? -1.240 15.138  38.182 1.00 33.04 ? 82  ASP B OD2 1 
ATOM   2409 N N   . ASP B 1 83  ? -0.361 14.847  33.300 1.00 18.46 ? 83  ASP B N   1 
ATOM   2410 C CA  . ASP B 1 83  ? 0.794  14.955  32.416 1.00 14.92 ? 83  ASP B CA  1 
ATOM   2411 C C   . ASP B 1 83  ? 1.605  16.205  32.707 1.00 12.69 ? 83  ASP B C   1 
ATOM   2412 O O   . ASP B 1 83  ? 2.358  16.662  31.864 1.00 9.15  ? 83  ASP B O   1 
ATOM   2413 C CB  . ASP B 1 83  ? 0.383  14.952  30.938 1.00 16.33 ? 83  ASP B CB  1 
ATOM   2414 C CG  . ASP B 1 83  ? -0.295 16.260  30.512 1.00 18.37 ? 83  ASP B CG  1 
ATOM   2415 O OD1 . ASP B 1 83  ? -0.720 17.045  31.394 1.00 22.55 ? 83  ASP B OD1 1 
ATOM   2416 O OD2 . ASP B 1 83  ? -0.423 16.498  29.295 1.00 15.77 ? 83  ASP B OD2 1 
ATOM   2417 N N   A SER B 1 84  ? 1.437  16.770  33.902 0.53 15.90 ? 84  SER B N   1 
ATOM   2418 N N   B SER B 1 84  ? 1.453  16.769  33.900 0.47 15.82 ? 84  SER B N   1 
ATOM   2419 C CA  A SER B 1 84  ? 2.168  17.991  34.252 0.53 14.61 ? 84  SER B CA  1 
ATOM   2420 C CA  B SER B 1 84  ? 2.182  18.001  34.192 0.47 14.31 ? 84  SER B CA  1 
ATOM   2421 C C   A SER B 1 84  ? 3.668  17.769  34.093 0.53 10.75 ? 84  SER B C   1 
ATOM   2422 C C   B SER B 1 84  ? 3.685  17.769  34.079 0.47 10.81 ? 84  SER B C   1 
ATOM   2423 O O   A SER B 1 84  ? 4.391  18.649  33.599 0.53 11.07 ? 84  SER B O   1 
ATOM   2424 O O   B SER B 1 84  ? 4.428  18.642  33.604 0.47 10.98 ? 84  SER B O   1 
ATOM   2425 C CB  A SER B 1 84  ? 1.882  18.396  35.694 0.53 16.53 ? 84  SER B CB  1 
ATOM   2426 C CB  B SER B 1 84  ? 1.856  18.519  35.583 0.47 16.54 ? 84  SER B CB  1 
ATOM   2427 O OG  A SER B 1 84  ? 2.112  17.304  36.565 0.53 15.98 ? 84  SER B OG  1 
ATOM   2428 O OG  B SER B 1 84  ? 2.248  19.868  35.681 0.47 17.06 ? 84  SER B OG  1 
ATOM   2429 N N   . LEU B 1 85  ? 4.121  16.577  34.485 1.00 8.60  ? 85  LEU B N   1 
ATOM   2430 C CA  . LEU B 1 85  ? 5.540  16.235  34.482 1.00 9.17  ? 85  LEU B CA  1 
ATOM   2431 C C   . LEU B 1 85  ? 6.092  16.072  33.089 1.00 6.63  ? 85  LEU B C   1 
ATOM   2432 O O   . LEU B 1 85  ? 7.324  16.131  32.903 1.00 7.98  ? 85  LEU B O   1 
ATOM   2433 C CB  . LEU B 1 85  ? 5.771  14.940  35.267 1.00 11.13 ? 85  LEU B CB  1 
ATOM   2434 C CG  . LEU B 1 85  ? 5.673  14.973  36.785 1.00 11.81 ? 85  LEU B CG  1 
ATOM   2435 C CD1 . LEU B 1 85  ? 5.932  13.557  37.301 1.00 13.29 ? 85  LEU B CD1 1 
ATOM   2436 C CD2 . LEU B 1 85  ? 6.668  15.982  37.349 1.00 11.57 ? 85  LEU B CD2 1 
ATOM   2437 N N   . TYR B 1 86  ? 5.213  15.810  32.117 1.00 7.65  ? 86  TYR B N   1 
ATOM   2438 C CA  . TYR B 1 86  ? 5.656  15.669  30.732 1.00 6.13  ? 86  TYR B CA  1 
ATOM   2439 C C   . TYR B 1 86  ? 4.452  15.947  29.841 1.00 7.59  ? 86  TYR B C   1 
ATOM   2440 O O   . TYR B 1 86  ? 3.765  15.039  29.418 1.00 7.12  ? 86  TYR B O   1 
ATOM   2441 C CB  . TYR B 1 86  ? 6.231  14.266  30.524 1.00 6.97  ? 86  TYR B CB  1 
ATOM   2442 C CG  . TYR B 1 86  ? 6.964  14.058  29.218 1.00 7.07  ? 86  TYR B CG  1 
ATOM   2443 C CD1 . TYR B 1 86  ? 7.917  14.982  28.771 1.00 6.11  ? 86  TYR B CD1 1 
ATOM   2444 C CD2 . TYR B 1 86  ? 6.712  12.941  28.433 1.00 5.58  ? 86  TYR B CD2 1 
ATOM   2445 C CE1 . TYR B 1 86  ? 8.595  14.787  27.556 1.00 6.98  ? 86  TYR B CE1 1 
ATOM   2446 C CE2 . TYR B 1 86  ? 7.363  12.744  27.241 1.00 5.37  ? 86  TYR B CE2 1 
ATOM   2447 C CZ  . TYR B 1 86  ? 8.340  13.628  26.820 1.00 5.00  ? 86  TYR B CZ  1 
ATOM   2448 O OH  . TYR B 1 86  ? 8.938  13.383  25.604 1.00 4.96  ? 86  TYR B OH  1 
ATOM   2449 N N   . PRO B 1 87  ? 4.157  17.226  29.628 1.00 7.78  ? 87  PRO B N   1 
ATOM   2450 C CA  . PRO B 1 87  ? 2.897  17.616  28.995 1.00 7.38  ? 87  PRO B CA  1 
ATOM   2451 C C   . PRO B 1 87  ? 2.745  17.041  27.590 1.00 7.59  ? 87  PRO B C   1 
ATOM   2452 O O   . PRO B 1 87  ? 3.707  16.917  26.819 1.00 6.72  ? 87  PRO B O   1 
ATOM   2453 C CB  . PRO B 1 87  ? 2.947  19.139  28.981 1.00 10.95 ? 87  PRO B CB  1 
ATOM   2454 C CG  . PRO B 1 87  ? 4.388  19.479  29.102 1.00 12.08 ? 87  PRO B CG  1 
ATOM   2455 C CD  . PRO B 1 87  ? 5.029  18.378  29.900 1.00 8.68  ? 87  PRO B CD  1 
ATOM   2456 N N   . LYS B 1 88  ? 1.512  16.700  27.263 1.00 8.60  ? 88  LYS B N   1 
ATOM   2457 C CA  . LYS B 1 88  ? 1.174  16.197  25.935 1.00 9.89  ? 88  LYS B CA  1 
ATOM   2458 C C   . LYS B 1 88  ? 1.113  17.270  24.860 1.00 9.22  ? 88  LYS B C   1 
ATOM   2459 O O   . LYS B 1 88  ? 1.271  16.963  23.675 1.00 9.35  ? 88  LYS B O   1 
ATOM   2460 C CB  . LYS B 1 88  ? -0.119 15.394  25.987 1.00 12.12 ? 88  LYS B CB  1 
ATOM   2461 C CG  . LYS B 1 88  ? 0.084  14.047  26.684 1.00 15.27 ? 88  LYS B CG  1 
ATOM   2462 C CD  . LYS B 1 88  ? -1.234 13.304  26.946 1.00 20.15 ? 88  LYS B CD  1 
ATOM   2463 C CE  . LYS B 1 88  ? -0.969 12.020  27.721 1.00 23.74 ? 88  LYS B CE  1 
ATOM   2464 N NZ  . LYS B 1 88  ? -2.156 11.535  28.451 1.00 27.56 ? 88  LYS B NZ  1 
ATOM   2465 N N   . ASP B 1 89  ? 0.889  18.520  25.254 1.00 9.35  ? 89  ASP B N   1 
ATOM   2466 C CA  . ASP B 1 89  ? 0.918  19.639  24.306 1.00 6.90  ? 89  ASP B CA  1 
ATOM   2467 C C   . ASP B 1 89  ? 2.275  19.613  23.580 1.00 5.21  ? 89  ASP B C   1 
ATOM   2468 O O   . ASP B 1 89  ? 3.336  19.542  24.225 1.00 5.53  ? 89  ASP B O   1 
ATOM   2469 C CB  . ASP B 1 89  ? 0.711  20.963  25.049 1.00 9.13  ? 89  ASP B CB  1 
ATOM   2470 C CG  . ASP B 1 89  ? 0.950  22.167  24.162 1.00 9.31  ? 89  ASP B CG  1 
ATOM   2471 O OD1 . ASP B 1 89  ? 0.019  22.576  23.422 1.00 9.69  ? 89  ASP B OD1 1 
ATOM   2472 O OD2 . ASP B 1 89  ? 2.060  22.743  24.192 1.00 9.09  ? 89  ASP B OD2 1 
ATOM   2473 N N   . LEU B 1 90  ? 2.267  19.684  22.249 1.00 5.08  ? 90  LEU B N   1 
ATOM   2474 C CA  . LEU B 1 90  ? 3.522  19.449  21.492 1.00 5.35  ? 90  LEU B CA  1 
ATOM   2475 C C   . LEU B 1 90  ? 4.572  20.497  21.712 1.00 4.96  ? 90  LEU B C   1 
ATOM   2476 O O   . LEU B 1 90  ? 5.743  20.128  21.787 1.00 4.66  ? 90  LEU B O   1 
ATOM   2477 C CB  . LEU B 1 90  ? 3.286  19.266  20.001 1.00 5.10  ? 90  LEU B CB  1 
ATOM   2478 C CG  . LEU B 1 90  ? 2.433  18.046  19.684 1.00 5.91  ? 90  LEU B CG  1 
ATOM   2479 C CD1 . LEU B 1 90  ? 2.294  17.924  18.193 1.00 6.69  ? 90  LEU B CD1 1 
ATOM   2480 C CD2 . LEU B 1 90  ? 3.064  16.735  20.230 1.00 6.95  ? 90  LEU B CD2 1 
ATOM   2481 N N   . VAL B 1 91  ? 4.198  21.773  21.807 1.00 5.02  ? 91  VAL B N   1 
ATOM   2482 C CA  . VAL B 1 91  ? 5.210  22.831  21.965 1.00 6.35  ? 91  VAL B CA  1 
ATOM   2483 C C   . VAL B 1 91  ? 5.816  22.792  23.361 1.00 6.92  ? 91  VAL B C   1 
ATOM   2484 O O   . VAL B 1 91  ? 7.043  22.879  23.523 1.00 6.40  ? 91  VAL B O   1 
ATOM   2485 C CB  . VAL B 1 91  ? 4.620  24.205  21.694 1.00 5.66  ? 91  VAL B CB  1 
ATOM   2486 C CG1 . VAL B 1 91  ? 5.628  25.275  22.034 1.00 7.48  ? 91  VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 1 91  ? 4.248  24.282  20.223 1.00 8.97  ? 91  VAL B CG2 1 
ATOM   2488 N N   . LYS B 1 92  ? 4.993  22.558  24.373 1.00 4.77  ? 92  LYS B N   1 
ATOM   2489 C CA  . LYS B 1 92  ? 5.492  22.418  25.732 1.00 5.85  ? 92  LYS B CA  1 
ATOM   2490 C C   . LYS B 1 92  ? 6.297  21.143  25.899 1.00 6.87  ? 92  LYS B C   1 
ATOM   2491 O O   . LYS B 1 92  ? 7.315  21.152  26.571 1.00 5.82  ? 92  LYS B O   1 
ATOM   2492 C CB  . LYS B 1 92  ? 4.370  22.476  26.756 1.00 8.03  ? 92  LYS B CB  1 
ATOM   2493 C CG  . LYS B 1 92  ? 3.840  23.872  26.897 1.00 12.70 ? 92  LYS B CG  1 
ATOM   2494 C CD  . LYS B 1 92  ? 2.631  23.937  27.783 1.00 13.68 ? 92  LYS B CD  1 
ATOM   2495 C CE  . LYS B 1 92  ? 2.278  25.405  28.037 1.00 18.83 ? 92  LYS B CE  1 
ATOM   2496 N NZ  . LYS B 1 92  ? 2.521  25.873  29.432 1.00 24.91 ? 92  LYS B NZ  1 
ATOM   2497 N N   . ARG B 1 93  ? 5.888  20.057  25.266 1.00 4.31  ? 93  ARG B N   1 
ATOM   2498 C CA  . ARG B 1 93  ? 6.675  18.844  25.330 1.00 4.14  ? 93  ARG B CA  1 
ATOM   2499 C C   . ARG B 1 93  ? 8.020  19.095  24.662 1.00 4.74  ? 93  ARG B C   1 
ATOM   2500 O O   . ARG B 1 93  ? 9.062  18.637  25.148 1.00 4.74  ? 93  ARG B O   1 
ATOM   2501 C CB  . ARG B 1 93  ? 5.996  17.685  24.642 1.00 5.06  ? 93  ARG B CB  1 
ATOM   2502 C CG  . ARG B 1 93  ? 6.875  16.447  24.703 1.00 5.51  ? 93  ARG B CG  1 
ATOM   2503 C CD  . ARG B 1 93  ? 6.075  15.196  24.447 1.00 5.44  ? 93  ARG B CD  1 
ATOM   2504 N NE  . ARG B 1 93  ? 5.087  14.933  25.498 1.00 6.20  ? 93  ARG B NE  1 
ATOM   2505 C CZ  . ARG B 1 93  ? 4.493  13.769  25.703 1.00 6.66  ? 93  ARG B CZ  1 
ATOM   2506 N NH1 . ARG B 1 93  ? 4.818  12.693  24.970 1.00 7.87  ? 93  ARG B NH1 1 
ATOM   2507 N NH2 . ARG B 1 93  ? 3.555  13.698  26.668 1.00 6.85  ? 93  ARG B NH2 1 
ATOM   2508 N N   . ALA B 1 94  ? 8.028  19.791  23.529 1.00 4.78  ? 94  ALA B N   1 
ATOM   2509 C CA  . ALA B 1 94  ? 9.294  20.091  22.855 1.00 5.14  ? 94  ALA B CA  1 
ATOM   2510 C C   . ALA B 1 94  ? 10.257 20.857  23.758 1.00 6.99  ? 94  ALA B C   1 
ATOM   2511 O O   . ALA B 1 94  ? 11.475 20.665  23.683 1.00 5.07  ? 94  ALA B O   1 
ATOM   2512 C CB  . ALA B 1 94  ? 9.028  20.858  21.562 1.00 5.04  ? 94  ALA B CB  1 
ATOM   2513 N N   . LEU B 1 95  ? 9.750  21.747  24.603 1.00 5.41  ? 95  LEU B N   1 
ATOM   2514 C CA  . LEU B 1 95  ? 10.634 22.461  25.518 1.00 5.44  ? 95  LEU B CA  1 
ATOM   2515 C C   . LEU B 1 95  ? 11.227 21.519  26.572 1.00 4.37  ? 95  LEU B C   1 
ATOM   2516 O O   . LEU B 1 95  ? 12.419 21.585  26.881 1.00 5.33  ? 95  LEU B O   1 
ATOM   2517 C CB  . LEU B 1 95  ? 9.911  23.647  26.171 1.00 5.68  ? 95  LEU B CB  1 
ATOM   2518 C CG  . LEU B 1 95  ? 10.839 24.463  27.077 1.00 7.26  ? 95  LEU B CG  1 
ATOM   2519 C CD1 . LEU B 1 95  ? 11.982 25.081  26.303 1.00 8.65  ? 95  LEU B CD1 1 
ATOM   2520 C CD2 . LEU B 1 95  ? 10.045 25.551  27.740 1.00 8.73  ? 95  LEU B CD2 1 
ATOM   2521 N N   . VAL B 1 96  ? 10.391 20.632  27.123 1.00 4.84  ? 96  VAL B N   1 
ATOM   2522 C CA  . VAL B 1 96  ? 10.903 19.652  28.082 1.00 4.32  ? 96  VAL B CA  1 
ATOM   2523 C C   . VAL B 1 96  ? 11.919 18.755  27.401 1.00 2.84  ? 96  VAL B C   1 
ATOM   2524 O O   . VAL B 1 96  ? 13.049 18.546  27.934 1.00 3.85  ? 96  VAL B O   1 
ATOM   2525 C CB  . VAL B 1 96  ? 9.812  18.790  28.678 1.00 3.93  ? 96  VAL B CB  1 
ATOM   2526 C CG1 . VAL B 1 96  ? 10.395 17.679  29.565 1.00 5.98  ? 96  VAL B CG1 1 
ATOM   2527 C CG2 . VAL B 1 96  ? 8.814  19.645  29.449 1.00 5.13  ? 96  VAL B CG2 1 
ATOM   2528 N N   . ASP B 1 97  ? 11.622 18.294  26.189 1.00 2.85  ? 97  ASP B N   1 
ATOM   2529 C CA  . ASP B 1 97  ? 12.570 17.458  25.442 1.00 4.90  ? 97  ASP B CA  1 
ATOM   2530 C C   . ASP B 1 97  ? 13.911 18.224  25.232 1.00 4.11  ? 97  ASP B C   1 
ATOM   2531 O O   . ASP B 1 97  ? 15.021 17.678  25.491 1.00 5.37  ? 97  ASP B O   1 
ATOM   2532 C CB  . ASP B 1 97  ? 12.027 17.043  24.061 1.00 2.96  ? 97  ASP B CB  1 
ATOM   2533 C CG  . ASP B 1 97  ? 10.935 15.985  24.109 1.00 4.52  ? 97  ASP B CG  1 
ATOM   2534 O OD1 . ASP B 1 97  ? 10.746 15.370  25.162 1.00 6.63  ? 97  ASP B OD1 1 
ATOM   2535 O OD2 . ASP B 1 97  ? 10.306 15.811  23.055 1.00 5.76  ? 97  ASP B OD2 1 
ATOM   2536 N N   . ASN B 1 98  ? 13.810 19.473  24.751 1.00 3.23  ? 98  ASN B N   1 
ATOM   2537 C CA  . ASN B 1 98  ? 14.980 20.331  24.485 1.00 4.98  ? 98  ASN B CA  1 
ATOM   2538 C C   . ASN B 1 98  ? 15.832 20.403  25.748 1.00 4.07  ? 98  ASN B C   1 
ATOM   2539 O O   . ASN B 1 98  ? 17.028 20.196  25.682 1.00 4.34  ? 98  ASN B O   1 
ATOM   2540 C CB  . ASN B 1 98  ? 14.475 21.721  24.080 1.00 5.95  ? 98  ASN B CB  1 
ATOM   2541 C CG  . ASN B 1 98  ? 15.550 22.754  23.969 1.00 5.79  ? 98  ASN B CG  1 
ATOM   2542 O OD1 . ASN B 1 98  ? 16.770 22.485  24.007 1.00 8.40  ? 98  ASN B OD1 1 
ATOM   2543 N ND2 . ASN B 1 98  ? 15.095 23.992  23.812 1.00 7.68  ? 98  ASN B ND2 1 
ATOM   2544 N N   . ARG B 1 99  ? 15.252 20.644  26.911 1.00 4.50  ? 99  ARG B N   1 
ATOM   2545 C CA  . ARG B 1 99  ? 16.034 20.773  28.131 1.00 4.05  ? 99  ARG B CA  1 
ATOM   2546 C C   . ARG B 1 99  ? 16.711 19.435  28.508 1.00 3.20  ? 99  ARG B C   1 
ATOM   2547 O O   . ARG B 1 99  ? 17.825 19.450  29.051 1.00 4.12  ? 99  ARG B O   1 
ATOM   2548 C CB  . ARG B 1 99  ? 15.191 21.298  29.300 1.00 5.90  ? 99  ARG B CB  1 
ATOM   2549 C CG  . ARG B 1 99  ? 14.637 22.690  29.088 1.00 7.29  ? 99  ARG B CG  1 
ATOM   2550 C CD  . ARG B 1 99  ? 15.731 23.742  28.991 1.00 9.10  ? 99  ARG B CD  1 
ATOM   2551 N NE  . ARG B 1 99  ? 15.173 25.101  28.992 1.00 9.59  ? 99  ARG B NE  1 
ATOM   2552 C CZ  . ARG B 1 99  ? 15.294 25.989  28.005 1.00 7.70  ? 99  ARG B CZ  1 
ATOM   2553 N NH1 . ARG B 1 99  ? 15.957 25.704  26.908 1.00 9.34  ? 99  ARG B NH1 1 
ATOM   2554 N NH2 . ARG B 1 99  ? 14.718 27.192  28.126 1.00 9.18  ? 99  ARG B NH2 1 
ATOM   2555 N N   . MET B 1 100 ? 16.058 18.287  28.276 1.00 3.53  ? 100 MET B N   1 
ATOM   2556 C CA  . MET B 1 100 ? 16.670 16.999  28.564 1.00 4.16  ? 100 MET B CA  1 
ATOM   2557 C C   . MET B 1 100 ? 17.774 16.680  27.588 1.00 3.75  ? 100 MET B C   1 
ATOM   2558 O O   . MET B 1 100 ? 18.824 16.107  28.012 1.00 3.22  ? 100 MET B O   1 
ATOM   2559 C CB  . MET B 1 100 ? 15.596 15.903  28.556 1.00 4.34  ? 100 MET B CB  1 
ATOM   2560 C CG  . MET B 1 100 ? 14.679 15.981  29.775 1.00 6.18  ? 100 MET B CG  1 
ATOM   2561 S SD  . MET B 1 100 ? 13.731 14.454  30.086 1.00 5.76  ? 100 MET B SD  1 
ATOM   2562 C CE  . MET B 1 100 ? 12.799 14.272  28.599 1.00 5.46  ? 100 MET B CE  1 
ATOM   2563 N N   . TYR B 1 101 ? 17.617 17.006  26.299 1.00 3.18  ? 101 TYR B N   1 
ATOM   2564 C CA  . TYR B 1 101 ? 18.735 16.836  25.353 1.00 3.46  ? 101 TYR B CA  1 
ATOM   2565 C C   . TYR B 1 101 ? 19.917 17.732  25.713 1.00 4.90  ? 101 TYR B C   1 
ATOM   2566 O O   . TYR B 1 101 ? 21.078 17.355  25.562 1.00 5.01  ? 101 TYR B O   1 
ATOM   2567 C CB  . TYR B 1 101 ? 18.304 17.021  23.897 1.00 3.59  ? 101 TYR B CB  1 
ATOM   2568 C CG  . TYR B 1 101 ? 17.527 15.865  23.385 1.00 3.71  ? 101 TYR B CG  1 
ATOM   2569 C CD1 . TYR B 1 101 ? 18.179 14.723  22.993 1.00 3.56  ? 101 TYR B CD1 1 
ATOM   2570 C CD2 . TYR B 1 101 ? 16.154 15.903  23.312 1.00 3.17  ? 101 TYR B CD2 1 
ATOM   2571 C CE1 . TYR B 1 101 ? 17.507 13.636  22.530 1.00 3.73  ? 101 TYR B CE1 1 
ATOM   2572 C CE2 . TYR B 1 101 ? 15.453 14.802  22.841 1.00 4.32  ? 101 TYR B CE2 1 
ATOM   2573 C CZ  . TYR B 1 101 ? 16.136 13.675  22.462 1.00 3.68  ? 101 TYR B CZ  1 
ATOM   2574 O OH  . TYR B 1 101 ? 15.468 12.566  21.981 1.00 5.00  ? 101 TYR B OH  1 
ATOM   2575 N N   . PHE B 1 102 ? 19.615 18.936  26.195 1.00 4.85  ? 102 PHE B N   1 
ATOM   2576 C CA  . PHE B 1 102 ? 20.662 19.825  26.690 1.00 5.54  ? 102 PHE B CA  1 
ATOM   2577 C C   . PHE B 1 102 ? 21.367 19.151  27.866 1.00 3.96  ? 102 PHE B C   1 
ATOM   2578 O O   . PHE B 1 102 ? 22.611 19.111  27.922 1.00 4.16  ? 102 PHE B O   1 
ATOM   2579 C CB  . PHE B 1 102 ? 20.056 21.139  27.145 1.00 5.21  ? 102 PHE B CB  1 
ATOM   2580 C CG  . PHE B 1 102 ? 21.033 22.020  27.891 1.00 3.62  ? 102 PHE B CG  1 
ATOM   2581 C CD1 . PHE B 1 102 ? 21.923 22.861  27.220 1.00 6.43  ? 102 PHE B CD1 1 
ATOM   2582 C CD2 . PHE B 1 102 ? 21.050 22.017  29.267 1.00 4.97  ? 102 PHE B CD2 1 
ATOM   2583 C CE1 . PHE B 1 102 ? 22.814 23.694  27.947 1.00 5.57  ? 102 PHE B CE1 1 
ATOM   2584 C CE2 . PHE B 1 102 ? 21.929 22.861  29.985 1.00 7.16  ? 102 PHE B CE2 1 
ATOM   2585 C CZ  . PHE B 1 102 ? 22.809 23.663  29.304 1.00 6.25  ? 102 PHE B CZ  1 
ATOM   2586 N N   . GLU B 1 103 ? 20.654 18.618  28.841 1.00 4.65  ? 103 GLU B N   1 
ATOM   2587 C CA  . GLU B 1 103 ? 21.301 17.922  29.966 1.00 4.63  ? 103 GLU B CA  1 
ATOM   2588 C C   . GLU B 1 103 ? 22.164 16.763  29.476 1.00 4.46  ? 103 GLU B C   1 
ATOM   2589 O O   . GLU B 1 103 ? 23.279 16.561  29.934 1.00 5.63  ? 103 GLU B O   1 
ATOM   2590 C CB  . GLU B 1 103 ? 20.232 17.376  30.917 1.00 4.31  ? 103 GLU B CB  1 
ATOM   2591 C CG  . GLU B 1 103 ? 20.745 16.988  32.292 1.00 5.67  ? 103 GLU B CG  1 
ATOM   2592 C CD  . GLU B 1 103 ? 21.363 15.583  32.327 1.00 5.78  ? 103 GLU B CD  1 
ATOM   2593 O OE1 . GLU B 1 103 ? 21.068 14.747  31.429 1.00 6.45  ? 103 GLU B OE1 1 
ATOM   2594 O OE2 . GLU B 1 103 ? 22.119 15.316  33.292 1.00 6.30  ? 103 GLU B OE2 1 
ATOM   2595 N N   A SER B 1 104 ? 21.645 15.988  28.521 0.61 4.38  ? 104 SER B N   1 
ATOM   2596 N N   B SER B 1 104 ? 21.660 15.977  28.527 0.39 4.40  ? 104 SER B N   1 
ATOM   2597 C CA  A SER B 1 104 ? 22.381 14.835  28.016 0.61 5.27  ? 104 SER B CA  1 
ATOM   2598 C CA  B SER B 1 104 ? 22.415 14.808  28.088 0.39 5.05  ? 104 SER B CA  1 
ATOM   2599 C C   A SER B 1 104 ? 23.785 15.173  27.513 0.61 4.97  ? 104 SER B C   1 
ATOM   2600 C C   B SER B 1 104 ? 23.791 15.139  27.480 0.39 5.03  ? 104 SER B C   1 
ATOM   2601 O O   A SER B 1 104 ? 24.751 14.494  27.826 0.61 4.85  ? 104 SER B O   1 
ATOM   2602 O O   B SER B 1 104 ? 24.755 14.420  27.707 0.39 5.03  ? 104 SER B O   1 
ATOM   2603 C CB  A SER B 1 104 ? 21.604 14.213  26.870 0.61 4.66  ? 104 SER B CB  1 
ATOM   2604 C CB  B SER B 1 104 ? 21.590 13.988  27.106 0.39 5.13  ? 104 SER B CB  1 
ATOM   2605 O OG  A SER B 1 104 ? 22.376 13.192  26.262 0.61 5.07  ? 104 SER B OG  1 
ATOM   2606 O OG  B SER B 1 104 ? 21.410 14.676  25.888 0.39 5.44  ? 104 SER B OG  1 
ATOM   2607 N N   . GLY B 1 105 ? 23.885 16.213  26.700 1.00 4.03  ? 105 GLY B N   1 
ATOM   2608 C CA  . GLY B 1 105 ? 25.139 16.548  26.028 1.00 5.35  ? 105 GLY B CA  1 
ATOM   2609 C C   . GLY B 1 105 ? 25.973 17.639  26.665 1.00 4.42  ? 105 GLY B C   1 
ATOM   2610 O O   . GLY B 1 105 ? 27.108 17.372  27.067 1.00 5.83  ? 105 GLY B O   1 
ATOM   2611 N N   . VAL B 1 106 ? 25.413 18.836  26.785 1.00 5.39  ? 106 VAL B N   1 
ATOM   2612 C CA  . VAL B 1 106 ? 26.148 19.978  27.332 1.00 4.51  ? 106 VAL B CA  1 
ATOM   2613 C C   . VAL B 1 106 ? 26.484 19.794  28.807 1.00 4.53  ? 106 VAL B C   1 
ATOM   2614 O O   . VAL B 1 106 ? 27.584 20.143  29.241 1.00 6.09  ? 106 VAL B O   1 
ATOM   2615 C CB  . VAL B 1 106 ? 25.376 21.298  27.159 1.00 6.06  ? 106 VAL B CB  1 
ATOM   2616 C CG1 . VAL B 1 106 ? 26.136 22.420  27.841 1.00 6.41  ? 106 VAL B CG1 1 
ATOM   2617 C CG2 . VAL B 1 106 ? 25.155 21.642  25.688 1.00 7.19  ? 106 VAL B CG2 1 
ATOM   2618 N N   . VAL B 1 107 ? 25.575 19.214  29.588 1.00 4.09  ? 107 VAL B N   1 
ATOM   2619 C CA  . VAL B 1 107 ? 25.823 19.041  31.021 1.00 4.14  ? 107 VAL B CA  1 
ATOM   2620 C C   . VAL B 1 107 ? 26.463 17.714  31.342 1.00 4.98  ? 107 VAL B C   1 
ATOM   2621 O O   . VAL B 1 107 ? 27.614 17.690  31.806 1.00 6.68  ? 107 VAL B O   1 
ATOM   2622 C CB  . VAL B 1 107 ? 24.536 19.188  31.832 1.00 3.88  ? 107 VAL B CB  1 
ATOM   2623 C CG1 . VAL B 1 107 ? 24.814 19.108  33.290 1.00 5.32  ? 107 VAL B CG1 1 
ATOM   2624 C CG2 . VAL B 1 107 ? 23.919 20.534  31.535 1.00 5.99  ? 107 VAL B CG2 1 
ATOM   2625 N N   . PHE B 1 108 ? 25.785 16.607  31.043 1.00 5.29  ? 108 PHE B N   1 
ATOM   2626 C CA  . PHE B 1 108 ? 26.278 15.298  31.425 1.00 5.67  ? 108 PHE B CA  1 
ATOM   2627 C C   . PHE B 1 108 ? 27.532 14.866  30.630 1.00 4.79  ? 108 PHE B C   1 
ATOM   2628 O O   . PHE B 1 108 ? 28.598 14.669  31.210 1.00 6.71  ? 108 PHE B O   1 
ATOM   2629 C CB  . PHE B 1 108 ? 25.200 14.226  31.337 1.00 4.22  ? 108 PHE B CB  1 
ATOM   2630 C CG  . PHE B 1 108 ? 25.649 12.923  31.870 1.00 4.61  ? 108 PHE B CG  1 
ATOM   2631 C CD1 . PHE B 1 108 ? 25.700 12.714  33.223 1.00 4.79  ? 108 PHE B CD1 1 
ATOM   2632 C CD2 . PHE B 1 108 ? 26.110 11.937  31.015 1.00 9.80  ? 108 PHE B CD2 1 
ATOM   2633 C CE1 . PHE B 1 108 ? 26.158 11.484  33.734 1.00 8.01  ? 108 PHE B CE1 1 
ATOM   2634 C CE2 . PHE B 1 108 ? 26.565 10.733  31.505 1.00 11.12 ? 108 PHE B CE2 1 
ATOM   2635 C CZ  . PHE B 1 108 ? 26.564 10.502  32.871 1.00 9.19  ? 108 PHE B CZ  1 
ATOM   2636 N N   . ALA B 1 109 ? 27.445 14.789  29.304 1.00 4.81  ? 109 ALA B N   1 
ATOM   2637 C CA  . ALA B 1 109 ? 28.562 14.272  28.523 1.00 6.84  ? 109 ALA B CA  1 
ATOM   2638 C C   . ALA B 1 109 ? 29.717 15.248  28.564 1.00 6.99  ? 109 ALA B C   1 
ATOM   2639 O O   . ALA B 1 109 ? 30.852 14.819  28.795 1.00 7.59  ? 109 ALA B O   1 
ATOM   2640 C CB  . ALA B 1 109 ? 28.146 14.006  27.082 1.00 7.16  ? 109 ALA B CB  1 
ATOM   2641 N N   . ASN B 1 110 ? 29.459 16.535  28.335 1.00 6.36  ? 110 ASN B N   1 
ATOM   2642 C CA  . ASN B 1 110 ? 30.566 17.485  28.153 1.00 7.41  ? 110 ASN B CA  1 
ATOM   2643 C C   . ASN B 1 110 ? 31.203 17.993  29.438 1.00 6.79  ? 110 ASN B C   1 
ATOM   2644 O O   . ASN B 1 110 ? 32.401 18.230  29.457 1.00 8.31  ? 110 ASN B O   1 
ATOM   2645 C CB  . ASN B 1 110 ? 30.098 18.699  27.336 1.00 9.06  ? 110 ASN B CB  1 
ATOM   2646 C CG  . ASN B 1 110 ? 31.245 19.600  26.906 1.00 11.43 ? 110 ASN B CG  1 
ATOM   2647 O OD1 . ASN B 1 110 ? 32.092 19.189  26.126 1.00 11.99 ? 110 ASN B OD1 1 
ATOM   2648 N ND2 . ASN B 1 110 ? 31.226 20.863  27.358 1.00 10.28 ? 110 ASN B ND2 1 
ATOM   2649 N N   . ALA B 1 111 ? 30.409 18.204  30.479 1.00 6.00  ? 111 ALA B N   1 
ATOM   2650 C CA  . ALA B 1 111 ? 30.909 18.745  31.733 1.00 6.67  ? 111 ALA B CA  1 
ATOM   2651 C C   . ALA B 1 111 ? 31.122 17.724  32.854 1.00 5.89  ? 111 ALA B C   1 
ATOM   2652 O O   . ALA B 1 111 ? 32.155 17.720  33.525 1.00 7.62  ? 111 ALA B O   1 
ATOM   2653 C CB  . ALA B 1 111 ? 30.010 19.883  32.210 1.00 6.95  ? 111 ALA B CB  1 
ATOM   2654 N N   A LEU B 1 112 ? 30.141 16.862  33.056 0.51 5.56  ? 112 LEU B N   1 
ATOM   2655 N N   B LEU B 1 112 ? 30.167 16.837  33.046 0.49 5.57  ? 112 LEU B N   1 
ATOM   2656 C CA  A LEU B 1 112 ? 30.162 15.972  34.216 0.51 6.45  ? 112 LEU B CA  1 
ATOM   2657 C CA  B LEU B 1 112 ? 30.197 15.994  34.239 0.49 6.52  ? 112 LEU B CA  1 
ATOM   2658 C C   A LEU B 1 112 ? 30.996 14.729  33.961 0.51 7.41  ? 112 LEU B C   1 
ATOM   2659 C C   B LEU B 1 112 ? 30.936 14.671  34.031 0.49 7.08  ? 112 LEU B C   1 
ATOM   2660 O O   A LEU B 1 112 ? 32.018 14.504  34.622 0.51 7.96  ? 112 LEU B O   1 
ATOM   2661 O O   B LEU B 1 112 ? 31.863 14.339  34.781 0.49 8.37  ? 112 LEU B O   1 
ATOM   2662 C CB  A LEU B 1 112 ? 28.745 15.563  34.614 0.51 5.52  ? 112 LEU B CB  1 
ATOM   2663 C CB  B LEU B 1 112 ? 28.779 15.760  34.744 0.49 5.62  ? 112 LEU B CB  1 
ATOM   2664 C CG  A LEU B 1 112 ? 28.620 14.908  35.995 0.51 7.13  ? 112 LEU B CG  1 
ATOM   2665 C CG  B LEU B 1 112 ? 28.538 14.990  36.046 0.49 7.30  ? 112 LEU B CG  1 
ATOM   2666 C CD1 A LEU B 1 112 ? 27.261 15.203  36.608 0.51 7.06  ? 112 LEU B CD1 1 
ATOM   2667 C CD1 B LEU B 1 112 ? 29.494 15.407  37.177 0.49 7.05  ? 112 LEU B CD1 1 
ATOM   2668 C CD2 A LEU B 1 112 ? 28.874 13.397  35.942 0.51 6.42  ? 112 LEU B CD2 1 
ATOM   2669 C CD2 B LEU B 1 112 ? 27.089 15.187  36.469 0.49 6.90  ? 112 LEU B CD2 1 
ATOM   2670 N N   . ARG B 1 113 ? 30.560 13.921  32.997 1.00 10.38 ? 113 ARG B N   1 
ATOM   2671 C CA  . ARG B 1 113 ? 31.123 12.590  32.783 1.00 8.74  ? 113 ARG B CA  1 
ATOM   2672 C C   . ARG B 1 113 ? 32.590 12.640  32.435 1.00 8.35  ? 113 ARG B C   1 
ATOM   2673 O O   . ARG B 1 113 ? 33.374 11.835  32.904 1.00 9.99  ? 113 ARG B O   1 
ATOM   2674 C CB  . ARG B 1 113 ? 30.357 11.859  31.686 1.00 9.90  ? 113 ARG B CB  1 
ATOM   2675 C CG  . ARG B 1 113 ? 30.726 10.400  31.540 1.00 12.01 ? 113 ARG B CG  1 
ATOM   2676 C CD  . ARG B 1 113 ? 29.935 9.773   30.413 1.00 15.68 ? 113 ARG B CD  1 
ATOM   2677 N NE  . ARG B 1 113 ? 30.226 8.349   30.319 1.00 18.89 ? 113 ARG B NE  1 
ATOM   2678 C CZ  . ARG B 1 113 ? 31.225 7.869   29.595 1.00 25.81 ? 113 ARG B CZ  1 
ATOM   2679 N NH1 . ARG B 1 113 ? 31.994 8.723   28.925 1.00 25.94 ? 113 ARG B NH1 1 
ATOM   2680 N NH2 . ARG B 1 113 ? 31.463 6.560   29.544 1.00 30.04 ? 113 ARG B NH2 1 
ATOM   2681 N N   . SER B 1 114 ? 32.949 13.635  31.620 1.00 8.57  ? 114 SER B N   1 
ATOM   2682 C CA  . SER B 1 114 ? 34.339 13.822  31.223 1.00 9.59  ? 114 SER B CA  1 
ATOM   2683 C C   . SER B 1 114 ? 35.222 14.010  32.434 1.00 10.94 ? 114 SER B C   1 
ATOM   2684 O O   . SER B 1 114 ? 36.220 13.326  32.571 1.00 12.62 ? 114 SER B O   1 
ATOM   2685 C CB  . SER B 1 114 ? 34.477 15.049  30.312 1.00 10.99 ? 114 SER B CB  1 
ATOM   2686 O OG  . SER B 1 114 ? 33.805 16.146  30.903 1.00 11.82 ? 114 SER B OG  1 
ATOM   2687 N N   . LEU B 1 115 ? 34.894 14.991  33.274 1.00 10.12 ? 115 LEU B N   1 
ATOM   2688 C CA  . LEU B 1 115 ? 35.698 15.291  34.454 1.00 9.84  ? 115 LEU B CA  1 
ATOM   2689 C C   . LEU B 1 115 ? 35.667 14.144  35.479 1.00 9.25  ? 115 LEU B C   1 
ATOM   2690 O O   . LEU B 1 115 ? 36.716 13.784  36.037 1.00 9.29  ? 115 LEU B O   1 
ATOM   2691 C CB  . LEU B 1 115 ? 35.285 16.635  35.080 1.00 10.36 ? 115 LEU B CB  1 
ATOM   2692 C CG  . LEU B 1 115 ? 36.149 17.172  36.217 1.00 12.65 ? 115 LEU B CG  1 
ATOM   2693 C CD1 . LEU B 1 115 ? 37.597 17.187  35.832 1.00 9.75  ? 115 LEU B CD1 1 
ATOM   2694 C CD2 . LEU B 1 115 ? 35.689 18.574  36.627 1.00 13.98 ? 115 LEU B CD2 1 
ATOM   2695 N N   . ALA B 1 116 ? 34.481 13.568  35.695 1.00 8.48  ? 116 ALA B N   1 
ATOM   2696 C CA  . ALA B 1 116 ? 34.361 12.466  36.646 1.00 10.01 ? 116 ALA B CA  1 
ATOM   2697 C C   . ALA B 1 116 ? 35.198 11.263  36.224 1.00 13.06 ? 116 ALA B C   1 
ATOM   2698 O O   . ALA B 1 116 ? 35.903 10.668  37.046 1.00 14.07 ? 116 ALA B O   1 
ATOM   2699 C CB  . ALA B 1 116 ? 32.907 12.094  36.838 1.00 13.59 ? 116 ALA B CB  1 
ATOM   2700 N N   . LYS B 1 117 ? 35.151 10.932  34.936 1.00 13.24 ? 117 LYS B N   1 
ATOM   2701 C CA  . LYS B 1 117 ? 36.004 9.869   34.417 1.00 13.22 ? 117 LYS B CA  1 
ATOM   2702 C C   . LYS B 1 117 ? 37.498 10.099  34.749 1.00 14.43 ? 117 LYS B C   1 
ATOM   2703 O O   . LYS B 1 117 ? 38.190 9.207   35.258 1.00 15.37 ? 117 LYS B O   1 
ATOM   2704 C CB  . LYS B 1 117 ? 35.789 9.704   32.912 1.00 16.40 ? 117 LYS B CB  1 
ATOM   2705 C CG  . LYS B 1 117 ? 36.586 8.577   32.308 1.00 19.28 ? 117 LYS B CG  1 
ATOM   2706 C CD  . LYS B 1 117 ? 36.558 8.594   30.786 1.00 22.12 ? 117 LYS B CD  1 
ATOM   2707 C CE  . LYS B 1 117 ? 37.120 7.281   30.236 1.00 24.03 ? 117 LYS B CE  1 
ATOM   2708 N NZ  . LYS B 1 117 ? 37.455 7.336   28.775 1.00 26.53 ? 117 LYS B NZ  1 
ATOM   2709 N N   . MET B 1 118 ? 37.990 11.297  34.466 1.00 12.49 ? 118 MET B N   1 
ATOM   2710 C CA  . MET B 1 118 ? 39.371 11.676  34.786 1.00 15.13 ? 118 MET B CA  1 
ATOM   2711 C C   . MET B 1 118 ? 39.748 11.464  36.257 1.00 14.44 ? 118 MET B C   1 
ATOM   2712 O O   . MET B 1 118 ? 40.782 10.872  36.565 1.00 16.31 ? 118 MET B O   1 
ATOM   2713 C CB  . MET B 1 118 ? 39.587 13.147  34.437 1.00 17.56 ? 118 MET B CB  1 
ATOM   2714 C CG  . MET B 1 118 ? 39.679 13.431  32.947 1.00 19.69 ? 118 MET B CG  1 
ATOM   2715 S SD  . MET B 1 118 ? 40.106 15.165  32.651 1.00 23.25 ? 118 MET B SD  1 
ATOM   2716 C CE  . MET B 1 118 ? 41.896 15.111  32.748 1.00 33.55 ? 118 MET B CE  1 
ATOM   2717 N N   . ILE B 1 119 ? 38.899 11.968  37.147 1.00 11.62 ? 119 ILE B N   1 
ATOM   2718 C CA  . ILE B 1 119 ? 39.138 11.997  38.588 1.00 13.03 ? 119 ILE B CA  1 
ATOM   2719 C C   . ILE B 1 119 ? 38.828 10.686  39.294 1.00 15.39 ? 119 ILE B C   1 
ATOM   2720 O O   . ILE B 1 119 ? 39.619 10.210  40.103 1.00 16.07 ? 119 ILE B O   1 
ATOM   2721 C CB  . ILE B 1 119 ? 38.217 13.069  39.229 1.00 18.30 ? 119 ILE B CB  1 
ATOM   2722 C CG1 . ILE B 1 119 ? 38.475 14.417  38.581 1.00 15.70 ? 119 ILE B CG1 1 
ATOM   2723 C CG2 . ILE B 1 119 ? 38.393 13.136  40.734 1.00 19.59 ? 119 ILE B CG2 1 
ATOM   2724 C CD1 . ILE B 1 119 ? 39.939 14.722  38.502 1.00 11.83 ? 119 ILE B CD1 1 
ATOM   2725 N N   . LEU B 1 120 ? 37.650 10.131  39.012 1.00 14.41 ? 120 LEU B N   1 
ATOM   2726 C CA  . LEU B 1 120 ? 37.155 8.974   39.749 1.00 17.43 ? 120 LEU B CA  1 
ATOM   2727 C C   . LEU B 1 120 ? 37.657 7.670   39.154 1.00 21.23 ? 120 LEU B C   1 
ATOM   2728 O O   . LEU B 1 120 ? 37.795 6.691   39.878 1.00 24.80 ? 120 LEU B O   1 
ATOM   2729 C CB  . LEU B 1 120 ? 35.631 8.961   39.845 1.00 14.86 ? 120 LEU B CB  1 
ATOM   2730 C CG  . LEU B 1 120 ? 35.013 10.196  40.508 1.00 15.22 ? 120 LEU B CG  1 
ATOM   2731 C CD1 . LEU B 1 120 ? 33.496 10.147  40.448 1.00 14.29 ? 120 LEU B CD1 1 
ATOM   2732 C CD2 . LEU B 1 120 ? 35.472 10.334  41.959 1.00 15.11 ? 120 LEU B CD2 1 
ATOM   2733 N N   . PHE B 1 121 ? 37.931 7.654   37.846 1.00 20.88 ? 121 PHE B N   1 
ATOM   2734 C CA  . PHE B 1 121 ? 38.255 6.401   37.156 1.00 23.13 ? 121 PHE B CA  1 
ATOM   2735 C C   . PHE B 1 121 ? 39.701 6.303   36.715 1.00 23.21 ? 121 PHE B C   1 
ATOM   2736 O O   . PHE B 1 121 ? 40.305 5.240   36.823 1.00 26.18 ? 121 PHE B O   1 
ATOM   2737 C CB  . PHE B 1 121 ? 37.365 6.190   35.935 1.00 27.04 ? 121 PHE B CB  1 
ATOM   2738 C CG  . PHE B 1 121 ? 35.936 5.938   36.268 1.00 31.37 ? 121 PHE B CG  1 
ATOM   2739 C CD1 . PHE B 1 121 ? 35.584 5.342   37.472 1.00 33.59 ? 121 PHE B CD1 1 
ATOM   2740 C CD2 . PHE B 1 121 ? 34.932 6.300   35.376 1.00 33.47 ? 121 PHE B CD2 1 
ATOM   2741 C CE1 . PHE B 1 121 ? 34.246 5.102   37.784 1.00 33.48 ? 121 PHE B CE1 1 
ATOM   2742 C CE2 . PHE B 1 121 ? 33.587 6.068   35.677 1.00 34.15 ? 121 PHE B CE2 1 
ATOM   2743 C CZ  . PHE B 1 121 ? 33.247 5.464   36.887 1.00 34.47 ? 121 PHE B CZ  1 
ATOM   2744 N N   . LEU B 1 122 ? 40.260 7.403   36.219 1.00 19.09 ? 122 LEU B N   1 
ATOM   2745 C CA  . LEU B 1 122 ? 41.590 7.374   35.611 1.00 19.73 ? 122 LEU B CA  1 
ATOM   2746 C C   . LEU B 1 122 ? 42.692 7.859   36.568 1.00 19.00 ? 122 LEU B C   1 
ATOM   2747 O O   . LEU B 1 122 ? 43.893 7.792   36.256 1.00 21.90 ? 122 LEU B O   1 
ATOM   2748 C CB  . LEU B 1 122 ? 41.596 8.208   34.324 1.00 22.71 ? 122 LEU B CB  1 
ATOM   2749 C CG  . LEU B 1 122 ? 40.473 7.916   33.321 1.00 25.05 ? 122 LEU B CG  1 
ATOM   2750 C CD1 . LEU B 1 122 ? 40.582 8.821   32.107 1.00 25.10 ? 122 LEU B CD1 1 
ATOM   2751 C CD2 . LEU B 1 122 ? 40.480 6.467   32.892 1.00 27.05 ? 122 LEU B CD2 1 
ATOM   2752 N N   . GLY B 1 123 ? 42.277 8.355   37.731 1.00 20.08 ? 123 GLY B N   1 
ATOM   2753 C CA  . GLY B 1 123 ? 43.212 8.744   38.775 1.00 19.89 ? 123 GLY B CA  1 
ATOM   2754 C C   . GLY B 1 123 ? 44.081 9.932   38.414 1.00 18.70 ? 123 GLY B C   1 
ATOM   2755 O O   . GLY B 1 123 ? 45.227 10.040  38.870 1.00 18.08 ? 123 GLY B O   1 
ATOM   2756 N N   . LYS B 1 124 ? 43.531 10.838  37.602 1.00 16.23 ? 124 LYS B N   1 
ATOM   2757 C CA  . LYS B 1 124 ? 44.294 12.020  37.236 1.00 17.01 ? 124 LYS B CA  1 
ATOM   2758 C C   . LYS B 1 124 ? 44.231 12.985  38.398 1.00 15.11 ? 124 LYS B C   1 
ATOM   2759 O O   . LYS B 1 124 ? 43.205 13.084  39.079 1.00 17.21 ? 124 LYS B O   1 
ATOM   2760 C CB  . LYS B 1 124 ? 43.788 12.697  35.952 1.00 19.23 ? 124 LYS B CB  1 
ATOM   2761 C CG  . LYS B 1 124 ? 43.654 11.787  34.723 1.00 23.17 ? 124 LYS B CG  1 
ATOM   2762 C CD  . LYS B 1 124 ? 44.948 11.047  34.421 1.00 28.36 ? 124 LYS B CD  1 
ATOM   2763 C CE  . LYS B 1 124 ? 44.748 9.988   33.342 1.00 30.96 ? 124 LYS B CE  1 
ATOM   2764 N NZ  . LYS B 1 124 ? 44.425 10.627  32.036 1.00 30.61 ? 124 LYS B NZ  1 
ATOM   2765 N N   . THR B 1 125 ? 45.343 13.687  38.611 1.00 14.94 ? 125 THR B N   1 
ATOM   2766 C CA  . THR B 1 125 ? 45.461 14.666  39.682 1.00 20.51 ? 125 THR B CA  1 
ATOM   2767 C C   . THR B 1 125 ? 45.638 16.082  39.155 1.00 20.52 ? 125 THR B C   1 
ATOM   2768 O O   . THR B 1 125 ? 45.840 17.007  39.934 1.00 21.19 ? 125 THR B O   1 
ATOM   2769 C CB  . THR B 1 125 ? 46.604 14.323  40.656 1.00 21.51 ? 125 THR B CB  1 
ATOM   2770 O OG1 . THR B 1 125 ? 47.771 13.948  39.913 1.00 24.41 ? 125 THR B OG1 1 
ATOM   2771 C CG2 . THR B 1 125 ? 46.211 13.161  41.519 1.00 19.18 ? 125 THR B CG2 1 
ATOM   2772 N N   . GLU B 1 126 ? 45.579 16.235  37.832 1.00 19.98 ? 126 GLU B N   1 
ATOM   2773 C CA  . GLU B 1 126 ? 45.611 17.547  37.173 1.00 17.13 ? 126 GLU B CA  1 
ATOM   2774 C C   . GLU B 1 126 ? 44.639 17.486  36.034 1.00 13.93 ? 126 GLU B C   1 
ATOM   2775 O O   . GLU B 1 126 ? 44.644 16.509  35.285 1.00 18.56 ? 126 GLU B O   1 
ATOM   2776 C CB  . GLU B 1 126 ? 46.982 17.839  36.552 1.00 17.34 ? 126 GLU B CB  1 
ATOM   2777 C CG  . GLU B 1 126 ? 48.004 18.511  37.445 1.00 20.90 ? 126 GLU B CG  1 
ATOM   2778 C CD  . GLU B 1 126 ? 49.395 18.388  36.880 1.00 25.02 ? 126 GLU B CD  1 
ATOM   2779 O OE1 . GLU B 1 126 ? 49.527 18.496  35.640 1.00 24.62 ? 126 GLU B OE1 1 
ATOM   2780 O OE2 . GLU B 1 126 ? 50.338 18.147  37.669 1.00 26.45 ? 126 GLU B OE2 1 
ATOM   2781 N N   . VAL B 1 127 ? 43.790 18.498  35.902 1.00 17.49 ? 127 VAL B N   1 
ATOM   2782 C CA  . VAL B 1 127 ? 42.886 18.530  34.762 1.00 16.36 ? 127 VAL B CA  1 
ATOM   2783 C C   . VAL B 1 127 ? 43.007 19.869  34.074 1.00 17.99 ? 127 VAL B C   1 
ATOM   2784 O O   . VAL B 1 127 ? 43.346 20.864  34.717 1.00 21.16 ? 127 VAL B O   1 
ATOM   2785 C CB  . VAL B 1 127 ? 41.411 18.253  35.169 1.00 23.72 ? 127 VAL B CB  1 
ATOM   2786 C CG1 . VAL B 1 127 ? 41.298 16.939  35.925 1.00 26.07 ? 127 VAL B CG1 1 
ATOM   2787 C CG2 . VAL B 1 127 ? 40.876 19.370  36.023 1.00 24.46 ? 127 VAL B CG2 1 
ATOM   2788 N N   . PRO B 1 128 ? 42.758 19.904  32.760 1.00 14.37 ? 128 PRO B N   1 
ATOM   2789 C CA  . PRO B 1 128 ? 42.865 21.221  32.115 1.00 12.53 ? 128 PRO B CA  1 
ATOM   2790 C C   . PRO B 1 128 ? 41.721 22.194  32.455 1.00 13.89 ? 128 PRO B C   1 
ATOM   2791 O O   . PRO B 1 128 ? 40.598 21.782  32.818 1.00 13.58 ? 128 PRO B O   1 
ATOM   2792 C CB  . PRO B 1 128 ? 42.916 20.885  30.622 1.00 13.94 ? 128 PRO B CB  1 
ATOM   2793 C CG  . PRO B 1 128 ? 42.278 19.545  30.505 1.00 14.87 ? 128 PRO B CG  1 
ATOM   2794 C CD  . PRO B 1 128 ? 42.545 18.815  31.787 1.00 15.24 ? 128 PRO B CD  1 
ATOM   2795 N N   . GLN B 1 129 ? 42.030 23.485  32.342 1.00 16.54 ? 129 GLN B N   1 
ATOM   2796 C CA  . GLN B 1 129 ? 41.069 24.532  32.634 1.00 15.71 ? 129 GLN B CA  1 
ATOM   2797 C C   . GLN B 1 129 ? 39.781 24.363  31.853 1.00 11.50 ? 129 GLN B C   1 
ATOM   2798 O O   . GLN B 1 129 ? 38.708 24.753  32.316 1.00 11.27 ? 129 GLN B O   1 
ATOM   2799 C CB  . GLN B 1 129 ? 41.698 25.906  32.354 1.00 15.02 ? 129 GLN B CB  1 
ATOM   2800 C CG  . GLN B 1 129 ? 40.743 27.079  32.585 1.00 15.22 ? 129 GLN B CG  1 
ATOM   2801 C CD  . GLN B 1 129 ? 40.333 27.200  34.043 1.00 18.52 ? 129 GLN B CD  1 
ATOM   2802 O OE1 . GLN B 1 129 ? 41.143 26.981  34.943 1.00 21.07 ? 129 GLN B OE1 1 
ATOM   2803 N NE2 . GLN B 1 129 ? 39.063 27.525  34.282 1.00 19.36 ? 129 GLN B NE2 1 
ATOM   2804 N N   . GLU B 1 130 ? 39.866 23.781  30.666 1.00 11.15 ? 130 GLU B N   1 
ATOM   2805 C CA  . GLU B 1 130 ? 38.665 23.583  29.850 1.00 12.78 ? 130 GLU B CA  1 
ATOM   2806 C C   . GLU B 1 130 ? 37.605 22.726  30.532 1.00 11.25 ? 130 GLU B C   1 
ATOM   2807 O O   . GLU B 1 130 ? 36.412 22.882  30.271 1.00 10.01 ? 130 GLU B O   1 
ATOM   2808 C CB  . GLU B 1 130 ? 38.978 22.985  28.470 1.00 19.40 ? 130 GLU B CB  1 
ATOM   2809 C CG  . GLU B 1 130 ? 39.905 23.841  27.615 1.00 23.78 ? 130 GLU B CG  1 
ATOM   2810 C CD  . GLU B 1 130 ? 41.358 23.460  27.807 1.00 27.77 ? 130 GLU B CD  1 
ATOM   2811 O OE1 . GLU B 1 130 ? 41.931 23.817  28.857 1.00 26.18 ? 130 GLU B OE1 1 
ATOM   2812 O OE2 . GLU B 1 130 ? 41.917 22.777  26.916 1.00 35.52 ? 130 GLU B OE2 1 
ATOM   2813 N N   . ARG B 1 131 ? 38.030 21.819  31.399 1.00 9.57  ? 131 ARG B N   1 
ATOM   2814 C CA  . ARG B 1 131 ? 37.060 20.968  32.099 1.00 8.86  ? 131 ARG B CA  1 
ATOM   2815 C C   . ARG B 1 131 ? 36.273 21.785  33.123 1.00 10.73 ? 131 ARG B C   1 
ATOM   2816 O O   . ARG B 1 131 ? 35.078 21.567  33.351 1.00 10.71 ? 131 ARG B O   1 
ATOM   2817 C CB  . ARG B 1 131 ? 37.740 19.768  32.772 1.00 10.12 ? 131 ARG B CB  1 
ATOM   2818 C CG  . ARG B 1 131 ? 38.380 18.804  31.786 1.00 14.07 ? 131 ARG B CG  1 
ATOM   2819 C CD  . ARG B 1 131 ? 37.407 17.773  31.223 1.00 14.11 ? 131 ARG B CD  1 
ATOM   2820 N NE  . ARG B 1 131 ? 36.235 18.353  30.574 1.00 10.83 ? 131 ARG B NE  1 
ATOM   2821 C CZ  . ARG B 1 131 ? 36.209 18.805  29.322 1.00 11.55 ? 131 ARG B CZ  1 
ATOM   2822 N NH1 . ARG B 1 131 ? 37.306 18.785  28.578 1.00 15.56 ? 131 ARG B NH1 1 
ATOM   2823 N NH2 . ARG B 1 131 ? 35.089 19.309  28.822 1.00 14.10 ? 131 ARG B NH2 1 
ATOM   2824 N N   . ILE B 1 132 ? 36.941 22.741  33.757 1.00 9.07  ? 132 ILE B N   1 
ATOM   2825 C CA  . ILE B 1 132 ? 36.227 23.695  34.637 1.00 8.97  ? 132 ILE B CA  1 
ATOM   2826 C C   . ILE B 1 132 ? 35.367 24.665  33.826 1.00 10.14 ? 132 ILE B C   1 
ATOM   2827 O O   . ILE B 1 132 ? 34.211 24.981  34.185 1.00 9.67  ? 132 ILE B O   1 
ATOM   2828 C CB  . ILE B 1 132 ? 37.245 24.488  35.505 1.00 14.30 ? 132 ILE B CB  1 
ATOM   2829 C CG1 . ILE B 1 132 ? 38.096 23.513  36.331 1.00 16.26 ? 132 ILE B CG1 1 
ATOM   2830 C CG2 . ILE B 1 132 ? 36.549 25.570  36.355 1.00 15.14 ? 132 ILE B CG2 1 
ATOM   2831 C CD1 . ILE B 1 132 ? 37.289 22.472  37.088 1.00 17.53 ? 132 ILE B CD1 1 
ATOM   2832 N N   . ASP B 1 133 ? 35.890 25.082  32.676 1.00 10.05 ? 133 ASP B N   1 
ATOM   2833 C CA  . ASP B 1 133 ? 35.138 25.980  31.806 1.00 10.68 ? 133 ASP B CA  1 
ATOM   2834 C C   . ASP B 1 133 ? 33.813 25.364  31.332 1.00 9.66  ? 133 ASP B C   1 
ATOM   2835 O O   . ASP B 1 133 ? 32.805 26.061  31.220 1.00 10.77 ? 133 ASP B O   1 
ATOM   2836 C CB  . ASP B 1 133 ? 36.007 26.424  30.620 1.00 14.20 ? 133 ASP B CB  1 
ATOM   2837 C CG  . ASP B 1 133 ? 37.113 27.396  31.020 1.00 18.02 ? 133 ASP B CG  1 
ATOM   2838 O OD1 . ASP B 1 133 ? 37.163 27.863  32.180 1.00 18.91 ? 133 ASP B OD1 1 
ATOM   2839 O OD2 . ASP B 1 133 ? 37.938 27.708  30.145 1.00 16.58 ? 133 ASP B OD2 1 
ATOM   2840 N N   . ALA B 1 134 ? 33.816 24.054  31.075 1.00 10.87 ? 134 ALA B N   1 
ATOM   2841 C CA  . ALA B 1 134 ? 32.621 23.339  30.630 1.00 9.28  ? 134 ALA B CA  1 
ATOM   2842 C C   . ALA B 1 134 ? 31.553 23.457  31.697 1.00 6.98  ? 134 ALA B C   1 
ATOM   2843 O O   . ALA B 1 134 ? 30.352 23.472  31.402 1.00 7.25  ? 134 ALA B O   1 
ATOM   2844 C CB  . ALA B 1 134 ? 32.950 21.863  30.377 1.00 9.08  ? 134 ALA B CB  1 
ATOM   2845 N N   . ILE B 1 135 ? 31.970 23.465  32.959 1.00 6.91  ? 135 ILE B N   1 
ATOM   2846 C CA  . ILE B 1 135 ? 31.012 23.502  34.061 1.00 9.00  ? 135 ILE B CA  1 
ATOM   2847 C C   . ILE B 1 135 ? 30.381 24.881  34.194 1.00 7.31  ? 135 ILE B C   1 
ATOM   2848 O O   . ILE B 1 135 ? 29.154 25.015  34.243 1.00 6.47  ? 135 ILE B O   1 
ATOM   2849 C CB  . ILE B 1 135 ? 31.643 23.069  35.387 1.00 7.50  ? 135 ILE B CB  1 
ATOM   2850 C CG1 . ILE B 1 135 ? 32.176 21.633  35.239 1.00 10.70 ? 135 ILE B CG1 1 
ATOM   2851 C CG2 . ILE B 1 135 ? 30.613 23.201  36.506 1.00 9.12  ? 135 ILE B CG2 1 
ATOM   2852 C CD1 . ILE B 1 135 ? 32.822 21.054  36.494 1.00 10.16 ? 135 ILE B CD1 1 
ATOM   2853 N N   . THR B 1 136 ? 31.212 25.908  34.215 1.00 8.58  ? 136 THR B N   1 
ATOM   2854 C CA  . THR B 1 136 ? 30.652 27.241  34.333 1.00 10.38 ? 136 THR B CA  1 
ATOM   2855 C C   . THR B 1 136 ? 29.798 27.618  33.110 1.00 9.04  ? 136 THR B C   1 
ATOM   2856 O O   . THR B 1 136 ? 28.805 28.346  33.252 1.00 8.90  ? 136 THR B O   1 
ATOM   2857 C CB  . THR B 1 136 ? 31.719 28.274  34.675 1.00 16.15 ? 136 THR B CB  1 
ATOM   2858 O OG1 . THR B 1 136 ? 32.711 28.288  33.655 1.00 16.38 ? 136 THR B OG1 1 
ATOM   2859 C CG2 . THR B 1 136 ? 32.385 27.887  35.994 1.00 18.56 ? 136 THR B CG2 1 
ATOM   2860 N N   . GLU B 1 137 ? 30.173 27.112  31.925 1.00 10.49 ? 137 GLU B N   1 
ATOM   2861 C CA  . GLU B 1 137 ? 29.361 27.329  30.725 1.00 8.48  ? 137 GLU B CA  1 
ATOM   2862 C C   . GLU B 1 137 ? 27.976 26.708  30.908 1.00 6.86  ? 137 GLU B C   1 
ATOM   2863 O O   . GLU B 1 137 ? 26.961 27.309  30.550 1.00 7.11  ? 137 GLU B O   1 
ATOM   2864 C CB  . GLU B 1 137 ? 30.038 26.747  29.477 1.00 9.82  ? 137 GLU B CB  1 
ATOM   2865 C CG  . GLU B 1 137 ? 31.259 27.517  28.990 1.00 9.88  ? 137 GLU B CG  1 
ATOM   2866 C CD  . GLU B 1 137 ? 32.063 26.701  27.971 1.00 10.10 ? 137 GLU B CD  1 
ATOM   2867 O OE1 . GLU B 1 137 ? 31.571 25.635  27.517 1.00 14.03 ? 137 GLU B OE1 1 
ATOM   2868 O OE2 . GLU B 1 137 ? 33.177 27.162  27.636 1.00 13.98 ? 137 GLU B OE2 1 
ATOM   2869 N N   . ALA B 1 138 ? 27.938 25.502  31.465 1.00 6.56  ? 138 ALA B N   1 
ATOM   2870 C CA  . ALA B 1 138 ? 26.650 24.882  31.753 1.00 6.86  ? 138 ALA B CA  1 
ATOM   2871 C C   . ALA B 1 138 ? 25.821 25.707  32.736 1.00 5.66  ? 138 ALA B C   1 
ATOM   2872 O O   . ALA B 1 138 ? 24.623 25.942  32.507 1.00 6.53  ? 138 ALA B O   1 
ATOM   2873 C CB  . ALA B 1 138 ? 26.862 23.448  32.282 1.00 8.46  ? 138 ALA B CB  1 
ATOM   2874 N N   . TYR B 1 139 ? 26.442 26.155  33.826 1.00 6.09  ? 139 TYR B N   1 
ATOM   2875 C CA  . TYR B 1 139 ? 25.726 27.008  34.782 1.00 6.80  ? 139 TYR B CA  1 
ATOM   2876 C C   . TYR B 1 139 ? 25.178 28.256  34.114 1.00 7.74  ? 139 TYR B C   1 
ATOM   2877 O O   . TYR B 1 139 ? 24.075 28.700  34.400 1.00 8.32  ? 139 TYR B O   1 
ATOM   2878 C CB  . TYR B 1 139 ? 26.616 27.416  35.966 1.00 7.01  ? 139 TYR B CB  1 
ATOM   2879 C CG  . TYR B 1 139 ? 27.060 26.289  36.890 1.00 7.43  ? 139 TYR B CG  1 
ATOM   2880 C CD1 . TYR B 1 139 ? 26.521 25.019  36.823 1.00 6.32  ? 139 TYR B CD1 1 
ATOM   2881 C CD2 . TYR B 1 139 ? 28.034 26.521  37.826 1.00 8.83  ? 139 TYR B CD2 1 
ATOM   2882 C CE1 . TYR B 1 139 ? 26.947 24.022  37.678 1.00 6.26  ? 139 TYR B CE1 1 
ATOM   2883 C CE2 . TYR B 1 139 ? 28.465 25.541  38.682 1.00 7.39  ? 139 TYR B CE2 1 
ATOM   2884 C CZ  . TYR B 1 139 ? 27.931 24.285  38.605 1.00 9.10  ? 139 TYR B CZ  1 
ATOM   2885 O OH  . TYR B 1 139 ? 28.363 23.284  39.467 1.00 7.71  ? 139 TYR B OH  1 
ATOM   2886 N N   . ASP B 1 140 ? 26.020 28.902  33.301 1.00 7.17  ? 140 ASP B N   1 
ATOM   2887 C CA  . ASP B 1 140 ? 25.597 30.106  32.588 1.00 8.22  ? 140 ASP B CA  1 
ATOM   2888 C C   . ASP B 1 140 ? 24.380 29.834  31.707 1.00 8.27  ? 140 ASP B C   1 
ATOM   2889 O O   . ASP B 1 140 ? 23.425 30.607  31.689 1.00 8.61  ? 140 ASP B O   1 
ATOM   2890 C CB  . ASP B 1 140 ? 26.726 30.687  31.719 1.00 10.16 ? 140 ASP B CB  1 
ATOM   2891 C CG  . ASP B 1 140 ? 27.867 31.285  32.515 1.00 12.15 ? 140 ASP B CG  1 
ATOM   2892 O OD1 . ASP B 1 140 ? 27.707 31.549  33.729 1.00 12.22 ? 140 ASP B OD1 1 
ATOM   2893 O OD2 . ASP B 1 140 ? 28.941 31.532  31.914 1.00 13.69 ? 140 ASP B OD2 1 
ATOM   2894 N N   . PHE B 1 141 ? 24.421 28.733  30.975 1.00 6.59  ? 141 PHE B N   1 
ATOM   2895 C CA  . PHE B 1 141 ? 23.257 28.402  30.152 1.00 7.26  ? 141 PHE B CA  1 
ATOM   2896 C C   . PHE B 1 141 ? 21.985 28.170  30.975 1.00 6.70  ? 141 PHE B C   1 
ATOM   2897 O O   . PHE B 1 141 ? 20.933 28.648  30.606 1.00 6.94  ? 141 PHE B O   1 
ATOM   2898 C CB  . PHE B 1 141 ? 23.479 27.145  29.284 1.00 8.95  ? 141 PHE B CB  1 
ATOM   2899 C CG  . PHE B 1 141 ? 24.443 27.338  28.150 1.00 10.26 ? 141 PHE B CG  1 
ATOM   2900 C CD1 . PHE B 1 141 ? 24.258 28.338  27.217 1.00 10.00 ? 141 PHE B CD1 1 
ATOM   2901 C CD2 . PHE B 1 141 ? 25.513 26.464  27.984 1.00 9.95  ? 141 PHE B CD2 1 
ATOM   2902 C CE1 . PHE B 1 141 ? 25.152 28.508  26.144 1.00 11.14 ? 141 PHE B CE1 1 
ATOM   2903 C CE2 . PHE B 1 141 ? 26.427 26.634  26.929 1.00 8.61  ? 141 PHE B CE2 1 
ATOM   2904 C CZ  . PHE B 1 141 ? 26.236 27.651  26.004 1.00 12.24 ? 141 PHE B CZ  1 
ATOM   2905 N N   . VAL B 1 142 ? 22.074 27.404  32.064 1.00 6.91  ? 142 VAL B N   1 
ATOM   2906 C CA  . VAL B 1 142 ? 20.879 27.081  32.838 1.00 6.80  ? 142 VAL B CA  1 
ATOM   2907 C C   . VAL B 1 142 ? 20.319 28.324  33.522 1.00 8.79  ? 142 VAL B C   1 
ATOM   2908 O O   . VAL B 1 142 ? 19.121 28.506  33.568 1.00 8.91  ? 142 VAL B O   1 
ATOM   2909 C CB  . VAL B 1 142 ? 21.133 25.970  33.865 1.00 6.67  ? 142 VAL B CB  1 
ATOM   2910 C CG1 . VAL B 1 142 ? 19.857 25.673  34.630 1.00 9.87  ? 142 VAL B CG1 1 
ATOM   2911 C CG2 . VAL B 1 142 ? 21.656 24.716  33.163 1.00 8.56  ? 142 VAL B CG2 1 
ATOM   2912 N N   . GLU B 1 143 ? 21.190 29.208  34.024 1.00 7.97  ? 143 GLU B N   1 
ATOM   2913 C CA  . GLU B 1 143 ? 20.740 30.473  34.620 1.00 10.06 ? 143 GLU B CA  1 
ATOM   2914 C C   . GLU B 1 143 ? 19.832 31.199  33.652 1.00 10.13 ? 143 GLU B C   1 
ATOM   2915 O O   . GLU B 1 143 ? 18.840 31.801  34.061 1.00 12.33 ? 143 GLU B O   1 
ATOM   2916 C CB  . GLU B 1 143 ? 21.926 31.375  34.993 1.00 10.65 ? 143 GLU B CB  1 
ATOM   2917 C CG  . GLU B 1 143 ? 21.571 32.747  35.612 1.00 10.12 ? 143 GLU B CG  1 
ATOM   2918 C CD  . GLU B 1 143 ? 21.052 32.623  37.059 1.00 13.11 ? 143 GLU B CD  1 
ATOM   2919 O OE1 . GLU B 1 143 ? 21.183 31.510  37.634 1.00 12.94 ? 143 GLU B OE1 1 
ATOM   2920 O OE2 . GLU B 1 143 ? 20.487 33.599  37.609 1.00 12.30 ? 143 GLU B OE2 1 
ATOM   2921 N N   . ALA B 1 144 ? 20.159 31.152  32.366 1.00 10.93 ? 144 ALA B N   1 
ATOM   2922 C CA  . ALA B 1 144 ? 19.409 31.931  31.374 1.00 13.43 ? 144 ALA B CA  1 
ATOM   2923 C C   . ALA B 1 144 ? 18.070 31.283  31.052 1.00 12.60 ? 144 ALA B C   1 
ATOM   2924 O O   . ALA B 1 144 ? 17.201 31.939  30.476 1.00 13.93 ? 144 ALA B O   1 
ATOM   2925 C CB  . ALA B 1 144 ? 20.219 32.143  30.095 1.00 13.32 ? 144 ALA B CB  1 
ATOM   2926 N N   . PHE B 1 145 ? 17.910 30.007  31.396 1.00 11.54 ? 145 PHE B N   1 
ATOM   2927 C CA  . PHE B 1 145 ? 16.670 29.296  31.072 1.00 10.50 ? 145 PHE B CA  1 
ATOM   2928 C C   . PHE B 1 145 ? 15.471 29.908  31.797 1.00 13.87 ? 145 PHE B C   1 
ATOM   2929 O O   . PHE B 1 145 ? 14.346 29.925  31.276 1.00 17.72 ? 145 PHE B O   1 
ATOM   2930 C CB  . PHE B 1 145 ? 16.718 27.808  31.471 1.00 9.43  ? 145 PHE B CB  1 
ATOM   2931 C CG  . PHE B 1 145 ? 17.611 26.950  30.629 1.00 8.89  ? 145 PHE B CG  1 
ATOM   2932 C CD1 . PHE B 1 145 ? 18.053 27.340  29.383 1.00 10.74 ? 145 PHE B CD1 1 
ATOM   2933 C CD2 . PHE B 1 145 ? 18.015 25.712  31.122 1.00 7.87  ? 145 PHE B CD2 1 
ATOM   2934 C CE1 . PHE B 1 145 ? 18.892 26.504  28.633 1.00 10.42 ? 145 PHE B CE1 1 
ATOM   2935 C CE2 . PHE B 1 145 ? 18.840 24.855  30.391 1.00 7.90  ? 145 PHE B CE2 1 
ATOM   2936 C CZ  . PHE B 1 145 ? 19.284 25.248  29.148 1.00 7.82  ? 145 PHE B CZ  1 
ATOM   2937 N N   . PHE B 1 146 ? 15.716 30.414  33.004 1.00 17.34 ? 146 PHE B N   1 
ATOM   2938 C CA  . PHE B 1 146 ? 14.621 30.780  33.898 1.00 15.41 ? 146 PHE B CA  1 
ATOM   2939 C C   . PHE B 1 146 ? 13.744 31.970  33.445 1.00 22.43 ? 146 PHE B C   1 
ATOM   2940 O O   . PHE B 1 146 ? 12.512 31.894  33.534 1.00 27.03 ? 146 PHE B O   1 
ATOM   2941 C CB  . PHE B 1 146 ? 15.120 30.889  35.342 1.00 14.98 ? 146 PHE B CB  1 
ATOM   2942 C CG  . PHE B 1 146 ? 15.691 29.591  35.860 1.00 15.00 ? 146 PHE B CG  1 
ATOM   2943 C CD1 . PHE B 1 146 ? 14.841 28.552  36.173 1.00 13.38 ? 146 PHE B CD1 1 
ATOM   2944 C CD2 . PHE B 1 146 ? 17.058 29.414  36.007 1.00 13.50 ? 146 PHE B CD2 1 
ATOM   2945 C CE1 . PHE B 1 146 ? 15.328 27.351  36.607 1.00 11.60 ? 146 PHE B CE1 1 
ATOM   2946 C CE2 . PHE B 1 146 ? 17.558 28.223  36.459 1.00 11.98 ? 146 PHE B CE2 1 
ATOM   2947 C CZ  . PHE B 1 146 ? 16.690 27.173  36.743 1.00 9.85  ? 146 PHE B CZ  1 
ATOM   2948 N N   . LYS B 1 147 ? 14.350 33.035  32.923 1.00 21.75 ? 147 LYS B N   1 
ATOM   2949 C CA  . LYS B 1 147 ? 13.559 34.205  32.501 1.00 25.30 ? 147 LYS B CA  1 
ATOM   2950 C C   . LYS B 1 147 ? 12.601 34.663  33.615 1.00 29.68 ? 147 LYS B C   1 
ATOM   2951 O O   . LYS B 1 147 ? 13.032 34.917  34.743 1.00 33.53 ? 147 LYS B O   1 
ATOM   2952 C CB  . LYS B 1 147 ? 12.744 33.893  31.241 1.00 30.11 ? 147 LYS B CB  1 
ATOM   2953 C CG  . LYS B 1 147 ? 13.445 34.176  29.919 1.00 32.48 ? 147 LYS B CG  1 
ATOM   2954 C CD  . LYS B 1 147 ? 12.485 33.940  28.738 1.00 34.07 ? 147 LYS B CD  1 
ATOM   2955 C CE  . LYS B 1 147 ? 12.790 32.632  27.992 1.00 34.78 ? 147 LYS B CE  1 
ATOM   2956 N NZ  . LYS B 1 147 ? 12.971 31.446  28.886 1.00 34.22 ? 147 LYS B NZ  1 
ATOM   2957 N N   . ASP B 1 148 ? 11.306 34.736  33.296 1.00 30.47 ? 148 ASP B N   1 
ATOM   2958 C CA  . ASP B 1 148 ? 10.283 35.102  34.279 1.00 32.88 ? 148 ASP B CA  1 
ATOM   2959 C C   . ASP B 1 148 ? 9.641  33.842  34.862 1.00 32.49 ? 148 ASP B C   1 
ATOM   2960 O O   . ASP B 1 148 ? 8.545  33.911  35.444 1.00 34.63 ? 148 ASP B O   1 
ATOM   2961 C CB  . ASP B 1 148 ? 9.185  35.967  33.646 1.00 35.75 ? 148 ASP B CB  1 
ATOM   2962 C CG  . ASP B 1 148 ? 9.711  36.900  32.572 1.00 37.57 ? 148 ASP B CG  1 
ATOM   2963 O OD1 . ASP B 1 148 ? 10.037 38.059  32.906 1.00 38.27 ? 148 ASP B OD1 1 
ATOM   2964 O OD2 . ASP B 1 148 ? 9.769  36.484  31.388 1.00 38.55 ? 148 ASP B OD2 1 
ATOM   2965 N N   . GLN B 1 149 ? 10.321 32.702  34.709 1.00 27.36 ? 149 GLN B N   1 
ATOM   2966 C CA  . GLN B 1 149 ? 9.742  31.413  35.082 1.00 27.07 ? 149 GLN B CA  1 
ATOM   2967 C C   . GLN B 1 149 ? 10.468 30.680  36.195 1.00 23.49 ? 149 GLN B C   1 
ATOM   2968 O O   . GLN B 1 149 ? 11.639 30.960  36.496 1.00 22.75 ? 149 GLN B O   1 
ATOM   2969 C CB  . GLN B 1 149 ? 9.651  30.498  33.868 1.00 29.13 ? 149 GLN B CB  1 
ATOM   2970 C CG  . GLN B 1 149 ? 8.861  31.110  32.747 1.00 32.86 ? 149 GLN B CG  1 
ATOM   2971 C CD  . GLN B 1 149 ? 8.241  30.063  31.844 1.00 34.43 ? 149 GLN B CD  1 
ATOM   2972 O OE1 . GLN B 1 149 ? 8.947  29.247  31.246 1.00 34.24 ? 149 GLN B OE1 1 
ATOM   2973 N NE2 . GLN B 1 149 ? 6.909  30.084  31.736 1.00 34.37 ? 149 GLN B NE2 1 
ATOM   2974 N N   . THR B 1 150 ? 9.744  29.724  36.779 1.00 18.69 ? 150 THR B N   1 
ATOM   2975 C CA  . THR B 1 150 ? 10.162 29.035  37.995 1.00 16.48 ? 150 THR B CA  1 
ATOM   2976 C C   . THR B 1 150 ? 11.048 27.833  37.723 1.00 11.40 ? 150 THR B C   1 
ATOM   2977 O O   . THR B 1 150 ? 11.959 27.557  38.474 1.00 12.58 ? 150 THR B O   1 
ATOM   2978 C CB  . THR B 1 150 ? 8.943  28.529  38.764 1.00 21.23 ? 150 THR B CB  1 
ATOM   2979 O OG1 . THR B 1 150 ? 7.998  29.586  38.899 1.00 23.52 ? 150 THR B OG1 1 
ATOM   2980 C CG2 . THR B 1 150 ? 9.351  28.085  40.125 1.00 22.42 ? 150 THR B CG2 1 
ATOM   2981 N N   . TYR B 1 151 ? 10.756 27.140  36.627 1.00 9.65  ? 151 TYR B N   1 
ATOM   2982 C CA  . TYR B 1 151 ? 11.399 25.868  36.359 1.00 8.49  ? 151 TYR B CA  1 
ATOM   2983 C C   . TYR B 1 151 ? 12.143 25.918  35.029 1.00 7.49  ? 151 TYR B C   1 
ATOM   2984 O O   . TYR B 1 151 ? 12.081 26.912  34.319 1.00 9.33  ? 151 TYR B O   1 
ATOM   2985 C CB  . TYR B 1 151 ? 10.364 24.736  36.398 1.00 9.49  ? 151 TYR B CB  1 
ATOM   2986 C CG  . TYR B 1 151 ? 9.700  24.586  37.743 1.00 9.83  ? 151 TYR B CG  1 
ATOM   2987 C CD1 . TYR B 1 151 ? 10.294 23.844  38.746 1.00 8.96  ? 151 TYR B CD1 1 
ATOM   2988 C CD2 . TYR B 1 151 ? 8.480  25.200  38.011 1.00 12.06 ? 151 TYR B CD2 1 
ATOM   2989 C CE1 . TYR B 1 151 ? 9.671  23.688  40.000 1.00 10.50 ? 151 TYR B CE1 1 
ATOM   2990 C CE2 . TYR B 1 151 ? 7.854  25.060  39.262 1.00 15.00 ? 151 TYR B CE2 1 
ATOM   2991 C CZ  . TYR B 1 151 ? 8.465  24.297  40.247 1.00 14.09 ? 151 TYR B CZ  1 
ATOM   2992 O OH  . TYR B 1 151 ? 7.893  24.128  41.498 1.00 14.68 ? 151 TYR B OH  1 
ATOM   2993 N N   . VAL B 1 152 ? 12.876 24.852  34.710 1.00 6.42  ? 152 VAL B N   1 
ATOM   2994 C CA  . VAL B 1 152 ? 13.691 24.889  33.482 1.00 6.35  ? 152 VAL B CA  1 
ATOM   2995 C C   . VAL B 1 152 ? 12.920 24.836  32.180 1.00 10.55 ? 152 VAL B C   1 
ATOM   2996 O O   . VAL B 1 152 ? 13.412 25.272  31.145 1.00 10.43 ? 152 VAL B O   1 
ATOM   2997 C CB  . VAL B 1 152 ? 14.749 23.751  33.460 1.00 7.25  ? 152 VAL B CB  1 
ATOM   2998 C CG1 . VAL B 1 152 ? 15.625 23.887  34.698 1.00 8.51  ? 152 VAL B CG1 1 
ATOM   2999 C CG2 . VAL B 1 152 ? 14.084 22.357  33.376 1.00 9.32  ? 152 VAL B CG2 1 
ATOM   3000 N N   . ALA B 1 153 ? 11.689 24.327  32.233 1.00 7.66  ? 153 ALA B N   1 
ATOM   3001 C CA  . ALA B 1 153 ? 10.902 24.093  31.023 1.00 8.79  ? 153 ALA B CA  1 
ATOM   3002 C C   . ALA B 1 153 ? 9.456  24.519  31.223 1.00 12.41 ? 153 ALA B C   1 
ATOM   3003 O O   . ALA B 1 153 ? 8.527  23.770  30.892 1.00 17.52 ? 153 ALA B O   1 
ATOM   3004 C CB  . ALA B 1 153 ? 10.991 22.594  30.598 1.00 9.43  ? 153 ALA B CB  1 
ATOM   3005 N N   . GLY B 1 154 ? 9.256  25.709  31.774 1.00 9.63  ? 154 GLY B N   1 
ATOM   3006 C CA  . GLY B 1 154 ? 7.917  26.237  31.990 1.00 11.08 ? 154 GLY B CA  1 
ATOM   3007 C C   . GLY B 1 154 ? 7.680  26.613  33.447 1.00 12.77 ? 154 GLY B C   1 
ATOM   3008 O O   . GLY B 1 154 ? 8.636  26.760  34.243 1.00 15.18 ? 154 GLY B O   1 
ATOM   3009 N N   . ASN B 1 155 ? 6.406  26.784  33.797 1.00 12.85 ? 155 ASN B N   1 
ATOM   3010 C CA  . ASN B 1 155 ? 6.069  27.208  35.142 1.00 13.99 ? 155 ASN B CA  1 
ATOM   3011 C C   . ASN B 1 155 ? 5.660  26.060  36.044 1.00 15.04 ? 155 ASN B C   1 
ATOM   3012 O O   . ASN B 1 155 ? 5.260  26.285  37.189 1.00 15.61 ? 155 ASN B O   1 
ATOM   3013 C CB  . ASN B 1 155 ? 4.962  28.259  35.096 1.00 18.05 ? 155 ASN B CB  1 
ATOM   3014 C CG  . ASN B 1 155 ? 5.477  29.649  35.346 1.00 26.56 ? 155 ASN B CG  1 
ATOM   3015 O OD1 . ASN B 1 155 ? 6.476  29.839  36.049 1.00 28.63 ? 155 ASN B OD1 1 
ATOM   3016 N ND2 . ASN B 1 155 ? 4.780  30.646  34.795 1.00 29.33 ? 155 ASN B ND2 1 
ATOM   3017 N N   . GLN B 1 156 ? 5.754  24.840  35.521 1.00 13.39 ? 156 GLN B N   1 
ATOM   3018 C CA  . GLN B 1 156 ? 5.499  23.642  36.317 1.00 13.66 ? 156 GLN B CA  1 
ATOM   3019 C C   . GLN B 1 156 ? 6.740  22.753  36.355 1.00 10.14 ? 156 GLN B C   1 
ATOM   3020 O O   . GLN B 1 156 ? 7.552  22.763  35.425 1.00 10.77 ? 156 GLN B O   1 
ATOM   3021 C CB  . GLN B 1 156 ? 4.301  22.854  35.760 1.00 18.03 ? 156 GLN B CB  1 
ATOM   3022 C CG  . GLN B 1 156 ? 3.034  23.692  35.522 1.00 23.16 ? 156 GLN B CG  1 
ATOM   3023 C CD  . GLN B 1 156 ? 2.550  24.386  36.777 1.00 29.22 ? 156 GLN B CD  1 
ATOM   3024 O OE1 . GLN B 1 156 ? 2.270  25.593  36.768 1.00 33.73 ? 156 GLN B OE1 1 
ATOM   3025 N NE2 . GLN B 1 156 ? 2.432  23.630  37.866 1.00 29.77 ? 156 GLN B NE2 1 
ATOM   3026 N N   . LEU B 1 157 ? 6.877  21.991  37.437 1.00 9.13  ? 157 LEU B N   1 
ATOM   3027 C CA  . LEU B 1 157 ? 7.921  20.986  37.586 1.00 8.54  ? 157 LEU B CA  1 
ATOM   3028 C C   . LEU B 1 157 ? 7.745  19.921  36.493 1.00 6.09  ? 157 LEU B C   1 
ATOM   3029 O O   . LEU B 1 157 ? 6.654  19.460  36.261 1.00 7.25  ? 157 LEU B O   1 
ATOM   3030 C CB  . LEU B 1 157 ? 7.768  20.350  38.980 1.00 10.78 ? 157 LEU B CB  1 
ATOM   3031 C CG  . LEU B 1 157 ? 8.757  19.243  39.361 1.00 9.23  ? 157 LEU B CG  1 
ATOM   3032 C CD1 . LEU B 1 157 ? 10.167 19.775  39.651 1.00 7.67  ? 157 LEU B CD1 1 
ATOM   3033 C CD2 . LEU B 1 157 ? 8.207  18.446  40.562 1.00 5.88  ? 157 LEU B CD2 1 
ATOM   3034 N N   . THR B 1 158 ? 8.829  19.544  35.826 1.00 6.01  ? 158 THR B N   1 
ATOM   3035 C CA  . THR B 1 158 ? 8.768  18.534  34.784 1.00 5.33  ? 158 THR B CA  1 
ATOM   3036 C C   . THR B 1 158 ? 9.969  17.616  34.963 1.00 5.71  ? 158 THR B C   1 
ATOM   3037 O O   . THR B 1 158 ? 10.885 17.877  35.763 1.00 5.42  ? 158 THR B O   1 
ATOM   3038 C CB  . THR B 1 158 ? 8.800  19.109  33.346 1.00 5.72  ? 158 THR B CB  1 
ATOM   3039 O OG1 . THR B 1 158 ? 10.097 19.704  33.118 1.00 5.88  ? 158 THR B OG1 1 
ATOM   3040 C CG2 . THR B 1 158 ? 7.669  20.128  33.126 1.00 8.02  ? 158 THR B CG2 1 
ATOM   3041 N N   . ILE B 1 159 ? 9.983  16.544  34.187 1.00 5.38  ? 159 ILE B N   1 
ATOM   3042 C CA  . ILE B 1 159 ? 11.115 15.646  34.207 1.00 4.63  ? 159 ILE B CA  1 
ATOM   3043 C C   . ILE B 1 159 ? 12.409 16.315  33.775 1.00 5.43  ? 159 ILE B C   1 
ATOM   3044 O O   . ILE B 1 159 ? 13.482 15.813  34.085 1.00 4.34  ? 159 ILE B O   1 
ATOM   3045 C CB  . ILE B 1 159 ? 10.860 14.349  33.409 1.00 3.85  ? 159 ILE B CB  1 
ATOM   3046 C CG1 . ILE B 1 159 ? 10.536 14.634  31.949 1.00 4.26  ? 159 ILE B CG1 1 
ATOM   3047 C CG2 . ILE B 1 159 ? 9.738  13.513  34.109 1.00 7.96  ? 159 ILE B CG2 1 
ATOM   3048 C CD1 . ILE B 1 159 ? 10.267 13.341  31.140 1.00 5.64  ? 159 ILE B CD1 1 
ATOM   3049 N N   . ALA B 1 160 ? 12.336 17.437  33.062 1.00 5.68  ? 160 ALA B N   1 
ATOM   3050 C CA  . ALA B 1 160 ? 13.568 18.146  32.734 1.00 5.11  ? 160 ALA B CA  1 
ATOM   3051 C C   . ALA B 1 160 ? 14.193 18.734  33.996 1.00 5.47  ? 160 ALA B C   1 
ATOM   3052 O O   . ALA B 1 160 ? 15.406 18.813  34.076 1.00 3.95  ? 160 ALA B O   1 
ATOM   3053 C CB  . ALA B 1 160 ? 13.327 19.259  31.695 1.00 5.47  ? 160 ALA B CB  1 
ATOM   3054 N N   . ASP B 1 161 ? 13.389 19.145  34.976 1.00 4.15  ? 161 ASP B N   1 
ATOM   3055 C CA  . ASP B 1 161 ? 13.970 19.620  36.238 1.00 4.72  ? 161 ASP B CA  1 
ATOM   3056 C C   . ASP B 1 161 ? 14.687 18.488  36.970 1.00 4.18  ? 161 ASP B C   1 
ATOM   3057 O O   . ASP B 1 161 ? 15.777 18.671  37.523 1.00 5.26  ? 161 ASP B O   1 
ATOM   3058 C CB  . ASP B 1 161 ? 12.920 20.252  37.153 1.00 6.80  ? 161 ASP B CB  1 
ATOM   3059 C CG  . ASP B 1 161 ? 12.299 21.459  36.531 1.00 5.76  ? 161 ASP B CG  1 
ATOM   3060 O OD1 . ASP B 1 161 ? 12.947 22.536  36.522 1.00 7.15  ? 161 ASP B OD1 1 
ATOM   3061 O OD2 . ASP B 1 161 ? 11.135 21.338  36.055 1.00 6.72  ? 161 ASP B OD2 1 
ATOM   3062 N N   . PHE B 1 162 ? 14.091 17.289  36.932 1.00 5.33  ? 162 PHE B N   1 
ATOM   3063 C CA  . PHE B 1 162 ? 14.689 16.126  37.580 1.00 4.89  ? 162 PHE B CA  1 
ATOM   3064 C C   . PHE B 1 162 ? 16.004 15.773  36.894 1.00 2.70  ? 162 PHE B C   1 
ATOM   3065 O O   . PHE B 1 162 ? 17.029 15.484  37.550 1.00 5.72  ? 162 PHE B O   1 
ATOM   3066 C CB  . PHE B 1 162 ? 13.759 14.891  37.560 1.00 4.96  ? 162 PHE B CB  1 
ATOM   3067 C CG  . PHE B 1 162 ? 12.488 15.062  38.333 1.00 6.33  ? 162 PHE B CG  1 
ATOM   3068 C CD1 . PHE B 1 162 ? 12.368 15.964  39.386 1.00 4.76  ? 162 PHE B CD1 1 
ATOM   3069 C CD2 . PHE B 1 162 ? 11.396 14.293  38.010 1.00 6.54  ? 162 PHE B CD2 1 
ATOM   3070 C CE1 . PHE B 1 162 ? 11.166 16.097  40.084 1.00 5.80  ? 162 PHE B CE1 1 
ATOM   3071 C CE2 . PHE B 1 162 ? 10.219 14.420  38.712 1.00 6.56  ? 162 PHE B CE2 1 
ATOM   3072 C CZ  . PHE B 1 162 ? 10.113 15.304  39.747 1.00 7.24  ? 162 PHE B CZ  1 
ATOM   3073 N N   . SER B 1 163 ? 15.991 15.774  35.563 1.00 2.70  ? 163 SER B N   1 
ATOM   3074 C CA  . SER B 1 163 ? 17.227 15.510  34.814 1.00 4.09  ? 163 SER B CA  1 
ATOM   3075 C C   . SER B 1 163 ? 18.327 16.512  35.186 1.00 4.03  ? 163 SER B C   1 
ATOM   3076 O O   . SER B 1 163 ? 19.444 16.132  35.553 1.00 4.32  ? 163 SER B O   1 
ATOM   3077 C CB  . SER B 1 163 ? 16.951 15.545  33.311 1.00 4.49  ? 163 SER B CB  1 
ATOM   3078 O OG  . SER B 1 163 ? 18.086 15.128  32.564 1.00 6.71  ? 163 SER B OG  1 
ATOM   3079 N N   . LEU B 1 164 ? 18.026 17.787  35.078 1.00 2.92  ? 164 LEU B N   1 
ATOM   3080 C CA  . LEU B 1 164 ? 19.043 18.822  35.324 1.00 3.94  ? 164 LEU B CA  1 
ATOM   3081 C C   . LEU B 1 164 ? 19.479 18.909  36.794 1.00 3.02  ? 164 LEU B C   1 
ATOM   3082 O O   . LEU B 1 164 ? 20.684 19.093  37.068 1.00 4.23  ? 164 LEU B O   1 
ATOM   3083 C CB  . LEU B 1 164 ? 18.578 20.180  34.772 1.00 4.20  ? 164 LEU B CB  1 
ATOM   3084 C CG  . LEU B 1 164 ? 18.826 20.269  33.267 1.00 3.54  ? 164 LEU B CG  1 
ATOM   3085 C CD1 . LEU B 1 164 ? 17.927 21.351  32.661 1.00 5.74  ? 164 LEU B CD1 1 
ATOM   3086 C CD2 . LEU B 1 164 ? 20.294 20.540  32.932 1.00 5.39  ? 164 LEU B CD2 1 
ATOM   3087 N N   . ILE B 1 165 ? 18.590 18.716  37.757 1.00 3.90  ? 165 ILE B N   1 
ATOM   3088 C CA  . ILE B 1 165 ? 19.039 18.767  39.152 1.00 5.20  ? 165 ILE B CA  1 
ATOM   3089 C C   . ILE B 1 165 ? 19.969 17.599  39.466 1.00 5.36  ? 165 ILE B C   1 
ATOM   3090 O O   . ILE B 1 165 ? 20.908 17.748  40.239 1.00 5.77  ? 165 ILE B O   1 
ATOM   3091 C CB  . ILE B 1 165 ? 17.866 18.851  40.182 1.00 4.49  ? 165 ILE B CB  1 
ATOM   3092 C CG1 . ILE B 1 165 ? 18.341 19.314  41.576 1.00 6.87  ? 165 ILE B CG1 1 
ATOM   3093 C CG2 . ILE B 1 165 ? 17.116 17.543  40.305 1.00 6.28  ? 165 ILE B CG2 1 
ATOM   3094 C CD1 . ILE B 1 165 ? 19.171 20.613  41.575 1.00 6.31  ? 165 ILE B CD1 1 
ATOM   3095 N N   . SER B 1 166 ? 19.717 16.436  38.861 1.00 5.89  ? 166 SER B N   1 
ATOM   3096 C CA  . SER B 1 166 ? 20.543 15.259  39.131 1.00 4.82  ? 166 SER B CA  1 
ATOM   3097 C C   . SER B 1 166 ? 22.018 15.538  38.801 1.00 3.41  ? 166 SER B C   1 
ATOM   3098 O O   . SER B 1 166 ? 22.934 15.195  39.578 1.00 5.79  ? 166 SER B O   1 
ATOM   3099 C CB  . SER B 1 166 ? 19.992 13.978  38.427 1.00 3.81  ? 166 SER B CB  1 
ATOM   3100 O OG  . SER B 1 166 ? 20.234 13.984  37.028 1.00 5.16  ? 166 SER B OG  1 
ATOM   3101 N N   . SER B 1 167 ? 22.248 16.142  37.646 1.00 4.88  ? 167 SER B N   1 
ATOM   3102 C CA  . SER B 1 167 ? 23.608 16.508  37.273 1.00 3.53  ? 167 SER B CA  1 
ATOM   3103 C C   . SER B 1 167 ? 24.147 17.784  37.893 1.00 5.65  ? 167 SER B C   1 
ATOM   3104 O O   . SER B 1 167 ? 25.303 17.808  38.270 1.00 4.48  ? 167 SER B O   1 
ATOM   3105 C CB  . SER B 1 167 ? 23.793 16.533  35.765 1.00 5.07  ? 167 SER B CB  1 
ATOM   3106 O OG  . SER B 1 167 ? 22.686 17.162  35.159 1.00 6.63  ? 167 SER B OG  1 
ATOM   3107 N N   A ILE B 1 168 ? 23.338 18.824  38.024 0.52 5.82  ? 168 ILE B N   1 
ATOM   3108 N N   B ILE B 1 168 ? 23.324 18.832  38.003 0.48 5.72  ? 168 ILE B N   1 
ATOM   3109 C CA  A ILE B 1 168 ? 23.864 20.045  38.647 0.52 5.29  ? 168 ILE B CA  1 
ATOM   3110 C CA  B ILE B 1 168 ? 23.790 20.082  38.640 0.48 4.85  ? 168 ILE B CA  1 
ATOM   3111 C C   A ILE B 1 168 ? 24.252 19.828  40.113 0.52 5.75  ? 168 ILE B C   1 
ATOM   3112 C C   B ILE B 1 168 ? 24.243 19.819  40.084 0.48 5.67  ? 168 ILE B C   1 
ATOM   3113 O O   A ILE B 1 168 ? 25.292 20.309  40.585 0.52 7.11  ? 168 ILE B O   1 
ATOM   3114 O O   B ILE B 1 168 ? 25.317 20.265  40.511 0.48 6.99  ? 168 ILE B O   1 
ATOM   3115 C CB  A ILE B 1 168 ? 22.923 21.231  38.432 0.52 5.02  ? 168 ILE B CB  1 
ATOM   3116 C CB  B ILE B 1 168 ? 22.747 21.246  38.574 0.48 6.17  ? 168 ILE B CB  1 
ATOM   3117 C CG1 A ILE B 1 168 ? 22.972 21.583  36.952 0.52 5.09  ? 168 ILE B CG1 1 
ATOM   3118 C CG1 B ILE B 1 168 ? 22.481 21.650  37.122 0.48 6.19  ? 168 ILE B CG1 1 
ATOM   3119 C CG2 A ILE B 1 168 ? 23.289 22.407  39.359 0.52 7.52  ? 168 ILE B CG2 1 
ATOM   3120 C CG2 B ILE B 1 168 ? 23.241 22.460  39.368 0.48 8.06  ? 168 ILE B CG2 1 
ATOM   3121 C CD1 A ILE B 1 168 ? 21.878 22.481  36.511 0.52 6.70  ? 168 ILE B CD1 1 
ATOM   3122 C CD1 B ILE B 1 168 ? 23.669 22.322  36.434 0.48 5.97  ? 168 ILE B CD1 1 
ATOM   3123 N N   . SER B 1 169 ? 23.433 19.056  40.820 1.00 5.79  ? 169 SER B N   1 
ATOM   3124 C CA  . SER B 1 169 ? 23.731 18.726  42.204 1.00 5.92  ? 169 SER B CA  1 
ATOM   3125 C C   . SER B 1 169 ? 24.968 17.825  42.335 1.00 4.47  ? 169 SER B C   1 
ATOM   3126 O O   . SER B 1 169 ? 25.481 17.616  43.439 1.00 7.56  ? 169 SER B O   1 
ATOM   3127 C CB  . SER B 1 169 ? 22.517 18.079  42.894 1.00 8.65  ? 169 SER B CB  1 
ATOM   3128 O OG  . SER B 1 169 ? 22.267 16.756  42.405 1.00 6.15  ? 169 SER B OG  1 
ATOM   3129 N N   . SER B 1 170 ? 25.428 17.273  41.217 1.00 6.26  ? 170 SER B N   1 
ATOM   3130 C CA  . SER B 1 170 ? 26.675 16.506  41.199 1.00 6.07  ? 170 SER B CA  1 
ATOM   3131 C C   . SER B 1 170 ? 27.851 17.396  40.835 1.00 6.02  ? 170 SER B C   1 
ATOM   3132 O O   . SER B 1 170 ? 28.960 17.284  41.383 1.00 8.14  ? 170 SER B O   1 
ATOM   3133 C CB  . SER B 1 170 ? 26.573 15.384  40.169 1.00 6.15  ? 170 SER B CB  1 
ATOM   3134 O OG  . SER B 1 170 ? 25.454 14.540  40.437 1.00 5.88  ? 170 SER B OG  1 
ATOM   3135 N N   . LEU B 1 171 ? 27.646 18.245  39.843 1.00 4.63  ? 171 LEU B N   1 
ATOM   3136 C CA  . LEU B 1 171 ? 28.693 19.173  39.426 1.00 5.01  ? 171 LEU B CA  1 
ATOM   3137 C C   . LEU B 1 171 ? 29.194 20.103  40.524 1.00 6.76  ? 171 LEU B C   1 
ATOM   3138 O O   . LEU B 1 171 ? 30.319 20.563  40.470 1.00 8.06  ? 171 LEU B O   1 
ATOM   3139 C CB  . LEU B 1 171 ? 28.205 19.979  38.235 1.00 7.05  ? 171 LEU B CB  1 
ATOM   3140 C CG  . LEU B 1 171 ? 28.228 19.292  36.882 1.00 8.59  ? 171 LEU B CG  1 
ATOM   3141 C CD1 . LEU B 1 171 ? 27.448 20.153  35.880 1.00 8.05  ? 171 LEU B CD1 1 
ATOM   3142 C CD2 . LEU B 1 171 ? 29.677 19.078  36.442 1.00 8.05  ? 171 LEU B CD2 1 
ATOM   3143 N N   . VAL B 1 172 ? 28.352 20.370  41.524 1.00 7.69  ? 172 VAL B N   1 
ATOM   3144 C CA  . VAL B 1 172 ? 28.776 21.243  42.619 1.00 9.44  ? 172 VAL B CA  1 
ATOM   3145 C C   . VAL B 1 172 ? 29.935 20.613  43.396 1.00 9.29  ? 172 VAL B C   1 
ATOM   3146 O O   . VAL B 1 172 ? 30.658 21.328  44.121 1.00 11.65 ? 172 VAL B O   1 
ATOM   3147 C CB  . VAL B 1 172 ? 27.638 21.650  43.590 1.00 12.98 ? 172 VAL B CB  1 
ATOM   3148 C CG1 . VAL B 1 172 ? 26.629 22.572  42.894 1.00 14.27 ? 172 VAL B CG1 1 
ATOM   3149 C CG2 . VAL B 1 172 ? 26.952 20.430  44.201 1.00 11.38 ? 172 VAL B CG2 1 
ATOM   3150 N N   . ALA B 1 173 ? 30.177 19.311  43.212 1.00 7.57  ? 173 ALA B N   1 
ATOM   3151 C CA  . ALA B 1 173 ? 31.326 18.637  43.814 1.00 9.67  ? 173 ALA B CA  1 
ATOM   3152 C C   . ALA B 1 173 ? 32.589 19.275  43.298 1.00 9.42  ? 173 ALA B C   1 
ATOM   3153 O O   . ALA B 1 173 ? 33.621 19.326  43.998 1.00 12.47 ? 173 ALA B O   1 
ATOM   3154 C CB  . ALA B 1 173 ? 31.346 17.156  43.467 1.00 10.68 ? 173 ALA B CB  1 
ATOM   3155 N N   . PHE B 1 174 ? 32.547 19.706  42.041 1.00 9.22  ? 174 PHE B N   1 
ATOM   3156 C CA  . PHE B 1 174 ? 33.709 20.275  41.373 1.00 10.05 ? 174 PHE B CA  1 
ATOM   3157 C C   . PHE B 1 174 ? 33.721 21.793  41.468 1.00 12.64 ? 174 PHE B C   1 
ATOM   3158 O O   . PHE B 1 174 ? 34.750 22.417  41.727 1.00 17.08 ? 174 PHE B O   1 
ATOM   3159 C CB  . PHE B 1 174 ? 33.675 19.909  39.885 1.00 9.95  ? 174 PHE B CB  1 
ATOM   3160 C CG  . PHE B 1 174 ? 33.623 18.431  39.612 1.00 8.51  ? 174 PHE B CG  1 
ATOM   3161 C CD1 . PHE B 1 174 ? 34.731 17.635  39.833 1.00 10.91 ? 174 PHE B CD1 1 
ATOM   3162 C CD2 . PHE B 1 174 ? 32.489 17.868  39.078 1.00 12.19 ? 174 PHE B CD2 1 
ATOM   3163 C CE1 . PHE B 1 174 ? 34.654 16.293  39.560 1.00 11.26 ? 174 PHE B CE1 1 
ATOM   3164 C CE2 . PHE B 1 174 ? 32.421 16.517  38.810 1.00 14.90 ? 174 PHE B CE2 1 
ATOM   3165 C CZ  . PHE B 1 174 ? 33.513 15.735  39.042 1.00 13.39 ? 174 PHE B CZ  1 
ATOM   3166 N N   . VAL B 1 175 ? 32.572 22.393  41.204 1.00 10.22 ? 175 VAL B N   1 
ATOM   3167 C CA  . VAL B 1 175 ? 32.433 23.849  41.245 1.00 13.24 ? 175 VAL B CA  1 
ATOM   3168 C C   . VAL B 1 175 ? 31.154 24.231  41.959 1.00 14.30 ? 175 VAL B C   1 
ATOM   3169 O O   . VAL B 1 175 ? 30.064 24.088  41.390 1.00 10.26 ? 175 VAL B O   1 
ATOM   3170 C CB  . VAL B 1 175 ? 32.381 24.463  39.825 1.00 14.29 ? 175 VAL B CB  1 
ATOM   3171 C CG1 . VAL B 1 175 ? 32.345 26.021  39.891 1.00 12.54 ? 175 VAL B CG1 1 
ATOM   3172 C CG2 . VAL B 1 175 ? 33.583 23.987  39.013 1.00 14.99 ? 175 VAL B CG2 1 
ATOM   3173 N N   . PRO B 1 176 ? 31.253 24.668  43.225 1.00 13.22 ? 176 PRO B N   1 
ATOM   3174 C CA  . PRO B 1 176 ? 30.008 25.081  43.892 1.00 15.76 ? 176 PRO B CA  1 
ATOM   3175 C C   . PRO B 1 176 ? 29.346 26.191  43.102 1.00 16.50 ? 176 PRO B C   1 
ATOM   3176 O O   . PRO B 1 176 ? 30.037 26.948  42.427 1.00 16.76 ? 176 PRO B O   1 
ATOM   3177 C CB  . PRO B 1 176 ? 30.481 25.607  45.244 1.00 15.54 ? 176 PRO B CB  1 
ATOM   3178 C CG  . PRO B 1 176 ? 31.780 24.863  45.494 1.00 15.74 ? 176 PRO B CG  1 
ATOM   3179 C CD  . PRO B 1 176 ? 32.419 24.674  44.131 1.00 14.36 ? 176 PRO B CD  1 
ATOM   3180 N N   . VAL B 1 177 ? 28.024 26.258  43.144 1.00 12.15 ? 177 VAL B N   1 
ATOM   3181 C CA  . VAL B 1 177 ? 27.298 27.336  42.484 1.00 14.09 ? 177 VAL B CA  1 
ATOM   3182 C C   . VAL B 1 177 ? 27.393 28.639  43.270 1.00 13.54 ? 177 VAL B C   1 
ATOM   3183 O O   . VAL B 1 177 ? 26.931 28.722  44.401 1.00 15.74 ? 177 VAL B O   1 
ATOM   3184 C CB  . VAL B 1 177 ? 25.811 26.970  42.313 1.00 12.08 ? 177 VAL B CB  1 
ATOM   3185 C CG1 . VAL B 1 177 ? 25.027 28.172  41.806 1.00 11.49 ? 177 VAL B CG1 1 
ATOM   3186 C CG2 . VAL B 1 177 ? 25.674 25.779  41.361 1.00 14.30 ? 177 VAL B CG2 1 
ATOM   3187 N N   . ASP B 1 178 ? 28.014 29.654  42.671 1.00 14.29 ? 178 ASP B N   1 
ATOM   3188 C CA  . ASP B 1 178 ? 28.112 30.994  43.270 1.00 15.70 ? 178 ASP B CA  1 
ATOM   3189 C C   . ASP B 1 178 ? 26.712 31.613  43.300 1.00 17.06 ? 178 ASP B C   1 
ATOM   3190 O O   . ASP B 1 178 ? 26.163 31.974  42.261 1.00 15.07 ? 178 ASP B O   1 
ATOM   3191 C CB  . ASP B 1 178 ? 29.064 31.814  42.392 1.00 14.86 ? 178 ASP B CB  1 
ATOM   3192 C CG  . ASP B 1 178 ? 29.303 33.227  42.901 1.00 19.10 ? 178 ASP B CG  1 
ATOM   3193 O OD1 . ASP B 1 178 ? 28.507 33.762  43.700 1.00 21.39 ? 178 ASP B OD1 1 
ATOM   3194 O OD2 . ASP B 1 178 ? 30.312 33.818  42.459 1.00 21.04 ? 178 ASP B OD2 1 
ATOM   3195 N N   . ALA B 1 179 ? 26.122 31.717  44.484 1.00 17.54 ? 179 ALA B N   1 
ATOM   3196 C CA  . ALA B 1 179 ? 24.741 32.173  44.581 1.00 16.05 ? 179 ALA B CA  1 
ATOM   3197 C C   . ALA B 1 179 ? 24.544 33.639  44.135 1.00 14.98 ? 179 ALA B C   1 
ATOM   3198 O O   . ALA B 1 179 ? 23.436 34.041  43.752 1.00 18.64 ? 179 ALA B O   1 
ATOM   3199 C CB  . ALA B 1 179 ? 24.193 31.935  45.992 1.00 17.60 ? 179 ALA B CB  1 
ATOM   3200 N N   . ALA B 1 180 ? 25.601 34.440  44.210 1.00 14.01 ? 180 ALA B N   1 
ATOM   3201 C CA  . ALA B 1 180 ? 25.518 35.835  43.794 1.00 17.88 ? 180 ALA B CA  1 
ATOM   3202 C C   . ALA B 1 180 ? 25.473 35.937  42.269 1.00 17.08 ? 180 ALA B C   1 
ATOM   3203 O O   . ALA B 1 180 ? 24.731 36.753  41.692 1.00 13.50 ? 180 ALA B O   1 
ATOM   3204 C CB  . ALA B 1 180 ? 26.692 36.609  44.355 1.00 17.50 ? 180 ALA B CB  1 
ATOM   3205 N N   . LYS B 1 181 ? 26.262 35.098  41.622 1.00 14.03 ? 181 LYS B N   1 
ATOM   3206 C CA  . LYS B 1 181 ? 26.357 35.108  40.180 1.00 12.01 ? 181 LYS B CA  1 
ATOM   3207 C C   . LYS B 1 181 ? 25.180 34.403  39.545 1.00 14.46 ? 181 LYS B C   1 
ATOM   3208 O O   . LYS B 1 181 ? 24.749 34.775  38.453 1.00 14.92 ? 181 LYS B O   1 
ATOM   3209 C CB  . LYS B 1 181 ? 27.659 34.437  39.752 1.00 14.39 ? 181 LYS B CB  1 
ATOM   3210 C CG  . LYS B 1 181 ? 27.756 34.099  38.269 1.00 13.89 ? 181 LYS B CG  1 
ATOM   3211 C CD  . LYS B 1 181 ? 29.203 33.823  37.875 1.00 12.80 ? 181 LYS B CD  1 
ATOM   3212 C CE  . LYS B 1 181 ? 29.382 33.739  36.377 1.00 11.75 ? 181 LYS B CE  1 
ATOM   3213 N NZ  . LYS B 1 181 ? 30.682 33.092  35.983 1.00 18.81 ? 181 LYS B NZ  1 
ATOM   3214 N N   . TYR B 1 182 ? 24.676 33.374  40.235 1.00 11.61 ? 182 TYR B N   1 
ATOM   3215 C CA  . TYR B 1 182 ? 23.631 32.490  39.723 1.00 10.27 ? 182 TYR B CA  1 
ATOM   3216 C C   . TYR B 1 182 ? 22.387 32.542  40.627 1.00 11.73 ? 182 TYR B C   1 
ATOM   3217 O O   . TYR B 1 182 ? 22.013 31.538  41.239 1.00 12.05 ? 182 TYR B O   1 
ATOM   3218 C CB  . TYR B 1 182 ? 24.165 31.060  39.597 1.00 10.23 ? 182 TYR B CB  1 
ATOM   3219 C CG  . TYR B 1 182 ? 25.343 30.931  38.649 1.00 10.56 ? 182 TYR B CG  1 
ATOM   3220 C CD1 . TYR B 1 182 ? 25.191 31.193  37.289 1.00 13.14 ? 182 TYR B CD1 1 
ATOM   3221 C CD2 . TYR B 1 182 ? 26.607 30.596  39.113 1.00 13.46 ? 182 TYR B CD2 1 
ATOM   3222 C CE1 . TYR B 1 182 ? 26.246 31.102  36.415 1.00 12.65 ? 182 TYR B CE1 1 
ATOM   3223 C CE2 . TYR B 1 182 ? 27.676 30.469  38.239 1.00 13.17 ? 182 TYR B CE2 1 
ATOM   3224 C CZ  . TYR B 1 182 ? 27.488 30.732  36.889 1.00 11.70 ? 182 TYR B CZ  1 
ATOM   3225 O OH  . TYR B 1 182 ? 28.522 30.630  36.000 1.00 11.98 ? 182 TYR B OH  1 
ATOM   3226 N N   . PRO B 1 183 ? 21.730 33.707  40.706 1.00 15.18 ? 183 PRO B N   1 
ATOM   3227 C CA  . PRO B 1 183 ? 20.647 33.725  41.696 1.00 14.62 ? 183 PRO B CA  1 
ATOM   3228 C C   . PRO B 1 183 ? 19.446 32.849  41.314 1.00 12.33 ? 183 PRO B C   1 
ATOM   3229 O O   . PRO B 1 183 ? 18.827 32.247  42.197 1.00 12.48 ? 183 PRO B O   1 
ATOM   3230 C CB  . PRO B 1 183 ? 20.244 35.207  41.751 1.00 15.22 ? 183 PRO B CB  1 
ATOM   3231 C CG  . PRO B 1 183 ? 20.717 35.774  40.438 1.00 14.36 ? 183 PRO B CG  1 
ATOM   3232 C CD  . PRO B 1 183 ? 21.971 35.033  40.111 1.00 16.21 ? 183 PRO B CD  1 
ATOM   3233 N N   . LYS B 1 184 ? 19.121 32.762  40.027 1.00 10.10 ? 184 LYS B N   1 
ATOM   3234 C CA  . LYS B 1 184 ? 17.936 32.004  39.628 1.00 13.42 ? 184 LYS B CA  1 
ATOM   3235 C C   . LYS B 1 184 ? 18.228 30.511  39.708 1.00 9.77  ? 184 LYS B C   1 
ATOM   3236 O O   . LYS B 1 184 ? 17.391 29.736  40.155 1.00 9.12  ? 184 LYS B O   1 
ATOM   3237 C CB  . LYS B 1 184 ? 17.429 32.408  38.231 1.00 12.17 ? 184 LYS B CB  1 
ATOM   3238 C CG  . LYS B 1 184 ? 17.003 33.876  38.124 1.00 13.65 ? 184 LYS B CG  1 
ATOM   3239 C CD  . LYS B 1 184 ? 16.462 34.163  36.732 1.00 16.08 ? 184 LYS B CD  1 
ATOM   3240 C CE  . LYS B 1 184 ? 16.505 35.639  36.393 1.00 21.06 ? 184 LYS B CE  1 
ATOM   3241 N NZ  . LYS B 1 184 ? 15.123 36.170  36.233 1.00 25.68 ? 184 LYS B NZ  1 
ATOM   3242 N N   . LEU B 1 185 ? 19.416 30.099  39.271 1.00 10.41 ? 185 LEU B N   1 
ATOM   3243 C CA  . LEU B 1 185 ? 19.856 28.729  39.429 1.00 9.42  ? 185 LEU B CA  1 
ATOM   3244 C C   . LEU B 1 185 ? 19.891 28.312  40.898 1.00 7.90  ? 185 LEU B C   1 
ATOM   3245 O O   . LEU B 1 185 ? 19.411 27.238  41.254 1.00 7.88  ? 185 LEU B O   1 
ATOM   3246 C CB  . LEU B 1 185 ? 21.250 28.603  38.824 1.00 8.38  ? 185 LEU B CB  1 
ATOM   3247 C CG  . LEU B 1 185 ? 21.911 27.227  38.887 1.00 9.49  ? 185 LEU B CG  1 
ATOM   3248 C CD1 . LEU B 1 185 ? 21.041 26.231  38.171 1.00 10.12 ? 185 LEU B CD1 1 
ATOM   3249 C CD2 . LEU B 1 185 ? 23.285 27.210  38.242 1.00 8.65  ? 185 LEU B CD2 1 
ATOM   3250 N N   . SER B 1 186 ? 20.402 29.187  41.759 1.00 9.47  ? 186 SER B N   1 
ATOM   3251 C CA  . SER B 1 186 ? 20.455 28.887  43.192 1.00 10.55 ? 186 SER B CA  1 
ATOM   3252 C C   . SER B 1 186 ? 19.038 28.747  43.790 1.00 8.81  ? 186 SER B C   1 
ATOM   3253 O O   . SER B 1 186 ? 18.774 27.856  44.603 1.00 10.39 ? 186 SER B O   1 
ATOM   3254 C CB  . SER B 1 186 ? 21.266 29.948  43.946 1.00 12.18 ? 186 SER B CB  1 
ATOM   3255 O OG  . SER B 1 186 ? 22.627 29.924  43.546 1.00 13.80 ? 186 SER B OG  1 
ATOM   3256 N N   . ALA B 1 187 ? 18.145 29.664  43.420 1.00 8.68  ? 187 ALA B N   1 
ATOM   3257 C CA  . ALA B 1 187 ? 16.765 29.594  43.911 1.00 8.95  ? 187 ALA B CA  1 
ATOM   3258 C C   . ALA B 1 187 ? 16.046 28.326  43.450 1.00 8.16  ? 187 ALA B C   1 
ATOM   3259 O O   . ALA B 1 187 ? 15.191 27.784  44.164 1.00 8.19  ? 187 ALA B O   1 
ATOM   3260 C CB  . ALA B 1 187 ? 15.980 30.816  43.491 1.00 9.81  ? 187 ALA B CB  1 
ATOM   3261 N N   . TRP B 1 188 ? 16.347 27.883  42.235 1.00 7.56  ? 188 TRP B N   1 
ATOM   3262 C CA  . TRP B 1 188 ? 15.730 26.687  41.692 1.00 7.04  ? 188 TRP B CA  1 
ATOM   3263 C C   . TRP B 1 188 ? 16.193 25.443  42.443 1.00 6.32  ? 188 TRP B C   1 
ATOM   3264 O O   . TRP B 1 188 ? 15.396 24.575  42.796 1.00 6.98  ? 188 TRP B O   1 
ATOM   3265 C CB  . TRP B 1 188 ? 16.013 26.630  40.188 1.00 6.67  ? 188 TRP B CB  1 
ATOM   3266 C CG  . TRP B 1 188 ? 15.787 25.313  39.475 1.00 7.01  ? 188 TRP B CG  1 
ATOM   3267 C CD1 . TRP B 1 188 ? 14.600 24.821  39.020 1.00 6.70  ? 188 TRP B CD1 1 
ATOM   3268 C CD2 . TRP B 1 188 ? 16.781 24.354  39.109 1.00 5.50  ? 188 TRP B CD2 1 
ATOM   3269 N NE1 . TRP B 1 188 ? 14.794 23.613  38.384 1.00 7.76  ? 188 TRP B NE1 1 
ATOM   3270 C CE2 . TRP B 1 188 ? 16.130 23.311  38.423 1.00 7.02  ? 188 TRP B CE2 1 
ATOM   3271 C CE3 . TRP B 1 188 ? 18.168 24.289  39.276 1.00 5.96  ? 188 TRP B CE3 1 
ATOM   3272 C CZ2 . TRP B 1 188 ? 16.811 22.207  37.919 1.00 7.04  ? 188 TRP B CZ2 1 
ATOM   3273 C CZ3 . TRP B 1 188 ? 18.839 23.176  38.784 1.00 6.89  ? 188 TRP B CZ3 1 
ATOM   3274 C CH2 . TRP B 1 188 ? 18.167 22.171  38.089 1.00 7.68  ? 188 TRP B CH2 1 
ATOM   3275 N N   . ILE B 1 189 ? 17.495 25.377  42.710 1.00 6.18  ? 189 ILE B N   1 
ATOM   3276 C CA  . ILE B 1 189 ? 18.009 24.282  43.548 1.00 6.99  ? 189 ILE B CA  1 
ATOM   3277 C C   . ILE B 1 189 ? 17.295 24.286  44.909 1.00 6.89  ? 189 ILE B C   1 
ATOM   3278 O O   . ILE B 1 189 ? 16.804 23.241  45.369 1.00 7.83  ? 189 ILE B O   1 
ATOM   3279 C CB  . ILE B 1 189 ? 19.560 24.389  43.759 1.00 5.93  ? 189 ILE B CB  1 
ATOM   3280 C CG1 . ILE B 1 189 ? 20.291 24.101  42.456 1.00 7.12  ? 189 ILE B CG1 1 
ATOM   3281 C CG2 . ILE B 1 189 ? 19.986 23.430  44.857 1.00 8.00  ? 189 ILE B CG2 1 
ATOM   3282 C CD1 . ILE B 1 189 ? 21.747 24.568  42.432 1.00 8.01  ? 189 ILE B CD1 1 
ATOM   3283 N N   . LYS B 1 190 ? 17.196 25.474  45.524 1.00 7.12  ? 190 LYS B N   1 
ATOM   3284 C CA  . LYS B 1 190 ? 16.580 25.594  46.839 1.00 7.75  ? 190 LYS B CA  1 
ATOM   3285 C C   . LYS B 1 190 ? 15.134 25.117  46.816 1.00 9.90  ? 190 LYS B C   1 
ATOM   3286 O O   . LYS B 1 190 ? 14.643 24.489  47.764 1.00 8.41  ? 190 LYS B O   1 
ATOM   3287 C CB  . LYS B 1 190 ? 16.635 27.039  47.323 1.00 10.36 ? 190 LYS B CB  1 
ATOM   3288 C CG  . LYS B 1 190 ? 16.393 27.162  48.798 1.00 14.82 ? 190 LYS B CG  1 
ATOM   3289 C CD  . LYS B 1 190 ? 17.689 26.947  49.526 1.00 18.84 ? 190 LYS B CD  1 
ATOM   3290 C CE  . LYS B 1 190 ? 18.616 28.117  49.240 1.00 20.00 ? 190 LYS B CE  1 
ATOM   3291 N NZ  . LYS B 1 190 ? 19.946 27.912  49.848 1.00 20.64 ? 190 LYS B NZ  1 
ATOM   3292 N N   . ARG B 1 191 ? 14.459 25.419  45.715 1.00 9.87  ? 191 ARG B N   1 
ATOM   3293 C CA  . ARG B 1 191 ? 13.057 25.043  45.566 1.00 9.84  ? 191 ARG B CA  1 
ATOM   3294 C C   . ARG B 1 191 ? 12.944 23.518  45.493 1.00 7.84  ? 191 ARG B C   1 
ATOM   3295 O O   . ARG B 1 191 ? 12.098 22.915  46.167 1.00 7.91  ? 191 ARG B O   1 
ATOM   3296 C CB  . ARG B 1 191 ? 12.505 25.687  44.292 1.00 10.94 ? 191 ARG B CB  1 
ATOM   3297 C CG  . ARG B 1 191 ? 11.051 25.419  43.939 1.00 12.96 ? 191 ARG B CG  1 
ATOM   3298 C CD  . ARG B 1 191 ? 10.718 26.323  42.736 1.00 21.60 ? 191 ARG B CD  1 
ATOM   3299 N NE  . ARG B 1 191 ? 11.072 27.737  42.978 1.00 27.92 ? 191 ARG B NE  1 
ATOM   3300 C CZ  . ARG B 1 191 ? 11.896 28.480  42.225 1.00 30.25 ? 191 ARG B CZ  1 
ATOM   3301 N NH1 . ARG B 1 191 ? 12.466 27.992  41.126 1.00 30.07 ? 191 ARG B NH1 1 
ATOM   3302 N NH2 . ARG B 1 191 ? 12.128 29.745  42.554 1.00 32.61 ? 191 ARG B NH2 1 
ATOM   3303 N N   . LEU B 1 192 ? 13.764 22.895  44.651 1.00 8.34  ? 192 LEU B N   1 
ATOM   3304 C CA  . LEU B 1 192 ? 13.704 21.459  44.497 1.00 7.03  ? 192 LEU B CA  1 
ATOM   3305 C C   . LEU B 1 192 ? 14.097 20.726  45.782 1.00 5.79  ? 192 LEU B C   1 
ATOM   3306 O O   . LEU B 1 192 ? 13.581 19.631  46.046 1.00 6.13  ? 192 LEU B O   1 
ATOM   3307 C CB  . LEU B 1 192 ? 14.560 21.009  43.321 1.00 7.23  ? 192 LEU B CB  1 
ATOM   3308 C CG  . LEU B 1 192 ? 14.229 21.592  41.941 1.00 6.48  ? 192 LEU B CG  1 
ATOM   3309 C CD1 . LEU B 1 192 ? 15.112 21.011  40.841 1.00 9.78  ? 192 LEU B CD1 1 
ATOM   3310 C CD2 . LEU B 1 192 ? 12.760 21.370  41.603 1.00 7.89  ? 192 LEU B CD2 1 
ATOM   3311 N N   . GLU B 1 193 ? 14.985 21.331  46.574 1.00 6.31  ? 193 GLU B N   1 
ATOM   3312 C CA  . GLU B 1 193 ? 15.423 20.730  47.831 1.00 6.73  ? 193 GLU B CA  1 
ATOM   3313 C C   . GLU B 1 193 ? 14.258 20.538  48.790 1.00 7.03  ? 193 GLU B C   1 
ATOM   3314 O O   . GLU B 1 193 ? 14.355 19.815  49.775 1.00 7.35  ? 193 GLU B O   1 
ATOM   3315 C CB  . GLU B 1 193 ? 16.534 21.586  48.455 1.00 9.04  ? 193 GLU B CB  1 
ATOM   3316 C CG  . GLU B 1 193 ? 17.856 21.391  47.764 1.00 8.49  ? 193 GLU B CG  1 
ATOM   3317 C CD  . GLU B 1 193 ? 18.976 22.219  48.350 1.00 10.32 ? 193 GLU B CD  1 
ATOM   3318 O OE1 . GLU B 1 193 ? 18.728 23.255  49.012 1.00 12.01 ? 193 GLU B OE1 1 
ATOM   3319 O OE2 . GLU B 1 193 ? 20.165 21.864  48.143 1.00 9.34  ? 193 GLU B OE2 1 
ATOM   3320 N N   . GLN B 1 194 ? 13.167 21.240  48.519 1.00 7.29  ? 194 GLN B N   1 
ATOM   3321 C CA  . GLN B 1 194 ? 12.012 21.188  49.388 1.00 9.77  ? 194 GLN B CA  1 
ATOM   3322 C C   . GLN B 1 194 ? 10.960 20.160  48.974 1.00 9.54  ? 194 GLN B C   1 
ATOM   3323 O O   . GLN B 1 194 ? 9.967  19.991  49.677 1.00 9.31  ? 194 GLN B O   1 
ATOM   3324 C CB  . GLN B 1 194 ? 11.395 22.578  49.476 1.00 8.63  ? 194 GLN B CB  1 
ATOM   3325 C CG  . GLN B 1 194 ? 12.354 23.615  50.007 1.00 9.16  ? 194 GLN B CG  1 
ATOM   3326 C CD  . GLN B 1 194 ? 11.785 25.006  49.974 1.00 10.05 ? 194 GLN B CD  1 
ATOM   3327 O OE1 . GLN B 1 194 ? 10.772 25.273  50.604 1.00 10.59 ? 194 GLN B OE1 1 
ATOM   3328 N NE2 . GLN B 1 194 ? 12.442 25.904  49.260 1.00 11.12 ? 194 GLN B NE2 1 
ATOM   3329 N N   . LEU B 1 195 ? 11.158 19.472  47.856 1.00 6.91  ? 195 LEU B N   1 
ATOM   3330 C CA  . LEU B 1 195 ? 10.235 18.406  47.478 1.00 9.37  ? 195 LEU B CA  1 
ATOM   3331 C C   . LEU B 1 195 ? 10.244 17.338  48.559 1.00 11.15 ? 195 LEU B C   1 
ATOM   3332 O O   . LEU B 1 195 ? 11.297 17.005  49.125 1.00 10.68 ? 195 LEU B O   1 
ATOM   3333 C CB  . LEU B 1 195 ? 10.653 17.799  46.147 1.00 8.73  ? 195 LEU B CB  1 
ATOM   3334 C CG  . LEU B 1 195 ? 10.451 18.699  44.927 1.00 8.45  ? 195 LEU B CG  1 
ATOM   3335 C CD1 . LEU B 1 195 ? 11.238 18.198  43.711 1.00 8.72  ? 195 LEU B CD1 1 
ATOM   3336 C CD2 . LEU B 1 195 ? 8.937  18.756  44.632 1.00 10.47 ? 195 LEU B CD2 1 
ATOM   3337 N N   . PRO B 1 196 ? 9.080  16.752  48.832 1.00 9.98  ? 196 PRO B N   1 
ATOM   3338 C CA  . PRO B 1 196 ? 9.059  15.770  49.921 1.00 9.73  ? 196 PRO B CA  1 
ATOM   3339 C C   . PRO B 1 196 ? 9.924  14.559  49.641 1.00 9.50  ? 196 PRO B C   1 
ATOM   3340 O O   . PRO B 1 196 ? 10.326 13.907  50.607 1.00 12.68 ? 196 PRO B O   1 
ATOM   3341 C CB  . PRO B 1 196 ? 7.570  15.378  50.042 1.00 15.00 ? 196 PRO B CB  1 
ATOM   3342 C CG  . PRO B 1 196 ? 6.949  15.824  48.792 1.00 15.85 ? 196 PRO B CG  1 
ATOM   3343 C CD  . PRO B 1 196 ? 7.741  16.974  48.261 1.00 12.49 ? 196 PRO B CD  1 
ATOM   3344 N N   . TYR B 1 197 ? 10.234 14.298  48.376 1.00 9.35  ? 197 TYR B N   1 
ATOM   3345 C CA  . TYR B 1 197 ? 11.030 13.118  48.012 1.00 5.43  ? 197 TYR B CA  1 
ATOM   3346 C C   . TYR B 1 197 ? 12.447 13.492  47.527 1.00 5.09  ? 197 TYR B C   1 
ATOM   3347 O O   . TYR B 1 197 ? 13.102 12.720  46.838 1.00 7.36  ? 197 TYR B O   1 
ATOM   3348 C CB  . TYR B 1 197 ? 10.300 12.274  46.942 1.00 9.10  ? 197 TYR B CB  1 
ATOM   3349 C CG  . TYR B 1 197 ? 9.799  13.133  45.788 1.00 9.71  ? 197 TYR B CG  1 
ATOM   3350 C CD1 . TYR B 1 197 ? 10.656 13.482  44.739 1.00 8.71  ? 197 TYR B CD1 1 
ATOM   3351 C CD2 . TYR B 1 197 ? 8.526  13.662  45.787 1.00 10.09 ? 197 TYR B CD2 1 
ATOM   3352 C CE1 . TYR B 1 197 ? 10.218 14.286  43.693 1.00 9.44  ? 197 TYR B CE1 1 
ATOM   3353 C CE2 . TYR B 1 197 ? 8.073  14.479  44.754 1.00 9.80  ? 197 TYR B CE2 1 
ATOM   3354 C CZ  . TYR B 1 197 ? 8.934  14.800  43.719 1.00 8.45  ? 197 TYR B CZ  1 
ATOM   3355 O OH  . TYR B 1 197 ? 8.514  15.590  42.696 1.00 7.95  ? 197 TYR B OH  1 
ATOM   3356 N N   . TYR B 1 198 ? 12.904 14.697  47.868 1.00 7.59  ? 198 TYR B N   1 
ATOM   3357 C CA  . TYR B 1 198 ? 14.210 15.136  47.391 1.00 6.54  ? 198 TYR B CA  1 
ATOM   3358 C C   . TYR B 1 198 ? 15.381 14.250  47.854 1.00 6.39  ? 198 TYR B C   1 
ATOM   3359 O O   . TYR B 1 198 ? 16.425 14.211  47.197 1.00 8.01  ? 198 TYR B O   1 
ATOM   3360 C CB  . TYR B 1 198 ? 14.457 16.620  47.688 1.00 6.96  ? 198 TYR B CB  1 
ATOM   3361 C CG  . TYR B 1 198 ? 15.690 17.159  46.972 1.00 6.67  ? 198 TYR B CG  1 
ATOM   3362 C CD1 . TYR B 1 198 ? 15.658 17.404  45.605 1.00 6.12  ? 198 TYR B CD1 1 
ATOM   3363 C CD2 . TYR B 1 198 ? 16.871 17.410  47.659 1.00 6.94  ? 198 TYR B CD2 1 
ATOM   3364 C CE1 . TYR B 1 198 ? 16.739 17.871  44.925 1.00 10.80 ? 198 TYR B CE1 1 
ATOM   3365 C CE2 . TYR B 1 198 ? 18.018 17.880  46.969 1.00 7.43  ? 198 TYR B CE2 1 
ATOM   3366 C CZ  . TYR B 1 198 ? 17.909 18.124  45.594 1.00 6.85  ? 198 TYR B CZ  1 
ATOM   3367 O OH  . TYR B 1 198 ? 18.933 18.594  44.833 1.00 7.68  ? 198 TYR B OH  1 
ATOM   3368 N N   . ALA B 1 199 ? 15.232 13.574  48.982 1.00 6.00  ? 199 ALA B N   1 
ATOM   3369 C CA  . ALA B 1 199 ? 16.289 12.640  49.394 1.00 8.60  ? 199 ALA B CA  1 
ATOM   3370 C C   . ALA B 1 199 ? 16.634 11.569  48.368 1.00 6.97  ? 199 ALA B C   1 
ATOM   3371 O O   . ALA B 1 199 ? 17.750 11.038  48.393 1.00 7.90  ? 199 ALA B O   1 
ATOM   3372 C CB  . ALA B 1 199 ? 16.011 12.005  50.759 1.00 9.42  ? 199 ALA B CB  1 
ATOM   3373 N N   . GLU B 1 200 ? 15.718 11.274  47.447 1.00 7.54  ? 200 GLU B N   1 
ATOM   3374 C CA  . GLU B 1 200 ? 16.013 10.341  46.343 1.00 7.89  ? 200 GLU B CA  1 
ATOM   3375 C C   . GLU B 1 200 ? 17.122 10.922  45.438 1.00 6.75  ? 200 GLU B C   1 
ATOM   3376 O O   . GLU B 1 200 ? 17.808 10.196  44.718 1.00 8.11  ? 200 GLU B O   1 
ATOM   3377 C CB  . GLU B 1 200 ? 14.753 10.056  45.518 1.00 7.91  ? 200 GLU B CB  1 
ATOM   3378 C CG  . GLU B 1 200 ? 13.681 9.303   46.299 1.00 10.58 ? 200 GLU B CG  1 
ATOM   3379 C CD  . GLU B 1 200 ? 14.157 7.933   46.733 1.00 12.98 ? 200 GLU B CD  1 
ATOM   3380 O OE1 . GLU B 1 200 ? 14.154 6.998   45.912 1.00 15.68 ? 200 GLU B OE1 1 
ATOM   3381 O OE2 . GLU B 1 200 ? 14.566 7.779   47.915 1.00 15.31 ? 200 GLU B OE2 1 
ATOM   3382 N N   . ASN B 1 201 ? 17.281 12.238  45.481 1.00 6.55  ? 201 ASN B N   1 
ATOM   3383 C CA  . ASN B 1 201 ? 18.440 12.838  44.870 1.00 7.68  ? 201 ASN B CA  1 
ATOM   3384 C C   . ASN B 1 201 ? 19.540 13.186  45.856 1.00 6.57  ? 201 ASN B C   1 
ATOM   3385 O O   . ASN B 1 201 ? 20.723 12.975  45.574 1.00 6.87  ? 201 ASN B O   1 
ATOM   3386 C CB  . ASN B 1 201 ? 18.087 14.079  44.069 1.00 5.09  ? 201 ASN B CB  1 
ATOM   3387 C CG  . ASN B 1 201 ? 19.300 14.628  43.334 1.00 5.40  ? 201 ASN B CG  1 
ATOM   3388 O OD1 . ASN B 1 201 ? 19.854 13.936  42.479 1.00 5.42  ? 201 ASN B OD1 1 
ATOM   3389 N ND2 . ASN B 1 201 ? 19.747 15.812  43.685 1.00 5.80  ? 201 ASN B ND2 1 
ATOM   3390 N N   . SER B 1 202 ? 19.191 13.767  46.989 1.00 5.92  ? 202 SER B N   1 
ATOM   3391 C CA  . SER B 1 202 ? 20.269 14.289  47.825 1.00 7.16  ? 202 SER B CA  1 
ATOM   3392 C C   . SER B 1 202 ? 21.179 13.234  48.423 1.00 7.62  ? 202 SER B C   1 
ATOM   3393 O O   . SER B 1 202 ? 22.358 13.479  48.617 1.00 7.66  ? 202 SER B O   1 
ATOM   3394 C CB  . SER B 1 202 ? 19.754 15.229  48.919 1.00 8.42  ? 202 SER B CB  1 
ATOM   3395 O OG  . SER B 1 202 ? 18.951 14.511  49.826 1.00 9.38  ? 202 SER B OG  1 
ATOM   3396 N N   . THR B 1 203 ? 20.647 12.058  48.708 1.00 7.84  ? 203 THR B N   1 
ATOM   3397 C CA  . THR B 1 203 ? 21.467 11.007  49.318 1.00 9.45  ? 203 THR B CA  1 
ATOM   3398 C C   . THR B 1 203 ? 22.612 10.601  48.386 1.00 6.87  ? 203 THR B C   1 
ATOM   3399 O O   . THR B 1 203 ? 23.790 10.685  48.746 1.00 8.46  ? 203 THR B O   1 
ATOM   3400 C CB  . THR B 1 203 ? 20.621 9.786   49.714 1.00 11.97 ? 203 THR B CB  1 
ATOM   3401 O OG1 . THR B 1 203 ? 19.723 10.185  50.753 1.00 11.91 ? 203 THR B OG1 1 
ATOM   3402 C CG2 . THR B 1 203 ? 21.510 8.688   50.238 1.00 13.50 ? 203 THR B CG2 1 
ATOM   3403 N N   . GLY B 1 204 ? 22.283 10.247  47.148 1.00 6.74  ? 204 GLY B N   1 
ATOM   3404 C CA  . GLY B 1 204 ? 23.275 9.874   46.167 1.00 6.93  ? 204 GLY B CA  1 
ATOM   3405 C C   . GLY B 1 204 ? 24.131 11.037  45.706 1.00 7.69  ? 204 GLY B C   1 
ATOM   3406 O O   . GLY B 1 204 ? 25.273 10.842  45.385 1.00 7.58  ? 204 GLY B O   1 
ATOM   3407 N N   . ALA B 1 205 ? 23.571 12.244  45.637 1.00 6.13  ? 205 ALA B N   1 
ATOM   3408 C CA  . ALA B 1 205 ? 24.368 13.425  45.282 1.00 6.33  ? 205 ALA B CA  1 
ATOM   3409 C C   . ALA B 1 205 ? 25.457 13.625  46.328 1.00 7.94  ? 205 ALA B C   1 
ATOM   3410 O O   . ALA B 1 205 ? 26.599 13.888  45.967 1.00 8.01  ? 205 ALA B O   1 
ATOM   3411 C CB  . ALA B 1 205 ? 23.505 14.689  45.157 1.00 6.30  ? 205 ALA B CB  1 
ATOM   3412 N N   . GLN B 1 206 ? 25.134 13.453  47.610 1.00 7.23  ? 206 GLN B N   1 
ATOM   3413 C CA  . GLN B 1 206 ? 26.129 13.557  48.662 1.00 8.34  ? 206 GLN B CA  1 
ATOM   3414 C C   . GLN B 1 206 ? 27.176 12.481  48.545 1.00 8.13  ? 206 GLN B C   1 
ATOM   3415 O O   . GLN B 1 206 ? 28.346 12.768  48.781 1.00 8.65  ? 206 GLN B O   1 
ATOM   3416 C CB  . GLN B 1 206 ? 25.487 13.557  50.042 1.00 12.24 ? 206 GLN B CB  1 
ATOM   3417 C CG  . GLN B 1 206 ? 24.712 14.842  50.339 1.00 19.35 ? 206 GLN B CG  1 
ATOM   3418 C CD  . GLN B 1 206 ? 23.750 14.711  51.519 1.00 26.08 ? 206 GLN B CD  1 
ATOM   3419 O OE1 . GLN B 1 206 ? 23.780 13.726  52.265 1.00 28.35 ? 206 GLN B OE1 1 
ATOM   3420 N NE2 . GLN B 1 206 ? 22.878 15.714  51.686 1.00 28.52 ? 206 GLN B NE2 1 
ATOM   3421 N N   . GLN B 1 207 ? 26.778 11.277  48.134 1.00 8.90  ? 207 GLN B N   1 
ATOM   3422 C CA  . GLN B 1 207 ? 27.751 10.204  47.886 1.00 8.29  ? 207 GLN B CA  1 
ATOM   3423 C C   . GLN B 1 207 ? 28.676 10.547  46.725 1.00 8.84  ? 207 GLN B C   1 
ATOM   3424 O O   . GLN B 1 207 ? 29.872 10.312  46.807 1.00 8.65  ? 207 GLN B O   1 
ATOM   3425 C CB  . GLN B 1 207 ? 27.059 8.851   47.655 1.00 9.47  ? 207 GLN B CB  1 
ATOM   3426 C CG  . GLN B 1 207 ? 26.315 8.379   48.869 1.00 9.28  ? 207 GLN B CG  1 
ATOM   3427 C CD  . GLN B 1 207 ? 25.271 7.326   48.561 1.00 12.08 ? 207 GLN B CD  1 
ATOM   3428 O OE1 . GLN B 1 207 ? 25.026 7.003   47.400 1.00 12.42 ? 207 GLN B OE1 1 
ATOM   3429 N NE2 . GLN B 1 207 ? 24.619 6.818   49.602 1.00 18.63 ? 207 GLN B NE2 1 
ATOM   3430 N N   . PHE B 1 208 ? 28.131 11.126  45.660 1.00 7.86  ? 208 PHE B N   1 
ATOM   3431 C CA  . PHE B 1 208 ? 28.942 11.532  44.523 1.00 8.80  ? 208 PHE B CA  1 
ATOM   3432 C C   . PHE B 1 208 ? 29.926 12.607  44.981 1.00 8.39  ? 208 PHE B C   1 
ATOM   3433 O O   . PHE B 1 208 ? 31.133 12.573  44.684 1.00 8.38  ? 208 PHE B O   1 
ATOM   3434 C CB  . PHE B 1 208 ? 28.040 12.098  43.414 1.00 8.77  ? 208 PHE B CB  1 
ATOM   3435 C CG  . PHE B 1 208 ? 28.782 12.502  42.173 1.00 8.63  ? 208 PHE B CG  1 
ATOM   3436 C CD1 . PHE B 1 208 ? 29.323 13.780  42.028 1.00 10.42 ? 208 PHE B CD1 1 
ATOM   3437 C CD2 . PHE B 1 208 ? 28.969 11.580  41.153 1.00 10.00 ? 208 PHE B CD2 1 
ATOM   3438 C CE1 . PHE B 1 208 ? 30.017 14.108  40.874 1.00 9.40  ? 208 PHE B CE1 1 
ATOM   3439 C CE2 . PHE B 1 208 ? 29.654 11.905  40.001 1.00 13.00 ? 208 PHE B CE2 1 
ATOM   3440 C CZ  . PHE B 1 208 ? 30.196 13.169  39.866 1.00 9.53  ? 208 PHE B CZ  1 
ATOM   3441 N N   . VAL B 1 209 ? 29.426 13.607  45.697 1.00 8.96  ? 209 VAL B N   1 
ATOM   3442 C CA  . VAL B 1 209 ? 30.298 14.664  46.187 1.00 8.56  ? 209 VAL B CA  1 
ATOM   3443 C C   . VAL B 1 209 ? 31.434 14.119  47.043 1.00 11.29 ? 209 VAL B C   1 
ATOM   3444 O O   . VAL B 1 209 ? 32.608 14.499  46.875 1.00 9.98  ? 209 VAL B O   1 
ATOM   3445 C CB  . VAL B 1 209 ? 29.519 15.744  46.984 1.00 11.36 ? 209 VAL B CB  1 
ATOM   3446 C CG1 . VAL B 1 209 ? 30.483 16.728  47.661 1.00 13.40 ? 209 VAL B CG1 1 
ATOM   3447 C CG2 . VAL B 1 209 ? 28.610 16.493  46.064 1.00 12.56 ? 209 VAL B CG2 1 
ATOM   3448 N N   . ALA B 1 210 ? 31.099 13.203  47.944 1.00 9.31  ? 210 ALA B N   1 
ATOM   3449 C CA  . ALA B 1 210 ? 32.109 12.584  48.808 1.00 11.62 ? 210 ALA B CA  1 
ATOM   3450 C C   . ALA B 1 210 ? 33.166 11.844  48.006 1.00 12.17 ? 210 ALA B C   1 
ATOM   3451 O O   . ALA B 1 210 ? 34.358 11.930  48.313 1.00 11.56 ? 210 ALA B O   1 
ATOM   3452 C CB  . ALA B 1 210 ? 31.444 11.629  49.810 1.00 13.14 ? 210 ALA B CB  1 
ATOM   3453 N N   . ALA B 1 211 ? 32.740 11.098  46.989 1.00 10.52 ? 211 ALA B N   1 
ATOM   3454 C CA  . ALA B 1 211 ? 33.705 10.403  46.149 1.00 10.63 ? 211 ALA B CA  1 
ATOM   3455 C C   . ALA B 1 211 ? 34.624 11.384  45.433 1.00 12.20 ? 211 ALA B C   1 
ATOM   3456 O O   . ALA B 1 211 ? 35.835 11.133  45.353 1.00 13.08 ? 211 ALA B O   1 
ATOM   3457 C CB  . ALA B 1 211 ? 33.031 9.493   45.158 1.00 11.04 ? 211 ALA B CB  1 
ATOM   3458 N N   . VAL B 1 212 ? 34.068 12.475  44.905 1.00 11.29 ? 212 VAL B N   1 
ATOM   3459 C CA  . VAL B 1 212 ? 34.904 13.492  44.265 1.00 10.51 ? 212 VAL B CA  1 
ATOM   3460 C C   . VAL B 1 212 ? 35.861 14.190  45.231 1.00 11.54 ? 212 VAL B C   1 
ATOM   3461 O O   . VAL B 1 212 ? 37.030 14.346  44.921 1.00 11.59 ? 212 VAL B O   1 
ATOM   3462 C CB  . VAL B 1 212 ? 34.028 14.533  43.489 1.00 10.49 ? 212 VAL B CB  1 
ATOM   3463 C CG1 . VAL B 1 212 ? 34.857 15.747  43.025 1.00 14.79 ? 212 VAL B CG1 1 
ATOM   3464 C CG2 . VAL B 1 212 ? 33.351 13.835  42.296 1.00 9.25  ? 212 VAL B CG2 1 
ATOM   3465 N N   . LYS B 1 213 ? 35.385 14.591  46.407 1.00 12.45 ? 213 LYS B N   1 
ATOM   3466 C CA  . LYS B 1 213 ? 36.261 15.252  47.382 1.00 13.20 ? 213 LYS B CA  1 
ATOM   3467 C C   . LYS B 1 213 ? 37.433 14.371  47.812 1.00 15.03 ? 213 LYS B C   1 
ATOM   3468 O O   . LYS B 1 213 ? 38.491 14.877  48.178 1.00 16.78 ? 213 LYS B O   1 
ATOM   3469 C CB  . LYS B 1 213 ? 35.462 15.711  48.610 1.00 14.32 ? 213 LYS B CB  1 
ATOM   3470 C CG  . LYS B 1 213 ? 34.324 16.681  48.286 1.00 19.91 ? 213 LYS B CG  1 
ATOM   3471 C CD  . LYS B 1 213 ? 34.827 17.837  47.443 1.00 24.00 ? 213 LYS B CD  1 
ATOM   3472 C CE  . LYS B 1 213 ? 33.920 19.059  47.519 1.00 24.38 ? 213 LYS B CE  1 
ATOM   3473 N NZ  . LYS B 1 213 ? 34.750 20.301  47.429 1.00 25.35 ? 213 LYS B NZ  1 
ATOM   3474 N N   A SER B 1 214 ? 37.221 13.058  47.740 0.31 14.77 ? 214 SER B N   1 
ATOM   3475 N N   B SER B 1 214 ? 37.265 13.053  47.766 0.69 12.04 ? 214 SER B N   1 
ATOM   3476 C CA  A SER B 1 214 ? 38.221 12.059  48.099 0.31 15.17 ? 214 SER B CA  1 
ATOM   3477 C CA  B SER B 1 214 ? 38.334 12.158  48.189 0.69 14.72 ? 214 SER B CA  1 
ATOM   3478 C C   A SER B 1 214 ? 39.391 12.025  47.122 0.31 14.63 ? 214 SER B C   1 
ATOM   3479 C C   B SER B 1 214 ? 39.405 11.983  47.100 0.69 14.31 ? 214 SER B C   1 
ATOM   3480 O O   A SER B 1 214 ? 40.466 11.521  47.451 0.31 15.99 ? 214 SER B O   1 
ATOM   3481 O O   B SER B 1 214 ? 40.428 11.327  47.323 0.69 16.14 ? 214 SER B O   1 
ATOM   3482 C CB  A SER B 1 214 ? 37.572 10.670  48.158 0.31 16.16 ? 214 SER B CB  1 
ATOM   3483 C CB  B SER B 1 214 ? 37.757 10.799  48.585 0.69 16.54 ? 214 SER B CB  1 
ATOM   3484 O OG  A SER B 1 214 ? 36.982 10.428  49.413 0.31 16.17 ? 214 SER B OG  1 
ATOM   3485 O OG  B SER B 1 214 ? 37.140 10.167  47.480 0.69 16.35 ? 214 SER B OG  1 
ATOM   3486 N N   . LYS B 1 215 ? 39.168 12.558  45.926 1.00 13.81 ? 215 LYS B N   1 
ATOM   3487 C CA  . LYS B 1 215 ? 40.116 12.458  44.823 1.00 14.64 ? 215 LYS B CA  1 
ATOM   3488 C C   . LYS B 1 215 ? 40.498 13.861  44.367 1.00 15.93 ? 215 LYS B C   1 
ATOM   3489 O O   . LYS B 1 215 ? 40.087 14.310  43.302 1.00 15.38 ? 215 LYS B O   1 
ATOM   3490 C CB  . LYS B 1 215 ? 39.473 11.689  43.664 1.00 18.52 ? 215 LYS B CB  1 
ATOM   3491 C CG  . LYS B 1 215 ? 39.048 10.255  43.981 1.00 21.27 ? 215 LYS B CG  1 
ATOM   3492 C CD  . LYS B 1 215 ? 40.239 9.354   44.104 1.00 24.25 ? 215 LYS B CD  1 
ATOM   3493 C CE  . LYS B 1 215 ? 39.858 7.899   43.874 1.00 25.66 ? 215 LYS B CE  1 
ATOM   3494 N NZ  . LYS B 1 215 ? 41.091 7.071   43.666 1.00 27.65 ? 215 LYS B NZ  1 
ATOM   3495 N N   . PRO B 1 216 ? 41.328 14.546  45.157 1.00 14.39 ? 216 PRO B N   1 
ATOM   3496 C CA  . PRO B 1 216 ? 41.705 15.928  44.839 1.00 13.86 ? 216 PRO B CA  1 
ATOM   3497 C C   . PRO B 1 216 ? 42.536 16.039  43.556 1.00 18.01 ? 216 PRO B C   1 
ATOM   3498 O O   . PRO B 1 216 ? 43.225 15.089  43.136 1.00 17.88 ? 216 PRO B O   1 
ATOM   3499 C CB  . PRO B 1 216 ? 42.564 16.319  46.037 1.00 20.09 ? 216 PRO B CB  1 
ATOM   3500 C CG  . PRO B 1 216 ? 43.258 15.044  46.372 1.00 21.56 ? 216 PRO B CG  1 
ATOM   3501 C CD  . PRO B 1 216 ? 42.210 13.972  46.190 1.00 19.50 ? 216 PRO B CD  1 
ATOM   3502 N N   . PHE B 1 217 ? 42.482 17.224  42.958 1.00 19.14 ? 217 PHE B N   1 
ATOM   3503 C CA  . PHE B 1 217 ? 43.199 17.500  41.726 1.00 19.78 ? 217 PHE B CA  1 
ATOM   3504 C C   . PHE B 1 217 ? 43.459 18.992  41.625 1.00 19.22 ? 217 PHE B C   1 
ATOM   3505 O O   . PHE B 1 217 ? 42.821 19.802  42.304 1.00 19.88 ? 217 PHE B O   1 
ATOM   3506 C CB  . PHE B 1 217 ? 42.375 17.027  40.524 1.00 20.03 ? 217 PHE B CB  1 
ATOM   3507 C CG  . PHE B 1 217 ? 41.054 17.728  40.384 1.00 20.28 ? 217 PHE B CG  1 
ATOM   3508 C CD1 . PHE B 1 217 ? 39.935 17.272  41.062 1.00 20.69 ? 217 PHE B CD1 1 
ATOM   3509 C CD2 . PHE B 1 217 ? 40.937 18.845  39.570 1.00 23.78 ? 217 PHE B CD2 1 
ATOM   3510 C CE1 . PHE B 1 217 ? 38.716 17.917  40.940 1.00 21.40 ? 217 PHE B CE1 1 
ATOM   3511 C CE2 . PHE B 1 217 ? 39.731 19.502  39.438 1.00 25.03 ? 217 PHE B CE2 1 
ATOM   3512 C CZ  . PHE B 1 217 ? 38.609 19.031  40.124 1.00 24.53 ? 217 PHE B CZ  1 
ATOM   3513 N N   . THR B 1 218 ? 44.402 19.354  40.768 1.00 19.44 ? 218 THR B N   1 
ATOM   3514 C CA  . THR B 1 218 ? 44.666 20.748  40.480 1.00 22.79 ? 218 THR B CA  1 
ATOM   3515 C C   . THR B 1 218 ? 44.297 21.014  39.027 1.00 24.42 ? 218 THR B C   1 
ATOM   3516 O O   . THR B 1 218 ? 43.950 20.085  38.289 1.00 23.49 ? 218 THR B O   1 
ATOM   3517 C CB  . THR B 1 218 ? 46.117 21.064  40.775 1.00 21.48 ? 218 THR B CB  1 
ATOM   3518 O OG1 . THR B 1 218 ? 46.958 20.213  39.992 1.00 22.84 ? 218 THR B OG1 1 
ATOM   3519 C CG2 . THR B 1 218 ? 46.390 20.778  42.230 1.00 20.60 ? 218 THR B CG2 1 
ATOM   3520 N N   . VAL B 1 219 ? 44.324 22.277  38.623 1.00 29.31 ? 219 VAL B N   1 
ATOM   3521 C CA  . VAL B 1 219 ? 43.911 22.637  37.272 1.00 16.72 ? 219 VAL B CA  1 
ATOM   3522 C C   . VAL B 1 219 ? 44.954 23.499  36.570 1.00 20.48 ? 219 VAL B C   1 
ATOM   3523 O O   . VAL B 1 219 ? 45.891 24.003  37.201 1.00 26.57 ? 219 VAL B O   1 
ATOM   3524 C CB  . VAL B 1 219 ? 42.540 23.364  37.281 1.00 29.81 ? 219 VAL B CB  1 
ATOM   3525 C CG1 . VAL B 1 219 ? 42.681 24.746  37.891 1.00 31.27 ? 219 VAL B CG1 1 
ATOM   3526 C CG2 . VAL B 1 219 ? 41.982 23.469  35.884 1.00 29.33 ? 219 VAL B CG2 1 
HETATM 3527 N N1  . GSH C 2 .   ? 21.916 19.354  20.986 1.00 6.24  ? 301 GSH A N1  1 
HETATM 3528 C CA1 . GSH C 2 .   ? 21.831 20.317  19.893 1.00 7.32  ? 301 GSH A CA1 1 
HETATM 3529 C C1  . GSH C 2 .   ? 20.997 19.801  18.752 1.00 5.74  ? 301 GSH A C1  1 
HETATM 3530 O O11 . GSH C 2 .   ? 20.843 18.550  18.562 1.00 5.23  ? 301 GSH A O11 1 
HETATM 3531 O O12 . GSH C 2 .   ? 20.430 20.648  18.012 1.00 6.57  ? 301 GSH A O12 1 
HETATM 3532 C CB1 . GSH C 2 .   ? 23.196 20.748  19.406 1.00 7.62  ? 301 GSH A CB1 1 
HETATM 3533 C CG1 . GSH C 2 .   ? 23.156 22.180  18.861 1.00 8.13  ? 301 GSH A CG1 1 
HETATM 3534 C CD1 . GSH C 2 .   ? 24.592 22.627  18.581 1.00 7.13  ? 301 GSH A CD1 1 
HETATM 3535 O OE1 . GSH C 2 .   ? 25.552 22.431  19.318 1.00 8.27  ? 301 GSH A OE1 1 
HETATM 3536 N N2  . GSH C 2 .   ? 24.794 23.299  17.327 1.00 8.79  ? 301 GSH A N2  1 
HETATM 3537 C CA2 . GSH C 2 .   ? 26.086 23.803  16.917 1.00 9.09  ? 301 GSH A CA2 1 
HETATM 3538 C C2  . GSH C 2 .   ? 26.048 25.283  17.124 1.00 11.39 ? 301 GSH A C2  1 
HETATM 3539 O O2  . GSH C 2 .   ? 25.014 25.945  17.008 1.00 9.26  ? 301 GSH A O2  1 
HETATM 3540 C CB2 . GSH C 2 .   ? 26.364 23.554  15.460 1.00 8.02  ? 301 GSH A CB2 1 
HETATM 3541 S SG2 . GSH C 2 .   ? 26.835 21.864  15.094 1.00 10.76 ? 301 GSH A SG2 1 
HETATM 3542 N N3  . GSH C 2 .   ? 27.267 25.945  17.481 1.00 10.29 ? 301 GSH A N3  1 
HETATM 3543 C CA3 . GSH C 2 .   ? 27.262 27.377  17.664 1.00 9.29  ? 301 GSH A CA3 1 
HETATM 3544 C C3  . GSH C 2 .   ? 27.524 27.756  19.089 1.00 11.17 ? 301 GSH A C3  1 
HETATM 3545 O O31 . GSH C 2 .   ? 27.481 26.891  20.022 1.00 12.26 ? 301 GSH A O31 1 
HETATM 3546 O O32 . GSH C 2 .   ? 27.782 28.981  19.329 1.00 12.73 ? 301 GSH A O32 1 
HETATM 3547 N N1  . GSH D 2 .   ? 23.005 10.191  29.584 1.00 11.21 ? 301 GSH B N1  1 
HETATM 3548 C CA1 . GSH D 2 .   ? 22.809 8.767   29.910 1.00 9.70  ? 301 GSH B CA1 1 
HETATM 3549 C C1  . GSH D 2 .   ? 21.502 8.628   30.673 1.00 8.21  ? 301 GSH B C1  1 
HETATM 3550 O O11 . GSH D 2 .   ? 21.071 7.519   31.130 1.00 7.82  ? 301 GSH B O11 1 
HETATM 3551 O O12 . GSH D 2 .   ? 20.859 9.701   30.850 1.00 8.78  ? 301 GSH B O12 1 
HETATM 3552 C CB1 . GSH D 2 .   ? 23.984 8.431   30.779 1.00 10.11 ? 301 GSH B CB1 1 
HETATM 3553 C CG1 . GSH D 2 .   ? 24.147 6.944   31.050 1.00 9.21  ? 301 GSH B CG1 1 
HETATM 3554 C CD1 . GSH D 2 .   ? 25.556 6.769   31.640 1.00 9.39  ? 301 GSH B CD1 1 
HETATM 3555 O OE1 . GSH D 2 .   ? 26.572 7.120   31.042 1.00 10.33 ? 301 GSH B OE1 1 
HETATM 3556 N N2  . GSH D 2 .   ? 25.628 6.216   32.970 1.00 8.97  ? 301 GSH B N2  1 
HETATM 3557 C CA2 . GSH D 2 .   ? 26.926 6.031   33.582 1.00 11.60 ? 301 GSH B CA2 1 
HETATM 3558 C C2  . GSH D 2 .   ? 27.332 4.604   33.392 1.00 14.13 ? 301 GSH B C2  1 
HETATM 3559 O O2  . GSH D 2 .   ? 26.531 3.685   33.350 1.00 12.62 ? 301 GSH B O2  1 
HETATM 3560 C CB2 . GSH D 2 .   ? 26.811 6.240   35.067 1.00 10.59 ? 301 GSH B CB2 1 
HETATM 3561 S SG2 . GSH D 2 .   ? 26.703 7.976   35.450 1.00 15.83 ? 301 GSH B SG2 1 
HETATM 3562 N N3  . GSH D 2 .   ? 28.745 4.313   33.274 1.00 11.51 ? 301 GSH B N3  1 
HETATM 3563 C CA3 . GSH D 2 .   ? 29.066 2.905   33.140 1.00 16.72 ? 301 GSH B CA3 1 
HETATM 3564 C C3  . GSH D 2 .   ? 29.797 2.671   31.862 1.00 21.73 ? 301 GSH B C3  1 
HETATM 3565 O O31 . GSH D 2 .   ? 30.428 1.597   31.718 1.00 21.44 ? 301 GSH B O31 1 
HETATM 3566 O O32 . GSH D 2 .   ? 29.767 3.529   30.937 1.00 22.29 ? 301 GSH B O32 1 
HETATM 3567 O O   . HOH E 3 .   ? 4.172  13.562  20.865 1.00 4.30  ? 401 HOH A O   1 
HETATM 3568 O O   . HOH E 3 .   ? 2.729  12.041  19.153 1.00 5.76  ? 402 HOH A O   1 
HETATM 3569 O O   . HOH E 3 .   ? 10.521 7.324   25.957 1.00 5.45  ? 403 HOH A O   1 
HETATM 3570 O O   . HOH E 3 .   ? 8.924  10.680  24.688 1.00 5.79  ? 404 HOH A O   1 
HETATM 3571 O O   . HOH E 3 .   ? 14.926 3.346   13.383 1.00 6.17  ? 405 HOH A O   1 
HETATM 3572 O O   . HOH E 3 .   ? 51.781 12.906  17.010 1.00 8.02  ? 406 HOH A O   1 
HETATM 3573 O O   . HOH E 3 .   ? 20.494 15.010  15.504 1.00 6.27  ? 407 HOH A O   1 
HETATM 3574 O O   . HOH E 3 .   ? 4.757  11.210  16.120 1.00 6.14  ? 408 HOH A O   1 
HETATM 3575 O O   . HOH E 3 .   ? 6.561  14.917  20.334 1.00 5.75  ? 409 HOH A O   1 
HETATM 3576 O O   . HOH E 3 .   ? 19.606 23.282  18.489 1.00 6.46  ? 410 HOH A O   1 
HETATM 3577 O O   . HOH E 3 .   ? 26.654 9.364   3.539  1.00 7.89  ? 411 HOH A O   1 
HETATM 3578 O O   . HOH E 3 .   ? 14.944 19.782  3.736  1.00 7.10  ? 412 HOH A O   1 
HETATM 3579 O O   . HOH E 3 .   ? 7.914  6.433   25.664 1.00 6.78  ? 413 HOH A O   1 
HETATM 3580 O O   . HOH E 3 .   ? 52.364 10.595  21.221 1.00 6.72  ? 414 HOH A O   1 
HETATM 3581 O O   . HOH E 3 .   ? 24.186 10.225  25.486 1.00 7.05  ? 415 HOH A O   1 
HETATM 3582 O O   . HOH E 3 .   ? 11.122 8.569   3.725  1.00 9.05  ? 416 HOH A O   1 
HETATM 3583 O O   . HOH E 3 .   ? 23.267 15.513  14.887 1.00 6.52  ? 417 HOH A O   1 
HETATM 3584 O O   . HOH E 3 .   ? 23.188 16.249  17.857 1.00 7.61  ? 418 HOH A O   1 
HETATM 3585 O O   . HOH E 3 .   ? 12.432 13.097  25.127 1.00 7.44  ? 419 HOH A O   1 
HETATM 3586 O O   . HOH E 3 .   ? 31.928 8.717   22.246 1.00 8.10  ? 420 HOH A O   1 
HETATM 3587 O O   . HOH E 3 .   ? 19.301 20.847  23.821 1.00 7.44  ? 421 HOH A O   1 
HETATM 3588 O O   . HOH E 3 .   ? 25.450 22.051  22.103 1.00 8.18  ? 422 HOH A O   1 
HETATM 3589 O O   . HOH E 3 .   ? 23.125 19.482  3.415  1.00 7.15  ? 423 HOH A O   1 
HETATM 3590 O O   . HOH E 3 .   ? 24.722 17.444  22.479 1.00 6.10  ? 424 HOH A O   1 
HETATM 3591 O O   . HOH E 3 .   ? 26.686 19.492  22.632 1.00 9.24  ? 425 HOH A O   1 
HETATM 3592 O O   . HOH E 3 .   ? 23.089 20.855  22.969 1.00 8.10  ? 426 HOH A O   1 
HETATM 3593 O O   . HOH E 3 .   ? 52.226 22.810  21.000 1.00 10.48 ? 427 HOH A O   1 
HETATM 3594 O O   . HOH E 3 .   ? 5.991  9.624   10.219 1.00 8.60  ? 428 HOH A O   1 
HETATM 3595 O O   . HOH E 3 .   ? 9.440  24.581  22.719 1.00 8.07  ? 429 HOH A O   1 
HETATM 3596 O O   . HOH E 3 .   ? 28.897 8.955   5.213  1.00 11.90 ? 430 HOH A O   1 
HETATM 3597 O O   . HOH E 3 .   ? 16.360 3.650   1.910  1.00 10.51 ? 431 HOH A O   1 
HETATM 3598 O O   . HOH E 3 .   ? 12.853 19.640  1.824  1.00 9.51  ? 432 HOH A O   1 
HETATM 3599 O O   . HOH E 3 .   ? 2.935  3.401   17.183 1.00 11.79 ? 433 HOH A O   1 
HETATM 3600 O O   . HOH E 3 .   ? 2.926  8.477   22.457 1.00 10.03 ? 434 HOH A O   1 
HETATM 3601 O O   . HOH E 3 .   ? 8.926  10.209  3.144  1.00 10.60 ? 435 HOH A O   1 
HETATM 3602 O O   . HOH E 3 .   ? 1.825  2.349   24.029 1.00 13.66 ? 436 HOH A O   1 
HETATM 3603 O O   . HOH E 3 .   ? 29.947 11.530  4.640  1.00 13.08 ? 437 HOH A O   1 
HETATM 3604 O O   . HOH E 3 .   ? 23.012 17.068  20.312 1.00 7.54  ? 438 HOH A O   1 
HETATM 3605 O O   . HOH E 3 .   ? 36.297 13.164  19.765 1.00 8.89  ? 439 HOH A O   1 
HETATM 3606 O O   . HOH E 3 .   ? 11.516 7.946   0.975  1.00 13.20 ? 440 HOH A O   1 
HETATM 3607 O O   . HOH E 3 .   ? 27.604 11.984  2.865  1.00 13.64 ? 441 HOH A O   1 
HETATM 3608 O O   . HOH E 3 .   ? 23.830 26.241  4.187  1.00 14.92 ? 442 HOH A O   1 
HETATM 3609 O O   . HOH E 3 .   ? 18.037 23.781  26.220 1.00 8.69  ? 443 HOH A O   1 
HETATM 3610 O O   . HOH E 3 .   ? 39.108 20.961  1.879  1.00 12.02 ? 444 HOH A O   1 
HETATM 3611 O O   . HOH E 3 .   ? 28.746 19.915  24.405 1.00 11.67 ? 445 HOH A O   1 
HETATM 3612 O O   . HOH E 3 .   ? 31.993 6.645   24.114 1.00 11.92 ? 446 HOH A O   1 
HETATM 3613 O O   . HOH E 3 .   ? 52.205 12.042  23.687 1.00 10.75 ? 447 HOH A O   1 
HETATM 3614 O O   . HOH E 3 .   ? 25.316 -0.565  21.714 1.00 12.44 ? 448 HOH A O   1 
HETATM 3615 O O   . HOH E 3 .   ? 27.368 24.814  4.891  1.00 12.45 ? 449 HOH A O   1 
HETATM 3616 O O   . HOH E 3 .   ? 10.460 20.848  2.442  1.00 13.94 ? 450 HOH A O   1 
HETATM 3617 O O   . HOH E 3 .   ? 7.426  28.392  22.073 1.00 12.08 ? 451 HOH A O   1 
HETATM 3618 O O   . HOH E 3 .   ? 7.213  31.570  7.258  1.00 13.25 ? 452 HOH A O   1 
HETATM 3619 O O   . HOH E 3 .   ? 20.310 23.891  21.088 1.00 11.43 ? 453 HOH A O   1 
HETATM 3620 O O   . HOH E 3 .   ? 15.013 3.915   4.298  1.00 11.15 ? 454 HOH A O   1 
HETATM 3621 O O   . HOH E 3 .   ? 15.046 4.627   -0.269 1.00 13.17 ? 455 HOH A O   1 
HETATM 3622 O O   . HOH E 3 .   ? 18.808 13.326  -2.787 1.00 14.17 ? 456 HOH A O   1 
HETATM 3623 O O   . HOH E 3 .   ? 2.155  10.864  15.195 1.00 11.27 ? 457 HOH A O   1 
HETATM 3624 O O   . HOH E 3 .   ? 31.156 18.793  23.428 1.00 17.21 ? 458 HOH A O   1 
HETATM 3625 O O   . HOH E 3 .   ? 30.571 6.757   4.552  1.00 14.73 ? 459 HOH A O   1 
HETATM 3626 O O   . HOH E 3 .   ? 25.307 4.770   -1.953 1.00 16.33 ? 460 HOH A O   1 
HETATM 3627 O O   . HOH E 3 .   ? 28.944 19.823  -0.801 1.00 11.75 ? 461 HOH A O   1 
HETATM 3628 O O   . HOH E 3 .   ? 28.883 -6.492  13.226 1.00 16.98 ? 462 HOH A O   1 
HETATM 3629 O O   . HOH E 3 .   ? 2.868  12.468  0.359  1.00 13.27 ? 463 HOH A O   1 
HETATM 3630 O O   . HOH E 3 .   ? 22.681 31.464  27.491 1.00 11.38 ? 464 HOH A O   1 
HETATM 3631 O O   . HOH E 3 .   ? 8.569  26.858  24.111 1.00 14.63 ? 465 HOH A O   1 
HETATM 3632 O O   . HOH E 3 .   ? 26.329 27.016  22.557 1.00 14.63 ? 466 HOH A O   1 
HETATM 3633 O O   . HOH E 3 .   ? 33.434 6.259   5.539  1.00 14.79 ? 467 HOH A O   1 
HETATM 3634 O O   . HOH E 3 .   ? 19.565 9.212   -2.937 1.00 14.03 ? 468 HOH A O   1 
HETATM 3635 O O   . HOH E 3 .   ? 28.410 -8.670  11.444 1.00 17.52 ? 469 HOH A O   1 
HETATM 3636 O O   . HOH E 3 .   ? 43.169 23.592  13.184 1.00 15.70 ? 470 HOH A O   1 
HETATM 3637 O O   . HOH E 3 .   ? 28.205 -4.022  4.690  1.00 15.90 ? 471 HOH A O   1 
HETATM 3638 O O   . HOH E 3 .   ? 12.683 27.180  23.110 1.00 14.15 ? 472 HOH A O   1 
HETATM 3639 O O   . HOH E 3 .   ? 24.508 7.993   26.997 1.00 13.63 ? 473 HOH A O   1 
HETATM 3640 O O   . HOH E 3 .   ? 18.228 24.232  1.319  1.00 19.71 ? 474 HOH A O   1 
HETATM 3641 O O   . HOH E 3 .   ? 5.807  -2.239  21.174 1.00 12.95 ? 475 HOH A O   1 
HETATM 3642 O O   . HOH E 3 .   ? 34.360 0.181   22.197 1.00 14.85 ? 476 HOH A O   1 
HETATM 3643 O O   . HOH E 3 .   ? 10.864 16.600  0.209  1.00 13.59 ? 477 HOH A O   1 
HETATM 3644 O O   . HOH E 3 .   ? 31.937 1.301   22.508 1.00 15.04 ? 478 HOH A O   1 
HETATM 3645 O O   . HOH E 3 .   ? 6.948  32.507  12.550 1.00 14.77 ? 479 HOH A O   1 
HETATM 3646 O O   . HOH E 3 .   ? 7.891  31.747  16.536 1.00 17.32 ? 480 HOH A O   1 
HETATM 3647 O O   . HOH E 3 .   ? 23.274 3.161   -1.686 1.00 13.51 ? 481 HOH A O   1 
HETATM 3648 O O   . HOH E 3 .   ? 6.741  30.046  11.314 1.00 13.34 ? 482 HOH A O   1 
HETATM 3649 O O   . HOH E 3 .   ? 5.705  12.731  3.314  1.00 15.57 ? 483 HOH A O   1 
HETATM 3650 O O   . HOH E 3 .   ? 31.825 -9.752  8.200  1.00 13.44 ? 484 HOH A O   1 
HETATM 3651 O O   . HOH E 3 .   ? 11.137 2.267   6.641  1.00 15.10 ? 485 HOH A O   1 
HETATM 3652 O O   . HOH E 3 .   ? 16.971 -1.518  15.573 1.00 16.24 ? 486 HOH A O   1 
HETATM 3653 O O   . HOH E 3 .   ? 30.175 -3.415  18.177 1.00 14.94 ? 487 HOH A O   1 
HETATM 3654 O O   . HOH E 3 .   ? 11.059 1.764   17.600 1.00 14.49 ? 488 HOH A O   1 
HETATM 3655 O O   . HOH E 3 .   ? 12.997 17.895  -0.303 1.00 15.43 ? 489 HOH A O   1 
HETATM 3656 O O   . HOH E 3 .   ? 35.206 8.739   25.110 1.00 16.41 ? 490 HOH A O   1 
HETATM 3657 O O   . HOH E 3 .   ? 11.515 1.347   13.590 1.00 15.35 ? 491 HOH A O   1 
HETATM 3658 O O   . HOH E 3 .   ? 4.743  28.589  22.483 1.00 17.85 ? 492 HOH A O   1 
HETATM 3659 O O   . HOH E 3 .   ? 33.378 23.575  3.650  1.00 19.15 ? 493 HOH A O   1 
HETATM 3660 O O   . HOH E 3 .   ? 23.256 12.282  -2.119 1.00 14.40 ? 494 HOH A O   1 
HETATM 3661 O O   . HOH E 3 .   ? 8.136  -3.117  20.299 1.00 24.23 ? 495 HOH A O   1 
HETATM 3662 O O   . HOH E 3 .   ? 4.036  27.161  24.774 1.00 13.82 ? 496 HOH A O   1 
HETATM 3663 O O   . HOH E 3 .   ? 21.753 20.896  1.448  1.00 14.46 ? 497 HOH A O   1 
HETATM 3664 O O   . HOH E 3 .   ? 12.293 5.283   0.281  1.00 15.66 ? 498 HOH A O   1 
HETATM 3665 O O   . HOH E 3 .   ? 31.313 -9.255  10.812 1.00 16.07 ? 499 HOH A O   1 
HETATM 3666 O O   . HOH E 3 .   ? 11.049 23.847  1.683  1.00 20.84 ? 500 HOH A O   1 
HETATM 3667 O O   . HOH E 3 .   ? 12.188 3.920   4.365  1.00 13.65 ? 501 HOH A O   1 
HETATM 3668 O O   . HOH E 3 .   ? 36.882 17.191  1.192  1.00 19.21 ? 502 HOH A O   1 
HETATM 3669 O O   . HOH E 3 .   ? 9.426  5.248   8.524  1.00 15.67 ? 503 HOH A O   1 
HETATM 3670 O O   . HOH E 3 .   ? 3.371  13.983  4.915  1.00 18.61 ? 504 HOH A O   1 
HETATM 3671 O O   . HOH E 3 .   ? 3.878  12.117  6.866  1.00 15.50 ? 505 HOH A O   1 
HETATM 3672 O O   . HOH E 3 .   ? 17.812 5.639   -4.714 1.00 19.32 ? 506 HOH A O   1 
HETATM 3673 O O   . HOH E 3 .   ? 48.690 11.421  13.699 1.00 22.30 ? 507 HOH A O   1 
HETATM 3674 O O   . HOH E 3 .   ? 32.857 -3.063  17.091 1.00 20.66 ? 508 HOH A O   1 
HETATM 3675 O O   . HOH E 3 .   ? 15.905 11.852  -5.732 1.00 19.67 ? 509 HOH A O   1 
HETATM 3676 O O   . HOH E 3 .   ? 1.685  12.455  2.989  1.00 15.69 ? 510 HOH A O   1 
HETATM 3677 O O   . HOH E 3 .   ? 22.628 -2.892  8.399  1.00 15.65 ? 511 HOH A O   1 
HETATM 3678 O O   . HOH E 3 .   ? 37.887 6.276   25.933 1.00 23.58 ? 512 HOH A O   1 
HETATM 3679 O O   . HOH E 3 .   ? 21.047 22.515  23.307 1.00 13.94 ? 513 HOH A O   1 
HETATM 3680 O O   . HOH E 3 .   ? 6.545  26.261  25.782 1.00 16.40 ? 514 HOH A O   1 
HETATM 3681 O O   . HOH E 3 .   ? 28.488 -5.607  17.240 1.00 17.80 ? 515 HOH A O   1 
HETATM 3682 O O   . HOH E 3 .   ? 13.915 28.470  1.952  1.00 19.28 ? 516 HOH A O   1 
HETATM 3683 O O   . HOH E 3 .   ? 32.166 11.382  3.006  1.00 22.34 ? 517 HOH A O   1 
HETATM 3684 O O   . HOH E 3 .   ? 40.390 4.126   18.604 1.00 22.02 ? 518 HOH A O   1 
HETATM 3685 O O   . HOH E 3 .   ? 37.771 9.317   24.907 1.00 18.75 ? 519 HOH A O   1 
HETATM 3686 O O   . HOH E 3 .   ? 2.643  33.549  13.377 1.00 20.35 ? 520 HOH A O   1 
HETATM 3687 O O   . HOH E 3 .   ? 18.167 30.278  2.658  1.00 21.70 ? 521 HOH A O   1 
HETATM 3688 O O   . HOH E 3 .   ? 12.028 -0.213  23.395 1.00 28.84 ? 522 HOH A O   1 
HETATM 3689 O O   . HOH E 3 .   ? 44.957 22.931  11.047 1.00 19.23 ? 523 HOH A O   1 
HETATM 3690 O O   . HOH E 3 .   ? 4.737  24.413  4.653  1.00 18.71 ? 524 HOH A O   1 
HETATM 3691 O O   . HOH E 3 .   ? 44.205 21.049  3.556  1.00 24.64 ? 525 HOH A O   1 
HETATM 3692 O O   . HOH E 3 .   ? 36.195 2.936   11.295 1.00 16.90 ? 526 HOH A O   1 
HETATM 3693 O O   . HOH E 3 .   ? 9.349  34.069  13.131 1.00 22.74 ? 527 HOH A O   1 
HETATM 3694 O O   . HOH E 3 .   ? 0.499  11.052  12.724 1.00 25.82 ? 528 HOH A O   1 
HETATM 3695 O O   . HOH E 3 .   ? 42.436 17.075  8.152  1.00 24.34 ? 529 HOH A O   1 
HETATM 3696 O O   . HOH E 3 .   ? 22.516 -1.541  2.354  1.00 14.84 ? 530 HOH A O   1 
HETATM 3697 O O   . HOH E 3 .   ? 25.434 -2.764  1.729  1.00 20.52 ? 531 HOH A O   1 
HETATM 3698 O O   . HOH E 3 .   ? 34.163 17.008  0.819  1.00 19.36 ? 532 HOH A O   1 
HETATM 3699 O O   . HOH E 3 .   ? 16.702 2.187   -3.963 1.00 18.77 ? 533 HOH A O   1 
HETATM 3700 O O   . HOH E 3 .   ? 11.989 -2.080  21.621 1.00 17.59 ? 534 HOH A O   1 
HETATM 3701 O O   . HOH E 3 .   ? 5.527  31.476  4.869  1.00 24.48 ? 535 HOH A O   1 
HETATM 3702 O O   . HOH E 3 .   ? 31.535 30.580  15.972 1.00 20.99 ? 536 HOH A O   1 
HETATM 3703 O O   . HOH E 3 .   ? 6.635  26.124  28.658 1.00 17.21 ? 537 HOH A O   1 
HETATM 3704 O O   . HOH E 3 .   ? 40.451 16.195  24.441 1.00 20.83 ? 538 HOH A O   1 
HETATM 3705 O O   . HOH E 3 .   ? 21.395 -6.437  11.098 1.00 26.84 ? 539 HOH A O   1 
HETATM 3706 O O   . HOH E 3 .   ? 28.797 2.815   3.637  1.00 26.90 ? 540 HOH A O   1 
HETATM 3707 O O   . HOH E 3 .   ? 29.765 26.179  5.429  1.00 25.80 ? 541 HOH A O   1 
HETATM 3708 O O   . HOH E 3 .   ? 18.165 -1.530  17.883 1.00 17.95 ? 542 HOH A O   1 
HETATM 3709 O O   . HOH E 3 .   ? 10.595 6.018   4.314  1.00 19.63 ? 543 HOH A O   1 
HETATM 3710 O O   . HOH E 3 .   ? 17.728 -4.668  17.104 1.00 26.30 ? 544 HOH A O   1 
HETATM 3711 O O   . HOH E 3 .   ? 47.625 9.013   18.574 1.00 18.08 ? 545 HOH A O   1 
HETATM 3712 O O   . HOH E 3 .   ? 29.623 28.107  9.732  1.00 27.31 ? 546 HOH A O   1 
HETATM 3713 O O   . HOH E 3 .   ? 5.726  10.102  7.492  1.00 24.69 ? 547 HOH A O   1 
HETATM 3714 O O   . HOH E 3 .   ? 44.774 15.654  9.080  1.00 24.18 ? 548 HOH A O   1 
HETATM 3715 O O   . HOH E 3 .   ? 18.507 22.449  -0.809 1.00 24.70 ? 549 HOH A O   1 
HETATM 3716 O O   . HOH E 3 .   ? 17.011 -2.880  19.848 1.00 27.19 ? 550 HOH A O   1 
HETATM 3717 O O   . HOH E 3 .   ? 19.182 32.793  4.494  1.00 20.27 ? 551 HOH A O   1 
HETATM 3718 O O   . HOH E 3 .   ? 23.121 34.511  25.416 1.00 20.64 ? 552 HOH A O   1 
HETATM 3719 O O   . HOH E 3 .   ? 22.985 -1.820  22.158 1.00 19.47 ? 553 HOH A O   1 
HETATM 3720 O O   . HOH E 3 .   ? 47.628 22.494  18.652 1.00 22.94 ? 554 HOH A O   1 
HETATM 3721 O O   . HOH E 3 .   ? 38.408 14.518  1.101  1.00 31.31 ? 555 HOH A O   1 
HETATM 3722 O O   . HOH E 3 .   ? -0.302 16.993  8.472  1.00 21.68 ? 556 HOH A O   1 
HETATM 3723 O O   . HOH E 3 .   ? 10.001 -1.634  20.261 1.00 28.40 ? 557 HOH A O   1 
HETATM 3724 O O   . HOH E 3 .   ? 26.610 -7.714  14.772 1.00 25.57 ? 558 HOH A O   1 
HETATM 3725 O O   . HOH E 3 .   ? 27.220 35.841  22.799 1.00 23.42 ? 559 HOH A O   1 
HETATM 3726 O O   . HOH E 3 .   ? 10.968 28.357  24.906 1.00 25.70 ? 560 HOH A O   1 
HETATM 3727 O O   . HOH E 3 .   ? 31.635 20.621  -0.305 1.00 24.00 ? 561 HOH A O   1 
HETATM 3728 O O   . HOH E 3 .   ? 38.311 1.730   12.775 1.00 27.25 ? 562 HOH A O   1 
HETATM 3729 O O   . HOH E 3 .   ? 29.375 24.019  17.953 1.00 21.13 ? 563 HOH A O   1 
HETATM 3730 O O   . HOH E 3 .   ? 14.261 1.589   24.714 1.00 23.63 ? 564 HOH A O   1 
HETATM 3731 O O   . HOH E 3 .   ? 26.578 10.201  -0.197 1.00 28.06 ? 565 HOH A O   1 
HETATM 3732 O O   . HOH E 3 .   ? 10.340 33.806  6.428  1.00 21.57 ? 566 HOH A O   1 
HETATM 3733 O O   . HOH E 3 .   ? 13.360 25.336  1.907  1.00 25.63 ? 567 HOH A O   1 
HETATM 3734 O O   . HOH E 3 .   ? 24.436 -5.791  15.837 1.00 15.69 ? 568 HOH A O   1 
HETATM 3735 O O   . HOH E 3 .   ? 4.103  0.161   24.176 1.00 27.83 ? 569 HOH A O   1 
HETATM 3736 O O   . HOH E 3 .   ? 13.255 -3.727  7.531  1.00 29.94 ? 570 HOH A O   1 
HETATM 3737 O O   . HOH E 3 .   ? 29.109 6.351   1.853  1.00 24.18 ? 571 HOH A O   1 
HETATM 3738 O O   . HOH E 3 .   ? 20.962 -0.925  23.182 1.00 23.61 ? 572 HOH A O   1 
HETATM 3739 O O   . HOH E 3 .   ? 30.703 25.986  24.300 1.00 33.27 ? 573 HOH A O   1 
HETATM 3740 O O   . HOH E 3 .   ? 11.407 32.900  18.329 1.00 21.48 ? 574 HOH A O   1 
HETATM 3741 O O   . HOH E 3 .   ? 27.663 -2.104  2.789  1.00 29.79 ? 575 HOH A O   1 
HETATM 3742 O O   . HOH E 3 .   ? 43.364 8.915   13.561 1.00 32.47 ? 576 HOH A O   1 
HETATM 3743 O O   . HOH E 3 .   ? 22.022 -0.442  -0.303 1.00 19.62 ? 577 HOH A O   1 
HETATM 3744 O O   . HOH E 3 .   ? 24.775 24.207  0.998  1.00 20.64 ? 578 HOH A O   1 
HETATM 3745 O O   . HOH E 3 .   ? 3.997  17.586  6.176  1.00 18.37 ? 579 HOH A O   1 
HETATM 3746 O O   . HOH E 3 .   ? 47.317 8.101   24.791 1.00 31.29 ? 580 HOH A O   1 
HETATM 3747 O O   . HOH E 3 .   ? 26.201 27.432  3.529  1.00 20.39 ? 581 HOH A O   1 
HETATM 3748 O O   . HOH E 3 .   ? 26.109 26.215  0.830  1.00 24.32 ? 582 HOH A O   1 
HETATM 3749 O O   . HOH E 3 .   ? 22.280 34.290  28.259 1.00 23.15 ? 583 HOH A O   1 
HETATM 3750 O O   . HOH E 3 .   ? 2.834  28.223  20.543 1.00 21.37 ? 584 HOH A O   1 
HETATM 3751 O O   . HOH E 3 .   ? 15.084 3.765   -2.910 1.00 27.40 ? 585 HOH A O   1 
HETATM 3752 O O   . HOH E 3 .   ? 2.452  4.564   11.065 1.00 21.22 ? 586 HOH A O   1 
HETATM 3753 O O   . HOH E 3 .   ? 28.381 12.155  0.350  1.00 31.73 ? 587 HOH A O   1 
HETATM 3754 O O   . HOH E 3 .   ? 27.184 -8.531  8.996  1.00 20.50 ? 588 HOH A O   1 
HETATM 3755 O O   . HOH E 3 .   ? 28.646 23.374  24.713 1.00 23.19 ? 589 HOH A O   1 
HETATM 3756 O O   . HOH E 3 .   ? 22.245 36.610  12.967 1.00 29.21 ? 590 HOH A O   1 
HETATM 3757 O O   . HOH E 3 .   ? 46.989 12.270  24.467 1.00 22.54 ? 591 HOH A O   1 
HETATM 3758 O O   . HOH E 3 .   ? 33.690 -8.162  7.422  1.00 24.18 ? 592 HOH A O   1 
HETATM 3759 O O   . HOH E 3 .   ? 40.402 26.533  13.799 1.00 22.31 ? 593 HOH A O   1 
HETATM 3760 O O   . HOH E 3 .   ? 22.806 9.560   -2.039 1.00 26.31 ? 594 HOH A O   1 
HETATM 3761 O O   . HOH E 3 .   ? 33.716 18.747  -1.127 1.00 35.18 ? 595 HOH A O   1 
HETATM 3762 O O   . HOH E 3 .   ? 1.951  36.624  18.331 1.00 29.66 ? 596 HOH A O   1 
HETATM 3763 O O   . HOH E 3 .   ? 20.460 11.977  -3.095 1.00 19.71 ? 597 HOH A O   1 
HETATM 3764 O O   . HOH E 3 .   ? 34.289 -4.852  18.743 1.00 32.16 ? 598 HOH A O   1 
HETATM 3765 O O   . HOH E 3 .   ? 8.944  6.920   6.568  1.00 30.40 ? 599 HOH A O   1 
HETATM 3766 O O   . HOH E 3 .   ? 4.676  10.122  3.063  1.00 24.27 ? 600 HOH A O   1 
HETATM 3767 O O   . HOH E 3 .   ? -0.405 36.730  18.244 1.00 24.25 ? 601 HOH A O   1 
HETATM 3768 O O   . HOH E 3 .   ? 21.278 41.534  15.237 1.00 24.70 ? 602 HOH A O   1 
HETATM 3769 O O   . HOH E 3 .   ? 22.188 26.158  2.074  1.00 19.46 ? 603 HOH A O   1 
HETATM 3770 O O   . HOH E 3 .   ? 31.260 -4.251  4.664  1.00 31.79 ? 604 HOH A O   1 
HETATM 3771 O O   . HOH E 3 .   ? 38.245 2.909   23.327 1.00 28.94 ? 605 HOH A O   1 
HETATM 3772 O O   . HOH E 3 .   ? 44.897 7.599   15.731 1.00 27.65 ? 606 HOH A O   1 
HETATM 3773 O O   . HOH E 3 .   ? 31.057 12.948  1.846  1.00 38.19 ? 607 HOH A O   1 
HETATM 3774 O O   . HOH E 3 .   ? 32.939 -7.607  11.830 1.00 18.51 ? 608 HOH A O   1 
HETATM 3775 O O   . HOH E 3 .   ? 8.537  32.351  19.516 1.00 38.20 ? 609 HOH A O   1 
HETATM 3776 O O   . HOH E 3 .   ? 19.525 29.002  1.368  1.00 35.20 ? 610 HOH A O   1 
HETATM 3777 O O   . HOH E 3 .   ? 15.094 29.177  21.921 1.00 28.61 ? 611 HOH A O   1 
HETATM 3778 O O   . HOH E 3 .   ? -2.220 5.620   16.184 1.00 29.00 ? 612 HOH A O   1 
HETATM 3779 O O   . HOH E 3 .   ? 43.456 4.018   22.353 1.00 31.13 ? 613 HOH A O   1 
HETATM 3780 O O   . HOH E 3 .   ? 0.233  24.570  12.459 1.00 28.00 ? 614 HOH A O   1 
HETATM 3781 O O   . HOH E 3 .   ? 28.525 21.947  -1.417 1.00 26.42 ? 615 HOH A O   1 
HETATM 3782 O O   . HOH E 3 .   ? 0.353  33.553  20.470 1.00 31.23 ? 616 HOH A O   1 
HETATM 3783 O O   . HOH E 3 .   ? 11.791 37.115  12.884 1.00 24.72 ? 617 HOH A O   1 
HETATM 3784 O O   . HOH E 3 .   ? 24.061 25.317  24.654 1.00 23.92 ? 618 HOH A O   1 
HETATM 3785 O O   . HOH E 3 .   ? 21.457 37.123  25.227 1.00 36.73 ? 619 HOH A O   1 
HETATM 3786 O O   . HOH E 3 .   ? 30.416 5.806   26.207 1.00 20.28 ? 620 HOH A O   1 
HETATM 3787 O O   . HOH E 3 .   ? 21.596 -3.783  3.039  1.00 25.38 ? 621 HOH A O   1 
HETATM 3788 O O   . HOH E 3 .   ? 31.593 8.385   2.270  1.00 34.98 ? 622 HOH A O   1 
HETATM 3789 O O   . HOH E 3 .   ? -0.186 4.936   15.282 1.00 22.65 ? 623 HOH A O   1 
HETATM 3790 O O   . HOH E 3 .   ? 15.044 21.671  0.826  1.00 28.77 ? 624 HOH A O   1 
HETATM 3791 O O   . HOH E 3 .   ? 35.880 11.199  28.559 1.00 23.97 ? 625 HOH A O   1 
HETATM 3792 O O   . HOH E 3 .   ? 10.101 35.969  11.129 1.00 31.29 ? 626 HOH A O   1 
HETATM 3793 O O   . HOH E 3 .   ? 29.584 22.584  12.493 1.00 27.35 ? 627 HOH A O   1 
HETATM 3794 O O   . HOH E 3 .   ? -0.278 7.172   12.979 1.00 18.70 ? 628 HOH A O   1 
HETATM 3795 O O   . HOH E 3 .   ? -0.971 13.355  2.851  1.00 20.93 ? 629 HOH A O   1 
HETATM 3796 O O   . HOH E 3 .   ? 22.104 -4.115  20.704 1.00 23.78 ? 630 HOH A O   1 
HETATM 3797 O O   . HOH E 3 .   ? 1.757  15.868  6.363  1.00 25.98 ? 631 HOH A O   1 
HETATM 3798 O O   . HOH E 3 .   ? 39.826 -3.832  9.667  1.00 27.92 ? 632 HOH A O   1 
HETATM 3799 O O   . HOH E 3 .   ? 36.166 24.108  3.237  1.00 22.16 ? 633 HOH A O   1 
HETATM 3800 O O   . HOH E 3 .   ? 30.436 27.897  6.999  1.00 32.24 ? 634 HOH A O   1 
HETATM 3801 O O   . HOH E 3 .   ? 30.743 2.956   5.001  1.00 30.81 ? 635 HOH A O   1 
HETATM 3802 O O   . HOH E 3 .   ? 9.617  1.723   15.177 1.00 22.48 ? 636 HOH A O   1 
HETATM 3803 O O   . HOH E 3 .   ? 14.649 -4.649  10.128 1.00 25.80 ? 637 HOH A O   1 
HETATM 3804 O O   . HOH E 3 .   ? 24.336 34.318  6.494  1.00 27.33 ? 638 HOH A O   1 
HETATM 3805 O O   . HOH E 3 .   ? 24.968 9.681   -1.611 1.00 25.69 ? 639 HOH A O   1 
HETATM 3806 O O   . HOH E 3 .   ? 15.993 23.794  2.121  1.00 37.49 ? 640 HOH A O   1 
HETATM 3807 O O   . HOH E 3 .   ? 41.354 7.417   28.116 1.00 28.25 ? 641 HOH A O   1 
HETATM 3808 O O   . HOH E 3 .   ? 32.157 24.889  5.745  1.00 25.58 ? 642 HOH A O   1 
HETATM 3809 O O   . HOH E 3 .   ? 30.362 30.618  20.078 1.00 23.62 ? 643 HOH A O   1 
HETATM 3810 O O   . HOH E 3 .   ? 23.641 42.326  16.584 1.00 27.99 ? 644 HOH A O   1 
HETATM 3811 O O   . HOH E 3 .   ? 47.279 14.493  24.269 1.00 27.31 ? 645 HOH A O   1 
HETATM 3812 O O   . HOH E 3 .   ? 26.369 40.540  20.829 1.00 34.36 ? 646 HOH A O   1 
HETATM 3813 O O   . HOH E 3 .   ? 6.960  9.156   1.981  1.00 30.28 ? 647 HOH A O   1 
HETATM 3814 O O   . HOH E 3 .   ? 35.276 -5.517  15.408 1.00 35.94 ? 648 HOH A O   1 
HETATM 3815 O O   . HOH E 3 .   ? 5.175  -3.504  23.312 1.00 20.44 ? 649 HOH A O   1 
HETATM 3816 O O   . HOH E 3 .   ? 14.987 35.310  24.864 1.00 27.32 ? 650 HOH A O   1 
HETATM 3817 O O   . HOH E 3 .   ? 31.269 0.001   -1.518 1.00 34.15 ? 651 HOH A O   1 
HETATM 3818 O O   . HOH E 3 .   ? 19.222 39.985  22.306 1.00 28.67 ? 652 HOH A O   1 
HETATM 3819 O O   . HOH E 3 .   ? 21.215 4.076   22.778 1.00 35.58 ? 653 HOH A O   1 
HETATM 3820 O O   . HOH E 3 .   ? 37.025 4.069   3.548  1.00 32.78 ? 654 HOH A O   1 
HETATM 3821 O O   . HOH E 3 .   ? 43.097 5.307   16.515 1.00 26.47 ? 655 HOH A O   1 
HETATM 3822 O O   . HOH E 3 .   ? 24.863 16.275  -2.090 1.00 29.12 ? 656 HOH A O   1 
HETATM 3823 O O   . HOH E 3 .   ? -0.171 3.335   20.934 1.00 26.05 ? 657 HOH A O   1 
HETATM 3824 O O   . HOH E 3 .   ? 31.063 10.667  0.464  1.00 41.88 ? 658 HOH A O   1 
HETATM 3825 O O   . HOH E 3 .   ? -0.193 4.039   18.859 1.00 26.23 ? 659 HOH A O   1 
HETATM 3826 O O   . HOH E 3 .   ? 29.165 -0.473  2.055  1.00 30.93 ? 660 HOH A O   1 
HETATM 3827 O O   . HOH E 3 .   ? -0.648 37.641  20.903 1.00 25.96 ? 661 HOH A O   1 
HETATM 3828 O O   . HOH E 3 .   ? 28.327 27.257  1.078  1.00 32.20 ? 662 HOH A O   1 
HETATM 3829 O O   . HOH E 3 .   ? 40.714 6.593   25.596 1.00 33.13 ? 663 HOH A O   1 
HETATM 3830 O O   . HOH E 3 .   ? 37.780 24.830  8.119  1.00 25.23 ? 664 HOH A O   1 
HETATM 3831 O O   . HOH E 3 .   ? 35.715 12.656  1.137  1.00 35.94 ? 665 HOH A O   1 
HETATM 3832 O O   . HOH E 3 .   ? 26.678 -6.248  5.119  1.00 28.59 ? 666 HOH A O   1 
HETATM 3833 O O   . HOH E 3 .   ? 3.855  -3.270  19.331 1.00 33.03 ? 667 HOH A O   1 
HETATM 3834 O O   . HOH E 3 .   ? 31.171 -3.414  20.853 1.00 25.42 ? 668 HOH A O   1 
HETATM 3835 O O   . HOH E 3 .   ? 26.736 32.144  26.106 1.00 29.49 ? 669 HOH A O   1 
HETATM 3836 O O   . HOH E 3 .   ? 11.029 -0.575  18.016 1.00 29.51 ? 670 HOH A O   1 
HETATM 3837 O O   . HOH E 3 .   ? 36.310 6.638   2.927  1.00 34.87 ? 671 HOH A O   1 
HETATM 3838 O O   . HOH E 3 .   ? 30.499 27.364  21.171 1.00 41.98 ? 672 HOH A O   1 
HETATM 3839 O O   . HOH E 3 .   ? 1.273  30.296  16.252 1.00 37.66 ? 673 HOH A O   1 
HETATM 3840 O O   . HOH E 3 .   ? 44.111 26.231  7.349  1.00 32.28 ? 674 HOH A O   1 
HETATM 3841 O O   . HOH E 3 .   ? 19.331 35.481  12.701 1.00 35.34 ? 675 HOH A O   1 
HETATM 3842 O O   . HOH E 3 .   ? 33.452 14.196  0.999  1.00 34.03 ? 676 HOH A O   1 
HETATM 3843 O O   . HOH E 3 .   ? -0.971 24.080  10.570 1.00 32.82 ? 677 HOH A O   1 
HETATM 3844 O O   . HOH E 3 .   ? 47.311 10.275  25.246 1.00 41.76 ? 678 HOH A O   1 
HETATM 3845 O O   . HOH E 3 .   ? 41.137 5.222   14.133 1.00 29.90 ? 679 HOH A O   1 
HETATM 3846 O O   . HOH E 3 .   ? 38.470 11.522  26.373 1.00 38.35 ? 680 HOH A O   1 
HETATM 3847 O O   . HOH E 3 .   ? 36.942 20.413  22.385 1.00 31.47 ? 681 HOH A O   1 
HETATM 3848 O O   . HOH E 3 .   ? 44.196 26.252  12.572 1.00 27.53 ? 682 HOH A O   1 
HETATM 3849 O O   . HOH E 3 .   ? 23.909 15.225  -4.629 1.00 32.13 ? 683 HOH A O   1 
HETATM 3850 O O   . HOH E 3 .   ? 42.063 7.296   12.731 1.00 33.52 ? 684 HOH A O   1 
HETATM 3851 O O   . HOH E 3 .   ? 31.573 30.639  22.499 1.00 32.78 ? 685 HOH A O   1 
HETATM 3852 O O   . HOH E 3 .   ? 36.483 10.279  4.884  1.00 36.97 ? 686 HOH A O   1 
HETATM 3853 O O   . HOH E 3 .   ? 22.580 -7.572  9.012  1.00 36.99 ? 687 HOH A O   1 
HETATM 3854 O O   . HOH E 3 .   ? 45.369 15.495  26.922 1.00 42.17 ? 688 HOH A O   1 
HETATM 3855 O O   . HOH E 3 .   ? 3.531  -0.757  16.062 1.00 38.06 ? 689 HOH A O   1 
HETATM 3856 O O   . HOH E 3 .   ? 35.100 8.259   4.324  1.00 37.08 ? 690 HOH A O   1 
HETATM 3857 O O   . HOH E 3 .   ? 35.227 32.358  14.089 1.00 29.81 ? 691 HOH A O   1 
HETATM 3858 O O   . HOH E 3 .   ? 30.988 2.281   -1.801 1.00 32.54 ? 692 HOH A O   1 
HETATM 3859 O O   . HOH E 3 .   ? 46.491 26.564  13.062 1.00 35.49 ? 693 HOH A O   1 
HETATM 3860 O O   . HOH E 3 .   ? 31.242 26.019  18.131 1.00 39.64 ? 694 HOH A O   1 
HETATM 3861 O O   . HOH E 3 .   ? 25.779 34.943  25.162 1.00 32.48 ? 695 HOH A O   1 
HETATM 3862 O O   . HOH E 3 .   ? -1.662 18.740  11.187 1.00 32.55 ? 696 HOH A O   1 
HETATM 3863 O O   . HOH E 3 .   ? 36.320 0.724   23.723 1.00 29.18 ? 697 HOH A O   1 
HETATM 3864 O O   . HOH E 3 .   ? 1.273  2.818   13.750 1.00 33.75 ? 698 HOH A O   1 
HETATM 3865 O O   . HOH E 3 .   ? 29.740 29.602  4.439  1.00 32.18 ? 699 HOH A O   1 
HETATM 3866 O O   . HOH E 3 .   ? 30.338 32.164  3.327  1.00 32.72 ? 700 HOH A O   1 
HETATM 3867 O O   . HOH E 3 .   ? 30.128 -6.488  15.328 1.00 25.07 ? 701 HOH A O   1 
HETATM 3868 O O   . HOH E 3 .   ? 15.878 0.202   1.586  1.00 28.07 ? 702 HOH A O   1 
HETATM 3869 O O   . HOH E 3 .   ? 0.656  30.602  6.561  1.00 26.86 ? 703 HOH A O   1 
HETATM 3870 O O   . HOH E 3 .   ? 1.983  12.413  13.359 1.00 29.73 ? 704 HOH A O   1 
HETATM 3871 O O   . HOH E 3 .   ? 13.433 -0.681  4.571  1.00 30.92 ? 705 HOH A O   1 
HETATM 3872 O O   . HOH E 3 .   ? 37.664 1.101   15.201 1.00 32.50 ? 706 HOH A O   1 
HETATM 3873 O O   . HOH E 3 .   ? 28.760 38.261  12.244 1.00 30.02 ? 707 HOH A O   1 
HETATM 3874 O O   . HOH E 3 .   ? 23.679 -1.682  0.162  1.00 40.82 ? 708 HOH A O   1 
HETATM 3875 O O   . HOH E 3 .   ? 40.615 12.358  27.413 1.00 28.97 ? 709 HOH A O   1 
HETATM 3876 O O   . HOH E 3 .   ? 12.825 22.214  0.000  0.50 44.06 ? 710 HOH A O   1 
HETATM 3877 O O   . HOH E 3 .   ? 28.426 30.050  26.153 1.00 31.71 ? 711 HOH A O   1 
HETATM 3878 O O   . HOH E 3 .   ? 40.764 14.465  8.464  1.00 25.19 ? 712 HOH A O   1 
HETATM 3879 O O   . HOH E 3 .   ? 19.708 -1.384  1.031  1.00 41.24 ? 713 HOH A O   1 
HETATM 3880 O O   . HOH E 3 .   ? -6.476 11.633  5.731  1.00 33.39 ? 714 HOH A O   1 
HETATM 3881 O O   . HOH E 3 .   ? 11.525 -0.532  6.565  1.00 37.00 ? 715 HOH A O   1 
HETATM 3882 O O   . HOH E 3 .   ? 2.688  24.371  6.963  1.00 29.88 ? 716 HOH A O   1 
HETATM 3883 O O   . HOH E 3 .   ? -2.425 16.356  9.012  1.00 29.44 ? 717 HOH A O   1 
HETATM 3884 O O   . HOH E 3 .   ? 36.092 11.924  26.356 1.00 31.70 ? 718 HOH A O   1 
HETATM 3885 O O   . HOH E 3 .   ? 26.522 14.941  -2.447 1.00 27.86 ? 719 HOH A O   1 
HETATM 3886 O O   . HOH E 3 .   ? 39.122 4.006   9.047  1.00 28.04 ? 720 HOH A O   1 
HETATM 3887 O O   . HOH E 3 .   ? 31.409 -7.267  13.681 1.00 40.50 ? 721 HOH A O   1 
HETATM 3888 O O   . HOH E 3 .   ? -2.085 21.122  11.017 1.00 38.04 ? 722 HOH A O   1 
HETATM 3889 O O   . HOH E 3 .   ? 24.593 6.637   -3.923 1.00 36.25 ? 723 HOH A O   1 
HETATM 3890 O O   . HOH E 3 .   ? 39.481 -0.321  11.858 1.00 29.79 ? 724 HOH A O   1 
HETATM 3891 O O   . HOH E 3 .   ? 17.430 -6.971  22.132 1.00 44.41 ? 725 HOH A O   1 
HETATM 3892 O O   . HOH E 3 .   ? -2.957 11.816  8.494  1.00 26.37 ? 726 HOH A O   1 
HETATM 3893 O O   . HOH E 3 .   ? 37.775 14.976  28.577 1.00 34.99 ? 727 HOH A O   1 
HETATM 3894 O O   . HOH E 3 .   ? 13.922 35.239  10.239 1.00 28.01 ? 728 HOH A O   1 
HETATM 3895 O O   . HOH E 3 .   ? 15.742 -0.563  3.882  1.00 40.62 ? 729 HOH A O   1 
HETATM 3896 O O   . HOH E 3 .   ? 37.139 10.519  -0.742 1.00 40.99 ? 730 HOH A O   1 
HETATM 3897 O O   . HOH E 3 .   ? 44.031 7.174   24.980 1.00 36.75 ? 731 HOH A O   1 
HETATM 3898 O O   . HOH E 3 .   ? 42.148 14.044  26.485 1.00 42.96 ? 732 HOH A O   1 
HETATM 3899 O O   . HOH E 3 .   ? 25.425 41.602  14.273 1.00 32.23 ? 733 HOH A O   1 
HETATM 3900 O O   . HOH E 3 .   ? 33.006 22.745  24.387 1.00 34.14 ? 734 HOH A O   1 
HETATM 3901 O O   . HOH E 3 .   ? 2.763  3.824   7.480  1.00 37.88 ? 735 HOH A O   1 
HETATM 3902 O O   . HOH E 3 .   ? 26.099 39.135  12.910 1.00 25.63 ? 736 HOH A O   1 
HETATM 3903 O O   . HOH E 3 .   ? 44.493 5.031   26.157 1.00 29.76 ? 737 HOH A O   1 
HETATM 3904 O O   . HOH E 3 .   ? -3.925 12.054  5.955  1.00 42.77 ? 738 HOH A O   1 
HETATM 3905 O O   . HOH E 3 .   ? 26.327 24.151  23.418 1.00 14.42 ? 739 HOH A O   1 
HETATM 3906 O O   . HOH E 3 .   ? 13.055 -3.128  17.801 1.00 27.52 ? 740 HOH A O   1 
HETATM 3907 O O   . HOH E 3 .   ? 2.881  -1.425  23.478 1.00 27.60 ? 741 HOH A O   1 
HETATM 3908 O O   . HOH E 3 .   ? 32.785 -5.033  14.976 1.00 29.91 ? 742 HOH A O   1 
HETATM 3909 O O   . HOH E 3 .   ? 40.127 3.543   12.546 1.00 31.87 ? 743 HOH A O   1 
HETATM 3910 O O   . HOH E 3 .   ? 7.770  3.008   12.562 1.00 29.00 ? 744 HOH A O   1 
HETATM 3911 O O   . HOH E 3 .   ? 37.506 26.562  9.860  1.00 34.00 ? 745 HOH A O   1 
HETATM 3912 O O   . HOH E 3 .   ? 12.023 36.018  9.423  1.00 37.28 ? 746 HOH A O   1 
HETATM 3913 O O   . HOH E 3 .   ? 32.350 -6.708  5.391  1.00 40.11 ? 747 HOH A O   1 
HETATM 3914 O O   . HOH E 3 .   ? 18.259 41.807  23.250 1.00 40.09 ? 748 HOH A O   1 
HETATM 3915 O O   . HOH E 3 .   ? 33.010 3.487   5.138  1.00 42.56 ? 749 HOH A O   1 
HETATM 3916 O O   . HOH E 3 .   ? 15.800 -7.389  10.262 1.00 44.89 ? 750 HOH A O   1 
HETATM 3917 O O   . HOH E 3 .   ? 36.902 4.376   27.507 1.00 34.20 ? 751 HOH A O   1 
HETATM 3918 O O   . HOH E 3 .   ? -2.625 11.422  3.723  1.00 40.89 ? 752 HOH A O   1 
HETATM 3919 O O   . HOH E 3 .   ? 6.082  1.888   13.588 1.00 32.00 ? 753 HOH A O   1 
HETATM 3920 O O   . HOH E 3 .   ? 8.217  1.170   13.641 1.00 35.79 ? 754 HOH A O   1 
HETATM 3921 O O   . HOH E 3 .   ? 33.973 37.862  20.624 1.00 32.46 ? 755 HOH A O   1 
HETATM 3922 O O   . HOH E 3 .   ? 5.342  3.330   6.906  1.00 40.46 ? 756 HOH A O   1 
HETATM 3923 O O   . HOH E 3 .   ? 27.837 35.182  6.290  1.00 34.69 ? 757 HOH A O   1 
HETATM 3924 O O   . HOH E 3 .   ? 3.045  25.217  9.402  1.00 35.85 ? 758 HOH A O   1 
HETATM 3925 O O   . HOH E 3 .   ? 24.230 -10.807 11.370 1.00 34.76 ? 759 HOH A O   1 
HETATM 3926 O O   . HOH E 3 .   ? 41.056 13.586  1.600  1.00 38.40 ? 760 HOH A O   1 
HETATM 3927 O O   . HOH E 3 .   ? 30.748 30.725  25.528 1.00 37.35 ? 761 HOH A O   1 
HETATM 3928 O O   . HOH E 3 .   ? 2.350  24.719  17.063 1.00 20.81 ? 762 HOH A O   1 
HETATM 3929 O O   . HOH E 3 .   ? 39.181 14.252  26.836 1.00 32.75 ? 763 HOH A O   1 
HETATM 3930 O O   . HOH E 3 .   ? 9.085  3.039   6.905  1.00 26.91 ? 764 HOH A O   1 
HETATM 3931 O O   . HOH E 3 .   ? 17.464 -1.875  3.069  1.00 28.98 ? 765 HOH A O   1 
HETATM 3932 O O   . HOH E 3 .   ? 18.352 3.201   -5.266 1.00 29.88 ? 766 HOH A O   1 
HETATM 3933 O O   . HOH E 3 .   ? -1.103 19.066  14.046 1.00 33.46 ? 767 HOH A O   1 
HETATM 3934 O O   . HOH F 3 .   ? 9.555  17.503  20.913 1.00 4.35  ? 401 HOH B O   1 
HETATM 3935 O O   . HOH F 3 .   ? 18.966 12.727  33.546 1.00 6.14  ? 402 HOH B O   1 
HETATM 3936 O O   . HOH F 3 .   ? 6.927  12.113  23.231 1.00 6.17  ? 403 HOH B O   1 
HETATM 3937 O O   . HOH F 3 .   ? 25.001 11.625  27.729 1.00 4.95  ? 404 HOH B O   1 
HETATM 3938 O O   . HOH F 3 .   ? 10.118 22.381  33.887 1.00 7.09  ? 405 HOH B O   1 
HETATM 3939 O O   . HOH F 3 .   ? 6.772  17.740  20.560 1.00 5.42  ? 406 HOH B O   1 
HETATM 3940 O O   . HOH F 3 .   ? 21.550 12.990  34.710 1.00 6.62  ? 407 HOH B O   1 
HETATM 3941 O O   . HOH F 3 .   ? 22.383 12.355  31.715 1.00 8.41  ? 408 HOH B O   1 
HETATM 3942 O O   . HOH F 3 .   ? 2.796  14.488  23.099 1.00 7.83  ? 409 HOH B O   1 
HETATM 3943 O O   . HOH F 3 .   ? 34.277 19.115  32.452 1.00 9.82  ? 410 HOH B O   1 
HETATM 3944 O O   . HOH F 3 .   ? 19.964 9.068   46.077 1.00 7.44  ? 411 HOH B O   1 
HETATM 3945 O O   . HOH F 3 .   ? 6.761  8.936   25.690 1.00 9.36  ? 412 HOH B O   1 
HETATM 3946 O O   . HOH F 3 .   ? 8.698  13.921  22.024 1.00 7.47  ? 413 HOH B O   1 
HETATM 3947 O O   . HOH F 3 .   ? 27.450 10.341  27.944 1.00 9.15  ? 414 HOH B O   1 
HETATM 3948 O O   . HOH F 3 .   ? 29.306 22.202  29.097 1.00 7.48  ? 415 HOH B O   1 
HETATM 3949 O O   . HOH F 3 .   ? 12.838 12.489  22.471 1.00 7.03  ? 416 HOH B O   1 
HETATM 3950 O O   . HOH F 3 .   ? 23.236 18.621  24.440 1.00 8.00  ? 417 HOH B O   1 
HETATM 3951 O O   . HOH F 3 .   ? 25.537 5.018   45.708 1.00 10.24 ? 418 HOH B O   1 
HETATM 3952 O O   . HOH F 3 .   ? -0.838 17.533  22.040 1.00 11.99 ? 419 HOH B O   1 
HETATM 3953 O O   . HOH F 3 .   ? 20.739 29.461  27.897 1.00 10.48 ? 420 HOH B O   1 
HETATM 3954 O O   . HOH F 3 .   ? 21.094 4.738   30.835 1.00 9.02  ? 421 HOH B O   1 
HETATM 3955 O O   . HOH F 3 .   ? 26.826 7.627   28.371 1.00 10.52 ? 422 HOH B O   1 
HETATM 3956 O O   . HOH F 3 .   ? 4.325  9.799   24.559 1.00 9.93  ? 423 HOH B O   1 
HETATM 3957 O O   . HOH F 3 .   ? 31.602 12.187  28.024 1.00 12.65 ? 424 HOH B O   1 
HETATM 3958 O O   . HOH F 3 .   ? 12.427 6.714   44.061 1.00 9.83  ? 425 HOH B O   1 
HETATM 3959 O O   . HOH F 3 .   ? 16.517 18.476  50.893 1.00 12.15 ? 426 HOH B O   1 
HETATM 3960 O O   . HOH F 3 .   ? 12.458 24.446  22.721 1.00 12.36 ? 427 HOH B O   1 
HETATM 3961 O O   . HOH F 3 .   ? 27.262 29.438  28.491 1.00 11.77 ? 428 HOH B O   1 
HETATM 3962 O O   . HOH F 3 .   ? 42.156 11.150  40.864 1.00 11.75 ? 429 HOH B O   1 
HETATM 3963 O O   . HOH F 3 .   ? 24.707 18.592  45.870 1.00 11.76 ? 430 HOH B O   1 
HETATM 3964 O O   . HOH F 3 .   ? 7.071  23.122  28.810 1.00 11.91 ? 431 HOH B O   1 
HETATM 3965 O O   . HOH F 3 .   ? 22.201 17.597  47.184 1.00 11.58 ? 432 HOH B O   1 
HETATM 3966 O O   . HOH F 3 .   ? 23.040 20.772  44.996 1.00 10.87 ? 433 HOH B O   1 
HETATM 3967 O O   . HOH F 3 .   ? 19.115 3.100   47.723 1.00 9.60  ? 434 HOH B O   1 
HETATM 3968 O O   . HOH F 3 .   ? 32.880 23.368  26.768 1.00 11.91 ? 435 HOH B O   1 
HETATM 3969 O O   . HOH F 3 .   ? 22.412 5.066   49.219 1.00 13.43 ? 436 HOH B O   1 
HETATM 3970 O O   . HOH F 3 .   ? 20.866 19.827  46.314 1.00 9.76  ? 437 HOH B O   1 
HETATM 3971 O O   . HOH F 3 .   ? 1.879  25.479  24.008 1.00 11.77 ? 438 HOH B O   1 
HETATM 3972 O O   . HOH F 3 .   ? 27.980 5.293   26.969 1.00 15.50 ? 439 HOH B O   1 
HETATM 3973 O O   . HOH F 3 .   ? 18.406 24.357  22.784 1.00 13.55 ? 440 HOH B O   1 
HETATM 3974 O O   . HOH F 3 .   ? 21.213 10.984  27.628 1.00 13.74 ? 441 HOH B O   1 
HETATM 3975 O O   . HOH F 3 .   ? 29.930 10.607  26.654 1.00 11.89 ? 442 HOH B O   1 
HETATM 3976 O O   . HOH F 3 .   ? -0.284 19.331  27.855 1.00 13.27 ? 443 HOH B O   1 
HETATM 3977 O O   . HOH F 3 .   ? 13.000 13.535  50.906 1.00 14.79 ? 444 HOH B O   1 
HETATM 3978 O O   . HOH F 3 .   ? 20.878 26.952  46.313 1.00 13.08 ? 445 HOH B O   1 
HETATM 3979 O O   . HOH F 3 .   ? 29.312 24.041  27.154 1.00 14.79 ? 446 HOH B O   1 
HETATM 3980 O O   . HOH F 3 .   ? 27.562 -2.007  22.568 1.00 15.49 ? 447 HOH B O   1 
HETATM 3981 O O   . HOH F 3 .   ? 29.680 29.013  40.355 1.00 15.79 ? 448 HOH B O   1 
HETATM 3982 O O   . HOH F 3 .   ? 5.947  16.445  42.725 1.00 19.37 ? 449 HOH B O   1 
HETATM 3983 O O   . HOH F 3 .   ? 4.238  -0.554  27.944 1.00 14.95 ? 450 HOH B O   1 
HETATM 3984 O O   . HOH F 3 .   ? 35.506 23.497  27.643 1.00 14.84 ? 451 HOH B O   1 
HETATM 3985 O O   . HOH F 3 .   ? 18.992 33.047  44.863 1.00 16.23 ? 452 HOH B O   1 
HETATM 3986 O O   . HOH F 3 .   ? 9.989  6.116   45.382 1.00 18.51 ? 453 HOH B O   1 
HETATM 3987 O O   . HOH F 3 .   ? 29.528 30.900  29.513 1.00 16.17 ? 454 HOH B O   1 
HETATM 3988 O O   . HOH F 3 .   ? 8.690  -5.468  35.353 1.00 17.85 ? 455 HOH B O   1 
HETATM 3989 O O   . HOH F 3 .   ? 28.829 2.945   28.103 1.00 17.15 ? 456 HOH B O   1 
HETATM 3990 O O   . HOH F 3 .   ? 9.356  22.384  45.679 1.00 16.82 ? 457 HOH B O   1 
HETATM 3991 O O   . HOH F 3 .   ? 6.681  9.531   46.669 1.00 21.63 ? 458 HOH B O   1 
HETATM 3992 O O   . HOH F 3 .   ? 7.534  21.087  47.308 1.00 20.15 ? 459 HOH B O   1 
HETATM 3993 O O   . HOH F 3 .   ? 26.362 19.564  47.897 1.00 21.96 ? 460 HOH B O   1 
HETATM 3994 O O   . HOH F 3 .   ? 12.486 14.759  21.273 1.00 12.61 ? 461 HOH B O   1 
HETATM 3995 O O   . HOH F 3 .   ? 24.138 23.294  45.840 1.00 15.69 ? 462 HOH B O   1 
HETATM 3996 O O   . HOH F 3 .   ? 31.780 30.459  39.383 1.00 19.40 ? 463 HOH B O   1 
HETATM 3997 O O   . HOH F 3 .   ? 30.210 -1.453  22.202 1.00 18.45 ? 464 HOH B O   1 
HETATM 3998 O O   . HOH F 3 .   ? 12.872 28.320  29.873 1.00 16.83 ? 465 HOH B O   1 
HETATM 3999 O O   . HOH F 3 .   ? 26.888 24.865  45.402 1.00 16.60 ? 466 HOH B O   1 
HETATM 4000 O O   . HOH F 3 .   ? 2.659  12.460  29.714 1.00 14.87 ? 467 HOH B O   1 
HETATM 4001 O O   . HOH F 3 .   ? 28.580 -5.051  24.859 1.00 22.04 ? 468 HOH B O   1 
HETATM 4002 O O   . HOH F 3 .   ? 40.035 18.177  28.686 1.00 21.22 ? 469 HOH B O   1 
HETATM 4003 O O   . HOH F 3 .   ? 8.474  -7.627  43.625 1.00 23.56 ? 470 HOH B O   1 
HETATM 4004 O O   . HOH F 3 .   ? 17.468 8.856   51.396 1.00 25.69 ? 471 HOH B O   1 
HETATM 4005 O O   . HOH F 3 .   ? 11.785 -2.211  25.026 1.00 30.65 ? 472 HOH B O   1 
HETATM 4006 O O   . HOH F 3 .   ? 11.334 27.870  31.827 1.00 21.37 ? 473 HOH B O   1 
HETATM 4007 O O   . HOH F 3 .   ? 28.225 -4.542  22.101 1.00 17.61 ? 474 HOH B O   1 
HETATM 4008 O O   . HOH F 3 .   ? 28.796 14.851  50.635 1.00 20.97 ? 475 HOH B O   1 
HETATM 4009 O O   . HOH F 3 .   ? 1.102  10.762  38.683 1.00 19.88 ? 476 HOH B O   1 
HETATM 4010 O O   . HOH F 3 .   ? 16.898 16.064  51.071 1.00 18.55 ? 477 HOH B O   1 
HETATM 4011 O O   . HOH F 3 .   ? 16.604 5.960   48.116 1.00 23.01 ? 478 HOH B O   1 
HETATM 4012 O O   . HOH F 3 .   ? 18.618 7.382   47.808 1.00 22.15 ? 479 HOH B O   1 
HETATM 4013 O O   . HOH F 3 .   ? 16.395 1.433   25.413 1.00 18.80 ? 480 HOH B O   1 
HETATM 4014 O O   . HOH F 3 .   ? 24.632 10.386  51.421 1.00 20.43 ? 481 HOH B O   1 
HETATM 4015 O O   . HOH F 3 .   ? 41.340 20.061  27.160 1.00 24.88 ? 482 HOH B O   1 
HETATM 4016 O O   . HOH F 3 .   ? 5.631  -6.156  29.154 1.00 40.65 ? 483 HOH B O   1 
HETATM 4017 O O   . HOH F 3 .   ? 34.874 13.113  50.954 1.00 21.11 ? 484 HOH B O   1 
HETATM 4018 O O   . HOH F 3 .   ? 20.095 25.657  50.722 1.00 28.36 ? 485 HOH B O   1 
HETATM 4019 O O   . HOH F 3 .   ? 30.829 8.384   48.474 1.00 23.46 ? 486 HOH B O   1 
HETATM 4020 O O   . HOH F 3 .   ? 2.696  13.916  35.434 1.00 22.16 ? 487 HOH B O   1 
HETATM 4021 O O   . HOH F 3 .   ? 19.737 35.817  36.354 1.00 25.89 ? 488 HOH B O   1 
HETATM 4022 O O   . HOH F 3 .   ? 38.300 17.071  44.624 1.00 26.53 ? 489 HOH B O   1 
HETATM 4023 O O   . HOH F 3 .   ? -2.030 21.296  22.877 1.00 23.32 ? 490 HOH B O   1 
HETATM 4024 O O   . HOH F 3 .   ? 12.475 10.738  26.222 1.00 20.77 ? 491 HOH B O   1 
HETATM 4025 O O   . HOH F 3 .   ? 2.411  10.937  26.677 1.00 18.10 ? 492 HOH B O   1 
HETATM 4026 O O   . HOH F 3 .   ? 4.312  19.019  37.698 1.00 17.60 ? 493 HOH B O   1 
HETATM 4027 O O   . HOH F 3 .   ? 42.972 12.379  43.184 1.00 15.71 ? 494 HOH B O   1 
HETATM 4028 O O   . HOH F 3 .   ? 4.623  -6.657  38.252 1.00 35.01 ? 495 HOH B O   1 
HETATM 4029 O O   . HOH F 3 .   ? 7.755  4.837   44.588 1.00 20.66 ? 496 HOH B O   1 
HETATM 4030 O O   . HOH F 3 .   ? 2.961  -5.989  41.106 1.00 20.98 ? 497 HOH B O   1 
HETATM 4031 O O   . HOH F 3 .   ? 6.481  23.552  32.848 1.00 20.87 ? 498 HOH B O   1 
HETATM 4032 O O   . HOH F 3 .   ? 2.108  13.671  37.987 1.00 30.20 ? 499 HOH B O   1 
HETATM 4033 O O   . HOH F 3 .   ? 34.625 19.616  26.067 1.00 22.84 ? 500 HOH B O   1 
HETATM 4034 O O   . HOH F 3 .   ? 20.491 -11.057 31.815 1.00 25.80 ? 501 HOH B O   1 
HETATM 4035 O O   . HOH F 3 .   ? 25.145 8.426   52.362 1.00 28.37 ? 502 HOH B O   1 
HETATM 4036 O O   . HOH F 3 .   ? 30.269 36.480  42.211 1.00 23.47 ? 503 HOH B O   1 
HETATM 4037 O O   . HOH F 3 .   ? 40.315 18.730  43.916 1.00 31.89 ? 504 HOH B O   1 
HETATM 4038 O O   . HOH F 3 .   ? 7.614  21.721  50.356 1.00 21.11 ? 505 HOH B O   1 
HETATM 4039 O O   . HOH F 3 .   ? 30.654 7.897   26.439 1.00 25.63 ? 506 HOH B O   1 
HETATM 4040 O O   . HOH F 3 .   ? 9.213  7.860   47.518 1.00 20.27 ? 507 HOH B O   1 
HETATM 4041 O O   . HOH F 3 .   ? 19.453 23.751  51.656 1.00 18.26 ? 508 HOH B O   1 
HETATM 4042 O O   . HOH F 3 .   ? 15.354 26.846  23.928 1.00 21.30 ? 509 HOH B O   1 
HETATM 4043 O O   . HOH F 3 .   ? 22.446 4.383   28.468 1.00 21.33 ? 510 HOH B O   1 
HETATM 4044 O O   . HOH F 3 .   ? 14.714 9.150   50.290 1.00 32.61 ? 511 HOH B O   1 
HETATM 4045 O O   . HOH F 3 .   ? 5.324  -3.367  29.775 1.00 30.54 ? 512 HOH B O   1 
HETATM 4046 O O   . HOH F 3 .   ? 32.286 28.118  43.170 1.00 23.27 ? 513 HOH B O   1 
HETATM 4047 O O   . HOH F 3 .   ? 46.387 19.837  30.366 1.00 35.91 ? 514 HOH B O   1 
HETATM 4048 O O   . HOH F 3 .   ? 18.396 37.610  38.196 1.00 38.60 ? 515 HOH B O   1 
HETATM 4049 O O   . HOH F 3 .   ? 32.123 3.762   27.103 1.00 31.41 ? 516 HOH B O   1 
HETATM 4050 O O   . HOH F 3 .   ? 31.564 -2.220  24.909 1.00 21.68 ? 517 HOH B O   1 
HETATM 4051 O O   . HOH F 3 .   ? 21.073 9.866   53.620 1.00 32.35 ? 518 HOH B O   1 
HETATM 4052 O O   . HOH F 3 .   ? 14.339 30.340  40.046 1.00 29.85 ? 519 HOH B O   1 
HETATM 4053 O O   . HOH F 3 .   ? 11.048 30.804  23.792 1.00 23.26 ? 520 HOH B O   1 
HETATM 4054 O O   . HOH F 3 .   ? -0.592 -8.493  35.296 1.00 31.01 ? 521 HOH B O   1 
HETATM 4055 O O   . HOH F 3 .   ? 12.254 -6.565  30.338 1.00 24.25 ? 522 HOH B O   1 
HETATM 4056 O O   . HOH F 3 .   ? 22.921 38.316  42.855 1.00 22.50 ? 523 HOH B O   1 
HETATM 4057 O O   . HOH F 3 .   ? 8.432  28.626  28.790 1.00 25.00 ? 524 HOH B O   1 
HETATM 4058 O O   . HOH F 3 .   ? 31.229 -9.700  42.600 1.00 24.79 ? 525 HOH B O   1 
HETATM 4059 O O   . HOH F 3 .   ? 35.493 29.035  33.846 1.00 20.60 ? 526 HOH B O   1 
HETATM 4060 O O   . HOH F 3 .   ? 4.178  -0.686  40.525 1.00 34.87 ? 527 HOH B O   1 
HETATM 4061 O O   . HOH F 3 .   ? 20.646 25.274  48.560 1.00 21.35 ? 528 HOH B O   1 
HETATM 4062 O O   . HOH F 3 .   ? 46.147 21.078  34.297 1.00 28.90 ? 529 HOH B O   1 
HETATM 4063 O O   . HOH F 3 .   ? 25.292 31.249  28.201 1.00 20.65 ? 530 HOH B O   1 
HETATM 4064 O O   . HOH F 3 .   ? 16.251 2.956   47.160 1.00 26.51 ? 531 HOH B O   1 
HETATM 4065 O O   . HOH F 3 .   ? 0.584  11.650  31.441 1.00 29.94 ? 532 HOH B O   1 
HETATM 4066 O O   . HOH F 3 .   ? 9.041  1.529   45.425 1.00 19.98 ? 533 HOH B O   1 
HETATM 4067 O O   . HOH F 3 .   ? 16.953 36.777  40.200 1.00 25.17 ? 534 HOH B O   1 
HETATM 4068 O O   . HOH F 3 .   ? 3.606  24.648  31.438 1.00 33.10 ? 535 HOH B O   1 
HETATM 4069 O O   . HOH F 3 .   ? 16.902 33.877  33.085 1.00 25.90 ? 536 HOH B O   1 
HETATM 4070 O O   . HOH F 3 .   ? 24.466 28.605  45.115 1.00 33.93 ? 537 HOH B O   1 
HETATM 4071 O O   . HOH F 3 .   ? 32.496 1.315   25.176 1.00 26.71 ? 538 HOH B O   1 
HETATM 4072 O O   . HOH F 3 .   ? 14.178 33.103  41.448 1.00 28.82 ? 539 HOH B O   1 
HETATM 4073 O O   . HOH F 3 .   ? -2.790 -7.497  34.948 1.00 29.29 ? 540 HOH B O   1 
HETATM 4074 O O   . HOH F 3 .   ? 9.153  -6.121  39.534 1.00 22.33 ? 541 HOH B O   1 
HETATM 4075 O O   . HOH F 3 .   ? 37.136 28.096  27.566 1.00 30.68 ? 542 HOH B O   1 
HETATM 4076 O O   . HOH F 3 .   ? 19.773 12.978  51.911 1.00 21.08 ? 543 HOH B O   1 
HETATM 4077 O O   . HOH F 3 .   ? 29.415 8.716   50.963 1.00 26.79 ? 544 HOH B O   1 
HETATM 4078 O O   . HOH F 3 .   ? 32.281 4.161   29.494 1.00 25.92 ? 545 HOH B O   1 
HETATM 4079 O O   . HOH F 3 .   ? 18.523 29.632  26.400 1.00 26.18 ? 546 HOH B O   1 
HETATM 4080 O O   . HOH F 3 .   ? 12.587 33.138  37.359 1.00 25.69 ? 547 HOH B O   1 
HETATM 4081 O O   . HOH F 3 .   ? 1.321  -2.692  31.502 1.00 26.61 ? 548 HOH B O   1 
HETATM 4082 O O   . HOH F 3 .   ? 26.094 -7.296  36.684 1.00 40.27 ? 549 HOH B O   1 
HETATM 4083 O O   . HOH F 3 .   ? 1.444  26.520  21.436 1.00 27.99 ? 550 HOH B O   1 
HETATM 4084 O O   . HOH F 3 .   ? 4.788  22.663  39.640 1.00 24.30 ? 551 HOH B O   1 
HETATM 4085 O O   . HOH F 3 .   ? 14.224 30.494  24.204 1.00 31.88 ? 552 HOH B O   1 
HETATM 4086 O O   . HOH F 3 .   ? 28.045 7.068   52.084 1.00 28.95 ? 553 HOH B O   1 
HETATM 4087 O O   . HOH F 3 .   ? 4.737  -6.561  26.992 1.00 44.65 ? 554 HOH B O   1 
HETATM 4088 O O   . HOH F 3 .   ? 1.123  8.203   39.100 1.00 24.32 ? 555 HOH B O   1 
HETATM 4089 O O   . HOH F 3 .   ? 5.843  19.996  46.352 1.00 38.46 ? 556 HOH B O   1 
HETATM 4090 O O   . HOH F 3 .   ? 34.334 29.297  28.850 1.00 28.73 ? 557 HOH B O   1 
HETATM 4091 O O   . HOH F 3 .   ? 25.365 -7.705  24.799 1.00 30.38 ? 558 HOH B O   1 
HETATM 4092 O O   . HOH F 3 .   ? 27.900 17.290  49.941 1.00 31.55 ? 559 HOH B O   1 
HETATM 4093 O O   . HOH F 3 .   ? 44.924 12.067  44.707 1.00 41.25 ? 560 HOH B O   1 
HETATM 4094 O O   . HOH F 3 .   ? 35.088 15.722  26.787 1.00 31.56 ? 561 HOH B O   1 
HETATM 4095 O O   . HOH F 3 .   ? 6.926  -4.541  25.275 1.00 22.19 ? 562 HOH B O   1 
HETATM 4096 O O   . HOH F 3 .   ? 0.923  8.884   25.049 1.00 19.95 ? 563 HOH B O   1 
HETATM 4097 O O   . HOH F 3 .   ? 23.585 -7.179  44.397 1.00 32.68 ? 564 HOH B O   1 
HETATM 4098 O O   . HOH F 3 .   ? 30.811 33.047  33.145 1.00 21.45 ? 565 HOH B O   1 
HETATM 4099 O O   . HOH F 3 .   ? 25.627 -5.328  43.060 1.00 27.51 ? 566 HOH B O   1 
HETATM 4100 O O   . HOH F 3 .   ? 35.154 25.855  26.673 1.00 23.81 ? 567 HOH B O   1 
HETATM 4101 O O   . HOH F 3 .   ? 37.635 12.651  30.177 1.00 21.50 ? 568 HOH B O   1 
HETATM 4102 O O   . HOH F 3 .   ? 14.783 32.663  25.492 1.00 37.87 ? 569 HOH B O   1 
HETATM 4103 O O   . HOH F 3 .   ? 25.666 4.754   25.730 1.00 21.51 ? 570 HOH B O   1 
HETATM 4104 O O   . HOH F 3 .   ? 9.688  24.299  46.788 1.00 27.72 ? 571 HOH B O   1 
HETATM 4105 O O   . HOH F 3 .   ? 33.850 16.760  25.181 1.00 30.93 ? 572 HOH B O   1 
HETATM 4106 O O   . HOH F 3 .   ? 13.579 -3.383  45.615 1.00 23.85 ? 573 HOH B O   1 
HETATM 4107 O O   . HOH F 3 .   ? 21.102 3.163   26.096 1.00 32.60 ? 574 HOH B O   1 
HETATM 4108 O O   . HOH F 3 .   ? 33.021 14.705  51.646 1.00 29.90 ? 575 HOH B O   1 
HETATM 4109 O O   . HOH F 3 .   ? 0.130  2.151   38.168 1.00 25.59 ? 576 HOH B O   1 
HETATM 4110 O O   . HOH F 3 .   ? 37.453 13.910  51.521 1.00 20.61 ? 577 HOH B O   1 
HETATM 4111 O O   . HOH F 3 .   ? 21.586 34.008  45.586 1.00 29.90 ? 578 HOH B O   1 
HETATM 4112 O O   . HOH F 3 .   ? 0.431  9.102   27.598 1.00 31.26 ? 579 HOH B O   1 
HETATM 4113 O O   . HOH F 3 .   ? -2.924 19.109  26.584 1.00 26.84 ? 580 HOH B O   1 
HETATM 4114 O O   . HOH F 3 .   ? 17.742 34.620  28.724 1.00 22.10 ? 581 HOH B O   1 
HETATM 4115 O O   . HOH F 3 .   ? 45.853 18.122  32.558 1.00 29.00 ? 582 HOH B O   1 
HETATM 4116 O O   . HOH F 3 .   ? 18.951 35.805  31.298 1.00 34.26 ? 583 HOH B O   1 
HETATM 4117 O O   . HOH F 3 .   ? 27.302 31.185  47.045 1.00 27.21 ? 584 HOH B O   1 
HETATM 4118 O O   . HOH F 3 .   ? 37.553 25.985  27.162 1.00 28.63 ? 585 HOH B O   1 
HETATM 4119 O O   . HOH F 3 .   ? 39.128 17.819  47.848 1.00 26.08 ? 586 HOH B O   1 
HETATM 4120 O O   . HOH F 3 .   ? 13.018 -8.311  34.162 1.00 22.36 ? 587 HOH B O   1 
HETATM 4121 O O   . HOH F 3 .   ? 15.537 1.158   49.232 1.00 29.41 ? 588 HOH B O   1 
HETATM 4122 O O   . HOH F 3 .   ? 31.817 32.833  40.579 1.00 25.46 ? 589 HOH B O   1 
HETATM 4123 O O   . HOH F 3 .   ? 2.777  0.867   26.724 1.00 25.14 ? 590 HOH B O   1 
HETATM 4124 O O   . HOH F 3 .   ? 1.688  4.547   45.601 1.00 36.36 ? 591 HOH B O   1 
HETATM 4125 O O   . HOH F 3 .   ? 12.836 10.659  50.419 1.00 22.91 ? 592 HOH B O   1 
HETATM 4126 O O   . HOH F 3 .   ? 40.691 7.091   39.861 1.00 36.90 ? 593 HOH B O   1 
HETATM 4127 O O   . HOH F 3 .   ? 14.378 4.044   50.423 1.00 25.45 ? 594 HOH B O   1 
HETATM 4128 O O   . HOH F 3 .   ? 37.557 19.749  46.963 1.00 28.61 ? 595 HOH B O   1 
HETATM 4129 O O   . HOH F 3 .   ? 35.584 0.406   39.355 1.00 29.43 ? 596 HOH B O   1 
HETATM 4130 O O   . HOH F 3 .   ? -0.373 25.788  25.641 1.00 25.02 ? 597 HOH B O   1 
HETATM 4131 O O   . HOH F 3 .   ? 36.235 8.451   45.375 1.00 33.15 ? 598 HOH B O   1 
HETATM 4132 O O   . HOH F 3 .   ? 20.367 35.710  28.526 1.00 24.99 ? 599 HOH B O   1 
HETATM 4133 O O   . HOH F 3 .   ? 7.275  -9.844  31.673 1.00 35.13 ? 600 HOH B O   1 
HETATM 4134 O O   . HOH F 3 .   ? 34.106 19.805  23.848 1.00 32.66 ? 601 HOH B O   1 
HETATM 4135 O O   . HOH F 3 .   ? 23.938 25.438  45.453 1.00 29.92 ? 602 HOH B O   1 
HETATM 4136 O O   . HOH F 3 .   ? 31.395 30.531  32.357 1.00 29.11 ? 603 HOH B O   1 
HETATM 4137 O O   . HOH F 3 .   ? 10.696 39.907  31.486 1.00 45.18 ? 604 HOH B O   1 
HETATM 4138 O O   . HOH F 3 .   ? 26.697 -10.925 27.495 1.00 32.09 ? 605 HOH B O   1 
HETATM 4139 O O   . HOH F 3 .   ? 35.030 6.393   43.710 1.00 32.16 ? 606 HOH B O   1 
HETATM 4140 O O   . HOH F 3 .   ? 5.410  -8.238  33.825 1.00 37.61 ? 607 HOH B O   1 
HETATM 4141 O O   . HOH F 3 .   ? 29.639 34.859  45.608 1.00 37.21 ? 608 HOH B O   1 
HETATM 4142 O O   . HOH F 3 .   ? 6.524  -7.325  36.242 1.00 31.29 ? 609 HOH B O   1 
HETATM 4143 O O   . HOH F 3 .   ? 16.281 -0.810  24.603 1.00 23.99 ? 610 HOH B O   1 
HETATM 4144 O O   . HOH F 3 .   ? 11.375 29.128  27.598 1.00 28.90 ? 611 HOH B O   1 
HETATM 4145 O O   . HOH F 3 .   ? 27.814 10.790  51.490 1.00 23.93 ? 612 HOH B O   1 
HETATM 4146 O O   . HOH F 3 .   ? -3.569 16.563  22.313 1.00 28.53 ? 613 HOH B O   1 
HETATM 4147 O O   . HOH F 3 .   ? 45.769 8.847   41.053 1.00 29.12 ? 614 HOH B O   1 
HETATM 4148 O O   . HOH F 3 .   ? 31.073 8.872   53.392 1.00 34.96 ? 615 HOH B O   1 
HETATM 4149 O O   . HOH F 3 .   ? 4.223  17.953  40.209 1.00 31.55 ? 616 HOH B O   1 
HETATM 4150 O O   . HOH F 3 .   ? 29.715 5.013   53.625 1.00 25.33 ? 617 HOH B O   1 
HETATM 4151 O O   . HOH F 3 .   ? 48.585 17.217  41.199 1.00 26.62 ? 618 HOH B O   1 
HETATM 4152 O O   . HOH F 3 .   ? 39.755 11.074  29.905 1.00 32.21 ? 619 HOH B O   1 
HETATM 4153 O O   . HOH F 3 .   ? 2.620  15.085  39.782 1.00 31.86 ? 620 HOH B O   1 
HETATM 4154 O O   . HOH F 3 .   ? 40.389 5.205   45.574 1.00 28.29 ? 621 HOH B O   1 
HETATM 4155 O O   . HOH F 3 .   ? 41.203 30.186  35.674 1.00 35.36 ? 622 HOH B O   1 
HETATM 4156 O O   . HOH F 3 .   ? 4.962  7.461   47.164 1.00 41.31 ? 623 HOH B O   1 
HETATM 4157 O O   . HOH F 3 .   ? 31.499 27.077  48.224 1.00 27.98 ? 624 HOH B O   1 
HETATM 4158 O O   . HOH F 3 .   ? 51.206 17.846  40.015 1.00 38.46 ? 625 HOH B O   1 
HETATM 4159 O O   . HOH F 3 .   ? 6.786  11.553  47.981 1.00 36.27 ? 626 HOH B O   1 
HETATM 4160 O O   . HOH F 3 .   ? 14.836 -3.046  21.028 1.00 38.77 ? 627 HOH B O   1 
HETATM 4161 O O   . HOH F 3 .   ? 45.913 19.760  28.203 1.00 38.47 ? 628 HOH B O   1 
HETATM 4162 O O   . HOH F 3 .   ? 18.923 38.564  42.208 1.00 30.37 ? 629 HOH B O   1 
HETATM 4163 O O   . HOH F 3 .   ? 39.081 10.201  51.693 1.00 30.95 ? 630 HOH B O   1 
HETATM 4164 O O   . HOH F 3 .   ? 39.834 8.828   28.649 1.00 30.47 ? 631 HOH B O   1 
HETATM 4165 O O   . HOH F 3 .   ? 10.967 -4.212  24.434 1.00 34.18 ? 632 HOH B O   1 
HETATM 4166 O O   . HOH F 3 .   ? 29.091 27.330  48.235 1.00 33.91 ? 633 HOH B O   1 
HETATM 4167 O O   . HOH F 3 .   ? 25.306 5.367   51.925 1.00 30.33 ? 634 HOH B O   1 
HETATM 4168 O O   . HOH F 3 .   ? -2.353 1.895   39.833 1.00 38.12 ? 635 HOH B O   1 
HETATM 4169 O O   . HOH F 3 .   ? 43.852 17.509  26.357 1.00 30.39 ? 636 HOH B O   1 
HETATM 4170 O O   . HOH F 3 .   ? 8.295  11.700  50.044 1.00 40.05 ? 637 HOH B O   1 
HETATM 4171 O O   . HOH F 3 .   ? 15.855 -2.489  23.125 1.00 30.52 ? 638 HOH B O   1 
HETATM 4172 O O   . HOH F 3 .   ? 32.374 -7.900  29.437 1.00 29.73 ? 639 HOH B O   1 
HETATM 4173 O O   . HOH F 3 .   ? 13.791 29.194  46.131 1.00 15.85 ? 640 HOH B O   1 
HETATM 4174 O O   . HOH F 3 .   ? 14.542 15.807  51.832 1.00 27.50 ? 641 HOH B O   1 
HETATM 4175 O O   . HOH F 3 .   ? 14.013 29.476  26.557 1.00 28.94 ? 642 HOH B O   1 
HETATM 4176 O O   . HOH F 3 .   ? 34.017 27.468  45.642 1.00 33.46 ? 643 HOH B O   1 
HETATM 4177 O O   . HOH F 3 .   ? 21.285 29.261  47.766 1.00 33.86 ? 644 HOH B O   1 
HETATM 4178 O O   . HOH F 3 .   ? 26.134 7.789   54.870 1.00 29.24 ? 645 HOH B O   1 
HETATM 4179 O O   . HOH F 3 .   ? 16.188 31.411  27.729 1.00 29.96 ? 646 HOH B O   1 
HETATM 4180 O O   . HOH F 3 .   ? 8.832  -5.095  24.016 1.00 31.87 ? 647 HOH B O   1 
HETATM 4181 O O   . HOH F 3 .   ? 5.099  21.012  50.627 1.00 27.02 ? 648 HOH B O   1 
HETATM 4182 O O   . HOH F 3 .   ? 37.015 1.119   37.395 1.00 32.95 ? 649 HOH B O   1 
HETATM 4183 O O   . HOH F 3 .   ? 16.240 29.350  26.067 1.00 23.95 ? 650 HOH B O   1 
HETATM 4184 O O   . HOH F 3 .   ? 33.769 30.594  30.688 1.00 32.80 ? 651 HOH B O   1 
HETATM 4185 O O   . HOH F 3 .   ? 34.595 31.438  36.703 1.00 36.93 ? 652 HOH B O   1 
HETATM 4186 O O   . HOH F 3 .   ? 1.883  31.566  34.547 1.00 32.40 ? 653 HOH B O   1 
HETATM 4187 O O   . HOH F 3 .   ? 31.251 31.125  37.136 1.00 51.73 ? 654 HOH B O   1 
HETATM 4188 O O   . HOH F 3 .   ? 22.544 17.971  49.812 1.00 37.34 ? 655 HOH B O   1 
HETATM 4189 O O   . HOH F 3 .   ? -3.414 19.317  24.408 1.00 31.19 ? 656 HOH B O   1 
HETATM 4190 O O   . HOH F 3 .   ? 24.181 28.957  47.970 1.00 33.52 ? 657 HOH B O   1 
HETATM 4191 O O   . HOH F 3 .   ? 31.759 10.973  53.790 1.00 32.74 ? 658 HOH B O   1 
HETATM 4192 O O   . HOH F 3 .   ? 3.134  -10.376 28.409 1.00 38.59 ? 659 HOH B O   1 
HETATM 4193 O O   . HOH F 3 .   ? 36.757 29.441  36.639 1.00 37.61 ? 660 HOH B O   1 
HETATM 4194 O O   . HOH F 3 .   ? 22.873 11.550  53.114 1.00 44.61 ? 661 HOH B O   1 
HETATM 4195 O O   . HOH F 3 .   ? 34.874 6.499   47.072 1.00 32.30 ? 662 HOH B O   1 
HETATM 4196 O O   . HOH F 3 .   ? 28.125 -15.214 26.327 1.00 39.19 ? 663 HOH B O   1 
HETATM 4197 O O   . HOH F 3 .   ? 38.617 28.459  37.323 1.00 39.16 ? 664 HOH B O   1 
HETATM 4198 O O   . HOH F 3 .   ? 39.200 2.875   37.889 1.00 42.23 ? 665 HOH B O   1 
HETATM 4199 O O   . HOH F 3 .   ? 25.570 -10.103 25.332 1.00 38.55 ? 666 HOH B O   1 
HETATM 4200 O O   . HOH F 3 .   ? 12.937 -9.923  36.060 1.00 33.29 ? 667 HOH B O   1 
HETATM 4201 O O   . HOH F 3 .   ? 5.103  16.794  45.874 1.00 34.21 ? 668 HOH B O   1 
HETATM 4202 O O   . HOH F 3 .   ? 0.562  -1.558  33.327 1.00 37.12 ? 669 HOH B O   1 
HETATM 4203 O O   . HOH F 3 .   ? -3.235 16.291  28.793 1.00 29.13 ? 670 HOH B O   1 
HETATM 4204 O O   . HOH F 3 .   ? 7.697  -9.189  36.679 1.00 40.09 ? 671 HOH B O   1 
HETATM 4205 O O   . HOH F 3 .   ? 28.608 23.184  46.975 1.00 28.63 ? 672 HOH B O   1 
HETATM 4206 O O   . HOH F 3 .   ? 27.363 3.445   53.460 1.00 20.58 ? 673 HOH B O   1 
HETATM 4207 O O   . HOH F 3 .   ? 12.320 1.455   46.148 1.00 35.83 ? 674 HOH B O   1 
HETATM 4208 O O   . HOH F 3 .   ? -0.016 0.649   42.070 1.00 32.10 ? 675 HOH B O   1 
HETATM 4209 O O   . HOH F 3 .   ? 43.977 20.073  26.849 1.00 27.56 ? 676 HOH B O   1 
HETATM 4210 O O   . HOH F 3 .   ? 25.889 33.822  29.785 1.00 24.12 ? 677 HOH B O   1 
HETATM 4211 O O   . HOH F 3 .   ? 4.202  26.838  32.218 1.00 24.03 ? 678 HOH B O   1 
HETATM 4212 O O   . HOH F 3 .   ? 37.167 31.554  34.357 1.00 32.80 ? 679 HOH B O   1 
HETATM 4213 O O   . HOH F 3 .   ? 5.344  22.547  31.100 1.00 28.63 ? 680 HOH B O   1 
HETATM 4214 O O   . HOH F 3 .   ? 38.111 20.097  26.229 1.00 29.94 ? 681 HOH B O   1 
HETATM 4215 O O   . HOH F 3 .   ? 30.068 -10.528 27.468 1.00 26.51 ? 682 HOH B O   1 
HETATM 4216 O O   . HOH F 3 .   ? 30.359 25.001  48.998 1.00 33.11 ? 683 HOH B O   1 
HETATM 4217 O O   . HOH F 3 .   ? 16.303 35.357  31.347 1.00 42.44 ? 684 HOH B O   1 
HETATM 4218 O O   . HOH F 3 .   ? 12.762 -1.163  45.875 1.00 36.97 ? 685 HOH B O   1 
HETATM 4219 O O   . HOH F 3 .   ? 40.866 1.235   39.282 1.00 32.65 ? 686 HOH B O   1 
HETATM 4220 O O   . HOH F 3 .   ? 1.273  -2.206  35.370 1.00 33.52 ? 687 HOH B O   1 
HETATM 4221 O O   . HOH F 3 .   ? -1.016 19.633  31.358 1.00 38.14 ? 688 HOH B O   1 
HETATM 4222 O O   . HOH F 3 .   ? 37.003 26.467  40.297 1.00 29.72 ? 689 HOH B O   1 
HETATM 4223 O O   . HOH F 3 .   ? 43.077 10.728  47.415 1.00 33.91 ? 690 HOH B O   1 
HETATM 4224 O O   . HOH F 3 .   ? 32.658 -2.085  22.412 1.00 40.26 ? 691 HOH B O   1 
HETATM 4225 O O   . HOH F 3 .   ? 25.369 20.612  50.331 1.00 37.51 ? 692 HOH B O   1 
HETATM 4226 O O   . HOH F 3 .   ? 45.567 21.539  25.560 1.00 42.73 ? 693 HOH B O   1 
HETATM 4227 O O   . HOH F 3 .   ? 28.939 -9.400  25.334 1.00 39.87 ? 694 HOH B O   1 
HETATM 4228 O O   . HOH F 3 .   ? 38.244 26.605  24.797 1.00 33.42 ? 695 HOH B O   1 
HETATM 4229 O O   . HOH F 3 .   ? 45.399 14.483  33.877 1.00 28.94 ? 696 HOH B O   1 
HETATM 4230 O O   . HOH F 3 .   ? 17.063 34.922  44.549 1.00 32.49 ? 697 HOH B O   1 
HETATM 4231 O O   . HOH F 3 .   ? 35.555 28.113  38.697 1.00 53.15 ? 698 HOH B O   1 
HETATM 4232 O O   . HOH F 3 .   ? 22.199 6.483   26.227 1.00 29.30 ? 699 HOH B O   1 
HETATM 4233 O O   . HOH F 3 .   ? 23.555 33.226  32.148 1.00 21.64 ? 700 HOH B O   1 
HETATM 4234 O O   . HOH F 3 .   ? 3.894  20.607  32.361 1.00 23.87 ? 701 HOH B O   1 
HETATM 4235 O O   . HOH F 3 .   ? 21.263 34.957  32.366 1.00 33.74 ? 702 HOH B O   1 
HETATM 4236 O O   . HOH F 3 .   ? 18.731 30.939  46.720 1.00 24.24 ? 703 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 3   ? 0.1629 0.1670 0.2038 0.0423  -0.0337 0.0177  3   LYS A N   
2    C CA  . LYS A 3   ? 0.1379 0.1427 0.1741 0.0377  -0.0317 0.0175  3   LYS A CA  
3    C C   . LYS A 3   ? 0.1119 0.1105 0.1485 0.0348  -0.0282 0.0151  3   LYS A C   
4    O O   . LYS A 3   ? 0.1519 0.1417 0.1881 0.0356  -0.0279 0.0162  3   LYS A O   
5    C CB  . LYS A 3   ? 0.1510 0.1519 0.1779 0.0370  -0.0332 0.0234  3   LYS A CB  
6    C CG  . LYS A 3   ? 0.1951 0.2030 0.2189 0.0384  -0.0364 0.0262  3   LYS A CG  
7    C CD  . LYS A 3   ? 0.2163 0.2200 0.2291 0.0366  -0.0362 0.0309  3   LYS A CD  
8    C CE  . LYS A 3   ? 0.2680 0.2769 0.2756 0.0383  -0.0392 0.0347  3   LYS A CE  
9    N NZ  . LYS A 3   ? 0.2893 0.2926 0.2956 0.0425  -0.0419 0.0394  3   LYS A NZ  
10   N N   . PRO A 4   ? 0.1144 0.1173 0.1512 0.0314  -0.0258 0.0118  4   PRO A N   
11   C CA  . PRO A 4   ? 0.1235 0.1209 0.1594 0.0285  -0.0230 0.0102  4   PRO A CA  
12   C C   . PRO A 4   ? 0.0866 0.0766 0.1169 0.0268  -0.0239 0.0153  4   PRO A C   
13   O O   . PRO A 4   ? 0.0808 0.0712 0.1062 0.0270  -0.0258 0.0198  4   PRO A O   
14   C CB  . PRO A 4   ? 0.1406 0.1446 0.1763 0.0258  -0.0208 0.0070  4   PRO A CB  
15   C CG  . PRO A 4   ? 0.1383 0.1507 0.1772 0.0270  -0.0218 0.0052  4   PRO A CG  
16   C CD  . PRO A 4   ? 0.1112 0.1235 0.1485 0.0299  -0.0256 0.0097  4   PRO A CD  
17   N N   . ILE A 5   ? 0.1164 0.0999 0.1473 0.0247  -0.0223 0.0144  5   ILE A N   
18   C CA  . ILE A 5   ? 0.0758 0.0526 0.1032 0.0217  -0.0225 0.0187  5   ILE A CA  
19   C C   . ILE A 5   ? 0.0917 0.0702 0.1195 0.0180  -0.0205 0.0167  5   ILE A C   
20   O O   . ILE A 5   ? 0.0796 0.0582 0.1103 0.0178  -0.0187 0.0117  5   ILE A O   
21   C CB  . ILE A 5   ? 0.1212 0.0877 0.1492 0.0222  -0.0227 0.0198  5   ILE A CB  
22   C CG1 . ILE A 5   ? 0.1310 0.0954 0.1585 0.0269  -0.0248 0.0218  5   ILE A CG1 
23   C CG2 . ILE A 5   ? 0.1153 0.0748 0.1400 0.0180  -0.0225 0.0245  5   ILE A CG2 
24   C CD1 . ILE A 5   ? 0.1898 0.1446 0.2187 0.0284  -0.0246 0.0213  5   ILE A CD1 
25   N N   . LEU A 6   ? 0.0704 0.0505 0.0949 0.0151  -0.0205 0.0207  6   LEU A N   
26   C CA  . LEU A 6   ? 0.0738 0.0568 0.0983 0.0118  -0.0184 0.0191  6   LEU A CA  
27   C C   . LEU A 6   ? 0.0874 0.0652 0.1111 0.0075  -0.0175 0.0224  6   LEU A C   
28   O O   . LEU A 6   ? 0.0905 0.0657 0.1108 0.0061  -0.0180 0.0283  6   LEU A O   
29   C CB  . LEU A 6   ? 0.0684 0.0606 0.0887 0.0111  -0.0172 0.0193  6   LEU A CB  
30   C CG  . LEU A 6   ? 0.0734 0.0699 0.0920 0.0078  -0.0143 0.0172  6   LEU A CG  
31   C CD1 . LEU A 6   ? 0.0793 0.0762 0.1002 0.0087  -0.0130 0.0111  6   LEU A CD1 
32   C CD2 . LEU A 6   ? 0.0666 0.0706 0.0799 0.0074  -0.0132 0.0183  6   LEU A CD2 
33   N N   . TYR A 7   ? 0.0908 0.0668 0.1172 0.0053  -0.0163 0.0187  7   TYR A N   
34   C CA  . TYR A 7   ? 0.0887 0.0612 0.1159 0.0003  -0.0154 0.0207  7   TYR A CA  
35   C C   . TYR A 7   ? 0.0755 0.0571 0.1018 -0.0027 -0.0131 0.0192  7   TYR A C   
36   O O   . TYR A 7   ? 0.0779 0.0639 0.1046 -0.0013 -0.0126 0.0141  7   TYR A O   
37   C CB  . TYR A 7   ? 0.0846 0.0491 0.1157 -0.0003 -0.0161 0.0168  7   TYR A CB  
38   C CG  . TYR A 7   ? 0.0850 0.0399 0.1171 0.0029  -0.0180 0.0179  7   TYR A CG  
39   C CD1 . TYR A 7   ? 0.0999 0.0571 0.1319 0.0080  -0.0182 0.0143  7   TYR A CD1 
40   C CD2 . TYR A 7   ? 0.0963 0.0429 0.1273 0.0005  -0.0180 0.0212  7   TYR A CD2 
41   C CE1 . TYR A 7   ? 0.1218 0.0739 0.1533 0.0111  -0.0188 0.0144  7   TYR A CE1 
42   C CE2 . TYR A 7   ? 0.1165 0.0562 0.1459 0.0042  -0.0187 0.0212  7   TYR A CE2 
43   C CZ  . TYR A 7   ? 0.1436 0.0867 0.1737 0.0097  -0.0192 0.0178  7   TYR A CZ  
44   O OH  . TYR A 7   ? 0.1646 0.1020 0.1940 0.0136  -0.0199 0.0178  7   TYR A OH  
45   N N   . GLY A 8   ? 0.0771 0.0614 0.1022 -0.0066 -0.0115 0.0235  8   GLY A N   
46   C CA  . GLY A 8   ? 0.0873 0.0814 0.1124 -0.0087 -0.0093 0.0219  8   GLY A CA  
47   C C   . GLY A 8   ? 0.0773 0.0745 0.1018 -0.0133 -0.0068 0.0269  8   GLY A C   
48   O O   . GLY A 8   ? 0.0880 0.0783 0.1118 -0.0158 -0.0066 0.0318  8   GLY A O   
49   N N   . ILE A 9   ? 0.0649 0.0723 0.0893 -0.0142 -0.0046 0.0256  9   ILE A N   
50   C CA  . ILE A 9   ? 0.0973 0.1099 0.1203 -0.0178 -0.0012 0.0300  9   ILE A CA  
51   C C   . ILE A 9   ? 0.0872 0.1099 0.1070 -0.0151 0.0004  0.0280  9   ILE A C   
52   O O   . ILE A 9   ? 0.0693 0.0952 0.0902 -0.0121 -0.0007 0.0229  9   ILE A O   
53   C CB  . ILE A 9   ? 0.1113 0.1258 0.1416 -0.0238 0.0004  0.0299  9   ILE A CB  
54   C CG1 . ILE A 9   ? 0.1480 0.1666 0.1770 -0.0282 0.0047  0.0353  9   ILE A CG1 
55   C CG2 . ILE A 9   ? 0.1302 0.1526 0.1663 -0.0232 -0.0005 0.0233  9   ILE A CG2 
56   C CD1 . ILE A 9   ? 0.1908 0.2056 0.2259 -0.0354 0.0064  0.0375  9   ILE A CD1 
57   N N   . ASP A 10  ? 0.0917 0.1182 0.1062 -0.0157 0.0031  0.0320  10  ASP A N   
58   C CA  . ASP A 10  ? 0.0679 0.1018 0.0775 -0.0122 0.0043  0.0299  10  ASP A CA  
59   C C   . ASP A 10  ? 0.0719 0.1154 0.0864 -0.0123 0.0062  0.0256  10  ASP A C   
60   O O   . ASP A 10  ? 0.0739 0.1215 0.0857 -0.0085 0.0062  0.0220  10  ASP A O   
61   C CB  . ASP A 10  ? 0.0839 0.1195 0.0857 -0.0126 0.0068  0.0347  10  ASP A CB  
62   C CG  . ASP A 10  ? 0.0827 0.1102 0.0778 -0.0105 0.0039  0.0382  10  ASP A CG  
63   O OD1 . ASP A 10  ? 0.1065 0.1283 0.1041 -0.0082 0.0002  0.0364  10  ASP A OD1 
64   O OD2 . ASP A 10  ? 0.1148 0.1419 0.1024 -0.0106 0.0051  0.0421  10  ASP A OD2 
65   N N   . ALA A 11  ? 0.0686 0.1156 0.0903 -0.0166 0.0077  0.0258  11  ALA A N   
66   C CA  . ALA A 11  ? 0.0620 0.1193 0.0891 -0.0160 0.0088  0.0215  11  ALA A CA  
67   C C   . ALA A 11  ? 0.0473 0.1033 0.0761 -0.0122 0.0051  0.0157  11  ALA A C   
68   O O   . ALA A 11  ? 0.0434 0.1068 0.0737 -0.0095 0.0054  0.0120  11  ALA A O   
69   C CB  . ALA A 11  ? 0.0902 0.1528 0.1262 -0.0218 0.0108  0.0224  11  ALA A CB  
70   N N   . SER A 12  ? 0.0662 0.1126 0.0945 -0.0117 0.0019  0.0150  12  SER A N   
71   C CA  . SER A 12  ? 0.0574 0.1013 0.0861 -0.0083 -0.0011 0.0098  12  SER A CA  
72   C C   . SER A 12  ? 0.0680 0.1114 0.0894 -0.0031 -0.0010 0.0077  12  SER A C   
73   O O   . SER A 12  ? 0.0611 0.1001 0.0775 -0.0018 -0.0009 0.0095  12  SER A O   
74   C CB  . SER A 12  ? 0.0734 0.1070 0.1031 -0.0093 -0.0038 0.0097  12  SER A CB  
75   O OG  . SER A 12  ? 0.0855 0.1153 0.1128 -0.0055 -0.0059 0.0051  12  SER A OG  
76   N N   . PRO A 13  ? 0.0585 0.1062 0.0795 0.0000  -0.0013 0.0037  13  PRO A N   
77   C CA  . PRO A 13  ? 0.0632 0.1085 0.0767 0.0046  -0.0009 0.0017  13  PRO A CA  
78   C C   . PRO A 13  ? 0.0588 0.0947 0.0686 0.0058  -0.0023 0.0009  13  PRO A C   
79   O O   . PRO A 13  ? 0.0418 0.0757 0.0470 0.0069  -0.0014 0.0018  13  PRO A O   
80   C CB  . PRO A 13  ? 0.0690 0.1183 0.0828 0.0078  -0.0017 -0.0023 13  PRO A CB  
81   C CG  . PRO A 13  ? 0.0616 0.1198 0.0839 0.0049  -0.0018 -0.0019 13  PRO A CG  
82   C CD  . PRO A 13  ? 0.0553 0.1106 0.0823 -0.0005 -0.0020 0.0012  13  PRO A CD  
83   N N   . PRO A 14  ? 0.0312 0.0619 0.0432 0.0055  -0.0044 -0.0012 14  PRO A N   
84   C CA  . PRO A 14  ? 0.0357 0.0588 0.0445 0.0071  -0.0049 -0.0024 14  PRO A CA  
85   C C   . PRO A 14  ? 0.0412 0.0619 0.0512 0.0055  -0.0049 0.0010  14  PRO A C   
86   O O   . PRO A 14  ? 0.0468 0.0642 0.0545 0.0071  -0.0048 0.0004  14  PRO A O   
87   C CB  . PRO A 14  ? 0.0402 0.0588 0.0507 0.0072  -0.0068 -0.0055 14  PRO A CB  
88   C CG  . PRO A 14  ? 0.0701 0.0933 0.0867 0.0042  -0.0081 -0.0048 14  PRO A CG  
89   C CD  . PRO A 14  ? 0.0493 0.0812 0.0658 0.0045  -0.0064 -0.0035 14  PRO A CD  
90   N N   . VAL A 15  ? 0.0325 0.0543 0.0464 0.0025  -0.0052 0.0047  15  VAL A N   
91   C CA  . VAL A 15  ? 0.0467 0.0661 0.0600 0.0018  -0.0055 0.0086  15  VAL A CA  
92   C C   . VAL A 15  ? 0.0288 0.0520 0.0369 0.0033  -0.0043 0.0098  15  VAL A C   
93   O O   . VAL A 15  ? 0.0373 0.0581 0.0437 0.0048  -0.0054 0.0102  15  VAL A O   
94   C CB  . VAL A 15  ? 0.0517 0.0704 0.0685 -0.0020 -0.0055 0.0129  15  VAL A CB  
95   C CG1 . VAL A 15  ? 0.0703 0.0856 0.0845 -0.0020 -0.0061 0.0176  15  VAL A CG1 
96   C CG2 . VAL A 15  ? 0.0516 0.0646 0.0735 -0.0037 -0.0072 0.0110  15  VAL A CG2 
97   N N   . ARG A 16  ? 0.0480 0.0774 0.0541 0.0031  -0.0023 0.0097  16  ARG A N   
98   C CA  . ARG A 16  ? 0.0341 0.0667 0.0344 0.0045  -0.0011 0.0103  16  ARG A CA  
99   C C   . ARG A 16  ? 0.0264 0.0567 0.0232 0.0073  -0.0014 0.0064  16  ARG A C   
100  O O   . ARG A 16  ? 0.0522 0.0824 0.0454 0.0080  -0.0018 0.0068  16  ARG A O   
101  C CB  . ARG A 16  ? 0.0409 0.0805 0.0398 0.0042  0.0016  0.0105  16  ARG A CB  
102  C CG  . ARG A 16  ? 0.0496 0.0920 0.0498 0.0010  0.0029  0.0153  16  ARG A CG  
103  C CD  . ARG A 16  ? 0.0332 0.0842 0.0332 0.0008  0.0062  0.0149  16  ARG A CD  
104  N NE  . ARG A 16  ? 0.0675 0.1230 0.0751 -0.0006 0.0066  0.0132  16  ARG A NE  
105  C CZ  . ARG A 16  ? 0.0620 0.1226 0.0711 0.0021  0.0070  0.0092  16  ARG A CZ  
106  N NH1 . ARG A 16  ? 0.0560 0.1216 0.0728 0.0006  0.0066  0.0078  16  ARG A NH1 
107  N NH2 . ARG A 16  ? 0.0703 0.1284 0.0732 0.0060  0.0068  0.0063  16  ARG A NH2 
108  N N   . ALA A 17  ? 0.0226 0.0504 0.0202 0.0086  -0.0013 0.0027  17  ALA A N   
109  C CA  . ALA A 17  ? 0.0383 0.0625 0.0326 0.0105  -0.0009 -0.0007 17  ALA A CA  
110  C C   . ALA A 17  ? 0.0457 0.0673 0.0426 0.0101  -0.0025 -0.0001 17  ALA A C   
111  O O   . ALA A 17  ? 0.0431 0.0651 0.0379 0.0106  -0.0024 -0.0013 17  ALA A O   
112  C CB  . ALA A 17  ? 0.0299 0.0504 0.0236 0.0119  -0.0005 -0.0042 17  ALA A CB  
113  N N   . VAL A 18  ? 0.0514 0.0705 0.0531 0.0093  -0.0041 0.0014  18  VAL A N   
114  C CA  . VAL A 18  ? 0.0240 0.0410 0.0288 0.0098  -0.0058 0.0020  18  VAL A CA  
115  C C   . VAL A 18  ? 0.0456 0.0657 0.0487 0.0097  -0.0073 0.0054  18  VAL A C   
116  O O   . VAL A 18  ? 0.0348 0.0559 0.0385 0.0108  -0.0086 0.0045  18  VAL A O   
117  C CB  . VAL A 18  ? 0.0399 0.0522 0.0498 0.0096  -0.0072 0.0026  18  VAL A CB  
118  C CG1 . VAL A 18  ? 0.0551 0.0657 0.0686 0.0111  -0.0091 0.0032  18  VAL A CG1 
119  C CG2 . VAL A 18  ? 0.0363 0.0453 0.0465 0.0101  -0.0060 -0.0014 18  VAL A CG2 
120  N N   A LYS A 19  ? 0.0483 0.0704 0.0492 0.0083  -0.0071 0.0093  19  LYS A N   
121  N N   B LYS A 19  ? 0.0512 0.0732 0.0521 0.0083  -0.0072 0.0094  19  LYS A N   
122  C CA  A LYS A 19  ? 0.0524 0.0766 0.0496 0.0083  -0.0084 0.0130  19  LYS A CA  
123  C CA  B LYS A 19  ? 0.0432 0.0674 0.0403 0.0083  -0.0084 0.0130  19  LYS A CA  
124  C C   A LYS A 19  ? 0.0523 0.0803 0.0446 0.0092  -0.0080 0.0105  19  LYS A C   
125  C C   B LYS A 19  ? 0.0499 0.0778 0.0423 0.0093  -0.0081 0.0103  19  LYS A C   
126  O O   A LYS A 19  ? 0.0577 0.0856 0.0486 0.0096  -0.0099 0.0109  19  LYS A O   
127  O O   B LYS A 19  ? 0.0611 0.0890 0.0524 0.0096  -0.0100 0.0107  19  LYS A O   
128  C CB  A LYS A 19  ? 0.0649 0.0903 0.0597 0.0061  -0.0071 0.0176  19  LYS A CB  
129  C CB  B LYS A 19  ? 0.0616 0.0872 0.0562 0.0062  -0.0071 0.0175  19  LYS A CB  
130  C CG  A LYS A 19  ? 0.0727 0.0933 0.0720 0.0044  -0.0078 0.0208  19  LYS A CG  
131  C CG  B LYS A 19  ? 0.0720 0.0928 0.0711 0.0045  -0.0078 0.0208  19  LYS A CG  
132  C CD  A LYS A 19  ? 0.0814 0.1030 0.0783 0.0015  -0.0060 0.0259  19  LYS A CD  
133  C CD  B LYS A 19  ? 0.0797 0.1013 0.0762 0.0016  -0.0061 0.0260  19  LYS A CD  
134  C CE  A LYS A 19  ? 0.1018 0.1208 0.0933 0.0019  -0.0076 0.0312  19  LYS A CE  
135  C CE  B LYS A 19  ? 0.1120 0.1296 0.1042 0.0019  -0.0080 0.0316  19  LYS A CE  
136  N NZ  A LYS A 19  ? 0.1081 0.1200 0.1028 0.0038  -0.0113 0.0323  19  LYS A NZ  
137  N NZ  B LYS A 19  ? 0.1178 0.1366 0.1050 -0.0010 -0.0054 0.0368  19  LYS A NZ  
138  N N   . LEU A 20  ? 0.0548 0.0839 0.0450 0.0091  -0.0053 0.0070  20  LEU A N   
139  C CA  . LEU A 20  ? 0.0654 0.0945 0.0526 0.0092  -0.0040 0.0036  20  LEU A CA  
140  C C   . LEU A 20  ? 0.0438 0.0726 0.0331 0.0100  -0.0058 0.0008  20  LEU A C   
141  O O   . LEU A 20  ? 0.0545 0.0845 0.0425 0.0096  -0.0068 -0.0005 20  LEU A O   
142  C CB  . LEU A 20  ? 0.0550 0.0825 0.0418 0.0092  -0.0011 0.0007  20  LEU A CB  
143  C CG  . LEU A 20  ? 0.0521 0.0810 0.0379 0.0087  0.0004  0.0020  20  LEU A CG  
144  C CD1 . LEU A 20  ? 0.0648 0.0907 0.0517 0.0093  0.0015  -0.0004 20  LEU A CD1 
145  C CD2 . LEU A 20  ? 0.0481 0.0775 0.0303 0.0081  0.0006  0.0026  20  LEU A CD2 
146  N N   . THR A 21  ? 0.0258 0.0526 0.0195 0.0106  -0.0058 -0.0009 21  THR A N   
147  C CA  . THR A 21  ? 0.0246 0.0509 0.0226 0.0109  -0.0063 -0.0043 21  THR A CA  
148  C C   . THR A 21  ? 0.0436 0.0729 0.0458 0.0117  -0.0101 -0.0026 21  THR A C   
149  O O   . THR A 21  ? 0.0594 0.0920 0.0635 0.0116  -0.0113 -0.0053 21  THR A O   
150  C CB  . THR A 21  ? 0.0265 0.0485 0.0283 0.0112  -0.0045 -0.0063 21  THR A CB  
151  O OG1 . THR A 21  ? 0.0422 0.0614 0.0389 0.0111  -0.0017 -0.0076 21  THR A OG1 
152  C CG2 . THR A 21  ? 0.0388 0.0608 0.0450 0.0111  -0.0037 -0.0102 21  THR A CG2 
153  N N   . LEU A 22  ? 0.0391 0.0670 0.0430 0.0125  -0.0121 0.0017  22  LEU A N   
154  C CA  . LEU A 22  ? 0.0335 0.0618 0.0402 0.0135  -0.0158 0.0041  22  LEU A CA  
155  C C   . LEU A 22  ? 0.0381 0.0689 0.0394 0.0128  -0.0172 0.0047  22  LEU A C   
156  O O   . LEU A 22  ? 0.0646 0.0976 0.0686 0.0135  -0.0200 0.0039  22  LEU A O   
157  C CB  . LEU A 22  ? 0.0374 0.0614 0.0450 0.0143  -0.0173 0.0091  22  LEU A CB  
158  C CG  . LEU A 22  ? 0.0345 0.0548 0.0484 0.0152  -0.0163 0.0074  22  LEU A CG  
159  C CD1 . LEU A 22  ? 0.0551 0.0698 0.0685 0.0142  -0.0163 0.0116  22  LEU A CD1 
160  C CD2 . LEU A 22  ? 0.0648 0.0854 0.0851 0.0171  -0.0180 0.0058  22  LEU A CD2 
161  N N   . ALA A 23  ? 0.0396 0.0702 0.0337 0.0114  -0.0151 0.0059  23  ALA A N   
162  C CA  . ALA A 23  ? 0.0451 0.0770 0.0335 0.0108  -0.0160 0.0061  23  ALA A CA  
163  C C   . ALA A 23  ? 0.0555 0.0904 0.0445 0.0102  -0.0157 0.0010  23  ALA A C   
164  O O   . ALA A 23  ? 0.0486 0.0855 0.0368 0.0102  -0.0184 0.0002  23  ALA A O   
165  C CB  . ALA A 23  ? 0.0731 0.1038 0.0550 0.0095  -0.0129 0.0079  23  ALA A CB  
166  N N   . ALA A 24  ? 0.0534 0.0882 0.0436 0.0097  -0.0127 -0.0025 24  ALA A N   
171  N N   . LEU A 25  ? 0.0603 0.0903 0.0403 0.0083  -0.0018 0.0108  25  LEU A N   
172  C CA  . LEU A 25  ? 0.0410 0.0831 0.0241 0.0089  -0.0015 0.0109  25  LEU A CA  
173  C C   . LEU A 25  ? 0.0432 0.0927 0.0322 0.0128  -0.0038 0.0145  25  LEU A C   
174  O O   . LEU A 25  ? 0.0514 0.1131 0.0470 0.0145  -0.0059 0.0139  25  LEU A O   
175  C CB  . LEU A 25  ? 0.0589 0.1074 0.0434 0.0093  0.0010  0.0093  25  LEU A CB  
176  C CG  . LEU A 25  ? 0.0720 0.1110 0.0499 0.0030  0.0028  0.0052  25  LEU A CG  
177  C CD1 . LEU A 25  ? 0.0966 0.1397 0.0766 0.0024  0.0064  0.0021  25  LEU A CD1 
178  C CD2 . LEU A 25  ? 0.0868 0.1270 0.0611 -0.0028 0.0035  0.0022  25  LEU A CD2 
179  N N   . GLN A 26  ? 0.0449 0.0870 0.0334 0.0133  -0.0046 0.0170  26  GLN A N   
180  C CA  . GLN A 26  ? 0.0486 0.0912 0.0406 0.0150  -0.0084 0.0209  26  GLN A CA  
181  C C   . GLN A 26  ? 0.0630 0.1095 0.0661 0.0192  -0.0112 0.0222  26  GLN A C   
182  O O   . GLN A 26  ? 0.0534 0.1029 0.0652 0.0217  -0.0162 0.0225  26  GLN A O   
183  C CB  . GLN A 26  ? 0.0577 0.1022 0.0478 0.0140  -0.0112 0.0207  26  GLN A CB  
184  C CG  . GLN A 26  ? 0.0848 0.1224 0.0662 0.0109  -0.0096 0.0187  26  GLN A CG  
185  C CD  . GLN A 26  ? 0.0613 0.0999 0.0394 0.0096  -0.0124 0.0182  26  GLN A CD  
186  O OE1 . GLN A 26  ? 0.0992 0.1416 0.0775 0.0084  -0.0123 0.0160  26  GLN A OE1 
187  N NE2 . GLN A 26  ? 0.0671 0.1042 0.0412 0.0094  -0.0148 0.0206  26  GLN A NE2 
188  N N   . LEU A 27  ? 0.0460 0.0922 0.0517 0.0205  -0.0088 0.0215  27  LEU A N   
189  C CA  . LEU A 27  ? 0.0468 0.0954 0.0674 0.0251  -0.0108 0.0197  27  LEU A CA  
190  C C   . LEU A 27  ? 0.0656 0.1031 0.0865 0.0256  -0.0141 0.0248  27  LEU A C   
191  O O   . LEU A 27  ? 0.0683 0.1018 0.0829 0.0233  -0.0113 0.0269  27  LEU A O   
192  C CB  . LEU A 27  ? 0.0546 0.1083 0.0777 0.0242  -0.0048 0.0127  27  LEU A CB  
193  C CG  . LEU A 27  ? 0.0945 0.1478 0.1332 0.0275  -0.0043 0.0064  27  LEU A CG  
194  C CD1 . LEU A 27  ? 0.1209 0.1835 0.1762 0.0321  -0.0074 0.0016  27  LEU A CD1 
195  C CD2 . LEU A 27  ? 0.1003 0.1553 0.1358 0.0228  0.0029  -0.0020 27  LEU A CD2 
196  N N   . PRO A 28  ? 0.0850 0.1175 0.1122 0.0284  -0.0209 0.0267  28  PRO A N   
197  C CA  . PRO A 28  ? 0.0998 0.1208 0.1238 0.0282  -0.0244 0.0321  28  PRO A CA  
198  C C   . PRO A 28  ? 0.0894 0.1072 0.1240 0.0311  -0.0235 0.0301  28  PRO A C   
199  O O   . PRO A 28  ? 0.0871 0.1110 0.1361 0.0359  -0.0221 0.0225  28  PRO A O   
200  C CB  . PRO A 28  ? 0.1294 0.1465 0.1558 0.0320  -0.0320 0.0342  28  PRO A CB  
201  C CG  . PRO A 28  ? 0.1758 0.2012 0.2013 0.0317  -0.0325 0.0312  28  PRO A CG  
202  C CD  . PRO A 28  ? 0.1225 0.1588 0.1556 0.0309  -0.0263 0.0250  28  PRO A CD  
203  N N   . TYR A 29  ? 0.0802 0.0893 0.1085 0.0274  -0.0234 0.0357  29  TYR A N   
204  C CA  . TYR A 29  ? 0.0806 0.0845 0.1176 0.0284  -0.0223 0.0341  29  TYR A CA  
205  C C   . TYR A 29  ? 0.0948 0.0856 0.1256 0.0239  -0.0262 0.0416  29  TYR A C   
206  O O   . TYR A 29  ? 0.1016 0.0918 0.1198 0.0186  -0.0266 0.0478  29  TYR A O   
207  C CB  . TYR A 29  ? 0.0680 0.0795 0.1003 0.0254  -0.0141 0.0294  29  TYR A CB  
208  C CG  . TYR A 29  ? 0.0702 0.0845 0.0885 0.0198  -0.0113 0.0355  29  TYR A CG  
209  C CD1 . TYR A 29  ? 0.0644 0.0857 0.0734 0.0180  -0.0092 0.0349  29  TYR A CD1 
210  C CD2 . TYR A 29  ? 0.0677 0.0776 0.0829 0.0152  -0.0099 0.0378  29  TYR A CD2 
211  C CE1 . TYR A 29  ? 0.0871 0.1112 0.0871 0.0134  -0.0058 0.0350  29  TYR A CE1 
212  C CE2 . TYR A 29  ? 0.0802 0.0966 0.0858 0.0108  -0.0069 0.0412  29  TYR A CE2 
213  C CZ  . TYR A 29  ? 0.0808 0.1042 0.0800 0.0103  -0.0046 0.0376  29  TYR A CZ  
214  O OH  . TYR A 29  ? 0.1046 0.1342 0.0992 0.0070  -0.0016 0.0362  29  TYR A OH  
215  N N   . ASP A 30  ? 0.1023 0.0828 0.1428 0.0254  -0.0287 0.0396  30  ASP A N   
216  C CA  . ASP A 30  ? 0.1164 0.0839 0.1510 0.0193  -0.0318 0.0465  30  ASP A CA  
217  C C   . ASP A 30  ? 0.1083 0.0788 0.1388 0.0134  -0.0261 0.0477  30  ASP A C   
218  O O   . ASP A 30  ? 0.0999 0.0747 0.1350 0.0151  -0.0209 0.0377  30  ASP A O   
219  C CB  . ASP A 30  ? 0.1325 0.0848 0.1786 0.0232  -0.0381 0.0428  30  ASP A CB  
220  C CG  . ASP A 30  ? 0.1689 0.1183 0.2198 0.0288  -0.0446 0.0422  30  ASP A CG  
221  O OD1 . ASP A 30  ? 0.2040 0.1556 0.2449 0.0261  -0.0467 0.0493  30  ASP A OD1 
222  O OD2 . ASP A 30  ? 0.1635 0.1086 0.2288 0.0356  -0.0477 0.0339  30  ASP A OD2 
223  N N   . TYR A 31  ? 0.1176 0.0895 0.1363 0.0050  -0.0247 0.0550  31  TYR A N   
224  C CA  . TYR A 31  ? 0.1054 0.0841 0.1201 -0.0011 -0.0188 0.0544  31  TYR A CA  
225  C C   . TYR A 31  ? 0.1207 0.0866 0.1352 -0.0084 -0.0220 0.0588  31  TYR A C   
226  O O   . TYR A 31  ? 0.1353 0.0956 0.1434 -0.0135 -0.0254 0.0648  31  TYR A O   
227  C CB  . TYR A 31  ? 0.1132 0.1074 0.1175 -0.0051 -0.0139 0.0570  31  TYR A CB  
228  C CG  . TYR A 31  ? 0.0890 0.0952 0.0910 -0.0095 -0.0080 0.0552  31  TYR A CG  
229  C CD1 . TYR A 31  ? 0.0894 0.0974 0.0962 -0.0069 -0.0054 0.0463  31  TYR A CD1 
230  C CD2 . TYR A 31  ? 0.1333 0.1506 0.1293 -0.0151 -0.0048 0.0559  31  TYR A CD2 
231  C CE1 . TYR A 31  ? 0.1114 0.1304 0.1171 -0.0098 -0.0017 0.0433  31  TYR A CE1 
232  C CE2 . TYR A 31  ? 0.1167 0.1475 0.1139 -0.0175 -0.0002 0.0524  31  TYR A CE2 
233  C CZ  . TYR A 31  ? 0.0920 0.1233 0.0941 -0.0148 0.0007  0.0473  31  TYR A CZ  
234  O OH  . TYR A 31  ? 0.0971 0.1411 0.1015 -0.0163 0.0034  0.0429  31  TYR A OH  
235  N N   . LYS A 32  ? 0.1188 0.0824 0.1381 -0.0094 -0.0196 0.0514  32  LYS A N   
236  C CA  . LYS A 32  ? 0.1611 0.1110 0.1810 -0.0167 -0.0231 0.0543  32  LYS A CA  
237  C C   . LYS A 32  ? 0.1267 0.0899 0.1429 -0.0241 -0.0171 0.0528  32  LYS A C   
238  O O   . LYS A 32  ? 0.1183 0.0908 0.1369 -0.0210 -0.0127 0.0440  32  LYS A O   
239  C CB  . LYS A 32  ? 0.1520 0.0875 0.1821 -0.0108 -0.0262 0.0449  32  LYS A CB  
240  C CG  . LYS A 32  ? 0.2469 0.1712 0.2854 -0.0012 -0.0330 0.0438  32  LYS A CG  
241  C CD  . LYS A 32  ? 0.3485 0.2577 0.3830 -0.0044 -0.0414 0.0524  32  LYS A CD  
242  C CE  . LYS A 32  ? 0.4050 0.3091 0.4479 0.0060  -0.0473 0.0485  32  LYS A CE  
243  N NZ  . LYS A 32  ? 0.4078 0.3081 0.4664 0.0153  -0.0473 0.0345  32  LYS A NZ  
244  N N   A ILE A 33  ? 0.1411 0.1056 0.1515 -0.0348 -0.0175 0.0615  33  ILE A N   
245  N N   B ILE A 33  ? 0.1421 0.1070 0.1524 -0.0347 -0.0174 0.0615  33  ILE A N   
246  C CA  A ILE A 33  ? 0.1478 0.1293 0.1572 -0.0419 -0.0120 0.0599  33  ILE A CA  
247  C CA  B ILE A 33  ? 0.1478 0.1302 0.1572 -0.0416 -0.0118 0.0597  33  ILE A CA  
248  C C   A ILE A 33  ? 0.1350 0.1088 0.1492 -0.0465 -0.0134 0.0550  33  ILE A C   
249  C C   B ILE A 33  ? 0.1348 0.1093 0.1488 -0.0467 -0.0132 0.0552  33  ILE A C   
250  O O   A ILE A 33  ? 0.1537 0.1091 0.1675 -0.0521 -0.0186 0.0589  33  ILE A O   
251  O O   B ILE A 33  ? 0.1537 0.1106 0.1670 -0.0530 -0.0183 0.0597  33  ILE A O   
252  C CB  A ILE A 33  ? 0.1648 0.1561 0.1670 -0.0502 -0.0101 0.0655  33  ILE A CB  
253  C CB  B ILE A 33  ? 0.1639 0.1570 0.1661 -0.0496 -0.0096 0.0653  33  ILE A CB  
254  C CG1 A ILE A 33  ? 0.1718 0.1688 0.1678 -0.0454 -0.0094 0.0678  33  ILE A CG1 
255  C CG1 B ILE A 33  ? 0.1766 0.1770 0.1729 -0.0445 -0.0084 0.0669  33  ILE A CG1 
256  C CG2 A ILE A 33  ? 0.1670 0.1798 0.1720 -0.0555 -0.0043 0.0615  33  ILE A CG2 
257  C CG2 B ILE A 33  ? 0.1691 0.1827 0.1742 -0.0552 -0.0041 0.0613  33  ILE A CG2 
258  C CD1 A ILE A 33  ? 0.1400 0.1533 0.1381 -0.0380 -0.0046 0.0625  33  ILE A CD1 
259  C CD1 B ILE A 33  ? 0.1419 0.1522 0.1305 -0.0522 -0.0060 0.0699  33  ILE A CD1 
260  N N   . VAL A 34  ? 0.1219 0.1077 0.1394 -0.0443 -0.0098 0.0466  34  VAL A N   
261  C CA  . VAL A 34  ? 0.1720 0.1534 0.1929 -0.0498 -0.0111 0.0417  34  VAL A CA  
262  C C   . VAL A 34  ? 0.1428 0.1458 0.1652 -0.0568 -0.0079 0.0422  34  VAL A C   
263  O O   . VAL A 34  ? 0.1200 0.1394 0.1441 -0.0515 -0.0052 0.0374  34  VAL A O   
264  C CB  . VAL A 34  ? 0.1442 0.1208 0.1670 -0.0422 -0.0110 0.0307  34  VAL A CB  
265  C CG1 . VAL A 34  ? 0.1903 0.1604 0.2148 -0.0489 -0.0130 0.0254  34  VAL A CG1 
266  C CG2 . VAL A 34  ? 0.1991 0.1604 0.2235 -0.0337 -0.0129 0.0283  34  VAL A CG2 
267  N N   . ASN A 35  ? 0.1858 0.1893 0.2083 -0.0690 -0.0086 0.0479  35  ASN A N   
268  C CA  . ASN A 35  ? 0.1814 0.2084 0.2074 -0.0742 -0.0049 0.0462  35  ASN A CA  
269  C C   . ASN A 35  ? 0.1505 0.1825 0.1831 -0.0772 -0.0068 0.0392  35  ASN A C   
270  O O   . ASN A 35  ? 0.1538 0.1730 0.1860 -0.0836 -0.0097 0.0386  35  ASN A O   
271  C CB  . ASN A 35  ? 0.2086 0.2355 0.2299 -0.0829 -0.0041 0.0516  35  ASN A CB  
272  C CG  . ASN A 35  ? 0.2268 0.2803 0.2527 -0.0866 0.0007  0.0485  35  ASN A CG  
273  O OD1 . ASN A 35  ? 0.2453 0.3089 0.2789 -0.0894 0.0005  0.0433  35  ASN A OD1 
274  N ND2 . ASN A 35  ? 0.2467 0.3115 0.2683 -0.0862 0.0046  0.0507  35  ASN A ND2 
275  N N   . LEU A 36  ? 0.1392 0.1894 0.1771 -0.0716 -0.0057 0.0334  36  LEU A N   
276  C CA  . LEU A 36  ? 0.1316 0.1863 0.1742 -0.0723 -0.0091 0.0262  36  LEU A CA  
277  C C   . LEU A 36  ? 0.1562 0.2250 0.2056 -0.0808 -0.0089 0.0254  36  LEU A C   
278  O O   . LEU A 36  ? 0.1835 0.2494 0.2353 -0.0850 -0.0127 0.0213  36  LEU A O   
279  C CB  . LEU A 36  ? 0.1296 0.1951 0.1730 -0.0610 -0.0100 0.0204  36  LEU A CB  
280  C CG  . LEU A 36  ? 0.1414 0.1938 0.1762 -0.0504 -0.0093 0.0194  36  LEU A CG  
281  C CD1 . LEU A 36  ? 0.1533 0.2152 0.1876 -0.0421 -0.0115 0.0147  36  LEU A CD1 
282  C CD2 . LEU A 36  ? 0.1327 0.1625 0.1611 -0.0505 -0.0111 0.0165  36  LEU A CD2 
283  N N   . MET A 37  ? 0.1547 0.2378 0.2058 -0.0825 -0.0043 0.0282  37  MET A N   
284  C CA  . MET A 37  ? 0.1775 0.2755 0.2354 -0.0897 -0.0031 0.0264  37  MET A CA  
285  C C   . MET A 37  ? 0.1962 0.2764 0.2492 -0.1005 -0.0050 0.0303  37  MET A C   
286  O O   . MET A 37  ? 0.2489 0.3355 0.3074 -0.1074 -0.0063 0.0277  37  MET A O   
287  C CB  . MET A 37  ? 0.2208 0.3375 0.2801 -0.0896 0.0030  0.0273  37  MET A CB  
288  C CG  . MET A 37  ? 0.2282 0.3631 0.2943 -0.0781 0.0043  0.0214  37  MET A CG  
289  S SD  . MET A 37  ? 0.5251 0.6778 0.6069 -0.0737 -0.0006 0.0119  37  MET A SD  
290  C CE  . MET A 37  ? 0.3670 0.5291 0.4518 -0.0581 -0.0012 0.0068  37  MET A CE  
291  N N   . ASN A 38  ? 0.2042 0.2610 0.2473 -0.1012 -0.0060 0.0361  38  ASN A N   
292  C CA  . ASN A 38  ? 0.2238 0.2586 0.2614 -0.1094 -0.0093 0.0397  38  ASN A CA  
293  C C   . ASN A 38  ? 0.1975 0.2108 0.2340 -0.1066 -0.0145 0.0353  38  ASN A C   
294  O O   . ASN A 38  ? 0.1997 0.1908 0.2319 -0.1109 -0.0179 0.0369  38  ASN A O   
295  C CB  . ASN A 38  ? 0.2656 0.2862 0.2932 -0.1113 -0.0090 0.0484  38  ASN A CB  
296  C CG  . ASN A 38  ? 0.3415 0.3819 0.3675 -0.1161 -0.0039 0.0518  38  ASN A CG  
297  O OD1 . ASN A 38  ? 0.3576 0.4152 0.3887 -0.1233 -0.0015 0.0495  38  ASN A OD1 
298  N ND2 . ASN A 38  ? 0.3468 0.3855 0.3656 -0.1124 -0.0023 0.0566  38  ASN A ND2 
299  N N   . LYS A 39  ? 0.1916 0.2113 0.2316 -0.0994 -0.0152 0.0291  39  LYS A N   
300  C CA  . LYS A 39  ? 0.1645 0.1681 0.2027 -0.0974 -0.0194 0.0222  39  LYS A CA  
301  C C   . LYS A 39  ? 0.1734 0.1501 0.2058 -0.0933 -0.0211 0.0229  39  LYS A C   
302  O O   . LYS A 39  ? 0.1843 0.1432 0.2147 -0.0931 -0.0241 0.0166  39  LYS A O   
303  C CB  . LYS A 39  ? 0.2786 0.2807 0.3191 -0.1052 -0.0223 0.0181  39  LYS A CB  
304  C CG  . LYS A 39  ? 0.2934 0.3226 0.3422 -0.1082 -0.0217 0.0165  39  LYS A CG  
305  C CD  . LYS A 39  ? 0.3340 0.3636 0.3851 -0.1114 -0.0264 0.0094  39  LYS A CD  
306  C CE  . LYS A 39  ? 0.3746 0.3963 0.4263 -0.1218 -0.0276 0.0105  39  LYS A CE  
307  N NZ  . LYS A 39  ? 0.4004 0.4278 0.4558 -0.1252 -0.0321 0.0038  39  LYS A NZ  
308  N N   . GLU A 40  ? 0.1997 0.1744 0.2299 -0.0891 -0.0193 0.0295  40  GLU A N   
309  C CA  . GLU A 40  ? 0.1959 0.1468 0.2230 -0.0831 -0.0218 0.0301  40  GLU A CA  
310  C C   . GLU A 40  ? 0.1901 0.1357 0.2174 -0.0732 -0.0215 0.0200  40  GLU A C   
311  O O   . GLU A 40  ? 0.1978 0.1244 0.2252 -0.0673 -0.0235 0.0161  40  GLU A O   
312  C CB  . GLU A 40  ? 0.1970 0.1497 0.2213 -0.0800 -0.0203 0.0394  40  GLU A CB  
313  C CG  . GLU A 40  ? 0.2093 0.1609 0.2291 -0.0883 -0.0208 0.0474  40  GLU A CG  
314  C CD  . GLU A 40  ? 0.2273 0.1839 0.2417 -0.0866 -0.0192 0.0557  40  GLU A CD  
315  O OE1 . GLU A 40  ? 0.2198 0.1786 0.2344 -0.0780 -0.0182 0.0560  40  GLU A OE1 
316  O OE2 . GLU A 40  ? 0.2706 0.2288 0.2795 -0.0946 -0.0192 0.0618  40  GLU A OE2 
317  N N   . GLN A 41  ? 0.1547 0.1180 0.1816 -0.0700 -0.0189 0.0146  41  GLN A N   
318  C CA  . GLN A 41  ? 0.1915 0.1509 0.2150 -0.0618 -0.0177 0.0047  41  GLN A CA  
319  C C   . GLN A 41  ? 0.2177 0.1629 0.2396 -0.0669 -0.0205 -0.0041 41  GLN A C   
320  O O   . GLN A 41  ? 0.1672 0.1059 0.1856 -0.0621 -0.0191 -0.0137 41  GLN A O   
321  C CB  . GLN A 41  ? 0.1603 0.1392 0.1810 -0.0580 -0.0159 0.0029  41  GLN A CB  
322  C CG  . GLN A 41  ? 0.1425 0.1323 0.1635 -0.0650 -0.0190 0.0003  41  GLN A CG  
323  C CD  . GLN A 41  ? 0.1388 0.1454 0.1678 -0.0713 -0.0196 0.0071  41  GLN A CD  
324  O OE1 . GLN A 41  ? 0.1510 0.1552 0.1833 -0.0760 -0.0183 0.0138  41  GLN A OE1 
325  N NE2 . GLN A 41  ? 0.1231 0.1471 0.1552 -0.0723 -0.0222 0.0050  41  GLN A NE2 
326  N N   . HIS A 42  ? 0.1776 0.1182 0.2015 -0.0775 -0.0241 -0.0015 42  HIS A N   
327  C CA  . HIS A 42  ? 0.1980 0.1251 0.2200 -0.0827 -0.0269 -0.0103 42  HIS A CA  
328  C C   . HIS A 42  ? 0.2316 0.1350 0.2560 -0.0817 -0.0289 -0.0113 42  HIS A C   
329  O O   . HIS A 42  ? 0.2339 0.1270 0.2578 -0.0849 -0.0303 -0.0185 42  HIS A O   
330  C CB  . HIS A 42  ? 0.1961 0.1372 0.2197 -0.0909 -0.0285 -0.0092 42  HIS A CB  
331  C CG  . HIS A 42  ? 0.2172 0.1793 0.2392 -0.0899 -0.0285 -0.0108 42  HIS A CG  
332  N ND1 . HIS A 42  ? 0.2320 0.1935 0.2465 -0.0877 -0.0295 -0.0196 42  HIS A ND1 
333  C CD2 . HIS A 42  ? 0.2062 0.1902 0.2328 -0.0902 -0.0282 -0.0049 42  HIS A CD2 
334  C CE1 . HIS A 42  ? 0.2416 0.2213 0.2555 -0.0865 -0.0311 -0.0179 42  HIS A CE1 
335  N NE2 . HIS A 42  ? 0.2076 0.2016 0.2303 -0.0874 -0.0305 -0.0098 42  HIS A NE2 
336  N N   . SER A 43  ? 0.2160 0.1110 0.2428 -0.0766 -0.0294 -0.0045 43  SER A N   
337  C CA  . SER A 43  ? 0.2516 0.1235 0.2801 -0.0737 -0.0327 -0.0048 43  SER A CA  
338  C C   . SER A 43  ? 0.2445 0.1046 0.2745 -0.0653 -0.0320 -0.0195 43  SER A C   
339  O O   . SER A 43  ? 0.2299 0.0997 0.2597 -0.0603 -0.0286 -0.0268 43  SER A O   
340  C CB  . SER A 43  ? 0.2476 0.1157 0.2773 -0.0690 -0.0345 0.0062  43  SER A CB  
341  O OG  . SER A 43  ? 0.2301 0.1016 0.2633 -0.0585 -0.0328 0.0028  43  SER A OG  
342  N N   . GLU A 44  ? 0.2884 0.1290 0.3193 -0.0641 -0.0348 -0.0243 44  GLU A N   
343  C CA  . GLU A 44  ? 0.2985 0.1299 0.3305 -0.0559 -0.0332 -0.0396 44  GLU A CA  
344  C C   . GLU A 44  ? 0.2973 0.1335 0.3357 -0.0430 -0.0315 -0.0423 44  GLU A C   
345  O O   . GLU A 44  ? 0.3033 0.1473 0.3419 -0.0374 -0.0266 -0.0546 44  GLU A O   
346  C CB  . GLU A 44  ? 0.3635 0.1726 0.3968 -0.0554 -0.0376 -0.0431 44  GLU A CB  
347  C CG  . GLU A 44  ? 0.4591 0.2637 0.4870 -0.0677 -0.0383 -0.0446 44  GLU A CG  
348  C CD  . GLU A 44  ? 0.5102 0.3271 0.5314 -0.0723 -0.0330 -0.0560 44  GLU A CD  
349  O OE1 . GLU A 44  ? 0.5282 0.3488 0.5455 -0.0651 -0.0297 -0.0660 44  GLU A OE1 
350  O OE2 . GLU A 44  ? 0.5261 0.3505 0.5464 -0.0829 -0.0331 -0.0546 44  GLU A OE2 
351  N N   . GLU A 45  ? 0.2773 0.1111 0.3203 -0.0393 -0.0351 -0.0305 45  GLU A N   
352  C CA  . GLU A 45  ? 0.3012 0.1409 0.3517 -0.0273 -0.0340 -0.0323 45  GLU A CA  
353  C C   . GLU A 45  ? 0.2824 0.1426 0.3320 -0.0272 -0.0278 -0.0337 45  GLU A C   
354  O O   . GLU A 45  ? 0.2347 0.1036 0.2885 -0.0192 -0.0230 -0.0442 45  GLU A O   
355  C CB  . GLU A 45  ? 0.3914 0.2226 0.4447 -0.0241 -0.0406 -0.0187 45  GLU A CB  
356  C CG  . GLU A 45  ? 0.4456 0.2832 0.5076 -0.0115 -0.0406 -0.0200 45  GLU A CG  
357  C CD  . GLU A 45  ? 0.5008 0.3367 0.5733 0.0000  -0.0397 -0.0359 45  GLU A CD  
358  O OE1 . GLU A 45  ? 0.5357 0.3554 0.6118 0.0027  -0.0456 -0.0382 45  GLU A OE1 
359  O OE2 . GLU A 45  ? 0.4983 0.3504 0.5754 0.0057  -0.0327 -0.0461 45  GLU A OE2 
360  N N   . TYR A 46  ? 0.2118 0.0834 0.2545 -0.0360 -0.0268 -0.0236 46  TYR A N   
361  C CA  . TYR A 46  ? 0.2043 0.0996 0.2416 -0.0340 -0.0198 -0.0237 46  TYR A CA  
362  C C   . TYR A 46  ? 0.1871 0.0896 0.2184 -0.0362 -0.0150 -0.0369 46  TYR A C   
363  O O   . TYR A 46  ? 0.1755 0.0915 0.2033 -0.0322 -0.0096 -0.0416 46  TYR A O   
364  C CB  . TYR A 46  ? 0.1758 0.0855 0.2077 -0.0405 -0.0195 -0.0103 46  TYR A CB  
365  C CG  . TYR A 46  ? 0.1782 0.1075 0.2065 -0.0354 -0.0142 -0.0095 46  TYR A CG  
366  C CD1 . TYR A 46  ? 0.1474 0.0792 0.1791 -0.0270 -0.0131 -0.0067 46  TYR A CD1 
367  C CD2 . TYR A 46  ? 0.1559 0.0994 0.1772 -0.0390 -0.0116 -0.0119 46  TYR A CD2 
368  C CE1 . TYR A 46  ? 0.1494 0.0970 0.1770 -0.0230 -0.0088 -0.0063 46  TYR A CE1 
369  C CE2 . TYR A 46  ? 0.1292 0.0870 0.1464 -0.0344 -0.0083 -0.0110 46  TYR A CE2 
370  C CZ  . TYR A 46  ? 0.1548 0.1142 0.1749 -0.0267 -0.0065 -0.0083 46  TYR A CZ  
371  O OH  . TYR A 46  ? 0.1342 0.1060 0.1496 -0.0229 -0.0036 -0.0075 46  TYR A OH  
372  N N   . LEU A 47  ? 0.2056 0.0994 0.2338 -0.0440 -0.0173 -0.0421 47  LEU A N   
373  C CA  . LEU A 47  ? 0.2319 0.1312 0.2520 -0.0474 -0.0136 -0.0546 47  LEU A CA  
374  C C   . LEU A 47  ? 0.2844 0.1821 0.3069 -0.0391 -0.0088 -0.0685 47  LEU A C   
375  O O   . LEU A 47  ? 0.2776 0.1877 0.2911 -0.0394 -0.0034 -0.0754 47  LEU A O   
376  C CB  . LEU A 47  ? 0.2555 0.1451 0.2710 -0.0571 -0.0180 -0.0571 47  LEU A CB  
377  C CG  . LEU A 47  ? 0.2799 0.1799 0.2921 -0.0670 -0.0210 -0.0465 47  LEU A CG  
378  C CD1 . LEU A 47  ? 0.3073 0.2019 0.3212 -0.0745 -0.0253 -0.0479 47  LEU A CD1 
379  C CD2 . LEU A 47  ? 0.2626 0.1821 0.2656 -0.0675 -0.0182 -0.0467 47  LEU A CD2 
380  N N   . LYS A 48  ? 0.3106 0.1957 0.3435 -0.0312 -0.0113 -0.0701 48  LYS A N   
381  C CA  . LYS A 48  ? 0.3456 0.2339 0.3841 -0.0214 -0.0070 -0.0818 48  LYS A CA  
382  C C   . LYS A 48  ? 0.3086 0.2147 0.3494 -0.0165 -0.0012 -0.0821 48  LYS A C   
383  O O   . LYS A 48  ? 0.3159 0.2351 0.3538 -0.0146 0.0056  -0.0917 48  LYS A O   
384  C CB  . LYS A 48  ? 0.3904 0.2623 0.4413 -0.0133 -0.0128 -0.0809 48  LYS A CB  
385  C CG  . LYS A 48  ? 0.4547 0.3185 0.5080 -0.0098 -0.0125 -0.0939 48  LYS A CG  
386  C CD  . LYS A 48  ? 0.4886 0.3320 0.5519 -0.0041 -0.0208 -0.0902 48  LYS A CD  
387  C CE  . LYS A 48  ? 0.5139 0.3555 0.5872 0.0051  -0.0198 -0.1050 48  LYS A CE  
388  N NZ  . LYS A 48  ? 0.5390 0.3604 0.6228 0.0117  -0.0293 -0.1018 48  LYS A NZ  
389  N N   . LYS A 49  ? 0.2567 0.1636 0.3020 -0.0154 -0.0037 -0.0709 49  LYS A N   
390  C CA  . LYS A 49  ? 0.2198 0.1439 0.2645 -0.0108 0.0011  -0.0680 49  LYS A CA  
391  C C   . LYS A 49  ? 0.1908 0.1300 0.2192 -0.0183 0.0063  -0.0676 49  LYS A C   
392  O O   . LYS A 49  ? 0.1839 0.1363 0.2086 -0.0168 0.0120  -0.0715 49  LYS A O   
393  C CB  . LYS A 49  ? 0.2060 0.1298 0.2544 -0.0075 -0.0038 -0.0515 49  LYS A CB  
394  C CG  . LYS A 49  ? 0.2176 0.1282 0.2812 0.0015  -0.0098 -0.0510 49  LYS A CG  
395  C CD  . LYS A 49  ? 0.2159 0.1261 0.2790 0.0025  -0.0148 -0.0336 49  LYS A CD  
396  C CE  . LYS A 49  ? 0.2298 0.1214 0.3049 0.0092  -0.0242 -0.0300 49  LYS A CE  
397  N NZ  . LYS A 49  ? 0.2533 0.1494 0.3411 0.0203  -0.0233 -0.0424 49  LYS A NZ  
398  N N   . ASN A 50  ? 0.2110 0.1481 0.2297 -0.0267 0.0034  -0.0621 50  ASN A N   
399  C CA  . ASN A 50  ? 0.1772 0.1261 0.1809 -0.0331 0.0051  -0.0594 50  ASN A CA  
400  C C   . ASN A 50  ? 0.1944 0.1384 0.1901 -0.0424 0.0014  -0.0601 50  ASN A C   
401  O O   . ASN A 50  ? 0.1769 0.1208 0.1741 -0.0454 -0.0037 -0.0498 50  ASN A O   
402  C CB  . ASN A 50  ? 0.1577 0.1154 0.1607 -0.0308 0.0032  -0.0451 50  ASN A CB  
403  C CG  . ASN A 50  ? 0.1675 0.1346 0.1563 -0.0361 0.0026  -0.0421 50  ASN A CG  
404  O OD1 . ASN A 50  ? 0.1782 0.1448 0.1559 -0.0424 0.0034  -0.0496 50  ASN A OD1 
405  N ND2 . ASN A 50  ? 0.1555 0.1306 0.1439 -0.0334 0.0008  -0.0318 50  ASN A ND2 
406  N N   . PRO A 51  ? 0.1891 0.1321 0.1762 -0.0463 0.0036  -0.0708 51  PRO A N   
407  C CA  . PRO A 51  ? 0.2077 0.1474 0.1874 -0.0535 -0.0012 -0.0701 51  PRO A CA  
408  C C   . PRO A 51  ? 0.1972 0.1456 0.1682 -0.0591 -0.0058 -0.0607 51  PRO A C   
409  O O   . PRO A 51  ? 0.2078 0.1545 0.1777 -0.0643 -0.0110 -0.0588 51  PRO A O   
410  C CB  . PRO A 51  ? 0.2438 0.1852 0.2151 -0.0540 0.0027  -0.0802 51  PRO A CB  
411  C CG  . PRO A 51  ? 0.2470 0.1894 0.2279 -0.0460 0.0091  -0.0879 51  PRO A CG  
412  C CD  . PRO A 51  ? 0.1982 0.1463 0.1843 -0.0421 0.0100  -0.0806 51  PRO A CD  
413  N N   . GLN A 52  ? 0.1809 0.1384 0.1472 -0.0573 -0.0048 -0.0552 52  GLN A N   
414  C CA  . GLN A 52  ? 0.1612 0.1267 0.1214 -0.0603 -0.0107 -0.0462 52  GLN A CA  
415  C C   . GLN A 52  ? 0.1847 0.1539 0.1573 -0.0591 -0.0145 -0.0369 52  GLN A C   
416  O O   . GLN A 52  ? 0.1817 0.1600 0.1540 -0.0603 -0.0198 -0.0304 52  GLN A O   
417  C CB  . GLN A 52  ? 0.2022 0.1747 0.1533 -0.0573 -0.0095 -0.0424 52  GLN A CB  
418  C CG  . GLN A 52  ? 0.2134 0.1863 0.1520 -0.0585 -0.0064 -0.0460 52  GLN A CG  
419  C CD  . GLN A 52  ? 0.2020 0.1796 0.1337 -0.0561 -0.0052 -0.0408 52  GLN A CD  
420  O OE1 . GLN A 52  ? 0.2419 0.2216 0.1730 -0.0546 0.0015  -0.0445 52  GLN A OE1 
421  N NE2 . GLN A 52  ? 0.2259 0.2057 0.1550 -0.0551 -0.0122 -0.0324 52  GLN A NE2 
422  N N   . HIS A 53  ? 0.1940 0.1574 0.1787 -0.0555 -0.0120 -0.0356 53  HIS A N   
423  C CA  . HIS A 53  ? 0.1735 0.1410 0.1694 -0.0541 -0.0140 -0.0253 53  HIS A CA  
424  C C   . HIS A 53  ? 0.1348 0.1170 0.1314 -0.0497 -0.0145 -0.0171 53  HIS A C   
425  O O   . HIS A 53  ? 0.1498 0.1421 0.1517 -0.0521 -0.0176 -0.0113 53  HIS A O   
426  C CB  . HIS A 53  ? 0.1854 0.1504 0.1856 -0.0626 -0.0185 -0.0241 53  HIS A CB  
427  C CG  . HIS A 53  ? 0.2066 0.1775 0.1996 -0.0693 -0.0231 -0.0275 53  HIS A CG  
428  N ND1 . HIS A 53  ? 0.1838 0.1703 0.1792 -0.0702 -0.0275 -0.0217 53  HIS A ND1 
429  C CD2 . HIS A 53  ? 0.2289 0.1932 0.2133 -0.0736 -0.0246 -0.0358 53  HIS A CD2 
430  C CE1 . HIS A 53  ? 0.2283 0.2163 0.2172 -0.0745 -0.0323 -0.0256 53  HIS A CE1 
431  N NE2 . HIS A 53  ? 0.2210 0.1961 0.2026 -0.0757 -0.0300 -0.0332 53  HIS A NE2 
432  N N   . THR A 54  ? 0.1276 0.1115 0.1196 -0.0435 -0.0113 -0.0176 54  THR A N   
433  C CA  . THR A 54  ? 0.1280 0.1231 0.1200 -0.0388 -0.0120 -0.0111 54  THR A CA  
434  C C   . THR A 54  ? 0.0979 0.0933 0.0953 -0.0322 -0.0080 -0.0070 54  THR A C   
435  O O   . THR A 54  ? 0.1089 0.0961 0.1083 -0.0300 -0.0049 -0.0105 54  THR A O   
436  C CB  . THR A 54  ? 0.1339 0.1303 0.1127 -0.0386 -0.0136 -0.0139 54  THR A CB  
437  O OG1 . THR A 54  ? 0.1343 0.1233 0.1060 -0.0390 -0.0087 -0.0209 54  THR A OG1 
438  C CG2 . THR A 54  ? 0.1399 0.1371 0.1122 -0.0448 -0.0202 -0.0158 54  THR A CG2 
439  N N   . VAL A 55  ? 0.0967 0.1022 0.0967 -0.0286 -0.0085 -0.0005 55  VAL A N   
440  C CA  . VAL A 55  ? 0.0800 0.0872 0.0817 -0.0224 -0.0054 0.0032  55  VAL A CA  
441  C C   . VAL A 55  ? 0.0809 0.0951 0.0761 -0.0186 -0.0065 0.0037  55  VAL A C   
442  O O   . VAL A 55  ? 0.0728 0.0927 0.0665 -0.0198 -0.0106 0.0037  55  VAL A O   
443  C CB  . VAL A 55  ? 0.0962 0.1079 0.1057 -0.0227 -0.0049 0.0106  55  VAL A CB  
444  C CG1 . VAL A 55  ? 0.1232 0.1232 0.1373 -0.0268 -0.0054 0.0113  55  VAL A CG1 
445  C CG2 . VAL A 55  ? 0.0740 0.0996 0.0869 -0.0254 -0.0067 0.0133  55  VAL A CG2 
446  N N   . PRO A 56  ? 0.0684 0.0816 0.0604 -0.0140 -0.0040 0.0041  56  PRO A N   
453  N N   . LEU A 57  ? 0.0745 0.0508 0.0900 0.0085  0.0089  0.0109  57  LEU A N   
454  C CA  . LEU A 57  ? 0.0897 0.0616 0.1054 0.0124  0.0075  0.0090  57  LEU A CA  
455  C C   . LEU A 57  ? 0.0785 0.0508 0.0920 0.0159  0.0068  0.0135  57  LEU A C   
456  O O   . LEU A 57  ? 0.0833 0.0534 0.0944 0.0146  0.0071  0.0185  57  LEU A O   
457  C CB  . LEU A 57  ? 0.0870 0.0485 0.1050 0.0113  0.0073  0.0082  57  LEU A CB  
458  C CG  . LEU A 57  ? 0.1003 0.0555 0.1186 0.0163  0.0068  0.0065  57  LEU A CG  
459  C CD1 . LEU A 57  ? 0.1246 0.0834 0.1419 0.0185  0.0068  0.0004  57  LEU A CD1 
460  C CD2 . LEU A 57  ? 0.1246 0.0669 0.1445 0.0152  0.0066  0.0067  57  LEU A CD2 
461  N N   . LEU A 58  ? 0.0749 0.0507 0.0892 0.0199  0.0058  0.0121  58  LEU A N   
462  C CA  . LEU A 58  ? 0.0794 0.0564 0.0939 0.0235  0.0040  0.0162  58  LEU A CA  
463  C C   . LEU A 58  ? 0.0854 0.0576 0.1046 0.0282  0.0039  0.0157  58  LEU A C   
464  O O   . LEU A 58  ? 0.0954 0.0679 0.1167 0.0300  0.0054  0.0109  58  LEU A O   
465  C CB  . LEU A 58  ? 0.0880 0.0746 0.1019 0.0243  0.0028  0.0156  58  LEU A CB  
466  C CG  . LEU A 58  ? 0.0730 0.0623 0.0868 0.0265  -0.0003 0.0205  58  LEU A CG  
467  C CD1 . LEU A 58  ? 0.1211 0.1091 0.1276 0.0236  -0.0014 0.0245  58  LEU A CD1 
468  C CD2 . LEU A 58  ? 0.1457 0.1439 0.1628 0.0281  -0.0018 0.0193  58  LEU A CD2 
469  N N   . GLU A 59  ? 0.0900 0.0574 0.1103 0.0304  0.0024  0.0208  59  GLU A N   
470  C CA  . GLU A 59  ? 0.1001 0.0641 0.1263 0.0361  0.0022  0.0210  59  GLU A CA  
471  C C   . GLU A 59  ? 0.0932 0.0657 0.1210 0.0379  -0.0012 0.0246  59  GLU A C   
472  O O   . GLU A 59  ? 0.1112 0.0841 0.1350 0.0362  -0.0039 0.0298  59  GLU A O   
473  C CB  . GLU A 59  ? 0.1084 0.0601 0.1346 0.0363  0.0018  0.0231  59  GLU A CB  
474  C CG  . GLU A 59  ? 0.1817 0.1237 0.2077 0.0344  0.0045  0.0182  59  GLU A CG  
475  C CD  . GLU A 59  ? 0.2197 0.1489 0.2451 0.0331  0.0036  0.0208  59  GLU A CD  
476  O OE1 . GLU A 59  ? 0.2006 0.1284 0.2246 0.0330  0.0014  0.0273  59  GLU A OE1 
477  O OE2 . GLU A 59  ? 0.2378 0.1581 0.2632 0.0316  0.0047  0.0162  59  GLU A OE2 
478  N N   . ASP A 60  ? 0.1008 0.0796 0.1338 0.0409  -0.0013 0.0218  60  ASP A N   
479  C CA  . ASP A 60  ? 0.0972 0.0839 0.1333 0.0420  -0.0049 0.0249  60  ASP A CA  
480  C C   . ASP A 60  ? 0.1237 0.1111 0.1669 0.0466  -0.0047 0.0235  60  ASP A C   
481  O O   . ASP A 60  ? 0.1169 0.1085 0.1638 0.0481  -0.0016 0.0190  60  ASP A O   
482  C CB  . ASP A 60  ? 0.1357 0.1326 0.1718 0.0398  -0.0049 0.0233  60  ASP A CB  
483  C CG  . ASP A 60  ? 0.1652 0.1695 0.2036 0.0395  -0.0094 0.0264  60  ASP A CG  
484  O OD1 . ASP A 60  ? 0.1860 0.1881 0.2250 0.0411  -0.0128 0.0303  60  ASP A OD1 
485  O OD2 . ASP A 60  ? 0.1148 0.1269 0.1542 0.0376  -0.0097 0.0251  60  ASP A OD2 
486  N N   . GLY A 61  ? 0.1422 0.1252 0.1868 0.0491  -0.0076 0.0275  61  GLY A N   
487  C CA  . GLY A 61  ? 0.1904 0.1721 0.2418 0.0543  -0.0070 0.0262  61  GLY A CA  
488  C C   . GLY A 61  ? 0.1777 0.1509 0.2279 0.0556  -0.0025 0.0208  61  GLY A C   
489  O O   . GLY A 61  ? 0.1858 0.1494 0.2303 0.0530  -0.0019 0.0208  61  GLY A O   
490  N N   . ASP A 62  ? 0.1622 0.1387 0.2171 0.0589  0.0007  0.0160  62  ASP A N   
491  C CA  . ASP A 62  ? 0.2039 0.1716 0.2559 0.0599  0.0046  0.0101  62  ASP A CA  
492  C C   . ASP A 62  ? 0.2180 0.1882 0.2648 0.0559  0.0075  0.0055  62  ASP A C   
493  O O   . ASP A 62  ? 0.2528 0.2163 0.2960 0.0562  0.0104  -0.0001 62  ASP A O   
494  C CB  . ASP A 62  ? 0.2546 0.2226 0.3124 0.0659  0.0070  0.0066  62  ASP A CB  
495  C CG  . ASP A 62  ? 0.2684 0.2335 0.3317 0.0706  0.0040  0.0111  62  ASP A CG  
496  O OD1 . ASP A 62  ? 0.2369 0.1940 0.2972 0.0695  0.0004  0.0159  62  ASP A OD1 
497  O OD2 . ASP A 62  ? 0.2875 0.2584 0.3584 0.0756  0.0053  0.0102  62  ASP A OD2 
498  N N   . ALA A 63  ? 0.1758 0.1548 0.2217 0.0523  0.0065  0.0078  63  ALA A N   
499  C CA  . ALA A 63  ? 0.1617 0.1437 0.2030 0.0488  0.0088  0.0042  63  ALA A CA  
500  C C   . ALA A 63  ? 0.1283 0.1032 0.1633 0.0449  0.0083  0.0046  63  ALA A C   
501  O O   . ALA A 63  ? 0.1389 0.1100 0.1732 0.0436  0.0059  0.0094  63  ALA A O   
502  C CB  . ALA A 63  ? 0.1549 0.1495 0.1985 0.0469  0.0081  0.0061  63  ALA A CB  
503  N N   . ASN A 64  ? 0.1406 0.1144 0.1711 0.0429  0.0106  -0.0001 64  ASN A N   
504  C CA  . ASN A 64  ? 0.1184 0.0856 0.1443 0.0392  0.0106  -0.0005 64  ASN A CA  
505  C C   . ASN A 64  ? 0.1155 0.0908 0.1379 0.0361  0.0110  -0.0026 64  ASN A C   
506  O O   . ASN A 64  ? 0.1603 0.1387 0.1814 0.0377  0.0133  -0.0065 64  ASN A O   
507  C CB  . ASN A 64  ? 0.1694 0.1241 0.1925 0.0393  0.0118  -0.0055 64  ASN A CB  
508  C CG  . ASN A 64  ? 0.2277 0.1769 0.2465 0.0334  0.0108  -0.0076 64  ASN A CG  
509  O OD1 . ASN A 64  ? 0.1954 0.1500 0.2105 0.0303  0.0105  -0.0107 64  ASN A OD1 
510  N ND2 . ASN A 64  ? 0.2618 0.2007 0.2812 0.0313  0.0096  -0.0061 64  ASN A ND2 
511  N N   . ILE A 65  ? 0.1182 0.0974 0.1387 0.0316  0.0089  0.0000  65  ILE A N   
512  C CA  . ILE A 65  ? 0.0848 0.0712 0.1023 0.0284  0.0086  -0.0019 65  ILE A CA  
513  C C   . ILE A 65  ? 0.0733 0.0576 0.0884 0.0235  0.0074  -0.0017 65  ILE A C   
514  O O   . ILE A 65  ? 0.0727 0.0562 0.0883 0.0220  0.0066  0.0022  65  ILE A O   
515  C CB  . ILE A 65  ? 0.1138 0.1097 0.1329 0.0288  0.0076  0.0014  65  ILE A CB  
516  C CG1 . ILE A 65  ? 0.1774 0.1776 0.2018 0.0335  0.0087  0.0024  65  ILE A CG1 
517  C CG2 . ILE A 65  ? 0.0907 0.0922 0.1068 0.0258  0.0073  -0.0005 65  ILE A CG2 
518  C CD1 . ILE A 65  ? 0.2063 0.2067 0.2351 0.0355  0.0065  0.0073  65  ILE A CD1 
519  N N   . ALA A 66  ? 0.0992 0.0832 0.1121 0.0210  0.0072  -0.0057 66  ALA A N   
520  C CA  . ALA A 66  ? 0.0972 0.0816 0.1101 0.0164  0.0060  -0.0056 66  ALA A CA  
521  C C   . ALA A 66  ? 0.0767 0.0691 0.0885 0.0153  0.0053  -0.0062 66  ALA A C   
522  O O   . ALA A 66  ? 0.0735 0.0694 0.0835 0.0175  0.0056  -0.0074 66  ALA A O   
523  C CB  . ALA A 66  ? 0.1391 0.1167 0.1516 0.0139  0.0051  -0.0093 66  ALA A CB  
524  N N   . ASP A 67  ? 0.0790 0.0742 0.0926 0.0121  0.0047  -0.0053 67  ASP A N   
525  C CA  . ASP A 67  ? 0.0457 0.0478 0.0596 0.0111  0.0040  -0.0054 67  ASP A CA  
526  C C   . ASP A 67  ? 0.0414 0.0471 0.0544 0.0124  0.0049  -0.0024 67  ASP A C   
527  O O   . ASP A 67  ? 0.0417 0.0481 0.0531 0.0147  0.0048  -0.0016 67  ASP A O   
528  C CB  . ASP A 67  ? 0.0537 0.0579 0.0650 0.0118  0.0025  -0.0082 67  ASP A CB  
529  C CG  . ASP A 67  ? 0.0477 0.0574 0.0603 0.0106  0.0012  -0.0078 67  ASP A CG  
530  O OD1 . ASP A 67  ? 0.0633 0.0764 0.0755 0.0118  0.0018  -0.0061 67  ASP A OD1 
531  O OD2 . ASP A 67  ? 0.0797 0.0902 0.0947 0.0084  -0.0008 -0.0091 67  ASP A OD2 
532  N N   . SER A 68  ? 0.0440 0.0522 0.0583 0.0108  0.0057  -0.0011 68  SER A N   
533  C CA  . SER A 68  ? 0.0420 0.0519 0.0534 0.0117  0.0066  0.0011  68  SER A CA  
534  C C   . SER A 68  ? 0.0438 0.0563 0.0532 0.0133  0.0050  0.0004  68  SER A C   
535  O O   . SER A 68  ? 0.0365 0.0491 0.0433 0.0142  0.0044  0.0021  68  SER A O   
536  C CB  . SER A 68  ? 0.0561 0.0685 0.0687 0.0104  0.0085  0.0015  68  SER A CB  
537  O OG  . SER A 68  ? 0.0450 0.0612 0.0610 0.0103  0.0076  -0.0006 68  SER A OG  
538  N N   . HIS A 69  ? 0.0484 0.0631 0.0590 0.0133  0.0040  -0.0016 69  HIS A N   
539  C CA  . HIS A 69  ? 0.0298 0.0470 0.0390 0.0141  0.0028  -0.0016 69  HIS A CA  
540  C C   . HIS A 69  ? 0.0474 0.0648 0.0562 0.0155  0.0026  -0.0010 69  HIS A C   
541  O O   . HIS A 69  ? 0.0510 0.0704 0.0597 0.0159  0.0018  0.0004  69  HIS A O   
542  C CB  . HIS A 69  ? 0.0555 0.0745 0.0655 0.0136  0.0016  -0.0030 69  HIS A CB  
543  C CG  . HIS A 69  ? 0.0401 0.0600 0.0533 0.0128  0.0017  -0.0035 69  HIS A CG  
544  N ND1 . HIS A 69  ? 0.0362 0.0561 0.0525 0.0115  0.0014  -0.0045 69  HIS A ND1 
545  C CD2 . HIS A 69  ? 0.0440 0.0654 0.0589 0.0131  0.0023  -0.0034 69  HIS A CD2 
546  C CE1 . HIS A 69  ? 0.0498 0.0724 0.0708 0.0109  0.0018  -0.0043 69  HIS A CE1 
547  N NE2 . HIS A 69  ? 0.0478 0.0714 0.0680 0.0123  0.0027  -0.0038 69  HIS A NE2 
548  N N   . ALA A 70  ? 0.0328 0.0482 0.0421 0.0161  0.0034  -0.0023 70  ALA A N   
549  C CA  . ALA A 70  ? 0.0347 0.0502 0.0447 0.0184  0.0043  -0.0020 70  ALA A CA  
550  C C   . ALA A 70  ? 0.0355 0.0506 0.0473 0.0195  0.0040  0.0008  70  ALA A C   
551  O O   . ALA A 70  ? 0.0373 0.0558 0.0516 0.0210  0.0037  0.0025  70  ALA A O   
552  C CB  . ALA A 70  ? 0.0467 0.0580 0.0558 0.0193  0.0056  -0.0048 70  ALA A CB  
553  N N   . ILE A 71  ? 0.0396 0.0509 0.0507 0.0187  0.0039  0.0018  71  ILE A N   
554  C CA  . ILE A 71  ? 0.0503 0.0604 0.0615 0.0196  0.0031  0.0051  71  ILE A CA  
555  C C   . ILE A 71  ? 0.0390 0.0528 0.0484 0.0189  0.0010  0.0069  71  ILE A C   
556  O O   . ILE A 71  ? 0.0474 0.0634 0.0587 0.0202  -0.0010 0.0093  71  ILE A O   
557  C CB  . ILE A 71  ? 0.0451 0.0502 0.0544 0.0181  0.0038  0.0064  71  ILE A CB  
558  C CG1 . ILE A 71  ? 0.0628 0.0625 0.0743 0.0185  0.0050  0.0051  71  ILE A CG1 
559  C CG2 . ILE A 71  ? 0.0495 0.0533 0.0562 0.0186  0.0024  0.0105  71  ILE A CG2 
560  C CD1 . ILE A 71  ? 0.0787 0.0742 0.0897 0.0156  0.0061  0.0060  71  ILE A CD1 
561  N N   . MET A 72  ? 0.0414 0.0560 0.0479 0.0169  0.0010  0.0056  72  MET A N   
562  C CA  . MET A 72  ? 0.0461 0.0622 0.0496 0.0160  -0.0012 0.0065  72  MET A CA  
563  C C   . MET A 72  ? 0.0385 0.0590 0.0457 0.0162  -0.0031 0.0069  72  MET A C   
564  O O   . MET A 72  ? 0.0376 0.0596 0.0446 0.0158  -0.0060 0.0088  72  MET A O   
565  C CB  . MET A 72  ? 0.0373 0.0523 0.0374 0.0145  -0.0002 0.0044  72  MET A CB  
566  C CG  . MET A 72  ? 0.0732 0.0853 0.0699 0.0139  0.0022  0.0046  72  MET A CG  
567  S SD  . MET A 72  ? 0.0546 0.0663 0.0485 0.0134  0.0043  0.0021  72  MET A SD  
568  C CE  . MET A 72  ? 0.0757 0.0904 0.0772 0.0136  0.0050  0.0003  72  MET A CE  
569  N N   . ALA A 73  ? 0.0372 0.0599 0.0473 0.0165  -0.0016 0.0054  73  ALA A N   
570  C CA  . ALA A 73  ? 0.0428 0.0702 0.0569 0.0164  -0.0023 0.0064  73  ALA A CA  
571  C C   . ALA A 73  ? 0.0421 0.0728 0.0616 0.0185  -0.0027 0.0087  73  ALA A C   
572  O O   . ALA A 73  ? 0.0307 0.0661 0.0544 0.0178  -0.0049 0.0109  73  ALA A O   
573  C CB  . ALA A 73  ? 0.0483 0.0769 0.0630 0.0166  0.0000  0.0048  73  ALA A CB  
574  N N   . TYR A 74  ? 0.0325 0.0609 0.0530 0.0210  -0.0007 0.0083  74  TYR A N   
575  C CA  . TYR A 74  ? 0.0359 0.0665 0.0624 0.0240  -0.0008 0.0106  74  TYR A CA  
576  C C   . TYR A 74  ? 0.0373 0.0686 0.0640 0.0234  -0.0053 0.0141  74  TYR A C   
577  O O   . TYR A 74  ? 0.0387 0.0740 0.0708 0.0233  -0.0073 0.0159  74  TYR A O   
578  C CB  . TYR A 74  ? 0.0384 0.0633 0.0642 0.0265  0.0017  0.0091  74  TYR A CB  
579  C CG  . TYR A 74  ? 0.0534 0.0773 0.0841 0.0292  0.0011  0.0113  74  TYR A CG  
580  C CD1 . TYR A 74  ? 0.0560 0.0829 0.0925 0.0310  0.0029  0.0104  74  TYR A CD1 
581  C CD2 . TYR A 74  ? 0.0516 0.0713 0.0808 0.0300  -0.0013 0.0143  74  TYR A CD2 
582  C CE1 . TYR A 74  ? 0.0657 0.0918 0.1073 0.0339  0.0021  0.0120  74  TYR A CE1 
583  C CE2 . TYR A 74  ? 0.0685 0.0867 0.1021 0.0324  -0.0025 0.0165  74  TYR A CE2 
584  C CZ  . TYR A 74  ? 0.0571 0.0788 0.0973 0.0346  -0.0010 0.0151  74  TYR A CZ  
585  O OH  . TYR A 74  ? 0.0884 0.1091 0.1338 0.0377  -0.0023 0.0170  74  TYR A OH  
586  N N   . LEU A 75  ? 0.0403 0.0660 0.0597 0.0219  -0.0065 0.0142  75  LEU A N   
587  C CA  . LEU A 75  ? 0.0454 0.0703 0.0617 0.0210  -0.0109 0.0174  75  LEU A CA  
588  C C   . LEU A 75  ? 0.0451 0.0747 0.0622 0.0186  -0.0151 0.0182  75  LEU A C   
589  O O   . LEU A 75  ? 0.0488 0.0811 0.0690 0.0186  -0.0192 0.0210  75  LEU A O   
590  C CB  . LEU A 75  ? 0.0540 0.0721 0.0606 0.0194  -0.0102 0.0171  75  LEU A CB  
591  C CG  . LEU A 75  ? 0.0704 0.0832 0.0766 0.0209  -0.0074 0.0179  75  LEU A CG  
592  C CD1 . LEU A 75  ? 0.0872 0.0950 0.0849 0.0186  -0.0056 0.0177  75  LEU A CD1 
593  C CD2 . LEU A 75  ? 0.0701 0.0819 0.0795 0.0236  -0.0100 0.0224  75  LEU A CD2 
594  N N   . VAL A 76  ? 0.0424 0.0717 0.0565 0.0160  -0.0143 0.0153  76  VAL A N   
595  C CA  . VAL A 76  ? 0.0621 0.0943 0.0768 0.0131  -0.0185 0.0158  76  VAL A CA  
596  C C   . VAL A 76  ? 0.0406 0.0807 0.0669 0.0136  -0.0190 0.0178  76  VAL A C   
597  O O   . VAL A 76  ? 0.0494 0.0919 0.0787 0.0119  -0.0232 0.0193  76  VAL A O   
598  C CB  . VAL A 76  ? 0.0714 0.1002 0.0810 0.0106  -0.0173 0.0124  76  VAL A CB  
599  C CG1 . VAL A 76  ? 0.0529 0.0832 0.0634 0.0072  -0.0220 0.0127  76  VAL A CG1 
600  C CG2 . VAL A 76  ? 0.0670 0.0885 0.0661 0.0105  -0.0158 0.0101  76  VAL A CG2 
601  N N   . SER A 77  ? 0.0373 0.0799 0.0688 0.0155  -0.0140 0.0168  77  SER A N   
602  C CA  . SER A 77  ? 0.0383 0.0870 0.0790 0.0155  -0.0127 0.0177  77  SER A CA  
603  C C   . SER A 77  ? 0.0391 0.0900 0.0856 0.0178  -0.0139 0.0196  77  SER A C   
604  O O   . SER A 77  ? 0.0405 0.0975 0.0950 0.0172  -0.0147 0.0212  77  SER A O   
605  C CB  . SER A 77  ? 0.0356 0.0856 0.0778 0.0170  -0.0067 0.0160  77  SER A CB  
606  O OG  . SER A 77  ? 0.0347 0.0831 0.0719 0.0151  -0.0063 0.0147  77  SER A OG  
607  N N   . LYS A 78  ? 0.0418 0.0879 0.0850 0.0204  -0.0140 0.0198  78  LYS A N   
608  C CA  . LYS A 78  ? 0.0517 0.0990 0.1004 0.0233  -0.0152 0.0218  78  LYS A CA  
609  C C   . LYS A 78  ? 0.0590 0.1061 0.1055 0.0218  -0.0218 0.0245  78  LYS A C   
610  O O   . LYS A 78  ? 0.0691 0.1206 0.1225 0.0229  -0.0242 0.0266  78  LYS A O   
611  C CB  . LYS A 78  ? 0.0604 0.1015 0.1067 0.0269  -0.0123 0.0211  78  LYS A CB  
612  C CG  . LYS A 78  ? 0.1166 0.1577 0.1687 0.0306  -0.0131 0.0230  78  LYS A CG  
613  C CD  . LYS A 78  ? 0.1311 0.1760 0.1909 0.0334  -0.0081 0.0209  78  LYS A CD  
614  C CE  . LYS A 78  ? 0.1676 0.2116 0.2331 0.0379  -0.0082 0.0221  78  LYS A CE  
615  N NZ  . LYS A 78  ? 0.1594 0.2085 0.2328 0.0407  -0.0034 0.0202  78  LYS A NZ  
616  N N   . TYR A 79  ? 0.0543 0.0963 0.0906 0.0195  -0.0245 0.0243  79  TYR A N   
617  C CA  . TYR A 79  ? 0.0627 0.1020 0.0928 0.0184  -0.0302 0.0265  79  TYR A CA  
618  C C   . TYR A 79  ? 0.0784 0.1169 0.1015 0.0140  -0.0344 0.0254  79  TYR A C   
619  O O   . TYR A 79  ? 0.1245 0.1609 0.1415 0.0128  -0.0393 0.0268  79  TYR A O   
620  C CB  . TYR A 79  ? 0.0760 0.1076 0.0971 0.0200  -0.0296 0.0277  79  TYR A CB  
621  C CG  . TYR A 79  ? 0.0760 0.1059 0.1025 0.0241  -0.0267 0.0291  79  TYR A CG  
622  C CD1 . TYR A 79  ? 0.0928 0.1240 0.1238 0.0264  -0.0297 0.0319  79  TYR A CD1 
623  C CD2 . TYR A 79  ? 0.0816 0.1084 0.1085 0.0258  -0.0213 0.0274  79  TYR A CD2 
624  C CE1 . TYR A 79  ? 0.1407 0.1692 0.1765 0.0305  -0.0272 0.0329  79  TYR A CE1 
625  C CE2 . TYR A 79  ? 0.0884 0.1121 0.1196 0.0294  -0.0189 0.0281  79  TYR A CE2 
626  C CZ  . TYR A 79  ? 0.1151 0.1393 0.1507 0.0318  -0.0218 0.0308  79  TYR A CZ  
627  O OH  . TYR A 79  ? 0.1483 0.1684 0.1879 0.0357  -0.0197 0.0313  79  TYR A OH  
628  N N   . GLY A 80  ? 0.0760 0.1153 0.0990 0.0116  -0.0327 0.0230  80  GLY A N   
629  C CA  . GLY A 80  ? 0.0833 0.1205 0.0996 0.0074  -0.0368 0.0215  80  GLY A CA  
630  C C   . GLY A 80  ? 0.0939 0.1361 0.1166 0.0049  -0.0416 0.0228  80  GLY A C   
631  O O   . GLY A 80  ? 0.1356 0.1851 0.1707 0.0054  -0.0405 0.0243  80  GLY A O   
632  N N   . LYS A 81  ? 0.1091 0.1473 0.1230 0.0019  -0.0468 0.0221  81  LYS A N   
633  C CA  . LYS A 81  ? 0.1232 0.1659 0.1433 -0.0012 -0.0520 0.0234  81  LYS A CA  
634  C C   . LYS A 81  ? 0.1064 0.1509 0.1318 -0.0052 -0.0520 0.0219  81  LYS A C   
635  O O   . LYS A 81  ? 0.1233 0.1741 0.1589 -0.0075 -0.0546 0.0238  81  LYS A O   
636  C CB  . LYS A 81  ? 0.1974 0.2354 0.2066 -0.0030 -0.0581 0.0234  81  LYS A CB  
637  C CG  . LYS A 81  ? 0.2133 0.2529 0.2230 0.0008  -0.0593 0.0269  81  LYS A CG  
638  C CD  . LYS A 81  ? 0.3515 0.4010 0.3786 0.0030  -0.0592 0.0303  81  LYS A CD  
639  C CE  . LYS A 81  ? 0.3604 0.4113 0.3888 0.0064  -0.0621 0.0341  81  LYS A CE  
640  N NZ  . LYS A 81  ? 0.3647 0.4252 0.4079 0.0064  -0.0658 0.0371  81  LYS A NZ  
641  N N   . ASP A 82  ? 0.0783 0.1176 0.0976 -0.0059 -0.0491 0.0190  82  ASP A N   
642  C CA  . ASP A 82  ? 0.1131 0.1536 0.1381 -0.0090 -0.0479 0.0182  82  ASP A CA  
643  C C   . ASP A 82  ? 0.0868 0.1251 0.1094 -0.0066 -0.0423 0.0168  82  ASP A C   
644  O O   . ASP A 82  ? 0.0762 0.1120 0.0930 -0.0030 -0.0397 0.0163  82  ASP A O   
645  C CB  . ASP A 82  ? 0.1814 0.2148 0.1990 -0.0142 -0.0531 0.0156  82  ASP A CB  
646  C CG  . ASP A 82  ? 0.2427 0.2650 0.2433 -0.0138 -0.0534 0.0115  82  ASP A CG  
647  O OD1 . ASP A 82  ? 0.2291 0.2483 0.2251 -0.0112 -0.0490 0.0100  82  ASP A OD1 
648  O OD2 . ASP A 82  ? 0.3304 0.3469 0.3218 -0.0162 -0.0580 0.0096  82  ASP A OD2 
649  N N   . ASP A 83  ? 0.0897 0.1287 0.1165 -0.0087 -0.0405 0.0165  83  ASP A N   
650  C CA  . ASP A 83  ? 0.0542 0.0921 0.0796 -0.0063 -0.0355 0.0156  83  ASP A CA  
651  C C   . ASP A 83  ? 0.0604 0.0874 0.0739 -0.0070 -0.0350 0.0113  83  ASP A C   
652  O O   . ASP A 83  ? 0.0730 0.0980 0.0859 -0.0054 -0.0300 0.0101  83  ASP A O   
653  C CB  . ASP A 83  ? 0.0592 0.1039 0.0954 -0.0070 -0.0318 0.0179  83  ASP A CB  
654  C CG  . ASP A 83  ? 0.0743 0.1171 0.1127 -0.0124 -0.0350 0.0183  83  ASP A CG  
655  O OD1 . ASP A 83  ? 0.1099 0.1456 0.1417 -0.0156 -0.0404 0.0161  83  ASP A OD1 
656  O OD2 . ASP A 83  ? 0.0926 0.1402 0.1386 -0.0137 -0.0319 0.0208  83  ASP A OD2 
657  N N   . SER A 84  ? 0.0686 0.0882 0.0720 -0.0089 -0.0396 0.0088  84  SER A N   
658  C CA  . SER A 84  ? 0.1033 0.1119 0.0962 -0.0093 -0.0383 0.0042  84  SER A CA  
659  C C   . SER A 84  ? 0.0818 0.0882 0.0710 -0.0047 -0.0313 0.0023  84  SER A C   
660  O O   . SER A 84  ? 0.1043 0.1056 0.0917 -0.0040 -0.0285 0.0000  84  SER A O   
661  C CB  . SER A 84  ? 0.1648 0.1648 0.1448 -0.0114 -0.0434 0.0010  84  SER A CB  
662  O OG  . SER A 84  ? 0.2272 0.2253 0.1982 -0.0081 -0.0411 0.0003  84  SER A OG  
663  N N   . LEU A 85  ? 0.0735 0.0831 0.0619 -0.0016 -0.0288 0.0036  85  LEU A N   
664  C CA  . LEU A 85  ? 0.0820 0.0900 0.0679 0.0019  -0.0228 0.0020  85  LEU A CA  
665  C C   . LEU A 85  ? 0.0846 0.0978 0.0793 0.0035  -0.0189 0.0033  85  LEU A C   
666  O O   . LEU A 85  ? 0.0704 0.0822 0.0641 0.0058  -0.0148 0.0019  85  LEU A O   
667  C CB  . LEU A 85  ? 0.0697 0.0782 0.0514 0.0040  -0.0215 0.0032  85  LEU A CB  
668  C CG  . LEU A 85  ? 0.0748 0.0772 0.0442 0.0031  -0.0239 0.0019  85  LEU A CG  
669  C CD1 . LEU A 85  ? 0.1222 0.1267 0.0899 0.0047  -0.0237 0.0052  85  LEU A CD1 
670  C CD2 . LEU A 85  ? 0.1400 0.1350 0.1005 0.0041  -0.0199 -0.0024 85  LEU A CD2 
671  N N   . TYR A 86  ? 0.0474 0.0670 0.0507 0.0023  -0.0201 0.0062  86  TYR A N   
672  C CA  . TYR A 86  ? 0.0406 0.0643 0.0499 0.0036  -0.0164 0.0073  86  TYR A CA  
673  C C   . TYR A 86  ? 0.0564 0.0855 0.0735 0.0010  -0.0180 0.0101  86  TYR A C   
674  O O   . TYR A 86  ? 0.0369 0.0734 0.0612 0.0015  -0.0175 0.0128  86  TYR A O   
675  C CB  . TYR A 86  ? 0.0360 0.0630 0.0471 0.0070  -0.0130 0.0078  86  TYR A CB  
676  C CG  . TYR A 86  ? 0.0449 0.0745 0.0591 0.0085  -0.0090 0.0078  86  TYR A CG  
677  C CD1 . TYR A 86  ? 0.0355 0.0615 0.0466 0.0085  -0.0077 0.0061  86  TYR A CD1 
678  C CD2 . TYR A 86  ? 0.0287 0.0639 0.0484 0.0103  -0.0068 0.0093  86  TYR A CD2 
679  C CE1 . TYR A 86  ? 0.0454 0.0732 0.0575 0.0096  -0.0050 0.0062  86  TYR A CE1 
680  C CE2 . TYR A 86  ? 0.0271 0.0635 0.0472 0.0115  -0.0033 0.0088  86  TYR A CE2 
681  C CZ  . TYR A 86  ? 0.0274 0.0599 0.0428 0.0109  -0.0027 0.0072  86  TYR A CZ  
682  O OH  . TYR A 86  ? 0.0387 0.0721 0.0529 0.0119  -0.0001 0.0068  86  TYR A OH  
683  N N   . PRO A 87  ? 0.0549 0.0802 0.0712 -0.0021 -0.0199 0.0099  87  PRO A N   
684  C CA  . PRO A 87  ? 0.0605 0.0901 0.0844 -0.0060 -0.0222 0.0130  87  PRO A CA  
685  C C   . PRO A 87  ? 0.0474 0.0857 0.0791 -0.0051 -0.0178 0.0163  87  PRO A C   
686  O O   . PRO A 87  ? 0.0454 0.0829 0.0743 -0.0023 -0.0135 0.0156  87  PRO A O   
687  C CB  . PRO A 87  ? 0.0720 0.0930 0.0918 -0.0086 -0.0237 0.0117  87  PRO A CB  
688  C CG  . PRO A 87  ? 0.1510 0.1633 0.1610 -0.0063 -0.0239 0.0072  87  PRO A CG  
689  C CD  . PRO A 87  ? 0.1090 0.1249 0.1176 -0.0020 -0.0201 0.0066  87  PRO A CD  
690  N N   . LYS A 88  ? 0.0467 0.0933 0.0882 -0.0073 -0.0190 0.0198  88  LYS A N   
691  C CA  . LYS A 88  ? 0.0362 0.0917 0.0855 -0.0066 -0.0140 0.0231  88  LYS A CA  
692  C C   . LYS A 88  ? 0.0390 0.0930 0.0883 -0.0097 -0.0121 0.0252  88  LYS A C   
693  O O   . LYS A 88  ? 0.0436 0.1016 0.0937 -0.0081 -0.0066 0.0269  88  LYS A O   
694  C CB  . LYS A 88  ? 0.0486 0.1144 0.1100 -0.0076 -0.0154 0.0264  88  LYS A CB  
695  C CG  . LYS A 88  ? 0.0563 0.1222 0.1165 -0.0031 -0.0154 0.0245  88  LYS A CG  
696  C CD  . LYS A 88  ? 0.0738 0.1461 0.1429 -0.0028 -0.0159 0.0265  88  LYS A CD  
697  C CE  . LYS A 88  ? 0.1025 0.1726 0.1713 -0.0064 -0.0234 0.0266  88  LYS A CE  
698  N NZ  . LYS A 88  ? 0.0911 0.1681 0.1694 -0.0061 -0.0249 0.0289  88  LYS A NZ  
699  N N   . ASP A 89  ? 0.0531 0.1003 0.1005 -0.0141 -0.0165 0.0253  89  ASP A N   
700  C CA  . ASP A 89  ? 0.0777 0.1209 0.1239 -0.0171 -0.0153 0.0277  89  ASP A CA  
701  C C   . ASP A 89  ? 0.0472 0.0869 0.0853 -0.0130 -0.0109 0.0264  89  ASP A C   
702  O O   . ASP A 89  ? 0.0785 0.1124 0.1095 -0.0096 -0.0116 0.0224  89  ASP A O   
703  C CB  . ASP A 89  ? 0.0910 0.1233 0.1336 -0.0210 -0.0211 0.0263  89  ASP A CB  
704  C CG  . ASP A 89  ? 0.1003 0.1269 0.1414 -0.0237 -0.0201 0.0291  89  ASP A CG  
705  O OD1 . ASP A 89  ? 0.1331 0.1632 0.1819 -0.0289 -0.0207 0.0337  89  ASP A OD1 
706  O OD2 . ASP A 89  ? 0.0927 0.1118 0.1259 -0.0207 -0.0189 0.0275  89  ASP A OD2 
707  N N   . LEU A 90  ? 0.0621 0.1056 0.1010 -0.0135 -0.0065 0.0300  90  LEU A N   
708  C CA  . LEU A 90  ? 0.0480 0.0894 0.0787 -0.0095 -0.0028 0.0287  90  LEU A CA  
709  C C   . LEU A 90  ? 0.0716 0.1023 0.0945 -0.0090 -0.0057 0.0271  90  LEU A C   
710  O O   . LEU A 90  ? 0.0517 0.0800 0.0686 -0.0052 -0.0050 0.0242  90  LEU A O   
711  C CB  . LEU A 90  ? 0.0862 0.1337 0.1173 -0.0102 0.0028  0.0329  90  LEU A CB  
712  C CG  . LEU A 90  ? 0.0488 0.1077 0.0879 -0.0091 0.0075  0.0341  90  LEU A CG  
713  C CD1 . LEU A 90  ? 0.0588 0.1229 0.0960 -0.0092 0.0143  0.0378  90  LEU A CD1 
714  C CD2 . LEU A 90  ? 0.0757 0.1355 0.1129 -0.0037 0.0082  0.0291  90  LEU A CD2 
715  N N   . VAL A 91  ? 0.0637 0.0881 0.0874 -0.0126 -0.0090 0.0290  91  VAL A N   
716  C CA  . VAL A 91  ? 0.0944 0.1082 0.1123 -0.0115 -0.0118 0.0277  91  VAL A CA  
717  C C   . VAL A 91  ? 0.0612 0.0709 0.0769 -0.0084 -0.0141 0.0219  91  VAL A C   
718  O O   . VAL A 91  ? 0.0736 0.0799 0.0851 -0.0047 -0.0139 0.0194  91  VAL A O   
719  C CB  . VAL A 91  ? 0.0972 0.1035 0.1167 -0.0160 -0.0148 0.0312  91  VAL A CB  
720  C CG1 . VAL A 91  ? 0.1372 0.1320 0.1517 -0.0136 -0.0177 0.0291  91  VAL A CG1 
721  C CG2 . VAL A 91  ? 0.1270 0.1370 0.1475 -0.0190 -0.0118 0.0378  91  VAL A CG2 
722  N N   . LYS A 92  ? 0.0718 0.0822 0.0903 -0.0102 -0.0162 0.0200  92  LYS A N   
723  C CA  . LYS A 92  ? 0.0971 0.1037 0.1119 -0.0075 -0.0177 0.0149  92  LYS A CA  
724  C C   . LYS A 92  ? 0.0647 0.0767 0.0779 -0.0033 -0.0145 0.0131  92  LYS A C   
725  O O   . LYS A 92  ? 0.0779 0.0863 0.0872 -0.0002 -0.0141 0.0098  92  LYS A O   
726  C CB  . LYS A 92  ? 0.0724 0.0788 0.0889 -0.0106 -0.0213 0.0137  92  LYS A CB  
727  C CG  . LYS A 92  ? 0.1186 0.1160 0.1348 -0.0148 -0.0255 0.0138  92  LYS A CG  
728  C CD  . LYS A 92  ? 0.1455 0.1425 0.1631 -0.0189 -0.0303 0.0127  92  LYS A CD  
729  C CE  . LYS A 92  ? 0.2197 0.2053 0.2358 -0.0234 -0.0348 0.0120  92  LYS A CE  
730  N NZ  . LYS A 92  ? 0.2626 0.2437 0.2756 -0.0267 -0.0406 0.0086  92  LYS A NZ  
731  N N   . ARG A 93  ? 0.0648 0.0854 0.0817 -0.0033 -0.0121 0.0151  93  ARG A N   
732  C CA  . ARG A 93  ? 0.0463 0.0707 0.0618 0.0005  -0.0092 0.0133  93  ARG A CA  
733  C C   . ARG A 93  ? 0.0392 0.0610 0.0502 0.0028  -0.0077 0.0125  93  ARG A C   
734  O O   . ARG A 93  ? 0.0404 0.0614 0.0493 0.0055  -0.0070 0.0097  93  ARG A O   
735  C CB  . ARG A 93  ? 0.0471 0.0801 0.0674 0.0008  -0.0063 0.0153  93  ARG A CB  
736  C CG  . ARG A 93  ? 0.0417 0.0767 0.0603 0.0045  -0.0038 0.0129  93  ARG A CG  
737  C CD  . ARG A 93  ? 0.0519 0.0943 0.0761 0.0058  -0.0012 0.0142  93  ARG A CD  
738  N NE  . ARG A 93  ? 0.0306 0.0752 0.0598 0.0049  -0.0043 0.0149  93  ARG A NE  
739  C CZ  . ARG A 93  ? 0.0284 0.0789 0.0636 0.0067  -0.0035 0.0159  93  ARG A CZ  
740  N NH1 . ARG A 93  ? 0.0461 0.1002 0.0832 0.0099  0.0011  0.0157  93  ARG A NH1 
741  N NH2 . ARG A 93  ? 0.0299 0.0816 0.0685 0.0055  -0.0077 0.0168  93  ARG A NH2 
742  N N   . ALA A 94  ? 0.0429 0.0638 0.0529 0.0016  -0.0074 0.0154  94  ALA A N   
743  C CA  . ALA A 94  ? 0.0494 0.0678 0.0551 0.0035  -0.0073 0.0153  94  ALA A CA  
744  C C   . ALA A 94  ? 0.0793 0.0920 0.0843 0.0054  -0.0097 0.0127  94  ALA A C   
745  O O   . ALA A 94  ? 0.0592 0.0720 0.0628 0.0078  -0.0097 0.0112  94  ALA A O   
746  C CB  . ALA A 94  ? 0.0646 0.0818 0.0684 0.0013  -0.0073 0.0199  94  ALA A CB  
747  N N   . LEU A 95  ? 0.0639 0.0716 0.0701 0.0044  -0.0116 0.0119  95  LEU A N   
748  C CA  . LEU A 95  ? 0.0810 0.0833 0.0867 0.0071  -0.0126 0.0089  95  LEU A CA  
749  C C   . LEU A 95  ? 0.0743 0.0794 0.0798 0.0092  -0.0108 0.0053  95  LEU A C   
750  O O   . LEU A 95  ? 0.0778 0.0829 0.0841 0.0118  -0.0101 0.0036  95  LEU A O   
751  C CB  . LEU A 95  ? 0.0850 0.0794 0.0904 0.0058  -0.0148 0.0082  95  LEU A CB  
752  C CG  . LEU A 95  ? 0.1150 0.1030 0.1199 0.0093  -0.0150 0.0049  95  LEU A CG  
753  C CD1 . LEU A 95  ? 0.1317 0.1200 0.1390 0.0121  -0.0154 0.0068  95  LEU A CD1 
754  C CD2 . LEU A 95  ? 0.1509 0.1292 0.1540 0.0080  -0.0170 0.0033  95  LEU A CD2 
755  N N   . VAL A 96  ? 0.0537 0.0614 0.0589 0.0078  -0.0103 0.0047  96  VAL A N   
756  C CA  . VAL A 96  ? 0.0642 0.0741 0.0686 0.0095  -0.0086 0.0023  96  VAL A CA  
757  C C   . VAL A 96  ? 0.0344 0.0487 0.0401 0.0110  -0.0068 0.0024  96  VAL A C   
758  O O   . VAL A 96  ? 0.0495 0.0640 0.0557 0.0128  -0.0057 0.0006  96  VAL A O   
759  C CB  . VAL A 96  ? 0.0658 0.0778 0.0699 0.0079  -0.0090 0.0025  96  VAL A CB  
760  C CG1 . VAL A 96  ? 0.0555 0.0685 0.0580 0.0097  -0.0073 0.0008  96  VAL A CG1 
761  C CG2 . VAL A 96  ? 0.0845 0.0917 0.0866 0.0057  -0.0119 0.0019  96  VAL A CG2 
762  N N   . ASP A 97  ? 0.0335 0.0511 0.0395 0.0102  -0.0064 0.0045  97  ASP A N   
763  C CA  . ASP A 97  ? 0.0472 0.0674 0.0524 0.0113  -0.0053 0.0039  97  ASP A CA  
764  C C   . ASP A 97  ? 0.0443 0.0629 0.0497 0.0124  -0.0068 0.0035  97  ASP A C   
765  O O   . ASP A 97  ? 0.0608 0.0807 0.0674 0.0134  -0.0066 0.0018  97  ASP A O   
766  C CB  . ASP A 97  ? 0.0337 0.0566 0.0372 0.0105  -0.0042 0.0059  97  ASP A CB  
767  C CG  . ASP A 97  ? 0.0561 0.0825 0.0614 0.0103  -0.0020 0.0063  97  ASP A CG  
768  O OD1 . ASP A 97  ? 0.0482 0.0748 0.0555 0.0110  -0.0019 0.0050  97  ASP A OD1 
769  O OD2 . ASP A 97  ? 0.0577 0.0871 0.0628 0.0097  -0.0001 0.0083  97  ASP A OD2 
770  N N   . ASN A 98  ? 0.0622 0.0781 0.0674 0.0122  -0.0087 0.0054  98  ASN A N   
771  C CA  . ASN A 98  ? 0.0536 0.0683 0.0604 0.0137  -0.0108 0.0057  98  ASN A CA  
772  C C   . ASN A 98  ? 0.0369 0.0520 0.0479 0.0157  -0.0100 0.0030  98  ASN A C   
773  O O   . ASN A 98  ? 0.0593 0.0772 0.0737 0.0167  -0.0108 0.0024  98  ASN A O   
774  C CB  . ASN A 98  ? 0.0859 0.0959 0.0926 0.0136  -0.0130 0.0084  98  ASN A CB  
775  C CG  . ASN A 98  ? 0.1011 0.1100 0.1115 0.0162  -0.0155 0.0088  98  ASN A CG  
776  O OD1 . ASN A 98  ? 0.1376 0.1450 0.1524 0.0185  -0.0148 0.0067  98  ASN A OD1 
777  N ND2 . ASN A 98  ? 0.1431 0.1530 0.1516 0.0161  -0.0182 0.0116  98  ASN A ND2 
778  N N   . ARG A 99  ? 0.0370 0.0496 0.0481 0.0160  -0.0083 0.0014  99  ARG A N   
779  C CA  . ARG A 99  ? 0.0522 0.0650 0.0666 0.0180  -0.0064 -0.0009 99  ARG A CA  
780  C C   . ARG A 99  ? 0.0406 0.0578 0.0561 0.0175  -0.0045 -0.0020 99  ARG A C   
781  O O   . ARG A 99  ? 0.0453 0.0650 0.0656 0.0188  -0.0033 -0.0029 99  ARG A O   
782  C CB  . ARG A 99  ? 0.0641 0.0718 0.0757 0.0184  -0.0050 -0.0028 99  ARG A CB  
783  C CG  . ARG A 99  ? 0.1402 0.1416 0.1506 0.0185  -0.0072 -0.0021 99  ARG A CG  
784  C CD  . ARG A 99  ? 0.1441 0.1446 0.1595 0.0214  -0.0082 -0.0014 99  ARG A CD  
785  N NE  . ARG A 99  ? 0.1237 0.1159 0.1380 0.0222  -0.0096 -0.0016 99  ARG A NE  
786  C CZ  . ARG A 99  ? 0.0966 0.0857 0.1131 0.0229  -0.0126 0.0014  99  ARG A CZ  
787  N NH1 . ARG A 99  ? 0.0786 0.0725 0.0971 0.0226  -0.0147 0.0048  99  ARG A NH1 
788  N NH2 . ARG A 99  ? 0.1132 0.0932 0.1288 0.0237  -0.0137 0.0010  99  ARG A NH2 
789  N N   . MET A 100 ? 0.0342 0.0522 0.0464 0.0158  -0.0041 -0.0017 100 MET A N   
790  C CA  . MET A 100 ? 0.0318 0.0523 0.0450 0.0153  -0.0025 -0.0025 100 MET A CA  
791  C C   . MET A 100 ? 0.0320 0.0552 0.0478 0.0149  -0.0042 -0.0025 100 MET A C   
792  O O   . MET A 100 ? 0.0342 0.0594 0.0537 0.0145  -0.0035 -0.0034 100 MET A O   
793  C CB  . MET A 100 ? 0.0274 0.0476 0.0373 0.0143  -0.0017 -0.0021 100 MET A CB  
794  C CG  . MET A 100 ? 0.0460 0.0640 0.0533 0.0143  -0.0009 -0.0021 100 MET A CG  
795  S SD  . MET A 100 ? 0.0594 0.0779 0.0649 0.0137  -0.0004 -0.0011 100 MET A SD  
796  C CE  . MET A 100 ? 0.0755 0.0964 0.0820 0.0133  -0.0016 0.0002  100 MET A CE  
797  N N   . TYR A 101 ? 0.0539 0.0769 0.0672 0.0146  -0.0066 -0.0015 101 TYR A N   
798  C CA  . TYR A 101 ? 0.0344 0.0591 0.0482 0.0140  -0.0093 -0.0016 101 TYR A CA  
799  C C   . TYR A 101 ? 0.0617 0.0890 0.0826 0.0150  -0.0112 -0.0013 101 TYR A C   
800  O O   . TYR A 101 ? 0.0451 0.0751 0.0697 0.0140  -0.0129 -0.0020 101 TYR A O   
801  C CB  . TYR A 101 ? 0.0478 0.0714 0.0552 0.0134  -0.0112 -0.0002 101 TYR A CB  
802  C CG  . TYR A 101 ? 0.0367 0.0595 0.0389 0.0127  -0.0089 -0.0012 101 TYR A CG  
803  C CD1 . TYR A 101 ? 0.0620 0.0843 0.0622 0.0120  -0.0090 -0.0037 101 TYR A CD1 
804  C CD2 . TYR A 101 ? 0.0695 0.0920 0.0696 0.0127  -0.0065 0.0001  101 TYR A CD2 
805  C CE1 . TYR A 101 ? 0.0587 0.0796 0.0547 0.0123  -0.0064 -0.0050 101 TYR A CE1 
806  C CE2 . TYR A 101 ? 0.0439 0.0667 0.0412 0.0129  -0.0038 -0.0008 101 TYR A CE2 
807  C CZ  . TYR A 101 ? 0.0540 0.0757 0.0490 0.0130  -0.0035 -0.0035 101 TYR A CZ  
808  O OH  . TYR A 101 ? 0.0702 0.0914 0.0628 0.0140  -0.0004 -0.0047 101 TYR A OH  
809  N N   . PHE A 102 ? 0.0461 0.0723 0.0694 0.0169  -0.0110 -0.0003 102 PHE A N   
810  C CA  . PHE A 102 ? 0.0628 0.0918 0.0946 0.0189  -0.0117 0.0000  102 PHE A CA  
811  C C   . PHE A 102 ? 0.0299 0.0624 0.0676 0.0187  -0.0083 -0.0016 102 PHE A C   
812  O O   . PHE A 102 ? 0.0300 0.0678 0.0761 0.0186  -0.0096 -0.0014 102 PHE A O   
813  C CB  . PHE A 102 ? 0.0453 0.0705 0.0777 0.0215  -0.0109 0.0005  102 PHE A CB  
814  C CG  . PHE A 102 ? 0.0627 0.0903 0.1043 0.0245  -0.0097 0.0003  102 PHE A CG  
815  C CD1 . PHE A 102 ? 0.0941 0.1235 0.1402 0.0255  -0.0128 0.0027  102 PHE A CD1 
816  C CD2 . PHE A 102 ? 0.0583 0.0856 0.1016 0.0258  -0.0045 -0.0018 102 PHE A CD2 
817  C CE1 . PHE A 102 ? 0.0618 0.0938 0.1152 0.0282  -0.0106 0.0028  102 PHE A CE1 
818  C CE2 . PHE A 102 ? 0.0812 0.1105 0.1307 0.0283  -0.0019 -0.0016 102 PHE A CE2 
819  C CZ  . PHE A 102 ? 0.0717 0.1037 0.1267 0.0297  -0.0050 0.0004  102 PHE A CZ  
820  N N   . GLU A 103 ? 0.0302 0.0604 0.0642 0.0184  -0.0042 -0.0028 103 GLU A N   
821  C CA  . GLU A 103 ? 0.0392 0.0722 0.0773 0.0178  -0.0004 -0.0036 103 GLU A CA  
822  C C   . GLU A 103 ? 0.0461 0.0820 0.0872 0.0150  -0.0021 -0.0035 103 GLU A C   
823  O O   . GLU A 103 ? 0.0286 0.0691 0.0781 0.0142  -0.0010 -0.0033 103 GLU A O   
824  C CB  . GLU A 103 ? 0.0348 0.0637 0.0656 0.0174  0.0031  -0.0043 103 GLU A CB  
825  C CG  . GLU A 103 ? 0.0302 0.0607 0.0631 0.0174  0.0080  -0.0045 103 GLU A CG  
826  C CD  . GLU A 103 ? 0.0510 0.0833 0.0862 0.0146  0.0087  -0.0036 103 GLU A CD  
827  O OE1 . GLU A 103 ? 0.0546 0.0851 0.0871 0.0130  0.0057  -0.0036 103 GLU A OE1 
828  O OE2 . GLU A 103 ? 0.0505 0.0856 0.0902 0.0141  0.0126  -0.0030 103 GLU A OE2 
829  N N   . SER A 104 ? 0.0328 0.0657 0.0673 0.0134  -0.0044 -0.0039 104 SER A N   
830  C CA  . SER A 104 ? 0.0341 0.0672 0.0695 0.0107  -0.0058 -0.0047 104 SER A CA  
831  C C   . SER A 104 ? 0.0374 0.0751 0.0801 0.0095  -0.0100 -0.0046 104 SER A C   
832  O O   . SER A 104 ? 0.0399 0.0797 0.0884 0.0069  -0.0106 -0.0050 104 SER A O   
833  C CB  . SER A 104 ? 0.0540 0.0825 0.0804 0.0101  -0.0070 -0.0057 104 SER A CB  
834  O OG  . SER A 104 ? 0.1030 0.1315 0.1256 0.0106  -0.0105 -0.0054 104 SER A OG  
835  N N   . GLY A 105 ? 0.0310 0.0701 0.0739 0.0110  -0.0136 -0.0037 105 GLY A N   
839  N N   . VAL A 106 ? 0.0451 0.0982 0.0636 0.0211  -0.0017 -0.0033 106 VAL A N   
840  C CA  . VAL A 106 ? 0.0289 0.0823 0.0579 0.0197  -0.0022 0.0018  106 VAL A CA  
841  C C   . VAL A 106 ? 0.0731 0.1221 0.1064 0.0195  0.0001  0.0007  106 VAL A C   
842  O O   . VAL A 106 ? 0.0694 0.1218 0.1133 0.0186  -0.0007 0.0023  106 VAL A O   
843  C CB  . VAL A 106 ? 0.0482 0.1007 0.0799 0.0207  0.0000  0.0042  106 VAL A CB  
844  C CG1 . VAL A 106 ? 0.0453 0.0990 0.0923 0.0215  0.0017  0.0068  106 VAL A CG1 
845  C CG2 . VAL A 106 ? 0.0578 0.1175 0.0875 0.0201  -0.0029 0.0074  106 VAL A CG2 
846  N N   . VAL A 107 ? 0.0277 0.0719 0.0540 0.0198  0.0021  -0.0017 107 VAL A N   
847  C CA  . VAL A 107 ? 0.0325 0.0761 0.0626 0.0185  0.0044  -0.0021 107 VAL A CA  
848  C C   . VAL A 107 ? 0.0265 0.0700 0.0577 0.0188  0.0027  -0.0021 107 VAL A C   
849  O O   . VAL A 107 ? 0.0573 0.1049 0.0956 0.0180  0.0029  -0.0016 107 VAL A O   
850  C CB  . VAL A 107 ? 0.0491 0.0930 0.0743 0.0174  0.0068  -0.0031 107 VAL A CB  
851  C CG1 . VAL A 107 ? 0.0730 0.1196 0.1020 0.0141  0.0110  -0.0039 107 VAL A CG1 
852  C CG2 . VAL A 107 ? 0.0563 0.0990 0.0842 0.0167  0.0103  -0.0041 107 VAL A CG2 
853  N N   . PHE A 108 ? 0.0457 0.0876 0.0731 0.0210  0.0017  -0.0023 108 PHE A N   
854  C CA  . PHE A 108 ? 0.0464 0.0900 0.0785 0.0242  0.0012  -0.0018 108 PHE A CA  
855  C C   . PHE A 108 ? 0.0394 0.0866 0.0744 0.0261  0.0006  -0.0062 108 PHE A C   
856  O O   . PHE A 108 ? 0.0417 0.0922 0.0807 0.0236  -0.0003 -0.0063 108 PHE A O   
857  C CB  . PHE A 108 ? 0.0374 0.0780 0.0724 0.0280  0.0014  0.0006  108 PHE A CB  
858  C CG  . PHE A 108 ? 0.0453 0.0839 0.0891 0.0333  0.0017  0.0043  108 PHE A CG  
859  C CD1 . PHE A 108 ? 0.0460 0.0914 0.0919 0.0321  -0.0003 0.0138  108 PHE A CD1 
860  C CD2 . PHE A 108 ? 0.0672 0.0952 0.1169 0.0386  0.0069  -0.0002 108 PHE A CD2 
861  C CE1 . PHE A 108 ? 0.0800 0.1155 0.1329 0.0325  0.0001  0.0210  108 PHE A CE1 
862  C CE2 . PHE A 108 ? 0.0861 0.1003 0.1431 0.0387  0.0099  0.0041  108 PHE A CE2 
863  C CZ  . PHE A 108 ? 0.0925 0.1103 0.1523 0.0364  0.0055  0.0161  108 PHE A CZ  
864  N N   . ALA A 109 ? 0.0389 0.0877 0.0708 0.0274  0.0011  -0.0119 109 ALA A N   
865  C CA  . ALA A 109 ? 0.0646 0.1101 0.0908 0.0194  0.0010  -0.0182 109 ALA A CA  
866  C C   . ALA A 109 ? 0.0468 0.1068 0.0754 0.0125  -0.0053 -0.0136 109 ALA A C   
867  O O   . ALA A 109 ? 0.0686 0.1280 0.0964 0.0042  -0.0068 -0.0143 109 ALA A O   
868  C CB  . ALA A 109 ? 0.0634 0.1054 0.0797 0.0157  0.0047  -0.0266 109 ALA A CB  
869  N N   . ASN A 110 ? 0.0348 0.1086 0.0703 0.0158  -0.0083 -0.0075 110 ASN A N   
870  C CA  . ASN A 110 ? 0.0640 0.1484 0.1069 0.0099  -0.0132 0.0006  110 ASN A CA  
871  C C   . ASN A 110 ? 0.0538 0.1334 0.1085 0.0108  -0.0106 0.0042  110 ASN A C   
872  O O   . ASN A 110 ? 0.0762 0.1658 0.1386 0.0053  -0.0141 0.0080  110 ASN A O   
873  C CB  . ASN A 110 ? 0.0490 0.1316 0.0920 0.0107  -0.0141 0.0065  110 ASN A CB  
874  C CG  . ASN A 110 ? 0.0844 0.1778 0.1354 0.0052  -0.0196 0.0156  110 ASN A CG  
875  O OD1 . ASN A 110 ? 0.1048 0.2108 0.1495 -0.0051 -0.0256 0.0178  110 ASN A OD1 
876  N ND2 . ASN A 110 ? 0.0572 0.1464 0.1199 0.0102  -0.0167 0.0202  110 ASN A ND2 
877  N N   . ALA A 111 ? 0.0314 0.0981 0.0863 0.0148  -0.0045 0.0023  111 ALA A N   
878  C CA  . ALA A 111 ? 0.0336 0.0997 0.0988 0.0141  -0.0002 0.0014  111 ALA A CA  
879  C C   . ALA A 111 ? 0.0332 0.1012 0.0972 0.0126  0.0027  0.0005  111 ALA A C   
880  O O   . ALA A 111 ? 0.0619 0.1369 0.1350 0.0092  0.0048  0.0006  111 ALA A O   
881  C CB  . ALA A 111 ? 0.0621 0.1208 0.1260 0.0152  0.0047  -0.0027 111 ALA A CB  
882  N N   A LEU A 112 ? 0.0410 0.1050 0.0944 0.0149  0.0026  -0.0008 112 LEU A N   
883  N N   B LEU A 112 ? 0.0384 0.1027 0.0919 0.0149  0.0025  -0.0008 112 LEU A N   
884  C CA  A LEU A 112 ? 0.0536 0.1190 0.1050 0.0125  0.0046  0.0000  112 LEU A CA  
885  C CA  B LEU A 112 ? 0.0301 0.0956 0.0817 0.0124  0.0047  0.0000  112 LEU A CA  
886  C C   A LEU A 112 ? 0.0683 0.1235 0.1153 0.0088  0.0014  0.0001  112 LEU A C   
887  C C   B LEU A 112 ? 0.0663 0.1210 0.1129 0.0089  0.0015  0.0003  112 LEU A C   
888  O O   A LEU A 112 ? 0.0680 0.1231 0.1169 0.0021  0.0022  0.0010  112 LEU A O   
889  O O   B LEU A 112 ? 0.0625 0.1160 0.1101 0.0023  0.0024  0.0016  112 LEU A O   
890  C CB  A LEU A 112 ? 0.0516 0.1142 0.0948 0.0147  0.0051  0.0023  112 LEU A CB  
891  C CB  B LEU A 112 ? 0.0552 0.1191 0.0989 0.0141  0.0058  0.0020  112 LEU A CB  
892  C CG  A LEU A 112 ? 0.0519 0.1145 0.0887 0.0072  0.0060  0.0074  112 LEU A CG  
893  C CG  B LEU A 112 ? 0.0520 0.1136 0.0886 0.0078  0.0054  0.0080  112 LEU A CG  
894  C CD1 A LEU A 112 ? 0.0407 0.1112 0.0702 0.0042  0.0068  0.0101  112 LEU A CD1 
895  C CD1 B LEU A 112 ? 0.0586 0.1254 0.0944 -0.0024 0.0111  0.0063  112 LEU A CD1 
896  C CD2 A LEU A 112 ? 0.0660 0.1176 0.1020 0.0080  0.0016  0.0141  112 LEU A CD2 
897  C CD2 B LEU A 112 ? 0.0496 0.1171 0.0804 0.0079  0.0039  0.0127  112 LEU A CD2 
898  N N   . ARG A 113 ? 0.0858 0.1313 0.1278 0.0122  0.0000  -0.0022 113 ARG A N   
899  C CA  . ARG A 113 ? 0.0995 0.1291 0.1382 0.0087  0.0013  -0.0039 113 ARG A CA  
900  C C   . ARG A 113 ? 0.1167 0.1485 0.1536 -0.0017 -0.0001 -0.0082 113 ARG A C   
901  O O   . ARG A 113 ? 0.1066 0.1284 0.1420 -0.0084 0.0016  -0.0083 113 ARG A O   
902  C CB  . ARG A 113 ? 0.1095 0.1263 0.1467 0.0142  0.0048  -0.0080 113 ARG A CB  
903  C CG  . ARG A 113 ? 0.1332 0.1286 0.1705 0.0099  0.0109  -0.0120 113 ARG A CG  
904  C CD  . ARG A 113 ? 0.1868 0.1660 0.2279 0.0153  0.0199  -0.0182 113 ARG A CD  
905  N NE  . ARG A 113 ? 0.2538 0.2106 0.2920 0.0063  0.0296  -0.0285 113 ARG A NE  
906  C CZ  . ARG A 113 ? 0.3266 0.2591 0.3778 0.0105  0.0413  -0.0287 113 ARG A CZ  
907  N NH1 . ARG A 113 ? 0.3178 0.2479 0.3895 0.0250  0.0428  -0.0154 113 ARG A NH1 
908  N NH2 . ARG A 113 ? 0.3326 0.2430 0.3784 -0.0011 0.0525  -0.0414 113 ARG A NH2 
909  N N   . SER A 114 ? 0.1144 0.1615 0.1527 -0.0042 -0.0039 -0.0095 114 SER A N   
910  C CA  . SER A 114 ? 0.1131 0.1718 0.1526 -0.0158 -0.0081 -0.0096 114 SER A CA  
911  C C   . SER A 114 ? 0.1216 0.1863 0.1708 -0.0198 -0.0075 -0.0052 114 SER A C   
912  O O   . SER A 114 ? 0.1204 0.1811 0.1658 -0.0305 -0.0077 -0.0074 114 SER A O   
913  C CB  . SER A 114 ? 0.1035 0.1843 0.1506 -0.0152 -0.0141 -0.0042 114 SER A CB  
914  O OG  . SER A 114 ? 0.1083 0.1965 0.1698 -0.0040 -0.0117 0.0016  114 SER A OG  
915  N N   . LEU A 115 ? 0.0840 0.1579 0.1452 -0.0129 -0.0050 -0.0005 115 LEU A N   
916  C CA  . LEU A 115 ? 0.1236 0.2055 0.1958 -0.0173 -0.0016 0.0023  115 LEU A CA  
917  C C   . LEU A 115 ? 0.0947 0.1596 0.1553 -0.0217 0.0017  0.0011  115 LEU A C   
918  O O   . LEU A 115 ? 0.1184 0.1835 0.1800 -0.0309 0.0024  0.0014  115 LEU A O   
919  C CB  . LEU A 115 ? 0.1349 0.2278 0.2224 -0.0104 0.0046  0.0045  115 LEU A CB  
920  C CG  . LEU A 115 ? 0.1470 0.2471 0.2478 -0.0140 0.0121  0.0042  115 LEU A CG  
921  C CD1 . LEU A 115 ? 0.1055 0.2158 0.2164 -0.0193 0.0069  0.0074  115 LEU A CD1 
922  C CD2 . LEU A 115 ? 0.1855 0.2847 0.2863 -0.0065 0.0178  0.0024  115 LEU A CD2 
923  N N   . ALA A 116 ? 0.0792 0.1311 0.1303 -0.0160 0.0029  0.0018  116 ALA A N   
924  C CA  . ALA A 116 ? 0.1141 0.1526 0.1576 -0.0198 0.0045  0.0062  116 ALA A CA  
925  C C   . ALA A 116 ? 0.1527 0.1737 0.1922 -0.0252 0.0042  0.0047  116 ALA A C   
926  O O   . ALA A 116 ? 0.1568 0.1707 0.1944 -0.0327 0.0057  0.0085  116 ALA A O   
927  C CB  . ALA A 116 ? 0.1220 0.1559 0.1609 -0.0127 0.0039  0.0116  116 ALA A CB  
928  N N   . LYS A 117 ? 0.1561 0.1691 0.1930 -0.0235 0.0039  -0.0017 117 LYS A N   
929  C CA  . LYS A 117 ? 0.1748 0.1682 0.2067 -0.0317 0.0075  -0.0071 117 LYS A CA  
930  C C   . LYS A 117 ? 0.1771 0.1803 0.2082 -0.0459 0.0059  -0.0093 117 LYS A C   
931  O O   . LYS A 117 ? 0.1693 0.1573 0.1975 -0.0547 0.0096  -0.0095 117 LYS A O   
932  C CB  . LYS A 117 ? 0.1904 0.1748 0.2164 -0.0318 0.0105  -0.0173 117 LYS A CB  
933  C CG  . LYS A 117 ? 0.2968 0.2542 0.3174 -0.0414 0.0197  -0.0260 117 LYS A CG  
934  C CD  . LYS A 117 ? 0.3323 0.2760 0.3474 -0.0413 0.0278  -0.0382 117 LYS A CD  
935  C CE  . LYS A 117 ? 0.3456 0.2927 0.3437 -0.0622 0.0291  -0.0524 117 LYS A CE  
936  N NZ  . LYS A 117 ? 0.3491 0.2792 0.3377 -0.0670 0.0410  -0.0678 117 LYS A NZ  
937  N N   . MET A 118 ? 0.1313 0.1606 0.1684 -0.0482 0.0006  -0.0092 118 MET A N   
938  C CA  . MET A 118 ? 0.1462 0.1926 0.1889 -0.0615 -0.0022 -0.0086 118 MET A CA  
939  C C   . MET A 118 ? 0.1414 0.1862 0.1885 -0.0653 0.0015  -0.0042 118 MET A C   
940  O O   . MET A 118 ? 0.1335 0.1735 0.1771 -0.0785 0.0027  -0.0060 118 MET A O   
941  C CB  . MET A 118 ? 0.1571 0.2356 0.2164 -0.0588 -0.0080 -0.0031 118 MET A CB  
942  C CG  . MET A 118 ? 0.1721 0.2639 0.2279 -0.0645 -0.0153 -0.0038 118 MET A CG  
943  S SD  . MET A 118 ? 0.3172 0.4387 0.3970 -0.0536 -0.0208 0.0088  118 MET A SD  
944  C CE  . MET A 118 ? 0.1580 0.2887 0.2580 -0.0531 -0.0164 0.0136  118 MET A CE  
945  N N   . ILE A 119 ? 0.1049 0.1544 0.1575 -0.0563 0.0043  0.0007  119 ILE A N   
946  C CA  . ILE A 119 ? 0.1260 0.1800 0.1819 -0.0618 0.0091  0.0043  119 ILE A CA  
947  C C   . ILE A 119 ? 0.1462 0.1769 0.1887 -0.0657 0.0109  0.0088  119 ILE A C   
948  O O   . ILE A 119 ? 0.1582 0.1861 0.1985 -0.0769 0.0135  0.0111  119 ILE A O   
949  C CB  . ILE A 119 ? 0.2206 0.2861 0.2824 -0.0541 0.0138  0.0057  119 ILE A CB  
950  C CG1 . ILE A 119 ? 0.2053 0.2918 0.2868 -0.0476 0.0141  0.0042  119 ILE A CG1 
951  C CG2 . ILE A 119 ? 0.2574 0.3269 0.3178 -0.0634 0.0213  0.0071  119 ILE A CG2 
952  C CD1 . ILE A 119 ? 0.1216 0.2252 0.2202 -0.0541 0.0132  0.0057  119 ILE A CD1 
953  N N   . LEU A 120 ? 0.1467 0.1625 0.1831 -0.0563 0.0096  0.0122  120 LEU A N   
954  C CA  . LEU A 120 ? 0.1997 0.1974 0.2303 -0.0574 0.0102  0.0225  120 LEU A CA  
955  C C   . LEU A 120 ? 0.2083 0.1791 0.2387 -0.0601 0.0127  0.0223  120 LEU A C   
956  O O   . LEU A 120 ? 0.2286 0.1846 0.2584 -0.0651 0.0144  0.0323  120 LEU A O   
957  C CB  . LEU A 120 ? 0.2030 0.2020 0.2328 -0.0469 0.0076  0.0304  120 LEU A CB  
958  C CG  . LEU A 120 ? 0.1513 0.1724 0.1782 -0.0476 0.0082  0.0293  120 LEU A CG  
959  C CD1 . LEU A 120 ? 0.1803 0.2032 0.2046 -0.0400 0.0046  0.0374  120 LEU A CD1 
960  C CD2 . LEU A 120 ? 0.1437 0.1732 0.1640 -0.0622 0.0118  0.0328  120 LEU A CD2 
961  N N   . PHE A 121 ? 0.2105 0.1742 0.2411 -0.0586 0.0143  0.0109  121 PHE A N   
962  C CA  . PHE A 121 ? 0.2627 0.1962 0.2933 -0.0613 0.0214  0.0071  121 PHE A CA  
963  C C   . PHE A 121 ? 0.3047 0.2353 0.3279 -0.0781 0.0244  -0.0061 121 PHE A C   
964  O O   . PHE A 121 ? 0.3387 0.2438 0.3601 -0.0872 0.0322  -0.0087 121 PHE A O   
965  C CB  . PHE A 121 ? 0.2929 0.2148 0.3279 -0.0488 0.0249  0.0031  121 PHE A CB  
966  C CG  . PHE A 121 ? 0.3153 0.2382 0.3604 -0.0340 0.0223  0.0185  121 PHE A CG  
967  C CD1 . PHE A 121 ? 0.3642 0.2662 0.4219 -0.0296 0.0263  0.0330  121 PHE A CD1 
968  C CD2 . PHE A 121 ? 0.2897 0.2358 0.3337 -0.0257 0.0157  0.0203  121 PHE A CD2 
969  C CE1 . PHE A 121 ? 0.3518 0.2613 0.4209 -0.0180 0.0214  0.0512  121 PHE A CE1 
970  C CE2 . PHE A 121 ? 0.3009 0.2518 0.3523 -0.0157 0.0123  0.0347  121 PHE A CE2 
971  C CZ  . PHE A 121 ? 0.3261 0.2613 0.3901 -0.0123 0.0140  0.0511  121 PHE A CZ  
972  N N   . LEU A 122 ? 0.2823 0.2402 0.3030 -0.0833 0.0183  -0.0126 122 LEU A N   
973  C CA  . LEU A 122 ? 0.2883 0.2512 0.3013 -0.1017 0.0185  -0.0236 122 LEU A CA  
974  C C   . LEU A 122 ? 0.2732 0.2584 0.2903 -0.1147 0.0141  -0.0200 122 LEU A C   
975  O O   . LEU A 122 ? 0.2924 0.2877 0.3042 -0.1262 0.0118  -0.0253 122 LEU A O   
976  C CB  . LEU A 122 ? 0.2788 0.2597 0.2878 -0.1020 0.0134  -0.0304 122 LEU A CB  
977  C CG  . LEU A 122 ? 0.3263 0.2839 0.3301 -0.0928 0.0205  -0.0373 122 LEU A CG  
978  C CD1 . LEU A 122 ? 0.3269 0.3057 0.3265 -0.0910 0.0143  -0.0410 122 LEU A CD1 
979  C CD2 . LEU A 122 ? 0.3743 0.2966 0.3685 -0.1052 0.0342  -0.0502 122 LEU A CD2 
980  N N   . GLY A 123 ? 0.2296 0.2251 0.2556 -0.1080 0.0130  -0.0099 123 GLY A N   
981  C CA  . GLY A 123 ? 0.2183 0.2324 0.2504 -0.1166 0.0118  -0.0067 123 GLY A CA  
982  C C   . GLY A 123 ? 0.2174 0.2667 0.2623 -0.1154 0.0055  -0.0061 123 GLY A C   
983  O O   . GLY A 123 ? 0.2800 0.3425 0.3305 -0.1218 0.0046  -0.0047 123 GLY A O   
984  N N   . LYS A 124 ? 0.1992 0.2634 0.2514 -0.1065 0.0012  -0.0052 124 LYS A N   
985  C CA  . LYS A 124 ? 0.1956 0.2907 0.2654 -0.1017 -0.0044 -0.0002 124 LYS A CA  
986  C C   . LYS A 124 ? 0.1635 0.2710 0.2532 -0.0912 0.0010  0.0051  124 LYS A C   
987  O O   . LYS A 124 ? 0.1365 0.2337 0.2227 -0.0853 0.0066  0.0046  124 LYS A O   
988  C CB  . LYS A 124 ? 0.2094 0.3123 0.2787 -0.0954 -0.0104 0.0002  124 LYS A CB  
989  C CG  . LYS A 124 ? 0.2657 0.3495 0.3113 -0.1052 -0.0113 -0.0090 124 LYS A CG  
990  C CD  . LYS A 124 ? 0.3058 0.3896 0.3383 -0.1216 -0.0129 -0.0131 124 LYS A CD  
991  C CE  . LYS A 124 ? 0.3500 0.4175 0.3590 -0.1307 -0.0109 -0.0239 124 LYS A CE  
992  N NZ  . LYS A 124 ? 0.4029 0.4696 0.3946 -0.1491 -0.0099 -0.0297 124 LYS A NZ  
993  N N   . THR A 125 ? 0.2038 0.3324 0.3141 -0.0901 0.0009  0.0094  125 THR A N   
1000 N N   . GLU A 126 ? 0.1390 0.2803 0.2410 -0.0382 -0.0132 0.0021  126 GLU A N   
1001 C CA  . GLU A 126 ? 0.1140 0.2633 0.2122 -0.0319 -0.0103 0.0021  126 GLU A CA  
1002 C C   . GLU A 126 ? 0.1117 0.2544 0.2099 -0.0281 -0.0107 -0.0008 126 GLU A C   
1003 O O   . GLU A 126 ? 0.1356 0.2733 0.2365 -0.0311 -0.0117 -0.0054 126 GLU A O   
1004 C CB  . GLU A 126 ? 0.0944 0.2513 0.1923 -0.0344 -0.0104 0.0013  126 GLU A CB  
1005 C CG  . GLU A 126 ? 0.0699 0.2340 0.1688 -0.0382 -0.0098 0.0040  126 GLU A CG  
1006 C CD  . GLU A 126 ? 0.0797 0.2509 0.1788 -0.0422 -0.0109 0.0032  126 GLU A CD  
1007 O OE1 . GLU A 126 ? 0.0757 0.2505 0.1725 -0.0418 -0.0118 0.0020  126 GLU A OE1 
1008 O OE2 . GLU A 126 ? 0.0893 0.2635 0.1901 -0.0470 -0.0111 0.0043  126 GLU A OE2 
1009 N N   . VAL A 127 ? 0.0543 0.1973 0.1501 -0.0221 -0.0091 0.0013  127 VAL A N   
1010 C CA  . VAL A 127 ? 0.1125 0.2491 0.2080 -0.0185 -0.0095 -0.0010 127 VAL A CA  
1011 C C   . VAL A 127 ? 0.0903 0.2332 0.1829 -0.0136 -0.0081 0.0011  127 VAL A C   
1012 O O   . VAL A 127 ? 0.1088 0.2570 0.2022 -0.0090 -0.0062 0.0049  127 VAL A O   
1013 C CB  . VAL A 127 ? 0.1509 0.2819 0.2465 -0.0161 -0.0097 0.0005  127 VAL A CB  
1014 C CG1 . VAL A 127 ? 0.1505 0.2751 0.2453 -0.0112 -0.0095 -0.0015 127 VAL A CG1 
1015 C CG2 . VAL A 127 ? 0.1845 0.3055 0.2830 -0.0223 -0.0135 0.0008  127 VAL A CG2 
1016 N N   . PRO A 128 ? 0.0605 0.2038 0.1511 -0.0158 -0.0091 -0.0013 128 PRO A N   
1017 C CA  . PRO A 128 ? 0.0533 0.2034 0.1415 -0.0128 -0.0098 0.0029  128 PRO A CA  
1018 C C   . PRO A 128 ? 0.0498 0.1946 0.1392 -0.0052 -0.0088 0.0052  128 PRO A C   
1019 O O   . PRO A 128 ? 0.0542 0.1902 0.1436 -0.0042 -0.0080 0.0018  128 PRO A O   
1020 C CB  . PRO A 128 ? 0.1522 0.3045 0.2359 -0.0196 -0.0106 -0.0014 128 PRO A CB  
1021 C CG  . PRO A 128 ? 0.1541 0.3035 0.2396 -0.0263 -0.0098 -0.0078 128 PRO A CG  
1022 C CD  . PRO A 128 ? 0.1190 0.2588 0.2104 -0.0226 -0.0095 -0.0078 128 PRO A CD  
1023 N N   . GLN A 129 ? 0.0518 0.2016 0.1442 -0.0002 -0.0090 0.0110  129 GLN A N   
1024 C CA  . GLN A 129 ? 0.0507 0.1949 0.1461 0.0072  -0.0076 0.0131  129 GLN A CA  
1025 C C   . GLN A 129 ? 0.0488 0.1872 0.1397 0.0066  -0.0088 0.0114  129 GLN A C   
1026 O O   . GLN A 129 ? 0.0526 0.1827 0.1439 0.0114  -0.0072 0.0105  129 GLN A O   
1027 C CB  . GLN A 129 ? 0.0559 0.2066 0.1595 0.0116  -0.0087 0.0196  129 GLN A CB  
1028 C CG  . GLN A 129 ? 0.0563 0.2001 0.1649 0.0190  -0.0076 0.0216  129 GLN A CG  
1029 C CD  . GLN A 129 ? 0.1237 0.2603 0.2346 0.0237  -0.0015 0.0166  129 GLN A CD  
1030 O OE1 . GLN A 129 ? 0.1024 0.2432 0.2155 0.0227  0.0022  0.0139  129 GLN A OE1 
1031 N NE2 . GLN A 129 ? 0.1285 0.2554 0.2377 0.0277  -0.0001 0.0154  129 GLN A NE2 
1032 N N   . GLU A 130 ? 0.0506 0.1948 0.1371 -0.0003 -0.0111 0.0104  130 GLU A N   
1033 C CA  . GLU A 130 ? 0.0495 0.1912 0.1325 -0.0032 -0.0111 0.0068  130 GLU A CA  
1034 C C   . GLU A 130 ? 0.0445 0.1745 0.1296 -0.0018 -0.0086 -0.0004 130 GLU A C   
1035 O O   . GLU A 130 ? 0.0443 0.1658 0.1280 -0.0001 -0.0079 -0.0023 130 GLU A O   
1036 C CB  . GLU A 130 ? 0.0796 0.2306 0.1568 -0.0140 -0.0119 0.0034  130 GLU A CB  
1037 C CG  . GLU A 130 ? 0.1506 0.3145 0.2240 -0.0177 -0.0162 0.0125  130 GLU A CG  
1038 C CD  . GLU A 130 ? 0.2044 0.3751 0.2800 -0.0180 -0.0183 0.0172  130 GLU A CD  
1039 O OE1 . GLU A 130 ? 0.1827 0.3486 0.2642 -0.0126 -0.0164 0.0160  130 GLU A OE1 
1040 O OE2 . GLU A 130 ? 0.2735 0.4554 0.3446 -0.0249 -0.0221 0.0228  130 GLU A OE2 
1041 N N   . ARG A 131 ? 0.0433 0.1694 0.1309 -0.0031 -0.0081 -0.0034 131 ARG A N   
1042 C CA  . ARG A 131 ? 0.0416 0.1545 0.1322 -0.0027 -0.0078 -0.0078 131 ARG A CA  
1043 C C   . ARG A 131 ? 0.0421 0.1452 0.1295 0.0040  -0.0076 -0.0040 131 ARG A C   
1044 O O   . ARG A 131 ? 0.0690 0.1598 0.1562 0.0051  -0.0082 -0.0057 131 ARG A O   
1045 C CB  . ARG A 131 ? 0.0419 0.1535 0.1376 -0.0073 -0.0089 -0.0102 131 ARG A CB  
1046 C CG  . ARG A 131 ? 0.1141 0.2300 0.2113 -0.0144 -0.0080 -0.0151 131 ARG A CG  
1047 C CD  . ARG A 131 ? 0.1523 0.2575 0.2560 -0.0178 -0.0067 -0.0230 131 ARG A CD  
1048 N NE  . ARG A 131 ? 0.1391 0.2404 0.2421 -0.0154 -0.0050 -0.0254 131 ARG A NE  
1049 C CZ  . ARG A 131 ? 0.1059 0.2150 0.2031 -0.0185 -0.0024 -0.0283 131 ARG A CZ  
1050 N NH1 . ARG A 131 ? 0.0992 0.2049 0.1966 -0.0170 -0.0010 -0.0302 131 ARG A NH1 
1051 N NH2 . ARG A 131 ? 0.1218 0.2425 0.2121 -0.0242 -0.0018 -0.0285 131 ARG A NH2 
1052 N N   . ILE A 132 ? 0.0541 0.1630 0.1405 0.0080  -0.0062 0.0005  132 ILE A N   
1053 C CA  . ILE A 132 ? 0.0536 0.1540 0.1371 0.0134  -0.0041 0.0019  132 ILE A CA  
1054 C C   . ILE A 132 ? 0.0738 0.1704 0.1573 0.0179  -0.0040 0.0034  132 ILE A C   
1055 O O   . ILE A 132 ? 0.0616 0.1461 0.1417 0.0200  -0.0035 0.0021  132 ILE A O   
1056 C CB  . ILE A 132 ? 0.0563 0.1650 0.1427 0.0161  -0.0005 0.0040  132 ILE A CB  
1057 C CG1 . ILE A 132 ? 0.0760 0.1887 0.1610 0.0103  -0.0004 0.0031  132 ILE A CG1 
1058 C CG2 . ILE A 132 ? 0.1023 0.2019 0.1863 0.0205  0.0037  0.0027  132 ILE A CG2 
1059 C CD1 . ILE A 132 ? 0.0730 0.1729 0.1512 0.0051  -0.0028 0.0015  132 ILE A CD1 
1060 N N   . ASP A 133 ? 0.0687 0.1758 0.1554 0.0182  -0.0054 0.0070  133 ASP A N   
1061 C CA  . ASP A 133 ? 0.0781 0.1824 0.1644 0.0203  -0.0065 0.0098  133 ASP A CA  
1062 C C   . ASP A 133 ? 0.0469 0.1406 0.1281 0.0172  -0.0067 0.0048  133 ASP A C   
1063 O O   . ASP A 133 ? 0.0529 0.1377 0.1326 0.0202  -0.0065 0.0057  133 ASP A O   
1064 C CB  . ASP A 133 ? 0.0607 0.1798 0.1494 0.0172  -0.0098 0.0159  133 ASP A CB  
1065 C CG  . ASP A 133 ? 0.1303 0.2549 0.2258 0.0206  -0.0104 0.0215  133 ASP A CG  
1066 O OD1 . ASP A 133 ? 0.1354 0.2540 0.2360 0.0266  -0.0070 0.0202  133 ASP A OD1 
1067 O OD2 . ASP A 133 ? 0.1521 0.2874 0.2481 0.0162  -0.0141 0.0265  133 ASP A OD2 
1068 N N   . ALA A 134 ? 0.0448 0.1393 0.1261 0.0112  -0.0068 -0.0009 134 ALA A N   
1069 C CA  . ALA A 134 ? 0.0444 0.1301 0.1267 0.0083  -0.0063 -0.0067 134 ALA A CA  
1070 C C   . ALA A 134 ? 0.0571 0.1280 0.1398 0.0121  -0.0071 -0.0068 134 ALA A C   
1071 O O   . ALA A 134 ? 0.0465 0.1092 0.1303 0.0122  -0.0072 -0.0088 134 ALA A O   
1072 C CB  . ALA A 134 ? 0.0697 0.1591 0.1575 0.0017  -0.0055 -0.0135 134 ALA A CB  
1073 N N   . ILE A 135 ? 0.0489 0.1171 0.1298 0.0139  -0.0076 -0.0046 135 ILE A N   
1074 C CA  . ILE A 135 ? 0.0706 0.1263 0.1482 0.0150  -0.0089 -0.0040 135 ILE A CA  
1075 C C   . ILE A 135 ? 0.0530 0.1036 0.1258 0.0200  -0.0067 -0.0022 135 ILE A C   
1076 O O   . ILE A 135 ? 0.0625 0.1028 0.1336 0.0202  -0.0078 -0.0029 135 ILE A O   
1077 C CB  . ILE A 135 ? 0.0615 0.1170 0.1360 0.0123  -0.0096 -0.0026 135 ILE A CB  
1078 C CG1 . ILE A 135 ? 0.0797 0.1380 0.1614 0.0070  -0.0127 -0.0036 135 ILE A CG1 
1079 C CG2 . ILE A 135 ? 0.0706 0.1146 0.1380 0.0104  -0.0112 -0.0015 135 ILE A CG2 
1080 C CD1 . ILE A 135 ? 0.1014 0.1612 0.1797 0.0029  -0.0140 -0.0009 135 ILE A CD1 
1081 N N   . THR A 136 ? 0.0703 0.1278 0.1436 0.0240  -0.0039 0.0002  136 THR A N   
1082 C CA  . THR A 136 ? 0.1138 0.1650 0.1867 0.0290  -0.0017 0.0014  136 THR A CA  
1083 C C   . THR A 136 ? 0.0582 0.1064 0.1319 0.0296  -0.0035 0.0031  136 THR A C   
1084 O O   . THR A 136 ? 0.0670 0.1046 0.1387 0.0313  -0.0030 0.0026  136 THR A O   
1085 C CB  . THR A 136 ? 0.1601 0.2190 0.2394 0.0338  0.0018  0.0037  136 THR A CB  
1086 O OG1 . THR A 136 ? 0.1599 0.2320 0.2452 0.0336  -0.0007 0.0084  136 THR A OG1 
1087 C CG2 . THR A 136 ? 0.1979 0.2597 0.2754 0.0320  0.0052  0.0006  136 THR A CG2 
1088 N N   . GLU A 137 ? 0.0600 0.1178 0.1357 0.0265  -0.0052 0.0044  137 GLU A N   
1089 C CA  . GLU A 137 ? 0.0710 0.1276 0.1456 0.0240  -0.0063 0.0049  137 GLU A CA  
1090 C C   . GLU A 137 ? 0.0631 0.1081 0.1369 0.0224  -0.0064 0.0000  137 GLU A C   
1091 O O   . GLU A 137 ? 0.0700 0.1082 0.1426 0.0233  -0.0064 0.0010  137 GLU A O   
1092 C CB  . GLU A 137 ? 0.0586 0.1285 0.1328 0.0175  -0.0068 0.0044  137 GLU A CB  
1093 C CG  . GLU A 137 ? 0.0657 0.1487 0.1409 0.0174  -0.0089 0.0121  137 GLU A CG  
1094 C CD  . GLU A 137 ? 0.1195 0.2168 0.1917 0.0086  -0.0095 0.0104  137 GLU A CD  
1095 O OE1 . GLU A 137 ? 0.1557 0.2523 0.2263 0.0027  -0.0068 0.0018  137 GLU A OE1 
1096 O OE2 . GLU A 137 ? 0.1564 0.2660 0.2294 0.0069  -0.0124 0.0172  137 GLU A OE2 
1097 N N   . ALA A 138 ? 0.0517 0.0948 0.1282 0.0197  -0.0072 -0.0042 138 ALA A N   
1098 C CA  . ALA A 138 ? 0.0546 0.0873 0.1344 0.0179  -0.0090 -0.0071 138 ALA A CA  
1099 C C   . ALA A 138 ? 0.0573 0.0785 0.1312 0.0205  -0.0100 -0.0049 138 ALA A C   
1100 O O   . ALA A 138 ? 0.0640 0.0779 0.1391 0.0199  -0.0112 -0.0055 138 ALA A O   
1101 C CB  . ALA A 138 ? 0.0587 0.0911 0.1458 0.0145  -0.0115 -0.0095 138 ALA A CB  
1102 N N   . TYR A 139 ? 0.0612 0.0813 0.1292 0.0223  -0.0090 -0.0034 139 TYR A N   
1103 C CA  . TYR A 139 ? 0.0692 0.0789 0.1303 0.0229  -0.0084 -0.0036 139 TYR A CA  
1104 C C   . TYR A 139 ? 0.0718 0.0777 0.1335 0.0271  -0.0061 -0.0026 139 TYR A C   
1105 O O   . TYR A 139 ? 0.0771 0.0727 0.1356 0.0263  -0.0068 -0.0034 139 TYR A O   
1106 C CB  . TYR A 139 ? 0.0806 0.0918 0.1359 0.0229  -0.0051 -0.0045 139 TYR A CB  
1107 C CG  . TYR A 139 ? 0.0759 0.0895 0.1279 0.0171  -0.0077 -0.0042 139 TYR A CG  
1108 C CD1 . TYR A 139 ? 0.0856 0.0975 0.1421 0.0123  -0.0141 -0.0024 139 TYR A CD1 
1109 C CD2 . TYR A 139 ? 0.0980 0.1157 0.1447 0.0157  -0.0036 -0.0056 139 TYR A CD2 
1110 C CE1 . TYR A 139 ? 0.0889 0.1023 0.1441 0.0063  -0.0178 -0.0002 139 TYR A CE1 
1111 C CE2 . TYR A 139 ? 0.0908 0.1110 0.1331 0.0087  -0.0064 -0.0042 139 TYR A CE2 
1112 C CZ  . TYR A 139 ? 0.0949 0.1124 0.1411 0.0039  -0.0143 -0.0006 139 TYR A CZ  
1113 O OH  . TYR A 139 ? 0.1027 0.1224 0.1462 -0.0036 -0.0183 0.0027  139 TYR A OH  
1114 N N   . ASP A 140 ? 0.0802 0.0943 0.1462 0.0307  -0.0044 0.0003  140 ASP A N   
1115 C CA  . ASP A 140 ? 0.0735 0.0842 0.1419 0.0338  -0.0038 0.0035  140 ASP A CA  
1116 C C   . ASP A 140 ? 0.0889 0.0953 0.1563 0.0303  -0.0060 0.0032  140 ASP A C   
1117 O O   . ASP A 140 ? 0.0952 0.0923 0.1617 0.0312  -0.0059 0.0038  140 ASP A O   
1118 C CB  . ASP A 140 ? 0.0726 0.0947 0.1472 0.0363  -0.0040 0.0095  140 ASP A CB  
1119 C CG  . ASP A 140 ? 0.1193 0.1456 0.2003 0.0412  -0.0012 0.0103  140 ASP A CG  
1120 O OD1 . ASP A 140 ? 0.0801 0.0988 0.1607 0.0433  0.0028  0.0057  140 ASP A OD1 
1121 O OD2 . ASP A 140 ? 0.1058 0.1444 0.1925 0.0417  -0.0028 0.0153  140 ASP A OD2 
1122 N N   . PHE A 141 ? 0.0665 0.0803 0.1359 0.0261  -0.0070 0.0014  141 PHE A N   
1123 C CA  . PHE A 141 ? 0.0678 0.0797 0.1394 0.0222  -0.0075 -0.0006 141 PHE A CA  
1124 C C   . PHE A 141 ? 0.0679 0.0674 0.1399 0.0216  -0.0095 -0.0029 141 PHE A C   
1125 O O   . PHE A 141 ? 0.0714 0.0647 0.1434 0.0208  -0.0097 -0.0023 141 PHE A O   
1126 C CB  . PHE A 141 ? 0.0602 0.0820 0.1371 0.0171  -0.0065 -0.0052 141 PHE A CB  
1127 C CG  . PHE A 141 ? 0.0755 0.1105 0.1498 0.0137  -0.0047 -0.0036 141 PHE A CG  
1128 C CD1 . PHE A 141 ? 0.1428 0.1802 0.2127 0.0114  -0.0047 0.0012  141 PHE A CD1 
1129 C CD2 . PHE A 141 ? 0.0698 0.1152 0.1454 0.0111  -0.0038 -0.0061 141 PHE A CD2 
1130 C CE1 . PHE A 141 ? 0.1479 0.1987 0.2134 0.0055  -0.0044 0.0042  141 PHE A CE1 
1131 C CE2 . PHE A 141 ? 0.0815 0.1400 0.1528 0.0057  -0.0029 -0.0045 141 PHE A CE2 
1132 C CZ  . PHE A 141 ? 0.1133 0.1749 0.1788 0.0023  -0.0035 0.0010  141 PHE A CZ  
1133 N N   . VAL A 142 ? 0.0878 0.0842 0.1595 0.0210  -0.0116 -0.0043 142 VAL A N   
1134 C CA  . VAL A 142 ? 0.0709 0.0575 0.1432 0.0180  -0.0155 -0.0048 142 VAL A CA  
1135 C C   . VAL A 142 ? 0.1038 0.0800 0.1665 0.0192  -0.0147 -0.0040 142 VAL A C   
1136 O O   . VAL A 142 ? 0.0841 0.0527 0.1470 0.0169  -0.0168 -0.0040 142 VAL A O   
1137 C CB  . VAL A 142 ? 0.0705 0.0573 0.1445 0.0147  -0.0197 -0.0044 142 VAL A CB  
1138 C CG1 . VAL A 142 ? 0.0899 0.0673 0.1639 0.0098  -0.0259 -0.0024 142 VAL A CG1 
1139 C CG2 . VAL A 142 ? 0.0625 0.0577 0.1497 0.0135  -0.0202 -0.0063 142 VAL A CG2 
1140 N N   . GLU A 143 ? 0.1033 0.0795 0.1600 0.0226  -0.0108 -0.0040 143 GLU A N   
1141 C CA  . GLU A 143 ? 0.1006 0.0666 0.1512 0.0237  -0.0081 -0.0055 143 GLU A CA  
1142 C C   . GLU A 143 ? 0.0966 0.0578 0.1509 0.0251  -0.0082 -0.0036 143 GLU A C   
1143 O O   . GLU A 143 ? 0.1261 0.0765 0.1766 0.0232  -0.0084 -0.0052 143 GLU A O   
1144 C CB  . GLU A 143 ? 0.1001 0.0693 0.1511 0.0284  -0.0025 -0.0066 143 GLU A CB  
1145 C CG  . GLU A 143 ? 0.1126 0.0712 0.1617 0.0299  0.0023  -0.0104 143 GLU A CG  
1146 C CD  . GLU A 143 ? 0.1225 0.0735 0.1591 0.0228  0.0037  -0.0165 143 GLU A CD  
1147 O OE1 . GLU A 143 ? 0.1216 0.0769 0.1517 0.0171  0.0001  -0.0159 143 GLU A OE1 
1148 O OE2 . GLU A 143 ? 0.1350 0.0760 0.1686 0.0217  0.0082  -0.0218 143 GLU A OE2 
1149 N N   . ALA A 144 ? 0.1063 0.0760 0.1667 0.0268  -0.0082 -0.0003 144 ALA A N   
1150 C CA  . ALA A 144 ? 0.1197 0.0872 0.1827 0.0265  -0.0085 0.0028  144 ALA A CA  
1151 C C   . ALA A 144 ? 0.1227 0.0873 0.1874 0.0216  -0.0108 0.0010  144 ALA A C   
1152 O O   . ALA A 144 ? 0.1713 0.1313 0.2366 0.0204  -0.0108 0.0030  144 ALA A O   
1153 C CB  . ALA A 144 ? 0.1273 0.1064 0.1936 0.0271  -0.0080 0.0076  144 ALA A CB  
1154 N N   . PHE A 145 ? 0.1024 0.0702 0.1707 0.0186  -0.0131 -0.0020 145 PHE A N   
1155 C CA  . PHE A 145 ? 0.1398 0.1057 0.2152 0.0144  -0.0157 -0.0035 145 PHE A CA  
1156 C C   . PHE A 145 ? 0.1538 0.1070 0.2243 0.0126  -0.0183 -0.0029 145 PHE A C   
1157 O O   . PHE A 145 ? 0.1498 0.1013 0.2243 0.0096  -0.0192 -0.0028 145 PHE A O   
1158 C CB  . PHE A 145 ? 0.0861 0.0559 0.1704 0.0121  -0.0191 -0.0055 145 PHE A CB  
1159 C CG  . PHE A 145 ? 0.1166 0.0985 0.2091 0.0122  -0.0162 -0.0082 145 PHE A CG  
1160 C CD1 . PHE A 145 ? 0.1030 0.0934 0.1941 0.0119  -0.0111 -0.0092 145 PHE A CD1 
1161 C CD2 . PHE A 145 ? 0.1099 0.0947 0.2116 0.0110  -0.0190 -0.0096 145 PHE A CD2 
1162 C CE1 . PHE A 145 ? 0.1143 0.1161 0.2112 0.0099  -0.0079 -0.0131 145 PHE A CE1 
1163 C CE2 . PHE A 145 ? 0.0768 0.0718 0.1870 0.0103  -0.0157 -0.0136 145 PHE A CE2 
1164 C CZ  . PHE A 145 ? 0.0711 0.0749 0.1782 0.0095  -0.0096 -0.0163 145 PHE A CZ  
1165 N N   . PHE A 146 ? 0.1441 0.0902 0.2051 0.0127  -0.0190 -0.0034 146 PHE A N   
1176 N N   . LYS A 147 ? 0.2656 0.1575 0.3133 0.0671  -0.0446 -0.0046 147 LYS A N   
1177 C CA  . LYS A 147 ? 0.2913 0.1466 0.3312 0.0682  -0.0438 0.0020  147 LYS A CA  
1178 C C   . LYS A 147 ? 0.3096 0.1526 0.3539 0.0589  -0.0428 -0.0097 147 LYS A C   
1179 O O   . LYS A 147 ? 0.3208 0.1750 0.3674 0.0640  -0.0422 -0.0220 147 LYS A O   
1180 C CB  . LYS A 147 ? 0.3213 0.1546 0.3514 0.0619  -0.0403 0.0197  147 LYS A CB  
1181 C CG  . LYS A 147 ? 0.3848 0.2210 0.4011 0.0747  -0.0415 0.0330  147 LYS A CG  
1182 C CD  . LYS A 147 ? 0.4124 0.2604 0.4217 0.0691  -0.0384 0.0422  147 LYS A CD  
1183 C CE  . LYS A 147 ? 0.4551 0.2739 0.4542 0.0595  -0.0268 0.0608  147 LYS A CE  
1184 N NZ  . LYS A 147 ? 0.4669 0.2978 0.4585 0.0526  -0.0209 0.0688  147 LYS A NZ  
1185 N N   . ASP A 148 ? 0.2761 0.0979 0.3214 0.0442  -0.0421 -0.0053 148 ASP A N   
1186 C CA  . ASP A 148 ? 0.3220 0.1332 0.3703 0.0337  -0.0444 -0.0176 148 ASP A CA  
1187 C C   . ASP A 148 ? 0.2940 0.1308 0.3537 0.0217  -0.0471 -0.0249 148 ASP A C   
1188 O O   . ASP A 148 ? 0.3293 0.1621 0.3892 0.0137  -0.0511 -0.0355 148 ASP A O   
1189 C CB  . ASP A 148 ? 0.4176 0.1919 0.4639 0.0225  -0.0432 -0.0108 148 ASP A CB  
1190 C CG  . ASP A 148 ? 0.4977 0.2726 0.5540 0.0076  -0.0389 0.0051  148 ASP A CG  
1191 O OD1 . ASP A 148 ? 0.4866 0.2820 0.5439 0.0121  -0.0359 0.0146  148 ASP A OD1 
1192 O OD2 . ASP A 148 ? 0.5715 0.3268 0.6347 -0.0088 -0.0371 0.0083  148 ASP A OD2 
1193 N N   . GLN A 149 ? 0.2542 0.1161 0.3208 0.0220  -0.0450 -0.0194 149 GLN A N   
1194 C CA  . GLN A 149 ? 0.2175 0.1026 0.2952 0.0124  -0.0460 -0.0244 149 GLN A CA  
1195 C C   . GLN A 149 ? 0.1737 0.0815 0.2441 0.0216  -0.0443 -0.0369 149 GLN A C   
1196 O O   . GLN A 149 ? 0.2320 0.1458 0.2955 0.0334  -0.0407 -0.0388 149 GLN A O   
1197 C CB  . GLN A 149 ? 0.2309 0.1265 0.3195 0.0066  -0.0412 -0.0095 149 GLN A CB  
1198 C CG  . GLN A 149 ? 0.2802 0.1583 0.3780 -0.0074 -0.0374 0.0059  149 GLN A CG  
1199 C CD  . GLN A 149 ? 0.2731 0.1673 0.3746 -0.0116 -0.0257 0.0244  149 GLN A CD  
1200 O OE1 . GLN A 149 ? 0.2374 0.1482 0.3236 -0.0002 -0.0216 0.0271  149 GLN A OE1 
1201 N NE2 . GLN A 149 ? 0.2739 0.1661 0.3945 -0.0279 -0.0189 0.0364  149 GLN A NE2 
1202 N N   . THR A 150 ? 0.1860 0.1082 0.2585 0.0155  -0.0455 -0.0437 150 THR A N   
1203 C CA  . THR A 150 ? 0.2031 0.1412 0.2632 0.0230  -0.0406 -0.0525 150 THR A CA  
1204 C C   . THR A 150 ? 0.1320 0.0955 0.1948 0.0240  -0.0339 -0.0499 150 THR A C   
1205 O O   . THR A 150 ? 0.1612 0.1368 0.2132 0.0276  -0.0267 -0.0527 150 THR A O   
1206 C CB  . THR A 150 ? 0.2296 0.1621 0.2798 0.0196  -0.0456 -0.0612 150 THR A CB  
1207 O OG1 . THR A 150 ? 0.2432 0.1789 0.3073 0.0075  -0.0534 -0.0588 150 THR A OG1 
1208 C CG2 . THR A 150 ? 0.2541 0.1603 0.2928 0.0220  -0.0489 -0.0671 150 THR A CG2 
1209 N N   . TYR A 151 ? 0.1052 0.0727 0.1807 0.0195  -0.0343 -0.0425 151 TYR A N   
1210 C CA  . TYR A 151 ? 0.0754 0.0661 0.1484 0.0209  -0.0259 -0.0383 151 TYR A CA  
1211 C C   . TYR A 151 ? 0.0737 0.0665 0.1461 0.0239  -0.0237 -0.0273 151 TYR A C   
1212 O O   . TYR A 151 ? 0.1339 0.1099 0.2074 0.0255  -0.0281 -0.0208 151 TYR A O   
1213 C CB  . TYR A 151 ? 0.0657 0.0704 0.1409 0.0128  -0.0242 -0.0339 151 TYR A CB  
1214 C CG  . TYR A 151 ? 0.0727 0.0752 0.1425 0.0131  -0.0298 -0.0462 151 TYR A CG  
1215 C CD1 . TYR A 151 ? 0.0673 0.0766 0.1200 0.0204  -0.0230 -0.0519 151 TYR A CD1 
1216 C CD2 . TYR A 151 ? 0.0947 0.0861 0.1729 0.0053  -0.0420 -0.0500 151 TYR A CD2 
1217 C CE1 . TYR A 151 ? 0.0900 0.0951 0.1287 0.0225  -0.0270 -0.0571 151 TYR A CE1 
1218 C CE2 . TYR A 151 ? 0.1534 0.1419 0.2183 0.0080  -0.0480 -0.0587 151 TYR A CE2 
1219 C CZ  . TYR A 151 ? 0.1150 0.1092 0.1586 0.0182  -0.0408 -0.0625 151 TYR A CZ  
1220 O OH  . TYR A 151 ? 0.1306 0.1183 0.1565 0.0220  -0.0465 -0.0683 151 TYR A OH  
1221 N N   . VAL A 152 ? 0.0584 0.0674 0.1249 0.0260  -0.0177 -0.0259 152 VAL A N   
1222 C CA  . VAL A 152 ? 0.0639 0.0723 0.1238 0.0307  -0.0192 -0.0183 152 VAL A CA  
1223 C C   . VAL A 152 ? 0.0815 0.0824 0.1329 0.0269  -0.0158 -0.0021 152 VAL A C   
1224 O O   . VAL A 152 ? 0.0933 0.0835 0.1330 0.0326  -0.0185 0.0063  152 VAL A O   
1225 C CB  . VAL A 152 ? 0.0537 0.0755 0.1048 0.0307  -0.0151 -0.0223 152 VAL A CB  
1226 C CG1 . VAL A 152 ? 0.0582 0.0830 0.1108 0.0278  -0.0134 -0.0307 152 VAL A CG1 
1227 C CG2 . VAL A 152 ? 0.0604 0.0899 0.1039 0.0266  -0.0064 -0.0197 152 VAL A CG2 
1228 N N   . ALA A 153 ? 0.0696 0.0767 0.1262 0.0187  -0.0092 0.0030  153 ALA A N   
1229 C CA  . ALA A 153 ? 0.0804 0.0857 0.1329 0.0154  -0.0004 0.0195  153 ALA A CA  
1230 C C   . ALA A 153 ? 0.1215 0.1264 0.1970 0.0040  0.0006  0.0250  153 ALA A C   
1231 O O   . ALA A 153 ? 0.1543 0.1744 0.2413 -0.0016 0.0086  0.0322  153 ALA A O   
1232 C CB  . ALA A 153 ? 0.0821 0.1016 0.1215 0.0183  0.0096  0.0220  153 ALA A CB  
1233 N N   . GLY A 154 ? 0.0981 0.0859 0.1826 0.0007  -0.0083 0.0204  154 GLY A N   
1234 C CA  . GLY A 154 ? 0.1473 0.1298 0.2557 -0.0128 -0.0106 0.0234  154 GLY A CA  
1235 C C   . GLY A 154 ? 0.1096 0.0896 0.2268 -0.0163 -0.0239 0.0053  154 GLY A C   
1236 O O   . GLY A 154 ? 0.1137 0.0889 0.2165 -0.0063 -0.0290 -0.0079 154 GLY A O   
1237 N N   . ASN A 155 ? 0.1161 0.0986 0.2569 -0.0300 -0.0296 0.0042  155 ASN A N   
1238 C CA  . ASN A 155 ? 0.1271 0.0996 0.2694 -0.0329 -0.0450 -0.0138 155 ASN A CA  
1239 C C   . ASN A 155 ? 0.1117 0.1082 0.2485 -0.0287 -0.0493 -0.0236 155 ASN A C   
1240 O O   . ASN A 155 ? 0.1688 0.1566 0.2928 -0.0260 -0.0592 -0.0368 155 ASN A O   
1241 C CB  . ASN A 155 ? 0.2566 0.2151 0.4116 -0.0453 -0.0494 -0.0113 155 ASN A CB  
1242 C CG  . ASN A 155 ? 0.2868 0.2682 0.4683 -0.0575 -0.0422 0.0022  155 ASN A CG  
1243 O OD1 . ASN A 155 ? 0.2949 0.3056 0.4835 -0.0561 -0.0412 0.0022  155 ASN A OD1 
1244 N ND2 . ASN A 155 ? 0.3375 0.3044 0.5312 -0.0676 -0.0352 0.0141  155 ASN A ND2 
1245 N N   . GLN A 156 ? 0.0876 0.1107 0.2288 -0.0261 -0.0403 -0.0155 156 GLN A N   
1246 C CA  . GLN A 156 ? 0.0773 0.1185 0.2067 -0.0188 -0.0418 -0.0220 156 GLN A CA  
1247 C C   . GLN A 156 ? 0.0571 0.1055 0.1669 -0.0065 -0.0309 -0.0221 156 GLN A C   
1248 O O   . GLN A 156 ? 0.0504 0.0974 0.1551 -0.0042 -0.0197 -0.0125 156 GLN A O   
1249 C CB  . GLN A 156 ? 0.0880 0.1536 0.2347 -0.0241 -0.0387 -0.0120 156 GLN A CB  
1250 C CG  . GLN A 156 ? 0.2047 0.2689 0.3750 -0.0375 -0.0463 -0.0105 156 GLN A CG  
1251 C CD  . GLN A 156 ? 0.2619 0.3558 0.4504 -0.0399 -0.0444 -0.0045 156 GLN A CD  
1252 O OE1 . GLN A 156 ? 0.2633 0.3742 0.4405 -0.0297 -0.0430 -0.0055 156 GLN A OE1 
1253 N NE2 . GLN A 156 ? 0.3025 0.4030 0.5199 -0.0524 -0.0433 0.0024  156 GLN A NE2 
1254 N N   . LEU A 157 ? 0.0626 0.1151 0.1553 0.0020  -0.0330 -0.0317 157 LEU A N   
1255 C CA  . LEU A 157 ? 0.0436 0.0988 0.1138 0.0125  -0.0203 -0.0318 157 LEU A CA  
1256 C C   . LEU A 157 ? 0.0334 0.1017 0.1057 0.0123  -0.0086 -0.0170 157 LEU A C   
1257 O O   . LEU A 157 ? 0.0347 0.1173 0.1212 0.0094  -0.0102 -0.0093 157 LEU A O   
1258 C CB  . LEU A 157 ? 0.0527 0.1071 0.1042 0.0208  -0.0242 -0.0413 157 LEU A CB  
1259 C CG  . LEU A 157 ? 0.0607 0.1098 0.0859 0.0280  -0.0095 -0.0390 157 LEU A CG  
1260 C CD1 . LEU A 157 ? 0.0591 0.0901 0.0738 0.0232  -0.0029 -0.0355 157 LEU A CD1 
1261 C CD2 . LEU A 157 ? 0.0862 0.1333 0.0924 0.0365  -0.0134 -0.0427 157 LEU A CD2 
1262 N N   . THR A 158 ? 0.0293 0.0893 0.0857 0.0150  0.0022  -0.0121 158 THR A N   
1269 N N   . ILE A 159 ? 0.0623 0.0575 0.0554 0.0159  -0.0105 0.0002  159 ILE A N   
1270 C CA  . ILE A 159 ? 0.0607 0.0581 0.0543 0.0170  -0.0109 -0.0015 159 ILE A CA  
1271 C C   . ILE A 159 ? 0.0523 0.0561 0.0469 0.0180  -0.0101 -0.0010 159 ILE A C   
1272 O O   . ILE A 159 ? 0.0499 0.0564 0.0449 0.0189  -0.0102 -0.0023 159 ILE A O   
1273 C CB  . ILE A 159 ? 0.0638 0.0633 0.0607 0.0172  -0.0121 -0.0041 159 ILE A CB  
1274 C CG1 . ILE A 159 ? 0.0483 0.0551 0.0468 0.0172  -0.0122 -0.0046 159 ILE A CG1 
1275 C CG2 . ILE A 159 ? 0.0732 0.0663 0.0709 0.0160  -0.0129 -0.0033 159 ILE A CG2 
1276 C CD1 . ILE A 159 ? 0.0310 0.0430 0.0348 0.0168  -0.0122 -0.0099 159 ILE A CD1 
1277 N N   . ALA A 160 ? 0.0354 0.0427 0.0319 0.0176  -0.0098 0.0015  160 ALA A N   
1278 C CA  . ALA A 160 ? 0.0397 0.0532 0.0388 0.0182  -0.0095 0.0033  160 ALA A CA  
1279 C C   . ALA A 160 ? 0.0381 0.0483 0.0375 0.0202  -0.0082 0.0034  160 ALA A C   
1280 O O   . ALA A 160 ? 0.0368 0.0525 0.0383 0.0210  -0.0077 0.0038  160 ALA A O   
1281 C CB  . ALA A 160 ? 0.0609 0.0776 0.0633 0.0170  -0.0103 0.0071  160 ALA A CB  
1282 N N   . ASP A 161 ? 0.0430 0.0456 0.0405 0.0209  -0.0075 0.0026  161 ASP A N   
1283 C CA  . ASP A 161 ? 0.0533 0.0532 0.0500 0.0233  -0.0058 0.0012  161 ASP A CA  
1284 C C   . ASP A 161 ? 0.0646 0.0652 0.0578 0.0229  -0.0055 -0.0007 161 ASP A C   
1285 O O   . ASP A 161 ? 0.0462 0.0502 0.0410 0.0230  -0.0033 -0.0013 161 ASP A O   
1286 C CB  . ASP A 161 ? 0.0705 0.0627 0.0647 0.0239  -0.0051 -0.0004 161 ASP A CB  
1287 C CG  . ASP A 161 ? 0.0782 0.0698 0.0785 0.0236  -0.0051 0.0015  161 ASP A CG  
1288 O OD1 . ASP A 161 ? 0.0566 0.0499 0.0645 0.0253  -0.0037 0.0025  161 ASP A OD1 
1289 O OD2 . ASP A 161 ? 0.0613 0.0510 0.0602 0.0217  -0.0066 0.0025  161 ASP A OD2 
1290 N N   . PHE A 162 ? 0.0625 0.0600 0.0524 0.0208  -0.0072 -0.0013 162 PHE A N   
1291 C CA  . PHE A 162 ? 0.0680 0.0654 0.0567 0.0183  -0.0069 -0.0021 162 PHE A CA  
1292 C C   . PHE A 162 ? 0.0389 0.0439 0.0317 0.0177  -0.0064 -0.0027 162 PHE A C   
1293 O O   . PHE A 162 ? 0.0620 0.0690 0.0550 0.0163  -0.0050 -0.0030 162 PHE A O   
1294 C CB  . PHE A 162 ? 0.0533 0.0463 0.0416 0.0166  -0.0093 -0.0018 162 PHE A CB  
1295 C CG  . PHE A 162 ? 0.0554 0.0423 0.0395 0.0161  -0.0106 -0.0004 162 PHE A CG  
1296 C CD1 . PHE A 162 ? 0.0533 0.0383 0.0323 0.0153  -0.0092 -0.0006 162 PHE A CD1 
1297 C CD2 . PHE A 162 ? 0.0589 0.0427 0.0447 0.0157  -0.0131 0.0006  162 PHE A CD2 
1298 C CE1 . PHE A 162 ? 0.0723 0.0532 0.0467 0.0137  -0.0105 0.0001  162 PHE A CE1 
1299 C CE2 . PHE A 162 ? 0.0813 0.0616 0.0641 0.0139  -0.0143 0.0022  162 PHE A CE2 
1300 C CZ  . PHE A 162 ? 0.0744 0.0527 0.0501 0.0131  -0.0138 0.0022  162 PHE A CZ  
1301 N N   . SER A 163 ? 0.0576 0.0680 0.0532 0.0181  -0.0074 -0.0029 163 SER A N   
1302 C CA  . SER A 163 ? 0.0688 0.0884 0.0676 0.0166  -0.0071 -0.0039 163 SER A CA  
1303 C C   . SER A 163 ? 0.0392 0.0640 0.0402 0.0178  -0.0057 -0.0017 163 SER A C   
1304 O O   . SER A 163 ? 0.0405 0.0690 0.0429 0.0161  -0.0046 -0.0025 163 SER A O   
1305 C CB  . SER A 163 ? 0.0571 0.0842 0.0575 0.0159  -0.0084 -0.0043 163 SER A CB  
1306 O OG  . SER A 163 ? 0.0649 0.1020 0.0673 0.0129  -0.0082 -0.0063 163 SER A OG  
1307 N N   . LEU A 164 ? 0.0409 0.0663 0.0441 0.0208  -0.0056 0.0012  164 LEU A N   
1308 C CA  . LEU A 164 ? 0.0452 0.0765 0.0539 0.0226  -0.0042 0.0035  164 LEU A CA  
1309 C C   . LEU A 164 ? 0.0479 0.0750 0.0555 0.0228  -0.0012 0.0013  164 LEU A C   
1310 O O   . LEU A 164 ? 0.0371 0.0707 0.0490 0.0229  0.0004  0.0018  164 LEU A O   
1311 C CB  . LEU A 164 ? 0.0351 0.0654 0.0486 0.0241  -0.0047 0.0071  164 LEU A CB  
1312 C CG  . LEU A 164 ? 0.0372 0.0749 0.0521 0.0212  -0.0070 0.0102  164 LEU A CG  
1313 C CD1 . LEU A 164 ? 0.0739 0.1078 0.0914 0.0211  -0.0083 0.0131  164 LEU A CD1 
1314 C CD2 . LEU A 164 ? 0.0654 0.1132 0.0848 0.0201  -0.0072 0.0124  164 LEU A CD2 
1315 N N   . ILE A 165 ? 0.0555 0.0736 0.0576 0.0225  -0.0002 -0.0009 165 ILE A N   
1316 C CA  . ILE A 165 ? 0.0522 0.0690 0.0525 0.0216  0.0031  -0.0030 165 ILE A CA  
1317 C C   . ILE A 165 ? 0.0439 0.0642 0.0425 0.0180  0.0030  -0.0031 165 ILE A C   
1318 O O   . ILE A 165 ? 0.0557 0.0805 0.0559 0.0171  0.0057  -0.0037 165 ILE A O   
1319 C CB  . ILE A 165 ? 0.0658 0.0745 0.0595 0.0207  0.0040  -0.0053 165 ILE A CB  
1320 C CG1 . ILE A 165 ? 0.0638 0.0740 0.0557 0.0193  0.0082  -0.0081 165 ILE A CG1 
1321 C CG2 . ILE A 165 ? 0.0647 0.0684 0.0519 0.0173  0.0011  -0.0044 165 ILE A CG2 
1322 C CD1 . ILE A 165 ? 0.0838 0.0982 0.0846 0.0230  0.0118  -0.0099 165 ILE A CD1 
1323 N N   . SER A 166 ? 0.0469 0.0653 0.0436 0.0157  0.0003  -0.0029 166 SER A N   
1324 C CA  . SER A 166 ? 0.0838 0.1039 0.0808 0.0120  0.0001  -0.0031 166 SER A CA  
1325 C C   . SER A 166 ? 0.0495 0.0795 0.0517 0.0117  0.0012  -0.0030 166 SER A C   
1326 O O   . SER A 166 ? 0.0533 0.0862 0.0562 0.0092  0.0027  -0.0028 166 SER A O   
1327 C CB  . SER A 166 ? 0.0423 0.0584 0.0399 0.0103  -0.0027 -0.0039 166 SER A CB  
1328 O OG  . SER A 166 ? 0.0413 0.0632 0.0422 0.0107  -0.0036 -0.0054 166 SER A OG  
1329 N N   . SER A 167 ? 0.0681 0.1044 0.0743 0.0136  0.0001  -0.0023 167 SER A N   
1330 C CA  . SER A 167 ? 0.0365 0.0841 0.0483 0.0129  0.0005  -0.0011 167 SER A CA  
1331 C C   . SER A 167 ? 0.0371 0.0890 0.0540 0.0161  0.0031  0.0008  167 SER A C   
1332 O O   . SER A 167 ? 0.0428 0.1014 0.0633 0.0148  0.0046  0.0011  167 SER A O   
1333 C CB  . SER A 167 ? 0.0825 0.1382 0.0966 0.0120  -0.0022 -0.0004 167 SER A CB  
1334 O OG  . SER A 167 ? 0.0638 0.1171 0.0773 0.0147  -0.0035 0.0013  167 SER A OG  
1335 N N   . ILE A 168 ? 0.0377 0.0855 0.0561 0.0201  0.0039  0.0015  168 ILE A N   
1336 C CA  . ILE A 168 ? 0.0672 0.1184 0.0932 0.0235  0.0072  0.0021  168 ILE A CA  
1337 C C   . ILE A 168 ? 0.0640 0.1140 0.0872 0.0218  0.0113  -0.0013 168 ILE A C   
1338 O O   . ILE A 168 ? 0.0688 0.1265 0.0988 0.0225  0.0142  -0.0013 168 ILE A O   
1339 C CB  . ILE A 168 ? 0.0665 0.1116 0.0959 0.0278  0.0076  0.0025  168 ILE A CB  
1340 C CG1 . ILE A 168 ? 0.1201 0.1681 0.1537 0.0281  0.0033  0.0075  168 ILE A CG1 
1341 C CG2 . ILE A 168 ? 0.0523 0.0977 0.0906 0.0311  0.0122  0.0006  168 ILE A CG2 
1342 C CD1 . ILE A 168 ? 0.1541 0.2107 0.1965 0.0275  0.0022  0.0115  168 ILE A CD1 
1343 N N   . SER A 169 ? 0.0461 0.0879 0.0595 0.0190  0.0114  -0.0036 169 SER A N   
1344 C CA  . SER A 169 ? 0.0526 0.0943 0.0612 0.0158  0.0147  -0.0058 169 SER A CA  
1345 C C   . SER A 169 ? 0.0626 0.1115 0.0726 0.0120  0.0146  -0.0043 169 SER A C   
1346 O O   . SER A 169 ? 0.0820 0.1342 0.0900 0.0090  0.0176  -0.0051 169 SER A O   
1347 C CB  . SER A 169 ? 0.0788 0.1116 0.0773 0.0129  0.0136  -0.0067 169 SER A CB  
1348 O OG  . SER A 169 ? 0.0647 0.0941 0.0601 0.0101  0.0096  -0.0042 169 SER A OG  
1349 N N   . SER A 170 ? 0.0576 0.1095 0.0707 0.0114  0.0112  -0.0023 170 SER A N   
1350 C CA  . SER A 170 ? 0.0671 0.1260 0.0827 0.0075  0.0109  -0.0014 170 SER A CA  
1351 C C   . SER A 170 ? 0.0600 0.1306 0.0849 0.0096  0.0121  -0.0001 170 SER A C   
1352 O O   . SER A 170 ? 0.0675 0.1458 0.0960 0.0073  0.0141  0.0003  170 SER A O   
1353 C CB  . SER A 170 ? 0.0479 0.1041 0.0621 0.0045  0.0068  -0.0015 170 SER A CB  
1354 O OG  . SER A 170 ? 0.0737 0.1192 0.0820 0.0033  0.0054  -0.0020 170 SER A OG  
1355 N N   . LEU A 171 ? 0.0541 0.1270 0.0842 0.0137  0.0106  0.0015  171 LEU A N   
1356 C CA  . LEU A 171 ? 0.0385 0.1237 0.0799 0.0160  0.0108  0.0046  171 LEU A CA  
1357 C C   . LEU A 171 ? 0.0630 0.1517 0.1117 0.0186  0.0158  0.0036  171 LEU A C   
1358 O O   . LEU A 171 ? 0.0546 0.1501 0.1114 0.0186  0.0159  0.0057  171 LEU A O   
1359 C CB  . LEU A 171 ? 0.0367 0.1221 0.0823 0.0191  0.0075  0.0081  171 LEU A CB  
1360 C CG  . LEU A 171 ? 0.0384 0.1268 0.0795 0.0154  0.0027  0.0094  171 LEU A CG  
1361 C CD1 . LEU A 171 ? 0.0499 0.1350 0.0914 0.0173  -0.0001 0.0127  171 LEU A CD1 
1362 C CD2 . LEU A 171 ? 0.0446 0.1430 0.0877 0.0109  0.0012  0.0106  171 LEU A CD2 
1363 N N   . VAL A 172 ? 0.0759 0.1567 0.1200 0.0199  0.0195  -0.0003 172 VAL A N   
1364 C CA  . VAL A 172 ? 0.0496 0.1330 0.0999 0.0215  0.0252  -0.0033 172 VAL A CA  
1365 C C   . VAL A 172 ? 0.0514 0.1428 0.1010 0.0171  0.0274  -0.0036 172 VAL A C   
1366 O O   . VAL A 172 ? 0.0784 0.1739 0.1353 0.0178  0.0315  -0.0053 172 VAL A O   
1367 C CB  . VAL A 172 ? 0.1495 0.2249 0.1937 0.0223  0.0293  -0.0088 172 VAL A CB  
1368 C CG1 . VAL A 172 ? 0.1111 0.1780 0.1585 0.0268  0.0277  -0.0089 172 VAL A CG1 
1369 C CG2 . VAL A 172 ? 0.1511 0.2210 0.1803 0.0166  0.0282  -0.0098 172 VAL A CG2 
1370 N N   . ALA A 173 ? 0.0702 0.1626 0.1123 0.0120  0.0245  -0.0020 173 ALA A N   
1375 N N   . PHE A 174 ? 0.0803 0.2157 0.1322 0.0188  0.0042  -0.0022 174 PHE A N   
1376 C CA  . PHE A 174 ? 0.0558 0.1968 0.1206 0.0199  -0.0007 0.0006  174 PHE A CA  
1377 C C   . PHE A 174 ? 0.0555 0.1966 0.1313 0.0272  -0.0011 -0.0011 174 PHE A C   
1378 O O   . PHE A 174 ? 0.0886 0.2367 0.1783 0.0291  -0.0010 -0.0006 174 PHE A O   
1379 C CB  . PHE A 174 ? 0.0748 0.2107 0.1345 0.0164  -0.0087 0.0052  174 PHE A CB  
1380 C CG  . PHE A 174 ? 0.0697 0.2036 0.1182 0.0090  -0.0085 0.0070  174 PHE A CG  
1381 C CD1 . PHE A 174 ? 0.0956 0.2360 0.1484 0.0042  -0.0078 0.0080  174 PHE A CD1 
1382 C CD2 . PHE A 174 ? 0.1008 0.2240 0.1346 0.0066  -0.0088 0.0077  174 PHE A CD2 
1383 C CE1 . PHE A 174 ? 0.0939 0.2310 0.1364 -0.0027 -0.0074 0.0095  174 PHE A CE1 
1384 C CE2 . PHE A 174 ? 0.1196 0.2396 0.1434 -0.0004 -0.0081 0.0094  174 PHE A CE2 
1385 C CZ  . PHE A 174 ? 0.0943 0.2220 0.1229 -0.0049 -0.0074 0.0101  174 PHE A CZ  
1386 N N   . VAL A 175 ? 0.1063 0.2387 0.1765 0.0312  -0.0019 -0.0028 175 VAL A N   
1387 C CA  . VAL A 175 ? 0.0667 0.1958 0.1454 0.0380  -0.0026 -0.0044 175 VAL A CA  
1388 C C   . VAL A 175 ? 0.0755 0.1967 0.1461 0.0414  0.0017  -0.0094 175 VAL A C   
1389 O O   . VAL A 175 ? 0.0715 0.1838 0.1329 0.0414  -0.0010 -0.0090 175 VAL A O   
1390 C CB  . VAL A 175 ? 0.0705 0.1929 0.1507 0.0390  -0.0107 0.0001  175 VAL A CB  
1391 C CG1 . VAL A 175 ? 0.0883 0.2064 0.1777 0.0456  -0.0107 -0.0014 175 VAL A CG1 
1392 C CG2 . VAL A 175 ? 0.0837 0.2122 0.1707 0.0354  -0.0161 0.0048  175 VAL A CG2 
1393 N N   . PRO A 176 ? 0.0906 0.2139 0.1638 0.0440  0.0085  -0.0142 176 PRO A N   
1394 C CA  . PRO A 176 ? 0.1336 0.2474 0.1983 0.0471  0.0118  -0.0195 176 PRO A CA  
1395 C C   . PRO A 176 ? 0.1294 0.2341 0.1977 0.0518  0.0071  -0.0192 176 PRO A C   
1396 O O   . PRO A 176 ? 0.1328 0.2397 0.2130 0.0541  0.0038  -0.0161 176 PRO A O   
1397 C CB  . PRO A 176 ? 0.1414 0.2587 0.2107 0.0493  0.0192  -0.0235 176 PRO A CB  
1398 C CG  . PRO A 176 ? 0.1146 0.2434 0.1906 0.0455  0.0211  -0.0203 176 PRO A CG  
1399 C CD  . PRO A 176 ? 0.0945 0.2274 0.1779 0.0439  0.0135  -0.0147 176 PRO A CD  
1400 N N   . VAL A 177 ? 0.1140 0.2077 0.1721 0.0528  0.0064  -0.0219 177 VAL A N   
1401 C CA  . VAL A 177 ? 0.1434 0.2263 0.2043 0.0565  0.0021  -0.0214 177 VAL A CA  
1402 C C   . VAL A 177 ? 0.1596 0.2410 0.2283 0.0613  0.0060  -0.0257 177 VAL A C   
1403 O O   . VAL A 177 ? 0.1914 0.2708 0.2543 0.0622  0.0113  -0.0314 177 VAL A O   
1404 C CB  . VAL A 177 ? 0.1405 0.2113 0.1894 0.0556  0.0001  -0.0227 177 VAL A CB  
1405 C CG1 . VAL A 177 ? 0.1218 0.1799 0.1742 0.0589  -0.0034 -0.0224 177 VAL A CG1 
1406 C CG2 . VAL A 177 ? 0.1554 0.2243 0.1960 0.0495  -0.0034 -0.0168 177 VAL A CG2 
1407 N N   . ASP A 178 ? 0.1411 0.2232 0.2224 0.0642  0.0037  -0.0224 178 ASP A N   
1408 C CA  . ASP A 178 ? 0.1693 0.2486 0.2589 0.0693  0.0072  -0.0254 178 ASP A CA  
1409 C C   . ASP A 178 ? 0.1464 0.2111 0.2287 0.0709  0.0057  -0.0284 178 ASP A C   
1410 O O   . ASP A 178 ? 0.1465 0.2044 0.2304 0.0707  0.0007  -0.0241 178 ASP A O   
1411 C CB  . ASP A 178 ? 0.1827 0.2667 0.2875 0.0716  0.0043  -0.0194 178 ASP A CB  
1412 C CG  . ASP A 178 ? 0.2456 0.3271 0.3600 0.0774  0.0080  -0.0211 178 ASP A CG  
1413 O OD1 . ASP A 178 ? 0.2756 0.3495 0.3843 0.0798  0.0122  -0.0272 178 ASP A OD1 
1414 O OD2 . ASP A 178 ? 0.2602 0.3475 0.3873 0.0797  0.0065  -0.0157 178 ASP A OD2 
1415 N N   . ALA A 179 ? 0.1615 0.2211 0.2360 0.0719  0.0102  -0.0353 179 ALA A N   
1416 C CA  . ALA A 179 ? 0.1852 0.2306 0.2527 0.0726  0.0081  -0.0384 179 ALA A CA  
1417 C C   . ALA A 179 ? 0.1751 0.2143 0.2522 0.0766  0.0070  -0.0369 179 ALA A C   
1418 O O   . ALA A 179 ? 0.1627 0.1910 0.2367 0.0762  0.0035  -0.0365 179 ALA A O   
1419 C CB  . ALA A 179 ? 0.2291 0.2700 0.2848 0.0724  0.0126  -0.0461 179 ALA A CB  
1420 N N   . ALA A 180 ? 0.1662 0.2124 0.2552 0.0804  0.0103  -0.0357 180 ALA A N   
1421 C CA  . ALA A 180 ? 0.2005 0.2420 0.2987 0.0845  0.0096  -0.0333 180 ALA A CA  
1422 C C   . ALA A 180 ? 0.2033 0.2444 0.3055 0.0828  0.0032  -0.0248 180 ALA A C   
1423 O O   . ALA A 180 ? 0.1341 0.1667 0.2369 0.0841  0.0008  -0.0225 180 ALA A O   
1424 C CB  . ALA A 180 ? 0.2192 0.2688 0.3291 0.0895  0.0152  -0.0337 180 ALA A CB  
1425 N N   . LYS A 181 ? 0.1487 0.1988 0.2526 0.0798  0.0007  -0.0199 181 LYS A N   
1426 C CA  . LYS A 181 ? 0.1155 0.1655 0.2212 0.0780  -0.0048 -0.0116 181 LYS A CA  
1427 C C   . LYS A 181 ? 0.1109 0.1513 0.2050 0.0735  -0.0084 -0.0103 181 LYS A C   
1428 O O   . LYS A 181 ? 0.1316 0.1663 0.2242 0.0727  -0.0115 -0.0048 181 LYS A O   
1429 C CB  . LYS A 181 ? 0.1410 0.2034 0.2522 0.0761  -0.0066 -0.0070 181 LYS A CB  
1430 C CG  . LYS A 181 ? 0.1625 0.2243 0.2725 0.0738  -0.0125 0.0015  181 LYS A CG  
1431 C CD  . LYS A 181 ? 0.2048 0.2794 0.3231 0.0735  -0.0147 0.0065  181 LYS A CD  
1432 C CE  . LYS A 181 ? 0.2076 0.2808 0.3202 0.0715  -0.0205 0.0138  181 LYS A CE  
1433 N NZ  . LYS A 181 ? 0.2685 0.3364 0.3806 0.0765  -0.0215 0.0152  181 LYS A NZ  
1434 N N   . TYR A 182 ? 0.1072 0.1464 0.1922 0.0707  -0.0074 -0.0151 182 TYR A N   
1435 C CA  . TYR A 182 ? 0.1025 0.1336 0.1768 0.0664  -0.0105 -0.0135 182 TYR A CA  
1436 C C   . TYR A 182 ? 0.1070 0.1295 0.1739 0.0665  -0.0091 -0.0201 182 TYR A C   
1437 O O   . TYR A 182 ? 0.1036 0.1268 0.1618 0.0644  -0.0085 -0.0234 182 TYR A O   
1438 C CB  . TYR A 182 ? 0.0936 0.1315 0.1622 0.0626  -0.0118 -0.0119 182 TYR A CB  
1439 C CG  . TYR A 182 ? 0.0901 0.1361 0.1652 0.0616  -0.0143 -0.0055 182 TYR A CG  
1440 C CD1 . TYR A 182 ? 0.0897 0.1306 0.1643 0.0598  -0.0179 0.0018  182 TYR A CD1 
1441 C CD2 . TYR A 182 ? 0.0883 0.1471 0.1700 0.0624  -0.0127 -0.0065 182 TYR A CD2 
1442 C CE1 . TYR A 182 ? 0.0881 0.1357 0.1673 0.0588  -0.0208 0.0076  182 TYR A CE1 
1443 C CE2 . TYR A 182 ? 0.0860 0.1517 0.1740 0.0610  -0.0162 -0.0006 182 TYR A CE2 
1444 C CZ  . TYR A 182 ? 0.0865 0.1461 0.1730 0.0593  -0.0206 0.0063  182 TYR A CZ  
1445 O OH  . TYR A 182 ? 0.0858 0.1516 0.1770 0.0576  -0.0248 0.0123  182 TYR A OH  
1446 N N   . PRO A 183 ? 0.1154 0.1297 0.1849 0.0690  -0.0087 -0.0218 183 PRO A N   
1447 C CA  . PRO A 183 ? 0.1240 0.1298 0.1862 0.0688  -0.0080 -0.0286 183 PRO A CA  
1448 C C   . PRO A 183 ? 0.1460 0.1441 0.1990 0.0641  -0.0115 -0.0268 183 PRO A C   
1449 O O   . PRO A 183 ? 0.1181 0.1135 0.1627 0.0629  -0.0113 -0.0320 183 PRO A O   
1450 C CB  . PRO A 183 ? 0.1484 0.1474 0.2166 0.0722  -0.0073 -0.0298 183 PRO A CB  
1451 C CG  . PRO A 183 ? 0.1535 0.1551 0.2295 0.0729  -0.0089 -0.0216 183 PRO A CG  
1452 C CD  . PRO A 183 ? 0.1214 0.1348 0.2004 0.0725  -0.0085 -0.0186 183 PRO A CD  
1453 N N   . LYS A 184 ? 0.1171 0.1119 0.1711 0.0613  -0.0142 -0.0191 184 LYS A N   
1454 C CA  . LYS A 184 ? 0.1265 0.1145 0.1730 0.0566  -0.0165 -0.0165 184 LYS A CA  
1455 C C   . LYS A 184 ? 0.0999 0.0927 0.1394 0.0540  -0.0167 -0.0162 184 LYS A C   
1456 O O   . LYS A 184 ? 0.1048 0.0930 0.1368 0.0516  -0.0177 -0.0180 184 LYS A O   
1457 C CB  . LYS A 184 ? 0.1102 0.0939 0.1585 0.0544  -0.0173 -0.0084 184 LYS A CB  
1458 C CG  . LYS A 184 ? 0.1453 0.1235 0.1989 0.0572  -0.0172 -0.0093 184 LYS A CG  
1459 C CD  . LYS A 184 ? 0.1596 0.1350 0.2134 0.0561  -0.0171 -0.0019 184 LYS A CD  
1460 C CE  . LYS A 184 ? 0.2627 0.2330 0.3217 0.0592  -0.0173 -0.0031 184 LYS A CE  
1461 N NZ  . LYS A 184 ? 0.3052 0.2735 0.3637 0.0589  -0.0177 0.0032  184 LYS A NZ  
1462 N N   . LEU A 185 ? 0.0947 0.0968 0.1365 0.0544  -0.0160 -0.0134 185 LEU A N   
1463 C CA  . LEU A 185 ? 0.0877 0.0956 0.1228 0.0523  -0.0159 -0.0132 185 LEU A CA  
1464 C C   . LEU A 185 ? 0.0903 0.1016 0.1201 0.0543  -0.0133 -0.0214 185 LEU A C   
1465 O O   . LEU A 185 ? 0.0875 0.0977 0.1083 0.0520  -0.0132 -0.0224 185 LEU A O   
1466 C CB  . LEU A 185 ? 0.1463 0.1647 0.1859 0.0526  -0.0158 -0.0096 185 LEU A CB  
1467 C CG  . LEU A 185 ? 0.1550 0.1813 0.1884 0.0501  -0.0156 -0.0083 185 LEU A CG  
1468 C CD1 . LEU A 185 ? 0.1687 0.1864 0.1940 0.0456  -0.0175 -0.0030 185 LEU A CD1 
1469 C CD2 . LEU A 185 ? 0.1678 0.2043 0.2076 0.0502  -0.0163 -0.0050 185 LEU A CD2 
1470 N N   A SER A 186 ? 0.0966 0.1120 0.1313 0.0580  -0.0103 -0.0268 186 SER A N   
1471 N N   B SER A 186 ? 0.0966 0.1121 0.1313 0.0580  -0.0102 -0.0268 186 SER A N   
1472 C CA  A SER A 186 ? 0.1062 0.1243 0.1345 0.0591  -0.0062 -0.0346 186 SER A CA  
1473 C CA  B SER A 186 ? 0.1074 0.1255 0.1355 0.0590  -0.0061 -0.0346 186 SER A CA  
1474 C C   A SER A 186 ? 0.1216 0.1280 0.1404 0.0576  -0.0079 -0.0385 186 SER A C   
1475 C C   B SER A 186 ? 0.1225 0.1288 0.1412 0.0575  -0.0079 -0.0384 186 SER A C   
1476 O O   A SER A 186 ? 0.1298 0.1367 0.1377 0.0551  -0.0061 -0.0415 186 SER A O   
1477 O O   B SER A 186 ? 0.1209 0.1276 0.1288 0.0548  -0.0064 -0.0412 186 SER A O   
1478 C CB  A SER A 186 ? 0.1139 0.1364 0.1496 0.0629  -0.0021 -0.0386 186 SER A CB  
1479 C CB  B SER A 186 ? 0.1164 0.1389 0.1515 0.0629  -0.0019 -0.0389 186 SER A CB  
1480 O OG  A SER A 186 ? 0.1040 0.1383 0.1483 0.0637  -0.0008 -0.0348 186 SER A OG  
1481 O OG  B SER A 186 ? 0.1237 0.1489 0.1505 0.0626  0.0032  -0.0453 186 SER A OG  
1482 N N   . ALA A 187 ? 0.1276 0.1235 0.1502 0.0577  -0.0113 -0.0374 187 ALA A N   
1483 C CA  . ALA A 187 ? 0.1456 0.1301 0.1611 0.0558  -0.0141 -0.0404 187 ALA A CA  
1484 C C   . ALA A 187 ? 0.1111 0.0918 0.1202 0.0516  -0.0172 -0.0362 187 ALA A C   
1485 O O   . ALA A 187 ? 0.1214 0.0965 0.1212 0.0494  -0.0184 -0.0395 187 ALA A O   
1486 C CB  . ALA A 187 ? 0.1434 0.1194 0.1663 0.0565  -0.0166 -0.0392 187 ALA A CB  
1487 N N   . TRP A 188 ? 0.1019 0.0850 0.1153 0.0499  -0.0183 -0.0283 188 TRP A N   
1488 C CA  . TRP A 188 ? 0.0949 0.0752 0.1028 0.0458  -0.0201 -0.0229 188 TRP A CA  
1489 C C   . TRP A 188 ? 0.0920 0.0799 0.0893 0.0412  -0.0165 -0.0237 188 TRP A C   
1490 O O   . TRP A 188 ? 0.0916 0.0752 0.0811 0.0365  -0.0174 -0.0225 188 TRP A O   
1491 C CB  . TRP A 188 ? 0.0885 0.0704 0.1016 0.0431  -0.0202 -0.0139 188 TRP A CB  
1492 C CG  . TRP A 188 ? 0.0857 0.0669 0.0933 0.0384  -0.0202 -0.0076 188 TRP A CG  
1493 C CD1 . TRP A 188 ? 0.0807 0.0550 0.0865 0.0333  -0.0206 -0.0031 188 TRP A CD1 
1494 C CD2 . TRP A 188 ? 0.0806 0.0694 0.0846 0.0377  -0.0189 -0.0045 188 TRP A CD2 
1495 N NE1 . TRP A 188 ? 0.0855 0.0617 0.0867 0.0293  -0.0189 0.0023  188 TRP A NE1 
1496 C CE2 . TRP A 188 ? 0.0702 0.0543 0.0691 0.0321  -0.0184 0.0016  188 TRP A CE2 
1497 C CE3 . TRP A 188 ? 0.0856 0.0860 0.0905 0.0386  -0.0165 -0.0059 188 TRP A CE3 
1498 C CZ2 . TRP A 188 ? 0.0951 0.0838 0.0884 0.0292  -0.0168 0.0058  188 TRP A CZ2 
1499 C CZ3 . TRP A 188 ? 0.0758 0.0817 0.0760 0.0345  -0.0150 -0.0017 188 TRP A CZ3 
1500 C CH2 . TRP A 188 ? 0.0668 0.0664 0.0607 0.0299  -0.0152 0.0039  188 TRP A CH2 
1501 N N   . ILE A 189 ? 0.1044 0.1037 0.1023 0.0423  -0.0126 -0.0252 189 ILE A N   
1502 C CA  . ILE A 189 ? 0.0893 0.0963 0.0782 0.0383  -0.0085 -0.0265 189 ILE A CA  
1503 C C   . ILE A 189 ? 0.0978 0.1001 0.0775 0.0375  -0.0078 -0.0328 189 ILE A C   
1504 O O   . ILE A 189 ? 0.1039 0.1052 0.0740 0.0325  -0.0074 -0.0315 189 ILE A O   
1505 C CB  . ILE A 189 ? 0.0974 0.1175 0.0907 0.0403  -0.0042 -0.0279 189 ILE A CB  
1506 C CG1 . ILE A 189 ? 0.1038 0.1287 0.1038 0.0397  -0.0058 -0.0212 189 ILE A CG1 
1507 C CG2 . ILE A 189 ? 0.0979 0.1256 0.0825 0.0368  0.0006  -0.0300 189 ILE A CG2 
1508 C CD1 . ILE A 189 ? 0.1192 0.1568 0.1270 0.0422  -0.0032 -0.0219 189 ILE A CD1 
1509 N N   . LYS A 190 ? 0.1074 0.1059 0.0893 0.0425  -0.0078 -0.0396 190 LYS A N   
1510 C CA  . LYS A 190 ? 0.1187 0.1114 0.0903 0.0421  -0.0075 -0.0463 190 LYS A CA  
1511 C C   . LYS A 190 ? 0.1383 0.1196 0.1050 0.0382  -0.0132 -0.0445 190 LYS A C   
1512 O O   . LYS A 190 ? 0.1318 0.1104 0.0871 0.0350  -0.0134 -0.0470 190 LYS A O   
1513 C CB  . LYS A 190 ? 0.1618 0.1521 0.1377 0.0476  -0.0060 -0.0532 190 LYS A CB  
1514 C CG  . LYS A 190 ? 0.2202 0.2222 0.1994 0.0498  0.0009  -0.0549 190 LYS A CG  
1515 C CD  . LYS A 190 ? 0.3012 0.3029 0.2689 0.0474  0.0054  -0.0591 190 LYS A CD  
1516 C CE  . LYS A 190 ? 0.3147 0.3288 0.2836 0.0471  0.0127  -0.0583 190 LYS A CE  
1517 N NZ  . LYS A 190 ? 0.3074 0.3196 0.2638 0.0437  0.0171  -0.0607 190 LYS A NZ  
1518 N N   . ARG A 191 ? 0.1228 0.0975 0.0983 0.0386  -0.0177 -0.0396 191 ARG A N   
1519 C CA  . ARG A 191 ? 0.1159 0.0803 0.0898 0.0348  -0.0232 -0.0363 191 ARG A CA  
1520 C C   . ARG A 191 ? 0.1251 0.0927 0.0922 0.0286  -0.0224 -0.0304 191 ARG A C   
1521 O O   . ARG A 191 ? 0.1305 0.0932 0.0900 0.0248  -0.0249 -0.0310 191 ARG A O   
1522 C CB  . ARG A 191 ? 0.1755 0.1337 0.1620 0.0370  -0.0267 -0.0312 191 ARG A CB  
1523 C CG  . ARG A 191 ? 0.1877 0.1348 0.1771 0.0342  -0.0323 -0.0273 191 ARG A CG  
1524 C CD  . ARG A 191 ? 0.2011 0.1496 0.2031 0.0337  -0.0319 -0.0211 191 ARG A CD  
1525 N NE  . ARG A 191 ? 0.2211 0.1687 0.2277 0.0376  -0.0318 -0.0265 191 ARG A NE  
1526 C CZ  . ARG A 191 ? 0.2288 0.1812 0.2420 0.0408  -0.0290 -0.0259 191 ARG A CZ  
1527 N NH1 . ARG A 191 ? 0.1675 0.1263 0.1837 0.0406  -0.0262 -0.0200 191 ARG A NH1 
1528 N NH2 . ARG A 191 ? 0.3027 0.2528 0.3195 0.0441  -0.0290 -0.0310 191 ARG A NH2 
1529 N N   . LEU A 192 ? 0.1069 0.0824 0.0767 0.0274  -0.0192 -0.0248 192 LEU A N   
1530 C CA  . LEU A 192 ? 0.0934 0.0717 0.0573 0.0216  -0.0179 -0.0193 192 LEU A CA  
1531 C C   . LEU A 192 ? 0.1170 0.1009 0.0696 0.0190  -0.0148 -0.0230 192 LEU A C   
1532 O O   . LEU A 192 ? 0.1030 0.0854 0.0494 0.0141  -0.0154 -0.0198 192 LEU A O   
1533 C CB  . LEU A 192 ? 0.0952 0.0800 0.0634 0.0210  -0.0152 -0.0133 192 LEU A CB  
1534 C CG  . LEU A 192 ? 0.1191 0.0982 0.0967 0.0233  -0.0178 -0.0083 192 LEU A CG  
1535 C CD1 . LEU A 192 ? 0.1031 0.0882 0.0819 0.0222  -0.0152 -0.0029 192 LEU A CD1 
1536 C CD2 . LEU A 192 ? 0.1368 0.1051 0.1160 0.0208  -0.0214 -0.0038 192 LEU A CD2 
1537 N N   . GLU A 193 ? 0.1373 0.1276 0.0878 0.0224  -0.0111 -0.0293 193 GLU A N   
1538 C CA  . GLU A 193 ? 0.1173 0.1130 0.0589 0.0198  -0.0069 -0.0321 193 GLU A CA  
1539 C C   . GLU A 193 ? 0.1394 0.1272 0.0739 0.0163  -0.0097 -0.0335 193 GLU A C   
1540 O O   . GLU A 193 ? 0.1413 0.1321 0.0699 0.0115  -0.0065 -0.0323 193 GLU A O   
1541 C CB  . GLU A 193 ? 0.1174 0.1203 0.0616 0.0238  -0.0018 -0.0371 193 GLU A CB  
1542 C CG  . GLU A 193 ? 0.1327 0.1471 0.0829 0.0239  0.0021  -0.0336 193 GLU A CG  
1543 C CD  . GLU A 193 ? 0.1494 0.1717 0.1049 0.0283  0.0068  -0.0377 193 GLU A CD  
1544 O OE1 . GLU A 193 ? 0.1703 0.1887 0.1259 0.0322  0.0074  -0.0435 193 GLU A OE1 
1545 O OE2 . GLU A 193 ? 0.1375 0.1698 0.0980 0.0274  0.0100  -0.0347 193 GLU A OE2 
1546 N N   . GLN A 194 ? 0.1428 0.1199 0.0786 0.0185  -0.0159 -0.0357 194 GLN A N   
1547 C CA  . GLN A 194 ? 0.1538 0.1232 0.0844 0.0153  -0.0200 -0.0368 194 GLN A CA  
1548 C C   . GLN A 194 ? 0.1390 0.1061 0.0692 0.0098  -0.0233 -0.0297 194 GLN A C   
1549 O O   . GLN A 194 ? 0.1370 0.1003 0.0634 0.0066  -0.0262 -0.0296 194 GLN A O   
1550 C CB  . GLN A 194 ? 0.1384 0.0970 0.0733 0.0192  -0.0257 -0.0414 194 GLN A CB  
1551 C CG  . GLN A 194 ? 0.1605 0.1199 0.0972 0.0248  -0.0225 -0.0485 194 GLN A CG  
1552 C CD  . GLN A 194 ? 0.2357 0.1850 0.1801 0.0283  -0.0278 -0.0514 194 GLN A CD  
1553 O OE1 . GLN A 194 ? 0.2771 0.2270 0.2306 0.0333  -0.0267 -0.0528 194 GLN A OE1 
1554 N NE2 . GLN A 194 ? 0.2675 0.2082 0.2095 0.0254  -0.0333 -0.0515 194 GLN A NE2 
1555 N N   . LEU A 195 ? 0.1492 0.1181 0.0838 0.0089  -0.0230 -0.0236 195 LEU A N   
1556 C CA  . LEU A 195 ? 0.1504 0.1163 0.0866 0.0039  -0.0254 -0.0161 195 LEU A CA  
1557 C C   . LEU A 195 ? 0.1285 0.1030 0.0607 -0.0004 -0.0215 -0.0147 195 LEU A C   
1558 O O   . LEU A 195 ? 0.1101 0.0954 0.0408 -0.0008 -0.0156 -0.0164 195 LEU A O   
1559 C CB  . LEU A 195 ? 0.1228 0.0896 0.0641 0.0034  -0.0242 -0.0093 195 LEU A CB  
1560 C CG  . LEU A 195 ? 0.1226 0.0834 0.0759 0.0067  -0.0266 -0.0071 195 LEU A CG  
1561 C CD1 . LEU A 195 ? 0.1206 0.0860 0.0793 0.0070  -0.0225 -0.0012 195 LEU A CD1 
1562 C CD2 . LEU A 195 ? 0.1492 0.0998 0.1078 0.0046  -0.0326 -0.0032 195 LEU A CD2 
1563 N N   . PRO A 196 ? 0.1116 0.0815 0.0437 -0.0036 -0.0250 -0.0114 196 PRO A N   
1564 C CA  . PRO A 196 ? 0.1154 0.0930 0.0442 -0.0059 -0.0222 -0.0109 196 PRO A CA  
1565 C C   . PRO A 196 ? 0.1182 0.1059 0.0515 -0.0060 -0.0162 -0.0066 196 PRO A C   
1566 O O   . PRO A 196 ? 0.1150 0.1096 0.0459 -0.0047 -0.0132 -0.0076 196 PRO A O   
1567 C CB  . PRO A 196 ? 0.1413 0.1099 0.0710 -0.0090 -0.0279 -0.0068 196 PRO A CB  
1568 C CG  . PRO A 196 ? 0.1917 0.1502 0.1281 -0.0089 -0.0324 -0.0033 196 PRO A CG  
1569 C CD  . PRO A 196 ? 0.1400 0.0976 0.0762 -0.0045 -0.0323 -0.0084 196 PRO A CD  
1570 N N   . TYR A 197 ? 0.0870 0.0733 0.0268 -0.0064 -0.0149 -0.0021 197 TYR A N   
1582 N N   . TYR A 198 ? 0.0461 0.1046 0.0820 0.0115  -0.0193 -0.0086 198 TYR A N   
1583 C CA  . TYR A 198 ? 0.0474 0.1100 0.0845 0.0108  -0.0177 -0.0072 198 TYR A CA  
1584 C C   . TYR A 198 ? 0.0625 0.1287 0.1017 0.0097  -0.0174 -0.0048 198 TYR A C   
1585 O O   . TYR A 198 ? 0.0415 0.1101 0.0822 0.0085  -0.0164 -0.0038 198 TYR A O   
1586 C CB  . TYR A 198 ? 0.0475 0.1125 0.0829 0.0127  -0.0168 -0.0079 198 TYR A CB  
1587 C CG  . TYR A 198 ? 0.0425 0.1113 0.0793 0.0119  -0.0153 -0.0065 198 TYR A CG  
1588 C CD1 . TYR A 198 ? 0.0574 0.1244 0.0951 0.0106  -0.0151 -0.0067 198 TYR A CD1 
1589 C CD2 . TYR A 198 ? 0.0529 0.1271 0.0900 0.0123  -0.0140 -0.0047 198 TYR A CD2 
1590 C CE1 . TYR A 198 ? 0.0384 0.1086 0.0774 0.0098  -0.0140 -0.0054 198 TYR A CE1 
1591 C CE2 . TYR A 198 ? 0.0335 0.1111 0.0717 0.0115  -0.0127 -0.0033 198 TYR A CE2 
1592 C CZ  . TYR A 198 ? 0.0322 0.1077 0.0716 0.0102  -0.0129 -0.0036 198 TYR A CZ  
1593 O OH  . TYR A 198 ? 0.0818 0.1608 0.1223 0.0094  -0.0118 -0.0020 198 TYR A OH  
1594 N N   . ALA A 199 ? 0.0564 0.1230 0.0957 0.0100  -0.0185 -0.0041 199 ALA A N   
1595 C CA  . ALA A 199 ? 0.0500 0.1200 0.0914 0.0089  -0.0183 -0.0019 199 ALA A CA  
1596 C C   . ALA A 199 ? 0.0453 0.1135 0.0898 0.0066  -0.0190 -0.0013 199 ALA A C   
1597 O O   . ALA A 199 ? 0.0683 0.1397 0.1146 0.0055  -0.0185 0.0000  199 ALA A O   
1598 C CB  . ALA A 199 ? 0.0872 0.1579 0.1281 0.0097  -0.0197 -0.0011 199 ALA A CB  
1599 N N   . GLU A 200 ? 0.0368 0.1006 0.0817 0.0059  -0.0199 -0.0023 200 GLU A N   
1600 C CA  . GLU A 200 ? 0.0537 0.1164 0.1011 0.0041  -0.0201 -0.0018 200 GLU A CA  
1601 C C   . GLU A 200 ? 0.0346 0.0998 0.0824 0.0035  -0.0185 -0.0019 200 GLU A C   
1602 O O   . GLU A 200 ? 0.0622 0.1275 0.1123 0.0020  -0.0187 -0.0015 200 GLU A O   
1603 C CB  . GLU A 200 ? 0.0684 0.1274 0.1145 0.0039  -0.0206 -0.0032 200 GLU A CB  
1604 C CG  . GLU A 200 ? 0.1558 0.2129 0.2016 0.0039  -0.0223 -0.0030 200 GLU A CG  
1605 C CD  . GLU A 200 ? 0.2129 0.2720 0.2619 0.0021  -0.0238 0.0001  200 GLU A CD  
1606 O OE1 . GLU A 200 ? 0.2621 0.3221 0.3139 0.0009  -0.0235 0.0011  200 GLU A OE1 
1607 O OE2 . GLU A 200 ? 0.2805 0.3397 0.3290 0.0021  -0.0252 0.0010  200 GLU A OE2 
1608 N N   . ASN A 201 ? 0.0386 0.1061 0.0842 0.0046  -0.0170 -0.0023 201 ASN A N   
1609 C CA  . ASN A 201 ? 0.0343 0.1053 0.0800 0.0041  -0.0154 -0.0016 201 ASN A CA  
1610 C C   . ASN A 201 ? 0.0314 0.1084 0.0765 0.0045  -0.0141 0.0003  201 ASN A C   
1611 O O   . ASN A 201 ? 0.0477 0.1283 0.0936 0.0032  -0.0132 0.0020  201 ASN A O   
1612 C CB  . ASN A 201 ? 0.0352 0.1054 0.0791 0.0048  -0.0147 -0.0027 201 ASN A CB  
1613 C CG  . ASN A 201 ? 0.0355 0.1094 0.0799 0.0039  -0.0134 -0.0015 201 ASN A CG  
1614 O OD1 . ASN A 201 ? 0.0297 0.1036 0.0755 0.0024  -0.0135 -0.0012 201 ASN A OD1 
1615 N ND2 . ASN A 201 ? 0.0428 0.1201 0.0861 0.0050  -0.0124 -0.0008 201 ASN A ND2 
1616 N N   . SER A 202 ? 0.0386 0.1170 0.0820 0.0063  -0.0139 0.0003  202 SER A N   
1617 C CA  . SER A 202 ? 0.0347 0.1196 0.0770 0.0071  -0.0121 0.0024  202 SER A CA  
1618 C C   . SER A 202 ? 0.0345 0.1230 0.0780 0.0056  -0.0119 0.0049  202 SER A C   
1619 O O   . SER A 202 ? 0.0552 0.1494 0.0987 0.0052  -0.0104 0.0074  202 SER A O   
1620 C CB  . SER A 202 ? 0.0596 0.1455 0.0995 0.0097  -0.0119 0.0017  202 SER A CB  
1621 O OG  . SER A 202 ? 0.0670 0.1507 0.1066 0.0102  -0.0133 0.0012  202 SER A OG  
1622 N N   . THR A 203 ? 0.0503 0.1356 0.0952 0.0048  -0.0137 0.0044  203 THR A N   
1623 C CA  . THR A 203 ? 0.0844 0.1729 0.1309 0.0033  -0.0138 0.0068  203 THR A CA  
1624 C C   . THR A 203 ? 0.0657 0.1562 0.1138 0.0010  -0.0132 0.0082  203 THR A C   
1625 O O   . THR A 203 ? 0.0367 0.1328 0.0847 0.0000  -0.0120 0.0114  203 THR A O   
1626 C CB  . THR A 203 ? 0.0937 0.1776 0.1420 0.0028  -0.0164 0.0057  203 THR A CB  
1627 O OG1 . THR A 203 ? 0.1109 0.1942 0.1573 0.0048  -0.0171 0.0051  203 THR A OG1 
1628 C CG2 . THR A 203 ? 0.1260 0.2131 0.1760 0.0009  -0.0168 0.0082  203 THR A CG2 
1629 N N   . GLY A 204 ? 0.0341 0.1199 0.0837 0.0002  -0.0142 0.0061  204 GLY A N   
1630 C CA  . GLY A 204 ? 0.0343 0.1215 0.0853 -0.0018 -0.0139 0.0070  204 GLY A CA  
1631 C C   . GLY A 204 ? 0.0348 0.1261 0.0841 -0.0017 -0.0120 0.0086  204 GLY A C   
1632 O O   . GLY A 204 ? 0.0359 0.1308 0.0859 -0.0034 -0.0115 0.0108  204 GLY A O   
1633 N N   . ALA A 205 ? 0.0342 0.1250 0.0816 0.0002  -0.0113 0.0074  205 ALA A N   
1634 C CA  . ALA A 205 ? 0.0374 0.1324 0.0838 0.0005  -0.0098 0.0090  205 ALA A CA  
1635 C C   . ALA A 205 ? 0.0370 0.1388 0.0830 0.0005  -0.0085 0.0126  205 ALA A C   
1636 O O   . ALA A 205 ? 0.0481 0.1541 0.0946 -0.0005 -0.0077 0.0151  205 ALA A O   
1637 C CB  . ALA A 205 ? 0.0423 0.1354 0.0872 0.0026  -0.0096 0.0071  205 ALA A CB  
1638 N N   . GLN A 206 ? 0.0375 0.1407 0.0828 0.0017  -0.0083 0.0130  206 GLN A N   
1639 C CA  . GLN A 206 ? 0.0397 0.1500 0.0848 0.0018  -0.0070 0.0167  206 GLN A CA  
1640 C C   . GLN A 206 ? 0.0409 0.1535 0.0877 -0.0011 -0.0073 0.0196  206 GLN A C   
1641 O O   . GLN A 206 ? 0.0430 0.1616 0.0901 -0.0017 -0.0063 0.0231  206 GLN A O   
1642 C CB  . GLN A 206 ? 0.0706 0.1819 0.1143 0.0037  -0.0068 0.0165  206 GLN A CB  
1643 C CG  . GLN A 206 ? 0.1295 0.2401 0.1712 0.0069  -0.0063 0.0143  206 GLN A CG  
1644 C CD  . GLN A 206 ? 0.2312 0.3427 0.2712 0.0091  -0.0062 0.0137  206 GLN A CD  
1645 O OE1 . GLN A 206 ? 0.2639 0.3710 0.3026 0.0108  -0.0071 0.0107  206 GLN A OE1 
1646 N NE2 . GLN A 206 ? 0.2649 0.3822 0.3048 0.0089  -0.0053 0.0168  206 GLN A NE2 
1647 N N   . GLN A 207 ? 0.0399 0.1478 0.0882 -0.0028 -0.0090 0.0181  207 GLN A N   
1648 C CA  . GLN A 207 ? 0.0413 0.1510 0.0915 -0.0057 -0.0096 0.0206  207 GLN A CA  
1649 C C   . GLN A 207 ? 0.0458 0.1570 0.0966 -0.0070 -0.0093 0.0215  207 GLN A C   
1650 O O   . GLN A 207 ? 0.0441 0.1601 0.0957 -0.0088 -0.0090 0.0251  207 GLN A O   
1651 C CB  . GLN A 207 ? 0.0451 0.1490 0.0973 -0.0069 -0.0117 0.0183  207 GLN A CB  
1652 C CG  . GLN A 207 ? 0.0704 0.1730 0.1225 -0.0060 -0.0126 0.0178  207 GLN A CG  
1653 C CD  . GLN A 207 ? 0.0978 0.1941 0.1522 -0.0066 -0.0151 0.0150  207 GLN A CD  
1654 O OE1 . GLN A 207 ? 0.1173 0.2091 0.1730 -0.0066 -0.0160 0.0120  207 GLN A OE1 
1655 N NE2 . GLN A 207 ? 0.1808 0.2771 0.2360 -0.0071 -0.0164 0.0160  207 GLN A NE2 
1656 N N   . PHE A 208 ? 0.0411 0.1486 0.0914 -0.0061 -0.0094 0.0186  208 PHE A N   
1657 C CA  . PHE A 208 ? 0.0458 0.1548 0.0963 -0.0072 -0.0091 0.0194  208 PHE A CA  
1658 C C   . PHE A 208 ? 0.0557 0.1714 0.1056 -0.0066 -0.0076 0.0230  208 PHE A C   
1659 O O   . PHE A 208 ? 0.0449 0.1649 0.0958 -0.0084 -0.0075 0.0261  208 PHE A O   
1660 C CB  . PHE A 208 ? 0.0458 0.1499 0.0955 -0.0061 -0.0094 0.0158  208 PHE A CB  
1661 C CG  . PHE A 208 ? 0.0394 0.1449 0.0894 -0.0073 -0.0093 0.0165  208 PHE A CG  
1662 C CD1 . PHE A 208 ? 0.0405 0.1502 0.0898 -0.0066 -0.0083 0.0186  208 PHE A CD1 
1663 C CD2 . PHE A 208 ? 0.0928 0.1960 0.1440 -0.0092 -0.0104 0.0153  208 PHE A CD2 
1664 C CE1 . PHE A 208 ? 0.0413 0.1524 0.0909 -0.0079 -0.0084 0.0195  208 PHE A CE1 
1665 C CE2 . PHE A 208 ? 0.0914 0.1964 0.1426 -0.0104 -0.0103 0.0161  208 PHE A CE2 
1666 C CZ  . PHE A 208 ? 0.0569 0.1658 0.1071 -0.0099 -0.0093 0.0184  208 PHE A CZ  
1667 N N   . VAL A 209 ? 0.0452 0.1623 0.0938 -0.0040 -0.0066 0.0226  209 VAL A N   
1668 C CA  . VAL A 209 ? 0.0447 0.1685 0.0933 -0.0028 -0.0052 0.0257  209 VAL A CA  
1669 C C   . VAL A 209 ? 0.0473 0.1772 0.0970 -0.0042 -0.0048 0.0299  209 VAL A C   
1670 O O   . VAL A 209 ? 0.0496 0.1851 0.1005 -0.0049 -0.0042 0.0333  209 VAL A O   
1671 C CB  . VAL A 209 ? 0.0443 0.1685 0.0917 0.0005  -0.0042 0.0241  209 VAL A CB  
1672 C CG1 . VAL A 209 ? 0.0931 0.2250 0.1412 0.0021  -0.0027 0.0274  209 VAL A CG1 
1673 C CG2 . VAL A 209 ? 0.0828 0.2017 0.1295 0.0017  -0.0047 0.0205  209 VAL A CG2 
1674 N N   . ALA A 210 ? 0.0472 0.1764 0.0967 -0.0047 -0.0052 0.0301  210 ALA A N   
1675 C CA  . ALA A 210 ? 0.0499 0.1848 0.1005 -0.0064 -0.0049 0.0344  210 ALA A CA  
1676 C C   . ALA A 210 ? 0.0514 0.1872 0.1039 -0.0098 -0.0060 0.0366  210 ALA A C   
1677 O O   . ALA A 210 ? 0.0544 0.1965 0.1081 -0.0111 -0.0057 0.0409  210 ALA A O   
1678 C CB  . ALA A 210 ? 0.0941 0.2275 0.1442 -0.0065 -0.0054 0.0340  210 ALA A CB  
1679 N N   . ALA A 211 ? 0.0497 0.1793 0.1025 -0.0111 -0.0074 0.0337  211 ALA A N   
1680 C CA  . ALA A 211 ? 0.0551 0.1849 0.1096 -0.0143 -0.0086 0.0352  211 ALA A CA  
1681 C C   . ALA A 211 ? 0.0562 0.1906 0.1110 -0.0145 -0.0080 0.0375  211 ALA A C   
1682 O O   . ALA A 211 ? 0.0643 0.2033 0.1206 -0.0167 -0.0084 0.0412  211 ALA A O   
1683 C CB  . ALA A 211 ? 0.0627 0.1851 0.1176 -0.0150 -0.0100 0.0309  211 ALA A CB  
1684 N N   . VAL A 212 ? 0.0662 0.1995 0.1198 -0.0122 -0.0071 0.0354  212 VAL A N   
1685 C CA  . VAL A 212 ? 0.0570 0.1947 0.1112 -0.0120 -0.0066 0.0376  212 VAL A CA  
1686 C C   . VAL A 212 ? 0.0558 0.2018 0.1112 -0.0112 -0.0054 0.0421  212 VAL A C   
1687 O O   . VAL A 212 ? 0.0584 0.2096 0.1156 -0.0126 -0.0055 0.0457  212 VAL A O   
1688 C CB  . VAL A 212 ? 0.0672 0.2015 0.1203 -0.0097 -0.0061 0.0344  212 VAL A CB  
1689 C CG1 . VAL A 212 ? 0.0757 0.2150 0.1299 -0.0093 -0.0055 0.0370  212 VAL A CG1 
1690 C CG2 . VAL A 212 ? 0.0733 0.2006 0.1256 -0.0107 -0.0073 0.0305  212 VAL A CG2 
1691 N N   . LYS A 213 ? 0.0556 0.2033 0.1104 -0.0089 -0.0042 0.0420  213 LYS A N   
1692 C CA  . LYS A 213 ? 0.0586 0.2147 0.1148 -0.0076 -0.0028 0.0461  213 LYS A CA  
1693 C C   . LYS A 213 ? 0.0615 0.2221 0.1193 -0.0106 -0.0035 0.0503  213 LYS A C   
1694 O O   . LYS A 213 ? 0.0647 0.2329 0.1245 -0.0105 -0.0027 0.0544  213 LYS A O   
1695 C CB  . LYS A 213 ? 0.1022 0.2591 0.1571 -0.0044 -0.0015 0.0448  213 LYS A CB  
1696 C CG  . LYS A 213 ? 0.1465 0.3002 0.2002 -0.0011 -0.0007 0.0411  213 LYS A CG  
1697 C CD  . LYS A 213 ? 0.1913 0.3476 0.2468 -0.0005 -0.0004 0.0421  213 LYS A CD  
1698 C CE  . LYS A 213 ? 0.2247 0.3779 0.2795 0.0027  0.0002  0.0386  213 LYS A CE  
1699 N NZ  . LYS A 213 ? 0.2371 0.3905 0.2935 0.0027  0.0000  0.0388  213 LYS A NZ  
1700 N N   . SER A 214 ? 0.0607 0.2168 0.1181 -0.0133 -0.0050 0.0494  214 SER A N   
1701 C CA  . SER A 214 ? 0.0712 0.2311 0.1303 -0.0165 -0.0060 0.0534  214 SER A CA  
1702 C C   . SER A 214 ? 0.0840 0.2457 0.1448 -0.0193 -0.0071 0.0556  214 SER A C   
1703 O O   . SER A 214 ? 0.1271 0.2928 0.1897 -0.0222 -0.0081 0.0594  214 SER A O   
1704 C CB  . SER A 214 ? 0.1050 0.2595 0.1636 -0.0184 -0.0073 0.0518  214 SER A CB  
1705 O OG  . SER A 214 ? 0.1252 0.2728 0.1838 -0.0200 -0.0089 0.0487  214 SER A OG  
1706 N N   . LYS A 215 ? 0.0759 0.2347 0.1362 -0.0186 -0.0072 0.0532  215 LYS A N   
1707 C CA  . LYS A 215 ? 0.0990 0.2595 0.1607 -0.0211 -0.0083 0.0550  215 LYS A CA  
1708 C C   . LYS A 215 ? 0.1133 0.2781 0.1757 -0.0190 -0.0072 0.0563  215 LYS A C   
1709 O O   . LYS A 215 ? 0.1279 0.2892 0.1894 -0.0181 -0.0072 0.0536  215 LYS A O   
1710 C CB  . LYS A 215 ? 0.1115 0.2644 0.1721 -0.0226 -0.0097 0.0510  215 LYS A CB  
1711 C CG  . LYS A 215 ? 0.1371 0.2851 0.1977 -0.0245 -0.0110 0.0493  215 LYS A CG  
1712 C CD  . LYS A 215 ? 0.1798 0.3311 0.2425 -0.0283 -0.0125 0.0531  215 LYS A CD  
1713 C CE  . LYS A 215 ? 0.2226 0.3680 0.2858 -0.0305 -0.0142 0.0507  215 LYS A CE  
1714 N NZ  . LYS A 215 ? 0.2314 0.3798 0.2968 -0.0346 -0.0160 0.0543  215 LYS A NZ  
1715 N N   . PRO A 216 ? 0.1213 0.2943 0.1858 -0.0183 -0.0062 0.0607  216 PRO A N   
1716 C CA  . PRO A 216 ? 0.1332 0.3112 0.1994 -0.0162 -0.0050 0.0622  216 PRO A CA  
1717 C C   . PRO A 216 ? 0.1047 0.2825 0.1716 -0.0182 -0.0062 0.0631  216 PRO A C   
1718 O O   . PRO A 216 ? 0.1064 0.2842 0.1738 -0.0218 -0.0079 0.0646  216 PRO A O   
1719 C CB  . PRO A 216 ? 0.1833 0.3708 0.2524 -0.0158 -0.0040 0.0673  216 PRO A CB  
1720 C CG  . PRO A 216 ? 0.1893 0.3773 0.2586 -0.0196 -0.0055 0.0695  216 PRO A CG  
1721 C CD  . PRO A 216 ? 0.1584 0.3371 0.2245 -0.0201 -0.0063 0.0649  216 PRO A CD  
1722 N N   . PHE A 217 ? 0.0906 0.2687 0.1580 -0.0160 -0.0054 0.0622  217 PHE A N   
1723 C CA  . PHE A 217 ? 0.0889 0.2667 0.1568 -0.0177 -0.0066 0.0627  217 PHE A CA  
1724 C C   . PHE A 217 ? 0.1132 0.2957 0.1835 -0.0153 -0.0054 0.0644  217 PHE A C   
1725 O O   . PHE A 217 ? 0.0985 0.2828 0.1697 -0.0118 -0.0036 0.0638  217 PHE A O   
1726 C CB  . PHE A 217 ? 0.1043 0.2733 0.1692 -0.0184 -0.0075 0.0578  217 PHE A CB  
1727 C CG  . PHE A 217 ? 0.1192 0.2835 0.1824 -0.0151 -0.0064 0.0538  217 PHE A CG  
1728 C CD1 . PHE A 217 ? 0.1346 0.2995 0.1987 -0.0135 -0.0060 0.0536  217 PHE A CD1 
1729 C CD2 . PHE A 217 ? 0.1664 0.3256 0.2276 -0.0138 -0.0060 0.0502  217 PHE A CD2 
1730 C CE1 . PHE A 217 ? 0.1724 0.3329 0.2353 -0.0107 -0.0052 0.0499  217 PHE A CE1 
1731 C CE2 . PHE A 217 ? 0.1729 0.3279 0.2327 -0.0110 -0.0052 0.0466  217 PHE A CE2 
1732 C CZ  . PHE A 217 ? 0.1847 0.3402 0.2453 -0.0095 -0.0049 0.0463  217 PHE A CZ  
1733 N N   . THR A 218 ? 0.1032 0.2881 0.1750 -0.0170 -0.0063 0.0667  218 THR A N   
1734 C CA  . THR A 218 ? 0.0757 0.2649 0.1504 -0.0150 -0.0055 0.0685  218 THR A CA  
1735 C C   . THR A 218 ? 0.1029 0.2871 0.1760 -0.0157 -0.0065 0.0662  218 THR A C   
1736 O O   . THR A 218 ? 0.1276 0.3070 0.1980 -0.0184 -0.0079 0.0643  218 THR A O   
1737 C CB  . THR A 218 ? 0.1751 0.3738 0.2540 -0.0163 -0.0056 0.0745  218 THR A CB  
1738 O OG1 . THR A 218 ? 0.2427 0.4458 0.3250 -0.0137 -0.0044 0.0761  218 THR A OG1 
1739 C CG2 . THR A 218 ? 0.0820 0.2805 0.1603 -0.0205 -0.0078 0.0763  218 THR A CG2 
1740 N N   . VAL A 219 ? 0.0913 0.2766 0.1662 -0.0132 -0.0056 0.0661  219 VAL A N   
1741 C CA  . VAL A 219 ? 0.0724 0.2536 0.1461 -0.0140 -0.0066 0.0644  219 VAL A CA  
1742 C C   . VAL A 219 ? 0.0809 0.2687 0.1582 -0.0152 -0.0072 0.0691  219 VAL A C   
1743 O O   . VAL A 219 ? 0.0935 0.2883 0.1751 -0.0135 -0.0061 0.0726  219 VAL A O   
1744 C CB  . VAL A 219 ? 0.1107 0.2867 0.1835 -0.0109 -0.0057 0.0602  219 VAL A CB  
1745 C CG1 . VAL A 219 ? 0.0791 0.2516 0.1509 -0.0120 -0.0068 0.0590  219 VAL A CG1 
1746 C CG2 . VAL A 219 ? 0.1448 0.3145 0.2141 -0.0101 -0.0054 0.0557  219 VAL A CG2 
1747 N N   . VAL A 220 ? 0.0796 0.2655 0.1553 -0.0182 -0.0089 0.0693  220 VAL A N   
1748 C CA  . VAL A 220 ? 0.0797 0.2715 0.1581 -0.0202 -0.0099 0.0739  220 VAL A CA  
1749 C C   . VAL A 220 ? 0.0788 0.2679 0.1567 -0.0202 -0.0105 0.0729  220 VAL A C   
1750 O O   . VAL A 220 ? 0.0762 0.2586 0.1502 -0.0208 -0.0110 0.0690  220 VAL A O   
1751 C CB  . VAL A 220 ? 0.0820 0.2748 0.1588 -0.0244 -0.0117 0.0757  220 VAL A CB  
1752 C CG1 . VAL A 220 ? 0.0859 0.2848 0.1653 -0.0268 -0.0129 0.0806  220 VAL A CG1 
1753 C CG2 . VAL A 220 ? 0.0832 0.2788 0.1608 -0.0248 -0.0113 0.0771  220 VAL A CG2 
1754 N N   . GLY A 221 ? 0.0811 0.2756 0.1632 -0.0193 -0.0103 0.0765  221 GLY A N   
1755 C CA  . GLY A 221 ? 0.0807 0.2734 0.1630 -0.0194 -0.0110 0.0762  221 GLY A CA  
1756 C C   . GLY A 221 ? 0.1097 0.3035 0.1959 -0.0156 -0.0095 0.0760  221 GLY A C   
1757 O O   . GLY A 221 ? 0.1328 0.3244 0.2191 -0.0126 -0.0081 0.0730  221 GLY A O   
1758 N N   . ALA A 222 ? 0.1437 0.3411 0.2334 -0.0157 -0.0101 0.0791  222 ALA A N   
1763 N N   . MET B 1   ? 0.3526 0.2369 0.3782 -0.1623 -0.0400 0.0202  1   MET B N   
1764 C CA  . MET B 1   ? 0.3705 0.2686 0.3893 -0.1543 -0.0364 0.0254  1   MET B CA  
1765 C C   . MET B 1   ? 0.3650 0.2492 0.3670 -0.1444 -0.0379 0.0267  1   MET B C   
1766 O O   . MET B 1   ? 0.3496 0.2202 0.3444 -0.1435 -0.0350 0.0335  1   MET B O   
1767 C CB  . MET B 1   ? 0.3854 0.2914 0.4092 -0.1586 -0.0285 0.0352  1   MET B CB  
1768 C CG  . MET B 1   ? 0.4026 0.3255 0.4444 -0.1677 -0.0259 0.0345  1   MET B CG  
1769 S SD  . MET B 1   ? 0.5905 0.5419 0.6396 -0.1631 -0.0278 0.0285  1   MET B SD  
1770 C CE  . MET B 1   ? 0.4754 0.4306 0.5415 -0.1721 -0.0334 0.0188  1   MET B CE  
1771 N N   . VAL B 2   ? 0.4029 0.2908 0.3989 -0.1367 -0.0423 0.0201  2   VAL B N   
1772 C CA  . VAL B 2   ? 0.4108 0.2866 0.3919 -0.1269 -0.0440 0.0200  2   VAL B CA  
1773 C C   . VAL B 2   ? 0.3974 0.2819 0.3719 -0.1207 -0.0394 0.0269  2   VAL B C   
1774 O O   . VAL B 2   ? 0.3994 0.3036 0.3774 -0.1186 -0.0373 0.0271  2   VAL B O   
1775 C CB  . VAL B 2   ? 0.3825 0.2589 0.3592 -0.1202 -0.0494 0.0106  2   VAL B CB  
1776 C CG1 . VAL B 2   ? 0.3906 0.2558 0.3529 -0.1097 -0.0502 0.0108  2   VAL B CG1 
1777 C CG2 . VAL B 2   ? 0.4068 0.2724 0.3879 -0.1250 -0.0544 0.0026  2   VAL B CG2 
1778 N N   . LYS B 3   ? 0.3752 0.2447 0.3406 -0.1173 -0.0381 0.0319  3   LYS B N   
1779 C CA  . LYS B 3   ? 0.3073 0.1822 0.2650 -0.1100 -0.0348 0.0369  3   LYS B CA  
1780 C C   . LYS B 3   ? 0.3074 0.1703 0.2540 -0.1006 -0.0387 0.0326  3   LYS B C   
1781 O O   . LYS B 3   ? 0.3477 0.1910 0.2889 -0.0991 -0.0410 0.0320  3   LYS B O   
1782 C CB  . LYS B 3   ? 0.3248 0.1920 0.2809 -0.1123 -0.0302 0.0457  3   LYS B CB  
1783 C CG  . LYS B 3   ? 0.3275 0.2004 0.2764 -0.1047 -0.0268 0.0506  3   LYS B CG  
1784 C CD  . LYS B 3   ? 0.3721 0.2457 0.3229 -0.1084 -0.0207 0.0596  3   LYS B CD  
1785 C CE  . LYS B 3   ? 0.3854 0.2590 0.3276 -0.1001 -0.0179 0.0644  3   LYS B CE  
1786 N NZ  . LYS B 3   ? 0.4444 0.2992 0.3813 -0.1004 -0.0161 0.0713  3   LYS B NZ  
1787 N N   . PRO B 4   ? 0.2698 0.1442 0.2134 -0.0940 -0.0392 0.0294  4   PRO B N   
1788 C CA  . PRO B 4   ? 0.2848 0.1471 0.2188 -0.0852 -0.0427 0.0245  4   PRO B CA  
1789 C C   . PRO B 4   ? 0.2611 0.1135 0.1867 -0.0785 -0.0413 0.0288  4   PRO B C   
1790 O O   . PRO B 4   ? 0.2761 0.1339 0.2027 -0.0798 -0.0373 0.0355  4   PRO B O   
1791 C CB  . PRO B 4   ? 0.2709 0.1489 0.2051 -0.0802 -0.0426 0.0205  4   PRO B CB  
1792 C CG  . PRO B 4   ? 0.2716 0.1700 0.2136 -0.0847 -0.0383 0.0248  4   PRO B CG  
1793 C CD  . PRO B 4   ? 0.2933 0.1904 0.2429 -0.0941 -0.0371 0.0285  4   PRO B CD  
1794 N N   . ILE B 5   ? 0.2656 0.1052 0.1837 -0.0706 -0.0442 0.0245  5   ILE B N   
1795 C CA  . ILE B 5   ? 0.2906 0.1227 0.2015 -0.0625 -0.0432 0.0272  5   ILE B CA  
1796 C C   . ILE B 5   ? 0.2646 0.1036 0.1714 -0.0531 -0.0435 0.0225  5   ILE B C   
1797 O O   . ILE B 5   ? 0.2811 0.1178 0.1863 -0.0496 -0.0460 0.0158  5   ILE B O   
1798 C CB  . ILE B 5   ? 0.2903 0.1007 0.1964 -0.0598 -0.0458 0.0260  5   ILE B CB  
1799 C CG1 . ILE B 5   ? 0.3322 0.1331 0.2428 -0.0696 -0.0456 0.0297  5   ILE B CG1 
1800 C CG2 . ILE B 5   ? 0.2926 0.0967 0.1926 -0.0510 -0.0446 0.0292  5   ILE B CG2 
1801 C CD1 . ILE B 5   ? 0.3645 0.1436 0.2713 -0.0677 -0.0483 0.0277  5   ILE B CD1 
1802 N N   . LEU B 6   ? 0.2401 0.0882 0.1461 -0.0488 -0.0403 0.0258  6   LEU B N   
1803 C CA  . LEU B 6   ? 0.2379 0.0926 0.1412 -0.0399 -0.0397 0.0219  6   LEU B CA  
1804 C C   . LEU B 6   ? 0.2391 0.0842 0.1377 -0.0310 -0.0398 0.0221  6   LEU B C   
1805 O O   . LEU B 6   ? 0.2648 0.1077 0.1634 -0.0312 -0.0382 0.0279  6   LEU B O   
1806 C CB  . LEU B 6   ? 0.2040 0.0775 0.1118 -0.0409 -0.0357 0.0246  6   LEU B CB  
1807 C CG  . LEU B 6   ? 0.2078 0.0895 0.1151 -0.0323 -0.0340 0.0208  6   LEU B CG  
1808 C CD1 . LEU B 6   ? 0.1983 0.0791 0.1033 -0.0299 -0.0359 0.0143  6   LEU B CD1 
1809 C CD2 . LEU B 6   ? 0.1887 0.0897 0.1029 -0.0333 -0.0292 0.0237  6   LEU B CD2 
1810 N N   . TYR B 7   ? 0.2249 0.0662 0.1204 -0.0229 -0.0413 0.0160  7   TYR B N   
1811 C CA  . TYR B 7   ? 0.2288 0.0650 0.1216 -0.0136 -0.0410 0.0153  7   TYR B CA  
1812 C C   . TYR B 7   ? 0.2323 0.0828 0.1274 -0.0068 -0.0381 0.0128  7   TYR B C   
1813 O O   . TYR B 7   ? 0.2064 0.0647 0.1025 -0.0056 -0.0374 0.0084  7   TYR B O   
1814 C CB  . TYR B 7   ? 0.2423 0.0661 0.1317 -0.0089 -0.0437 0.0101  7   TYR B CB  
1815 C CG  . TYR B 7   ? 0.2696 0.0779 0.1576 -0.0153 -0.0465 0.0114  7   TYR B CG  
1816 C CD1 . TYR B 7   ? 0.2666 0.0749 0.1567 -0.0232 -0.0480 0.0096  7   TYR B CD1 
1817 C CD2 . TYR B 7   ? 0.3182 0.1121 0.2036 -0.0133 -0.0474 0.0143  7   TYR B CD2 
1818 C CE1 . TYR B 7   ? 0.2928 0.0873 0.1831 -0.0296 -0.0503 0.0103  7   TYR B CE1 
1819 C CE2 . TYR B 7   ? 0.3390 0.1179 0.2238 -0.0194 -0.0495 0.0154  7   TYR B CE2 
1820 C CZ  . TYR B 7   ? 0.3363 0.1156 0.2238 -0.0278 -0.0509 0.0132  7   TYR B CZ  
1821 O OH  . TYR B 7   ? 0.3296 0.0941 0.2179 -0.0342 -0.0527 0.0138  7   TYR B OH  
1822 N N   . GLY B 8   ? 0.2232 0.0775 0.1198 -0.0021 -0.0363 0.0157  8   GLY B N   
1823 C CA  . GLY B 8   ? 0.2047 0.0737 0.1056 0.0038  -0.0331 0.0131  8   GLY B CA  
1824 C C   . GLY B 8   ? 0.2173 0.0916 0.1208 0.0075  -0.0315 0.0175  8   GLY B C   
1825 O O   . GLY B 8   ? 0.2022 0.0670 0.1026 0.0076  -0.0331 0.0222  8   GLY B O   
1826 N N   . ILE B 9   ? 0.1928 0.0828 0.1023 0.0107  -0.0284 0.0160  9   ILE B N   
1827 C CA  . ILE B 9   ? 0.1641 0.0632 0.0772 0.0140  -0.0269 0.0197  9   ILE B CA  
1828 C C   . ILE B 9   ? 0.1422 0.0606 0.0634 0.0125  -0.0230 0.0187  9   ILE B C   
1829 O O   . ILE B 9   ? 0.1528 0.0765 0.0774 0.0129  -0.0212 0.0134  9   ILE B O   
1830 C CB  . ILE B 9   ? 0.1755 0.0720 0.0882 0.0228  -0.0283 0.0165  9   ILE B CB  
1831 C CG1 . ILE B 9   ? 0.1707 0.0733 0.0851 0.0260  -0.0285 0.0211  9   ILE B CG1 
1832 C CG2 . ILE B 9   ? 0.2047 0.1093 0.1214 0.0272  -0.0263 0.0088  9   ILE B CG2 
1833 C CD1 . ILE B 9   ? 0.2177 0.1120 0.1293 0.0331  -0.0312 0.0203  9   ILE B CD1 
1834 N N   . ASP B 10  ? 0.1387 0.0679 0.0631 0.0109  -0.0214 0.0240  10  ASP B N   
1835 C CA  . ASP B 10  ? 0.1189 0.0678 0.0520 0.0087  -0.0175 0.0235  10  ASP B CA  
1836 C C   . ASP B 10  ? 0.1143 0.0735 0.0545 0.0130  -0.0158 0.0175  10  ASP B C   
1837 O O   . ASP B 10  ? 0.1188 0.0882 0.0648 0.0110  -0.0130 0.0147  10  ASP B O   
1838 C CB  . ASP B 10  ? 0.1204 0.0793 0.0543 0.0074  -0.0162 0.0298  10  ASP B CB  
1839 C CG  . ASP B 10  ? 0.1342 0.0852 0.0625 0.0023  -0.0156 0.0356  10  ASP B CG  
1840 O OD1 . ASP B 10  ? 0.1508 0.0911 0.0763 -0.0026 -0.0167 0.0345  10  ASP B OD1 
1841 O OD2 . ASP B 10  ? 0.1583 0.1135 0.0844 0.0026  -0.0143 0.0411  10  ASP B OD2 
1842 N N   . ALA B 11  ? 0.1079 0.0620 0.0462 0.0194  -0.0175 0.0148  11  ALA B N   
1843 C CA  . ALA B 11  ? 0.1040 0.0658 0.0482 0.0242  -0.0153 0.0083  11  ALA B CA  
1844 C C   . ALA B 11  ? 0.1049 0.0653 0.0509 0.0249  -0.0128 0.0027  11  ALA B C   
1845 O O   . ALA B 11  ? 0.0945 0.0637 0.0469 0.0274  -0.0093 -0.0017 11  ALA B O   
1846 C CB  . ALA B 11  ? 0.1432 0.1006 0.0848 0.0314  -0.0175 0.0063  11  ALA B CB  
1847 N N   . SER B 12  ? 0.1192 0.0676 0.0585 0.0233  -0.0146 0.0027  12  SER B N   
1848 C CA  . SER B 12  ? 0.1214 0.0667 0.0592 0.0249  -0.0131 -0.0028 12  SER B CA  
1849 C C   . SER B 12  ? 0.1296 0.0847 0.0762 0.0203  -0.0098 -0.0018 12  SER B C   
1850 O O   . SER B 12  ? 0.1151 0.0719 0.0614 0.0136  -0.0108 0.0025  12  SER B O   
1851 C CB  . SER B 12  ? 0.1617 0.0911 0.0889 0.0237  -0.0173 -0.0028 12  SER B CB  
1852 O OG  . SER B 12  ? 0.1642 0.0965 0.0926 0.0228  -0.0160 -0.0052 12  SER B OG  
1853 N N   . PRO B 13  ? 0.1079 0.0756 0.0667 0.0212  -0.0061 -0.0033 13  PRO B N   
1854 C CA  . PRO B 13  ? 0.0901 0.0639 0.0543 0.0192  -0.0042 -0.0022 13  PRO B CA  
1855 C C   . PRO B 13  ? 0.1036 0.0719 0.0630 0.0142  -0.0054 -0.0016 13  PRO B C   
1856 O O   . PRO B 13  ? 0.0794 0.0551 0.0403 0.0081  -0.0050 0.0004  13  PRO B O   
1857 C CB  . PRO B 13  ? 0.0962 0.0829 0.0725 0.0178  -0.0029 -0.0014 13  PRO B CB  
1858 C CG  . PRO B 13  ? 0.1178 0.1064 0.0939 0.0190  -0.0040 -0.0013 13  PRO B CG  
1859 C CD  . PRO B 13  ? 0.1111 0.0891 0.0795 0.0218  -0.0054 -0.0026 13  PRO B CD  
1860 N N   . PRO B 14  ? 0.0955 0.0553 0.0511 0.0161  -0.0070 -0.0025 14  PRO B N   
1861 C CA  . PRO B 14  ? 0.0865 0.0408 0.0372 0.0117  -0.0087 -0.0022 14  PRO B CA  
1862 C C   . PRO B 14  ? 0.0958 0.0394 0.0360 0.0055  -0.0126 -0.0005 14  PRO B C   
1863 O O   . PRO B 14  ? 0.0983 0.0448 0.0385 -0.0007 -0.0133 0.0009  14  PRO B O   
1864 C CB  . PRO B 14  ? 0.1206 0.0698 0.0679 0.0154  -0.0104 -0.0027 14  PRO B CB  
1865 C CG  . PRO B 14  ? 0.1248 0.0762 0.0718 0.0190  -0.0108 -0.0028 14  PRO B CG  
1866 C CD  . PRO B 14  ? 0.0939 0.0572 0.0515 0.0188  -0.0076 -0.0023 14  PRO B CD  
1867 N N   . VAL B 15  ? 0.1216 0.0556 0.0543 0.0065  -0.0154 0.0004  15  VAL B N   
1868 C CA  . VAL B 15  ? 0.1245 0.0524 0.0514 -0.0005 -0.0188 0.0052  15  VAL B CA  
1869 C C   . VAL B 15  ? 0.1047 0.0519 0.0418 -0.0052 -0.0150 0.0092  15  VAL B C   
1870 O O   . VAL B 15  ? 0.1069 0.0535 0.0424 -0.0127 -0.0162 0.0120  15  VAL B O   
1871 C CB  . VAL B 15  ? 0.1350 0.0537 0.0567 0.0025  -0.0213 0.0074  15  VAL B CB  
1872 C CG1 . VAL B 15  ? 0.1623 0.0782 0.0822 -0.0044 -0.0228 0.0142  15  VAL B CG1 
1873 C CG2 . VAL B 15  ? 0.1657 0.0690 0.0784 0.0071  -0.0250 0.0033  15  VAL B CG2 
1874 N N   . ARG B 16  ? 0.0849 0.0494 0.0324 -0.0011 -0.0107 0.0088  16  ARG B N   
1875 C CA  . ARG B 16  ? 0.0911 0.0707 0.0454 -0.0034 -0.0077 0.0110  16  ARG B CA  
1876 C C   . ARG B 16  ? 0.0835 0.0690 0.0423 -0.0064 -0.0062 0.0092  16  ARG B C   
1877 O O   . ARG B 16  ? 0.0939 0.0841 0.0548 -0.0112 -0.0056 0.0110  16  ARG B O   
1878 C CB  . ARG B 16  ? 0.0812 0.0726 0.0416 0.0007  -0.0054 0.0100  16  ARG B CB  
1879 C CG  . ARG B 16  ? 0.0898 0.0778 0.0459 0.0021  -0.0072 0.0133  16  ARG B CG  
1880 C CD  . ARG B 16  ? 0.0948 0.0902 0.0549 0.0031  -0.0067 0.0116  16  ARG B CD  
1881 N NE  . ARG B 16  ? 0.0973 0.0861 0.0579 0.0102  -0.0065 0.0068  16  ARG B NE  
1882 C CZ  . ARG B 16  ? 0.0862 0.0802 0.0546 0.0146  -0.0035 0.0023  16  ARG B CZ  
1883 N NH1 . ARG B 16  ? 0.0903 0.0817 0.0604 0.0219  -0.0030 -0.0011 16  ARG B NH1 
1884 N NH2 . ARG B 16  ? 0.0854 0.0886 0.0618 0.0125  -0.0012 0.0017  16  ARG B NH2 
1885 N N   . ALA B 17  ? 0.0763 0.0613 0.0368 -0.0044 -0.0059 0.0057  17  ALA B N   
1886 C CA  . ALA B 17  ? 0.0685 0.0587 0.0328 -0.0069 -0.0049 0.0045  17  ALA B CA  
1887 C C   . ALA B 17  ? 0.0914 0.0757 0.0509 -0.0146 -0.0079 0.0067  17  ALA B C   
1888 O O   . ALA B 17  ? 0.0863 0.0785 0.0505 -0.0197 -0.0073 0.0078  17  ALA B O   
1889 C CB  . ALA B 17  ? 0.0847 0.0753 0.0509 -0.0028 -0.0042 0.0011  17  ALA B CB  
1890 N N   . VAL B 18  ? 0.0898 0.0569 0.0378 -0.0179 -0.0125 0.0077  18  VAL B N   
1891 C CA  . VAL B 18  ? 0.1049 0.0607 0.0441 -0.0288 -0.0178 0.0107  18  VAL B CA  
1892 C C   . VAL B 18  ? 0.1025 0.0649 0.0443 -0.0340 -0.0174 0.0154  18  VAL B C   
1893 O O   . VAL B 18  ? 0.1127 0.0804 0.0558 -0.0421 -0.0188 0.0176  18  VAL B O   
1894 C CB  . VAL B 18  ? 0.1173 0.0476 0.0415 -0.0294 -0.0244 0.0099  18  VAL B CB  
1895 C CG1 . VAL B 18  ? 0.1375 0.0597 0.0550 -0.0392 -0.0300 0.0134  18  VAL B CG1 
1896 C CG2 . VAL B 18  ? 0.1146 0.0424 0.0389 -0.0221 -0.0238 0.0054  18  VAL B CG2 
1897 N N   . LYS B 19  ? 0.1054 0.0692 0.0486 -0.0284 -0.0150 0.0172  19  LYS B N   
1898 C CA  . LYS B 19  ? 0.1102 0.0805 0.0561 -0.0309 -0.0132 0.0217  19  LYS B CA  
1899 C C   . LYS B 19  ? 0.0836 0.0720 0.0397 -0.0320 -0.0098 0.0205  19  LYS B C   
1900 O O   . LYS B 19  ? 0.1151 0.1080 0.0723 -0.0380 -0.0100 0.0236  19  LYS B O   
1901 C CB  . LYS B 19  ? 0.1239 0.0926 0.0682 -0.0238 -0.0114 0.0237  19  LYS B CB  
1902 C CG  . LYS B 19  ? 0.1566 0.1069 0.0914 -0.0227 -0.0153 0.0254  19  LYS B CG  
1903 C CD  . LYS B 19  ? 0.1685 0.1209 0.1030 -0.0154 -0.0137 0.0275  19  LYS B CD  
1904 C CE  . LYS B 19  ? 0.2235 0.1841 0.1594 -0.0164 -0.0106 0.0323  19  LYS B CE  
1905 N NZ  . LYS B 19  ? 0.2047 0.1551 0.1337 -0.0149 -0.0120 0.0380  19  LYS B NZ  
1906 N N   . LEU B 20  ? 0.0869 0.0844 0.0501 -0.0264 -0.0072 0.0162  20  LEU B N   
1907 C CA  . LEU B 20  ? 0.0709 0.0836 0.0432 -0.0285 -0.0061 0.0146  20  LEU B CA  
1908 C C   . LEU B 20  ? 0.0748 0.0909 0.0479 -0.0344 -0.0083 0.0145  20  LEU B C   
1909 O O   . LEU B 20  ? 0.0938 0.1197 0.0697 -0.0375 -0.0088 0.0157  20  LEU B O   
1910 C CB  . LEU B 20  ? 0.0841 0.1039 0.0641 -0.0228 -0.0040 0.0105  20  LEU B CB  
1911 C CG  . LEU B 20  ? 0.0615 0.0827 0.0429 -0.0173 -0.0022 0.0100  20  LEU B CG  
1912 C CD1 . LEU B 20  ? 0.1003 0.1254 0.0886 -0.0122 -0.0009 0.0064  20  LEU B CD1 
1913 C CD2 . LEU B 20  ? 0.0672 0.0982 0.0521 -0.0191 -0.0023 0.0116  20  LEU B CD2 
1914 N N   . THR B 21  ? 0.0681 0.0766 0.0370 -0.0369 -0.0103 0.0134  21  THR B N   
1915 C CA  . THR B 21  ? 0.0778 0.0891 0.0452 -0.0422 -0.0124 0.0137  21  THR B CA  
1916 C C   . THR B 21  ? 0.0934 0.1020 0.0530 -0.0510 -0.0164 0.0187  21  THR B C   
1917 O O   . THR B 21  ? 0.1001 0.1175 0.0625 -0.0535 -0.0156 0.0201  21  THR B O   
1918 C CB  . THR B 21  ? 0.0816 0.0812 0.0439 -0.0424 -0.0128 0.0127  21  THR B CB  
1919 O OG1 . THR B 21  ? 0.0862 0.0891 0.0543 -0.0334 -0.0089 0.0090  21  THR B OG1 
1920 C CG2 . THR B 21  ? 0.1002 0.1022 0.0585 -0.0468 -0.0137 0.0145  21  THR B CG2 
1921 N N   . LEU B 22  ? 0.1119 0.1058 0.0656 -0.0530 -0.0177 0.0217  22  LEU B N   
1922 C CA  . LEU B 22  ? 0.1335 0.1227 0.0868 -0.0593 -0.0181 0.0266  22  LEU B CA  
1923 C C   . LEU B 22  ? 0.1252 0.1276 0.0855 -0.0587 -0.0138 0.0290  22  LEU B C   
1924 O O   . LEU B 22  ? 0.1457 0.1518 0.1094 -0.0642 -0.0130 0.0318  22  LEU B O   
1925 C CB  . LEU B 22  ? 0.1290 0.0986 0.0747 -0.0597 -0.0201 0.0291  22  LEU B CB  
1926 C CG  . LEU B 22  ? 0.1479 0.1009 0.0865 -0.0608 -0.0251 0.0264  22  LEU B CG  
1927 C CD1 . LEU B 22  ? 0.1510 0.0856 0.0818 -0.0564 -0.0269 0.0269  22  LEU B CD1 
1928 C CD2 . LEU B 22  ? 0.1534 0.1027 0.0955 -0.0687 -0.0272 0.0274  22  LEU B CD2 
1929 N N   . ALA B 23  ? 0.1409 0.1496 0.1041 -0.0516 -0.0109 0.0274  23  ALA B N   
1930 C CA  . ALA B 23  ? 0.1223 0.1411 0.0902 -0.0501 -0.0073 0.0290  23  ALA B CA  
1931 C C   . ALA B 23  ? 0.1213 0.1544 0.0946 -0.0508 -0.0075 0.0267  23  ALA B C   
1932 O O   . ALA B 23  ? 0.1378 0.1780 0.1133 -0.0541 -0.0060 0.0294  23  ALA B O   
1933 C CB  . ALA B 23  ? 0.1385 0.1597 0.1066 -0.0439 -0.0058 0.0278  23  ALA B CB  
1934 N N   . ALA B 24  ? 0.1263 0.1631 0.1013 -0.0474 -0.0092 0.0220  24  ALA B N   
1939 N N   . LEU B 25  ? 0.1400 0.1893 0.1584 -0.0484 0.0325  0.0449  25  LEU B N   
1940 C CA  . LEU B 25  ? 0.1542 0.2016 0.1697 -0.0533 0.0291  0.0492  25  LEU B CA  
1941 C C   . LEU B 25  ? 0.1862 0.2251 0.1878 -0.0609 0.0288  0.0539  25  LEU B C   
1942 O O   . LEU B 25  ? 0.1917 0.2295 0.1930 -0.0663 0.0272  0.0573  25  LEU B O   
1943 C CB  . LEU B 25  ? 0.1823 0.2288 0.1917 -0.0553 0.0191  0.0531  25  LEU B CB  
1944 C CG  . LEU B 25  ? 0.1589 0.2164 0.1815 -0.0475 0.0191  0.0511  25  LEU B CG  
1945 C CD1 . LEU B 25  ? 0.1548 0.2121 0.1687 -0.0500 0.0095  0.0562  25  LEU B CD1 
1946 C CD2 . LEU B 25  ? 0.1317 0.1976 0.1666 -0.0452 0.0226  0.0498  25  LEU B CD2 
1947 N N   . GLN B 26  ? 0.2116 0.2454 0.2009 -0.0619 0.0300  0.0544  26  GLN B N   
1948 C CA  . GLN B 26  ? 0.2409 0.2641 0.2119 -0.0686 0.0293  0.0599  26  GLN B CA  
1949 C C   . GLN B 26  ? 0.2240 0.2330 0.1829 -0.0754 0.0198  0.0650  26  GLN B C   
1950 O O   . GLN B 26  ? 0.2453 0.2492 0.2008 -0.0816 0.0209  0.0697  26  GLN B O   
1951 C CB  . GLN B 26  ? 0.2718 0.3022 0.2525 -0.0693 0.0393  0.0606  26  GLN B CB  
1952 C CG  . GLN B 26  ? 0.3035 0.3438 0.2928 -0.0638 0.0486  0.0555  26  GLN B CG  
1953 C CD  . GLN B 26  ? 0.3419 0.3880 0.3440 -0.0633 0.0589  0.0552  26  GLN B CD  
1954 O OE1 . GLN B 26  ? 0.3876 0.4317 0.3853 -0.0691 0.0600  0.0610  26  GLN B OE1 
1955 N NE2 . GLN B 26  ? 0.3221 0.3772 0.3400 -0.0585 0.0660  0.0491  26  GLN B NE2 
1956 N N   . LEU B 27  ? 0.2068 0.2089 0.1601 -0.0747 0.0109  0.0642  27  LEU B N   
1957 C CA  . LEU B 27  ? 0.2284 0.2144 0.1702 -0.0813 0.0009  0.0675  27  LEU B CA  
1958 C C   . LEU B 27  ? 0.2670 0.2269 0.1821 -0.0815 -0.0065 0.0700  27  LEU B C   
1959 O O   . LEU B 27  ? 0.2575 0.2116 0.1628 -0.0745 -0.0101 0.0675  27  LEU B O   
1960 C CB  . LEU B 27  ? 0.2137 0.2050 0.1624 -0.0794 -0.0051 0.0653  27  LEU B CB  
1961 C CG  . LEU B 27  ? 0.2354 0.2092 0.1721 -0.0875 -0.0165 0.0677  27  LEU B CG  
1962 C CD1 . LEU B 27  ? 0.2577 0.2374 0.2036 -0.0968 -0.0149 0.0703  27  LEU B CD1 
1963 C CD2 . LEU B 27  ? 0.2275 0.2074 0.1676 -0.0849 -0.0221 0.0664  27  LEU B CD2 
1964 N N   . PRO B 28  ? 0.3022 0.2456 0.2057 -0.0881 -0.0087 0.0752  28  PRO B N   
1965 C CA  . PRO B 28  ? 0.3012 0.2172 0.1793 -0.0857 -0.0161 0.0779  28  PRO B CA  
1966 C C   . PRO B 28  ? 0.2915 0.1874 0.1588 -0.0824 -0.0287 0.0745  28  PRO B C   
1967 O O   . PRO B 28  ? 0.3005 0.1986 0.1764 -0.0873 -0.0326 0.0727  28  PRO B O   
1968 C CB  . PRO B 28  ? 0.3267 0.2314 0.2007 -0.0945 -0.0144 0.0854  28  PRO B CB  
1969 C CG  . PRO B 28  ? 0.3417 0.2718 0.2375 -0.0991 -0.0034 0.0862  28  PRO B CG  
1970 C CD  . PRO B 28  ? 0.3169 0.2657 0.2306 -0.0967 -0.0041 0.0794  28  PRO B CD  
1971 N N   . TYR B 29  ? 0.3216 0.1989 0.1699 -0.0728 -0.0354 0.0731  29  TYR B N   
1972 C CA  . TYR B 29  ? 0.3298 0.1870 0.1675 -0.0655 -0.0475 0.0682  29  TYR B CA  
1973 C C   . TYR B 29  ? 0.3362 0.1713 0.1539 -0.0547 -0.0542 0.0678  29  TYR B C   
1974 O O   . TYR B 29  ? 0.3407 0.1810 0.1524 -0.0512 -0.0498 0.0708  29  TYR B O   
1975 C CB  . TYR B 29  ? 0.2836 0.1591 0.1322 -0.0574 -0.0476 0.0618  29  TYR B CB  
1976 C CG  . TYR B 29  ? 0.2689 0.1588 0.1188 -0.0465 -0.0442 0.0582  29  TYR B CG  
1977 C CD1 . TYR B 29  ? 0.2506 0.1641 0.1127 -0.0510 -0.0330 0.0601  29  TYR B CD1 
1978 C CD2 . TYR B 29  ? 0.2742 0.1552 0.1150 -0.0315 -0.0526 0.0514  29  TYR B CD2 
1979 C CE1 . TYR B 29  ? 0.2582 0.1865 0.1252 -0.0414 -0.0302 0.0534  29  TYR B CE1 
1980 C CE2 . TYR B 29  ? 0.2606 0.1578 0.1070 -0.0218 -0.0503 0.0456  29  TYR B CE2 
1981 C CZ  . TYR B 29  ? 0.2424 0.1631 0.1026 -0.0272 -0.0392 0.0458  29  TYR B CZ  
1982 O OH  . TYR B 29  ? 0.2302 0.1674 0.0989 -0.0181 -0.0374 0.0374  29  TYR B OH  
1983 N N   . ASP B 30  ? 0.3541 0.1651 0.1611 -0.0485 -0.0652 0.0639  30  ASP B N   
1984 C CA  . ASP B 30  ? 0.3755 0.1682 0.1672 -0.0356 -0.0719 0.0623  30  ASP B CA  
1985 C C   . ASP B 30  ? 0.3558 0.1611 0.1527 -0.0197 -0.0754 0.0521  30  ASP B C   
1986 O O   . ASP B 30  ? 0.3381 0.1523 0.1448 -0.0178 -0.0768 0.0463  30  ASP B O   
1987 C CB  . ASP B 30  ? 0.4094 0.1680 0.1886 -0.0370 -0.0812 0.0632  30  ASP B CB  
1988 C CG  . ASP B 30  ? 0.4698 0.2171 0.2475 -0.0527 -0.0772 0.0735  30  ASP B CG  
1989 O OD1 . ASP B 30  ? 0.4658 0.2216 0.2420 -0.0553 -0.0694 0.0816  30  ASP B OD1 
1990 O OD2 . ASP B 30  ? 0.5064 0.2377 0.2854 -0.0619 -0.0818 0.0729  30  ASP B OD2 
1991 N N   . TYR B 31  ? 0.3622 0.1711 0.1541 -0.0081 -0.0766 0.0502  31  TYR B N   
1992 C CA  . TYR B 31  ? 0.3546 0.1801 0.1560 0.0065  -0.0789 0.0401  31  TYR B CA  
1993 C C   . TYR B 31  ? 0.3628 0.1705 0.1540 0.0196  -0.0875 0.0365  31  TYR B C   
1994 O O   . TYR B 31  ? 0.3841 0.1829 0.1630 0.0216  -0.0891 0.0418  31  TYR B O   
1995 C CB  . TYR B 31  ? 0.3495 0.1992 0.1563 0.0080  -0.0734 0.0396  31  TYR B CB  
1996 C CG  . TYR B 31  ? 0.3018 0.1726 0.1229 0.0208  -0.0751 0.0290  31  TYR B CG  
1997 C CD1 . TYR B 31  ? 0.2898 0.1675 0.1253 0.0269  -0.0763 0.0221  31  TYR B CD1 
1998 C CD2 . TYR B 31  ? 0.2996 0.1849 0.1206 0.0266  -0.0755 0.0254  31  TYR B CD2 
1999 C CE1 . TYR B 31  ? 0.2785 0.1774 0.1307 0.0381  -0.0767 0.0130  31  TYR B CE1 
2000 C CE2 . TYR B 31  ? 0.2854 0.1909 0.1227 0.0371  -0.0775 0.0148  31  TYR B CE2 
2001 C CZ  . TYR B 31  ? 0.2626 0.1749 0.1169 0.0426  -0.0775 0.0091  31  TYR B CZ  
2002 O OH  . TYR B 31  ? 0.2443 0.1785 0.1182 0.0528  -0.0785 -0.0009 31  TYR B OH  
2003 N N   . LYS B 32  ? 0.3642 0.1683 0.1604 0.0292  -0.0925 0.0279  32  LYS B N   
2004 C CA  . LYS B 32  ? 0.4172 0.2047 0.2048 0.0424  -0.1004 0.0234  32  LYS B CA  
2005 C C   . LYS B 32  ? 0.3843 0.1955 0.1871 0.0566  -0.1002 0.0136  32  LYS B C   
2006 O O   . LYS B 32  ? 0.3369 0.1659 0.1556 0.0595  -0.0971 0.0071  32  LYS B O   
2007 C CB  . LYS B 32  ? 0.4748 0.2360 0.2538 0.0426  -0.1069 0.0205  32  LYS B CB  
2008 C CG  . LYS B 32  ? 0.5652 0.3021 0.3315 0.0543  -0.1153 0.0175  32  LYS B CG  
2009 C CD  . LYS B 32  ? 0.5873 0.3343 0.3623 0.0700  -0.1180 0.0048  32  LYS B CD  
2010 C CE  . LYS B 32  ? 0.6339 0.3532 0.3950 0.0804  -0.1269 0.0009  32  LYS B CE  
2011 N NZ  . LYS B 32  ? 0.6192 0.3477 0.3871 0.0946  -0.1290 -0.0120 32  LYS B NZ  
2012 N N   . ILE B 33  ? 0.3726 0.1857 0.1714 0.0653  -0.1033 0.0133  33  ILE B N   
2013 C CA  . ILE B 33  ? 0.3558 0.1919 0.1700 0.0775  -0.1038 0.0041  33  ILE B CA  
2014 C C   . ILE B 33  ? 0.3612 0.1916 0.1789 0.0894  -0.1077 -0.0044 33  ILE B C   
2015 O O   . ILE B 33  ? 0.3905 0.1965 0.1931 0.0945  -0.1139 -0.0037 33  ILE B O   
2016 C CB  . ILE B 33  ? 0.3679 0.2100 0.1767 0.0833  -0.1072 0.0056  33  ILE B CB  
2017 C CG1 . ILE B 33  ? 0.3625 0.2145 0.1672 0.0726  -0.1028 0.0124  33  ILE B CG1 
2018 C CG2 . ILE B 33  ? 0.3538 0.2183 0.1797 0.0957  -0.1090 -0.0050 33  ILE B CG2 
2019 C CD1 . ILE B 33  ? 0.3292 0.2033 0.1509 0.0650  -0.0956 0.0090  33  ILE B CD1 
2020 N N   . VAL B 34  ? 0.3345 0.1880 0.1719 0.0938  -0.1034 -0.0121 34  VAL B N   
2021 C CA  . VAL B 34  ? 0.3365 0.1935 0.1799 0.1062  -0.1052 -0.0210 34  VAL B CA  
2022 C C   . VAL B 34  ? 0.3219 0.2052 0.1825 0.1138  -0.1041 -0.0266 34  VAL B C   
2023 O O   . VAL B 34  ? 0.2950 0.2048 0.1766 0.1121  -0.0978 -0.0296 34  VAL B O   
2024 C CB  . VAL B 34  ? 0.3213 0.1851 0.1729 0.1056  -0.1007 -0.0247 34  VAL B CB  
2025 C CG1 . VAL B 34  ? 0.3249 0.1958 0.1815 0.1188  -0.1015 -0.0337 34  VAL B CG1 
2026 C CG2 . VAL B 34  ? 0.3388 0.1758 0.1728 0.0976  -0.1039 -0.0202 34  VAL B CG2 
2027 N N   . ASN B 35  ? 0.3529 0.2284 0.2050 0.1223  -0.1107 -0.0276 35  ASN B N   
2028 C CA  . ASN B 35  ? 0.3777 0.2762 0.2439 0.1294  -0.1119 -0.0329 35  ASN B CA  
2029 C C   . ASN B 35  ? 0.3437 0.2605 0.2275 0.1369  -0.1088 -0.0413 35  ASN B C   
2030 O O   . ASN B 35  ? 0.3601 0.2681 0.2375 0.1461  -0.1126 -0.0442 35  ASN B O   
2031 C CB  . ASN B 35  ? 0.4325 0.3178 0.2829 0.1362  -0.1204 -0.0299 35  ASN B CB  
2032 C CG  . ASN B 35  ? 0.4631 0.3725 0.3254 0.1407  -0.1229 -0.0341 35  ASN B CG  
2033 O OD1 . ASN B 35  ? 0.4796 0.4129 0.3634 0.1446  -0.1206 -0.0425 35  ASN B OD1 
2034 N ND2 . ASN B 35  ? 0.3771 0.2815 0.2256 0.1395  -0.1276 -0.0282 35  ASN B ND2 
2035 N N   . LEU B 36  ? 0.3182 0.2616 0.2250 0.1328  -0.1014 -0.0442 36  LEU B N   
2036 C CA  . LEU B 36  ? 0.3201 0.2833 0.2454 0.1370  -0.0960 -0.0490 36  LEU B CA  
2037 C C   . LEU B 36  ? 0.3582 0.3335 0.2922 0.1462  -0.1003 -0.0543 36  LEU B C   
2038 O O   . LEU B 36  ? 0.3562 0.3395 0.2979 0.1522  -0.0982 -0.0569 36  LEU B O   
2039 C CB  . LEU B 36  ? 0.2946 0.2827 0.2444 0.1287  -0.0860 -0.0483 36  LEU B CB  
2040 C CG  . LEU B 36  ? 0.2701 0.2513 0.2152 0.1204  -0.0808 -0.0428 36  LEU B CG  
2041 C CD1 . LEU B 36  ? 0.2350 0.2418 0.2069 0.1125  -0.0708 -0.0410 36  LEU B CD1 
2042 C CD2 . LEU B 36  ? 0.2570 0.2264 0.1906 0.1239  -0.0797 -0.0425 36  LEU B CD2 
2043 N N   . MET B 37  ? 0.3901 0.3678 0.3228 0.1477  -0.1065 -0.0555 37  MET B N   
2044 C CA  . MET B 37  ? 0.4359 0.4247 0.3755 0.1572  -0.1124 -0.0604 37  MET B CA  
2045 C C   . MET B 37  ? 0.4583 0.4261 0.3787 0.1679  -0.1192 -0.0592 37  MET B C   
2046 O O   . MET B 37  ? 0.4910 0.4688 0.4196 0.1772  -0.1219 -0.0630 37  MET B O   
2047 C CB  . MET B 37  ? 0.4551 0.4516 0.3954 0.1567  -0.1184 -0.0622 37  MET B CB  
2048 C CG  . MET B 37  ? 0.4490 0.4719 0.4152 0.1485  -0.1127 -0.0670 37  MET B CG  
2049 S SD  . MET B 37  ? 0.7693 0.8187 0.7682 0.1488  -0.1050 -0.0712 37  MET B SD  
2050 C CE  . MET B 37  ? 0.2945 0.3630 0.3198 0.1347  -0.0939 -0.0712 37  MET B CE  
2051 N N   . ASN B 38  ? 0.4479 0.3865 0.3443 0.1665  -0.1218 -0.0537 38  ASN B N   
2052 C CA  . ASN B 38  ? 0.4733 0.3884 0.3515 0.1759  -0.1279 -0.0523 38  ASN B CA  
2053 C C   . ASN B 38  ? 0.4737 0.3851 0.3527 0.1772  -0.1232 -0.0553 38  ASN B C   
2054 O O   . ASN B 38  ? 0.4931 0.3808 0.3552 0.1831  -0.1277 -0.0548 38  ASN B O   
2055 C CB  . ASN B 38  ? 0.4909 0.3749 0.3437 0.1727  -0.1332 -0.0440 38  ASN B CB  
2056 C CG  . ASN B 38  ? 0.5166 0.3782 0.3526 0.1840  -0.1416 -0.0413 38  ASN B CG  
2057 O OD1 . ASN B 38  ? 0.5263 0.3994 0.3690 0.1949  -0.1459 -0.0444 38  ASN B OD1 
2058 N ND2 . ASN B 38  ? 0.5370 0.3665 0.3524 0.1811  -0.1442 -0.0349 38  ASN B ND2 
2059 N N   . LYS B 39  ? 0.4318 0.3671 0.3306 0.1717  -0.1143 -0.0578 39  LYS B N   
2060 C CA  . LYS B 39  ? 0.4262 0.3640 0.3274 0.1727  -0.1085 -0.0598 39  LYS B CA  
2061 C C   . LYS B 39  ? 0.4252 0.3325 0.3026 0.1704  -0.1115 -0.0580 39  LYS B C   
2062 O O   . LYS B 39  ? 0.4647 0.3627 0.3337 0.1764  -0.1124 -0.0612 39  LYS B O   
2063 C CB  . LYS B 39  ? 0.4681 0.4136 0.3749 0.1850  -0.1098 -0.0642 39  LYS B CB  
2064 C CG  . LYS B 39  ? 0.4817 0.4589 0.4156 0.1868  -0.1062 -0.0661 39  LYS B CG  
2065 C CD  . LYS B 39  ? 0.4765 0.4785 0.4328 0.1814  -0.0942 -0.0652 39  LYS B CD  
2066 C CE  . LYS B 39  ? 0.4928 0.5162 0.4694 0.1892  -0.0908 -0.0673 39  LYS B CE  
2067 N NZ  . LYS B 39  ? 0.4907 0.5360 0.4909 0.1872  -0.0913 -0.0680 39  LYS B NZ  
2068 N N   . GLU B 40  ? 0.3926 0.2846 0.2596 0.1616  -0.1135 -0.0528 40  GLU B N   
2069 C CA  . GLU B 40  ? 0.4010 0.2610 0.2458 0.1577  -0.1177 -0.0496 40  GLU B CA  
2070 C C   . GLU B 40  ? 0.3820 0.2438 0.2274 0.1528  -0.1127 -0.0513 40  GLU B C   
2071 O O   . GLU B 40  ? 0.4031 0.2389 0.2306 0.1523  -0.1177 -0.0515 40  GLU B O   
2072 C CB  . GLU B 40  ? 0.4074 0.2525 0.2424 0.1485  -0.1203 -0.0415 40  GLU B CB  
2073 C CG  . GLU B 40  ? 0.4497 0.2826 0.2743 0.1553  -0.1278 -0.0382 40  GLU B CG  
2074 C CD  . GLU B 40  ? 0.4939 0.3174 0.3091 0.1466  -0.1292 -0.0287 40  GLU B CD  
2075 O OE1 . GLU B 40  ? 0.4633 0.2826 0.2763 0.1345  -0.1252 -0.0239 40  GLU B OE1 
2076 O OE2 . GLU B 40  ? 0.5272 0.3494 0.3371 0.1524  -0.1342 -0.0253 40  GLU B OE2 
2077 N N   . GLN B 41  ? 0.3427 0.2344 0.2087 0.1493  -0.1034 -0.0519 41  GLN B N   
2078 C CA  . GLN B 41  ? 0.3319 0.2295 0.1994 0.1474  -0.0982 -0.0532 41  GLN B CA  
2079 C C   . GLN B 41  ? 0.3512 0.2444 0.2100 0.1589  -0.1008 -0.0598 41  GLN B C   
2080 O O   . GLN B 41  ? 0.4036 0.2925 0.2546 0.1596  -0.1004 -0.0621 41  GLN B O   
2081 C CB  . GLN B 41  ? 0.2955 0.2274 0.1888 0.1416  -0.0865 -0.0503 41  GLN B CB  
2082 C CG  . GLN B 41  ? 0.2986 0.2587 0.2124 0.1475  -0.0798 -0.0525 41  GLN B CG  
2083 C CD  . GLN B 41  ? 0.2934 0.2644 0.2207 0.1481  -0.0813 -0.0528 41  GLN B CD  
2084 O OE1 . GLN B 41  ? 0.3344 0.2881 0.2489 0.1499  -0.0898 -0.0535 41  GLN B OE1 
2085 N NE2 . GLN B 41  ? 0.2598 0.2590 0.2133 0.1464  -0.0730 -0.0517 41  GLN B NE2 
2086 N N   . HIS B 42  ? 0.3670 0.2622 0.2272 0.1686  -0.1039 -0.0632 42  HIS B N   
2087 C CA  . HIS B 42  ? 0.3854 0.2780 0.2389 0.1806  -0.1061 -0.0695 42  HIS B CA  
2088 C C   . HIS B 42  ? 0.4889 0.3452 0.3186 0.1868  -0.1178 -0.0723 42  HIS B C   
2089 O O   . HIS B 42  ? 0.4459 0.2975 0.2699 0.1981  -0.1208 -0.0781 42  HIS B O   
2090 C CB  . HIS B 42  ? 0.3789 0.2973 0.2511 0.1883  -0.1013 -0.0711 42  HIS B CB  
2091 C CG  . HIS B 42  ? 0.3902 0.3429 0.2874 0.1827  -0.0890 -0.0679 42  HIS B CG  
2092 N ND1 . HIS B 42  ? 0.3826 0.3532 0.3001 0.1750  -0.0846 -0.0635 42  HIS B ND1 
2093 C CD2 . HIS B 42  ? 0.3754 0.3466 0.2807 0.1835  -0.0802 -0.0676 42  HIS B CD2 
2094 C CE1 . HIS B 42  ? 0.3417 0.3386 0.2807 0.1703  -0.0733 -0.0601 42  HIS B CE1 
2095 N NE2 . HIS B 42  ? 0.3644 0.3624 0.2960 0.1753  -0.0700 -0.0618 42  HIS B NE2 
2096 N N   . SER B 43  ? 0.5605 0.3908 0.3774 0.1793  -0.1239 -0.0676 43  SER B N   
2102 N N   . GLU B 44  ? 0.5981 0.3901 0.4766 0.1594  -0.1029 -0.0226 44  GLU B N   
2103 C CA  . GLU B 44  ? 0.5426 0.3238 0.4271 0.1560  -0.1040 -0.0269 44  GLU B CA  
2104 C C   . GLU B 44  ? 0.4841 0.2608 0.3716 0.1484  -0.1041 -0.0254 44  GLU B C   
2105 O O   . GLU B 44  ? 0.4566 0.2330 0.3419 0.1427  -0.1083 -0.0329 44  GLU B O   
2106 C CB  . GLU B 44  ? 0.5658 0.3327 0.4661 0.1639  -0.0983 -0.0215 44  GLU B CB  
2107 C CG  . GLU B 44  ? 0.5838 0.3460 0.4873 0.1649  -0.1002 -0.0315 44  GLU B CG  
2108 C CD  . GLU B 44  ? 0.6206 0.3651 0.5435 0.1726  -0.0924 -0.0271 44  GLU B CD  
2109 O OE1 . GLU B 44  ? 0.6489 0.3936 0.5757 0.1819  -0.0893 -0.0213 44  GLU B OE1 
2110 O OE2 . GLU B 44  ? 0.6186 0.3486 0.5547 0.1698  -0.0884 -0.0299 44  GLU B OE2 
2111 N N   . GLU B 45  ? 0.4803 0.2549 0.3732 0.1494  -0.0995 -0.0150 45  GLU B N   
2112 C CA  . GLU B 45  ? 0.5057 0.2769 0.4027 0.1429  -0.0989 -0.0126 45  GLU B CA  
2113 C C   . GLU B 45  ? 0.4797 0.2629 0.3631 0.1349  -0.1055 -0.0219 45  GLU B C   
2114 O O   . GLU B 45  ? 0.4685 0.2496 0.3535 0.1291  -0.1084 -0.0260 45  GLU B O   
2115 C CB  . GLU B 45  ? 0.5651 0.3341 0.4703 0.1468  -0.0923 0.0020  45  GLU B CB  
2116 C CG  . GLU B 45  ? 0.6453 0.3971 0.5702 0.1537  -0.0837 0.0139  45  GLU B CG  
2117 C CD  . GLU B 45  ? 0.7067 0.4560 0.6425 0.1574  -0.0772 0.0314  45  GLU B CD  
2118 O OE1 . GLU B 45  ? 0.7152 0.4784 0.6414 0.1553  -0.0798 0.0334  45  GLU B OE1 
2119 O OE2 . GLU B 45  ? 0.7409 0.4739 0.6965 0.1626  -0.0690 0.0434  45  GLU B OE2 
2120 N N   . TYR B 46  ? 0.4083 0.2035 0.2804 0.1352  -0.1074 -0.0253 46  TYR B N   
2121 C CA  . TYR B 46  ? 0.3906 0.1946 0.2529 0.1284  -0.1116 -0.0333 46  TYR B CA  
2122 C C   . TYR B 46  ? 0.3847 0.1906 0.2404 0.1258  -0.1167 -0.0425 46  TYR B C   
2123 O O   . TYR B 46  ? 0.4000 0.2085 0.2516 0.1206  -0.1201 -0.0471 46  TYR B O   
2124 C CB  . TYR B 46  ? 0.3823 0.1970 0.2390 0.1299  -0.1101 -0.0342 46  TYR B CB  
2125 C CG  . TYR B 46  ? 0.3670 0.1878 0.2184 0.1233  -0.1123 -0.0406 46  TYR B CG  
2126 C CD1 . TYR B 46  ? 0.3631 0.1837 0.2175 0.1197  -0.1117 -0.0381 46  TYR B CD1 
2127 C CD2 . TYR B 46  ? 0.3809 0.2069 0.2261 0.1215  -0.1141 -0.0480 46  TYR B CD2 
2128 C CE1 . TYR B 46  ? 0.3508 0.1763 0.2020 0.1148  -0.1134 -0.0438 46  TYR B CE1 
2129 C CE2 . TYR B 46  ? 0.3470 0.1769 0.1900 0.1165  -0.1150 -0.0522 46  TYR B CE2 
2130 C CZ  . TYR B 46  ? 0.3435 0.1730 0.1894 0.1133  -0.1148 -0.0505 46  TYR B CZ  
2131 O OH  . TYR B 46  ? 0.3339 0.1669 0.1792 0.1092  -0.1156 -0.0544 46  TYR B OH  
2132 N N   . LEU B 47  ? 0.3910 0.1964 0.2457 0.1306  -0.1169 -0.0445 47  LEU B N   
2133 C CA  . LEU B 47  ? 0.4107 0.2189 0.2592 0.1299  -0.1210 -0.0517 47  LEU B CA  
2134 C C   . LEU B 47  ? 0.4233 0.2263 0.2763 0.1281  -0.1246 -0.0540 47  LEU B C   
2135 O O   . LEU B 47  ? 0.4467 0.2541 0.2935 0.1271  -0.1287 -0.0595 47  LEU B O   
2136 C CB  . LEU B 47  ? 0.4189 0.2280 0.2672 0.1363  -0.1202 -0.0532 47  LEU B CB  
2137 C CG  . LEU B 47  ? 0.4116 0.2294 0.2552 0.1388  -0.1181 -0.0540 47  LEU B CG  
2138 C CD1 . LEU B 47  ? 0.4103 0.2286 0.2563 0.1463  -0.1173 -0.0549 47  LEU B CD1 
2139 C CD2 . LEU B 47  ? 0.3770 0.2021 0.2130 0.1344  -0.1191 -0.0586 47  LEU B CD2 
2140 N N   . LYS B 48  ? 0.4294 0.2228 0.2947 0.1288  -0.1222 -0.0494 48  LYS B N   
2141 C CA  . LYS B 48  ? 0.4506 0.2394 0.3238 0.1268  -0.1249 -0.0526 48  LYS B CA  
2142 C C   . LYS B 48  ? 0.4502 0.2456 0.3177 0.1210  -0.1287 -0.0542 48  LYS B C   
2143 O O   . LYS B 48  ? 0.4398 0.2397 0.3048 0.1203  -0.1342 -0.0602 48  LYS B O   
2144 C CB  . LYS B 48  ? 0.4883 0.2622 0.3796 0.1283  -0.1182 -0.0472 48  LYS B CB  
2145 C CG  . LYS B 48  ? 0.5191 0.2865 0.4226 0.1259  -0.1190 -0.0529 48  LYS B CG  
2146 C CD  . LYS B 48  ? 0.5560 0.3041 0.4803 0.1264  -0.1086 -0.0482 48  LYS B CD  
2147 C CE  . LYS B 48  ? 0.5555 0.2988 0.4908 0.1210  -0.1079 -0.0535 48  LYS B CE  
2148 N NZ  . LYS B 48  ? 0.5373 0.2928 0.4672 0.1202  -0.1174 -0.0663 48  LYS B NZ  
2149 N N   . LYS B 49  ? 0.4333 0.2302 0.2993 0.1181  -0.1257 -0.0491 49  LYS B N   
2150 C CA  . LYS B 49  ? 0.4187 0.2213 0.2808 0.1130  -0.1281 -0.0508 49  LYS B CA  
2151 C C   . LYS B 49  ? 0.4045 0.2153 0.2534 0.1120  -0.1310 -0.0571 49  LYS B C   
2152 O O   . LYS B 49  ? 0.4183 0.2322 0.2641 0.1098  -0.1342 -0.0608 49  LYS B O   
2153 C CB  . LYS B 49  ? 0.4250 0.2279 0.2896 0.1114  -0.1233 -0.0444 49  LYS B CB  
2154 C CG  . LYS B 49  ? 0.4416 0.2348 0.3198 0.1133  -0.1179 -0.0354 49  LYS B CG  
2155 C CD  . LYS B 49  ? 0.4582 0.2546 0.3373 0.1132  -0.1133 -0.0282 49  LYS B CD  
2156 C CE  . LYS B 49  ? 0.4851 0.2709 0.3790 0.1161  -0.1062 -0.0163 49  LYS B CE  
2157 N NZ  . LYS B 49  ? 0.4864 0.2652 0.3911 0.1121  -0.1064 -0.0172 49  LYS B NZ  
2158 N N   . ASN B 50  ? 0.3982 0.2114 0.2409 0.1143  -0.1287 -0.0578 50  ASN B N   
2159 C CA  . ASN B 50  ? 0.3564 0.1750 0.1899 0.1138  -0.1282 -0.0617 50  ASN B CA  
2160 C C   . ASN B 50  ? 0.3594 0.1799 0.1888 0.1180  -0.1267 -0.0628 50  ASN B C   
2161 O O   . ASN B 50  ? 0.3578 0.1806 0.1881 0.1192  -0.1234 -0.0612 50  ASN B O   
2162 C CB  . ASN B 50  ? 0.3466 0.1698 0.1829 0.1101  -0.1235 -0.0594 50  ASN B CB  
2163 C CG  . ASN B 50  ? 0.3374 0.1683 0.1762 0.1086  -0.1181 -0.0584 50  ASN B CG  
2164 O OD1 . ASN B 50  ? 0.3447 0.1767 0.1815 0.1103  -0.1173 -0.0589 50  ASN B OD1 
2165 N ND2 . ASN B 50  ? 0.3320 0.1668 0.1739 0.1067  -0.1154 -0.0573 50  ASN B ND2 
2166 N N   . PRO B 51  ? 0.3623 0.1845 0.1911 0.1206  -0.1277 -0.0647 51  PRO B N   
2167 C CA  . PRO B 51  ? 0.3815 0.2055 0.2062 0.1256  -0.1268 -0.0661 51  PRO B CA  
2168 C C   . PRO B 51  ? 0.3745 0.2046 0.1990 0.1247  -0.1205 -0.0640 51  PRO B C   
2169 O O   . PRO B 51  ? 0.4098 0.2416 0.2315 0.1289  -0.1199 -0.0651 51  PRO B O   
2170 C CB  . PRO B 51  ? 0.3702 0.1966 0.1948 0.1288  -0.1286 -0.0686 51  PRO B CB  
2171 C CG  . PRO B 51  ? 0.3919 0.2147 0.2208 0.1272  -0.1340 -0.0701 51  PRO B CG  
2172 C CD  . PRO B 51  ? 0.3698 0.1922 0.2015 0.1208  -0.1311 -0.0666 51  PRO B CD  
2173 N N   . GLN B 52  ? 0.3703 0.2030 0.1978 0.1202  -0.1169 -0.0616 52  GLN B N   
2174 C CA  . GLN B 52  ? 0.3805 0.2166 0.2079 0.1204  -0.1131 -0.0603 52  GLN B CA  
2175 C C   . GLN B 52  ? 0.4140 0.2525 0.2451 0.1196  -0.1132 -0.0604 52  GLN B C   
2176 O O   . GLN B 52  ? 0.4070 0.2493 0.2399 0.1203  -0.1114 -0.0602 52  GLN B O   
2177 C CB  . GLN B 52  ? 0.3677 0.2036 0.1952 0.1182  -0.1110 -0.0585 52  GLN B CB  
2178 C CG  . GLN B 52  ? 0.4414 0.2752 0.2630 0.1215  -0.1106 -0.0588 52  GLN B CG  
2179 C CD  . GLN B 52  ? 0.4584 0.2895 0.2771 0.1216  -0.1095 -0.0574 52  GLN B CD  
2180 O OE1 . GLN B 52  ? 0.4896 0.3200 0.3074 0.1222  -0.1103 -0.0581 52  GLN B OE1 
2181 N NE2 . GLN B 52  ? 0.4403 0.2732 0.2644 0.1207  -0.1059 -0.0531 52  GLN B NE2 
2182 N N   . HIS B 53  ? 0.3447 0.1801 0.1758 0.1198  -0.1159 -0.0611 53  HIS B N   
2183 C CA  . HIS B 53  ? 0.3435 0.1814 0.1775 0.1210  -0.1154 -0.0609 53  HIS B CA  
2184 C C   . HIS B 53  ? 0.3336 0.1772 0.1724 0.1179  -0.1134 -0.0609 53  HIS B C   
2185 O O   . HIS B 53  ? 0.3302 0.1804 0.1731 0.1200  -0.1122 -0.0619 53  HIS B O   
2186 C CB  . HIS B 53  ? 0.3526 0.1940 0.1881 0.1269  -0.1144 -0.0611 53  HIS B CB  
2187 C CG  . HIS B 53  ? 0.3614 0.2075 0.1967 0.1287  -0.1131 -0.0625 53  HIS B CG  
2188 N ND1 . HIS B 53  ? 0.3534 0.2076 0.1948 0.1285  -0.1108 -0.0627 53  HIS B ND1 
2189 C CD2 . HIS B 53  ? 0.3843 0.2293 0.2162 0.1314  -0.1133 -0.0632 53  HIS B CD2 
2190 C CE1 . HIS B 53  ? 0.3581 0.2150 0.2007 0.1307  -0.1090 -0.0623 53  HIS B CE1 
2191 N NE2 . HIS B 53  ? 0.3748 0.2264 0.2105 0.1328  -0.1103 -0.0627 53  HIS B NE2 
2192 N N   . THR B 54  ? 0.3284 0.1714 0.1701 0.1130  -0.1125 -0.0591 54  THR B N   
2193 C CA  . THR B 54  ? 0.3201 0.1681 0.1681 0.1104  -0.1111 -0.0587 54  THR B CA  
2194 C C   . THR B 54  ? 0.3178 0.1654 0.1681 0.1079  -0.1115 -0.0582 54  THR B C   
2195 O O   . THR B 54  ? 0.3226 0.1645 0.1696 0.1073  -0.1131 -0.0576 54  THR B O   
2196 C CB  . THR B 54  ? 0.3188 0.1656 0.1665 0.1090  -0.1104 -0.0576 54  THR B CB  
2197 O OG1 . THR B 54  ? 0.3500 0.1921 0.1938 0.1078  -0.1106 -0.0565 54  THR B OG1 
2198 C CG2 . THR B 54  ? 0.3616 0.2091 0.2080 0.1125  -0.1091 -0.0571 54  THR B CG2 
2199 N N   . VAL B 55  ? 0.3115 0.1650 0.1677 0.1073  -0.1108 -0.0590 55  VAL B N   
2200 C CA  . VAL B 55  ? 0.3086 0.1629 0.1676 0.1055  -0.1109 -0.0587 55  VAL B CA  
2201 C C   . VAL B 55  ? 0.3016 0.1601 0.1672 0.1027  -0.1106 -0.0588 55  VAL B C   
2202 O O   . VAL B 55  ? 0.3000 0.1614 0.1686 0.1039  -0.1112 -0.0599 55  VAL B O   
2203 C CB  . VAL B 55  ? 0.3112 0.1686 0.1691 0.1103  -0.1112 -0.0608 55  VAL B CB  
2204 C CG1 . VAL B 55  ? 0.3220 0.1739 0.1737 0.1147  -0.1113 -0.0586 55  VAL B CG1 
2205 C CG2 . VAL B 55  ? 0.3057 0.1735 0.1703 0.1127  -0.1105 -0.0637 55  VAL B CG2 
2206 N N   . PRO B 56  ? 0.2996 0.1572 0.1672 0.1003  -0.1109 -0.0580 56  PRO B N   
2213 N N   . LEU B 57  ? 0.1752 0.0763 0.1419 0.0002  -0.0500 0.0122  57  LEU B N   
2214 C CA  . LEU B 57  ? 0.1549 0.0486 0.1197 -0.0022 -0.0479 0.0094  57  LEU B CA  
2215 C C   . LEU B 57  ? 0.1627 0.0520 0.1152 -0.0105 -0.0488 0.0146  57  LEU B C   
2216 O O   . LEU B 57  ? 0.1708 0.0574 0.1183 -0.0128 -0.0512 0.0201  57  LEU B O   
2217 C CB  . LEU B 57  ? 0.1860 0.0702 0.1609 0.0009  -0.0488 0.0075  57  LEU B CB  
2218 C CG  . LEU B 57  ? 0.2240 0.0974 0.1962 -0.0030 -0.0474 0.0040  57  LEU B CG  
2219 C CD1 . LEU B 57  ? 0.1961 0.0733 0.1666 -0.0025 -0.0420 -0.0041 57  LEU B CD1 
2220 C CD2 . LEU B 57  ? 0.2157 0.0780 0.1976 0.0007  -0.0483 0.0027  57  LEU B CD2 
2221 N N   . LEU B 58  ? 0.1750 0.0643 0.1232 -0.0155 -0.0462 0.0129  58  LEU B N   
2222 C CA  . LEU B 58  ? 0.1695 0.0571 0.1106 -0.0245 -0.0455 0.0183  58  LEU B CA  
2223 C C   . LEU B 58  ? 0.1814 0.0609 0.1261 -0.0292 -0.0465 0.0157  58  LEU B C   
2224 O O   . LEU B 58  ? 0.1978 0.0785 0.1454 -0.0287 -0.0456 0.0084  58  LEU B O   
2225 C CB  . LEU B 58  ? 0.1843 0.0826 0.1206 -0.0288 -0.0413 0.0195  58  LEU B CB  
2226 C CG  . LEU B 58  ? 0.1954 0.0977 0.1286 -0.0377 -0.0376 0.0263  58  LEU B CG  
2227 C CD1 . LEU B 58  ? 0.2074 0.1134 0.1336 -0.0354 -0.0340 0.0311  58  LEU B CD1 
2228 C CD2 . LEU B 58  ? 0.2079 0.1225 0.1446 -0.0439 -0.0342 0.0264  58  LEU B CD2 
2229 N N   . GLU B 59  ? 0.2031 0.0746 0.1470 -0.0338 -0.0483 0.0210  59  GLU B N   
2230 C CA  . GLU B 59  ? 0.2381 0.1028 0.1852 -0.0402 -0.0494 0.0197  59  GLU B CA  
2231 C C   . GLU B 59  ? 0.2457 0.1176 0.1911 -0.0502 -0.0467 0.0261  59  GLU B C   
2232 O O   . GLU B 59  ? 0.2682 0.1410 0.2090 -0.0527 -0.0444 0.0339  59  GLU B O   
2233 C CB  . GLU B 59  ? 0.3034 0.1539 0.2529 -0.0388 -0.0529 0.0217  59  GLU B CB  
2234 C CG  . GLU B 59  ? 0.3462 0.1909 0.3023 -0.0293 -0.0540 0.0151  59  GLU B CG  
2235 C CD  . GLU B 59  ? 0.3928 0.2227 0.3529 -0.0282 -0.0576 0.0173  59  GLU B CD  
2236 O OE1 . GLU B 59  ? 0.3603 0.1856 0.3159 -0.0332 -0.0601 0.0257  59  GLU B OE1 
2237 O OE2 . GLU B 59  ? 0.4338 0.2562 0.4012 -0.0224 -0.0570 0.0108  59  GLU B OE2 
2238 N N   . ASP B 60  ? 0.2098 0.0886 0.1598 -0.0555 -0.0464 0.0225  60  ASP B N   
2239 C CA  . ASP B 60  ? 0.2091 0.0994 0.1637 -0.0649 -0.0433 0.0285  60  ASP B CA  
2240 C C   . ASP B 60  ? 0.2299 0.1158 0.1920 -0.0722 -0.0471 0.0266  60  ASP B C   
2241 O O   . ASP B 60  ? 0.2179 0.1075 0.1832 -0.0732 -0.0501 0.0197  60  ASP B O   
2242 C CB  . ASP B 60  ? 0.2211 0.1284 0.1776 -0.0647 -0.0404 0.0268  60  ASP B CB  
2243 C CG  . ASP B 60  ? 0.1949 0.1187 0.1610 -0.0727 -0.0355 0.0336  60  ASP B CG  
2244 O OD1 . ASP B 60  ? 0.2467 0.1728 0.2109 -0.0740 -0.0290 0.0414  60  ASP B OD1 
2245 O OD2 . ASP B 60  ? 0.2284 0.1639 0.2045 -0.0768 -0.0377 0.0310  60  ASP B OD2 
2246 N N   . GLY B 61  ? 0.2740 0.1512 0.2378 -0.0771 -0.0474 0.0325  61  GLY B N   
2247 C CA  . GLY B 61  ? 0.3182 0.1867 0.2879 -0.0831 -0.0521 0.0299  61  GLY B CA  
2248 C C   . GLY B 61  ? 0.3113 0.1659 0.2763 -0.0761 -0.0566 0.0193  61  GLY B C   
2249 O O   . GLY B 61  ? 0.3222 0.1660 0.2826 -0.0685 -0.0566 0.0182  61  GLY B O   
2250 N N   . ASP B 62  ? 0.3230 0.1787 0.2896 -0.0782 -0.0597 0.0115  62  ASP B N   
2251 C CA  . ASP B 62  ? 0.3381 0.1804 0.2991 -0.0721 -0.0617 0.0006  62  ASP B CA  
2252 C C   . ASP B 62  ? 0.3114 0.1609 0.2669 -0.0631 -0.0583 -0.0060 62  ASP B C   
2253 O O   . ASP B 62  ? 0.3195 0.1601 0.2706 -0.0567 -0.0572 -0.0151 62  ASP B O   
2254 C CB  . ASP B 62  ? 0.3574 0.1949 0.3192 -0.0791 -0.0668 -0.0050 62  ASP B CB  
2255 C CG  . ASP B 62  ? 0.4051 0.2324 0.3729 -0.0878 -0.0704 0.0004  62  ASP B CG  
2256 O OD1 . ASP B 62  ? 0.4230 0.2386 0.3909 -0.0857 -0.0694 0.0046  62  ASP B OD1 
2257 O OD2 . ASP B 62  ? 0.4481 0.2794 0.4213 -0.0968 -0.0748 0.0010  62  ASP B OD2 
2258 N N   . ALA B 63  ? 0.2824 0.1481 0.2388 -0.0628 -0.0558 -0.0015 63  ALA B N   
2259 C CA  . ALA B 63  ? 0.2635 0.1370 0.2153 -0.0549 -0.0526 -0.0069 63  ALA B CA  
2260 C C   . ALA B 63  ? 0.2779 0.1471 0.2284 -0.0457 -0.0496 -0.0058 63  ALA B C   
2261 O O   . ALA B 63  ? 0.2869 0.1542 0.2387 -0.0463 -0.0498 0.0022  63  ALA B O   
2262 C CB  . ALA B 63  ? 0.2684 0.1611 0.2226 -0.0584 -0.0517 -0.0030 63  ALA B CB  
2263 N N   . ASN B 64  ? 0.2508 0.1195 0.1991 -0.0374 -0.0465 -0.0134 64  ASN B N   
2264 C CA  . ASN B 64  ? 0.2849 0.1520 0.2358 -0.0283 -0.0441 -0.0126 64  ASN B CA  
2265 C C   . ASN B 64  ? 0.2287 0.1083 0.1775 -0.0234 -0.0404 -0.0158 64  ASN B C   
2266 O O   . ASN B 64  ? 0.2725 0.1532 0.2183 -0.0211 -0.0373 -0.0238 64  ASN B O   
2267 C CB  . ASN B 64  ? 0.3552 0.2092 0.3096 -0.0224 -0.0421 -0.0195 64  ASN B CB  
2268 C CG  . ASN B 64  ? 0.4363 0.2807 0.3972 -0.0199 -0.0445 -0.0137 64  ASN B CG  
2269 O OD1 . ASN B 64  ? 0.4521 0.2897 0.4123 -0.0262 -0.0485 -0.0081 64  ASN B OD1 
2270 N ND2 . ASN B 64  ? 0.4710 0.3152 0.4392 -0.0110 -0.0420 -0.0146 64  ASN B ND2 
2271 N N   . ILE B 65  ? 0.2180 0.1060 0.1668 -0.0221 -0.0405 -0.0097 65  ILE B N   
2272 C CA  . ILE B 65  ? 0.2169 0.1167 0.1639 -0.0179 -0.0374 -0.0122 65  ILE B CA  
2273 C C   . ILE B 65  ? 0.1745 0.0744 0.1265 -0.0100 -0.0369 -0.0097 65  ILE B C   
2274 O O   . ILE B 65  ? 0.1728 0.0709 0.1251 -0.0107 -0.0400 -0.0023 65  ILE B O   
2275 C CB  . ILE B 65  ? 0.2258 0.1384 0.1696 -0.0242 -0.0381 -0.0076 65  ILE B CB  
2276 C CG1 . ILE B 65  ? 0.2665 0.1827 0.2104 -0.0324 -0.0398 -0.0085 65  ILE B CG1 
2277 C CG2 . ILE B 65  ? 0.1820 0.1088 0.1249 -0.0191 -0.0346 -0.0099 65  ILE B CG2 
2278 C CD1 . ILE B 65  ? 0.2844 0.2008 0.2313 -0.0416 -0.0421 -0.0004 65  ILE B CD1 
2279 N N   . ALA B 66  ? 0.1786 0.0817 0.1351 -0.0027 -0.0327 -0.0154 66  ALA B N   
2280 C CA  . ALA B 66  ? 0.1774 0.0854 0.1424 0.0044  -0.0323 -0.0127 66  ALA B CA  
2281 C C   . ALA B 66  ? 0.1401 0.0595 0.1014 0.0059  -0.0302 -0.0134 66  ALA B C   
2282 O O   . ALA B 66  ? 0.1481 0.0736 0.1010 0.0021  -0.0281 -0.0167 66  ALA B O   
2283 C CB  . ALA B 66  ? 0.1844 0.0893 0.1617 0.0112  -0.0278 -0.0171 66  ALA B CB  
2284 N N   . ASP B 67  ? 0.1125 0.0379 0.0813 0.0107  -0.0313 -0.0093 67  ASP B N   
2285 C CA  . ASP B 67  ? 0.1330 0.0714 0.1012 0.0125  -0.0296 -0.0079 67  ASP B CA  
2286 C C   . ASP B 67  ? 0.1125 0.0564 0.0714 0.0078  -0.0319 -0.0022 67  ASP B C   
2287 O O   . ASP B 67  ? 0.1098 0.0568 0.0617 0.0024  -0.0305 -0.0023 67  ASP B O   
2288 C CB  . ASP B 67  ? 0.1348 0.0824 0.1005 0.0134  -0.0228 -0.0137 67  ASP B CB  
2289 C CG  . ASP B 67  ? 0.0991 0.0590 0.0694 0.0166  -0.0209 -0.0112 67  ASP B CG  
2290 O OD1 . ASP B 67  ? 0.1039 0.0714 0.0681 0.0139  -0.0224 -0.0077 67  ASP B OD1 
2291 O OD2 . ASP B 67  ? 0.1060 0.0677 0.0874 0.0218  -0.0178 -0.0126 67  ASP B OD2 
2292 N N   . SER B 68  ? 0.0999 0.0492 0.0634 0.0083  -0.0315 0.0008  68  SER B N   
2293 C CA  . SER B 68  ? 0.0900 0.0455 0.0504 0.0042  -0.0275 0.0038  68  SER B CA  
2294 C C   . SER B 68  ? 0.0910 0.0600 0.0524 0.0030  -0.0214 0.0034  68  SER B C   
2295 O O   . SER B 68  ? 0.0803 0.0534 0.0390 0.0002  -0.0192 0.0055  68  SER B O   
2296 C CB  . SER B 68  ? 0.0824 0.0415 0.0472 0.0052  -0.0270 0.0046  68  SER B CB  
2297 O OG  . SER B 68  ? 0.0790 0.0470 0.0506 0.0075  -0.0240 0.0030  68  SER B OG  
2298 N N   . HIS B 69  ? 0.0608 0.0371 0.0266 0.0052  -0.0192 0.0009  69  HIS B N   
2299 C CA  . HIS B 69  ? 0.0716 0.0619 0.0409 0.0033  -0.0145 0.0012  69  HIS B CA  
2300 C C   . HIS B 69  ? 0.0594 0.0511 0.0249 0.0004  -0.0154 -0.0001 69  HIS B C   
2301 O O   . HIS B 69  ? 0.0531 0.0532 0.0198 -0.0006 -0.0142 0.0011  69  HIS B O   
2302 C CB  . HIS B 69  ? 0.0674 0.0613 0.0403 0.0053  -0.0129 -0.0002 69  HIS B CB  
2303 C CG  . HIS B 69  ? 0.0643 0.0545 0.0403 0.0085  -0.0138 -0.0001 69  HIS B CG  
2304 N ND1 . HIS B 69  ? 0.0767 0.0606 0.0535 0.0122  -0.0171 -0.0017 69  HIS B ND1 
2305 C CD2 . HIS B 69  ? 0.0694 0.0593 0.0468 0.0091  -0.0135 0.0006  69  HIS B CD2 
2306 C CE1 . HIS B 69  ? 0.0960 0.0813 0.0789 0.0123  -0.0176 -0.0001 69  HIS B CE1 
2307 N NE2 . HIS B 69  ? 0.0683 0.0552 0.0491 0.0107  -0.0160 0.0004  69  HIS B NE2 
2308 N N   . ALA B 70  ? 0.0713 0.0524 0.0310 -0.0002 -0.0186 -0.0035 70  ALA B N   
2309 C CA  . ALA B 70  ? 0.0987 0.0775 0.0541 -0.0052 -0.0208 -0.0054 70  ALA B CA  
2310 C C   . ALA B 70  ? 0.0824 0.0557 0.0344 -0.0107 -0.0239 -0.0012 70  ALA B C   
2311 O O   . ALA B 70  ? 0.0960 0.0744 0.0486 -0.0163 -0.0252 0.0003  70  ALA B O   
2312 C CB  . ALA B 70  ? 0.0919 0.0578 0.0414 -0.0050 -0.0225 -0.0114 70  ALA B CB  
2313 N N   . ILE B 71  ? 0.0979 0.0599 0.0460 -0.0099 -0.0263 0.0016  71  ILE B N   
2314 C CA  . ILE B 71  ? 0.1196 0.0741 0.0614 -0.0157 -0.0288 0.0074  71  ILE B CA  
2315 C C   . ILE B 71  ? 0.0917 0.0597 0.0362 -0.0166 -0.0230 0.0115  71  ILE B C   
2316 O O   . ILE B 71  ? 0.0975 0.0687 0.0412 -0.0236 -0.0222 0.0158  71  ILE B O   
2317 C CB  . ILE B 71  ? 0.1279 0.0685 0.0667 -0.0128 -0.0316 0.0103  71  ILE B CB  
2318 C CG1 . ILE B 71  ? 0.1409 0.0679 0.0833 -0.0111 -0.0357 0.0062  71  ILE B CG1 
2319 C CG2 . ILE B 71  ? 0.1175 0.0533 0.0516 -0.0182 -0.0304 0.0166  71  ILE B CG2 
2320 C CD1 . ILE B 71  ? 0.1451 0.0615 0.0895 -0.0072 -0.0400 0.0090  71  ILE B CD1 
2321 N N   . MET B 72  ? 0.0794 0.0567 0.0298 -0.0096 -0.0183 0.0099  72  MET B N   
2322 C CA  . MET B 72  ? 0.0779 0.0643 0.0288 -0.0084 -0.0131 0.0125  72  MET B CA  
2323 C C   . MET B 72  ? 0.0795 0.0776 0.0346 -0.0117 -0.0125 0.0134  72  MET B C   
2324 O O   . MET B 72  ? 0.0802 0.0850 0.0351 -0.0167 -0.0091 0.0188  72  MET B O   
2325 C CB  . MET B 72  ? 0.0853 0.0777 0.0411 -0.0010 -0.0102 0.0104  72  MET B CB  
2326 C CG  . MET B 72  ? 0.0727 0.0564 0.0248 -0.0010 -0.0115 0.0113  72  MET B CG  
2327 S SD  . MET B 72  ? 0.0928 0.0758 0.0456 0.0018  -0.0115 0.0093  72  MET B SD  
2328 C CE  . MET B 72  ? 0.1127 0.0971 0.0747 0.0037  -0.0134 0.0060  72  MET B CE  
2329 N N   . ALA B 73  ? 0.0747 0.0772 0.0355 -0.0099 -0.0149 0.0091  73  ALA B N   
2330 C CA  . ALA B 73  ? 0.0629 0.0773 0.0300 -0.0139 -0.0167 0.0101  73  ALA B CA  
2331 C C   . ALA B 73  ? 0.0776 0.0940 0.0460 -0.0246 -0.0211 0.0136  73  ALA B C   
2332 O O   . ALA B 73  ? 0.0810 0.1100 0.0614 -0.0284 -0.0195 0.0177  73  ALA B O   
2333 C CB  . ALA B 73  ? 0.0720 0.0852 0.0414 -0.0097 -0.0181 0.0048  73  ALA B CB  
2334 N N   . TYR B 74  ? 0.0818 0.0839 0.0442 -0.0278 -0.0247 0.0110  74  TYR B N   
2335 C CA  . TYR B 74  ? 0.1047 0.1031 0.0722 -0.0369 -0.0276 0.0130  74  TYR B CA  
2336 C C   . TYR B 74  ? 0.1130 0.1154 0.0860 -0.0410 -0.0215 0.0209  74  TYR B C   
2337 O O   . TYR B 74  ? 0.0987 0.1115 0.0850 -0.0479 -0.0211 0.0250  74  TYR B O   
2338 C CB  . TYR B 74  ? 0.1048 0.0835 0.0637 -0.0381 -0.0318 0.0086  74  TYR B CB  
2339 C CG  . TYR B 74  ? 0.1229 0.0930 0.0854 -0.0477 -0.0355 0.0106  74  TYR B CG  
2340 C CD1 . TYR B 74  ? 0.1274 0.0964 0.0927 -0.0531 -0.0415 0.0066  74  TYR B CD1 
2341 C CD2 . TYR B 74  ? 0.1543 0.1151 0.1156 -0.0507 -0.0331 0.0165  74  TYR B CD2 
2342 C CE1 . TYR B 74  ? 0.1424 0.1028 0.1118 -0.0604 -0.0446 0.0083  74  TYR B CE1 
2343 C CE2 . TYR B 74  ? 0.1430 0.0944 0.1080 -0.0601 -0.0367 0.0189  74  TYR B CE2 
2344 C CZ  . TYR B 74  ? 0.1602 0.1124 0.1304 -0.0645 -0.0426 0.0144  74  TYR B CZ  
2345 O OH  . TYR B 74  ? 0.1652 0.1096 0.1399 -0.0705 -0.0453 0.0161  74  TYR B OH  
2346 N N   . LEU B 75  ? 0.0992 0.0934 0.0621 -0.0369 -0.0166 0.0234  75  LEU B N   
2347 C CA  . LEU B 75  ? 0.1073 0.1025 0.0695 -0.0401 -0.0087 0.0308  75  LEU B CA  
2348 C C   . LEU B 75  ? 0.1004 0.1157 0.0756 -0.0396 -0.0009 0.0341  75  LEU B C   
2349 O O   . LEU B 75  ? 0.1067 0.1297 0.0927 -0.0461 0.0047  0.0401  75  LEU B O   
2350 C CB  . LEU B 75  ? 0.1217 0.1029 0.0657 -0.0349 -0.0063 0.0322  75  LEU B CB  
2351 C CG  . LEU B 75  ? 0.1259 0.0876 0.0623 -0.0366 -0.0131 0.0319  75  LEU B CG  
2352 C CD1 . LEU B 75  ? 0.1751 0.1286 0.1037 -0.0284 -0.0131 0.0294  75  LEU B CD1 
2353 C CD2 . LEU B 75  ? 0.1656 0.1217 0.1050 -0.0458 -0.0121 0.0376  75  LEU B CD2 
2354 N N   . VAL B 76  ? 0.0887 0.1127 0.0649 -0.0320 0.0000  0.0308  76  VAL B N   
2355 C CA  . VAL B 76  ? 0.0833 0.1256 0.0738 -0.0299 0.0076  0.0337  76  VAL B CA  
2356 C C   . VAL B 76  ? 0.0790 0.1372 0.0925 -0.0363 0.0029  0.0357  76  VAL B C   
2357 O O   . VAL B 76  ? 0.0847 0.1569 0.1160 -0.0398 0.0095  0.0413  76  VAL B O   
2358 C CB  . VAL B 76  ? 0.0865 0.1319 0.0723 -0.0197 0.0088  0.0298  76  VAL B CB  
2359 C CG1 . VAL B 76  ? 0.0909 0.1538 0.0934 -0.0165 0.0168  0.0326  76  VAL B CG1 
2360 C CG2 . VAL B 76  ? 0.0995 0.1280 0.0644 -0.0146 0.0120  0.0278  76  VAL B CG2 
2361 N N   . SER B 77  ? 0.0755 0.1307 0.0884 -0.0382 -0.0086 0.0311  77  SER B N   
2362 C CA  . SER B 77  ? 0.0746 0.1424 0.1057 -0.0447 -0.0165 0.0323  77  SER B CA  
2363 C C   . SER B 77  ? 0.1124 0.1809 0.1553 -0.0556 -0.0169 0.0373  77  SER B C   
2364 O O   . SER B 77  ? 0.0868 0.1681 0.1495 -0.0584 -0.0179 0.0406  77  SER B O   
2365 C CB  . SER B 77  ? 0.0898 0.1489 0.1101 -0.0450 -0.0284 0.0255  77  SER B CB  
2366 O OG  . SER B 77  ? 0.0972 0.1589 0.1108 -0.0362 -0.0281 0.0225  77  SER B OG  
2367 N N   . LYS B 78  ? 0.0966 0.1475 0.1257 -0.0590 -0.0158 0.0370  78  LYS B N   
2368 C CA  . LYS B 78  ? 0.1079 0.1562 0.1465 -0.0693 -0.0166 0.0418  78  LYS B CA  
2369 C C   . LYS B 78  ? 0.1311 0.1859 0.1772 -0.0690 -0.0026 0.0490  78  LYS B C   
2370 O O   . LYS B 78  ? 0.1211 0.1848 0.1856 -0.0736 -0.0003 0.0526  78  LYS B O   
2371 C CB  . LYS B 78  ? 0.1197 0.1438 0.1406 -0.0730 -0.0225 0.0384  78  LYS B CB  
2372 C CG  . LYS B 78  ? 0.1464 0.1644 0.1750 -0.0806 -0.0239 0.0416  78  LYS B CG  
2373 C CD  . LYS B 78  ? 0.1524 0.1457 0.1654 -0.0824 -0.0310 0.0371  78  LYS B CD  
2374 C CE  . LYS B 78  ? 0.1835 0.1712 0.2050 -0.0902 -0.0325 0.0406  78  LYS B CE  
2375 N NZ  . LYS B 78  ? 0.1966 0.1605 0.2049 -0.0906 -0.0392 0.0358  78  LYS B NZ  
2376 N N   . TYR B 79  ? 0.1275 0.1756 0.1571 -0.0630 0.0070  0.0500  79  TYR B N   
2377 C CA  . TYR B 79  ? 0.1394 0.1846 0.1658 -0.0621 0.0205  0.0545  79  TYR B CA  
2378 C C   . TYR B 79  ? 0.1247 0.1802 0.1528 -0.0533 0.0330  0.0541  79  TYR B C   
2379 O O   . TYR B 79  ? 0.1915 0.2440 0.2159 -0.0528 0.0459  0.0565  79  TYR B O   
2380 C CB  . TYR B 79  ? 0.1845 0.2058 0.1846 -0.0614 0.0207  0.0547  79  TYR B CB  
2381 C CG  . TYR B 79  ? 0.1753 0.1821 0.1728 -0.0690 0.0105  0.0550  79  TYR B CG  
2382 C CD1 . TYR B 79  ? 0.2062 0.2131 0.2154 -0.0769 0.0122  0.0596  79  TYR B CD1 
2383 C CD2 . TYR B 79  ? 0.1479 0.1393 0.1316 -0.0675 -0.0001 0.0501  79  TYR B CD2 
2384 C CE1 . TYR B 79  ? 0.2232 0.2149 0.2294 -0.0828 0.0028  0.0590  79  TYR B CE1 
2385 C CE2 . TYR B 79  ? 0.1669 0.1427 0.1483 -0.0726 -0.0087 0.0489  79  TYR B CE2 
2386 C CZ  . TYR B 79  ? 0.2073 0.1833 0.1996 -0.0802 -0.0076 0.0533  79  TYR B CZ  
2387 O OH  . TYR B 79  ? 0.2635 0.2230 0.2534 -0.0845 -0.0160 0.0517  79  TYR B OH  
2388 N N   . GLY B 80  ? 0.1213 0.1866 0.1529 -0.0467 0.0297  0.0505  80  GLY B N   
2389 C CA  . GLY B 80  ? 0.1388 0.2103 0.1708 -0.0374 0.0403  0.0485  80  GLY B CA  
2390 C C   . GLY B 80  ? 0.1899 0.2792 0.2485 -0.0385 0.0477  0.0510  80  GLY B C   
2391 O O   . GLY B 80  ? 0.1630 0.2665 0.2448 -0.0418 0.0395  0.0524  80  GLY B O   
2392 N N   . LYS B 81  ? 0.2649 0.3522 0.3183 -0.0361 0.0620  0.0507  81  LYS B N   
2393 C CA  . LYS B 81  ? 0.3330 0.4381 0.4117 -0.0373 0.0702  0.0530  81  LYS B CA  
2394 C C   . LYS B 81  ? 0.3384 0.4555 0.4295 -0.0273 0.0724  0.0498  81  LYS B C   
2395 O O   . LYS B 81  ? 0.3949 0.5270 0.5077 -0.0259 0.0792  0.0513  81  LYS B O   
2396 C CB  . LYS B 81  ? 0.3800 0.4791 0.4472 -0.0419 0.0843  0.0552  81  LYS B CB  
2397 C CG  . LYS B 81  ? 0.4021 0.4949 0.4697 -0.0534 0.0824  0.0605  81  LYS B CG  
2398 C CD  . LYS B 81  ? 0.4054 0.5163 0.5078 -0.0590 0.0745  0.0641  81  LYS B CD  
2399 C CE  . LYS B 81  ? 0.4479 0.5547 0.5548 -0.0707 0.0755  0.0696  81  LYS B CE  
2400 N NZ  . LYS B 81  ? 0.4617 0.5496 0.5532 -0.0755 0.0637  0.0700  81  LYS B NZ  
2401 N N   . ASP B 82  ? 0.2638 0.3737 0.3417 -0.0202 0.0664  0.0456  82  ASP B N   
2402 C CA  . ASP B 82  ? 0.2551 0.3759 0.3486 -0.0123 0.0622  0.0436  82  ASP B CA  
2403 C C   . ASP B 82  ? 0.2164 0.3299 0.2969 -0.0106 0.0496  0.0416  82  ASP B C   
2404 O O   . ASP B 82  ? 0.1890 0.2914 0.2521 -0.0154 0.0454  0.0420  82  ASP B O   
2405 C CB  . ASP B 82  ? 0.2955 0.4145 0.3842 -0.0034 0.0739  0.0397  82  ASP B CB  
2406 C CG  . ASP B 82  ? 0.3531 0.4509 0.4071 -0.0010 0.0792  0.0352  82  ASP B CG  
2407 O OD1 . ASP B 82  ? 0.3686 0.4545 0.4055 0.0013  0.0707  0.0324  82  ASP B OD1 
2408 O OD2 . ASP B 82  ? 0.3727 0.4662 0.4166 -0.0012 0.0909  0.0345  82  ASP B OD2 
2409 N N   . ASP B 83  ? 0.1648 0.2839 0.2528 -0.0042 0.0430  0.0398  83  ASP B N   
2410 C CA  . ASP B 83  ? 0.1260 0.2397 0.2012 -0.0033 0.0313  0.0381  83  ASP B CA  
2411 C C   . ASP B 83  ? 0.1061 0.2102 0.1657 0.0062  0.0337  0.0336  83  ASP B C   
2412 O O   . ASP B 83  ? 0.0636 0.1662 0.1178 0.0086  0.0246  0.0321  83  ASP B O   
2413 C CB  . ASP B 83  ? 0.1352 0.2589 0.2265 -0.0061 0.0172  0.0394  83  ASP B CB  
2414 C CG  . ASP B 83  ? 0.1543 0.2841 0.2595 0.0010  0.0163  0.0388  83  ASP B CG  
2415 O OD1 . ASP B 83  ? 0.2056 0.3362 0.3150 0.0072  0.0275  0.0378  83  ASP B OD1 
2416 O OD2 . ASP B 83  ? 0.1193 0.2508 0.2291 -0.0001 0.0043  0.0387  83  ASP B OD2 
2417 N N   A SER B 84  ? 0.1523 0.2482 0.2036 0.0107  0.0454  0.0310  84  SER B N   
2418 N N   B SER B 84  ? 0.1515 0.2472 0.2025 0.0107  0.0453  0.0310  84  SER B N   
2419 C CA  A SER B 84  ? 0.1451 0.2288 0.1810 0.0187  0.0464  0.0261  84  SER B CA  
2420 C CA  B SER B 84  ? 0.1412 0.2252 0.1775 0.0187  0.0459  0.0262  84  SER B CA  
2421 C C   A SER B 84  ? 0.1085 0.1783 0.1215 0.0182  0.0385  0.0237  84  SER B C   
2422 C C   B SER B 84  ? 0.1093 0.1791 0.1222 0.0182  0.0383  0.0237  84  SER B C   
2423 O O   A SER B 84  ? 0.1156 0.1813 0.1235 0.0231  0.0325  0.0214  84  SER B O   
2424 O O   B SER B 84  ? 0.1149 0.1802 0.1222 0.0230  0.0323  0.0214  84  SER B O   
2425 C CB  A SER B 84  ? 0.1768 0.2502 0.2012 0.0211  0.0587  0.0227  84  SER B CB  
2426 C CB  B SER B 84  ? 0.1759 0.2504 0.2022 0.0218  0.0582  0.0227  84  SER B CB  
2427 O OG  A SER B 84  ? 0.1781 0.2426 0.1866 0.0145  0.0625  0.0231  84  SER B OG  
2428 O OG  B SER B 84  ? 0.1873 0.2538 0.2071 0.0293  0.0576  0.0187  84  SER B OG  
2429 N N   . LEU B 85  ? 0.0880 0.1500 0.0885 0.0117  0.0377  0.0243  85  LEU B N   
2430 C CA  . LEU B 85  ? 0.1074 0.1531 0.0877 0.0103  0.0294  0.0211  85  LEU B CA  
2431 C C   . LEU B 85  ? 0.0710 0.1243 0.0566 0.0096  0.0190  0.0216  85  LEU B C   
2432 O O   . LEU B 85  ? 0.0963 0.1356 0.0714 0.0099  0.0116  0.0172  85  LEU B O   
2433 C CB  . LEU B 85  ? 0.1404 0.1743 0.1080 0.0032  0.0306  0.0220  85  LEU B CB  
2434 C CG  . LEU B 85  ? 0.1582 0.1798 0.1108 0.0014  0.0379  0.0204  85  LEU B CG  
2435 C CD1 . LEU B 85  ? 0.1836 0.1961 0.1251 -0.0066 0.0364  0.0232  85  LEU B CD1 
2436 C CD2 . LEU B 85  ? 0.1633 0.1731 0.1032 0.0052  0.0333  0.0152  85  LEU B CD2 
2437 N N   . TYR B 86  ? 0.0710 0.1433 0.0762 0.0066  0.0167  0.0256  86  TYR B N   
2438 C CA  . TYR B 86  ? 0.0504 0.1245 0.0579 0.0043  0.0047  0.0241  86  TYR B CA  
2439 C C   . TYR B 86  ? 0.0549 0.1474 0.0859 0.0030  0.0010  0.0279  86  TYR B C   
2440 O O   . TYR B 86  ? 0.0429 0.1426 0.0849 -0.0043 -0.0030 0.0304  86  TYR B O   
2441 C CB  . TYR B 86  ? 0.0674 0.1319 0.0653 -0.0029 -0.0006 0.0227  86  TYR B CB  
2442 C CG  . TYR B 86  ? 0.0721 0.1309 0.0658 -0.0043 -0.0098 0.0186  86  TYR B CG  
2443 C CD1 . TYR B 86  ? 0.0656 0.1111 0.0554 0.0007  -0.0091 0.0131  86  TYR B CD1 
2444 C CD2 . TYR B 86  ? 0.0531 0.1103 0.0485 -0.0113 -0.0157 0.0178  86  TYR B CD2 
2445 C CE1 . TYR B 86  ? 0.0818 0.1153 0.0682 -0.0001 -0.0125 0.0088  86  TYR B CE1 
2446 C CE2 . TYR B 86  ? 0.0569 0.1004 0.0466 -0.0104 -0.0188 0.0119  86  TYR B CE2 
2447 C CZ  . TYR B 86  ? 0.0575 0.0903 0.0424 -0.0042 -0.0167 0.0079  86  TYR B CZ  
2448 O OH  . TYR B 86  ? 0.0617 0.0857 0.0410 -0.0036 -0.0193 0.0043  86  TYR B OH  
2449 N N   . PRO B 87  ? 0.0544 0.1495 0.0918 0.0096  0.0018  0.0279  87  PRO B N   
2450 C CA  . PRO B 87  ? 0.0406 0.1430 0.0968 0.0088  -0.0008 0.0302  87  PRO B CA  
2451 C C   . PRO B 87  ? 0.0441 0.1440 0.1002 0.0023  -0.0123 0.0294  87  PRO B C   
2452 O O   . PRO B 87  ? 0.0430 0.1301 0.0823 0.0009  -0.0173 0.0254  87  PRO B O   
2453 C CB  . PRO B 87  ? 0.0873 0.1852 0.1436 0.0165  0.0009  0.0286  87  PRO B CB  
2454 C CG  . PRO B 87  ? 0.1130 0.1979 0.1478 0.0190  0.0004  0.0250  87  PRO B CG  
2455 C CD  . PRO B 87  ? 0.0733 0.1583 0.0981 0.0171  0.0037  0.0248  87  PRO B CD  
2456 N N   . LYS B 88  ? 0.0475 0.1573 0.1219 -0.0014 -0.0153 0.0324  88  LYS B N   
2457 C CA  . LYS B 88  ? 0.0650 0.1718 0.1389 -0.0069 -0.0264 0.0314  88  LYS B CA  
2458 C C   . LYS B 88  ? 0.0587 0.1612 0.1302 -0.0032 -0.0324 0.0299  88  LYS B C   
2459 O O   . LYS B 88  ? 0.0662 0.1614 0.1276 -0.0063 -0.0404 0.0276  88  LYS B O   
2460 C CB  . LYS B 88  ? 0.0823 0.2013 0.1768 -0.0128 -0.0284 0.0354  88  LYS B CB  
2461 C CG  . LYS B 88  ? 0.1233 0.2416 0.2153 -0.0195 -0.0254 0.0362  88  LYS B CG  
2462 C CD  . LYS B 88  ? 0.1736 0.3036 0.2885 -0.0256 -0.0249 0.0407  88  LYS B CD  
2463 C CE  . LYS B 88  ? 0.2216 0.3482 0.3324 -0.0327 -0.0207 0.0417  88  LYS B CE  
2464 N NZ  . LYS B 88  ? 0.2587 0.3967 0.3918 -0.0367 -0.0139 0.0466  88  LYS B NZ  
2465 N N   . ASP B 89  ? 0.0566 0.1627 0.1361 0.0036  -0.0282 0.0310  89  ASP B N   
2473 N N   . LEU B 90  ? 0.0526 0.0884 0.0518 0.0112  -0.0102 0.0064  90  LEU B N   
2474 C CA  . LEU B 90  ? 0.0617 0.0890 0.0526 0.0099  -0.0099 0.0081  90  LEU B CA  
2475 C C   . LEU B 90  ? 0.0594 0.0791 0.0499 0.0118  -0.0078 0.0093  90  LEU B C   
2476 O O   . LEU B 90  ? 0.0588 0.0735 0.0446 0.0098  -0.0058 0.0090  90  LEU B O   
2477 C CB  . LEU B 90  ? 0.0596 0.0884 0.0458 0.0100  -0.0133 0.0106  90  LEU B CB  
2478 C CG  . LEU B 90  ? 0.0679 0.1028 0.0538 0.0070  -0.0160 0.0085  90  LEU B CG  
2479 C CD1 . LEU B 90  ? 0.0791 0.1161 0.0590 0.0074  -0.0196 0.0099  90  LEU B CD1 
2480 C CD2 . LEU B 90  ? 0.0832 0.1144 0.0666 0.0029  -0.0148 0.0052  90  LEU B CD2 
2481 N N   . VAL B 91  ? 0.0586 0.0773 0.0549 0.0157  -0.0087 0.0106  91  VAL B N   
2482 C CA  . VAL B 91  ? 0.0781 0.0882 0.0752 0.0169  -0.0077 0.0121  91  VAL B CA  
2483 C C   . VAL B 91  ? 0.0853 0.0936 0.0841 0.0159  -0.0043 0.0073  91  VAL B C   
2484 O O   . VAL B 91  ? 0.0817 0.0841 0.0774 0.0140  -0.0026 0.0078  91  VAL B O   
2485 C CB  . VAL B 91  ? 0.0677 0.0753 0.0722 0.0215  -0.0108 0.0146  91  VAL B CB  
2486 C CG1 . VAL B 91  ? 0.0931 0.0908 0.1001 0.0220  -0.0103 0.0156  91  VAL B CG1 
2487 C CG2 . VAL B 91  ? 0.1101 0.1193 0.1113 0.0218  -0.0145 0.0211  91  VAL B CG2 
2488 N N   . LYS B 92  ? 0.0542 0.0695 0.0573 0.0166  -0.0034 0.0029  92  LYS B N   
2489 C CA  . LYS B 92  ? 0.0676 0.0839 0.0709 0.0152  -0.0004 -0.0015 92  LYS B CA  
2490 C C   . LYS B 92  ? 0.0829 0.0985 0.0794 0.0102  0.0010  -0.0005 92  LYS B C   
2491 O O   . LYS B 92  ? 0.0716 0.0835 0.0662 0.0087  0.0026  -0.0017 92  LYS B O   
2492 C CB  . LYS B 92  ? 0.0896 0.1168 0.0987 0.0168  0.0007  -0.0063 92  LYS B CB  
2493 C CG  . LYS B 92  ? 0.1462 0.1728 0.1636 0.0229  -0.0006 -0.0096 92  LYS B CG  
2494 C CD  . LYS B 92  ? 0.1517 0.1922 0.1757 0.0255  0.0008  -0.0152 92  LYS B CD  
2495 C CE  . LYS B 92  ? 0.2145 0.2528 0.2481 0.0327  -0.0007 -0.0205 92  LYS B CE  
2496 N NZ  . LYS B 92  ? 0.2894 0.3319 0.3252 0.0342  0.0020  -0.0291 92  LYS B NZ  
2497 N N   . ARG B 93  ? 0.0506 0.0690 0.0441 0.0079  -0.0002 0.0014  93  ARG B N   
2498 C CA  . ARG B 93  ? 0.0509 0.0668 0.0395 0.0040  0.0001  0.0019  93  ARG B CA  
2499 C C   . ARG B 93  ? 0.0624 0.0705 0.0471 0.0044  0.0006  0.0032  93  ARG B C   
2500 O O   . ARG B 93  ? 0.0640 0.0691 0.0468 0.0027  0.0018  0.0026  93  ARG B O   
2501 C CB  . ARG B 93  ? 0.0620 0.0808 0.0493 0.0018  -0.0024 0.0028  93  ARG B CB  
2502 C CG  . ARG B 93  ? 0.0705 0.0847 0.0542 -0.0014 -0.0029 0.0026  93  ARG B CG  
2503 C CD  . ARG B 93  ? 0.0686 0.0852 0.0531 -0.0046 -0.0060 0.0027  93  ARG B CD  
2504 N NE  . ARG B 93  ? 0.0741 0.0985 0.0631 -0.0076 -0.0059 0.0038  93  ARG B NE  
2505 C CZ  . ARG B 93  ? 0.0785 0.1051 0.0695 -0.0123 -0.0086 0.0051  93  ARG B CZ  
2506 N NH1 . ARG B 93  ? 0.0966 0.1163 0.0861 -0.0141 -0.0121 0.0044  93  ARG B NH1 
2507 N NH2 . ARG B 93  ? 0.0761 0.1128 0.0713 -0.0154 -0.0078 0.0070  93  ARG B NH2 
2508 N N   . ALA B 94  ? 0.0639 0.0701 0.0476 0.0065  -0.0003 0.0057  94  ALA B N   
2509 C CA  . ALA B 94  ? 0.0712 0.0728 0.0514 0.0062  0.0007  0.0077  94  ALA B CA  
2510 C C   . ALA B 94  ? 0.0951 0.0925 0.0781 0.0059  0.0025  0.0071  94  ALA B C   
2511 O O   . ALA B 94  ? 0.0721 0.0674 0.0530 0.0044  0.0039  0.0075  94  ALA B O   
2512 C CB  . ALA B 94  ? 0.0703 0.0722 0.0492 0.0077  -0.0010 0.0120  94  ALA B CB  
2513 N N   . LEU B 95  ? 0.0736 0.0703 0.0617 0.0075  0.0024  0.0054  95  LEU B N   
2514 C CA  . LEU B 95  ? 0.0744 0.0671 0.0651 0.0071  0.0035  0.0036  95  LEU B CA  
2515 C C   . LEU B 95  ? 0.0607 0.0560 0.0494 0.0046  0.0050  0.0007  95  LEU B C   
2516 O O   . LEU B 95  ? 0.0740 0.0665 0.0622 0.0030  0.0058  0.0007  95  LEU B O   
2517 C CB  . LEU B 95  ? 0.0756 0.0674 0.0729 0.0102  0.0025  0.0006  95  LEU B CB  
2518 C CG  . LEU B 95  ? 0.0962 0.0832 0.0966 0.0096  0.0029  -0.0025 95  LEU B CG  
2519 C CD1 . LEU B 95  ? 0.1160 0.0958 0.1168 0.0077  0.0022  0.0023  95  LEU B CD1 
2520 C CD2 . LEU B 95  ? 0.1126 0.0989 0.1201 0.0135  0.0015  -0.0075 95  LEU B CD2 
2521 N N   . VAL B 96  ? 0.0650 0.0660 0.0528 0.0039  0.0049  -0.0008 96  VAL B N   
2522 C CA  . VAL B 96  ? 0.0584 0.0617 0.0441 0.0010  0.0054  -0.0016 96  VAL B CA  
2523 C C   . VAL B 96  ? 0.0419 0.0414 0.0247 -0.0004 0.0049  0.0004  96  VAL B C   
2524 O O   . VAL B 96  ? 0.0552 0.0532 0.0378 -0.0016 0.0052  0.0001  96  VAL B O   
2525 C CB  . VAL B 96  ? 0.0511 0.0615 0.0367 -0.0007 0.0049  -0.0018 96  VAL B CB  
2526 C CG1 . VAL B 96  ? 0.0774 0.0891 0.0608 -0.0044 0.0044  -0.0005 96  VAL B CG1 
2527 C CG2 . VAL B 96  ? 0.0628 0.0802 0.0518 0.0011  0.0060  -0.0050 96  VAL B CG2 
2528 N N   . ASP B 97  ? 0.0428 0.0417 0.0239 0.0003  0.0040  0.0017  97  ASP B N   
2529 C CA  . ASP B 97  ? 0.0702 0.0669 0.0489 0.0001  0.0038  0.0019  97  ASP B CA  
2530 C C   . ASP B 97  ? 0.0606 0.0556 0.0399 0.0005  0.0056  0.0025  97  ASP B C   
2531 O O   . ASP B 97  ? 0.0765 0.0712 0.0564 -0.0001 0.0059  0.0017  97  ASP B O   
2532 C CB  . ASP B 97  ? 0.0462 0.0440 0.0223 0.0011  0.0026  0.0020  97  ASP B CB  
2533 C CG  . ASP B 97  ? 0.0655 0.0647 0.0417 -0.0001 0.0000  0.0010  97  ASP B CG  
2534 O OD1 . ASP B 97  ? 0.0915 0.0907 0.0698 -0.0023 -0.0009 0.0011  97  ASP B OD1 
2535 O OD2 . ASP B 97  ? 0.0812 0.0821 0.0555 0.0006  -0.0014 0.0006  97  ASP B OD2 
2536 N N   . ASN B 98  ? 0.0495 0.0436 0.0295 0.0012  0.0064  0.0045  98  ASN B N   
2537 C CA  . ASN B 98  ? 0.0717 0.0645 0.0531 0.0005  0.0078  0.0065  98  ASN B CA  
2538 C C   . ASN B 98  ? 0.0594 0.0512 0.0439 -0.0009 0.0081  0.0045  98  ASN B C   
2539 O O   . ASN B 98  ? 0.0621 0.0553 0.0475 -0.0019 0.0091  0.0047  98  ASN B O   
2540 C CB  . ASN B 98  ? 0.0841 0.0742 0.0677 0.0010  0.0072  0.0096  98  ASN B CB  
2541 C CG  . ASN B 98  ? 0.0819 0.0694 0.0686 -0.0009 0.0078  0.0126  98  ASN B CG  
2542 O OD1 . ASN B 98  ? 0.1141 0.1039 0.1011 -0.0027 0.0094  0.0127  98  ASN B OD1 
2543 N ND2 . ASN B 98  ? 0.1062 0.0890 0.0966 -0.0005 0.0061  0.0153  98  ASN B ND2 
2544 N N   . ARG B 99  ? 0.0646 0.0558 0.0506 -0.0010 0.0073  0.0021  99  ARG B N   
2545 C CA  . ARG B 99  ? 0.0581 0.0496 0.0460 -0.0025 0.0072  -0.0001 99  ARG B CA  
2546 C C   . ARG B 99  ? 0.0470 0.0410 0.0335 -0.0035 0.0066  -0.0001 99  ARG B C   
2547 O O   . ARG B 99  ? 0.0577 0.0525 0.0462 -0.0047 0.0064  -0.0005 99  ARG B O   
2548 C CB  . ARG B 99  ? 0.0808 0.0736 0.0697 -0.0021 0.0066  -0.0035 99  ARG B CB  
2549 C CG  . ARG B 99  ? 0.0984 0.0876 0.0910 -0.0002 0.0063  -0.0048 99  ARG B CG  
2550 C CD  . ARG B 99  ? 0.1218 0.1057 0.1184 -0.0016 0.0057  -0.0042 99  ARG B CD  
2551 N NE  . ARG B 99  ? 0.1281 0.1066 0.1298 0.0003  0.0041  -0.0060 99  ARG B NE  
2552 C CZ  . ARG B 99  ? 0.1050 0.0772 0.1103 0.0003  0.0029  -0.0016 99  ARG B CZ  
2553 N NH1 . ARG B 99  ? 0.1263 0.0990 0.1295 -0.0018 0.0039  0.0048  99  ARG B NH1 
2554 N NH2 . ARG B 99  ? 0.1237 0.0897 0.1352 0.0026  0.0004  -0.0035 99  ARG B NH2 
2555 N N   . MET B 100 ? 0.0516 0.0465 0.0359 -0.0031 0.0057  0.0004  100 MET B N   
2556 C CA  . MET B 100 ? 0.0594 0.0546 0.0439 -0.0036 0.0040  0.0006  100 MET B CA  
2557 C C   . MET B 100 ? 0.0538 0.0490 0.0398 -0.0020 0.0047  0.0003  100 MET B C   
2558 O O   . MET B 100 ? 0.0459 0.0419 0.0346 -0.0019 0.0036  0.0000  100 MET B O   
2559 C CB  . MET B 100 ? 0.0622 0.0573 0.0453 -0.0041 0.0020  0.0013  100 MET B CB  
2560 C CG  . MET B 100 ? 0.0846 0.0832 0.0668 -0.0065 0.0015  0.0022  100 MET B CG  
2561 S SD  . MET B 100 ? 0.0792 0.0785 0.0611 -0.0093 -0.0018 0.0051  100 MET B SD  
2562 C CE  . MET B 100 ? 0.0762 0.0734 0.0579 -0.0076 -0.0019 0.0038  100 MET B CE  
2563 N N   . TYR B 101 ? 0.0469 0.0427 0.0313 -0.0007 0.0064  0.0004  101 TYR B N   
2564 C CA  . TYR B 101 ? 0.0490 0.0481 0.0345 0.0007  0.0080  -0.0003 101 TYR B CA  
2565 C C   . TYR B 101 ? 0.0651 0.0667 0.0543 -0.0009 0.0096  0.0010  101 TYR B C   
2566 O O   . TYR B 101 ? 0.0640 0.0699 0.0565 -0.0002 0.0102  0.0000  101 TYR B O   
2567 C CB  . TYR B 101 ? 0.0510 0.0527 0.0327 0.0018  0.0095  0.0000  101 TYR B CB  
2568 C CG  . TYR B 101 ? 0.0537 0.0544 0.0328 0.0035  0.0075  -0.0029 101 TYR B CG  
2569 C CD1 . TYR B 101 ? 0.0508 0.0530 0.0314 0.0058  0.0066  -0.0070 101 TYR B CD1 
2570 C CD2 . TYR B 101 ? 0.0485 0.0469 0.0251 0.0029  0.0059  -0.0020 101 TYR B CD2 
2571 C CE1 . TYR B 101 ? 0.0541 0.0541 0.0334 0.0072  0.0039  -0.0105 101 TYR B CE1 
2572 C CE2 . TYR B 101 ? 0.0639 0.0613 0.0390 0.0038  0.0034  -0.0048 101 TYR B CE2 
2573 C CZ  . TYR B 101 ? 0.0554 0.0528 0.0318 0.0057  0.0022  -0.0092 101 TYR B CZ  
2574 O OH  . TYR B 101 ? 0.0730 0.0681 0.0489 0.0064  -0.0012 -0.0129 101 TYR B OH  
2575 N N   . PHE B 102 ? 0.0652 0.0643 0.0549 -0.0028 0.0098  0.0027  102 PHE B N   
2576 C CA  . PHE B 102 ? 0.0721 0.0722 0.0662 -0.0051 0.0103  0.0035  102 PHE B CA  
2577 C C   . PHE B 102 ? 0.0508 0.0524 0.0474 -0.0054 0.0084  0.0015  102 PHE B C   
2578 O O   . PHE B 102 ? 0.0503 0.0562 0.0513 -0.0061 0.0087  0.0016  102 PHE B O   
2579 C CB  . PHE B 102 ? 0.0693 0.0645 0.0642 -0.0066 0.0096  0.0042  102 PHE B CB  
2580 C CG  . PHE B 102 ? 0.0476 0.0424 0.0476 -0.0094 0.0089  0.0037  102 PHE B CG  
2581 C CD1 . PHE B 102 ? 0.0814 0.0774 0.0856 -0.0120 0.0100  0.0071  102 PHE B CD1 
2582 C CD2 . PHE B 102 ? 0.0646 0.0589 0.0653 -0.0100 0.0070  0.0002  102 PHE B CD2 
2583 C CE1 . PHE B 102 ? 0.0688 0.0639 0.0788 -0.0154 0.0086  0.0065  102 PHE B CE1 
2584 C CE2 . PHE B 102 ? 0.0908 0.0849 0.0962 -0.0128 0.0056  -0.0012 102 PHE B CE2 
2585 C CZ  . PHE B 102 ? 0.0776 0.0716 0.0881 -0.0155 0.0063  0.0018  102 PHE B CZ  
2586 N N   . GLU B 103 ? 0.0609 0.0604 0.0554 -0.0053 0.0063  0.0004  103 GLU B N   
2587 C CA  . GLU B 103 ? 0.0594 0.0609 0.0556 -0.0060 0.0037  -0.0001 103 GLU B CA  
2588 C C   . GLU B 103 ? 0.0555 0.0592 0.0549 -0.0037 0.0028  -0.0001 103 GLU B C   
2589 O O   . GLU B 103 ? 0.0675 0.0747 0.0715 -0.0038 0.0015  -0.0002 103 GLU B O   
2590 C CB  . GLU B 103 ? 0.0570 0.0575 0.0493 -0.0067 0.0017  0.0001  103 GLU B CB  
2591 C CG  . GLU B 103 ? 0.0731 0.0767 0.0658 -0.0086 -0.0013 0.0008  103 GLU B CG  
2592 C CD  . GLU B 103 ? 0.0736 0.0770 0.0690 -0.0074 -0.0044 0.0030  103 GLU B CD  
2593 O OE1 . GLU B 103 ? 0.0829 0.0831 0.0791 -0.0052 -0.0046 0.0032  103 GLU B OE1 
2594 O OE2 . GLU B 103 ? 0.0785 0.0850 0.0757 -0.0086 -0.0074 0.0044  103 GLU B OE2 
2595 N N   A SER B 104 ? 0.0556 0.0577 0.0533 -0.0013 0.0032  -0.0008 104 SER B N   
2596 N N   B SER B 104 ? 0.0557 0.0579 0.0536 -0.0013 0.0032  -0.0008 104 SER B N   
2597 C CA  A SER B 104 ? 0.0650 0.0686 0.0666 0.0019  0.0020  -0.0026 104 SER B CA  
2598 C CA  B SER B 104 ? 0.0621 0.0657 0.0639 0.0018  0.0018  -0.0026 104 SER B CA  
2599 C C   A SER B 104 ? 0.0570 0.0680 0.0639 0.0030  0.0042  -0.0038 104 SER B C   
2600 C C   B SER B 104 ? 0.0577 0.0688 0.0647 0.0031  0.0042  -0.0039 104 SER B C   
2601 O O   A SER B 104 ? 0.0525 0.0666 0.0653 0.0050  0.0022  -0.0050 104 SER B O   
2602 O O   B SER B 104 ? 0.0547 0.0689 0.0676 0.0054  0.0024  -0.0053 104 SER B O   
2603 C CB  A SER B 104 ? 0.0589 0.0605 0.0575 0.0042  0.0025  -0.0047 104 SER B CB  
2604 C CB  B SER B 104 ? 0.0650 0.0656 0.0642 0.0042  0.0015  -0.0046 104 SER B CB  
2605 O OG  A SER B 104 ? 0.0619 0.0657 0.0650 0.0081  0.0015  -0.0084 104 SER B OG  
2606 O OG  B SER B 104 ? 0.0689 0.0729 0.0649 0.0047  0.0053  -0.0054 104 SER B OG  
2607 N N   . GLY B 105 ? 0.0443 0.0590 0.0498 0.0016  0.0081  -0.0030 105 GLY B N   
2608 C CA  . GLY B 105 ? 0.0562 0.0804 0.0666 0.0019  0.0110  -0.0033 105 GLY B CA  
2609 C C   . GLY B 105 ? 0.0420 0.0693 0.0568 -0.0022 0.0115  -0.0007 105 GLY B C   
2610 O O   . GLY B 105 ? 0.0555 0.0890 0.0771 -0.0017 0.0106  -0.0016 105 GLY B O   
2611 N N   . VAL B 106 ? 0.0567 0.0794 0.0687 -0.0058 0.0121  0.0020  106 VAL B N   
2612 C CA  . VAL B 106 ? 0.0434 0.0675 0.0603 -0.0102 0.0119  0.0040  106 VAL B CA  
2613 C C   . VAL B 106 ? 0.0434 0.0659 0.0627 -0.0109 0.0080  0.0020  106 VAL B C   
2614 O O   . VAL B 106 ? 0.0593 0.0872 0.0849 -0.0132 0.0072  0.0022  106 VAL B O   
2615 C CB  . VAL B 106 ? 0.0663 0.0835 0.0807 -0.0134 0.0122  0.0066  106 VAL B CB  
2616 C CG1 . VAL B 106 ? 0.0688 0.0855 0.0894 -0.0180 0.0107  0.0075  106 VAL B CG1 
2617 C CG2 . VAL B 106 ? 0.0804 0.1004 0.0925 -0.0137 0.0154  0.0104  106 VAL B CG2 
2618 N N   . VAL B 107 ? 0.0414 0.0583 0.0559 -0.0094 0.0056  0.0006  107 VAL B N   
2619 C CA  . VAL B 107 ? 0.0417 0.0588 0.0569 -0.0106 0.0018  -0.0005 107 VAL B CA  
2620 C C   . VAL B 107 ? 0.0501 0.0709 0.0683 -0.0079 -0.0009 -0.0003 107 VAL B C   
2621 O O   . VAL B 107 ? 0.0676 0.0944 0.0919 -0.0086 -0.0027 -0.0003 107 VAL B O   
2622 C CB  . VAL B 107 ? 0.0425 0.0540 0.0509 -0.0113 0.0005  -0.0014 107 VAL B CB  
2623 C CG1 . VAL B 107 ? 0.0600 0.0742 0.0678 -0.0131 -0.0031 -0.0024 107 VAL B CG1 
2624 C CG2 . VAL B 107 ? 0.0710 0.0781 0.0783 -0.0129 0.0023  -0.0023 107 VAL B CG2 
2625 N N   . PHE B 108 ? 0.0561 0.0734 0.0714 -0.0048 -0.0016 -0.0001 108 PHE B N   
2626 C CA  . PHE B 108 ? 0.0594 0.0777 0.0785 -0.0020 -0.0055 0.0003  108 PHE B CA  
2627 C C   . PHE B 108 ? 0.0429 0.0681 0.0707 0.0015  -0.0047 -0.0016 108 PHE B C   
2628 O O   . PHE B 108 ? 0.0632 0.0940 0.0978 0.0020  -0.0073 -0.0013 108 PHE B O   
2629 C CB  . PHE B 108 ? 0.0446 0.0561 0.0598 -0.0003 -0.0075 0.0011  108 PHE B CB  
2630 C CG  . PHE B 108 ? 0.0484 0.0586 0.0684 0.0019  -0.0129 0.0027  108 PHE B CG  
2631 C CD1 . PHE B 108 ? 0.0508 0.0615 0.0698 -0.0007 -0.0174 0.0067  108 PHE B CD1 
2632 C CD2 . PHE B 108 ? 0.1122 0.1217 0.1384 0.0070  -0.0139 0.0001  108 PHE B CD2 
2633 C CE1 . PHE B 108 ? 0.0903 0.0992 0.1147 0.0012  -0.0236 0.0097  108 PHE B CE1 
2634 C CE2 . PHE B 108 ? 0.1278 0.1346 0.1603 0.0097  -0.0200 0.0015  108 PHE B CE2 
2635 C CZ  . PHE B 108 ? 0.1038 0.1097 0.1355 0.0066  -0.0251 0.0072  108 PHE B CZ  
2636 N N   . ALA B 109 ? 0.0427 0.0696 0.0705 0.0040  -0.0008 -0.0039 109 ALA B N   
2637 C CA  . ALA B 109 ? 0.0627 0.0986 0.0985 0.0082  0.0005  -0.0070 109 ALA B CA  
2638 C C   . ALA B 109 ? 0.0593 0.1056 0.1009 0.0053  0.0029  -0.0060 109 ALA B C   
2639 O O   . ALA B 109 ? 0.0610 0.1154 0.1118 0.0076  0.0012  -0.0073 109 ALA B O   
2640 C CB  . ALA B 109 ? 0.0672 0.1046 0.1001 0.0111  0.0044  -0.0103 109 ALA B CB  
2641 N N   . ASN B 110 ? 0.0525 0.0987 0.0903 0.0003  0.0061  -0.0036 110 ASN B N   
2642 C CA  . ASN B 110 ? 0.0601 0.1167 0.1046 -0.0033 0.0085  -0.0021 110 ASN B CA  
2643 C C   . ASN B 110 ? 0.0506 0.1078 0.0996 -0.0070 0.0047  -0.0009 110 ASN B C   
2644 O O   . ASN B 110 ? 0.0633 0.1313 0.1213 -0.0084 0.0049  -0.0007 110 ASN B O   
2645 C CB  . ASN B 110 ? 0.0830 0.1384 0.1230 -0.0078 0.0127  0.0010  110 ASN B CB  
2646 C CG  . ASN B 110 ? 0.1065 0.1736 0.1541 -0.0123 0.0154  0.0037  110 ASN B CG  
2647 O OD1 . ASN B 110 ? 0.1075 0.1879 0.1604 -0.0103 0.0185  0.0027  110 ASN B OD1 
2648 N ND2 . ASN B 110 ? 0.0933 0.1556 0.1417 -0.0185 0.0143  0.0070  110 ASN B ND2 
2649 N N   . ALA B 111 ? 0.0458 0.0933 0.0888 -0.0090 0.0013  -0.0005 111 ALA B N   
2650 C CA  . ALA B 111 ? 0.0531 0.1017 0.0986 -0.0127 -0.0026 -0.0003 111 ALA B CA  
2651 C C   . ALA B 111 ? 0.0429 0.0920 0.0891 -0.0104 -0.0082 -0.0004 111 ALA B C   
2652 O O   . ALA B 111 ? 0.0600 0.1166 0.1130 -0.0114 -0.0115 -0.0002 111 ALA B O   
2653 C CB  . ALA B 111 ? 0.0616 0.1017 0.1007 -0.0170 -0.0027 -0.0006 111 ALA B CB  
2654 N N   A LEU B 112 ? 0.0433 0.0851 0.0830 -0.0077 -0.0097 0.0002  112 LEU B N   
2655 N N   B LEU B 112 ? 0.0433 0.0853 0.0832 -0.0076 -0.0097 0.0002  112 LEU B N   
2656 C CA  A LEU B 112 ? 0.0549 0.0962 0.0939 -0.0068 -0.0156 0.0020  112 LEU B CA  
2657 C CA  B LEU B 112 ? 0.0558 0.0973 0.0948 -0.0069 -0.0157 0.0020  112 LEU B CA  
2658 C C   A LEU B 112 ? 0.0629 0.1080 0.1106 -0.0015 -0.0185 0.0025  112 LEU B C   
2659 C C   B LEU B 112 ? 0.0590 0.1036 0.1063 -0.0015 -0.0188 0.0028  112 LEU B C   
2660 O O   A LEU B 112 ? 0.0653 0.1173 0.1201 -0.0012 -0.0227 0.0035  112 LEU B O   
2661 O O   B LEU B 112 ? 0.0713 0.1219 0.1249 -0.0011 -0.0236 0.0042  112 LEU B O   
2662 C CB  A LEU B 112 ? 0.0493 0.0820 0.0783 -0.0072 -0.0164 0.0036  112 LEU B CB  
2663 C CB  B LEU B 112 ? 0.0505 0.0838 0.0792 -0.0080 -0.0164 0.0034  112 LEU B CB  
2664 C CG  A LEU B 112 ? 0.0706 0.1039 0.0966 -0.0086 -0.0225 0.0071  112 LEU B CG  
2665 C CG  B LEU B 112 ? 0.0730 0.1062 0.0981 -0.0090 -0.0223 0.0070  112 LEU B CG  
2666 C CD1 A LEU B 112 ? 0.0746 0.1041 0.0898 -0.0118 -0.0217 0.0077  112 LEU B CD1 
2667 C CD1 B LEU B 112 ? 0.0664 0.1076 0.0939 -0.0119 -0.0264 0.0074  112 LEU B CD1 
2668 C CD2 A LEU B 112 ? 0.0606 0.0917 0.0916 -0.0045 -0.0270 0.0104  112 LEU B CD2 
2669 C CD2 B LEU B 112 ? 0.0731 0.1015 0.0877 -0.0116 -0.0211 0.0076  112 LEU B CD2 
2670 N N   . ARG B 113 ? 0.1019 0.1427 0.1498 0.0029  -0.0167 0.0012  113 ARG B N   
2671 C CA  . ARG B 113 ? 0.0780 0.1195 0.1343 0.0091  -0.0205 0.0005  113 ARG B CA  
2672 C C   . ARG B 113 ? 0.0650 0.1189 0.1334 0.0119  -0.0199 -0.0020 113 ARG B C   
2673 O O   . ARG B 113 ? 0.0816 0.1389 0.1590 0.0156  -0.0253 -0.0014 113 ARG B O   
2674 C CB  . ARG B 113 ? 0.0956 0.1305 0.1499 0.0131  -0.0183 -0.0024 113 ARG B CB  
2675 C CG  . ARG B 113 ? 0.1205 0.1525 0.1833 0.0198  -0.0235 -0.0039 113 ARG B CG  
2676 C CD  . ARG B 113 ? 0.1700 0.1954 0.2304 0.0233  -0.0214 -0.0083 113 ARG B CD  
2677 N NE  . ARG B 113 ? 0.2092 0.2296 0.2788 0.0298  -0.0275 -0.0107 113 ARG B NE  
2678 C CZ  . ARG B 113 ? 0.2908 0.3188 0.3712 0.0368  -0.0270 -0.0173 113 ARG B CZ  
2679 N NH1 . ARG B 113 ? 0.2870 0.3294 0.3694 0.0370  -0.0203 -0.0209 113 ARG B NH1 
2680 N NH2 . ARG B 113 ? 0.3455 0.3658 0.4300 0.0406  -0.0315 -0.0191 113 ARG B NH2 
2681 N N   . SER B 114 ? 0.0649 0.1265 0.1342 0.0098  -0.0136 -0.0042 114 SER B N   
2682 C CA  . SER B 114 ? 0.0689 0.1455 0.1501 0.0114  -0.0119 -0.0063 114 SER B CA  
2683 C C   . SER B 114 ? 0.0819 0.1643 0.1694 0.0090  -0.0174 -0.0037 114 SER B C   
2684 O O   . SER B 114 ? 0.0966 0.1874 0.1955 0.0135  -0.0207 -0.0048 114 SER B O   
2685 C CB  . SER B 114 ? 0.0848 0.1684 0.1645 0.0069  -0.0047 -0.0066 114 SER B CB  
2686 O OG  . SER B 114 ? 0.1006 0.1766 0.1720 -0.0001 -0.0046 -0.0036 114 SER B OG  
2687 N N   . LEU B 115 ? 0.0750 0.1540 0.1557 0.0021  -0.0183 -0.0011 115 LEU B N   
2688 C CA  . LEU B 115 ? 0.0678 0.1530 0.1530 -0.0011 -0.0237 0.0007  115 LEU B CA  
2689 C C   . LEU B 115 ? 0.0614 0.1431 0.1469 0.0022  -0.0317 0.0036  115 LEU B C   
2690 O O   . LEU B 115 ? 0.0556 0.1463 0.1509 0.0038  -0.0369 0.0047  115 LEU B O   
2691 C CB  . LEU B 115 ? 0.0780 0.1600 0.1555 -0.0089 -0.0231 0.0010  115 LEU B CB  
2692 C CG  . LEU B 115 ? 0.1030 0.1928 0.1849 -0.0134 -0.0283 0.0015  115 LEU B CG  
2693 C CD1 . LEU B 115 ? 0.0563 0.1608 0.1532 -0.0125 -0.0284 0.0009  115 LEU B CD1 
2694 C CD2 . LEU B 115 ? 0.1236 0.2089 0.1987 -0.0206 -0.0272 -0.0003 115 LEU B CD2 
2695 N N   . ALA B 116 ? 0.0590 0.1285 0.1346 0.0029  -0.0329 0.0056  116 ALA B N   
2696 C CA  . ALA B 116 ? 0.0798 0.1453 0.1553 0.0049  -0.0408 0.0103  116 ALA B CA  
2697 C C   . ALA B 116 ? 0.1136 0.1812 0.2013 0.0126  -0.0440 0.0096  116 ALA B C   
2698 O O   . ALA B 116 ? 0.1251 0.1943 0.2151 0.0139  -0.0490 0.0125  116 ALA B O   
2699 C CB  . ALA B 116 ? 0.1332 0.1864 0.1966 0.0033  -0.0408 0.0130  116 ALA B CB  
2700 N N   . LYS B 117 ? 0.1142 0.1813 0.2075 0.0178  -0.0397 0.0048  117 LYS B N   
2701 C CA  . LYS B 117 ? 0.1103 0.1791 0.2128 0.0253  -0.0405 0.0020  117 LYS B CA  
2702 C C   . LYS B 117 ? 0.1179 0.2007 0.2296 0.0260  -0.0413 0.0017  117 LYS B C   
2703 O O   . LYS B 117 ? 0.1281 0.2108 0.2451 0.0298  -0.0464 0.0035  117 LYS B O   
2704 C CB  . LYS B 117 ? 0.1497 0.2190 0.2545 0.0299  -0.0341 -0.0048 117 LYS B CB  
2705 C CG  . LYS B 117 ? 0.1830 0.2534 0.2960 0.0376  -0.0346 -0.0090 117 LYS B CG  
2706 C CD  . LYS B 117 ? 0.2174 0.2923 0.3310 0.0412  -0.0272 -0.0166 117 LYS B CD  
2707 C CE  . LYS B 117 ? 0.2401 0.3126 0.3604 0.0488  -0.0289 -0.0217 117 LYS B CE  
2708 N NZ  . LYS B 117 ? 0.2683 0.3502 0.3897 0.0522  -0.0215 -0.0296 117 LYS B NZ  
2709 N N   . MET B 118 ? 0.0885 0.1833 0.2027 0.0219  -0.0366 -0.0001 118 MET B N   
2710 C CA  . MET B 118 ? 0.1143 0.2236 0.2371 0.0210  -0.0372 0.0001  118 MET B CA  
2711 C C   . MET B 118 ? 0.1063 0.2152 0.2273 0.0191  -0.0450 0.0046  118 MET B C   
2712 O O   . MET B 118 ? 0.1250 0.2406 0.2541 0.0229  -0.0484 0.0053  118 MET B O   
2713 C CB  . MET B 118 ? 0.1417 0.2605 0.2649 0.0140  -0.0317 -0.0009 118 MET B CB  
2714 C CG  . MET B 118 ? 0.1658 0.2901 0.2924 0.0155  -0.0232 -0.0047 118 MET B CG  
2715 S SD  . MET B 118 ? 0.2074 0.3406 0.3353 0.0058  -0.0177 -0.0035 118 MET B SD  
2716 C CE  . MET B 118 ? 0.3277 0.4764 0.4706 0.0067  -0.0188 -0.0027 118 MET B CE  
2717 N N   . ILE B 119 ? 0.0768 0.1783 0.1866 0.0131  -0.0474 0.0075  119 ILE B N   
2718 C CA  . ILE B 119 ? 0.0961 0.1979 0.2010 0.0097  -0.0536 0.0112  119 ILE B CA  
2719 C C   . ILE B 119 ? 0.1303 0.2226 0.2318 0.0132  -0.0597 0.0163  119 ILE B C   
2720 O O   . ILE B 119 ? 0.1364 0.2328 0.2413 0.0146  -0.0650 0.0190  119 ILE B O   
2721 C CB  . ILE B 119 ? 0.1686 0.2659 0.2609 0.0018  -0.0526 0.0115  119 ILE B CB  
2722 C CG1 . ILE B 119 ? 0.1324 0.2363 0.2279 -0.0027 -0.0470 0.0070  119 ILE B CG1 
2723 C CG2 . ILE B 119 ? 0.1869 0.2851 0.2722 -0.0016 -0.0582 0.0143  119 ILE B CG2 
2724 C CD1 . ILE B 119 ? 0.0748 0.1924 0.1821 -0.0024 -0.0472 0.0046  119 ILE B CD1 
2725 N N   . LEU B 120 ? 0.1244 0.2039 0.2193 0.0139  -0.0590 0.0181  120 LEU B N   
2726 C CA  . LEU B 120 ? 0.1678 0.2366 0.2579 0.0149  -0.0645 0.0242  120 LEU B CA  
2727 C C   . LEU B 120 ? 0.2138 0.2781 0.3146 0.0227  -0.0669 0.0236  120 LEU B C   
2728 O O   . LEU B 120 ? 0.2605 0.3194 0.3622 0.0239  -0.0729 0.0287  120 LEU B O   
2729 C CB  . LEU B 120 ? 0.1431 0.2007 0.2209 0.0108  -0.0630 0.0269  120 LEU B CB  
2730 C CG  . LEU B 120 ? 0.1503 0.2115 0.2164 0.0034  -0.0606 0.0269  120 LEU B CG  
2731 C CD1 . LEU B 120 ? 0.1453 0.1971 0.2005 0.0002  -0.0583 0.0290  120 LEU B CD1 
2732 C CD2 . LEU B 120 ? 0.1487 0.2156 0.2097 -0.0002 -0.0650 0.0304  120 LEU B CD2 
2733 N N   . PHE B 121 ? 0.2059 0.2727 0.3149 0.0277  -0.0621 0.0171  121 PHE B N   
2734 C CA  . PHE B 121 ? 0.2332 0.2943 0.3513 0.0354  -0.0636 0.0145  121 PHE B CA  
2735 C C   . PHE B 121 ? 0.2254 0.2997 0.3569 0.0411  -0.0628 0.0100  121 PHE B C   
2736 O O   . PHE B 121 ? 0.2612 0.3328 0.4008 0.0467  -0.0674 0.0103  121 PHE B O   
2737 C CB  . PHE B 121 ? 0.2862 0.3390 0.4024 0.0376  -0.0588 0.0093  121 PHE B CB  
2738 C CG  . PHE B 121 ? 0.3494 0.3879 0.4545 0.0332  -0.0604 0.0137  121 PHE B CG  
2739 C CD1 . PHE B 121 ? 0.3817 0.4127 0.4819 0.0295  -0.0668 0.0218  121 PHE B CD1 
2740 C CD2 . PHE B 121 ? 0.3794 0.4133 0.4790 0.0323  -0.0554 0.0100  121 PHE B CD2 
2741 C CE1 . PHE B 121 ? 0.3874 0.4072 0.4775 0.0245  -0.0676 0.0264  121 PHE B CE1 
2742 C CE2 . PHE B 121 ? 0.3953 0.4172 0.4851 0.0279  -0.0567 0.0143  121 PHE B CE2 
2743 C CZ  . PHE B 121 ? 0.4031 0.4185 0.4882 0.0238  -0.0626 0.0226  121 PHE B CZ  
2744 N N   . LEU B 122 ? 0.1674 0.2561 0.3018 0.0395  -0.0570 0.0063  122 LEU B N   
2745 C CA  . LEU B 122 ? 0.1663 0.2696 0.3137 0.0444  -0.0546 0.0019  122 LEU B CA  
2746 C C   . LEU B 122 ? 0.1510 0.2679 0.3032 0.0418  -0.0581 0.0054  122 LEU B C   
2747 O O   . LEU B 122 ? 0.1791 0.3097 0.3432 0.0455  -0.0572 0.0031  122 LEU B O   
2748 C CB  . LEU B 122 ? 0.2008 0.3129 0.3494 0.0436  -0.0453 -0.0039 122 LEU B CB  
2749 C CG  . LEU B 122 ? 0.2363 0.3370 0.3784 0.0454  -0.0411 -0.0080 122 LEU B CG  
2750 C CD1 . LEU B 122 ? 0.2332 0.3448 0.3756 0.0439  -0.0319 -0.0129 122 LEU B CD1 
2751 C CD2 . LEU B 122 ? 0.2633 0.3546 0.4100 0.0532  -0.0440 -0.0117 122 LEU B CD2 
2752 N N   . GLY B 123 ? 0.1687 0.2826 0.3116 0.0354  -0.0621 0.0103  123 GLY B N   
2753 C CA  . GLY B 123 ? 0.1617 0.2869 0.3072 0.0326  -0.0666 0.0130  123 GLY B CA  
2754 C C   . GLY B 123 ? 0.1388 0.2816 0.2901 0.0290  -0.0618 0.0096  123 GLY B C   
2755 O O   . GLY B 123 ? 0.1238 0.2799 0.2832 0.0294  -0.0647 0.0100  123 GLY B O   
2756 N N   . LYS B 124 ? 0.1086 0.2517 0.2563 0.0249  -0.0548 0.0067  124 LYS B N   
2757 C CA  . LYS B 124 ? 0.1116 0.2701 0.2647 0.0198  -0.0502 0.0049  124 LYS B CA  
2758 C C   . LYS B 124 ? 0.0898 0.2489 0.2355 0.0121  -0.0538 0.0044  124 LYS B C   
2759 O O   . LYS B 124 ? 0.1247 0.2705 0.2587 0.0090  -0.0563 0.0056  124 LYS B O   
2760 C CB  . LYS B 124 ? 0.1400 0.2978 0.2927 0.0174  -0.0416 0.0030  124 LYS B CB  
2761 C CG  . LYS B 124 ? 0.1895 0.3438 0.3471 0.0253  -0.0373 -0.0002 124 LYS B CG  
2762 C CD  . LYS B 124 ? 0.2468 0.4124 0.4184 0.0320  -0.0379 -0.0015 124 LYS B CD  
2763 C CE  . LYS B 124 ? 0.2806 0.4410 0.4548 0.0407  -0.0347 -0.0070 124 LYS B CE  
2764 N NZ  . LYS B 124 ? 0.2760 0.4394 0.4477 0.0387  -0.0256 -0.0110 124 LYS B NZ  
2765 N N   . THR B 125 ? 0.0810 0.2533 0.2335 0.0088  -0.0539 0.0022  125 THR B N   
2766 C CA  . THR B 125 ? 0.1533 0.3238 0.3023 0.0018  -0.0579 -0.0005 125 THR B CA  
2767 C C   . THR B 125 ? 0.1522 0.3222 0.3053 -0.0055 -0.0529 -0.0046 125 THR B C   
2768 O O   . THR B 125 ? 0.1611 0.3305 0.3134 -0.0119 -0.0559 -0.0053 125 THR B O   
2769 C CB  . THR B 125 ? 0.1603 0.3410 0.3161 0.0034  -0.0649 0.0001  125 THR B CB  
2770 O OG1 . THR B 125 ? 0.1879 0.3835 0.3561 0.0078  -0.0622 -0.0004 125 THR B OG1 
2771 C CG2 . THR B 125 ? 0.1351 0.3089 0.2848 0.0081  -0.0715 0.0056  125 THR B CG2 
2772 N N   . GLU B 126 ? 0.1436 0.3128 0.3026 -0.0046 -0.0460 -0.0058 126 GLU B N   
2773 C CA  . GLU B 126 ? 0.1066 0.2746 0.2698 -0.0123 -0.0409 -0.0048 126 GLU B CA  
2774 C C   . GLU B 126 ? 0.0697 0.2312 0.2282 -0.0112 -0.0342 -0.0031 126 GLU B C   
2775 O O   . GLU B 126 ? 0.1265 0.2898 0.2890 -0.0047 -0.0320 -0.0005 126 GLU B O   
2776 C CB  . GLU B 126 ? 0.0991 0.2807 0.2789 -0.0133 -0.0385 -0.0039 126 GLU B CB  
2777 C CG  . GLU B 126 ? 0.1395 0.3290 0.3255 -0.0182 -0.0432 -0.0056 126 GLU B CG  
2778 C CD  . GLU B 126 ? 0.1807 0.3856 0.3845 -0.0169 -0.0418 -0.0045 126 GLU B CD  
2779 O OE1 . GLU B 126 ? 0.1716 0.3827 0.3811 -0.0167 -0.0344 -0.0029 126 GLU B OE1 
2780 O OE2 . GLU B 126 ? 0.1937 0.4060 0.4052 -0.0158 -0.0478 -0.0055 126 GLU B OE2 
2781 N N   . VAL B 127 ? 0.1203 0.2745 0.2698 -0.0174 -0.0311 -0.0033 127 VAL B N   
2782 C CA  . VAL B 127 ? 0.1095 0.2586 0.2533 -0.0166 -0.0243 -0.0021 127 VAL B CA  
2783 C C   . VAL B 127 ? 0.1301 0.2799 0.2737 -0.0239 -0.0187 -0.0014 127 VAL B C   
2784 O O   . VAL B 127 ? 0.1704 0.3190 0.3146 -0.0304 -0.0212 -0.0019 127 VAL B O   
2785 C CB  . VAL B 127 ? 0.2119 0.3478 0.3417 -0.0157 -0.0258 -0.0021 127 VAL B CB  
2786 C CG1 . VAL B 127 ? 0.2424 0.3773 0.3708 -0.0090 -0.0319 -0.0025 127 VAL B CG1 
2787 C CG2 . VAL B 127 ? 0.2271 0.3545 0.3476 -0.0230 -0.0278 -0.0025 127 VAL B CG2 
2788 N N   . PRO B 128 ? 0.0838 0.2356 0.2266 -0.0230 -0.0115 -0.0001 128 PRO B N   
2789 C CA  . PRO B 128 ? 0.0609 0.2123 0.2031 -0.0305 -0.0069 0.0018  128 PRO B CA  
2790 C C   . PRO B 128 ? 0.0868 0.2228 0.2180 -0.0360 -0.0077 0.0024  128 PRO B C   
2791 O O   . PRO B 128 ? 0.0893 0.2156 0.2112 -0.0335 -0.0094 0.0015  128 PRO B O   
2792 C CB  . PRO B 128 ? 0.0762 0.2348 0.2188 -0.0274 0.0006  0.0030  128 PRO B CB  
2793 C CG  . PRO B 128 ? 0.0900 0.2464 0.2288 -0.0186 0.0003  0.0007  128 PRO B CG  
2794 C CD  . PRO B 128 ? 0.0935 0.2490 0.2364 -0.0153 -0.0075 -0.0007 128 PRO B CD  
2795 N N   . GLN B 129 ? 0.1205 0.2545 0.2536 -0.0435 -0.0069 0.0038  129 GLN B N   
2796 C CA  . GLN B 129 ? 0.1176 0.2367 0.2426 -0.0486 -0.0080 0.0038  129 GLN B CA  
2797 C C   . GLN B 129 ? 0.0706 0.1809 0.1856 -0.0463 -0.0041 0.0056  129 GLN B C   
2798 O O   . GLN B 129 ? 0.0747 0.1719 0.1815 -0.0474 -0.0061 0.0044  129 GLN B O   
2799 C CB  . GLN B 129 ? 0.1071 0.2260 0.2375 -0.0565 -0.0072 0.0057  129 GLN B CB  
2800 C CG  . GLN B 129 ? 0.1176 0.2200 0.2409 -0.0614 -0.0086 0.0052  129 GLN B CG  
2801 C CD  . GLN B 129 ? 0.1632 0.2579 0.2825 -0.0615 -0.0150 -0.0008 129 GLN B CD  
2802 O OE1 . GLN B 129 ? 0.1914 0.2932 0.3159 -0.0615 -0.0192 -0.0039 129 GLN B OE1 
2803 N NE2 . GLN B 129 ? 0.1817 0.2625 0.2914 -0.0611 -0.0158 -0.0026 129 GLN B NE2 
2804 N N   . GLU B 130 ? 0.0635 0.1812 0.1789 -0.0428 0.0015  0.0079  130 GLU B N   
2805 C CA  . GLU B 130 ? 0.0898 0.2004 0.1956 -0.0404 0.0052  0.0095  130 GLU B CA  
2806 C C   . GLU B 130 ? 0.0752 0.1784 0.1738 -0.0357 0.0023  0.0068  130 GLU B C   
2807 O O   . GLU B 130 ? 0.0657 0.1589 0.1557 -0.0357 0.0036  0.0076  130 GLU B O   
2808 C CB  . GLU B 130 ? 0.1698 0.2912 0.2761 -0.0366 0.0115  0.0111  130 GLU B CB  
2809 C CG  . GLU B 130 ? 0.2208 0.3504 0.3323 -0.0418 0.0151  0.0149  130 GLU B CG  
2810 C CD  . GLU B 130 ? 0.2623 0.4073 0.3856 -0.0409 0.0147  0.0133  130 GLU B CD  
2811 O OE1 . GLU B 130 ? 0.2401 0.3847 0.3700 -0.0439 0.0099  0.0121  130 GLU B OE1 
2812 O OE2 . GLU B 130 ? 0.3553 0.5131 0.4813 -0.0367 0.0190  0.0128  130 GLU B OE2 
2813 N N   . ARG B 131 ? 0.0510 0.1593 0.1532 -0.0318 -0.0018 0.0040  131 ARG B N   
2814 C CA  . ARG B 131 ? 0.0464 0.1484 0.1417 -0.0278 -0.0052 0.0022  131 ARG B CA  
2815 C C   . ARG B 131 ? 0.0766 0.1663 0.1647 -0.0326 -0.0093 0.0012  131 ARG B C   
2816 O O   . ARG B 131 ? 0.0841 0.1618 0.1613 -0.0302 -0.0095 0.0002  131 ARG B O   
2817 C CB  . ARG B 131 ? 0.0578 0.1676 0.1589 -0.0222 -0.0096 0.0005  131 ARG B CB  
2818 C CG  . ARG B 131 ? 0.1020 0.2223 0.2102 -0.0156 -0.0061 -0.0004 131 ARG B CG  
2819 C CD  . ARG B 131 ? 0.1065 0.2213 0.2083 -0.0088 -0.0044 -0.0021 131 ARG B CD  
2820 N NE  . ARG B 131 ? 0.0726 0.1761 0.1629 -0.0112 -0.0001 -0.0010 131 ARG B NE  
2821 C CZ  . ARG B 131 ? 0.0800 0.1889 0.1699 -0.0126 0.0062  0.0000  131 ARG B CZ  
2822 N NH1 . ARG B 131 ? 0.1239 0.2456 0.2216 -0.0118 0.0096  -0.0001 131 ARG B NH1 
2823 N NH2 . ARG B 131 ? 0.1194 0.2173 0.1989 -0.0145 0.0088  0.0016  131 ARG B NH2 
2824 N N   . ILE B 132 ? 0.0546 0.1436 0.1465 -0.0375 -0.0120 0.0001  132 ILE B N   
2825 C CA  . ILE B 132 ? 0.0593 0.1364 0.1449 -0.0416 -0.0154 -0.0027 132 ILE B CA  
2826 C C   . ILE B 132 ? 0.0790 0.1456 0.1609 -0.0444 -0.0118 -0.0013 132 ILE B C   
2827 O O   . ILE B 132 ? 0.0793 0.1349 0.1533 -0.0445 -0.0129 -0.0034 132 ILE B O   
2828 C CB  . ILE B 132 ? 0.1238 0.2038 0.2158 -0.0457 -0.0195 -0.0055 132 ILE B CB  
2829 C CG1 . ILE B 132 ? 0.1440 0.2342 0.2396 -0.0425 -0.0238 -0.0062 132 ILE B CG1 
2830 C CG2 . ILE B 132 ? 0.1401 0.2085 0.2267 -0.0493 -0.0228 -0.0103 132 ILE B CG2 
2831 C CD1 . ILE B 132 ? 0.1641 0.2516 0.2503 -0.0380 -0.0269 -0.0067 132 ILE B CD1 
2832 N N   . ASP B 133 ? 0.0748 0.1452 0.1618 -0.0462 -0.0073 0.0026  133 ASP B N   
2833 C CA  . ASP B 133 ? 0.0873 0.1480 0.1706 -0.0487 -0.0042 0.0055  133 ASP B CA  
2834 C C   . ASP B 133 ? 0.0792 0.1340 0.1539 -0.0446 -0.0019 0.0065  133 ASP B C   
2835 O O   . ASP B 133 ? 0.0990 0.1416 0.1687 -0.0456 -0.0022 0.0067  133 ASP B O   
2836 C CB  . ASP B 133 ? 0.1274 0.1956 0.2164 -0.0513 0.0001  0.0105  133 ASP B CB  
2837 C CG  . ASP B 133 ? 0.1723 0.2429 0.2695 -0.0572 -0.0023 0.0102  133 ASP B CG  
2838 O OD1 . ASP B 133 ? 0.1851 0.2504 0.2831 -0.0594 -0.0073 0.0055  133 ASP B OD1 
2839 O OD2 . ASP B 133 ? 0.1495 0.2282 0.2521 -0.0599 0.0009  0.0145  133 ASP B OD2 
2840 N N   . ALA B 134 ? 0.0925 0.1552 0.1654 -0.0391 0.0000  0.0065  134 ALA B N   
2841 C CA  . ALA B 134 ? 0.0782 0.1336 0.1408 -0.0333 0.0024  0.0059  134 ALA B CA  
2842 C C   . ALA B 134 ? 0.0559 0.0990 0.1104 -0.0322 -0.0012 0.0021  134 ALA B C   
2843 O O   . ALA B 134 ? 0.0648 0.0990 0.1115 -0.0299 0.0002  0.0019  134 ALA B O   
2844 C CB  . ALA B 134 ? 0.0726 0.1367 0.1355 -0.0268 0.0036  0.0047  134 ALA B CB  
2845 N N   . ILE B 135 ? 0.0539 0.0986 0.1100 -0.0335 -0.0059 -0.0012 135 ILE B N   
2846 C CA  . ILE B 135 ? 0.0858 0.1226 0.1337 -0.0325 -0.0090 -0.0053 135 ILE B CA  
2847 C C   . ILE B 135 ? 0.0680 0.0949 0.1150 -0.0359 -0.0097 -0.0078 135 ILE B C   
2848 O O   . ILE B 135 ? 0.0624 0.0811 0.1023 -0.0336 -0.0089 -0.0097 135 ILE B O   
2849 C CB  . ILE B 135 ? 0.0643 0.1077 0.1129 -0.0330 -0.0140 -0.0079 135 ILE B CB  
2850 C CG1 . ILE B 135 ? 0.1015 0.1529 0.1521 -0.0285 -0.0142 -0.0050 135 ILE B CG1 
2851 C CG2 . ILE B 135 ? 0.0898 0.1277 0.1289 -0.0326 -0.0166 -0.0122 135 ILE B CG2 
2852 C CD1 . ILE B 135 ? 0.0919 0.1503 0.1436 -0.0286 -0.0200 -0.0057 135 ILE B CD1 
2853 N N   . THR B 136 ? 0.0810 0.1085 0.1366 -0.0415 -0.0116 -0.0079 136 THR B N   
2854 C CA  . THR B 136 ? 0.1072 0.1234 0.1639 -0.0445 -0.0134 -0.0107 136 THR B CA  
2855 C C   . THR B 136 ? 0.0935 0.1015 0.1485 -0.0433 -0.0097 -0.0061 136 THR B C   
2856 O O   . THR B 136 ? 0.0962 0.0933 0.1487 -0.0423 -0.0110 -0.0091 136 THR B O   
2857 C CB  . THR B 136 ? 0.1779 0.1949 0.2407 -0.0499 -0.0162 -0.0115 136 THR B CB  
2858 O OG1 . THR B 136 ? 0.1761 0.2002 0.2461 -0.0524 -0.0129 -0.0052 136 THR B OG1 
2859 C CG2 . THR B 136 ? 0.2062 0.2310 0.2681 -0.0505 -0.0205 -0.0161 136 THR B CG2 
2860 N N   . GLU B 137 ? 0.1093 0.1237 0.1656 -0.0429 -0.0055 0.0007  137 GLU B N   
2861 C CA  . GLU B 137 ? 0.0866 0.0956 0.1398 -0.0416 -0.0021 0.0057  137 GLU B CA  
2862 C C   . GLU B 137 ? 0.0714 0.0746 0.1145 -0.0353 -0.0012 0.0024  137 GLU B C   
2863 O O   . GLU B 137 ? 0.0786 0.0725 0.1192 -0.0342 -0.0013 0.0028  137 GLU B O   
2864 C CB  . GLU B 137 ? 0.0993 0.1196 0.1543 -0.0419 0.0026  0.0122  137 GLU B CB  
2865 C CG  . GLU B 137 ? 0.0957 0.1217 0.1578 -0.0468 0.0033  0.0160  137 GLU B CG  
2866 C CD  . GLU B 137 ? 0.0932 0.1343 0.1565 -0.0455 0.0082  0.0196  137 GLU B CD  
2867 O OE1 . GLU B 137 ? 0.1430 0.1887 0.2014 -0.0408 0.0110  0.0194  137 GLU B OE1 
2868 O OE2 . GLU B 137 ? 0.1379 0.1862 0.2072 -0.0489 0.0091  0.0220  137 GLU B OE2 
2869 N N   . ALA B 138 ? 0.0674 0.0763 0.1055 -0.0315 -0.0009 -0.0004 138 ALA B N   
2870 C CA  . ALA B 138 ? 0.0755 0.0802 0.1048 -0.0267 -0.0005 -0.0030 138 ALA B CA  
2871 C C   . ALA B 138 ? 0.0635 0.0608 0.0909 -0.0268 -0.0033 -0.0088 138 ALA B C   
2872 O O   . ALA B 138 ? 0.0778 0.0690 0.1013 -0.0241 -0.0025 -0.0098 138 ALA B O   
2873 C CB  . ALA B 138 ? 0.0946 0.1064 0.1204 -0.0237 -0.0008 -0.0039 138 ALA B CB  
2874 N N   . TYR B 139 ? 0.0674 0.0663 0.0977 -0.0295 -0.0068 -0.0134 139 TYR B N   
2875 C CA  . TYR B 139 ? 0.0787 0.0720 0.1077 -0.0292 -0.0096 -0.0209 139 TYR B CA  
2876 C C   . TYR B 139 ? 0.0928 0.0748 0.1266 -0.0297 -0.0100 -0.0208 139 TYR B C   
2877 O O   . TYR B 139 ? 0.1027 0.0792 0.1342 -0.0265 -0.0106 -0.0257 139 TYR B O   
2878 C CB  . TYR B 139 ? 0.0790 0.0762 0.1111 -0.0328 -0.0139 -0.0265 139 TYR B CB  
2879 C CG  . TYR B 139 ? 0.0823 0.0907 0.1093 -0.0323 -0.0150 -0.0270 139 TYR B CG  
2880 C CD1 . TYR B 139 ? 0.0691 0.0818 0.0891 -0.0287 -0.0127 -0.0235 139 TYR B CD1 
2881 C CD2 . TYR B 139 ? 0.0972 0.1113 0.1272 -0.0358 -0.0191 -0.0306 139 TYR B CD2 
2882 C CE1 . TYR B 139 ? 0.0667 0.0883 0.0830 -0.0287 -0.0148 -0.0227 139 TYR B CE1 
2883 C CE2 . TYR B 139 ? 0.0768 0.1012 0.1026 -0.0355 -0.0211 -0.0300 139 TYR B CE2 
2884 C CZ  . TYR B 139 ? 0.0996 0.1274 0.1187 -0.0319 -0.0190 -0.0255 139 TYR B CZ  
2885 O OH  . TYR B 139 ? 0.0801 0.1172 0.0957 -0.0319 -0.0219 -0.0236 139 TYR B OH  
2886 N N   . ASP B 140 ? 0.0837 0.0630 0.1256 -0.0340 -0.0105 -0.0154 140 ASP B N   
2887 C CA  . ASP B 140 ? 0.0993 0.0675 0.1454 -0.0347 -0.0115 -0.0127 140 ASP B CA  
2888 C C   . ASP B 140 ? 0.1026 0.0668 0.1449 -0.0306 -0.0089 -0.0094 140 ASP B C   
2889 O O   . ASP B 140 ? 0.1096 0.0651 0.1524 -0.0277 -0.0106 -0.0118 140 ASP B O   
2890 C CB  . ASP B 140 ? 0.1216 0.0909 0.1735 -0.0399 -0.0111 -0.0048 140 ASP B CB  
2891 C CG  . ASP B 140 ? 0.1446 0.1159 0.2010 -0.0442 -0.0142 -0.0080 140 ASP B CG  
2892 O OD1 . ASP B 140 ? 0.1467 0.1160 0.2015 -0.0431 -0.0174 -0.0164 140 ASP B OD1 
2893 O OD2 . ASP B 140 ? 0.1610 0.1369 0.2224 -0.0488 -0.0132 -0.0021 140 ASP B OD2 
2894 N N   . PHE B 141 ? 0.0805 0.0526 0.1172 -0.0291 -0.0048 -0.0039 141 PHE B N   
2895 C CA  . PHE B 141 ? 0.0915 0.0614 0.1228 -0.0248 -0.0025 -0.0010 141 PHE B CA  
2896 C C   . PHE B 141 ? 0.0867 0.0549 0.1128 -0.0198 -0.0030 -0.0081 141 PHE B C   
2897 O O   . PHE B 141 ? 0.0918 0.0540 0.1181 -0.0169 -0.0035 -0.0082 141 PHE B O   
2898 C CB  . PHE B 141 ? 0.1117 0.0908 0.1375 -0.0236 0.0017  0.0041  141 PHE B CB  
2899 C CG  . PHE B 141 ? 0.1256 0.1092 0.1551 -0.0276 0.0035  0.0118  141 PHE B CG  
2900 C CD1 . PHE B 141 ? 0.1230 0.1011 0.1558 -0.0302 0.0029  0.0183  141 PHE B CD1 
2901 C CD2 . PHE B 141 ? 0.1178 0.1126 0.1478 -0.0285 0.0059  0.0129  141 PHE B CD2 
2902 C CE1 . PHE B 141 ? 0.1344 0.1195 0.1694 -0.0343 0.0051  0.0260  141 PHE B CE1 
2903 C CE2 . PHE B 141 ? 0.0971 0.0995 0.1307 -0.0322 0.0084  0.0196  141 PHE B CE2 
2904 C CZ  . PHE B 141 ? 0.1437 0.1420 0.1793 -0.0355 0.0082  0.0264  141 PHE B CZ  
2905 N N   . VAL B 142 ? 0.0886 0.0635 0.1104 -0.0189 -0.0029 -0.0134 142 VAL B N   
2906 C CA  . VAL B 142 ? 0.0885 0.0652 0.1048 -0.0149 -0.0026 -0.0192 142 VAL B CA  
2907 C C   . VAL B 142 ? 0.1143 0.0849 0.1350 -0.0135 -0.0055 -0.0270 142 VAL B C   
2908 O O   . VAL B 142 ? 0.1165 0.0859 0.1361 -0.0095 -0.0051 -0.0302 142 VAL B O   
2909 C CB  . VAL B 142 ? 0.0855 0.0720 0.0960 -0.0152 -0.0023 -0.0215 142 VAL B CB  
2910 C CG1 . VAL B 142 ? 0.1265 0.1170 0.1314 -0.0121 -0.0017 -0.0263 142 VAL B CG1 
2911 C CG2 . VAL B 142 ? 0.1087 0.0998 0.1167 -0.0155 -0.0003 -0.0148 142 VAL B CG2 
2912 N N   . GLU B 143 ? 0.1031 0.0698 0.1299 -0.0167 -0.0088 -0.0306 143 GLU B N   
2913 C CA  . GLU B 143 ? 0.1304 0.0907 0.1613 -0.0147 -0.0119 -0.0377 143 GLU B CA  
2914 C C   . GLU B 143 ? 0.1328 0.0840 0.1679 -0.0115 -0.0123 -0.0344 143 GLU B C   
2915 O O   . GLU B 143 ? 0.1609 0.1108 0.1967 -0.0068 -0.0132 -0.0400 143 GLU B O   
2916 C CB  . GLU B 143 ? 0.1373 0.0942 0.1733 -0.0189 -0.0152 -0.0383 143 GLU B CB  
2917 C CG  . GLU B 143 ? 0.1313 0.0817 0.1714 -0.0166 -0.0185 -0.0450 143 GLU B CG  
2918 C CD  . GLU B 143 ? 0.1681 0.1270 0.2029 -0.0132 -0.0185 -0.0552 143 GLU B CD  
2919 O OE1 . GLU B 143 ? 0.1649 0.1346 0.1923 -0.0139 -0.0165 -0.0559 143 GLU B OE1 
2920 O OE2 . GLU B 143 ? 0.1578 0.1137 0.1957 -0.0099 -0.0204 -0.0621 143 GLU B OE2 
2921 N N   . ALA B 144 ? 0.1437 0.0903 0.1814 -0.0141 -0.0116 -0.0247 144 ALA B N   
2922 C CA  . ALA B 144 ? 0.1768 0.1153 0.2182 -0.0117 -0.0128 -0.0196 144 ALA B CA  
2923 C C   . ALA B 144 ? 0.1668 0.1075 0.2045 -0.0065 -0.0108 -0.0202 144 ALA B C   
2924 O O   . ALA B 144 ? 0.1844 0.1199 0.2250 -0.0031 -0.0123 -0.0181 144 ALA B O   
2925 C CB  . ALA B 144 ? 0.1755 0.1113 0.2193 -0.0166 -0.0126 -0.0079 144 ALA B CB  
2926 N N   . PHE B 145 ? 0.1525 0.1038 0.1820 -0.0058 -0.0071 -0.0215 145 PHE B N   
2937 N N   . PHE B 146 ? 0.2547 0.1635 0.2406 0.0331  -0.0067 0.0221  146 PHE B N   
2938 C CA  . PHE B 146 ? 0.2254 0.1373 0.2229 0.0415  -0.0063 0.0169  146 PHE B CA  
2939 C C   . PHE B 146 ? 0.3147 0.2170 0.3204 0.0495  -0.0087 0.0222  146 PHE B C   
2940 O O   . PHE B 146 ? 0.3656 0.2789 0.3826 0.0566  -0.0111 0.0223  146 PHE B O   
2941 C CB  . PHE B 146 ? 0.2190 0.1310 0.2192 0.0379  -0.0005 0.0056  146 PHE B CB  
2942 C CG  . PHE B 146 ? 0.2154 0.1429 0.2116 0.0311  0.0004  0.0014  146 PHE B CG  
2943 C CD1 . PHE B 146 ? 0.1879 0.1323 0.1880 0.0337  -0.0008 -0.0004 146 PHE B CD1 
2944 C CD2 . PHE B 146 ? 0.1994 0.1245 0.1891 0.0224  0.0024  -0.0005 146 PHE B CD2 
2945 C CE1 . PHE B 146 ? 0.1626 0.1192 0.1591 0.0282  0.0000  -0.0030 146 PHE B CE1 
2946 C CE2 . PHE B 146 ? 0.1762 0.1151 0.1638 0.0176  0.0027  -0.0032 146 PHE B CE2 
2947 C CZ  . PHE B 146 ? 0.1434 0.0972 0.1339 0.0206  0.0015  -0.0039 146 PHE B CZ  
2948 N N   . LYS B 147 ? 0.3124 0.1987 0.3153 0.0466  -0.0081 0.0265  147 LYS B N   
2949 C CA  . LYS B 147 ? 0.3568 0.2353 0.3693 0.0528  -0.0117 0.0314  147 LYS B CA  
2950 C C   . LYS B 147 ? 0.4082 0.2883 0.4313 0.0605  -0.0107 0.0217  147 LYS B C   
2951 O O   . LYS B 147 ? 0.4591 0.3335 0.4814 0.0587  -0.0048 0.0116  147 LYS B O   
2952 C CB  . LYS B 147 ? 0.4140 0.3031 0.4270 0.0559  -0.0180 0.0427  147 LYS B CB  
2953 C CG  . LYS B 147 ? 0.4504 0.3320 0.4518 0.0503  -0.0195 0.0534  147 LYS B CG  
2954 C CD  . LYS B 147 ? 0.4666 0.3606 0.4673 0.0546  -0.0246 0.0638  147 LYS B CD  
2955 C CE  . LYS B 147 ? 0.4758 0.3826 0.4631 0.0489  -0.0265 0.0660  147 LYS B CE  
2956 N NZ  . LYS B 147 ? 0.4652 0.3817 0.4531 0.0462  -0.0256 0.0567  147 LYS B NZ  
2957 N N   . ASP B 148 ? 0.4143 0.3016 0.4419 0.0694  -0.0159 0.0240  148 ASP B N   
2958 C CA  . ASP B 148 ? 0.4418 0.3321 0.4752 0.0788  -0.0109 0.0165  148 ASP B CA  
2959 C C   . ASP B 148 ? 0.4273 0.3406 0.4666 0.0796  -0.0076 0.0127  148 ASP B C   
2960 O O   . ASP B 148 ? 0.4475 0.3705 0.4978 0.0861  -0.0050 0.0087  148 ASP B O   
2961 C CB  . ASP B 148 ? 0.4779 0.3646 0.5159 0.0893  -0.0145 0.0228  148 ASP B CB  
2962 C CG  . ASP B 148 ? 0.5103 0.3778 0.5395 0.0881  -0.0193 0.0318  148 ASP B CG  
2963 O OD1 . ASP B 148 ? 0.5251 0.3738 0.5552 0.0888  -0.0166 0.0295  148 ASP B OD1 
2964 O OD2 . ASP B 148 ? 0.5244 0.3955 0.5448 0.0862  -0.0252 0.0411  148 ASP B OD2 
2965 N N   . GLN B 149 ? 0.3573 0.2820 0.4003 0.0704  -0.0063 0.0153  149 GLN B N   
2966 C CA  . GLN B 149 ? 0.3458 0.2904 0.3924 0.0705  -0.0077 0.0111  149 GLN B CA  
2967 C C   . GLN B 149 ? 0.3017 0.2490 0.3416 0.0647  -0.0034 0.0007  149 GLN B C   
2968 O O   . GLN B 149 ? 0.2998 0.2341 0.3304 0.0596  -0.0010 -0.0021 149 GLN B O   
2969 C CB  . GLN B 149 ? 0.3703 0.3254 0.4110 0.0681  -0.0157 0.0193  149 GLN B CB  
2970 C CG  . GLN B 149 ? 0.4153 0.3713 0.4619 0.0726  -0.0213 0.0296  149 GLN B CG  
2971 C CD  . GLN B 149 ? 0.4297 0.4033 0.4751 0.0709  -0.0285 0.0344  149 GLN B CD  
2972 O OE1 . GLN B 149 ? 0.4315 0.4066 0.4629 0.0643  -0.0308 0.0364  149 GLN B OE1 
2973 N NE2 . GLN B 149 ? 0.4200 0.4071 0.4788 0.0760  -0.0309 0.0353  149 GLN B NE2 
2974 N N   . THR B 150 ? 0.2335 0.1986 0.2780 0.0648  -0.0023 -0.0045 150 THR B N   
2975 C CA  . THR B 150 ? 0.2051 0.1760 0.2451 0.0597  0.0026  -0.0143 150 THR B CA  
2976 C C   . THR B 150 ? 0.1426 0.1200 0.1705 0.0513  0.0008  -0.0116 150 THR B C   
2977 O O   . THR B 150 ? 0.1606 0.1363 0.1810 0.0446  0.0040  -0.0160 150 THR B O   
2978 C CB  . THR B 150 ? 0.2568 0.2440 0.3057 0.0609  0.0062  -0.0195 150 THR B CB  
2979 O OG1 . THR B 150 ? 0.2838 0.2671 0.3427 0.0675  0.0087  -0.0196 150 THR B OG1 
2980 C CG2 . THR B 150 ? 0.2731 0.2632 0.3157 0.0546  0.0122  -0.0286 150 THR B CG2 
2981 N N   . TYR B 151 ? 0.1182 0.1035 0.1449 0.0516  -0.0043 -0.0044 151 TYR B N   
2982 C CA  . TYR B 151 ? 0.1039 0.0970 0.1215 0.0440  -0.0048 -0.0026 151 TYR B CA  
2983 C C   . TYR B 151 ? 0.0965 0.0823 0.1057 0.0409  -0.0087 0.0058  151 TYR B C   
2984 O O   . TYR B 151 ? 0.1233 0.0984 0.1327 0.0447  -0.0115 0.0110  151 TYR B O   
2985 C CB  . TYR B 151 ? 0.1089 0.1201 0.1316 0.0446  -0.0052 -0.0041 151 TYR B CB  
2986 C CG  . TYR B 151 ? 0.1085 0.1272 0.1377 0.0459  -0.0001 -0.0127 151 TYR B CG  
2987 C CD1 . TYR B 151 ? 0.0990 0.1201 0.1214 0.0396  0.0042  -0.0172 151 TYR B CD1 
2988 C CD2 . TYR B 151 ? 0.1311 0.1541 0.1729 0.0525  0.0007  -0.0156 151 TYR B CD2 
2989 C CE1 . TYR B 151 ? 0.1151 0.1429 0.1410 0.0397  0.0094  -0.0249 151 TYR B CE1 
2990 C CE2 . TYR B 151 ? 0.1653 0.1938 0.2109 0.0504  0.0069  -0.0228 151 TYR B CE2 
2991 C CZ  . TYR B 151 ? 0.1564 0.1865 0.1926 0.0436  0.0111  -0.0271 151 TYR B CZ  
2992 O OH  . TYR B 151 ? 0.1626 0.1963 0.1988 0.0404  0.0167  -0.0326 151 TYR B OH  
2993 N N   . VAL B 152 ? 0.0839 0.0745 0.0854 0.0339  -0.0082 0.0069  152 VAL B N   
2994 C CA  . VAL B 152 ? 0.0883 0.0718 0.0810 0.0296  -0.0104 0.0136  152 VAL B CA  
2995 C C   . VAL B 152 ? 0.1406 0.1281 0.1320 0.0319  -0.0157 0.0205  152 VAL B C   
2996 O O   . VAL B 152 ? 0.1448 0.1233 0.1281 0.0297  -0.0179 0.0268  152 VAL B O   
2997 C CB  . VAL B 152 ? 0.1004 0.0880 0.0870 0.0216  -0.0075 0.0123  152 VAL B CB  
2998 C CG1 . VAL B 152 ? 0.1173 0.1014 0.1046 0.0191  -0.0037 0.0067  152 VAL B CG1 
2999 C CG2 . VAL B 152 ? 0.1211 0.1236 0.1093 0.0202  -0.0073 0.0110  152 VAL B CG2 
3000 N N   . ALA B 153 ? 0.0970 0.0984 0.0957 0.0358  -0.0180 0.0192  153 ALA B N   
3001 C CA  . ALA B 153 ? 0.1090 0.1184 0.1065 0.0369  -0.0240 0.0251  153 ALA B CA  
3002 C C   . ALA B 153 ? 0.1473 0.1659 0.1582 0.0458  -0.0278 0.0248  153 ALA B C   
3003 O O   . ALA B 153 ? 0.2056 0.2391 0.2211 0.0443  -0.0301 0.0236  153 ALA B O   
3004 C CB  . ALA B 153 ? 0.1148 0.1363 0.1072 0.0293  -0.0226 0.0231  153 ALA B CB  
3005 N N   . GLY B 154 ? 0.1128 0.1217 0.1314 0.0521  -0.0272 0.0243  154 GLY B N   
3006 C CA  . GLY B 154 ? 0.1235 0.1395 0.1578 0.0583  -0.0291 0.0233  154 GLY B CA  
3007 C C   . GLY B 154 ? 0.1420 0.1569 0.1863 0.0621  -0.0224 0.0147  154 GLY B C   
3008 O O   . GLY B 154 ? 0.1779 0.1828 0.2162 0.0606  -0.0175 0.0102  154 GLY B O   
3009 N N   . ASN B 155 ? 0.1345 0.1597 0.1938 0.0664  -0.0220 0.0122  155 ASN B N   
3010 C CA  . ASN B 155 ? 0.1465 0.1706 0.2146 0.0691  -0.0145 0.0040  155 ASN B CA  
3011 C C   . ASN B 155 ? 0.1549 0.1930 0.2238 0.0646  -0.0097 -0.0040 155 ASN B C   
3012 O O   . ASN B 155 ? 0.1601 0.1989 0.2343 0.0653  -0.0031 -0.0109 155 ASN B O   
3013 C CB  . ASN B 155 ? 0.1926 0.2172 0.2760 0.0771  -0.0144 0.0066  155 ASN B CB  
3014 C CG  . ASN B 155 ? 0.3071 0.3125 0.3896 0.0820  -0.0109 0.0079  155 ASN B CG  
3015 O OD1 . ASN B 155 ? 0.3402 0.3336 0.4141 0.0786  -0.0063 0.0025  155 ASN B OD1 
3016 N ND2 . ASN B 155 ? 0.3411 0.3432 0.4302 0.0901  -0.0128 0.0144  155 ASN B ND2 
3017 N N   . GLN B 156 ? 0.1329 0.1809 0.1951 0.0592  -0.0123 -0.0028 156 GLN B N   
3018 C CA  . GLN B 156 ? 0.1332 0.1920 0.1938 0.0535  -0.0073 -0.0092 156 GLN B CA  
3019 C C   . GLN B 156 ? 0.0942 0.1502 0.1408 0.0473  -0.0059 -0.0093 156 GLN B C   
3020 O O   . GLN B 156 ? 0.1065 0.1573 0.1453 0.0468  -0.0101 -0.0036 156 GLN B O   
3021 C CB  . GLN B 156 ? 0.1810 0.2555 0.2485 0.0520  -0.0098 -0.0086 156 GLN B CB  
3022 C CG  . GLN B 156 ? 0.2390 0.3188 0.3223 0.0587  -0.0124 -0.0069 156 GLN B CG  
3023 C CD  . GLN B 156 ? 0.3137 0.3910 0.4056 0.0623  -0.0053 -0.0127 156 GLN B CD  
3024 O OE1 . GLN B 156 ? 0.3699 0.4412 0.4706 0.0695  -0.0055 -0.0105 156 GLN B OE1 
3025 N NE2 . GLN B 156 ? 0.3205 0.4016 0.4089 0.0570  0.0015  -0.0196 156 GLN B NE2 
3026 N N   . LEU B 157 ? 0.0817 0.1404 0.1247 0.0422  0.0000  -0.0149 157 LEU B N   
3027 C CA  . LEU B 157 ? 0.0783 0.1360 0.1102 0.0360  0.0020  -0.0146 157 LEU B CA  
3028 C C   . LEU B 157 ? 0.0451 0.1114 0.0750 0.0324  -0.0008 -0.0110 157 LEU B C   
3029 O O   . LEU B 157 ? 0.0549 0.1303 0.0903 0.0313  -0.0013 -0.0121 157 LEU B O   
3030 C CB  . LEU B 157 ? 0.1075 0.1658 0.1363 0.0306  0.0080  -0.0196 157 LEU B CB  
3031 C CG  . LEU B 157 ? 0.0925 0.1478 0.1105 0.0236  0.0100  -0.0182 157 LEU B CG  
3032 C CD1 . LEU B 157 ? 0.0779 0.1243 0.0890 0.0236  0.0101  -0.0177 157 LEU B CD1 
3033 C CD2 . LEU B 157 ? 0.0505 0.1065 0.0664 0.0186  0.0141  -0.0205 157 LEU B CD2 
3034 N N   . THR B 158 ? 0.0490 0.1095 0.0697 0.0285  -0.0020 -0.0069 158 THR B N   
3035 C CA  . THR B 158 ? 0.0395 0.1063 0.0568 0.0236  -0.0035 -0.0043 158 THR B CA  
3036 C C   . THR B 158 ? 0.0495 0.1097 0.0579 0.0171  0.0005  -0.0039 158 THR B C   
3037 O O   . THR B 158 ? 0.0498 0.1015 0.0547 0.0168  0.0027  -0.0044 158 THR B O   
3038 C CB  . THR B 158 ? 0.0461 0.1106 0.0606 0.0249  -0.0101 0.0017  158 THR B CB  
3039 O OG1 . THR B 158 ? 0.0560 0.1055 0.0619 0.0237  -0.0102 0.0053  158 THR B OG1 
3040 C CG2 . THR B 158 ? 0.0700 0.1401 0.0947 0.0330  -0.0153 0.0030  158 THR B CG2 
3041 N N   . ILE B 159 ? 0.0448 0.1095 0.0503 0.0117  0.0013  -0.0033 159 ILE B N   
3042 C CA  . ILE B 159 ? 0.0394 0.0978 0.0387 0.0062  0.0052  -0.0026 159 ILE B CA  
3043 C C   . ILE B 159 ? 0.0553 0.1022 0.0489 0.0060  0.0038  0.0009  159 ILE B C   
3044 O O   . ILE B 159 ? 0.0443 0.0852 0.0355 0.0031  0.0068  0.0012  159 ILE B O   
3045 C CB  . ILE B 159 ? 0.0294 0.0890 0.0277 0.0000  0.0061  -0.0035 159 ILE B CB  
3046 C CG1 . ILE B 159 ? 0.0330 0.1007 0.0280 -0.0014 0.0031  -0.0018 159 ILE B CG1 
3047 C CG2 . ILE B 159 ? 0.0791 0.1415 0.0817 -0.0013 0.0073  -0.0069 159 ILE B CG2 
3048 C CD1 . ILE B 159 ? 0.0501 0.1195 0.0447 -0.0085 0.0045  -0.0043 159 ILE B CD1 
3049 N N   . ALA B 160 ? 0.0602 0.1034 0.0524 0.0089  -0.0008 0.0039  160 ALA B N   
3050 C CA  . ALA B 160 ? 0.0587 0.0902 0.0454 0.0079  -0.0013 0.0069  160 ALA B CA  
3051 C C   . ALA B 160 ? 0.0646 0.0900 0.0532 0.0102  0.0002  0.0050  160 ALA B C   
3052 O O   . ALA B 160 ? 0.0484 0.0672 0.0343 0.0074  0.0017  0.0057  160 ALA B O   
3053 C CB  . ALA B 160 ? 0.0658 0.0927 0.0494 0.0102  -0.0064 0.0115  160 ALA B CB  
3054 N N   . ASP B 161 ? 0.0451 0.0737 0.0388 0.0146  0.0001  0.0020  161 ASP B N   
3055 C CA  . ASP B 161 ? 0.0540 0.0779 0.0477 0.0153  0.0020  -0.0010 161 ASP B CA  
3056 C C   . ASP B 161 ? 0.0469 0.0735 0.0385 0.0111  0.0051  -0.0019 161 ASP B C   
3057 O O   . ASP B 161 ? 0.0628 0.0849 0.0522 0.0093  0.0054  -0.0020 161 ASP B O   
3058 C CB  . ASP B 161 ? 0.0774 0.1044 0.0765 0.0201  0.0025  -0.0052 161 ASP B CB  
3059 C CG  . ASP B 161 ? 0.0642 0.0871 0.0674 0.0256  -0.0008 -0.0037 161 ASP B CG  
3060 O OD1 . ASP B 161 ? 0.0862 0.0977 0.0876 0.0267  -0.0015 -0.0029 161 ASP B OD1 
3061 O OD2 . ASP B 161 ? 0.0716 0.1029 0.0808 0.0290  -0.0027 -0.0031 161 ASP B OD2 
3062 N N   . PHE B 162 ? 0.0586 0.0928 0.0513 0.0094  0.0072  -0.0022 162 PHE B N   
3063 C CA  . PHE B 162 ? 0.0539 0.0856 0.0463 0.0055  0.0088  -0.0016 162 PHE B CA  
3064 C C   . PHE B 162 ? 0.0282 0.0548 0.0195 0.0028  0.0090  0.0010  162 PHE B C   
3065 O O   . PHE B 162 ? 0.0672 0.0916 0.0586 0.0017  0.0094  0.0018  162 PHE B O   
3066 C CB  . PHE B 162 ? 0.0537 0.0862 0.0485 0.0032  0.0098  -0.0021 162 PHE B CB  
3067 C CG  . PHE B 162 ? 0.0689 0.1063 0.0655 0.0047  0.0104  -0.0047 162 PHE B CG  
3068 C CD1 . PHE B 162 ? 0.0489 0.0872 0.0449 0.0070  0.0108  -0.0070 162 PHE B CD1 
3069 C CD2 . PHE B 162 ? 0.0695 0.1104 0.0686 0.0032  0.0112  -0.0057 162 PHE B CD2 
3070 C CE1 . PHE B 162 ? 0.0599 0.1022 0.0585 0.0079  0.0123  -0.0101 162 PHE B CE1 
3071 C CE2 . PHE B 162 ? 0.0672 0.1130 0.0690 0.0041  0.0123  -0.0085 162 PHE B CE2 
3072 C CZ  . PHE B 162 ? 0.0757 0.1220 0.0775 0.0065  0.0131  -0.0106 162 PHE B CZ  
3073 N N   . SER B 163 ? 0.0286 0.0548 0.0192 0.0015  0.0089  0.0021  163 SER B N   
3074 C CA  . SER B 163 ? 0.0482 0.0689 0.0383 -0.0014 0.0100  0.0036  163 SER B CA  
3075 C C   . SER B 163 ? 0.0485 0.0677 0.0370 -0.0012 0.0097  0.0048  163 SER B C   
3076 O O   . SER B 163 ? 0.0515 0.0698 0.0428 -0.0028 0.0108  0.0052  163 SER B O   
3077 C CB  . SER B 163 ? 0.0544 0.0745 0.0417 -0.0035 0.0099  0.0043  163 SER B CB  
3078 O OG  . SER B 163 ? 0.0842 0.0987 0.0721 -0.0059 0.0119  0.0046  163 SER B OG  
3079 N N   . LEU B 164 ? 0.0365 0.0515 0.0229 0.0008  0.0069  0.0047  164 LEU B N   
3080 C CA  . LEU B 164 ? 0.0518 0.0601 0.0378 0.0001  0.0059  0.0046  164 LEU B CA  
3081 C C   . LEU B 164 ? 0.0388 0.0492 0.0266 0.0006  0.0054  0.0021  164 LEU B C   
3082 O O   . LEU B 164 ? 0.0540 0.0632 0.0434 -0.0020 0.0052  0.0019  164 LEU B O   
3083 C CB  . LEU B 164 ? 0.0586 0.0594 0.0417 0.0021  0.0036  0.0056  164 LEU B CB  
3084 C CG  . LEU B 164 ? 0.0531 0.0496 0.0319 -0.0008 0.0038  0.0092  164 LEU B CG  
3085 C CD1 . LEU B 164 ? 0.0838 0.0747 0.0595 0.0027  0.0004  0.0121  164 LEU B CD1 
3086 C CD2 . LEU B 164 ? 0.0786 0.0695 0.0567 -0.0058 0.0061  0.0096  164 LEU B CD2 
3087 N N   . ILE B 165 ? 0.0486 0.0633 0.0361 0.0031  0.0052  0.0001  165 ILE B N   
3088 C CA  . ILE B 165 ? 0.0646 0.0817 0.0512 0.0025  0.0046  -0.0021 165 ILE B CA  
3089 C C   . ILE B 165 ? 0.0645 0.0862 0.0529 0.0004  0.0048  0.0007  165 ILE B C   
3090 O O   . ILE B 165 ? 0.0690 0.0925 0.0578 -0.0012 0.0029  0.0004  165 ILE B O   
3091 C CB  . ILE B 165 ? 0.0552 0.0758 0.0397 0.0048  0.0054  -0.0054 165 ILE B CB  
3092 C CG1 . ILE B 165 ? 0.0864 0.1077 0.0671 0.0031  0.0045  -0.0088 165 ILE B CG1 
3093 C CG2 . ILE B 165 ? 0.0756 0.1026 0.0602 0.0050  0.0075  -0.0039 165 ILE B CG2 
3094 C CD1 . ILE B 165 ? 0.0815 0.0962 0.0621 0.0015  0.0030  -0.0115 165 ILE B CD1 
3095 N N   . SER B 166 ? 0.0698 0.0938 0.0603 0.0003  0.0071  0.0032  166 SER B N   
3096 C CA  . SER B 166 ? 0.0540 0.0811 0.0482 -0.0006 0.0080  0.0063  166 SER B CA  
3097 C C   . SER B 166 ? 0.0345 0.0610 0.0339 -0.0024 0.0068  0.0071  166 SER B C   
3098 O O   . SER B 166 ? 0.0622 0.0928 0.0652 -0.0025 0.0047  0.0089  166 SER B O   
3099 C CB  . SER B 166 ? 0.0414 0.0654 0.0380 -0.0008 0.0106  0.0068  166 SER B CB  
3100 O OG  . SER B 166 ? 0.0593 0.0789 0.0577 -0.0024 0.0120  0.0059  166 SER B OG  
3101 N N   . SER B 167 ? 0.0544 0.0766 0.0545 -0.0040 0.0081  0.0061  167 SER B N   
3102 C CA  . SER B 167 ? 0.0357 0.0575 0.0411 -0.0066 0.0081  0.0060  167 SER B CA  
3103 C C   . SER B 167 ? 0.0634 0.0839 0.0675 -0.0081 0.0049  0.0036  167 SER B C   
3104 O O   . SER B 167 ? 0.0452 0.0700 0.0552 -0.0100 0.0035  0.0034  167 SER B O   
3105 C CB  . SER B 167 ? 0.0565 0.0739 0.0623 -0.0093 0.0119  0.0060  167 SER B CB  
3106 O OG  . SER B 167 ? 0.0804 0.0929 0.0785 -0.0087 0.0116  0.0057  167 SER B OG  
3107 N N   A ILE B 168 ? 0.0694 0.0845 0.0671 -0.0073 0.0039  0.0014  168 ILE B N   
3108 N N   B ILE B 168 ? 0.0683 0.0832 0.0660 -0.0073 0.0040  0.0014  168 ILE B N   
3109 C CA  A ILE B 168 ? 0.0640 0.0764 0.0606 -0.0095 0.0019  -0.0019 168 ILE B CA  
3110 C CA  B ILE B 168 ? 0.0587 0.0707 0.0549 -0.0093 0.0019  -0.0020 168 ILE B CA  
3111 C C   A ILE B 168 ? 0.0673 0.0874 0.0640 -0.0100 -0.0014 -0.0034 168 ILE B C   
3112 C C   B ILE B 168 ? 0.0663 0.0863 0.0630 -0.0099 -0.0013 -0.0033 168 ILE B C   
3113 O O   A ILE B 168 ? 0.0825 0.1056 0.0820 -0.0134 -0.0036 -0.0054 168 ILE B O   
3114 O O   B ILE B 168 ? 0.0809 0.1040 0.0808 -0.0134 -0.0034 -0.0052 168 ILE B O   
3115 C CB  A ILE B 168 ? 0.0655 0.0686 0.0565 -0.0080 0.0023  -0.0040 168 ILE B CB  
3116 C CB  B ILE B 168 ? 0.0802 0.0835 0.0706 -0.0074 0.0021  -0.0043 168 ILE B CB  
3117 C CG1 A ILE B 168 ? 0.0692 0.0647 0.0594 -0.0090 0.0043  -0.0014 168 ILE B CG1 
3118 C CG1 B ILE B 168 ? 0.0837 0.0789 0.0726 -0.0073 0.0039  -0.0017 168 ILE B CG1 
3119 C CG2 A ILE B 168 ? 0.0989 0.0987 0.0883 -0.0102 0.0010  -0.0089 168 ILE B CG2 
3120 C CG2 B ILE B 168 ? 0.1059 0.1052 0.0951 -0.0101 0.0010  -0.0091 168 ILE B CG2 
3121 C CD1 A ILE B 168 ? 0.0940 0.0810 0.0797 -0.0059 0.0041  -0.0009 168 ILE B CD1 
3122 C CD1 B ILE B 168 ? 0.0824 0.0718 0.0726 -0.0123 0.0053  -0.0015 168 ILE B CD1 
3123 N N   . SER B 169 ? 0.0674 0.0916 0.0608 -0.0072 -0.0019 -0.0022 169 SER B N   
3124 C CA  . SER B 169 ? 0.0675 0.0991 0.0585 -0.0080 -0.0052 -0.0023 169 SER B CA  
3125 C C   . SER B 169 ? 0.0440 0.0835 0.0425 -0.0086 -0.0077 0.0020  169 SER B C   
3126 O O   . SER B 169 ? 0.0810 0.1279 0.0782 -0.0097 -0.0120 0.0030  169 SER B O   
3127 C CB  . SER B 169 ? 0.1037 0.1368 0.0881 -0.0055 -0.0040 -0.0015 169 SER B CB  
3128 O OG  . SER B 169 ? 0.0704 0.1051 0.0581 -0.0033 -0.0021 0.0035  169 SER B OG  
3129 N N   . SER B 170 ? 0.0643 0.1028 0.0709 -0.0080 -0.0051 0.0045  170 SER B N   
3130 C CA  . SER B 170 ? 0.0557 0.1017 0.0732 -0.0080 -0.0066 0.0079  170 SER B CA  
3131 C C   . SER B 170 ? 0.0521 0.1001 0.0765 -0.0120 -0.0074 0.0047  170 SER B C   
3132 O O   . SER B 170 ? 0.0731 0.1307 0.1056 -0.0132 -0.0114 0.0053  170 SER B O   
3133 C CB  . SER B 170 ? 0.0554 0.0991 0.0791 -0.0057 -0.0017 0.0110  170 SER B CB  
3134 O OG  . SER B 170 ? 0.0547 0.0960 0.0725 -0.0029 -0.0002 0.0134  170 SER B OG  
3135 N N   . LEU B 171 ? 0.0382 0.0776 0.0602 -0.0142 -0.0036 0.0016  171 LEU B N   
3136 C CA  . LEU B 171 ? 0.0413 0.0806 0.0686 -0.0192 -0.0030 -0.0017 171 LEU B CA  
3137 C C   . LEU B 171 ? 0.0625 0.1060 0.0882 -0.0228 -0.0077 -0.0058 171 LEU B C   
3138 O O   . LEU B 171 ? 0.0748 0.1232 0.1082 -0.0273 -0.0084 -0.0082 171 LEU B O   
3139 C CB  . LEU B 171 ? 0.0732 0.1000 0.0947 -0.0210 0.0017  -0.0032 171 LEU B CB  
3140 C CG  . LEU B 171 ? 0.0927 0.1167 0.1172 -0.0209 0.0070  -0.0008 171 LEU B CG  
3141 C CD1 . LEU B 171 ? 0.0934 0.1048 0.1079 -0.0222 0.0098  -0.0009 171 LEU B CD1 
3142 C CD2 . LEU B 171 ? 0.0795 0.1100 0.1164 -0.0246 0.0093  -0.0018 171 LEU B CD2 
3143 N N   . VAL B 172 ? 0.0781 0.1203 0.0939 -0.0216 -0.0103 -0.0072 172 VAL B N   
3144 C CA  . VAL B 172 ? 0.1001 0.1463 0.1125 -0.0261 -0.0143 -0.0122 172 VAL B CA  
3145 C C   . VAL B 172 ? 0.0900 0.1522 0.1106 -0.0275 -0.0203 -0.0102 172 VAL B C   
3146 O O   . VAL B 172 ? 0.1176 0.1862 0.1386 -0.0329 -0.0242 -0.0147 172 VAL B O   
3147 C CB  . VAL B 172 ? 0.1506 0.1926 0.1502 -0.0252 -0.0149 -0.0152 172 VAL B CB  
3148 C CG1 . VAL B 172 ? 0.1736 0.2007 0.1680 -0.0239 -0.0097 -0.0182 172 VAL B CG1 
3149 C CG2 . VAL B 172 ? 0.1297 0.1772 0.1253 -0.0205 -0.0166 -0.0101 172 VAL B CG2 
3150 N N   . ALA B 173 ? 0.0635 0.1324 0.0919 -0.0229 -0.0213 -0.0036 173 ALA B N   
3151 C CA  . ALA B 173 ? 0.0817 0.1649 0.1207 -0.0223 -0.0270 -0.0002 173 ALA B CA  
3152 C C   . ALA B 173 ? 0.0735 0.1601 0.1243 -0.0265 -0.0262 -0.0042 173 ALA B C   
3153 O O   . ALA B 173 ? 0.1072 0.2024 0.1640 -0.0274 -0.0311 -0.0047 173 ALA B O   
3154 C CB  . ALA B 173 ? 0.0911 0.1764 0.1382 -0.0158 -0.0260 0.0073  173 ALA B CB  
3155 N N   . PHE B 174 ? 0.0721 0.1516 0.1265 -0.0290 -0.0196 -0.0066 174 PHE B N   
3156 C CA  . PHE B 174 ? 0.0791 0.1590 0.1439 -0.0331 -0.0169 -0.0099 174 PHE B CA  
3157 C C   . PHE B 174 ? 0.1172 0.1891 0.1740 -0.0398 -0.0157 -0.0165 174 PHE B C   
3158 O O   . PHE B 174 ? 0.1703 0.2463 0.2323 -0.0438 -0.0172 -0.0196 174 PHE B O   
3159 C CB  . PHE B 174 ? 0.0784 0.1512 0.1484 -0.0322 -0.0090 -0.0084 174 PHE B CB  
3160 C CG  . PHE B 174 ? 0.0558 0.1332 0.1342 -0.0258 -0.0079 -0.0031 174 PHE B CG  
3161 C CD1 . PHE B 174 ? 0.0778 0.1658 0.1708 -0.0227 -0.0096 -0.0026 174 PHE B CD1 
3162 C CD2 . PHE B 174 ? 0.1077 0.1770 0.1783 -0.0227 -0.0040 -0.0004 174 PHE B CD2 
3163 C CE1 . PHE B 174 ? 0.0809 0.1706 0.1764 -0.0168 -0.0073 0.0015  174 PHE B CE1 
3164 C CE2 . PHE B 174 ? 0.1399 0.2103 0.2160 -0.0171 -0.0018 0.0036  174 PHE B CE2 
3165 C CZ  . PHE B 174 ? 0.1141 0.1931 0.2017 -0.0141 -0.0032 0.0044  174 PHE B CZ  
3166 N N   . VAL B 175 ? 0.0948 0.1543 0.1393 -0.0408 -0.0124 -0.0186 175 VAL B N   
3167 C CA  . VAL B 175 ? 0.1396 0.1873 0.1760 -0.0460 -0.0101 -0.0245 175 VAL B CA  
3168 C C   . VAL B 175 ? 0.1601 0.2002 0.1829 -0.0444 -0.0111 -0.0266 175 VAL B C   
3169 O O   . VAL B 175 ? 0.1148 0.1440 0.1311 -0.0393 -0.0078 -0.0236 175 VAL B O   
3170 C CB  . VAL B 175 ? 0.1581 0.1912 0.1936 -0.0480 -0.0027 -0.0243 175 VAL B CB  
3171 C CG1 . VAL B 175 ? 0.1429 0.1625 0.1710 -0.0526 -0.0002 -0.0293 175 VAL B CG1 
3172 C CG2 . VAL B 175 ? 0.1609 0.2003 0.2082 -0.0483 -0.0004 -0.0219 175 VAL B CG2 
3173 N N   . PRO B 176 ? 0.1466 0.1914 0.1644 -0.0467 -0.0152 -0.0308 176 PRO B N   
3174 C CA  . PRO B 176 ? 0.1857 0.2225 0.1906 -0.0452 -0.0146 -0.0340 176 PRO B CA  
3175 C C   . PRO B 176 ? 0.2029 0.2205 0.2035 -0.0457 -0.0082 -0.0370 176 PRO B C   
3176 O O   . PRO B 176 ? 0.2069 0.2181 0.2118 -0.0499 -0.0052 -0.0386 176 PRO B O   
3177 C CB  . PRO B 176 ? 0.1824 0.2248 0.1833 -0.0484 -0.0181 -0.0382 176 PRO B CB  
3178 C CG  . PRO B 176 ? 0.1762 0.2345 0.1872 -0.0490 -0.0235 -0.0344 176 PRO B CG  
3179 C CD  . PRO B 176 ? 0.1551 0.2125 0.1781 -0.0492 -0.0203 -0.0318 176 PRO B CD  
3180 N N   . VAL B 177 ? 0.1535 0.1619 0.1464 -0.0401 -0.0061 -0.0363 177 VAL B N   
3181 C CA  . VAL B 177 ? 0.1853 0.1754 0.1748 -0.0389 -0.0009 -0.0382 177 VAL B CA  
3182 C C   . VAL B 177 ? 0.1821 0.1645 0.1678 -0.0443 0.0010  -0.0473 177 VAL B C   
3183 O O   . VAL B 177 ? 0.2104 0.1968 0.1910 -0.0435 -0.0001 -0.0511 177 VAL B O   
3184 C CB  . VAL B 177 ? 0.1630 0.1481 0.1480 -0.0305 0.0005  -0.0348 177 VAL B CB  
3185 C CG1 . VAL B 177 ? 0.1622 0.1293 0.1450 -0.0283 0.0049  -0.0367 177 VAL B CG1 
3186 C CG2 . VAL B 177 ? 0.1882 0.1784 0.1767 -0.0260 -0.0002 -0.0264 177 VAL B CG2 
3187 N N   . ASP B 178 ? 0.1940 0.1662 0.1826 -0.0477 0.0042  -0.0480 178 ASP B N   
3188 C CA  . ASP B 178 ? 0.2155 0.1790 0.2019 -0.0507 0.0068  -0.0541 178 ASP B CA  
3189 C C   . ASP B 178 ? 0.2392 0.1880 0.2211 -0.0448 0.0105  -0.0557 178 ASP B C   
3190 O O   . ASP B 178 ? 0.2185 0.1533 0.2010 -0.0409 0.0134  -0.0516 178 ASP B O   
3191 C CB  . ASP B 178 ? 0.2061 0.1617 0.1969 -0.0551 0.0097  -0.0529 178 ASP B CB  
3192 C CG  . ASP B 178 ? 0.2634 0.2096 0.2527 -0.0591 0.0130  -0.0591 178 ASP B CG  
3193 O OD1 . ASP B 178 ? 0.2957 0.2364 0.2807 -0.0573 0.0144  -0.0639 178 ASP B OD1 
3194 O OD2 . ASP B 178 ? 0.2875 0.2316 0.2803 -0.0644 0.0148  -0.0593 178 ASP B OD2 
3195 N N   . ALA B 179 ? 0.2453 0.1980 0.2231 -0.0438 0.0103  -0.0611 179 ALA B N   
3196 C CA  . ALA B 179 ? 0.2308 0.1726 0.2066 -0.0373 0.0140  -0.0628 179 ALA B CA  
3197 C C   . ALA B 179 ? 0.2228 0.1457 0.2008 -0.0364 0.0188  -0.0644 179 ALA B C   
3198 O O   . ALA B 179 ? 0.2724 0.1840 0.2519 -0.0293 0.0214  -0.0629 179 ALA B O   
3199 C CB  . ALA B 179 ? 0.2488 0.2003 0.2197 -0.0371 0.0135  -0.0681 179 ALA B CB  
3200 N N   . ALA B 180 ? 0.2110 0.1312 0.1901 -0.0433 0.0198  -0.0670 180 ALA B N   
3201 C CA  . ALA B 180 ? 0.2654 0.1675 0.2463 -0.0433 0.0244  -0.0681 180 ALA B CA  
3202 C C   . ALA B 180 ? 0.2586 0.1489 0.2416 -0.0399 0.0248  -0.0592 180 ALA B C   
3203 O O   . ALA B 180 ? 0.2182 0.0924 0.2023 -0.0345 0.0274  -0.0564 180 ALA B O   
3204 C CB  . ALA B 180 ? 0.2602 0.1639 0.2410 -0.0524 0.0257  -0.0740 180 ALA B CB  
3205 N N   . LYS B 181 ? 0.2169 0.1158 0.2005 -0.0429 0.0222  -0.0543 181 LYS B N   
3206 C CA  . LYS B 181 ? 0.1940 0.0841 0.1782 -0.0412 0.0228  -0.0456 181 LYS B CA  
3207 C C   . LYS B 181 ? 0.2264 0.1138 0.2093 -0.0327 0.0214  -0.0393 181 LYS B C   
3208 O O   . LYS B 181 ? 0.2365 0.1119 0.2186 -0.0286 0.0220  -0.0319 181 LYS B O   
3209 C CB  . LYS B 181 ? 0.2196 0.1215 0.2057 -0.0477 0.0212  -0.0434 181 LYS B CB  
3210 C CG  . LYS B 181 ? 0.2150 0.1123 0.2003 -0.0463 0.0217  -0.0342 181 LYS B CG  
3211 C CD  . LYS B 181 ? 0.1967 0.1041 0.1856 -0.0534 0.0221  -0.0338 181 LYS B CD  
3212 C CE  . LYS B 181 ? 0.1859 0.0876 0.1729 -0.0531 0.0238  -0.0256 181 LYS B CE  
3213 N NZ  . LYS B 181 ? 0.2692 0.1846 0.2611 -0.0584 0.0242  -0.0254 181 LYS B NZ  
3214 N N   . TYR B 182 ? 0.1863 0.0859 0.1687 -0.0302 0.0191  -0.0418 182 TYR B N   
3215 C CA  . TYR B 182 ? 0.1695 0.0698 0.1509 -0.0228 0.0179  -0.0366 182 TYR B CA  
3216 C C   . TYR B 182 ? 0.1873 0.0889 0.1696 -0.0162 0.0186  -0.0416 182 TYR B C   
3217 O O   . TYR B 182 ? 0.1865 0.1033 0.1682 -0.0143 0.0163  -0.0426 182 TYR B O   
3218 C CB  . TYR B 182 ? 0.1628 0.0814 0.1443 -0.0247 0.0141  -0.0332 182 TYR B CB  
3219 C CG  . TYR B 182 ? 0.1668 0.0852 0.1491 -0.0310 0.0146  -0.0290 182 TYR B CG  
3220 C CD1 . TYR B 182 ? 0.2043 0.1109 0.1842 -0.0294 0.0160  -0.0212 182 TYR B CD1 
3221 C CD2 . TYR B 182 ? 0.1987 0.1287 0.1842 -0.0387 0.0136  -0.0329 182 TYR B CD2 
3222 C CE1 . TYR B 182 ? 0.1973 0.1056 0.1778 -0.0350 0.0172  -0.0176 182 TYR B CE1 
3223 C CE2 . TYR B 182 ? 0.1929 0.1258 0.1816 -0.0432 0.0145  -0.0291 182 TYR B CE2 
3224 C CZ  . TYR B 182 ? 0.1790 0.1009 0.1648 -0.0415 0.0168  -0.0219 182 TYR B CZ  
3225 O OH  . TYR B 182 ? 0.1806 0.1062 0.1686 -0.0457 0.0184  -0.0187 182 TYR B OH  
3226 N N   . PRO B 183 ? 0.2342 0.1236 0.2191 -0.0119 0.0210  -0.0430 183 PRO B N   
3227 C CA  . PRO B 183 ? 0.2249 0.1187 0.2117 -0.0067 0.0222  -0.0489 183 PRO B CA  
3228 C C   . PRO B 183 ? 0.1932 0.0925 0.1827 0.0021  0.0210  -0.0446 183 PRO B C   
3229 O O   . PRO B 183 ? 0.1911 0.1022 0.1808 0.0038  0.0214  -0.0494 183 PRO B O   
3230 C CB  . PRO B 183 ? 0.2364 0.1151 0.2266 -0.0038 0.0253  -0.0509 183 PRO B CB  
3231 C CG  . PRO B 183 ? 0.2299 0.0953 0.2203 -0.0041 0.0245  -0.0425 183 PRO B CG  
3232 C CD  . PRO B 183 ? 0.2522 0.1253 0.2383 -0.0124 0.0228  -0.0405 183 PRO B CD  
3233 N N   . LYS B 184 ? 0.1664 0.0597 0.1575 0.0072  0.0189  -0.0349 184 LYS B N   
3234 C CA  . LYS B 184 ? 0.2039 0.1072 0.1987 0.0156  0.0159  -0.0295 184 LYS B CA  
3235 C C   . LYS B 184 ? 0.1526 0.0749 0.1438 0.0124  0.0126  -0.0273 184 LYS B C   
3236 O O   . LYS B 184 ? 0.1395 0.0742 0.1328 0.0160  0.0120  -0.0285 184 LYS B O   
3237 C CB  . LYS B 184 ? 0.1908 0.0840 0.1876 0.0219  0.0133  -0.0191 184 LYS B CB  
3238 C CG  . LYS B 184 ? 0.2137 0.0894 0.2155 0.0265  0.0152  -0.0193 184 LYS B CG  
3239 C CD  . LYS B 184 ? 0.2461 0.1157 0.2493 0.0325  0.0105  -0.0074 184 LYS B CD  
3240 C CE  . LYS B 184 ? 0.3142 0.1670 0.3192 0.0335  0.0104  -0.0053 184 LYS B CE  
3241 N NZ  . LYS B 184 ? 0.3703 0.2218 0.3836 0.0445  0.0074  -0.0029 184 LYS B NZ  
3242 N N   . LEU B 185 ? 0.1616 0.0858 0.1483 0.0057  0.0111  -0.0241 185 LEU B N   
3243 C CA  . LEU B 185 ? 0.1443 0.0849 0.1289 0.0025  0.0087  -0.0226 185 LEU B CA  
3244 C C   . LEU B 185 ? 0.1218 0.0731 0.1052 0.0001  0.0093  -0.0301 185 LEU B C   
3245 O O   . LEU B 185 ? 0.1176 0.0813 0.1006 0.0019  0.0081  -0.0290 185 LEU B O   
3246 C CB  . LEU B 185 ? 0.1321 0.0716 0.1147 -0.0045 0.0082  -0.0197 185 LEU B CB  
3247 C CG  . LEU B 185 ? 0.1411 0.0960 0.1237 -0.0076 0.0061  -0.0177 185 LEU B CG  
3248 C CD1 . LEU B 185 ? 0.1468 0.1081 0.1296 -0.0026 0.0047  -0.0119 185 LEU B CD1 
3249 C CD2 . LEU B 185 ? 0.1305 0.0845 0.1137 -0.0142 0.0065  -0.0157 185 LEU B CD2 
3250 N N   . SER B 186 ? 0.1440 0.0897 0.1259 -0.0045 0.0116  -0.0377 186 SER B N   
3251 C CA  . SER B 186 ? 0.1558 0.1113 0.1339 -0.0080 0.0120  -0.0451 186 SER B CA  
3252 C C   . SER B 186 ? 0.1323 0.0911 0.1114 -0.0021 0.0145  -0.0484 186 SER B C   
3253 O O   . SER B 186 ? 0.1494 0.1206 0.1248 -0.0031 0.0139  -0.0497 186 SER B O   
3254 C CB  . SER B 186 ? 0.1795 0.1282 0.1551 -0.0153 0.0141  -0.0538 186 SER B CB  
3255 O OG  . SER B 186 ? 0.1996 0.1494 0.1754 -0.0218 0.0117  -0.0516 186 SER B OG  
3256 N N   . ALA B 187 ? 0.1326 0.0800 0.1172 0.0039  0.0176  -0.0498 187 ALA B N   
3257 C CA  . ALA B 187 ? 0.1334 0.0848 0.1219 0.0100  0.0206  -0.0535 187 ALA B CA  
3258 C C   . ALA B 187 ? 0.1183 0.0828 0.1088 0.0142  0.0178  -0.0467 187 ALA B C   
3259 O O   . ALA B 187 ? 0.1154 0.0895 0.1063 0.0157  0.0200  -0.0501 187 ALA B O   
3260 C CB  . ALA B 187 ? 0.1460 0.0840 0.1426 0.0168  0.0233  -0.0541 187 ALA B CB  
3261 N N   . TRP B 188 ? 0.1105 0.0747 0.1019 0.0154  0.0138  -0.0376 188 TRP B N   
3262 C CA  . TRP B 188 ? 0.0996 0.0753 0.0926 0.0183  0.0114  -0.0316 188 TRP B CA  
3263 C C   . TRP B 188 ? 0.0884 0.0763 0.0754 0.0131  0.0108  -0.0319 188 TRP B C   
3264 O O   . TRP B 188 ? 0.0934 0.0911 0.0807 0.0146  0.0118  -0.0320 188 TRP B O   
3265 C CB  . TRP B 188 ? 0.0962 0.0673 0.0901 0.0197  0.0078  -0.0228 188 TRP B CB  
3266 C CG  . TRP B 188 ? 0.0970 0.0789 0.0904 0.0197  0.0054  -0.0169 188 TRP B CG  
3267 C CD1 . TRP B 188 ? 0.0891 0.0784 0.0871 0.0245  0.0044  -0.0147 188 TRP B CD1 
3268 C CD2 . TRP B 188 ? 0.0779 0.0641 0.0670 0.0145  0.0040  -0.0131 188 TRP B CD2 
3269 N NE1 . TRP B 188 ? 0.1008 0.0978 0.0962 0.0217  0.0029  -0.0101 188 TRP B NE1 
3270 C CE2 . TRP B 188 ? 0.0939 0.0885 0.0843 0.0161  0.0030  -0.0090 188 TRP B CE2 
3271 C CE3 . TRP B 188 ? 0.0854 0.0698 0.0712 0.0087  0.0038  -0.0131 188 TRP B CE3 
3272 C CZ2 . TRP B 188 ? 0.0933 0.0927 0.0813 0.0121  0.0026  -0.0054 188 TRP B CZ2 
3273 C CZ3 . TRP B 188 ? 0.0955 0.0860 0.0804 0.0056  0.0030  -0.0090 188 TRP B CZ3 
3274 C CH2 . TRP B 188 ? 0.1031 0.0999 0.0890 0.0074  0.0028  -0.0053 188 TRP B CH2 
3275 N N   . ILE B 189 ? 0.0887 0.0758 0.0706 0.0071  0.0092  -0.0318 189 ILE B N   
3276 C CA  . ILE B 189 ? 0.0970 0.0951 0.0735 0.0027  0.0079  -0.0314 189 ILE B CA  
3277 C C   . ILE B 189 ? 0.0955 0.0985 0.0676 0.0019  0.0110  -0.0381 189 ILE B C   
3278 O O   . ILE B 189 ? 0.1055 0.1174 0.0748 0.0019  0.0115  -0.0365 189 ILE B O   
3279 C CB  . ILE B 189 ? 0.0846 0.0826 0.0583 -0.0035 0.0052  -0.0311 189 ILE B CB  
3280 C CG1 . ILE B 189 ? 0.0990 0.0947 0.0769 -0.0036 0.0032  -0.0244 189 ILE B CG1 
3281 C CG2 . ILE B 189 ? 0.1089 0.1182 0.0769 -0.0072 0.0032  -0.0309 189 ILE B CG2 
3282 C CD1 . ILE B 189 ? 0.1107 0.1045 0.0892 -0.0094 0.0016  -0.0253 189 ILE B CD1 
3283 N N   . LYS B 190 ? 0.1011 0.0971 0.0724 0.0009  0.0139  -0.0461 190 LYS B N   
3284 C CA  . LYS B 190 ? 0.1093 0.1086 0.0767 -0.0007 0.0168  -0.0506 190 LYS B CA  
3285 C C   . LYS B 190 ? 0.1335 0.1372 0.1055 0.0043  0.0197  -0.0494 190 LYS B C   
3286 O O   . LYS B 190 ? 0.1139 0.1239 0.0818 0.0023  0.0210  -0.0490 190 LYS B O   
3287 C CB  . LYS B 190 ? 0.1453 0.1348 0.1133 -0.0019 0.0197  -0.0578 190 LYS B CB  
3288 C CG  . LYS B 190 ? 0.2025 0.1961 0.1644 -0.0060 0.0218  -0.0623 190 LYS B CG  
3289 C CD  . LYS B 190 ? 0.2547 0.2529 0.2084 -0.0135 0.0179  -0.0620 190 LYS B CD  
3290 C CE  . LYS B 190 ? 0.2718 0.2610 0.2271 -0.0165 0.0176  -0.0661 190 LYS B CE  
3291 N NZ  . LYS B 190 ? 0.2797 0.2754 0.2292 -0.0238 0.0130  -0.0655 190 LYS B NZ  
3292 N N   . ARG B 191 ? 0.1312 0.1315 0.1123 0.0108  0.0204  -0.0483 191 ARG B N   
3293 C CA  . ARG B 191 ? 0.1266 0.1326 0.1146 0.0155  0.0225  -0.0471 191 ARG B CA  
3294 C C   . ARG B 191 ? 0.0989 0.1149 0.0840 0.0134  0.0208  -0.0411 191 ARG B C   
3295 O O   . ARG B 191 ? 0.0981 0.1196 0.0828 0.0122  0.0230  -0.0410 191 ARG B O   
3296 C CB  . ARG B 191 ? 0.1385 0.1397 0.1377 0.0232  0.0217  -0.0456 191 ARG B CB  
3297 C CG  . ARG B 191 ? 0.1584 0.1667 0.1672 0.0285  0.0226  -0.0437 191 ARG B CG  
3298 C CD  . ARG B 191 ? 0.2667 0.2682 0.2860 0.0364  0.0201  -0.0411 191 ARG B CD  
3299 N NE  . ARG B 191 ? 0.3511 0.3382 0.3713 0.0379  0.0222  -0.0447 191 ARG B NE  
3300 C CZ  . ARG B 191 ? 0.3851 0.3592 0.4051 0.0391  0.0197  -0.0424 191 ARG B CZ  
3301 N NH1 . ARG B 191 ? 0.3840 0.3578 0.4006 0.0382  0.0143  -0.0339 191 ARG B NH1 
3302 N NH2 . ARG B 191 ? 0.4196 0.3800 0.4396 0.0393  0.0224  -0.0458 191 ARG B NH2 
3303 N N   . LEU B 192 ? 0.1054 0.1227 0.0889 0.0127  0.0172  -0.0362 192 LEU B N   
3304 C CA  . LEU B 192 ? 0.0870 0.1113 0.0688 0.0107  0.0159  -0.0300 192 LEU B CA  
3305 C C   . LEU B 192 ? 0.0734 0.0998 0.0469 0.0053  0.0160  -0.0287 192 LEU B C   
3306 O O   . LEU B 192 ? 0.0766 0.1066 0.0498 0.0041  0.0167  -0.0252 192 LEU B O   
3307 C CB  . LEU B 192 ? 0.0894 0.1138 0.0715 0.0112  0.0126  -0.0249 192 LEU B CB  
3308 C CG  . LEU B 192 ? 0.0791 0.0988 0.0684 0.0156  0.0106  -0.0221 192 LEU B CG  
3309 C CD1 . LEU B 192 ? 0.1218 0.1397 0.1101 0.0136  0.0077  -0.0155 192 LEU B CD1 
3310 C CD2 . LEU B 192 ? 0.0923 0.1188 0.0887 0.0199  0.0121  -0.0230 192 LEU B CD2 
3311 N N   . GLU B 193 ? 0.0829 0.1067 0.0502 0.0021  0.0150  -0.0317 193 GLU B N   
3312 C CA  . GLU B 193 ? 0.0900 0.1165 0.0491 -0.0025 0.0141  -0.0303 193 GLU B CA  
3313 C C   . GLU B 193 ? 0.0938 0.1221 0.0512 -0.0030 0.0181  -0.0326 193 GLU B C   
3314 O O   . GLU B 193 ? 0.0993 0.1300 0.0498 -0.0062 0.0179  -0.0306 193 GLU B O   
3315 C CB  . GLU B 193 ? 0.1218 0.1463 0.0755 -0.0063 0.0118  -0.0339 193 GLU B CB  
3316 C CG  . GLU B 193 ? 0.1143 0.1397 0.0687 -0.0075 0.0072  -0.0301 193 GLU B CG  
3317 C CD  . GLU B 193 ? 0.1390 0.1635 0.0896 -0.0121 0.0045  -0.0338 193 GLU B CD  
3318 O OE1 . GLU B 193 ? 0.1625 0.1831 0.1108 -0.0138 0.0069  -0.0407 193 GLU B OE1 
3319 O OE2 . GLU B 193 ? 0.1252 0.1535 0.0762 -0.0144 -0.0001 -0.0301 193 GLU B OE2 
3320 N N   . GLN B 194 ? 0.0953 0.1224 0.0592 0.0004  0.0217  -0.0372 194 GLN B N   
3321 C CA  . GLN B 194 ? 0.1260 0.1555 0.0898 -0.0001 0.0261  -0.0405 194 GLN B CA  
3322 C C   . GLN B 194 ? 0.1199 0.1537 0.0889 0.0015  0.0275  -0.0369 194 GLN B C   
3323 O O   . GLN B 194 ? 0.1158 0.1525 0.0852 0.0006  0.0313  -0.0395 194 GLN B O   
3324 C CB  . GLN B 194 ? 0.1108 0.1371 0.0801 0.0027  0.0297  -0.0481 194 GLN B CB  
3325 C CG  . GLN B 194 ? 0.1211 0.1420 0.0851 0.0000  0.0291  -0.0528 194 GLN B CG  
3326 C CD  . GLN B 194 ? 0.1319 0.1470 0.1028 0.0034  0.0329  -0.0601 194 GLN B CD  
3327 O OE1 . GLN B 194 ? 0.1372 0.1542 0.1109 0.0041  0.0375  -0.0645 194 GLN B OE1 
3328 N NE2 . GLN B 194 ? 0.1470 0.1545 0.1210 0.0054  0.0314  -0.0613 194 GLN B NE2 
3329 N N   . LEU B 195 ? 0.0849 0.1194 0.0581 0.0031  0.0248  -0.0315 195 LEU B N   
3330 C CA  . LEU B 195 ? 0.1134 0.1515 0.0910 0.0033  0.0259  -0.0284 195 LEU B CA  
3331 C C   . LEU B 195 ? 0.1386 0.1770 0.1080 -0.0008 0.0273  -0.0260 195 LEU B C   
3332 O O   . LEU B 195 ? 0.1361 0.1723 0.0974 -0.0033 0.0251  -0.0232 195 LEU B O   
3333 C CB  . LEU B 195 ? 0.1041 0.1420 0.0858 0.0045  0.0226  -0.0233 195 LEU B CB  
3334 C CG  . LEU B 195 ? 0.0974 0.1362 0.0873 0.0089  0.0211  -0.0249 195 LEU B CG  
3335 C CD1 . LEU B 195 ? 0.1008 0.1388 0.0916 0.0091  0.0175  -0.0200 195 LEU B CD1 
3336 C CD2 . LEU B 195 ? 0.1182 0.1626 0.1169 0.0114  0.0232  -0.0272 195 LEU B CD2 
3337 N N   . PRO B 196 ? 0.1218 0.1635 0.0937 -0.0015 0.0307  -0.0268 196 PRO B N   
3338 C CA  . PRO B 196 ? 0.1218 0.1630 0.0851 -0.0053 0.0325  -0.0246 196 PRO B CA  
3339 C C   . PRO B 196 ? 0.1213 0.1591 0.0807 -0.0062 0.0299  -0.0175 196 PRO B C   
3340 O O   . PRO B 196 ? 0.1651 0.2014 0.1153 -0.0089 0.0304  -0.0148 196 PRO B O   
3341 C CB  . PRO B 196 ? 0.1851 0.2310 0.1537 -0.0058 0.0369  -0.0271 196 PRO B CB  
3342 C CG  . PRO B 196 ? 0.1910 0.2399 0.1714 -0.0021 0.0359  -0.0287 196 PRO B CG  
3343 C CD  . PRO B 196 ? 0.1487 0.1952 0.1309 0.0010  0.0330  -0.0299 196 PRO B CD  
3344 N N   . TYR B 197 ? 0.1177 0.1542 0.0835 -0.0042 0.0274  -0.0148 197 TYR B N   
3356 N N   . TYR B 198 ? 0.1198 0.1077 0.0610 0.0107  0.0124  -0.0125 198 TYR B N   
3357 C CA  . TYR B 198 ? 0.1058 0.0922 0.0505 0.0079  0.0102  -0.0117 198 TYR B CA  
3358 C C   . TYR B 198 ? 0.1017 0.0970 0.0441 0.0064  0.0083  -0.0083 198 TYR B C   
3359 O O   . TYR B 198 ? 0.1212 0.1161 0.0670 0.0048  0.0070  -0.0059 198 TYR B O   
3360 C CB  . TYR B 198 ? 0.1102 0.0920 0.0621 0.0055  0.0096  -0.0192 198 TYR B CB  
3361 C CG  . TYR B 198 ? 0.1050 0.0841 0.0643 0.0023  0.0079  -0.0159 198 TYR B CG  
3362 C CD1 . TYR B 198 ? 0.0972 0.0726 0.0626 0.0027  0.0084  -0.0069 198 TYR B CD1 
3363 C CD2 . TYR B 198 ? 0.1062 0.0909 0.0666 -0.0015 0.0057  -0.0212 198 TYR B CD2 
3364 C CE1 . TYR B 198 ? 0.1536 0.1302 0.1264 -0.0004 0.0073  -0.0017 198 TYR B CE1 
3365 C CE2 . TYR B 198 ? 0.1103 0.0930 0.0789 -0.0048 0.0044  -0.0175 198 TYR B CE2 
3366 C CZ  . TYR B 198 ? 0.1023 0.0804 0.0773 -0.0042 0.0055  -0.0071 198 TYR B CZ  
3367 O OH  . TYR B 198 ? 0.1095 0.0892 0.0933 -0.0075 0.0049  -0.0009 198 TYR B OH  
3368 N N   . ALA B 199 ? 0.0946 0.1006 0.0329 0.0071  0.0082  -0.0065 199 ALA B N   
3369 C CA  . ALA B 199 ? 0.1232 0.1397 0.0637 0.0066  0.0063  0.0010  199 ALA B CA  
3370 C C   . ALA B 199 ? 0.1008 0.1121 0.0518 0.0083  0.0073  0.0070  199 ALA B C   
3371 O O   . ALA B 199 ? 0.1085 0.1254 0.0661 0.0078  0.0057  0.0114  199 ALA B O   
3372 C CB  . ALA B 199 ? 0.1286 0.1616 0.0678 0.0069  0.0059  0.0070  199 ALA B CB  
3373 N N   . GLU B 200 ? 0.1093 0.1128 0.0642 0.0102  0.0100  0.0053  200 GLU B N   
3374 C CA  . GLU B 200 ? 0.1098 0.1127 0.0773 0.0111  0.0116  0.0050  200 GLU B CA  
3375 C C   . GLU B 200 ? 0.0952 0.0994 0.0620 0.0087  0.0102  0.0018  200 GLU B C   
3376 O O   . GLU B 200 ? 0.1070 0.1162 0.0848 0.0087  0.0111  0.0000  200 GLU B O   
3377 C CB  . GLU B 200 ? 0.1099 0.1101 0.0806 0.0126  0.0146  0.0006  200 GLU B CB  
3378 C CG  . GLU B 200 ? 0.1422 0.1419 0.1180 0.0146  0.0167  0.0044  200 GLU B CG  
3379 C CD  . GLU B 200 ? 0.1647 0.1683 0.1604 0.0157  0.0179  0.0113  200 GLU B CD  
3380 O OE1 . GLU B 200 ? 0.1922 0.1959 0.2076 0.0162  0.0204  0.0064  200 GLU B OE1 
3381 O OE2 . GLU B 200 ? 0.1923 0.2020 0.1873 0.0159  0.0163  0.0219  200 GLU B OE2 
3382 N N   . ASN B 201 ? 0.0968 0.0977 0.0543 0.0065  0.0085  0.0005  201 ASN B N   
3383 C CA  . ASN B 201 ? 0.1098 0.1133 0.0687 0.0036  0.0071  0.0005  201 ASN B CA  
3384 C C   . ASN B 201 ? 0.0954 0.1014 0.0530 0.0012  0.0041  0.0009  201 ASN B C   
3385 O O   . ASN B 201 ? 0.0957 0.1072 0.0582 -0.0004 0.0030  0.0020  201 ASN B O   
3386 C CB  . ASN B 201 ? 0.0785 0.0790 0.0360 0.0020  0.0074  0.0013  201 ASN B CB  
3387 C CG  . ASN B 201 ? 0.0791 0.0852 0.0408 -0.0014 0.0065  0.0042  201 ASN B CG  
3388 O OD1 . ASN B 201 ? 0.0747 0.0918 0.0395 -0.0017 0.0075  0.0041  201 ASN B OD1 
3389 N ND2 . ASN B 201 ? 0.0849 0.0856 0.0500 -0.0044 0.0051  0.0052  201 ASN B ND2 
3390 N N   . SER B 202 ? 0.0891 0.0947 0.0411 0.0005  0.0029  -0.0018 202 SER B N   
3391 C CA  . SER B 202 ? 0.1024 0.1156 0.0540 -0.0029 -0.0001 -0.0046 202 SER B CA  
3392 C C   . SER B 202 ? 0.1032 0.1294 0.0569 -0.0021 -0.0022 0.0015  202 SER B C   
3393 O O   . SER B 202 ? 0.1005 0.1340 0.0566 -0.0049 -0.0048 0.0009  202 SER B O   
3394 C CB  . SER B 202 ? 0.1186 0.1349 0.0662 -0.0047 -0.0007 -0.0136 202 SER B CB  
3395 O OG  . SER B 202 ? 0.1299 0.1556 0.0709 -0.0021 -0.0001 -0.0114 202 SER B OG  
3396 N N   . THR B 203 ? 0.1038 0.1336 0.0605 0.0016  -0.0010 0.0089  203 THR B N   
3397 C CA  . THR B 203 ? 0.1168 0.1601 0.0821 0.0030  -0.0029 0.0189  203 THR B CA  
3398 C C   . THR B 203 ? 0.0809 0.1220 0.0582 0.0030  -0.0030 0.0195  203 THR B C   
3399 O O   . THR B 203 ? 0.0967 0.1482 0.0766 0.0013  -0.0060 0.0216  203 THR B O   
3400 C CB  . THR B 203 ? 0.1447 0.1909 0.1190 0.0071  -0.0007 0.0295  203 THR B CB  
3401 O OG1 . THR B 203 ? 0.1451 0.2002 0.1070 0.0066  -0.0009 0.0299  203 THR B OG1 
3402 C CG2 . THR B 203 ? 0.1540 0.2139 0.1451 0.0092  -0.0023 0.0436  203 THR B CG2 
3403 N N   . GLY B 204 ? 0.0801 0.1114 0.0645 0.0043  0.0004  0.0154  204 GLY B N   
3404 C CA  . GLY B 204 ? 0.0778 0.1114 0.0741 0.0040  0.0013  0.0127  204 GLY B CA  
3405 C C   . GLY B 204 ? 0.0899 0.1246 0.0779 -0.0004 -0.0003 0.0083  204 GLY B C   
3406 O O   . GLY B 204 ? 0.0834 0.1251 0.0795 -0.0014 -0.0010 0.0083  204 GLY B O   
3407 N N   . ALA B 205 ? 0.0763 0.1043 0.0522 -0.0031 -0.0006 0.0052  205 ALA B N   
3408 C CA  . ALA B 205 ? 0.0792 0.1076 0.0536 -0.0078 -0.0018 0.0032  205 ALA B CA  
3409 C C   . ALA B 205 ? 0.0965 0.1331 0.0720 -0.0103 -0.0057 0.0030  205 ALA B C   
3410 O O   . ALA B 205 ? 0.0938 0.1358 0.0748 -0.0132 -0.0067 0.0029  205 ALA B O   
3411 C CB  . ALA B 205 ? 0.0836 0.1024 0.0534 -0.0098 -0.0011 0.0013  205 ALA B CB  
3412 N N   . GLN B 206 ? 0.0874 0.1294 0.0578 -0.0093 -0.0078 0.0033  206 GLN B N   
3413 C CA  . GLN B 206 ? 0.0960 0.1540 0.0668 -0.0117 -0.0120 0.0031  206 GLN B CA  
3414 C C   . GLN B 206 ? 0.0865 0.1545 0.0678 -0.0094 -0.0132 0.0114  206 GLN B C   
3415 O O   . GLN B 206 ? 0.0883 0.1672 0.0731 -0.0124 -0.0162 0.0105  206 GLN B O   
3416 C CB  . GLN B 206 ? 0.1440 0.2146 0.1064 -0.0113 -0.0138 0.0023  206 GLN B CB  
3417 C CG  . GLN B 206 ? 0.2380 0.3028 0.1946 -0.0147 -0.0128 -0.0109 206 GLN B CG  
3418 C CD  . GLN B 206 ? 0.3216 0.4001 0.2693 -0.0134 -0.0129 -0.0131 206 GLN B CD  
3419 O OE1 . GLN B 206 ? 0.3452 0.4393 0.2926 -0.0105 -0.0138 -0.0021 206 GLN B OE1 
3420 N NE2 . GLN B 206 ? 0.3553 0.4270 0.3015 -0.0152 -0.0110 -0.0259 206 GLN B NE2 
3421 N N   . GLN B 207 ? 0.0945 0.1589 0.0848 -0.0043 -0.0107 0.0181  207 GLN B N   
3422 C CA  . GLN B 207 ? 0.0781 0.1502 0.0866 -0.0014 -0.0108 0.0246  207 GLN B CA  
3423 C C   . GLN B 207 ? 0.0839 0.1543 0.0974 -0.0040 -0.0094 0.0177  207 GLN B C   
3424 O O   . GLN B 207 ? 0.0747 0.1557 0.0981 -0.0044 -0.0113 0.0200  207 GLN B O   
3425 C CB  . GLN B 207 ? 0.0889 0.1566 0.1142 0.0043  -0.0073 0.0304  207 GLN B CB  
3426 C CG  . GLN B 207 ? 0.0846 0.1589 0.1092 0.0068  -0.0087 0.0421  207 GLN B CG  
3427 C CD  . GLN B 207 ? 0.1179 0.1829 0.1581 0.0111  -0.0043 0.0456  207 GLN B CD  
3428 O OE1 . GLN B 207 ? 0.1227 0.1768 0.1727 0.0119  -0.0002 0.0356  207 GLN B OE1 
3429 N NE2 . GLN B 207 ? 0.1973 0.2701 0.2406 0.0133  -0.0049 0.0591  207 GLN B NE2 
3430 N N   . PHE B 208 ? 0.0769 0.1376 0.0840 -0.0059 -0.0061 0.0107  208 PHE B N   
3431 C CA  . PHE B 208 ? 0.0862 0.1512 0.0970 -0.0090 -0.0043 0.0064  208 PHE B CA  
3432 C C   . PHE B 208 ? 0.0809 0.1501 0.0877 -0.0144 -0.0079 0.0066  208 PHE B C   
3433 O O   . PHE B 208 ? 0.0747 0.1538 0.0899 -0.0164 -0.0085 0.0066  208 PHE B O   
3434 C CB  . PHE B 208 ? 0.0900 0.1497 0.0935 -0.0104 -0.0008 0.0030  208 PHE B CB  
3435 C CG  . PHE B 208 ? 0.0832 0.1543 0.0904 -0.0139 0.0015  0.0015  208 PHE B CG  
3436 C CD1 . PHE B 208 ? 0.1068 0.1783 0.1109 -0.0195 0.0003  0.0054  208 PHE B CD1 
3437 C CD2 . PHE B 208 ? 0.0927 0.1773 0.1099 -0.0121 0.0053  -0.0045 208 PHE B CD2 
3438 C CE1 . PHE B 208 ? 0.0873 0.1736 0.0961 -0.0229 0.0027  0.0073  208 PHE B CE1 
3439 C CE2 . PHE B 208 ? 0.1239 0.2263 0.1437 -0.0156 0.0078  -0.0060 208 PHE B CE2 
3440 C CZ  . PHE B 208 ? 0.0812 0.1850 0.0957 -0.0210 0.0064  0.0019  208 PHE B CZ  
3441 N N   . VAL B 209 ? 0.0934 0.1565 0.0904 -0.0174 -0.0099 0.0048  209 VAL B N   
3442 C CA  . VAL B 209 ? 0.0864 0.1542 0.0846 -0.0233 -0.0129 0.0013  209 VAL B CA  
3443 C C   . VAL B 209 ? 0.1138 0.1984 0.1169 -0.0232 -0.0170 0.0031  209 VAL B C   
3444 O O   . VAL B 209 ? 0.0921 0.1849 0.1023 -0.0272 -0.0184 0.0017  209 VAL B O   
3445 C CB  . VAL B 209 ? 0.1261 0.1872 0.1185 -0.0262 -0.0139 -0.0054 209 VAL B CB  
3446 C CG1 . VAL B 209 ? 0.1467 0.2166 0.1458 -0.0329 -0.0171 -0.0133 209 VAL B CG1 
3447 C CG2 . VAL B 209 ? 0.1461 0.1919 0.1394 -0.0269 -0.0102 -0.0048 209 VAL B CG2 
3448 N N   . ALA B 210 ? 0.0867 0.1789 0.0881 -0.0186 -0.0189 0.0083  210 ALA B N   
3449 C CA  . ALA B 210 ? 0.1067 0.2197 0.1150 -0.0175 -0.0233 0.0145  210 ALA B CA  
3450 C C   . ALA B 210 ? 0.1072 0.2237 0.1315 -0.0154 -0.0222 0.0186  210 ALA B C   
3451 O O   . ALA B 210 ? 0.0922 0.2238 0.1232 -0.0175 -0.0255 0.0197  210 ALA B O   
3452 C CB  . ALA B 210 ? 0.1229 0.2459 0.1306 -0.0123 -0.0248 0.0250  210 ALA B CB  
3453 N N   . ALA B 211 ? 0.0871 0.1929 0.1195 -0.0113 -0.0173 0.0191  211 ALA B N   
3454 C CA  . ALA B 211 ? 0.0805 0.1923 0.1310 -0.0095 -0.0152 0.0186  211 ALA B CA  
3455 C C   . ALA B 211 ? 0.1001 0.2157 0.1478 -0.0157 -0.0148 0.0124  211 ALA B C   
3456 O O   . ALA B 211 ? 0.1028 0.2311 0.1629 -0.0161 -0.0159 0.0132  211 ALA B O   
3457 C CB  . ALA B 211 ? 0.0845 0.1887 0.1462 -0.0050 -0.0095 0.0149  211 ALA B CB  
3458 N N   . VAL B 212 ? 0.0960 0.2019 0.1311 -0.0205 -0.0129 0.0080  212 VAL B N   
3459 C CA  . VAL B 212 ? 0.0842 0.1944 0.1205 -0.0271 -0.0123 0.0057  212 VAL B CA  
3460 C C   . VAL B 212 ? 0.0939 0.2123 0.1322 -0.0321 -0.0174 0.0047  212 VAL B C   
3461 O O   . VAL B 212 ? 0.0878 0.2172 0.1353 -0.0352 -0.0178 0.0045  212 VAL B O   
3462 C CB  . VAL B 212 ? 0.0902 0.1895 0.1187 -0.0308 -0.0091 0.0056  212 VAL B CB  
3463 C CG1 . VAL B 212 ? 0.1412 0.2446 0.1761 -0.0385 -0.0087 0.0072  212 VAL B CG1 
3464 C CG2 . VAL B 212 ? 0.0740 0.1754 0.1021 -0.0271 -0.0040 0.0054  212 VAL B CG2 
3465 N N   . LYS B 213 ? 0.1086 0.2255 0.1390 -0.0331 -0.0211 0.0023  213 LYS B N   
3466 C CA  . LYS B 213 ? 0.1125 0.2433 0.1457 -0.0385 -0.0261 -0.0026 213 LYS B CA  
3467 C C   . LYS B 213 ? 0.1258 0.2775 0.1678 -0.0360 -0.0297 0.0028  213 LYS B C   
3468 O O   . LYS B 213 ? 0.1411 0.3072 0.1892 -0.0411 -0.0330 -0.0010 213 LYS B O   
3469 C CB  . LYS B 213 ? 0.1292 0.2624 0.1526 -0.0397 -0.0291 -0.0090 213 LYS B CB  
3470 C CG  . LYS B 213 ? 0.2080 0.3209 0.2276 -0.0421 -0.0256 -0.0154 213 LYS B CG  
3471 C CD  . LYS B 213 ? 0.2585 0.3624 0.2910 -0.0489 -0.0231 -0.0186 213 LYS B CD  
3472 C CE  . LYS B 213 ? 0.2666 0.3553 0.3045 -0.0527 -0.0210 -0.0265 213 LYS B CE  
3473 N NZ  . LYS B 213 ? 0.2717 0.3607 0.3308 -0.0614 -0.0209 -0.0334 213 LYS B NZ  
3474 N N   A SER B 214 ? 0.1205 0.2737 0.1670 -0.0281 -0.0288 0.0117  214 SER B N   
3475 N N   B SER B 214 ? 0.0855 0.2395 0.1323 -0.0281 -0.0290 0.0118  214 SER B N   
3476 C CA  A SER B 214 ? 0.1144 0.2861 0.1758 -0.0238 -0.0317 0.0201  214 SER B CA  
3477 C CA  B SER B 214 ? 0.1081 0.2819 0.1692 -0.0246 -0.0323 0.0197  214 SER B CA  
3478 C C   A SER B 214 ? 0.1015 0.2776 0.1768 -0.0254 -0.0294 0.0176  214 SER B C   
3479 C C   B SER B 214 ? 0.0972 0.2734 0.1731 -0.0252 -0.0293 0.0178  214 SER B C   
3480 O O   A SER B 214 ? 0.1100 0.3000 0.1974 -0.0233 -0.0318 0.0220  214 SER B O   
3481 O O   B SER B 214 ? 0.1113 0.3007 0.2013 -0.0221 -0.0311 0.0227  214 SER B O   
3482 C CB  A SER B 214 ? 0.1248 0.2933 0.1960 -0.0148 -0.0299 0.0304  214 SER B CB  
3483 C CB  B SER B 214 ? 0.1278 0.3033 0.1974 -0.0157 -0.0322 0.0318  214 SER B CB  
3484 O OG  A SER B 214 ? 0.1237 0.3024 0.1884 -0.0127 -0.0340 0.0390  214 SER B OG  
3485 O OG  B SER B 214 ? 0.1288 0.2865 0.2058 -0.0116 -0.0258 0.0297  214 SER B OG  
3486 N N   . LYS B 215 ? 0.0963 0.2598 0.1686 -0.0286 -0.0241 0.0113  215 LYS B N   
3487 C CA  . LYS B 215 ? 0.1002 0.2712 0.1849 -0.0300 -0.0204 0.0089  215 LYS B CA  
3488 C C   . LYS B 215 ? 0.1185 0.2884 0.1983 -0.0393 -0.0196 0.0052  215 LYS B C   
3489 O O   . LYS B 215 ? 0.1146 0.2785 0.1912 -0.0418 -0.0146 0.0048  215 LYS B O   
3490 C CB  . LYS B 215 ? 0.1498 0.3149 0.2388 -0.0253 -0.0138 0.0061  215 LYS B CB  
3491 C CG  . LYS B 215 ? 0.1805 0.3443 0.2832 -0.0163 -0.0133 0.0086  215 LYS B CG  
3492 C CD  . LYS B 215 ? 0.2046 0.3841 0.3327 -0.0122 -0.0141 0.0108  215 LYS B CD  
3493 C CE  . LYS B 215 ? 0.2148 0.3923 0.3680 -0.0036 -0.0104 0.0101  215 LYS B CE  
3494 N NZ  . LYS B 215 ? 0.2280 0.4147 0.4078 0.0004  -0.0091 0.0073  215 LYS B NZ  
3495 N N   . PRO B 216 ? 0.0959 0.2733 0.1777 -0.0443 -0.0241 0.0035  216 PRO B N   
3496 C CA  . PRO B 216 ? 0.0896 0.2636 0.1736 -0.0534 -0.0231 0.0000  216 PRO B CA  
3497 C C   . PRO B 216 ? 0.1376 0.3165 0.2302 -0.0552 -0.0179 0.0029  216 PRO B C   
3498 O O   . PRO B 216 ? 0.1310 0.3191 0.2291 -0.0500 -0.0163 0.0037  216 PRO B O   
3499 C CB  . PRO B 216 ? 0.1647 0.3475 0.2512 -0.0559 -0.0287 -0.0049 216 PRO B CB  
3500 C CG  . PRO B 216 ? 0.1779 0.3733 0.2680 -0.0483 -0.0307 0.0002  216 PRO B CG  
3501 C CD  . PRO B 216 ? 0.1548 0.3448 0.2413 -0.0408 -0.0291 0.0055  216 PRO B CD  
3502 N N   . PHE B 217 ? 0.1523 0.3260 0.2487 -0.0625 -0.0152 0.0050  217 PHE B N   
3503 C CA  . PHE B 217 ? 0.1558 0.3367 0.2591 -0.0647 -0.0100 0.0103  217 PHE B CA  
3504 C C   . PHE B 217 ? 0.1463 0.3221 0.2619 -0.0738 -0.0092 0.0136  217 PHE B C   
3505 O O   . PHE B 217 ? 0.1572 0.3211 0.2769 -0.0781 -0.0114 0.0107  217 PHE B O   
3506 C CB  . PHE B 217 ? 0.1613 0.3435 0.2563 -0.0607 -0.0044 0.0148  217 PHE B CB  
3507 C CG  . PHE B 217 ? 0.1702 0.3403 0.2600 -0.0631 -0.0032 0.0200  217 PHE B CG  
3508 C CD1 . PHE B 217 ? 0.1814 0.3421 0.2625 -0.0598 -0.0056 0.0162  217 PHE B CD1 
3509 C CD2 . PHE B 217 ? 0.2130 0.3816 0.3089 -0.0682 0.0002  0.0302  217 PHE B CD2 
3510 C CE1 . PHE B 217 ? 0.1975 0.3427 0.2728 -0.0601 -0.0043 0.0202  217 PHE B CE1 
3511 C CE2 . PHE B 217 ? 0.2333 0.3898 0.3278 -0.0694 0.0013  0.0368  217 PHE B CE2 
3512 C CZ  . PHE B 217 ? 0.2337 0.3799 0.3185 -0.0662 -0.0009 0.0312  217 PHE B CZ  
3513 N N   . THR B 218 ? 0.1430 0.3280 0.2678 -0.0766 -0.0057 0.0191  218 THR B N   
3514 C CA  . THR B 218 ? 0.1811 0.3616 0.3231 -0.0847 -0.0034 0.0251  218 THR B CA  
3515 C C   . THR B 218 ? 0.2012 0.3863 0.3405 -0.0840 0.0028  0.0395  218 THR B C   
3516 O O   . THR B 218 ? 0.1915 0.3861 0.3150 -0.0779 0.0049  0.0409  218 THR B O   
3517 C CB  . THR B 218 ? 0.1565 0.3462 0.3134 -0.0889 -0.0048 0.0209  218 THR B CB  
3518 O OG1 . THR B 218 ? 0.1702 0.3763 0.3210 -0.0847 -0.0025 0.0235  218 THR B OG1 
3519 C CG2 . THR B 218 ? 0.1458 0.3349 0.3021 -0.0884 -0.0120 0.0075  218 THR B CG2 
3520 N N   . VAL B 219 ? 0.2595 0.4392 0.4150 -0.0900 0.0057  0.0494  219 VAL B N   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  MET 37  37  37  MET MET A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  TYR 46  46  46  TYR TYR A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ASN 155 155 155 ASN ASN A . n 
A 1 156 GLN 156 156 156 GLN GLN A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 TRP 188 188 188 TRP TRP A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 GLU 223 223 ?   ?   ?   A . n 
A 1 224 ASN 224 224 ?   ?   ?   A . n 
A 1 225 LEU 225 225 ?   ?   ?   A . n 
A 1 226 TYR 226 226 ?   ?   ?   A . n 
A 1 227 PHE 227 227 ?   ?   ?   A . n 
A 1 228 GLN 228 228 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   VAL 2   2   2   VAL VAL B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   PRO 4   4   4   PRO PRO B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   TYR 7   7   7   TYR TYR B . n 
B 1 8   GLY 8   8   8   GLY GLY B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  ALA 17  17  17  ALA ALA B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  THR 21  21  21  THR THR B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLN 26  26  26  GLN GLN B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  TYR 29  29  29  TYR TYR B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  TYR 31  31  31  TYR TYR B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  ASN 35  35  35  ASN ASN B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  MET 37  37  37  MET MET B . n 
B 1 38  ASN 38  38  38  ASN ASN B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  GLN 41  41  41  GLN GLN B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  SER 43  43  43  SER SER B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  TYR 46  46  46  TYR TYR B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  GLN 52  52  52  GLN GLN B . n 
B 1 53  HIS 53  53  53  HIS HIS B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  SER 68  68  68  SER SER B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  ILE 71  71  71  ILE ILE B . n 
B 1 72  MET 72  72  72  MET MET B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  TYR 74  74  74  TYR TYR B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  SER 84  84  84  SER SER B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  TYR 86  86  86  TYR TYR B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  ASP 89  89  89  ASP ASP B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  ARG 93  93  93  ARG ARG B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  ASN 98  98  98  ASN ASN B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 VAL 106 106 106 VAL VAL B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 PHE 108 108 108 PHE PHE B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 SER 114 114 114 SER SER B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 LYS 117 117 117 LYS LYS B . n 
B 1 118 MET 118 118 118 MET MET B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 LYS 124 124 124 LYS LYS B . n 
B 1 125 THR 125 125 125 THR THR B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 GLN 129 129 129 GLN GLN B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 ILE 135 135 135 ILE ILE B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 TYR 139 139 139 TYR TYR B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 PHE 141 141 141 PHE PHE B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 GLU 143 143 143 GLU GLU B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 PHE 145 145 145 PHE PHE B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 GLN 149 149 149 GLN GLN B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 ASN 155 155 155 ASN ASN B . n 
B 1 156 GLN 156 156 156 GLN GLN B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 ILE 159 159 159 ILE ILE B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 ALA 173 173 173 ALA ALA B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 PRO 176 176 176 PRO PRO B . n 
B 1 177 VAL 177 177 177 VAL VAL B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 ALA 180 180 180 ALA ALA B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 TRP 188 188 188 TRP TRP B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 LYS 190 190 190 LYS LYS B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 GLU 193 193 193 GLU GLU B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 PRO 196 196 196 PRO PRO B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 ASN 201 201 201 ASN ASN B . n 
B 1 202 SER 202 202 202 SER SER B . n 
B 1 203 THR 203 203 203 THR THR B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 GLN 206 206 206 GLN GLN B . n 
B 1 207 GLN 207 207 207 GLN GLN B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 ALA 210 210 210 ALA ALA B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 VAL 212 212 212 VAL VAL B . n 
B 1 213 LYS 213 213 213 LYS LYS B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 LYS 215 215 215 LYS LYS B . n 
B 1 216 PRO 216 216 216 PRO PRO B . n 
B 1 217 PHE 217 217 217 PHE PHE B . n 
B 1 218 THR 218 218 218 THR THR B . n 
B 1 219 VAL 219 219 219 VAL VAL B . n 
B 1 220 VAL 220 220 ?   ?   ?   B . n 
B 1 221 GLY 221 221 ?   ?   ?   B . n 
B 1 222 ALA 222 222 ?   ?   ?   B . n 
B 1 223 GLU 223 223 ?   ?   ?   B . n 
B 1 224 ASN 224 224 ?   ?   ?   B . n 
B 1 225 LEU 225 225 ?   ?   ?   B . n 
B 1 226 TYR 226 226 ?   ?   ?   B . n 
B 1 227 PHE 227 227 ?   ?   ?   B . n 
B 1 228 GLN 228 228 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'Enzyme Function Initiative' 
_pdbx_SG_project.full_name_of_center   ? 
_pdbx_SG_project.initial_of_center     ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3880  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  19130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     710 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2012-10-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 17.5776 21.8555 8.6470  0.0384  0.0518 0.0467 0.0051  -0.0092 0.0164  0.5893 0.8751 0.9136 
-0.0960 -0.0600 0.2388  -0.0252 -0.0092 0.0196  0.1326  0.1767  0.0091  -0.0852 -0.1133 0.0443  
'X-RAY DIFFRACTION' 2  ? refined 20.2047 30.6594 13.2410 0.1148  0.0808 0.1387 -0.0259 -0.0091 0.0136  1.4780 1.4572 1.7562 0.8231 
0.7686  0.6242  -0.0458 -0.0583 0.0713  0.0159  0.4151  0.0489  0.0182  -0.3305 0.1355  
'X-RAY DIFFRACTION' 3  ? refined 10.5988 14.0450 17.5448 0.0289  0.0550 0.0405 0.0152  -0.0023 0.0051  0.8976 1.2468 0.8682 0.0595 
0.0925  -0.2256 0.0128  0.0373  -0.0359 0.0052  0.0371  0.0832  -0.0457 -0.0130 -0.0822 
'X-RAY DIFFRACTION' 4  ? refined 34.5847 19.2926 18.2898 0.0719  0.1124 0.1148 -0.0126 -0.0009 -0.0043 3.6949 2.3973 2.0221 2.4486 
-1.4339 -0.8989 0.0531  -0.0329 -0.0156 -0.0906 0.2185  -0.1036 0.0638  -0.3674 0.2335  
'X-RAY DIFFRACTION' 5  ? refined 35.2285 6.4650  19.1064 0.0491  0.1133 0.1259 0.0203  -0.0060 -0.0008 2.3411 1.6694 0.6410 1.5642 
0.0604  -0.0540 0.0055  -0.0605 0.0412  -0.1324 -0.0243 -0.0126 -0.0461 0.0652  0.2021  
'X-RAY DIFFRACTION' 6  ? refined 15.6375 -1.4068 12.1911 0.1075  0.0731 0.2026 0.0002  -0.0341 -0.0192 2.0982 4.6683 3.3726 
-1.4036 -0.4303 -0.0957 0.0869  0.0966  -0.1347 -0.0076 -0.6554 0.2995  -0.0012 0.5434  -0.1574 
'X-RAY DIFFRACTION' 7  ? refined 23.8746 10.5738 11.4771 0.0394  0.0646 0.0430 0.0200  0.0006  -0.0012 1.8959 0.6205 0.5257 0.6848 
-0.0254 -0.1335 -0.0184 -0.0006 0.0216  -0.0454 -0.0737 -0.0950 -0.0807 0.0058  0.1516  
'X-RAY DIFFRACTION' 8  ? refined 27.4931 2.6950  6.6101  0.0901  0.1130 0.1034 0.0504  -0.0058 -0.0294 0.6216 1.0620 0.2944 
-0.0036 -0.0545 -0.2977 0.0275  0.0229  -0.0252 0.1292  -0.2826 -0.1426 -0.1411 0.1263  0.2365  
'X-RAY DIFFRACTION' 9  ? refined 34.5146 17.1434 6.9911  -0.1022 0.2061 0.0962 -0.0095 -0.0229 0.0378  0.4499 0.3486 0.4281 0.1130 
0.1907  -0.1404 0.0317  -0.1301 0.0509  0.0559  0.0333  -0.1027 -0.1494 -0.0490 0.2403  
'X-RAY DIFFRACTION' 10 ? refined 15.2224 4.4126  39.4715 0.1628  0.0566 0.0659 -0.0428 -0.0303 0.0319  0.9465 0.8933 0.9273 
-0.3060 -0.0693 0.1285  0.0845  0.0044  -0.0326 -0.1152 -0.3405 0.1112  0.0230  0.4692  -0.1481 
'X-RAY DIFFRACTION' 11 ? refined 20.8792 -0.5525 40.0576 0.3067  0.1635 0.1339 0.0756  -0.1044 0.0029  2.5528 1.4514 1.4410 
-0.6050 -0.2066 -0.0096 0.1636  0.0722  -0.1090 -0.1353 -0.1976 -0.1196 0.2352  0.7060  0.1616  
'X-RAY DIFFRACTION' 12 ? refined 24.1911 -4.6970 29.9669 0.3866  0.0465 0.2186 0.2553  -0.1867 -0.0359 3.4825 0.8697 1.8286 
-0.6094 -0.9154 0.6991  -0.0402 0.0229  -0.0850 -0.0002 -0.4124 0.0125  -0.0660 0.3328  0.1322  
'X-RAY DIFFRACTION' 13 ? refined 8.2158  6.7920  31.3710 0.0952  0.0910 0.0576 -0.0344 -0.0174 0.0214  1.2852 2.7540 1.1756 0.2698 
0.2673  -0.4383 0.0479  0.0639  -0.0610 -0.0260 -0.2246 0.2514  0.1189  0.2468  -0.2746 
'X-RAY DIFFRACTION' 14 ? refined 27.5159 18.9983 31.2282 0.0418  0.0678 0.0660 -0.0116 0.0006  -0.0003 1.8322 0.6598 1.0301 0.1522 
0.5710  0.0309  0.0411  -0.0245 -0.0108 0.0034  0.0336  -0.1645 0.0200  -0.0267 0.1663  
'X-RAY DIFFRACTION' 15 ? refined 17.7970 24.2956 39.6320 0.0738  0.0597 0.0600 0.0099  0.0043  -0.0148 1.3960 1.2536 1.1332 0.5530 
-0.4236 0.2461  0.0281  -0.0270 -0.0100 -0.1090 0.2467  0.0593  0.0250  -0.2303 -0.0494 
'X-RAY DIFFRACTION' 16 ? refined 29.5972 13.5575 45.9263 0.0814  0.1467 0.0789 -0.0174 -0.0107 0.0051  5.2693 0.5081 0.6503 0.2782 
-0.3299 0.0449  -0.0113 -0.0046 0.0057  -0.1784 -0.0051 -0.1613 0.0827  -0.1020 0.2295  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 0 A 0 
;chain 'A' and (resid 3 through 24 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 0 A 0 
;chain 'A' and (resid 25 through 56 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 0 A 0 
;chain 'A' and (resid 57 through 105 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 0 A 0 
;chain 'A' and (resid 106 through 125 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 0 A 0 
;chain 'A' and (resid 126 through 146 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 0 A 0 
;chain 'A' and (resid 147 through 158 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 0 A 0 
;chain 'A' and (resid 159 through 173 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 0 A 0 
;chain 'A' and (resid 174 through 197 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 0 A 0 
;chain 'A' and (resid 198 through 222 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 0 B 0 
;chain 'B' and (resid 1 through 24 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 B 0 B 0 
;chain 'B' and (resid 25 through 43 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 B 0 B 0 
;chain 'B' and (resid 44 through 56 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 B 0 B 0 
;chain 'B' and (resid 57 through 89 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 B 0 B 0 
;chain 'B' and (resid 90 through 145 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 B 0 B 0 
;chain 'B' and (resid 146 through 197 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 B 0 B 0 
;chain 'B' and (resid 198 through 219 )
;
? ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA       3.3.20   2011/05/18       other   'Phil R. Evans' pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 
2 PHENIX      1.8_1069 ?                package 'Paul D. Adams' PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/              C++        ? 
3 PDB_EXTRACT 3.11     'April 22, 2011' package PDB             deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/  C++        ? 
4 MOSFLM      .        ?                ?       ?               ?                        'data reduction'  ? ?          ? 
5 PHENIX      1.8_1069 ?                ?       ?               ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 528 ? ? O A HOH 704 ? ? 2.11 
2  1 O   A HOH 620 ? ? O B HOH 506 ? ? 2.12 
3  1 O   A HOH 569 ? ? O A HOH 741 ? ? 2.12 
4  1 O   A HOH 577 ? ? O A HOH 708 ? ? 2.12 
5  1 O   A HOH 641 ? ? O B HOH 631 ? ? 2.14 
6  1 O   A HOH 636 ? ? O A HOH 754 ? ? 2.15 
7  1 O   A HOH 456 ? ? O A HOH 597 ? ? 2.15 
8  1 O   A HOH 656 ? ? O A HOH 719 ? ? 2.16 
9  1 O   A HOH 591 ? ? O A HOH 678 ? ? 2.17 
10 1 O   A ASP 148 ? ? O A HOH 750 ? ? 2.17 
11 1 OD1 A ASN 98  ? ? O A HOH 653 ? ? 2.17 
12 1 O   A HOH 744 ? ? O A HOH 754 ? ? 2.18 
13 1 O   B HOH 462 ? ? O B HOH 602 ? ? 2.19 
14 1 O   B HOH 542 ? ? O B HOH 585 ? ? 2.19 
15 1 O   A HOH 657 ? ? O A HOH 659 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 67  ? ? 81.55   119.33  
2 1 TYR A 86  ? ? -157.47 79.31   
3 1 LYS A 147 ? ? 51.52   -117.47 
4 1 ASP B 67  ? ? 81.97   117.26  
5 1 TYR B 86  ? ? -157.29 80.55   
6 1 VAL B 107 ? ? -91.63  -61.68  
7 1 LYS B 147 ? ? 50.58   -124.31 
8 1 TYR B 182 ? ? -119.76 64.48   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A VAL 2   ? A VAL 2   
3  1 Y 1 A GLU 223 ? A GLU 223 
4  1 Y 1 A ASN 224 ? A ASN 224 
5  1 Y 1 A LEU 225 ? A LEU 225 
6  1 Y 1 A TYR 226 ? A TYR 226 
7  1 Y 1 A PHE 227 ? A PHE 227 
8  1 Y 1 A GLN 228 ? A GLN 228 
9  1 Y 1 B VAL 220 ? B VAL 220 
10 1 Y 1 B GLY 221 ? B GLY 221 
11 1 Y 1 B ALA 222 ? B ALA 222 
12 1 Y 1 B GLU 223 ? B GLU 223 
13 1 Y 1 B ASN 224 ? B ASN 224 
14 1 Y 1 B LEU 225 ? B LEU 225 
15 1 Y 1 B TYR 226 ? B TYR 226 
16 1 Y 1 B PHE 227 ? B PHE 227 
17 1 Y 1 B GLN 228 ? B GLN 228 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLUTATHIONE GSH 
3 water       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GSH 1   301 1   GSH GSH A . 
D 2 GSH 1   301 1   GSH GSH B . 
E 3 HOH 1   401 1   HOH HOH A . 
E 3 HOH 2   402 3   HOH HOH A . 
E 3 HOH 3   403 4   HOH HOH A . 
E 3 HOH 4   404 6   HOH HOH A . 
E 3 HOH 5   405 7   HOH HOH A . 
E 3 HOH 6   406 8   HOH HOH A . 
E 3 HOH 7   407 9   HOH HOH A . 
E 3 HOH 8   408 11  HOH HOH A . 
E 3 HOH 9   409 14  HOH HOH A . 
E 3 HOH 10  410 17  HOH HOH A . 
E 3 HOH 11  411 18  HOH HOH A . 
E 3 HOH 12  412 19  HOH HOH A . 
E 3 HOH 13  413 21  HOH HOH A . 
E 3 HOH 14  414 22  HOH HOH A . 
E 3 HOH 15  415 27  HOH HOH A . 
E 3 HOH 16  416 28  HOH HOH A . 
E 3 HOH 17  417 30  HOH HOH A . 
E 3 HOH 18  418 33  HOH HOH A . 
E 3 HOH 19  419 34  HOH HOH A . 
E 3 HOH 20  420 36  HOH HOH A . 
E 3 HOH 21  421 38  HOH HOH A . 
E 3 HOH 22  422 39  HOH HOH A . 
E 3 HOH 23  423 40  HOH HOH A . 
E 3 HOH 24  424 41  HOH HOH A . 
E 3 HOH 25  425 43  HOH HOH A . 
E 3 HOH 26  426 44  HOH HOH A . 
E 3 HOH 27  427 45  HOH HOH A . 
E 3 HOH 28  428 47  HOH HOH A . 
E 3 HOH 29  429 49  HOH HOH A . 
E 3 HOH 30  430 51  HOH HOH A . 
E 3 HOH 31  431 54  HOH HOH A . 
E 3 HOH 32  432 55  HOH HOH A . 
E 3 HOH 33  433 56  HOH HOH A . 
E 3 HOH 34  434 57  HOH HOH A . 
E 3 HOH 35  435 58  HOH HOH A . 
E 3 HOH 36  436 59  HOH HOH A . 
E 3 HOH 37  437 61  HOH HOH A . 
E 3 HOH 38  438 62  HOH HOH A . 
E 3 HOH 39  439 64  HOH HOH A . 
E 3 HOH 40  440 66  HOH HOH A . 
E 3 HOH 41  441 68  HOH HOH A . 
E 3 HOH 42  442 69  HOH HOH A . 
E 3 HOH 43  443 71  HOH HOH A . 
E 3 HOH 44  444 72  HOH HOH A . 
E 3 HOH 45  445 73  HOH HOH A . 
E 3 HOH 46  446 77  HOH HOH A . 
E 3 HOH 47  447 79  HOH HOH A . 
E 3 HOH 48  448 80  HOH HOH A . 
E 3 HOH 49  449 81  HOH HOH A . 
E 3 HOH 50  450 83  HOH HOH A . 
E 3 HOH 51  451 84  HOH HOH A . 
E 3 HOH 52  452 88  HOH HOH A . 
E 3 HOH 53  453 89  HOH HOH A . 
E 3 HOH 54  454 91  HOH HOH A . 
E 3 HOH 55  455 92  HOH HOH A . 
E 3 HOH 56  456 93  HOH HOH A . 
E 3 HOH 57  457 94  HOH HOH A . 
E 3 HOH 58  458 97  HOH HOH A . 
E 3 HOH 59  459 98  HOH HOH A . 
E 3 HOH 60  460 99  HOH HOH A . 
E 3 HOH 61  461 100 HOH HOH A . 
E 3 HOH 62  462 101 HOH HOH A . 
E 3 HOH 63  463 102 HOH HOH A . 
E 3 HOH 64  464 103 HOH HOH A . 
E 3 HOH 65  465 104 HOH HOH A . 
E 3 HOH 66  466 105 HOH HOH A . 
E 3 HOH 67  467 106 HOH HOH A . 
E 3 HOH 68  468 107 HOH HOH A . 
E 3 HOH 69  469 110 HOH HOH A . 
E 3 HOH 70  470 111 HOH HOH A . 
E 3 HOH 71  471 112 HOH HOH A . 
E 3 HOH 72  472 118 HOH HOH A . 
E 3 HOH 73  473 120 HOH HOH A . 
E 3 HOH 74  474 121 HOH HOH A . 
E 3 HOH 75  475 122 HOH HOH A . 
E 3 HOH 76  476 124 HOH HOH A . 
E 3 HOH 77  477 125 HOH HOH A . 
E 3 HOH 78  478 126 HOH HOH A . 
E 3 HOH 79  479 127 HOH HOH A . 
E 3 HOH 80  480 128 HOH HOH A . 
E 3 HOH 81  481 129 HOH HOH A . 
E 3 HOH 82  482 130 HOH HOH A . 
E 3 HOH 83  483 132 HOH HOH A . 
E 3 HOH 84  484 133 HOH HOH A . 
E 3 HOH 85  485 134 HOH HOH A . 
E 3 HOH 86  486 135 HOH HOH A . 
E 3 HOH 87  487 136 HOH HOH A . 
E 3 HOH 88  488 138 HOH HOH A . 
E 3 HOH 89  489 142 HOH HOH A . 
E 3 HOH 90  490 145 HOH HOH A . 
E 3 HOH 91  491 146 HOH HOH A . 
E 3 HOH 92  492 148 HOH HOH A . 
E 3 HOH 93  493 149 HOH HOH A . 
E 3 HOH 94  494 150 HOH HOH A . 
E 3 HOH 95  495 152 HOH HOH A . 
E 3 HOH 96  496 153 HOH HOH A . 
E 3 HOH 97  497 154 HOH HOH A . 
E 3 HOH 98  498 157 HOH HOH A . 
E 3 HOH 99  499 158 HOH HOH A . 
E 3 HOH 100 500 162 HOH HOH A . 
E 3 HOH 101 501 164 HOH HOH A . 
E 3 HOH 102 502 165 HOH HOH A . 
E 3 HOH 103 503 166 HOH HOH A . 
E 3 HOH 104 504 167 HOH HOH A . 
E 3 HOH 105 505 168 HOH HOH A . 
E 3 HOH 106 506 170 HOH HOH A . 
E 3 HOH 107 507 171 HOH HOH A . 
E 3 HOH 108 508 172 HOH HOH A . 
E 3 HOH 109 509 173 HOH HOH A . 
E 3 HOH 110 510 174 HOH HOH A . 
E 3 HOH 111 511 175 HOH HOH A . 
E 3 HOH 112 512 176 HOH HOH A . 
E 3 HOH 113 513 177 HOH HOH A . 
E 3 HOH 114 514 178 HOH HOH A . 
E 3 HOH 115 515 179 HOH HOH A . 
E 3 HOH 116 516 180 HOH HOH A . 
E 3 HOH 117 517 183 HOH HOH A . 
E 3 HOH 118 518 184 HOH HOH A . 
E 3 HOH 119 519 185 HOH HOH A . 
E 3 HOH 120 520 188 HOH HOH A . 
E 3 HOH 121 521 189 HOH HOH A . 
E 3 HOH 122 522 190 HOH HOH A . 
E 3 HOH 123 523 193 HOH HOH A . 
E 3 HOH 124 524 198 HOH HOH A . 
E 3 HOH 125 525 200 HOH HOH A . 
E 3 HOH 126 526 201 HOH HOH A . 
E 3 HOH 127 527 203 HOH HOH A . 
E 3 HOH 128 528 207 HOH HOH A . 
E 3 HOH 129 529 212 HOH HOH A . 
E 3 HOH 130 530 216 HOH HOH A . 
E 3 HOH 131 531 217 HOH HOH A . 
E 3 HOH 132 532 219 HOH HOH A . 
E 3 HOH 133 533 222 HOH HOH A . 
E 3 HOH 134 534 224 HOH HOH A . 
E 3 HOH 135 535 225 HOH HOH A . 
E 3 HOH 136 536 227 HOH HOH A . 
E 3 HOH 137 537 230 HOH HOH A . 
E 3 HOH 138 538 232 HOH HOH A . 
E 3 HOH 139 539 234 HOH HOH A . 
E 3 HOH 140 540 235 HOH HOH A . 
E 3 HOH 141 541 237 HOH HOH A . 
E 3 HOH 142 542 238 HOH HOH A . 
E 3 HOH 143 543 239 HOH HOH A . 
E 3 HOH 144 544 240 HOH HOH A . 
E 3 HOH 145 545 242 HOH HOH A . 
E 3 HOH 146 546 244 HOH HOH A . 
E 3 HOH 147 547 247 HOH HOH A . 
E 3 HOH 148 548 248 HOH HOH A . 
E 3 HOH 149 549 252 HOH HOH A . 
E 3 HOH 150 550 254 HOH HOH A . 
E 3 HOH 151 551 255 HOH HOH A . 
E 3 HOH 152 552 257 HOH HOH A . 
E 3 HOH 153 553 258 HOH HOH A . 
E 3 HOH 154 554 259 HOH HOH A . 
E 3 HOH 155 555 260 HOH HOH A . 
E 3 HOH 156 556 263 HOH HOH A . 
E 3 HOH 157 557 264 HOH HOH A . 
E 3 HOH 158 558 265 HOH HOH A . 
E 3 HOH 159 559 266 HOH HOH A . 
E 3 HOH 160 560 267 HOH HOH A . 
E 3 HOH 161 561 268 HOH HOH A . 
E 3 HOH 162 562 269 HOH HOH A . 
E 3 HOH 163 563 272 HOH HOH A . 
E 3 HOH 164 564 277 HOH HOH A . 
E 3 HOH 165 565 280 HOH HOH A . 
E 3 HOH 166 566 281 HOH HOH A . 
E 3 HOH 167 567 284 HOH HOH A . 
E 3 HOH 168 568 285 HOH HOH A . 
E 3 HOH 169 569 286 HOH HOH A . 
E 3 HOH 170 570 288 HOH HOH A . 
E 3 HOH 171 571 291 HOH HOH A . 
E 3 HOH 172 572 293 HOH HOH A . 
E 3 HOH 173 573 296 HOH HOH A . 
E 3 HOH 174 574 297 HOH HOH A . 
E 3 HOH 175 575 298 HOH HOH A . 
E 3 HOH 176 576 299 HOH HOH A . 
E 3 HOH 177 577 301 HOH HOH A . 
E 3 HOH 178 578 302 HOH HOH A . 
E 3 HOH 179 579 304 HOH HOH A . 
E 3 HOH 180 580 307 HOH HOH A . 
E 3 HOH 181 581 308 HOH HOH A . 
E 3 HOH 182 582 309 HOH HOH A . 
E 3 HOH 183 583 310 HOH HOH A . 
E 3 HOH 184 584 311 HOH HOH A . 
E 3 HOH 185 585 312 HOH HOH A . 
E 3 HOH 186 586 313 HOH HOH A . 
E 3 HOH 187 587 319 HOH HOH A . 
E 3 HOH 188 588 325 HOH HOH A . 
E 3 HOH 189 589 326 HOH HOH A . 
E 3 HOH 190 590 329 HOH HOH A . 
E 3 HOH 191 591 330 HOH HOH A . 
E 3 HOH 192 592 331 HOH HOH A . 
E 3 HOH 193 593 333 HOH HOH A . 
E 3 HOH 194 594 335 HOH HOH A . 
E 3 HOH 195 595 336 HOH HOH A . 
E 3 HOH 196 596 337 HOH HOH A . 
E 3 HOH 197 597 339 HOH HOH A . 
E 3 HOH 198 598 340 HOH HOH A . 
E 3 HOH 199 599 341 HOH HOH A . 
E 3 HOH 200 600 342 HOH HOH A . 
E 3 HOH 201 601 344 HOH HOH A . 
E 3 HOH 202 602 345 HOH HOH A . 
E 3 HOH 203 603 347 HOH HOH A . 
E 3 HOH 204 604 348 HOH HOH A . 
E 3 HOH 205 605 349 HOH HOH A . 
E 3 HOH 206 606 356 HOH HOH A . 
E 3 HOH 207 607 357 HOH HOH A . 
E 3 HOH 208 608 358 HOH HOH A . 
E 3 HOH 209 609 360 HOH HOH A . 
E 3 HOH 210 610 361 HOH HOH A . 
E 3 HOH 211 611 362 HOH HOH A . 
E 3 HOH 212 612 366 HOH HOH A . 
E 3 HOH 213 613 369 HOH HOH A . 
E 3 HOH 214 614 371 HOH HOH A . 
E 3 HOH 215 615 374 HOH HOH A . 
E 3 HOH 216 616 375 HOH HOH A . 
E 3 HOH 217 617 377 HOH HOH A . 
E 3 HOH 218 618 379 HOH HOH A . 
E 3 HOH 219 619 381 HOH HOH A . 
E 3 HOH 220 620 385 HOH HOH A . 
E 3 HOH 221 621 386 HOH HOH A . 
E 3 HOH 222 622 387 HOH HOH A . 
E 3 HOH 223 623 388 HOH HOH A . 
E 3 HOH 224 624 393 HOH HOH A . 
E 3 HOH 225 625 394 HOH HOH A . 
E 3 HOH 226 626 397 HOH HOH A . 
E 3 HOH 227 627 401 HOH HOH A . 
E 3 HOH 228 628 403 HOH HOH A . 
E 3 HOH 229 629 405 HOH HOH A . 
E 3 HOH 230 630 412 HOH HOH A . 
E 3 HOH 231 631 413 HOH HOH A . 
E 3 HOH 232 632 414 HOH HOH A . 
E 3 HOH 233 633 415 HOH HOH A . 
E 3 HOH 234 634 418 HOH HOH A . 
E 3 HOH 235 635 419 HOH HOH A . 
E 3 HOH 236 636 420 HOH HOH A . 
E 3 HOH 237 637 421 HOH HOH A . 
E 3 HOH 238 638 426 HOH HOH A . 
E 3 HOH 239 639 430 HOH HOH A . 
E 3 HOH 240 640 433 HOH HOH A . 
E 3 HOH 241 641 435 HOH HOH A . 
E 3 HOH 242 642 436 HOH HOH A . 
E 3 HOH 243 643 439 HOH HOH A . 
E 3 HOH 244 644 445 HOH HOH A . 
E 3 HOH 245 645 447 HOH HOH A . 
E 3 HOH 246 646 450 HOH HOH A . 
E 3 HOH 247 647 453 HOH HOH A . 
E 3 HOH 248 648 454 HOH HOH A . 
E 3 HOH 249 649 455 HOH HOH A . 
E 3 HOH 250 650 457 HOH HOH A . 
E 3 HOH 251 651 459 HOH HOH A . 
E 3 HOH 252 652 461 HOH HOH A . 
E 3 HOH 253 653 464 HOH HOH A . 
E 3 HOH 254 654 465 HOH HOH A . 
E 3 HOH 255 655 467 HOH HOH A . 
E 3 HOH 256 656 468 HOH HOH A . 
E 3 HOH 257 657 470 HOH HOH A . 
E 3 HOH 258 658 472 HOH HOH A . 
E 3 HOH 259 659 473 HOH HOH A . 
E 3 HOH 260 660 477 HOH HOH A . 
E 3 HOH 261 661 479 HOH HOH A . 
E 3 HOH 262 662 482 HOH HOH A . 
E 3 HOH 263 663 483 HOH HOH A . 
E 3 HOH 264 664 485 HOH HOH A . 
E 3 HOH 265 665 486 HOH HOH A . 
E 3 HOH 266 666 488 HOH HOH A . 
E 3 HOH 267 667 489 HOH HOH A . 
E 3 HOH 268 668 491 HOH HOH A . 
E 3 HOH 269 669 493 HOH HOH A . 
E 3 HOH 270 670 494 HOH HOH A . 
E 3 HOH 271 671 496 HOH HOH A . 
E 3 HOH 272 672 498 HOH HOH A . 
E 3 HOH 273 673 499 HOH HOH A . 
E 3 HOH 274 674 500 HOH HOH A . 
E 3 HOH 275 675 501 HOH HOH A . 
E 3 HOH 276 676 502 HOH HOH A . 
E 3 HOH 277 677 504 HOH HOH A . 
E 3 HOH 278 678 508 HOH HOH A . 
E 3 HOH 279 679 509 HOH HOH A . 
E 3 HOH 280 680 512 HOH HOH A . 
E 3 HOH 281 681 515 HOH HOH A . 
E 3 HOH 282 682 518 HOH HOH A . 
E 3 HOH 283 683 521 HOH HOH A . 
E 3 HOH 284 684 522 HOH HOH A . 
E 3 HOH 285 685 523 HOH HOH A . 
E 3 HOH 286 686 524 HOH HOH A . 
E 3 HOH 287 687 525 HOH HOH A . 
E 3 HOH 288 688 526 HOH HOH A . 
E 3 HOH 289 689 527 HOH HOH A . 
E 3 HOH 290 690 529 HOH HOH A . 
E 3 HOH 291 691 535 HOH HOH A . 
E 3 HOH 292 692 537 HOH HOH A . 
E 3 HOH 293 693 538 HOH HOH A . 
E 3 HOH 294 694 542 HOH HOH A . 
E 3 HOH 295 695 543 HOH HOH A . 
E 3 HOH 296 696 544 HOH HOH A . 
E 3 HOH 297 697 546 HOH HOH A . 
E 3 HOH 298 698 550 HOH HOH A . 
E 3 HOH 299 699 551 HOH HOH A . 
E 3 HOH 300 700 552 HOH HOH A . 
E 3 HOH 301 701 554 HOH HOH A . 
E 3 HOH 302 702 557 HOH HOH A . 
E 3 HOH 303 703 559 HOH HOH A . 
E 3 HOH 304 704 560 HOH HOH A . 
E 3 HOH 305 705 561 HOH HOH A . 
E 3 HOH 306 706 562 HOH HOH A . 
E 3 HOH 307 707 565 HOH HOH A . 
E 3 HOH 308 708 566 HOH HOH A . 
E 3 HOH 309 709 567 HOH HOH A . 
E 3 HOH 310 710 568 HOH HOH A . 
E 3 HOH 311 711 571 HOH HOH A . 
E 3 HOH 312 712 572 HOH HOH A . 
E 3 HOH 313 713 573 HOH HOH A . 
E 3 HOH 314 714 577 HOH HOH A . 
E 3 HOH 315 715 578 HOH HOH A . 
E 3 HOH 316 716 579 HOH HOH A . 
E 3 HOH 317 717 583 HOH HOH A . 
E 3 HOH 318 718 585 HOH HOH A . 
E 3 HOH 319 719 586 HOH HOH A . 
E 3 HOH 320 720 587 HOH HOH A . 
E 3 HOH 321 721 589 HOH HOH A . 
E 3 HOH 322 722 592 HOH HOH A . 
E 3 HOH 323 723 597 HOH HOH A . 
E 3 HOH 324 724 598 HOH HOH A . 
E 3 HOH 325 725 599 HOH HOH A . 
E 3 HOH 326 726 601 HOH HOH A . 
E 3 HOH 327 727 602 HOH HOH A . 
E 3 HOH 328 728 605 HOH HOH A . 
E 3 HOH 329 729 607 HOH HOH A . 
E 3 HOH 330 730 612 HOH HOH A . 
E 3 HOH 331 731 614 HOH HOH A . 
E 3 HOH 332 732 615 HOH HOH A . 
E 3 HOH 333 733 617 HOH HOH A . 
E 3 HOH 334 734 619 HOH HOH A . 
E 3 HOH 335 735 623 HOH HOH A . 
E 3 HOH 336 736 626 HOH HOH A . 
E 3 HOH 337 737 627 HOH HOH A . 
E 3 HOH 338 738 630 HOH HOH A . 
E 3 HOH 339 739 636 HOH HOH A . 
E 3 HOH 340 740 642 HOH HOH A . 
E 3 HOH 341 741 643 HOH HOH A . 
E 3 HOH 342 742 646 HOH HOH A . 
E 3 HOH 343 743 648 HOH HOH A . 
E 3 HOH 344 744 655 HOH HOH A . 
E 3 HOH 345 745 656 HOH HOH A . 
E 3 HOH 346 746 657 HOH HOH A . 
E 3 HOH 347 747 658 HOH HOH A . 
E 3 HOH 348 748 662 HOH HOH A . 
E 3 HOH 349 749 663 HOH HOH A . 
E 3 HOH 350 750 664 HOH HOH A . 
E 3 HOH 351 751 667 HOH HOH A . 
E 3 HOH 352 752 668 HOH HOH A . 
E 3 HOH 353 753 670 HOH HOH A . 
E 3 HOH 354 754 671 HOH HOH A . 
E 3 HOH 355 755 674 HOH HOH A . 
E 3 HOH 356 756 675 HOH HOH A . 
E 3 HOH 357 757 676 HOH HOH A . 
E 3 HOH 358 758 684 HOH HOH A . 
E 3 HOH 359 759 685 HOH HOH A . 
E 3 HOH 360 760 686 HOH HOH A . 
E 3 HOH 361 761 687 HOH HOH A . 
E 3 HOH 362 762 689 HOH HOH A . 
E 3 HOH 363 763 691 HOH HOH A . 
E 3 HOH 364 764 692 HOH HOH A . 
E 3 HOH 365 765 693 HOH HOH A . 
E 3 HOH 366 766 694 HOH HOH A . 
E 3 HOH 367 767 700 HOH HOH A . 
F 3 HOH 1   401 2   HOH HOH B . 
F 3 HOH 2   402 5   HOH HOH B . 
F 3 HOH 3   403 10  HOH HOH B . 
F 3 HOH 4   404 12  HOH HOH B . 
F 3 HOH 5   405 13  HOH HOH B . 
F 3 HOH 6   406 15  HOH HOH B . 
F 3 HOH 7   407 16  HOH HOH B . 
F 3 HOH 8   408 20  HOH HOH B . 
F 3 HOH 9   409 23  HOH HOH B . 
F 3 HOH 10  410 24  HOH HOH B . 
F 3 HOH 11  411 25  HOH HOH B . 
F 3 HOH 12  412 26  HOH HOH B . 
F 3 HOH 13  413 29  HOH HOH B . 
F 3 HOH 14  414 31  HOH HOH B . 
F 3 HOH 15  415 32  HOH HOH B . 
F 3 HOH 16  416 35  HOH HOH B . 
F 3 HOH 17  417 37  HOH HOH B . 
F 3 HOH 18  418 42  HOH HOH B . 
F 3 HOH 19  419 46  HOH HOH B . 
F 3 HOH 20  420 48  HOH HOH B . 
F 3 HOH 21  421 50  HOH HOH B . 
F 3 HOH 22  422 52  HOH HOH B . 
F 3 HOH 23  423 53  HOH HOH B . 
F 3 HOH 24  424 60  HOH HOH B . 
F 3 HOH 25  425 63  HOH HOH B . 
F 3 HOH 26  426 65  HOH HOH B . 
F 3 HOH 27  427 67  HOH HOH B . 
F 3 HOH 28  428 70  HOH HOH B . 
F 3 HOH 29  429 74  HOH HOH B . 
F 3 HOH 30  430 75  HOH HOH B . 
F 3 HOH 31  431 76  HOH HOH B . 
F 3 HOH 32  432 78  HOH HOH B . 
F 3 HOH 33  433 82  HOH HOH B . 
F 3 HOH 34  434 85  HOH HOH B . 
F 3 HOH 35  435 86  HOH HOH B . 
F 3 HOH 36  436 87  HOH HOH B . 
F 3 HOH 37  437 90  HOH HOH B . 
F 3 HOH 38  438 95  HOH HOH B . 
F 3 HOH 39  439 108 HOH HOH B . 
F 3 HOH 40  440 109 HOH HOH B . 
F 3 HOH 41  441 113 HOH HOH B . 
F 3 HOH 42  442 114 HOH HOH B . 
F 3 HOH 43  443 115 HOH HOH B . 
F 3 HOH 44  444 116 HOH HOH B . 
F 3 HOH 45  445 117 HOH HOH B . 
F 3 HOH 46  446 119 HOH HOH B . 
F 3 HOH 47  447 123 HOH HOH B . 
F 3 HOH 48  448 131 HOH HOH B . 
F 3 HOH 49  449 137 HOH HOH B . 
F 3 HOH 50  450 139 HOH HOH B . 
F 3 HOH 51  451 140 HOH HOH B . 
F 3 HOH 52  452 141 HOH HOH B . 
F 3 HOH 53  453 143 HOH HOH B . 
F 3 HOH 54  454 144 HOH HOH B . 
F 3 HOH 55  455 147 HOH HOH B . 
F 3 HOH 56  456 151 HOH HOH B . 
F 3 HOH 57  457 155 HOH HOH B . 
F 3 HOH 58  458 156 HOH HOH B . 
F 3 HOH 59  459 159 HOH HOH B . 
F 3 HOH 60  460 160 HOH HOH B . 
F 3 HOH 61  461 161 HOH HOH B . 
F 3 HOH 62  462 163 HOH HOH B . 
F 3 HOH 63  463 169 HOH HOH B . 
F 3 HOH 64  464 181 HOH HOH B . 
F 3 HOH 65  465 182 HOH HOH B . 
F 3 HOH 66  466 186 HOH HOH B . 
F 3 HOH 67  467 187 HOH HOH B . 
F 3 HOH 68  468 191 HOH HOH B . 
F 3 HOH 69  469 192 HOH HOH B . 
F 3 HOH 70  470 194 HOH HOH B . 
F 3 HOH 71  471 195 HOH HOH B . 
F 3 HOH 72  472 196 HOH HOH B . 
F 3 HOH 73  473 197 HOH HOH B . 
F 3 HOH 74  474 199 HOH HOH B . 
F 3 HOH 75  475 202 HOH HOH B . 
F 3 HOH 76  476 204 HOH HOH B . 
F 3 HOH 77  477 205 HOH HOH B . 
F 3 HOH 78  478 206 HOH HOH B . 
F 3 HOH 79  479 208 HOH HOH B . 
F 3 HOH 80  480 209 HOH HOH B . 
F 3 HOH 81  481 210 HOH HOH B . 
F 3 HOH 82  482 211 HOH HOH B . 
F 3 HOH 83  483 213 HOH HOH B . 
F 3 HOH 84  484 214 HOH HOH B . 
F 3 HOH 85  485 215 HOH HOH B . 
F 3 HOH 86  486 218 HOH HOH B . 
F 3 HOH 87  487 220 HOH HOH B . 
F 3 HOH 88  488 221 HOH HOH B . 
F 3 HOH 89  489 223 HOH HOH B . 
F 3 HOH 90  490 226 HOH HOH B . 
F 3 HOH 91  491 228 HOH HOH B . 
F 3 HOH 92  492 229 HOH HOH B . 
F 3 HOH 93  493 231 HOH HOH B . 
F 3 HOH 94  494 233 HOH HOH B . 
F 3 HOH 95  495 236 HOH HOH B . 
F 3 HOH 96  496 241 HOH HOH B . 
F 3 HOH 97  497 243 HOH HOH B . 
F 3 HOH 98  498 245 HOH HOH B . 
F 3 HOH 99  499 246 HOH HOH B . 
F 3 HOH 100 500 249 HOH HOH B . 
F 3 HOH 101 501 250 HOH HOH B . 
F 3 HOH 102 502 251 HOH HOH B . 
F 3 HOH 103 503 253 HOH HOH B . 
F 3 HOH 104 504 256 HOH HOH B . 
F 3 HOH 105 505 261 HOH HOH B . 
F 3 HOH 106 506 262 HOH HOH B . 
F 3 HOH 107 507 270 HOH HOH B . 
F 3 HOH 108 508 271 HOH HOH B . 
F 3 HOH 109 509 273 HOH HOH B . 
F 3 HOH 110 510 274 HOH HOH B . 
F 3 HOH 111 511 275 HOH HOH B . 
F 3 HOH 112 512 276 HOH HOH B . 
F 3 HOH 113 513 278 HOH HOH B . 
F 3 HOH 114 514 279 HOH HOH B . 
F 3 HOH 115 515 282 HOH HOH B . 
F 3 HOH 116 516 283 HOH HOH B . 
F 3 HOH 117 517 287 HOH HOH B . 
F 3 HOH 118 518 289 HOH HOH B . 
F 3 HOH 119 519 290 HOH HOH B . 
F 3 HOH 120 520 292 HOH HOH B . 
F 3 HOH 121 521 294 HOH HOH B . 
F 3 HOH 122 522 295 HOH HOH B . 
F 3 HOH 123 523 300 HOH HOH B . 
F 3 HOH 124 524 303 HOH HOH B . 
F 3 HOH 125 525 305 HOH HOH B . 
F 3 HOH 126 526 306 HOH HOH B . 
F 3 HOH 127 527 314 HOH HOH B . 
F 3 HOH 128 528 315 HOH HOH B . 
F 3 HOH 129 529 316 HOH HOH B . 
F 3 HOH 130 530 317 HOH HOH B . 
F 3 HOH 131 531 318 HOH HOH B . 
F 3 HOH 132 532 320 HOH HOH B . 
F 3 HOH 133 533 321 HOH HOH B . 
F 3 HOH 134 534 322 HOH HOH B . 
F 3 HOH 135 535 323 HOH HOH B . 
F 3 HOH 136 536 324 HOH HOH B . 
F 3 HOH 137 537 327 HOH HOH B . 
F 3 HOH 138 538 332 HOH HOH B . 
F 3 HOH 139 539 334 HOH HOH B . 
F 3 HOH 140 540 338 HOH HOH B . 
F 3 HOH 141 541 346 HOH HOH B . 
F 3 HOH 142 542 351 HOH HOH B . 
F 3 HOH 143 543 352 HOH HOH B . 
F 3 HOH 144 544 353 HOH HOH B . 
F 3 HOH 145 545 354 HOH HOH B . 
F 3 HOH 146 546 355 HOH HOH B . 
F 3 HOH 147 547 359 HOH HOH B . 
F 3 HOH 148 548 363 HOH HOH B . 
F 3 HOH 149 549 364 HOH HOH B . 
F 3 HOH 150 550 367 HOH HOH B . 
F 3 HOH 151 551 370 HOH HOH B . 
F 3 HOH 152 552 372 HOH HOH B . 
F 3 HOH 153 553 373 HOH HOH B . 
F 3 HOH 154 554 376 HOH HOH B . 
F 3 HOH 155 555 380 HOH HOH B . 
F 3 HOH 156 556 383 HOH HOH B . 
F 3 HOH 157 557 389 HOH HOH B . 
F 3 HOH 158 558 390 HOH HOH B . 
F 3 HOH 159 559 391 HOH HOH B . 
F 3 HOH 160 560 392 HOH HOH B . 
F 3 HOH 161 561 395 HOH HOH B . 
F 3 HOH 162 562 396 HOH HOH B . 
F 3 HOH 163 563 398 HOH HOH B . 
F 3 HOH 164 564 399 HOH HOH B . 
F 3 HOH 165 565 400 HOH HOH B . 
F 3 HOH 166 566 402 HOH HOH B . 
F 3 HOH 167 567 404 HOH HOH B . 
F 3 HOH 168 568 406 HOH HOH B . 
F 3 HOH 169 569 407 HOH HOH B . 
F 3 HOH 170 570 408 HOH HOH B . 
F 3 HOH 171 571 409 HOH HOH B . 
F 3 HOH 172 572 410 HOH HOH B . 
F 3 HOH 173 573 411 HOH HOH B . 
F 3 HOH 174 574 416 HOH HOH B . 
F 3 HOH 175 575 417 HOH HOH B . 
F 3 HOH 176 576 422 HOH HOH B . 
F 3 HOH 177 577 423 HOH HOH B . 
F 3 HOH 178 578 424 HOH HOH B . 
F 3 HOH 179 579 425 HOH HOH B . 
F 3 HOH 180 580 427 HOH HOH B . 
F 3 HOH 181 581 428 HOH HOH B . 
F 3 HOH 182 582 429 HOH HOH B . 
F 3 HOH 183 583 431 HOH HOH B . 
F 3 HOH 184 584 432 HOH HOH B . 
F 3 HOH 185 585 434 HOH HOH B . 
F 3 HOH 186 586 437 HOH HOH B . 
F 3 HOH 187 587 438 HOH HOH B . 
F 3 HOH 188 588 440 HOH HOH B . 
F 3 HOH 189 589 441 HOH HOH B . 
F 3 HOH 190 590 442 HOH HOH B . 
F 3 HOH 191 591 443 HOH HOH B . 
F 3 HOH 192 592 444 HOH HOH B . 
F 3 HOH 193 593 446 HOH HOH B . 
F 3 HOH 194 594 448 HOH HOH B . 
F 3 HOH 195 595 449 HOH HOH B . 
F 3 HOH 196 596 451 HOH HOH B . 
F 3 HOH 197 597 452 HOH HOH B . 
F 3 HOH 198 598 456 HOH HOH B . 
F 3 HOH 199 599 458 HOH HOH B . 
F 3 HOH 200 600 460 HOH HOH B . 
F 3 HOH 201 601 462 HOH HOH B . 
F 3 HOH 202 602 463 HOH HOH B . 
F 3 HOH 203 603 466 HOH HOH B . 
F 3 HOH 204 604 469 HOH HOH B . 
F 3 HOH 205 605 471 HOH HOH B . 
F 3 HOH 206 606 474 HOH HOH B . 
F 3 HOH 207 607 475 HOH HOH B . 
F 3 HOH 208 608 476 HOH HOH B . 
F 3 HOH 209 609 478 HOH HOH B . 
F 3 HOH 210 610 481 HOH HOH B . 
F 3 HOH 211 611 484 HOH HOH B . 
F 3 HOH 212 612 487 HOH HOH B . 
F 3 HOH 213 613 490 HOH HOH B . 
F 3 HOH 214 614 492 HOH HOH B . 
F 3 HOH 215 615 497 HOH HOH B . 
F 3 HOH 216 616 503 HOH HOH B . 
F 3 HOH 217 617 505 HOH HOH B . 
F 3 HOH 218 618 506 HOH HOH B . 
F 3 HOH 219 619 507 HOH HOH B . 
F 3 HOH 220 620 510 HOH HOH B . 
F 3 HOH 221 621 511 HOH HOH B . 
F 3 HOH 222 622 513 HOH HOH B . 
F 3 HOH 223 623 514 HOH HOH B . 
F 3 HOH 224 624 516 HOH HOH B . 
F 3 HOH 225 625 517 HOH HOH B . 
F 3 HOH 226 626 519 HOH HOH B . 
F 3 HOH 227 627 520 HOH HOH B . 
F 3 HOH 228 628 528 HOH HOH B . 
F 3 HOH 229 629 530 HOH HOH B . 
F 3 HOH 230 630 531 HOH HOH B . 
F 3 HOH 231 631 532 HOH HOH B . 
F 3 HOH 232 632 536 HOH HOH B . 
F 3 HOH 233 633 539 HOH HOH B . 
F 3 HOH 234 634 540 HOH HOH B . 
F 3 HOH 235 635 541 HOH HOH B . 
F 3 HOH 236 636 545 HOH HOH B . 
F 3 HOH 237 637 547 HOH HOH B . 
F 3 HOH 238 638 548 HOH HOH B . 
F 3 HOH 239 639 549 HOH HOH B . 
F 3 HOH 240 640 553 HOH HOH B . 
F 3 HOH 241 641 556 HOH HOH B . 
F 3 HOH 242 642 558 HOH HOH B . 
F 3 HOH 243 643 563 HOH HOH B . 
F 3 HOH 244 644 564 HOH HOH B . 
F 3 HOH 245 645 569 HOH HOH B . 
F 3 HOH 246 646 570 HOH HOH B . 
F 3 HOH 247 647 574 HOH HOH B . 
F 3 HOH 248 648 575 HOH HOH B . 
F 3 HOH 249 649 576 HOH HOH B . 
F 3 HOH 250 650 580 HOH HOH B . 
F 3 HOH 251 651 581 HOH HOH B . 
F 3 HOH 252 652 582 HOH HOH B . 
F 3 HOH 253 653 584 HOH HOH B . 
F 3 HOH 254 654 591 HOH HOH B . 
F 3 HOH 255 655 593 HOH HOH B . 
F 3 HOH 256 656 594 HOH HOH B . 
F 3 HOH 257 657 595 HOH HOH B . 
F 3 HOH 258 658 596 HOH HOH B . 
F 3 HOH 259 659 600 HOH HOH B . 
F 3 HOH 260 660 603 HOH HOH B . 
F 3 HOH 261 661 604 HOH HOH B . 
F 3 HOH 262 662 606 HOH HOH B . 
F 3 HOH 263 663 608 HOH HOH B . 
F 3 HOH 264 664 609 HOH HOH B . 
F 3 HOH 265 665 613 HOH HOH B . 
F 3 HOH 266 666 618 HOH HOH B . 
F 3 HOH 267 667 621 HOH HOH B . 
F 3 HOH 268 668 625 HOH HOH B . 
F 3 HOH 269 669 629 HOH HOH B . 
F 3 HOH 270 670 631 HOH HOH B . 
F 3 HOH 271 671 633 HOH HOH B . 
F 3 HOH 272 672 635 HOH HOH B . 
F 3 HOH 273 673 637 HOH HOH B . 
F 3 HOH 274 674 639 HOH HOH B . 
F 3 HOH 275 675 640 HOH HOH B . 
F 3 HOH 276 676 641 HOH HOH B . 
F 3 HOH 277 677 644 HOH HOH B . 
F 3 HOH 278 678 645 HOH HOH B . 
F 3 HOH 279 679 647 HOH HOH B . 
F 3 HOH 280 680 649 HOH HOH B . 
F 3 HOH 281 681 650 HOH HOH B . 
F 3 HOH 282 682 651 HOH HOH B . 
F 3 HOH 283 683 652 HOH HOH B . 
F 3 HOH 284 684 653 HOH HOH B . 
F 3 HOH 285 685 654 HOH HOH B . 
F 3 HOH 286 686 659 HOH HOH B . 
F 3 HOH 287 687 660 HOH HOH B . 
F 3 HOH 288 688 661 HOH HOH B . 
F 3 HOH 289 689 669 HOH HOH B . 
F 3 HOH 290 690 672 HOH HOH B . 
F 3 HOH 291 691 673 HOH HOH B . 
F 3 HOH 292 692 677 HOH HOH B . 
F 3 HOH 293 693 678 HOH HOH B . 
F 3 HOH 294 694 679 HOH HOH B . 
F 3 HOH 295 695 680 HOH HOH B . 
F 3 HOH 296 696 681 HOH HOH B . 
F 3 HOH 297 697 683 HOH HOH B . 
F 3 HOH 298 698 688 HOH HOH B . 
F 3 HOH 299 699 690 HOH HOH B . 
F 3 HOH 300 700 695 HOH HOH B . 
F 3 HOH 301 701 696 HOH HOH B . 
F 3 HOH 302 702 698 HOH HOH B . 
F 3 HOH 303 703 699 HOH HOH B . 
#