data_4HKC
# 
_entry.id   4HKC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HKC         
RCSB  RCSB075573   
WWPDB D_1000075573 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
BMRB 18718 'Alpha4 Integrin Cytoplasmic Tail 1H and 15N Chemical Shift'                        unspecified 
BMRB 18719 'Beta2 Integrin Cytoplasmic Tail 1H and 15N Chemical Shift'                         unspecified 
PDB  2V7D  '14-3-3 Protein zeta in complex with Thr758 phosphorylated integrin beta 2 peptide' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4HKC 
_pdbx_database_status.recvd_initial_deposition_date   2012-10-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bonet, R.'      1 ? 
'Campbell, I.D.' 2 ? 
# 
_citation.id                        primary 
_citation.title                     'Characterization of 14-3-3-zeta Interactions with integrin tails' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            425 
_citation.page_first                3060 
_citation.page_last                 3072 
_citation.year                      2013 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23763993 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2013.05.024 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bonet, R.'      1 
primary 'Vakonakis, I.'  2 
primary 'Campbell, I.D.' 3 
# 
_cell.entry_id           4HKC 
_cell.length_a           89.030 
_cell.length_b           111.600 
_cell.length_c           72.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4HKC 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '14-3-3 protein zeta/delta'                       28188.545 1   ? ? ?                        ? 
2 polymer     syn 'alpha-4 integrin derived phosphorylated peptide' 3797.991  1   ? ? 'UNP residues 1003-1032' ? 
3 non-polymer syn GLYCEROL                                          92.094    1   ? ? ?                        ? 
4 water       nat water                                             18.015    121 ? ? ?                        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 '14-3-3 zeta protein, Protein kinase C inhibitor protein 1, KCIP-1'         
2 'CD49 antigen-like family member D, Integrin alpha-IV, VLA-4 subunit alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPLGSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKK
QQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGD
EAEAGEGGEN
;
;GPLGSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKK
QQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGD
EAEAGEGGEN
;
A ? 
2 'polypeptide(L)' no yes 'GFFKRQYK(SEP)ILQEENRRDSWSYINSKSNDD' GFFKRQYKSILQEENRRDSWSYINSKSNDD B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ASP n 
1 8   LYS n 
1 9   ASN n 
1 10  GLU n 
1 11  LEU n 
1 12  VAL n 
1 13  GLN n 
1 14  LYS n 
1 15  ALA n 
1 16  LYS n 
1 17  LEU n 
1 18  ALA n 
1 19  GLU n 
1 20  GLN n 
1 21  ALA n 
1 22  GLU n 
1 23  ARG n 
1 24  TYR n 
1 25  ASP n 
1 26  ASP n 
1 27  MET n 
1 28  ALA n 
1 29  ALA n 
1 30  CYS n 
1 31  MET n 
1 32  LYS n 
1 33  SER n 
1 34  VAL n 
1 35  THR n 
1 36  GLU n 
1 37  GLN n 
1 38  GLY n 
1 39  ALA n 
1 40  GLU n 
1 41  LEU n 
1 42  SER n 
1 43  ASN n 
1 44  GLU n 
1 45  GLU n 
1 46  ARG n 
1 47  ASN n 
1 48  LEU n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  ALA n 
1 53  TYR n 
1 54  LYS n 
1 55  ASN n 
1 56  VAL n 
1 57  VAL n 
1 58  GLY n 
1 59  ALA n 
1 60  ARG n 
1 61  ARG n 
1 62  SER n 
1 63  SER n 
1 64  TRP n 
1 65  ARG n 
1 66  VAL n 
1 67  VAL n 
1 68  SER n 
1 69  SER n 
1 70  ILE n 
1 71  GLU n 
1 72  GLN n 
1 73  LYS n 
1 74  THR n 
1 75  GLU n 
1 76  GLY n 
1 77  ALA n 
1 78  GLU n 
1 79  LYS n 
1 80  LYS n 
1 81  GLN n 
1 82  GLN n 
1 83  MET n 
1 84  ALA n 
1 85  ARG n 
1 86  GLU n 
1 87  TYR n 
1 88  ARG n 
1 89  GLU n 
1 90  LYS n 
1 91  ILE n 
1 92  GLU n 
1 93  THR n 
1 94  GLU n 
1 95  LEU n 
1 96  ARG n 
1 97  ASP n 
1 98  ILE n 
1 99  CYS n 
1 100 ASN n 
1 101 ASP n 
1 102 VAL n 
1 103 LEU n 
1 104 SER n 
1 105 LEU n 
1 106 LEU n 
1 107 GLU n 
1 108 LYS n 
1 109 PHE n 
1 110 LEU n 
1 111 ILE n 
1 112 PRO n 
1 113 ASN n 
1 114 ALA n 
1 115 SER n 
1 116 GLN n 
1 117 ALA n 
1 118 GLU n 
1 119 SER n 
1 120 LYS n 
1 121 VAL n 
1 122 PHE n 
1 123 TYR n 
1 124 LEU n 
1 125 LYS n 
1 126 MET n 
1 127 LYS n 
1 128 GLY n 
1 129 ASP n 
1 130 TYR n 
1 131 TYR n 
1 132 ARG n 
1 133 TYR n 
1 134 LEU n 
1 135 ALA n 
1 136 GLU n 
1 137 VAL n 
1 138 ALA n 
1 139 ALA n 
1 140 GLY n 
1 141 ASP n 
1 142 ASP n 
1 143 LYS n 
1 144 LYS n 
1 145 GLY n 
1 146 ILE n 
1 147 VAL n 
1 148 ASP n 
1 149 GLN n 
1 150 SER n 
1 151 GLN n 
1 152 GLN n 
1 153 ALA n 
1 154 TYR n 
1 155 GLN n 
1 156 GLU n 
1 157 ALA n 
1 158 PHE n 
1 159 GLU n 
1 160 ILE n 
1 161 SER n 
1 162 LYS n 
1 163 LYS n 
1 164 GLU n 
1 165 MET n 
1 166 GLN n 
1 167 PRO n 
1 168 THR n 
1 169 HIS n 
1 170 PRO n 
1 171 ILE n 
1 172 ARG n 
1 173 LEU n 
1 174 GLY n 
1 175 LEU n 
1 176 ALA n 
1 177 LEU n 
1 178 ASN n 
1 179 PHE n 
1 180 SER n 
1 181 VAL n 
1 182 PHE n 
1 183 TYR n 
1 184 TYR n 
1 185 GLU n 
1 186 ILE n 
1 187 LEU n 
1 188 ASN n 
1 189 SER n 
1 190 PRO n 
1 191 GLU n 
1 192 LYS n 
1 193 ALA n 
1 194 CYS n 
1 195 SER n 
1 196 LEU n 
1 197 ALA n 
1 198 LYS n 
1 199 THR n 
1 200 ALA n 
1 201 PHE n 
1 202 ASP n 
1 203 GLU n 
1 204 ALA n 
1 205 ILE n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
1 209 ASP n 
1 210 THR n 
1 211 LEU n 
1 212 SER n 
1 213 GLU n 
1 214 GLU n 
1 215 SER n 
1 216 TYR n 
1 217 LYS n 
1 218 ASP n 
1 219 SER n 
1 220 THR n 
1 221 LEU n 
1 222 ILE n 
1 223 MET n 
1 224 GLN n 
1 225 LEU n 
1 226 LEU n 
1 227 ARG n 
1 228 ASP n 
1 229 ASN n 
1 230 LEU n 
1 231 THR n 
1 232 LEU n 
1 233 TRP n 
1 234 THR n 
1 235 SER n 
1 236 ASP n 
1 237 THR n 
1 238 GLN n 
1 239 GLY n 
1 240 ASP n 
1 241 GLU n 
1 242 ALA n 
1 243 GLU n 
1 244 ALA n 
1 245 GLY n 
1 246 GLU n 
1 247 GLY n 
1 248 GLY n 
1 249 GLU n 
1 250 ASN n 
2 1   GLY n 
2 2   PHE n 
2 3   PHE n 
2 4   LYS n 
2 5   ARG n 
2 6   GLN n 
2 7   TYR n 
2 8   LYS n 
2 9   SEP n 
2 10  ILE n 
2 11  LEU n 
2 12  GLN n 
2 13  GLU n 
2 14  GLU n 
2 15  ASN n 
2 16  ARG n 
2 17  ARG n 
2 18  ASP n 
2 19  SER n 
2 20  TRP n 
2 21  SER n 
2 22  TYR n 
2 23  ILE n 
2 24  ASN n 
2 25  SER n 
2 26  LYS n 
2 27  SER n 
2 28  ASN n 
2 29  ASP n 
2 30  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 YWHAZ 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'N-terminal His-tag followed by a 3C protease cleavage site' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET16-b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'Chemically synthesized peptide corresponding to alpha-4 integrin tail' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP 1433Z_HUMAN P63104 1 
;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR
EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM
QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
;
1    ? 
2 UNP ITA4_HUMAN  P13612 2 GFFKRQYKSILQEENRRDSWSYINSKSNDD 1003 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4HKC A 6 ? 250 ? P63104 1    ? 245  ? 1    245  
2 2 4HKC B 1 ? 30  ? P13612 1003 ? 1032 ? 1003 1032 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4HKC GLY A 1 ? UNP P63104 ? ? 'EXPRESSION TAG' -4 1 
1 4HKC PRO A 2 ? UNP P63104 ? ? 'EXPRESSION TAG' -3 2 
1 4HKC LEU A 3 ? UNP P63104 ? ? 'EXPRESSION TAG' -2 3 
1 4HKC GLY A 4 ? UNP P63104 ? ? 'EXPRESSION TAG' -1 4 
1 4HKC SER A 5 ? UNP P63104 ? ? 'EXPRESSION TAG' 0  5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE                 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4HKC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.60 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '0.1M Na HEPES (pH 7.5), 25% PEG 2000 MME, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-01-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9163 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9163 
# 
_reflns.entry_id                     4HKC 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             44.50 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   18798 
_reflns.number_all                   18798 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.8 
_reflns.B_iso_Wilson_estimate        49.47 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.32 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.394 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.pdbx_redundancy             5.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           2725 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4HKC 
_refine.ls_number_reflns_obs                     18727 
_refine.ls_number_reflns_all                     18798 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.80 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.40 
_refine.ls_R_factor_obs                          0.1991 
_refine.ls_R_factor_all                          0.1991 
_refine.ls_R_factor_R_work                       0.1970 
_refine.ls_R_factor_R_free                       0.2390 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.15 
_refine.ls_number_reflns_R_free                  965 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9507 
_refine.correlation_coeff_Fo_to_Fc_free          0.9375 
_refine.B_iso_mean                               60.17 
_refine.aniso_B[1][1]                            0.4036 
_refine.aniso_B[2][2]                            0.2998 
_refine.aniso_B[3][3]                            -0.7034 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2O02 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.192 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4HKC 
_refine_analyze.Luzzati_coordinate_error_obs    0.357 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1895 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             121 
_refine_hist.number_atoms_total               2022 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        34.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  1925 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.02  ? 2.00  2589 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  710  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  61   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  268  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 1925 HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           3.06  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           17.20 ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  249  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  2414 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.33 
_refine_ls_shell.number_reflns_R_work             2827 
_refine_ls_shell.R_factor_R_work                  0.2274 
_refine_ls_shell.percent_reflns_obs               99.40 
_refine_ls_shell.R_factor_R_free                  0.2379 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.70 
_refine_ls_shell.number_reflns_R_free             171 
_refine_ls_shell.number_reflns_all                2998 
_refine_ls_shell.R_factor_all                     0.2280 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4HKC 
_struct.title                     '14-3-3-zeta in complex with S1011 phosphorylated integrin alpha-4 peptide' 
_struct.pdbx_descriptor           '14-3-3 protein zeta/delta, alpha-4 integrin derived phosphorylated peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HKC 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/PEPTIDE' 
_struct_keywords.text            
;14-3-3, all-helical protein, regulatory, alpha-4 integrin tail, phosphorylation, SIGNAL TRANSDUCTION, SIGNALING PROTEIN-PEPTIDE complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 7   ? ALA A 21  ? ASP A 2   ALA A 16  1 ? 15 
HELX_P HELX_P2  2  ARG A 23  ? GLN A 37  ? ARG A 18  GLN A 32  1 ? 15 
HELX_P HELX_P3  3  SER A 42  ? THR A 74  ? SER A 37  THR A 69  1 ? 33 
HELX_P HELX_P4  4  ALA A 77  ? PHE A 109 ? ALA A 72  PHE A 104 1 ? 33 
HELX_P HELX_P5  5  PHE A 109 ? ALA A 114 ? PHE A 104 ALA A 109 1 ? 6  
HELX_P HELX_P6  6  GLN A 116 ? VAL A 137 ? GLN A 111 VAL A 132 1 ? 22 
HELX_P HELX_P7  7  ALA A 139 ? MET A 165 ? ALA A 134 MET A 160 1 ? 27 
HELX_P HELX_P8  8  HIS A 169 ? ILE A 186 ? HIS A 164 ILE A 181 1 ? 18 
HELX_P HELX_P9  9  SER A 189 ? GLU A 207 ? SER A 184 GLU A 202 1 ? 19 
HELX_P HELX_P10 10 LEU A 208 ? LEU A 211 ? LEU A 203 LEU A 206 5 ? 4  
HELX_P HELX_P11 11 SER A 215 ? THR A 234 ? SER A 210 THR A 229 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B LYS 8 C ? ? ? 1_555 B SEP 9  N ? ? B LYS 1010 B SEP 1011 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale2 covale ? ? B SEP 9 C ? ? ? 1_555 B ILE 10 N ? ? B SEP 1011 B ILE 1012 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LEU A 208 ? LEU A 203 . ? 1_555 ? 
2 AC1 4 ASP A 209 ? ASP A 204 . ? 1_555 ? 
3 AC1 4 LEU A 211 ? LEU A 206 . ? 1_555 ? 
4 AC1 4 HOH D .   ? HOH A 501 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4HKC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4HKC 
_atom_sites.fract_transf_matrix[1][1]   0.011232 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008961 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013701 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 7   ? 37.751 23.880  -0.251 1.00 89.47  ? 2    ASP A N   1 
ATOM   2    C CA  . ASP A 1 7   ? 37.101 24.697  0.768  1.00 88.91  ? 2    ASP A CA  1 
ATOM   3    C C   . ASP A 1 7   ? 35.860 24.009  1.333  1.00 88.56  ? 2    ASP A C   1 
ATOM   4    O O   . ASP A 1 7   ? 35.287 23.128  0.680  1.00 85.60  ? 2    ASP A O   1 
ATOM   5    C CB  . ASP A 1 7   ? 36.834 26.144  0.281  1.00 92.33  ? 2    ASP A CB  1 
ATOM   6    C CG  . ASP A 1 7   ? 35.586 26.338  -0.560 1.00 105.94 ? 2    ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 7   ? 35.568 25.859  -1.713 1.00 108.01 ? 2    ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 7   ? 34.641 26.997  -0.075 1.00 111.81 ? 2    ASP A OD2 1 
ATOM   9    N N   . LYS A 1 8   ? 35.496 24.367  2.578  1.00 83.97  ? 3    LYS A N   1 
ATOM   10   C CA  . LYS A 1 8   ? 34.398 23.771  3.334  1.00 80.68  ? 3    LYS A CA  1 
ATOM   11   C C   . LYS A 1 8   ? 33.112 23.742  2.552  1.00 82.83  ? 3    LYS A C   1 
ATOM   12   O O   . LYS A 1 8   ? 32.477 22.682  2.499  1.00 82.36  ? 3    LYS A O   1 
ATOM   13   C CB  . LYS A 1 8   ? 34.200 24.493  4.665  1.00 82.66  ? 3    LYS A CB  1 
ATOM   14   C CG  . LYS A 1 8   ? 32.916 24.152  5.402  1.00 93.46  ? 3    LYS A CG  1 
ATOM   15   C CD  . LYS A 1 8   ? 32.858 24.884  6.719  1.00 104.87 ? 3    LYS A CD  1 
ATOM   16   C CE  . LYS A 1 8   ? 32.390 26.313  6.547  1.00 121.86 ? 3    LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 8   ? 31.052 26.380  5.895  1.00 133.18 ? 3    LYS A NZ  1 
ATOM   18   N N   . ASN A 1 9   ? 32.738 24.853  1.935  1.00 77.40  ? 4    ASN A N   1 
ATOM   19   C CA  . ASN A 1 9   ? 31.502 24.908  1.172  1.00 74.99  ? 4    ASN A CA  1 
ATOM   20   C C   . ASN A 1 9   ? 31.429 23.910  0.022  1.00 74.68  ? 4    ASN A C   1 
ATOM   21   O O   . ASN A 1 9   ? 30.361 23.391  -0.270 1.00 70.94  ? 4    ASN A O   1 
ATOM   22   C CB  . ASN A 1 9   ? 31.218 26.325  0.683  1.00 79.02  ? 4    ASN A CB  1 
ATOM   23   C CG  . ASN A 1 9   ? 30.686 27.220  1.783  1.00 117.97 ? 4    ASN A CG  1 
ATOM   24   O OD1 . ASN A 1 9   ? 30.725 26.865  2.958  1.00 115.94 ? 4    ASN A OD1 1 
ATOM   25   N ND2 . ASN A 1 9   ? 30.185 28.388  1.407  1.00 114.41 ? 4    ASN A ND2 1 
ATOM   26   N N   . GLU A 1 10  ? 32.556 23.635  -0.623 1.00 71.22  ? 5    GLU A N   1 
ATOM   27   C CA  . GLU A 1 10  ? 32.573 22.657  -1.705 1.00 69.89  ? 5    GLU A CA  1 
ATOM   28   C C   . GLU A 1 10  ? 32.368 21.243  -1.180 1.00 70.82  ? 5    GLU A C   1 
ATOM   29   O O   . GLU A 1 10  ? 31.660 20.453  -1.782 1.00 68.53  ? 5    GLU A O   1 
ATOM   30   C CB  . GLU A 1 10  ? 33.867 22.728  -2.512 1.00 73.70  ? 5    GLU A CB  1 
ATOM   31   C CG  . GLU A 1 10  ? 33.796 23.638  -3.723 1.00 87.98  ? 5    GLU A CG  1 
ATOM   32   C CD  . GLU A 1 10  ? 34.902 23.368  -4.723 1.00 117.57 ? 5    GLU A CD  1 
ATOM   33   O OE1 . GLU A 1 10  ? 35.529 24.340  -5.193 1.00 115.50 ? 5    GLU A OE1 1 
ATOM   34   O OE2 . GLU A 1 10  ? 35.146 22.187  -5.043 1.00 109.10 ? 5    GLU A OE2 1 
ATOM   35   N N   . LEU A 1 11  ? 32.997 20.924  -0.057 1.00 66.27  ? 6    LEU A N   1 
ATOM   36   C CA  . LEU A 1 11  ? 32.822 19.596  0.548  1.00 63.52  ? 6    LEU A CA  1 
ATOM   37   C C   . LEU A 1 11  ? 31.357 19.370  0.986  1.00 63.94  ? 6    LEU A C   1 
ATOM   38   O O   . LEU A 1 11  ? 30.818 18.272  0.797  1.00 62.11  ? 6    LEU A O   1 
ATOM   39   C CB  . LEU A 1 11  ? 33.790 19.384  1.720  1.00 64.05  ? 6    LEU A CB  1 
ATOM   40   C CG  . LEU A 1 11  ? 35.267 19.270  1.392  1.00 69.87  ? 6    LEU A CG  1 
ATOM   41   C CD1 . LEU A 1 11  ? 36.110 19.455  2.648  1.00 70.39  ? 6    LEU A CD1 1 
ATOM   42   C CD2 . LEU A 1 11  ? 35.566 17.945  0.708  1.00 70.85  ? 6    LEU A CD2 1 
ATOM   43   N N   . VAL A 1 12  ? 30.705 20.415  1.522  1.00 59.39  ? 7    VAL A N   1 
ATOM   44   C CA  . VAL A 1 12  ? 29.301 20.344  1.952  1.00 57.02  ? 7    VAL A CA  1 
ATOM   45   C C   . VAL A 1 12  ? 28.406 20.111  0.734  1.00 58.26  ? 7    VAL A C   1 
ATOM   46   O O   . VAL A 1 12  ? 27.497 19.290  0.789  1.00 56.58  ? 7    VAL A O   1 
ATOM   47   C CB  . VAL A 1 12  ? 28.916 21.612  2.738  1.00 61.27  ? 7    VAL A CB  1 
ATOM   48   C CG1 . VAL A 1 12  ? 27.424 21.651  3.020  1.00 59.37  ? 7    VAL A CG1 1 
ATOM   49   C CG2 . VAL A 1 12  ? 29.711 21.708  4.038  1.00 62.23  ? 7    VAL A CG2 1 
ATOM   50   N N   . GLN A 1 13  ? 28.662 20.818  -0.368 1.00 56.64  ? 8    GLN A N   1 
ATOM   51   C CA  . GLN A 1 13  ? 27.890 20.615  -1.591 1.00 55.36  ? 8    GLN A CA  1 
ATOM   52   C C   . GLN A 1 13  ? 28.097 19.198  -2.158 1.00 55.69  ? 8    GLN A C   1 
ATOM   53   O O   . GLN A 1 13  ? 27.154 18.582  -2.649 1.00 53.22  ? 8    GLN A O   1 
ATOM   54   C CB  . GLN A 1 13  ? 28.177 21.715  -2.615 1.00 58.22  ? 8    GLN A CB  1 
ATOM   55   C CG  . GLN A 1 13  ? 27.700 23.099  -2.138 1.00 71.45  ? 8    GLN A CG  1 
ATOM   56   C CD  . GLN A 1 13  ? 26.240 23.151  -1.701 1.00 87.01  ? 8    GLN A CD  1 
ATOM   57   O OE1 . GLN A 1 13  ? 25.307 22.854  -2.474 1.00 75.90  ? 8    GLN A OE1 1 
ATOM   58   N NE2 . GLN A 1 13  ? 26.012 23.559  -0.448 1.00 86.05  ? 8    GLN A NE2 1 
ATOM   59   N N   . LYS A 1 14  ? 29.316 18.681  -2.047 1.00 51.96  ? 9    LYS A N   1 
ATOM   60   C CA  . LYS A 1 14  ? 29.667 17.332  -2.451 1.00 50.82  ? 9    LYS A CA  1 
ATOM   61   C C   . LYS A 1 14  ? 28.916 16.313  -1.573 1.00 52.33  ? 9    LYS A C   1 
ATOM   62   O O   . LYS A 1 14  ? 28.430 15.306  -2.092 1.00 52.20  ? 9    LYS A O   1 
ATOM   63   C CB  . LYS A 1 14  ? 31.188 17.140  -2.374 1.00 55.36  ? 9    LYS A CB  1 
ATOM   64   N N   . ALA A 1 15  ? 28.768 16.606  -0.253 1.00 47.03  ? 10   ALA A N   1 
ATOM   65   C CA  . ALA A 1 15  ? 28.062 15.723  0.674  1.00 45.15  ? 10   ALA A CA  1 
ATOM   66   C C   . ALA A 1 15  ? 26.580 15.691  0.301  1.00 47.56  ? 10   ALA A C   1 
ATOM   67   O O   . ALA A 1 15  ? 25.980 14.614  0.326  1.00 45.34  ? 10   ALA A O   1 
ATOM   68   C CB  . ALA A 1 15  ? 28.236 16.192  2.108  1.00 46.05  ? 10   ALA A CB  1 
ATOM   69   N N   . LYS A 1 16  ? 26.008 16.841  -0.119 1.00 43.31  ? 11   LYS A N   1 
ATOM   70   C CA  . LYS A 1 16  ? 24.594 16.867  -0.518 1.00 43.00  ? 11   LYS A CA  1 
ATOM   71   C C   . LYS A 1 16  ? 24.379 16.065  -1.795 1.00 47.47  ? 11   LYS A C   1 
ATOM   72   O O   . LYS A 1 16  ? 23.363 15.402  -1.908 1.00 46.52  ? 11   LYS A O   1 
ATOM   73   C CB  . LYS A 1 16  ? 24.092 18.287  -0.717 1.00 44.52  ? 11   LYS A CB  1 
ATOM   74   C CG  . LYS A 1 16  ? 24.033 19.074  0.567  1.00 57.44  ? 11   LYS A CG  1 
ATOM   75   C CD  . LYS A 1 16  ? 23.602 20.489  0.209  1.00 64.30  ? 11   LYS A CD  1 
ATOM   76   C CE  . LYS A 1 16  ? 23.581 21.394  1.391  1.00 85.68  ? 11   LYS A CE  1 
ATOM   77   N NZ  . LYS A 1 16  ? 23.311 22.804  0.983  1.00 95.98  ? 11   LYS A NZ  1 
ATOM   78   N N   . LEU A 1 17  ? 25.315 16.133  -2.751 1.00 45.73  ? 12   LEU A N   1 
ATOM   79   C CA  . LEU A 1 17  ? 25.261 15.378  -3.993 1.00 45.98  ? 12   LEU A CA  1 
ATOM   80   C C   . LEU A 1 17  ? 25.353 13.874  -3.671 1.00 48.06  ? 12   LEU A C   1 
ATOM   81   O O   . LEU A 1 17  ? 24.545 13.081  -4.162 1.00 45.65  ? 12   LEU A O   1 
ATOM   82   C CB  . LEU A 1 17  ? 26.432 15.827  -4.872 1.00 48.13  ? 12   LEU A CB  1 
ATOM   83   C CG  . LEU A 1 17  ? 26.291 15.695  -6.382 1.00 53.70  ? 12   LEU A CG  1 
ATOM   84   C CD1 . LEU A 1 17  ? 25.035 16.428  -6.906 1.00 54.62  ? 12   LEU A CD1 1 
ATOM   85   C CD2 . LEU A 1 17  ? 27.531 16.208  -7.060 1.00 53.50  ? 12   LEU A CD2 1 
ATOM   86   N N   . ALA A 1 18  ? 26.323 13.498  -2.807 1.00 44.47  ? 13   ALA A N   1 
ATOM   87   C CA  . ALA A 1 18  ? 26.509 12.109  -2.398 1.00 43.07  ? 13   ALA A CA  1 
ATOM   88   C C   . ALA A 1 18  ? 25.231 11.581  -1.744 1.00 44.15  ? 13   ALA A C   1 
ATOM   89   O O   . ALA A 1 18  ? 24.838 10.454  -2.021 1.00 41.76  ? 13   ALA A O   1 
ATOM   90   C CB  . ALA A 1 18  ? 27.672 12.007  -1.428 1.00 44.07  ? 13   ALA A CB  1 
ATOM   91   N N   . GLU A 1 19  ? 24.582 12.384  -0.876 1.00 40.19  ? 14   GLU A N   1 
ATOM   92   C CA  . GLU A 1 19  ? 23.334 11.951  -0.233 1.00 38.45  ? 14   GLU A CA  1 
ATOM   93   C C   . GLU A 1 19  ? 22.280 11.622  -1.274 1.00 43.05  ? 14   GLU A C   1 
ATOM   94   O O   . GLU A 1 19  ? 21.620 10.596  -1.171 1.00 43.21  ? 14   GLU A O   1 
ATOM   95   C CB  . GLU A 1 19  ? 22.792 13.053  0.676  1.00 39.33  ? 14   GLU A CB  1 
ATOM   96   C CG  . GLU A 1 19  ? 21.524 12.643  1.416  1.00 39.80  ? 14   GLU A CG  1 
ATOM   97   C CD  . GLU A 1 19  ? 20.982 13.685  2.372  1.00 44.07  ? 14   GLU A CD  1 
ATOM   98   O OE1 . GLU A 1 19  ? 21.293 14.882  2.199  1.00 45.06  ? 14   GLU A OE1 1 
ATOM   99   O OE2 . GLU A 1 19  ? 20.173 13.316  3.246  1.00 43.86  ? 14   GLU A OE2 1 
ATOM   100  N N   . GLN A 1 20  ? 22.092 12.514  -2.258 1.00 40.71  ? 15   GLN A N   1 
ATOM   101  C CA  . GLN A 1 20  ? 21.122 12.311  -3.332 1.00 40.22  ? 15   GLN A CA  1 
ATOM   102  C C   . GLN A 1 20  ? 21.409 11.005  -4.098 1.00 44.84  ? 15   GLN A C   1 
ATOM   103  O O   . GLN A 1 20  ? 20.485 10.283  -4.449 1.00 43.75  ? 15   GLN A O   1 
ATOM   104  C CB  . GLN A 1 20  ? 21.129 13.511  -4.289 1.00 42.06  ? 15   GLN A CB  1 
ATOM   105  C CG  . GLN A 1 20  ? 20.372 14.733  -3.744 1.00 47.47  ? 15   GLN A CG  1 
ATOM   106  C CD  . GLN A 1 20  ? 18.973 14.353  -3.321 1.00 71.94  ? 15   GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 20  ? 18.157 13.894  -4.134 1.00 70.20  ? 15   GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 20  ? 18.692 14.455  -2.014 1.00 60.59  ? 15   GLN A NE2 1 
ATOM   109  N N   . ALA A 1 21  ? 22.687 10.703  -4.300 1.00 40.99  ? 16   ALA A N   1 
ATOM   110  C CA  . ALA A 1 21  ? 23.162 9.510   -5.002 1.00 40.49  ? 16   ALA A CA  1 
ATOM   111  C C   . ALA A 1 21  ? 23.134 8.240   -4.127 1.00 42.70  ? 16   ALA A C   1 
ATOM   112  O O   . ALA A 1 21  ? 23.496 7.169   -4.595 1.00 42.23  ? 16   ALA A O   1 
ATOM   113  C CB  . ALA A 1 21  ? 24.581 9.762   -5.499 1.00 41.62  ? 16   ALA A CB  1 
ATOM   114  N N   . GLU A 1 22  ? 22.806 8.396   -2.836 1.00 38.96  ? 17   GLU A N   1 
ATOM   115  C CA  . GLU A 1 22  ? 22.787 7.351   -1.828 1.00 38.43  ? 17   GLU A CA  1 
ATOM   116  C C   . GLU A 1 22  ? 24.151 6.714   -1.681 1.00 41.52  ? 17   GLU A C   1 
ATOM   117  O O   . GLU A 1 22  ? 24.290 5.489   -1.550 1.00 40.99  ? 17   GLU A O   1 
ATOM   118  C CB  . GLU A 1 22  ? 21.691 6.305   -2.106 1.00 38.92  ? 17   GLU A CB  1 
ATOM   119  C CG  . GLU A 1 22  ? 20.299 6.890   -2.011 1.00 50.74  ? 17   GLU A CG  1 
ATOM   120  C CD  . GLU A 1 22  ? 19.228 5.861   -2.296 1.00 51.75  ? 17   GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 22  ? 19.007 4.981   -1.438 1.00 61.21  ? 17   GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 22  ? 18.695 5.865   -3.422 1.00 54.67  ? 17   GLU A OE2 1 
ATOM   123  N N   . ARG A 1 23  ? 25.171 7.549   -1.706 1.00 39.42  ? 18   ARG A N   1 
ATOM   124  C CA  . ARG A 1 23  ? 26.561 7.102   -1.566 1.00 39.74  ? 18   ARG A CA  1 
ATOM   125  C C   . ARG A 1 23  ? 27.042 7.672   -0.238 1.00 45.27  ? 18   ARG A C   1 
ATOM   126  O O   . ARG A 1 23  ? 27.712 8.719   -0.176 1.00 45.03  ? 18   ARG A O   1 
ATOM   127  C CB  . ARG A 1 23  ? 27.413 7.566   -2.757 1.00 38.39  ? 18   ARG A CB  1 
ATOM   128  C CG  . ARG A 1 23  ? 27.075 6.812   -4.039 1.00 40.04  ? 18   ARG A CG  1 
ATOM   129  C CD  . ARG A 1 23  ? 27.762 7.429   -5.255 1.00 39.54  ? 18   ARG A CD  1 
ATOM   130  N NE  . ARG A 1 23  ? 29.220 7.446   -5.103 1.00 42.52  ? 18   ARG A NE  1 
ATOM   131  C CZ  . ARG A 1 23  ? 30.057 6.499   -5.525 1.00 51.10  ? 18   ARG A CZ  1 
ATOM   132  N NH1 . ARG A 1 23  ? 29.600 5.446   -6.197 1.00 35.10  ? 18   ARG A NH1 1 
ATOM   133  N NH2 . ARG A 1 23  ? 31.360 6.617   -5.313 1.00 42.13  ? 18   ARG A NH2 1 
ATOM   134  N N   . TYR A 1 24  ? 26.636 6.991   0.846  1.00 41.42  ? 19   TYR A N   1 
ATOM   135  C CA  . TYR A 1 24  ? 26.880 7.446   2.209  1.00 40.88  ? 19   TYR A CA  1 
ATOM   136  C C   . TYR A 1 24  ? 28.300 7.422   2.686  1.00 46.38  ? 19   TYR A C   1 
ATOM   137  O O   . TYR A 1 24  ? 28.637 8.236   3.535  1.00 48.72  ? 19   TYR A O   1 
ATOM   138  C CB  . TYR A 1 24  ? 25.915 6.807   3.190  1.00 40.66  ? 19   TYR A CB  1 
ATOM   139  C CG  . TYR A 1 24  ? 24.483 7.104   2.825  1.00 41.29  ? 19   TYR A CG  1 
ATOM   140  C CD1 . TYR A 1 24  ? 23.955 8.389   2.966  1.00 43.03  ? 19   TYR A CD1 1 
ATOM   141  C CD2 . TYR A 1 24  ? 23.669 6.121   2.275  1.00 42.29  ? 19   TYR A CD2 1 
ATOM   142  C CE1 . TYR A 1 24  ? 22.636 8.675   2.614  1.00 43.63  ? 19   TYR A CE1 1 
ATOM   143  C CE2 . TYR A 1 24  ? 22.341 6.393   1.924  1.00 42.30  ? 19   TYR A CE2 1 
ATOM   144  C CZ  . TYR A 1 24  ? 21.833 7.673   2.092  1.00 48.62  ? 19   TYR A CZ  1 
ATOM   145  O OH  . TYR A 1 24  ? 20.525 7.933   1.759  1.00 52.99  ? 19   TYR A OH  1 
ATOM   146  N N   . ASP A 1 25  ? 29.156 6.539   2.149  1.00 43.03  ? 20   ASP A N   1 
ATOM   147  C CA  . ASP A 1 25  ? 30.572 6.559   2.537  1.00 44.01  ? 20   ASP A CA  1 
ATOM   148  C C   . ASP A 1 25  ? 31.179 7.845   1.983  1.00 48.78  ? 20   ASP A C   1 
ATOM   149  O O   . ASP A 1 25  ? 31.903 8.517   2.706  1.00 50.55  ? 20   ASP A O   1 
ATOM   150  C CB  . ASP A 1 25  ? 31.339 5.371   1.988  1.00 46.07  ? 20   ASP A CB  1 
ATOM   151  C CG  . ASP A 1 25  ? 30.939 4.035   2.554  1.00 57.33  ? 20   ASP A CG  1 
ATOM   152  O OD1 . ASP A 1 25  ? 30.670 3.956   3.760  1.00 58.19  ? 20   ASP A OD1 1 
ATOM   153  O OD2 . ASP A 1 25  ? 31.040 3.052   1.832  1.00 68.73  ? 20   ASP A OD2 1 
ATOM   154  N N   . ASP A 1 26  ? 30.847 8.231   0.730  1.00 44.88  ? 21   ASP A N   1 
ATOM   155  C CA  . ASP A 1 26  ? 31.339 9.510   0.168  1.00 46.52  ? 21   ASP A CA  1 
ATOM   156  C C   . ASP A 1 26  ? 30.805 10.667  1.004  1.00 48.91  ? 21   ASP A C   1 
ATOM   157  O O   . ASP A 1 26  ? 31.549 11.574  1.329  1.00 49.91  ? 21   ASP A O   1 
ATOM   158  C CB  . ASP A 1 26  ? 30.865 9.719   -1.286 1.00 48.16  ? 21   ASP A CB  1 
ATOM   159  C CG  . ASP A 1 26  ? 31.575 8.884   -2.314 1.00 55.00  ? 21   ASP A CG  1 
ATOM   160  O OD1 . ASP A 1 26  ? 32.553 8.190   -1.949 1.00 58.09  ? 21   ASP A OD1 1 
ATOM   161  O OD2 . ASP A 1 26  ? 31.206 8.970   -3.487 1.00 56.69  ? 21   ASP A OD2 1 
ATOM   162  N N   . MET A 1 27  ? 29.536 10.612  1.395  1.00 41.75  ? 22   MET A N   1 
ATOM   163  C CA  . MET A 1 27  ? 28.929 11.667  2.199  1.00 40.73  ? 22   MET A CA  1 
ATOM   164  C C   . MET A 1 27  ? 29.631 11.833  3.529  1.00 48.61  ? 22   MET A C   1 
ATOM   165  O O   . MET A 1 27  ? 29.965 12.955  3.931  1.00 50.53  ? 22   MET A O   1 
ATOM   166  C CB  . MET A 1 27  ? 27.461 11.337  2.426  1.00 40.04  ? 22   MET A CB  1 
ATOM   167  C CG  . MET A 1 27  ? 26.667 12.500  2.903  1.00 40.67  ? 22   MET A CG  1 
ATOM   168  S SD  . MET A 1 27  ? 25.012 11.954  3.383  1.00 41.65  ? 22   MET A SD  1 
ATOM   169  C CE  . MET A 1 27  ? 24.385 13.501  4.036  1.00 39.84  ? 22   MET A CE  1 
ATOM   170  N N   . ALA A 1 28  ? 29.880 10.710  4.192  1.00 45.00  ? 23   ALA A N   1 
ATOM   171  C CA  . ALA A 1 28  ? 30.583 10.693  5.473  1.00 46.50  ? 23   ALA A CA  1 
ATOM   172  C C   . ALA A 1 28  ? 31.993 11.237  5.339  1.00 51.11  ? 23   ALA A C   1 
ATOM   173  O O   . ALA A 1 28  ? 32.398 12.019  6.199  1.00 52.17  ? 23   ALA A O   1 
ATOM   174  C CB  . ALA A 1 28  ? 30.609 9.279   6.061  1.00 46.09  ? 23   ALA A CB  1 
ATOM   175  N N   . ALA A 1 29  ? 32.745 10.833  4.276  1.00 48.02  ? 24   ALA A N   1 
ATOM   176  C CA  . ALA A 1 29  ? 34.131 11.302  4.064  1.00 49.60  ? 24   ALA A CA  1 
ATOM   177  C C   . ALA A 1 29  ? 34.130 12.792  3.889  1.00 57.98  ? 24   ALA A C   1 
ATOM   178  O O   . ALA A 1 29  ? 34.963 13.461  4.490  1.00 62.12  ? 24   ALA A O   1 
ATOM   179  C CB  . ALA A 1 29  ? 34.754 10.637  2.859  1.00 50.28  ? 24   ALA A CB  1 
ATOM   180  N N   . CYS A 1 30  ? 33.162 13.345  3.128  1.00 54.10  ? 25   CYS A N   1 
ATOM   181  C CA  . CYS A 1 30  ? 33.076 14.801  2.956  1.00 53.63  ? 25   CYS A CA  1 
ATOM   182  C C   . CYS A 1 30  ? 32.867 15.489  4.282  1.00 55.34  ? 25   CYS A C   1 
ATOM   183  O O   . CYS A 1 30  ? 33.538 16.469  4.578  1.00 56.08  ? 25   CYS A O   1 
ATOM   184  C CB  . CYS A 1 30  ? 31.973 15.172  1.974  1.00 52.84  ? 25   CYS A CB  1 
ATOM   185  S SG  . CYS A 1 30  ? 32.361 14.724  0.275  1.00 57.51  ? 25   CYS A SG  1 
ATOM   186  N N   . MET A 1 31  ? 31.894 15.013  5.058  1.00 49.60  ? 26   MET A N   1 
ATOM   187  C CA  . MET A 1 31  ? 31.549 15.635  6.331  1.00 48.23  ? 26   MET A CA  1 
ATOM   188  C C   . MET A 1 31  ? 32.612 15.470  7.387  1.00 53.59  ? 26   MET A C   1 
ATOM   189  O O   . MET A 1 31  ? 32.797 16.374  8.190  1.00 53.10  ? 26   MET A O   1 
ATOM   190  C CB  . MET A 1 31  ? 30.150 15.220  6.782  1.00 47.44  ? 26   MET A CB  1 
ATOM   191  C CG  . MET A 1 31  ? 29.049 15.706  5.833  1.00 48.31  ? 26   MET A CG  1 
ATOM   192  S SD  . MET A 1 31  ? 29.201 17.439  5.267  1.00 51.99  ? 26   MET A SD  1 
ATOM   193  C CE  . MET A 1 31  ? 29.246 18.340  6.850  1.00 49.69  ? 26   MET A CE  1 
ATOM   194  N N   . LYS A 1 32  ? 33.331 14.337  7.379  1.00 50.48  ? 27   LYS A N   1 
ATOM   195  C CA  . LYS A 1 32  ? 34.455 14.145  8.283  1.00 52.49  ? 27   LYS A CA  1 
ATOM   196  C C   . LYS A 1 32  ? 35.567 15.163  7.903  1.00 60.98  ? 27   LYS A C   1 
ATOM   197  O O   . LYS A 1 32  ? 36.133 15.785  8.805  1.00 63.59  ? 27   LYS A O   1 
ATOM   198  C CB  . LYS A 1 32  ? 34.967 12.699  8.204  1.00 54.98  ? 27   LYS A CB  1 
ATOM   199  C CG  . LYS A 1 32  ? 36.226 12.479  9.019  1.00 61.43  ? 27   LYS A CG  1 
ATOM   200  C CD  . LYS A 1 32  ? 36.656 11.060  8.953  1.00 66.09  ? 27   LYS A CD  1 
ATOM   201  C CE  . LYS A 1 32  ? 37.895 10.910  9.773  1.00 71.38  ? 27   LYS A CE  1 
ATOM   202  N NZ  . LYS A 1 32  ? 38.265 9.507   9.831  1.00 65.47  ? 27   LYS A NZ  1 
ATOM   203  N N   . SER A 1 33  ? 35.847 15.368  6.583  1.00 57.98  ? 28   SER A N   1 
ATOM   204  C CA  . SER A 1 33  ? 36.857 16.355  6.134  1.00 59.97  ? 28   SER A CA  1 
ATOM   205  C C   . SER A 1 33  ? 36.463 17.746  6.582  1.00 64.79  ? 28   SER A C   1 
ATOM   206  O O   . SER A 1 33  ? 37.319 18.490  7.033  1.00 66.08  ? 28   SER A O   1 
ATOM   207  C CB  . SER A 1 33  ? 37.042 16.335  4.621  1.00 63.18  ? 28   SER A CB  1 
ATOM   208  O OG  . SER A 1 33  ? 37.440 15.055  4.163  1.00 73.54  ? 28   SER A OG  1 
ATOM   209  N N   . VAL A 1 34  ? 35.169 18.089  6.513  1.00 60.68  ? 29   VAL A N   1 
ATOM   210  C CA  . VAL A 1 34  ? 34.686 19.384  6.976  1.00 61.04  ? 29   VAL A CA  1 
ATOM   211  C C   . VAL A 1 34  ? 34.941 19.522  8.486  1.00 67.20  ? 29   VAL A C   1 
ATOM   212  O O   . VAL A 1 34  ? 35.502 20.524  8.919  1.00 68.28  ? 29   VAL A O   1 
ATOM   213  C CB  . VAL A 1 34  ? 33.200 19.562  6.609  1.00 62.04  ? 29   VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 34  ? 32.589 20.777  7.295  1.00 61.54  ? 29   VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 34  ? 33.037 19.679  5.104  1.00 61.45  ? 29   VAL A CG2 1 
ATOM   216  N N   . THR A 1 35  ? 34.545 18.505  9.272  1.00 63.00  ? 30   THR A N   1 
ATOM   217  C CA  . THR A 1 35  ? 34.724 18.519  10.725 1.00 63.13  ? 30   THR A CA  1 
ATOM   218  C C   . THR A 1 35  ? 36.194 18.689  11.106 1.00 68.44  ? 30   THR A C   1 
ATOM   219  O O   . THR A 1 35  ? 36.486 19.481  12.005 1.00 68.68  ? 30   THR A O   1 
ATOM   220  C CB  . THR A 1 35  ? 34.130 17.255  11.336 1.00 62.20  ? 30   THR A CB  1 
ATOM   221  O OG1 . THR A 1 35  ? 32.746 17.177  10.961 1.00 56.56  ? 30   THR A OG1 1 
ATOM   222  C CG2 . THR A 1 35  ? 34.280 17.215  12.851 1.00 57.06  ? 30   THR A CG2 1 
ATOM   223  N N   . GLU A 1 36  ? 37.105 17.987  10.392 1.00 65.41  ? 31   GLU A N   1 
ATOM   224  C CA  . GLU A 1 36  ? 38.552 18.028  10.634 1.00 68.82  ? 31   GLU A CA  1 
ATOM   225  C C   . GLU A 1 36  ? 39.201 19.380  10.407 1.00 77.91  ? 31   GLU A C   1 
ATOM   226  O O   . GLU A 1 36  ? 40.302 19.608  10.900 1.00 81.36  ? 31   GLU A O   1 
ATOM   227  C CB  . GLU A 1 36  ? 39.263 16.944  9.864  1.00 70.14  ? 31   GLU A CB  1 
ATOM   228  C CG  . GLU A 1 36  ? 38.925 15.602  10.454 1.00 74.81  ? 31   GLU A CG  1 
ATOM   229  C CD  . GLU A 1 36  ? 39.473 14.420  9.698  1.00 84.78  ? 31   GLU A CD  1 
ATOM   230  O OE1 . GLU A 1 36  ? 39.676 14.526  8.467  1.00 75.80  ? 31   GLU A OE1 1 
ATOM   231  O OE2 . GLU A 1 36  ? 39.680 13.370  10.343 1.00 79.49  ? 31   GLU A OE2 1 
ATOM   232  N N   . GLN A 1 37  ? 38.521 20.289  9.696  1.00 74.84  ? 32   GLN A N   1 
ATOM   233  C CA  . GLN A 1 37  ? 39.005 21.658  9.513  1.00 77.44  ? 32   GLN A CA  1 
ATOM   234  C C   . GLN A 1 37  ? 39.004 22.403  10.861 1.00 83.86  ? 32   GLN A C   1 
ATOM   235  O O   . GLN A 1 37  ? 39.701 23.407  11.007 1.00 85.23  ? 32   GLN A O   1 
ATOM   236  C CB  . GLN A 1 37  ? 38.183 22.409  8.463  1.00 77.28  ? 32   GLN A CB  1 
ATOM   237  C CG  . GLN A 1 37  ? 38.381 21.847  7.064  1.00 79.57  ? 32   GLN A CG  1 
ATOM   238  C CD  . GLN A 1 37  ? 37.750 22.697  6.003  1.00 97.52  ? 32   GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 37  ? 37.225 23.794  6.259  1.00 94.86  ? 32   GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 37  ? 37.819 22.216  4.770  1.00 89.14  ? 32   GLN A NE2 1 
ATOM   241  N N   . GLY A 1 38  ? 38.245 21.886  11.832 1.00 79.42  ? 33   GLY A N   1 
ATOM   242  C CA  . GLY A 1 38  ? 38.244 22.397  13.193 1.00 80.24  ? 33   GLY A CA  1 
ATOM   243  C C   . GLY A 1 38  ? 37.264 23.492  13.528 1.00 82.12  ? 33   GLY A C   1 
ATOM   244  O O   . GLY A 1 38  ? 37.121 23.807  14.703 1.00 83.65  ? 33   GLY A O   1 
ATOM   245  N N   . ALA A 1 39  ? 36.568 24.072  12.540 1.00 74.90  ? 34   ALA A N   1 
ATOM   246  C CA  . ALA A 1 39  ? 35.586 25.121  12.802 1.00 73.34  ? 34   ALA A CA  1 
ATOM   247  C C   . ALA A 1 39  ? 34.224 24.546  13.159 1.00 74.80  ? 34   ALA A C   1 
ATOM   248  O O   . ALA A 1 39  ? 33.781 23.564  12.562 1.00 72.83  ? 34   ALA A O   1 
ATOM   249  C CB  . ALA A 1 39  ? 35.466 26.046  11.607 1.00 73.79  ? 34   ALA A CB  1 
ATOM   250  N N   . GLU A 1 40  ? 33.556 25.176  14.112 1.00 71.75  ? 35   GLU A N   1 
ATOM   251  C CA  . GLU A 1 40  ? 32.233 24.789  14.580 1.00 69.80  ? 35   GLU A CA  1 
ATOM   252  C C   . GLU A 1 40  ? 31.256 24.617  13.389 1.00 70.32  ? 35   GLU A C   1 
ATOM   253  O O   . GLU A 1 40  ? 31.242 25.442  12.482 1.00 70.92  ? 35   GLU A O   1 
ATOM   254  C CB  . GLU A 1 40  ? 31.764 25.865  15.536 1.00 71.96  ? 35   GLU A CB  1 
ATOM   255  C CG  . GLU A 1 40  ? 30.491 25.552  16.257 1.00 79.80  ? 35   GLU A CG  1 
ATOM   256  C CD  . GLU A 1 40  ? 30.286 26.389  17.500 1.00 105.29 ? 35   GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 40  ? 30.943 27.445  17.671 1.00 104.11 ? 35   GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 40  ? 29.400 26.000  18.288 1.00 106.36 ? 35   GLU A OE2 1 
ATOM   259  N N   . LEU A 1 41  ? 30.511 23.508  13.353 1.00 62.32  ? 36   LEU A N   1 
ATOM   260  C CA  . LEU A 1 41  ? 29.614 23.220  12.241 1.00 57.75  ? 36   LEU A CA  1 
ATOM   261  C C   . LEU A 1 41  ? 28.330 24.026  12.321 1.00 61.34  ? 36   LEU A C   1 
ATOM   262  O O   . LEU A 1 41  ? 27.799 24.219  13.408 1.00 61.93  ? 36   LEU A O   1 
ATOM   263  C CB  . LEU A 1 41  ? 29.261 21.697  12.164 1.00 54.79  ? 36   LEU A CB  1 
ATOM   264  C CG  . LEU A 1 41  ? 30.383 20.658  12.005 1.00 57.89  ? 36   LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 41  ? 29.802 19.274  11.803 1.00 54.68  ? 36   LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 41  ? 31.265 20.967  10.826 1.00 60.46  ? 36   LEU A CD2 1 
ATOM   267  N N   . SER A 1 42  ? 27.753 24.375  11.165 1.00 56.66  ? 37   SER A N   1 
ATOM   268  C CA  . SER A 1 42  ? 26.443 25.009  11.095 1.00 56.16  ? 37   SER A CA  1 
ATOM   269  C C   . SER A 1 42  ? 25.411 23.904  11.345 1.00 59.06  ? 37   SER A C   1 
ATOM   270  O O   . SER A 1 42  ? 25.756 22.719  11.292 1.00 58.30  ? 37   SER A O   1 
ATOM   271  C CB  . SER A 1 42  ? 26.207 25.592  9.705  1.00 60.82  ? 37   SER A CB  1 
ATOM   272  O OG  . SER A 1 42  ? 26.079 24.554  8.744  1.00 69.80  ? 37   SER A OG  1 
ATOM   273  N N   . ASN A 1 43  ? 24.147 24.277  11.551 1.00 54.17  ? 38   ASN A N   1 
ATOM   274  C CA  . ASN A 1 43  ? 23.066 23.332  11.789 1.00 53.01  ? 38   ASN A CA  1 
ATOM   275  C C   . ASN A 1 43  ? 22.940 22.361  10.604 1.00 58.14  ? 38   ASN A C   1 
ATOM   276  O O   . ASN A 1 43  ? 22.775 21.146  10.783 1.00 57.69  ? 38   ASN A O   1 
ATOM   277  C CB  . ASN A 1 43  ? 21.763 24.080  12.049 1.00 53.76  ? 38   ASN A CB  1 
ATOM   278  C CG  . ASN A 1 43  ? 21.878 25.088  13.179 1.00 102.01 ? 38   ASN A CG  1 
ATOM   279  O OD1 . ASN A 1 43  ? 21.862 24.740  14.369 1.00 97.63  ? 38   ASN A OD1 1 
ATOM   280  N ND2 . ASN A 1 43  ? 22.059 26.363  12.831 1.00 102.66 ? 38   ASN A ND2 1 
ATOM   281  N N   . GLU A 1 44  ? 23.042 22.908  9.399  1.00 54.20  ? 39   GLU A N   1 
ATOM   282  C CA  . GLU A 1 44  ? 22.948 22.138  8.176  1.00 52.61  ? 39   GLU A CA  1 
ATOM   283  C C   . GLU A 1 44  ? 24.082 21.125  8.106  1.00 52.51  ? 39   GLU A C   1 
ATOM   284  O O   . GLU A 1 44  ? 23.813 19.969  7.807  1.00 50.30  ? 39   GLU A O   1 
ATOM   285  C CB  . GLU A 1 44  ? 22.990 23.077  6.971  1.00 54.89  ? 39   GLU A CB  1 
ATOM   286  C CG  . GLU A 1 44  ? 23.008 22.327  5.661  1.00 68.45  ? 39   GLU A CG  1 
ATOM   287  C CD  . GLU A 1 44  ? 23.154 23.230  4.458  1.00 89.75  ? 39   GLU A CD  1 
ATOM   288  O OE1 . GLU A 1 44  ? 24.071 24.084  4.455  1.00 87.15  ? 39   GLU A OE1 1 
ATOM   289  O OE2 . GLU A 1 44  ? 22.343 23.082  3.518  1.00 76.21  ? 39   GLU A OE2 1 
ATOM   290  N N   . GLU A 1 45  ? 25.338 21.552  8.365  1.00 49.11  ? 40   GLU A N   1 
ATOM   291  C CA  . GLU A 1 45  ? 26.523 20.686  8.316  1.00 48.29  ? 40   GLU A CA  1 
ATOM   292  C C   . GLU A 1 45  ? 26.435 19.595  9.358  1.00 51.74  ? 40   GLU A C   1 
ATOM   293  O O   . GLU A 1 45  ? 26.793 18.445  9.092  1.00 50.85  ? 40   GLU A O   1 
ATOM   294  C CB  . GLU A 1 45  ? 27.803 21.510  8.525  1.00 50.81  ? 40   GLU A CB  1 
ATOM   295  C CG  . GLU A 1 45  ? 28.112 22.418  7.356  1.00 59.25  ? 40   GLU A CG  1 
ATOM   296  C CD  . GLU A 1 45  ? 29.017 23.592  7.684  1.00 78.93  ? 40   GLU A CD  1 
ATOM   297  O OE1 . GLU A 1 45  ? 29.408 23.762  8.863  1.00 55.89  ? 40   GLU A OE1 1 
ATOM   298  O OE2 . GLU A 1 45  ? 29.384 24.315  6.731  1.00 76.04  ? 40   GLU A OE2 1 
ATOM   299  N N   . ARG A 1 46  ? 25.955 19.956  10.540 1.00 48.28  ? 41   ARG A N   1 
ATOM   300  C CA  . ARG A 1 46  ? 25.799 19.029  11.653 1.00 48.83  ? 41   ARG A CA  1 
ATOM   301  C C   . ARG A 1 46  ? 24.816 17.929  11.214 1.00 53.44  ? 41   ARG A C   1 
ATOM   302  O O   . ARG A 1 46  ? 25.125 16.744  11.358 1.00 52.71  ? 41   ARG A O   1 
ATOM   303  C CB  . ARG A 1 46  ? 25.219 19.811  12.815 1.00 48.23  ? 41   ARG A CB  1 
ATOM   304  C CG  . ARG A 1 46  ? 25.421 19.299  14.186 1.00 55.28  ? 41   ARG A CG  1 
ATOM   305  C CD  . ARG A 1 46  ? 24.553 20.141  15.120 1.00 59.18  ? 41   ARG A CD  1 
ATOM   306  N NE  . ARG A 1 46  ? 23.184 20.234  14.586 1.00 79.86  ? 41   ARG A NE  1 
ATOM   307  C CZ  . ARG A 1 46  ? 22.201 20.991  15.064 1.00 86.57  ? 41   ARG A CZ  1 
ATOM   308  N NH1 . ARG A 1 46  ? 22.413 21.791  16.097 1.00 60.89  ? 41   ARG A NH1 1 
ATOM   309  N NH2 . ARG A 1 46  ? 21.001 20.964  14.497 1.00 79.25  ? 41   ARG A NH2 1 
ATOM   310  N N   . ASN A 1 47  ? 23.664 18.314  10.617 1.00 48.10  ? 42   ASN A N   1 
ATOM   311  C CA  . ASN A 1 47  ? 22.654 17.369  10.145 1.00 45.79  ? 42   ASN A CA  1 
ATOM   312  C C   . ASN A 1 47  ? 23.200 16.454  9.052  1.00 45.87  ? 42   ASN A C   1 
ATOM   313  O O   . ASN A 1 47  ? 22.944 15.265  9.102  1.00 44.35  ? 42   ASN A O   1 
ATOM   314  C CB  . ASN A 1 47  ? 21.399 18.092  9.684  1.00 48.37  ? 42   ASN A CB  1 
ATOM   315  C CG  . ASN A 1 47  ? 20.630 18.753  10.806 1.00 84.63  ? 42   ASN A CG  1 
ATOM   316  O OD1 . ASN A 1 47  ? 20.933 18.590  12.001 1.00 78.46  ? 42   ASN A OD1 1 
ATOM   317  N ND2 . ASN A 1 47  ? 19.596 19.509  10.446 1.00 78.59  ? 42   ASN A ND2 1 
ATOM   318  N N   . LEU A 1 48  ? 24.004 16.980  8.121  1.00 41.45  ? 43   LEU A N   1 
ATOM   319  C CA  . LEU A 1 48  ? 24.611 16.181  7.057  1.00 40.05  ? 43   LEU A CA  1 
ATOM   320  C C   . LEU A 1 48  ? 25.572 15.122  7.608  1.00 44.14  ? 43   LEU A C   1 
ATOM   321  O O   . LEU A 1 48  ? 25.571 14.005  7.128  1.00 42.68  ? 43   LEU A O   1 
ATOM   322  C CB  . LEU A 1 48  ? 25.355 17.083  6.055  1.00 40.45  ? 43   LEU A CB  1 
ATOM   323  C CG  . LEU A 1 48  ? 24.439 17.923  5.143  1.00 45.60  ? 43   LEU A CG  1 
ATOM   324  C CD1 . LEU A 1 48  ? 25.202 19.038  4.440  1.00 47.28  ? 43   LEU A CD1 1 
ATOM   325  C CD2 . LEU A 1 48  ? 23.743 17.072  4.091  1.00 46.80  ? 43   LEU A CD2 1 
ATOM   326  N N   . LEU A 1 49  ? 26.440 15.499  8.569  1.00 43.25  ? 44   LEU A N   1 
ATOM   327  C CA  . LEU A 1 49  ? 27.399 14.589  9.180  1.00 44.04  ? 44   LEU A CA  1 
ATOM   328  C C   . LEU A 1 49  ? 26.619 13.453  9.840  1.00 45.44  ? 44   LEU A C   1 
ATOM   329  O O   . LEU A 1 49  ? 26.954 12.287  9.655  1.00 43.15  ? 44   LEU A O   1 
ATOM   330  C CB  . LEU A 1 49  ? 28.246 15.327  10.234 1.00 45.44  ? 44   LEU A CB  1 
ATOM   331  C CG  . LEU A 1 49  ? 29.215 14.474  11.063 1.00 50.72  ? 44   LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 49  ? 30.348 13.951  10.216 1.00 49.71  ? 44   LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 49  ? 29.794 15.310  12.211 1.00 55.31  ? 44   LEU A CD2 1 
ATOM   334  N N   . SER A 1 50  ? 25.564 13.809  10.581 1.00 41.53  ? 45   SER A N   1 
ATOM   335  C CA  . SER A 1 50  ? 24.709 12.883  11.301 1.00 41.36  ? 45   SER A CA  1 
ATOM   336  C C   . SER A 1 50  ? 23.985 11.887  10.370 1.00 46.06  ? 45   SER A C   1 
ATOM   337  O O   . SER A 1 50  ? 24.014 10.689  10.634 1.00 47.33  ? 45   SER A O   1 
ATOM   338  C CB  . SER A 1 50  ? 23.745 13.663  12.182 1.00 43.96  ? 45   SER A CB  1 
ATOM   339  O OG  . SER A 1 50  ? 23.047 12.785  13.036 1.00 56.36  ? 45   SER A OG  1 
ATOM   340  N N   . VAL A 1 51  ? 23.374 12.375  9.272  1.00 41.81  ? 46   VAL A N   1 
ATOM   341  C CA  . VAL A 1 51  ? 22.694 11.537  8.270  1.00 39.88  ? 46   VAL A CA  1 
ATOM   342  C C   . VAL A 1 51  ? 23.712 10.556  7.628  1.00 41.75  ? 46   VAL A C   1 
ATOM   343  O O   . VAL A 1 51  ? 23.415 9.374   7.477  1.00 41.76  ? 46   VAL A O   1 
ATOM   344  C CB  . VAL A 1 51  ? 21.988 12.417  7.188  1.00 43.28  ? 46   VAL A CB  1 
ATOM   345  C CG1 . VAL A 1 51  ? 21.541 11.578  5.979  1.00 42.10  ? 46   VAL A CG1 1 
ATOM   346  C CG2 . VAL A 1 51  ? 20.790 13.181  7.772  1.00 42.21  ? 46   VAL A CG2 1 
ATOM   347  N N   . ALA A 1 52  ? 24.901 11.064  7.247  1.00 37.01  ? 47   ALA A N   1 
ATOM   348  C CA  . ALA A 1 52  ? 25.926 10.229  6.607  1.00 36.89  ? 47   ALA A CA  1 
ATOM   349  C C   . ALA A 1 52  ? 26.296 9.074   7.529  1.00 42.20  ? 47   ALA A C   1 
ATOM   350  O O   . ALA A 1 52  ? 26.209 7.919   7.137  1.00 42.06  ? 47   ALA A O   1 
ATOM   351  C CB  . ALA A 1 52  ? 27.162 11.053  6.302  1.00 38.45  ? 47   ALA A CB  1 
ATOM   352  N N   . TYR A 1 53  ? 26.676 9.386   8.780  1.00 40.25  ? 48   TYR A N   1 
ATOM   353  C CA  . TYR A 1 53  ? 27.103 8.339   9.692  1.00 40.40  ? 48   TYR A CA  1 
ATOM   354  C C   . TYR A 1 53  ? 26.005 7.404   10.117 1.00 42.48  ? 48   TYR A C   1 
ATOM   355  O O   . TYR A 1 53  ? 26.243 6.214   10.238 1.00 43.21  ? 48   TYR A O   1 
ATOM   356  C CB  . TYR A 1 53  ? 27.941 8.887   10.845 1.00 42.73  ? 48   TYR A CB  1 
ATOM   357  C CG  . TYR A 1 53  ? 29.396 9.038   10.455 1.00 47.69  ? 48   TYR A CG  1 
ATOM   358  C CD1 . TYR A 1 53  ? 30.250 7.929   10.410 1.00 50.04  ? 48   TYR A CD1 1 
ATOM   359  C CD2 . TYR A 1 53  ? 29.916 10.278  10.098 1.00 48.95  ? 48   TYR A CD2 1 
ATOM   360  C CE1 . TYR A 1 53  ? 31.587 8.061   10.033 1.00 52.51  ? 48   TYR A CE1 1 
ATOM   361  C CE2 . TYR A 1 53  ? 31.259 10.423  9.748  1.00 51.28  ? 48   TYR A CE2 1 
ATOM   362  C CZ  . TYR A 1 53  ? 32.090 9.315   9.713  1.00 58.09  ? 48   TYR A CZ  1 
ATOM   363  O OH  . TYR A 1 53  ? 33.408 9.469   9.328  1.00 59.90  ? 48   TYR A OH  1 
ATOM   364  N N   . LYS A 1 54  ? 24.801 7.921   10.273 1.00 37.25  ? 49   LYS A N   1 
ATOM   365  C CA  . LYS A 1 54  ? 23.670 7.093   10.611 1.00 35.71  ? 49   LYS A CA  1 
ATOM   366  C C   . LYS A 1 54  ? 23.480 6.011   9.552  1.00 39.78  ? 49   LYS A C   1 
ATOM   367  O O   . LYS A 1 54  ? 23.162 4.883   9.885  1.00 39.49  ? 49   LYS A O   1 
ATOM   368  C CB  . LYS A 1 54  ? 22.420 7.957   10.732 1.00 39.25  ? 49   LYS A CB  1 
ATOM   369  C CG  . LYS A 1 54  ? 21.146 7.208   10.982 1.00 42.34  ? 49   LYS A CG  1 
ATOM   370  C CD  . LYS A 1 54  ? 21.035 6.794   12.424 1.00 64.91  ? 49   LYS A CD  1 
ATOM   371  C CE  . LYS A 1 54  ? 19.693 6.158   12.697 1.00 81.03  ? 49   LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 54  ? 19.669 5.503   14.012 1.00 91.90  ? 49   LYS A NZ  1 
ATOM   373  N N   . ASN A 1 55  ? 23.681 6.355   8.283  1.00 35.16  ? 50   ASN A N   1 
ATOM   374  C CA  . ASN A 1 55  ? 23.496 5.387   7.189  1.00 34.77  ? 50   ASN A CA  1 
ATOM   375  C C   . ASN A 1 55  ? 24.673 4.436   7.081  1.00 41.73  ? 50   ASN A C   1 
ATOM   376  O O   . ASN A 1 55  ? 24.462 3.254   6.838  1.00 42.39  ? 50   ASN A O   1 
ATOM   377  C CB  . ASN A 1 55  ? 23.295 6.107   5.884  1.00 34.05  ? 50   ASN A CB  1 
ATOM   378  C CG  . ASN A 1 55  ? 21.868 6.551   5.676  1.00 46.99  ? 50   ASN A CG  1 
ATOM   379  O OD1 . ASN A 1 55  ? 21.003 5.763   5.323  1.00 44.94  ? 50   ASN A OD1 1 
ATOM   380  N ND2 . ASN A 1 55  ? 21.582 7.822   5.892  1.00 38.54  ? 50   ASN A ND2 1 
ATOM   381  N N   . VAL A 1 56  ? 25.879 4.934   7.320  1.00 38.45  ? 51   VAL A N   1 
ATOM   382  C CA  . VAL A 1 56  ? 27.069 4.100   7.307  1.00 38.02  ? 51   VAL A CA  1 
ATOM   383  C C   . VAL A 1 56  ? 26.993 3.029   8.392  1.00 44.19  ? 51   VAL A C   1 
ATOM   384  O O   . VAL A 1 56  ? 27.172 1.858   8.107  1.00 46.08  ? 51   VAL A O   1 
ATOM   385  C CB  . VAL A 1 56  ? 28.351 4.926   7.470  1.00 40.82  ? 51   VAL A CB  1 
ATOM   386  C CG1 . VAL A 1 56  ? 29.548 4.017   7.568  1.00 41.89  ? 51   VAL A CG1 1 
ATOM   387  C CG2 . VAL A 1 56  ? 28.513 5.870   6.314  1.00 40.28  ? 51   VAL A CG2 1 
ATOM   388  N N   . VAL A 1 57  ? 26.713 3.425   9.627  1.00 39.41  ? 52   VAL A N   1 
ATOM   389  C CA  . VAL A 1 57  ? 26.599 2.451   10.705 1.00 40.24  ? 52   VAL A CA  1 
ATOM   390  C C   . VAL A 1 57  ? 25.317 1.648   10.592 1.00 40.96  ? 52   VAL A C   1 
ATOM   391  O O   . VAL A 1 57  ? 25.277 0.490   10.966 1.00 40.47  ? 52   VAL A O   1 
ATOM   392  C CB  . VAL A 1 57  ? 26.635 3.084   12.105 1.00 45.70  ? 52   VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 57  ? 27.846 3.935   12.274 1.00 49.27  ? 52   VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 57  ? 25.376 3.867   12.377 1.00 42.85  ? 52   VAL A CG2 1 
ATOM   395  N N   . GLY A 1 58  ? 24.268 2.281   10.087 1.00 35.52  ? 53   GLY A N   1 
ATOM   396  C CA  . GLY A 1 58  ? 22.983 1.636   9.933  1.00 34.18  ? 53   GLY A CA  1 
ATOM   397  C C   . GLY A 1 58  ? 23.060 0.382   9.099  1.00 41.12  ? 53   GLY A C   1 
ATOM   398  O O   . GLY A 1 58  ? 22.447 -0.618  9.430  1.00 41.95  ? 53   GLY A O   1 
ATOM   399  N N   . ALA A 1 59  ? 23.821 0.440   8.015  1.00 40.01  ? 54   ALA A N   1 
ATOM   400  C CA  . ALA A 1 59  ? 23.992 -0.723  7.134  1.00 38.78  ? 54   ALA A CA  1 
ATOM   401  C C   . ALA A 1 59  ? 24.615 -1.886  7.929  1.00 41.94  ? 54   ALA A C   1 
ATOM   402  O O   . ALA A 1 59  ? 24.165 -3.028  7.810  1.00 40.25  ? 54   ALA A O   1 
ATOM   403  C CB  . ALA A 1 59  ? 24.873 -0.353  5.943  1.00 39.17  ? 54   ALA A CB  1 
ATOM   404  N N   . ARG A 1 60  ? 25.584 -1.586  8.787  1.00 39.49  ? 55   ARG A N   1 
ATOM   405  C CA  . ARG A 1 60  ? 26.220 -2.622  9.605  1.00 41.11  ? 55   ARG A CA  1 
ATOM   406  C C   . ARG A 1 60  ? 25.313 -3.135  10.696 1.00 43.71  ? 55   ARG A C   1 
ATOM   407  O O   . ARG A 1 60  ? 25.387 -4.319  11.004 1.00 43.15  ? 55   ARG A O   1 
ATOM   408  C CB  . ARG A 1 60  ? 27.523 -2.111  10.231 1.00 44.14  ? 55   ARG A CB  1 
ATOM   409  C CG  . ARG A 1 60  ? 28.723 -2.198  9.313  1.00 43.32  ? 55   ARG A CG  1 
ATOM   410  C CD  . ARG A 1 60  ? 28.616 -1.168  8.229  1.00 39.84  ? 55   ARG A CD  1 
ATOM   411  N NE  . ARG A 1 60  ? 29.700 -1.267  7.262  1.00 47.44  ? 55   ARG A NE  1 
ATOM   412  C CZ  . ARG A 1 60  ? 29.816 -0.462  6.217  1.00 57.71  ? 55   ARG A CZ  1 
ATOM   413  N NH1 . ARG A 1 60  ? 28.946 0.528   6.030  1.00 42.14  ? 55   ARG A NH1 1 
ATOM   414  N NH2 . ARG A 1 60  ? 30.809 -0.627  5.359  1.00 51.86  ? 55   ARG A NH2 1 
ATOM   415  N N   . ARG A 1 61  ? 24.504 -2.251  11.324 1.00 40.26  ? 56   ARG A N   1 
ATOM   416  C CA  . ARG A 1 61  ? 23.568 -2.676  12.388 1.00 39.84  ? 56   ARG A CA  1 
ATOM   417  C C   . ARG A 1 61  ? 22.560 -3.649  11.802 1.00 41.36  ? 56   ARG A C   1 
ATOM   418  O O   . ARG A 1 61  ? 22.241 -4.669  12.413 1.00 42.92  ? 56   ARG A O   1 
ATOM   419  C CB  . ARG A 1 61  ? 22.827 -1.458  13.005 1.00 35.76  ? 56   ARG A CB  1 
ATOM   420  C CG  . ARG A 1 61  ? 23.744 -0.585  13.873 1.00 41.66  ? 56   ARG A CG  1 
ATOM   421  C CD  . ARG A 1 61  ? 23.022 0.671   14.403 1.00 44.23  ? 56   ARG A CD  1 
ATOM   422  N NE  . ARG A 1 61  ? 22.026 0.426   15.460 1.00 44.99  ? 56   ARG A NE  1 
ATOM   423  C CZ  . ARG A 1 61  ? 20.907 1.139   15.617 1.00 52.66  ? 56   ARG A CZ  1 
ATOM   424  N NH1 . ARG A 1 61  ? 20.610 2.115   14.770 1.00 38.71  ? 56   ARG A NH1 1 
ATOM   425  N NH2 . ARG A 1 61  ? 20.083 0.884   16.627 1.00 42.89  ? 56   ARG A NH2 1 
ATOM   426  N N   . SER A 1 62  ? 22.058 -3.339  10.618 1.00 36.61  ? 57   SER A N   1 
ATOM   427  C CA  . SER A 1 62  ? 21.082 -4.187  9.957  1.00 35.32  ? 57   SER A CA  1 
ATOM   428  C C   . SER A 1 62  ? 21.707 -5.525  9.544  1.00 40.13  ? 57   SER A C   1 
ATOM   429  O O   . SER A 1 62  ? 21.128 -6.583  9.787  1.00 40.13  ? 57   SER A O   1 
ATOM   430  C CB  . SER A 1 62  ? 20.496 -3.458  8.750  1.00 36.91  ? 57   SER A CB  1 
ATOM   431  O OG  . SER A 1 62  ? 19.764 -4.387  7.965  1.00 45.89  ? 57   SER A OG  1 
ATOM   432  N N   . SER A 1 63  ? 22.905 -5.497  8.959  1.00 38.65  ? 58   SER A N   1 
ATOM   433  C CA  . SER A 1 63  ? 23.583 -6.750  8.586  1.00 39.97  ? 58   SER A CA  1 
ATOM   434  C C   . SER A 1 63  ? 23.828 -7.592  9.811  1.00 45.19  ? 58   SER A C   1 
ATOM   435  O O   . SER A 1 63  ? 23.609 -8.790  9.760  1.00 45.97  ? 58   SER A O   1 
ATOM   436  C CB  . SER A 1 63  ? 24.917 -6.437  7.928  1.00 42.45  ? 58   SER A CB  1 
ATOM   437  O OG  . SER A 1 63  ? 24.730 -5.833  6.656  1.00 39.20  ? 58   SER A OG  1 
ATOM   438  N N   . TRP A 1 64  ? 24.241 -6.950  10.929 1.00 41.99  ? 59   TRP A N   1 
ATOM   439  C CA  . TRP A 1 64  ? 24.533 -7.624  12.192 1.00 42.70  ? 59   TRP A CA  1 
ATOM   440  C C   . TRP A 1 64  ? 23.289 -8.335  12.688 1.00 46.69  ? 59   TRP A C   1 
ATOM   441  O O   . TRP A 1 64  ? 23.390 -9.485  13.077 1.00 47.50  ? 59   TRP A O   1 
ATOM   442  C CB  . TRP A 1 64  ? 25.028 -6.614  13.254 1.00 41.05  ? 59   TRP A CB  1 
ATOM   443  C CG  . TRP A 1 64  ? 25.507 -7.278  14.531 1.00 43.32  ? 59   TRP A CG  1 
ATOM   444  C CD1 . TRP A 1 64  ? 26.778 -7.659  14.832 1.00 47.15  ? 59   TRP A CD1 1 
ATOM   445  C CD2 . TRP A 1 64  ? 24.705 -7.610  15.679 1.00 43.88  ? 59   TRP A CD2 1 
ATOM   446  N NE1 . TRP A 1 64  ? 26.817 -8.218  16.085 1.00 48.37  ? 59   TRP A NE1 1 
ATOM   447  C CE2 . TRP A 1 64  ? 25.559 -8.198  16.629 1.00 49.36  ? 59   TRP A CE2 1 
ATOM   448  C CE3 . TRP A 1 64  ? 23.344 -7.460  15.996 1.00 45.00  ? 59   TRP A CE3 1 
ATOM   449  C CZ2 . TRP A 1 64  ? 25.105 -8.623  17.885 1.00 50.11  ? 59   TRP A CZ2 1 
ATOM   450  C CZ3 . TRP A 1 64  ? 22.884 -7.924  17.223 1.00 47.52  ? 59   TRP A CZ3 1 
ATOM   451  C CH2 . TRP A 1 64  ? 23.754 -8.507  18.144 1.00 50.28  ? 59   TRP A CH2 1 
ATOM   452  N N   . ARG A 1 65  ? 22.111 -7.673  12.648 1.00 41.82  ? 60   ARG A N   1 
ATOM   453  C CA  . ARG A 1 65  ? 20.878 -8.280  13.147 1.00 41.09  ? 60   ARG A CA  1 
ATOM   454  C C   . ARG A 1 65  ? 20.536 -9.494  12.346 1.00 43.91  ? 60   ARG A C   1 
ATOM   455  O O   . ARG A 1 65  ? 20.180 -10.521 12.925 1.00 46.35  ? 60   ARG A O   1 
ATOM   456  C CB  . ARG A 1 65  ? 19.689 -7.288  13.171 1.00 39.48  ? 60   ARG A CB  1 
ATOM   457  C CG  . ARG A 1 65  ? 19.842 -6.160  14.174 1.00 53.71  ? 60   ARG A CG  1 
ATOM   458  C CD  . ARG A 1 65  ? 18.650 -5.210  14.165 1.00 70.54  ? 60   ARG A CD  1 
ATOM   459  N NE  . ARG A 1 65  ? 18.717 -4.220  13.081 1.00 86.40  ? 60   ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 65  ? 19.109 -2.955  13.234 1.00 99.52  ? 60   ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 65  ? 19.475 -2.502  14.431 1.00 84.44  ? 60   ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 65  ? 19.125 -2.130  12.194 1.00 81.52  ? 60   ARG A NH2 1 
ATOM   463  N N   . VAL A 1 66  ? 20.672 -9.401  11.020 1.00 38.15  ? 61   VAL A N   1 
ATOM   464  C CA  . VAL A 1 66  ? 20.383 -10.518 10.135 1.00 38.06  ? 61   VAL A CA  1 
ATOM   465  C C   . VAL A 1 66  ? 21.336 -11.696 10.435 1.00 45.08  ? 61   VAL A C   1 
ATOM   466  O O   . VAL A 1 66  ? 20.879 -12.825 10.628 1.00 42.89  ? 61   VAL A O   1 
ATOM   467  C CB  . VAL A 1 66  ? 20.442 -10.119 8.635  1.00 40.74  ? 61   VAL A CB  1 
ATOM   468  C CG1 . VAL A 1 66  ? 20.439 -11.383 7.758  1.00 40.80  ? 61   VAL A CG1 1 
ATOM   469  C CG2 . VAL A 1 66  ? 19.265 -9.185  8.252  1.00 38.87  ? 61   VAL A CG2 1 
ATOM   470  N N   . VAL A 1 67  ? 22.650 -11.443 10.441 1.00 43.03  ? 62   VAL A N   1 
ATOM   471  C CA  . VAL A 1 67  ? 23.614 -12.515 10.673 1.00 44.00  ? 62   VAL A CA  1 
ATOM   472  C C   . VAL A 1 67  ? 23.487 -13.100 12.099 1.00 50.90  ? 62   VAL A C   1 
ATOM   473  O O   . VAL A 1 67  ? 23.594 -14.304 12.252 1.00 50.05  ? 62   VAL A O   1 
ATOM   474  C CB  . VAL A 1 67  ? 25.042 -12.102 10.286 1.00 46.59  ? 62   VAL A CB  1 
ATOM   475  C CG1 . VAL A 1 67  ? 26.023 -13.210 10.588 1.00 47.60  ? 62   VAL A CG1 1 
ATOM   476  C CG2 . VAL A 1 67  ? 25.134 -11.744 8.802  1.00 44.90  ? 62   VAL A CG2 1 
ATOM   477  N N   . SER A 1 68  ? 23.181 -12.271 13.113 1.00 49.28  ? 63   SER A N   1 
ATOM   478  C CA  . SER A 1 68  ? 22.960 -12.737 14.492 1.00 50.73  ? 63   SER A CA  1 
ATOM   479  C C   . SER A 1 68  ? 21.760 -13.691 14.527 1.00 54.50  ? 63   SER A C   1 
ATOM   480  O O   . SER A 1 68  ? 21.837 -14.748 15.141 1.00 56.47  ? 63   SER A O   1 
ATOM   481  C CB  . SER A 1 68  ? 22.691 -11.556 15.420 1.00 52.97  ? 63   SER A CB  1 
ATOM   482  O OG  . SER A 1 68  ? 23.834 -10.727 15.508 1.00 68.39  ? 63   SER A OG  1 
ATOM   483  N N   . SER A 1 69  ? 20.658 -13.329 13.845 1.00 49.24  ? 64   SER A N   1 
ATOM   484  C CA  . SER A 1 69  ? 19.449 -14.141 13.787 1.00 48.43  ? 64   SER A CA  1 
ATOM   485  C C   . SER A 1 69  ? 19.748 -15.501 13.142 1.00 51.76  ? 64   SER A C   1 
ATOM   486  O O   . SER A 1 69  ? 19.225 -16.519 13.606 1.00 52.87  ? 64   SER A O   1 
ATOM   487  C CB  . SER A 1 69  ? 18.360 -13.398 13.020 1.00 51.23  ? 64   SER A CB  1 
ATOM   488  O OG  . SER A 1 69  ? 17.291 -14.254 12.649 1.00 65.30  ? 64   SER A OG  1 
ATOM   489  N N   . ILE A 1 70  ? 20.598 -15.525 12.094 1.00 46.19  ? 65   ILE A N   1 
ATOM   490  C CA  . ILE A 1 70  ? 20.928 -16.763 11.381 1.00 45.51  ? 65   ILE A CA  1 
ATOM   491  C C   . ILE A 1 70  ? 21.719 -17.655 12.296 1.00 54.96  ? 65   ILE A C   1 
ATOM   492  O O   . ILE A 1 70  ? 21.433 -18.850 12.411 1.00 57.05  ? 65   ILE A O   1 
ATOM   493  C CB  . ILE A 1 70  ? 21.695 -16.493 10.057 1.00 45.11  ? 65   ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 70  ? 20.724 -16.052 8.952  1.00 41.99  ? 65   ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 70  ? 22.559 -17.747 9.603  1.00 41.63  ? 65   ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 70  ? 21.389 -15.303 7.868  1.00 41.45  ? 65   ILE A CD1 1 
ATOM   497  N N   . GLU A 1 71  ? 22.718 -17.072 12.945 1.00 53.38  ? 66   GLU A N   1 
ATOM   498  C CA  . GLU A 1 71  ? 23.589 -17.771 13.871 1.00 55.40  ? 66   GLU A CA  1 
ATOM   499  C C   . GLU A 1 71  ? 22.837 -18.446 15.011 1.00 60.40  ? 66   GLU A C   1 
ATOM   500  O O   . GLU A 1 71  ? 23.231 -19.515 15.466 1.00 62.33  ? 66   GLU A O   1 
ATOM   501  C CB  . GLU A 1 71  ? 24.560 -16.765 14.420 1.00 57.01  ? 66   GLU A CB  1 
ATOM   502  C CG  . GLU A 1 71  ? 25.708 -17.394 15.179 1.00 63.51  ? 66   GLU A CG  1 
ATOM   503  C CD  . GLU A 1 71  ? 26.378 -16.310 15.982 1.00 77.78  ? 66   GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 71  ? 25.858 -15.171 15.969 1.00 72.04  ? 66   GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 71  ? 27.410 -16.592 16.630 1.00 68.78  ? 66   GLU A OE2 1 
ATOM   506  N N   . GLN A 1 72  ? 21.737 -17.840 15.455 1.00 56.50  ? 67   GLN A N   1 
ATOM   507  C CA  . GLN A 1 72  ? 20.918 -18.432 16.517 1.00 57.07  ? 67   GLN A CA  1 
ATOM   508  C C   . GLN A 1 72  ? 20.092 -19.593 15.965 1.00 61.78  ? 67   GLN A C   1 
ATOM   509  O O   . GLN A 1 72  ? 20.082 -20.654 16.576 1.00 63.85  ? 67   GLN A O   1 
ATOM   510  C CB  . GLN A 1 72  ? 20.065 -17.375 17.227 1.00 57.43  ? 67   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 72  ? 20.924 -16.402 18.044 1.00 73.28  ? 67   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 72  ? 20.273 -15.062 18.313 1.00 104.44 ? 67   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 72  ? 19.041 -14.921 18.372 1.00 102.83 ? 67   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 72  ? 21.098 -14.045 18.526 1.00 97.86  ? 67   GLN A NE2 1 
ATOM   515  N N   . LYS A 1 73  ? 19.492 -19.429 14.766 1.00 56.33  ? 68   LYS A N   1 
ATOM   516  C CA  . LYS A 1 73  ? 18.707 -20.426 14.040 1.00 56.18  ? 68   LYS A CA  1 
ATOM   517  C C   . LYS A 1 73  ? 19.538 -21.657 13.632 1.00 60.89  ? 68   LYS A C   1 
ATOM   518  O O   . LYS A 1 73  ? 18.964 -22.714 13.408 1.00 61.28  ? 68   LYS A O   1 
ATOM   519  C CB  . LYS A 1 73  ? 18.061 -19.775 12.811 1.00 56.64  ? 68   LYS A CB  1 
ATOM   520  C CG  . LYS A 1 73  ? 16.664 -19.226 13.094 1.00 75.89  ? 68   LYS A CG  1 
ATOM   521  C CD  . LYS A 1 73  ? 16.434 -17.976 12.308 1.00 84.93  ? 68   LYS A CD  1 
ATOM   522  C CE  . LYS A 1 73  ? 15.182 -17.266 12.722 1.00 97.53  ? 68   LYS A CE  1 
ATOM   523  N NZ  . LYS A 1 73  ? 15.095 -15.942 12.054 1.00 106.83 ? 68   LYS A NZ  1 
ATOM   524  N N   . THR A 1 74  ? 20.853 -21.501 13.559 1.00 57.36  ? 69   THR A N   1 
ATOM   525  C CA  . THR A 1 74  ? 21.730 -22.597 13.184 1.00 56.77  ? 69   THR A CA  1 
ATOM   526  C C   . THR A 1 74  ? 22.373 -23.277 14.392 1.00 62.12  ? 69   THR A C   1 
ATOM   527  O O   . THR A 1 74  ? 23.466 -23.817 14.302 1.00 62.81  ? 69   THR A O   1 
ATOM   528  C CB  . THR A 1 74  ? 22.813 -22.161 12.181 1.00 53.33  ? 69   THR A CB  1 
ATOM   529  O OG1 . THR A 1 74  ? 23.545 -21.055 12.707 1.00 51.13  ? 69   THR A OG1 1 
ATOM   530  C CG2 . THR A 1 74  ? 22.188 -21.763 10.874 1.00 47.35  ? 69   THR A CG2 1 
ATOM   531  N N   . GLU A 1 75  ? 21.683 -23.248 15.522 1.00 59.61  ? 70   GLU A N   1 
ATOM   532  C CA  . GLU A 1 75  ? 22.151 -23.951 16.700 1.00 61.65  ? 70   GLU A CA  1 
ATOM   533  C C   . GLU A 1 75  ? 21.972 -25.435 16.418 1.00 63.66  ? 70   GLU A C   1 
ATOM   534  O O   . GLU A 1 75  ? 20.901 -25.867 16.015 1.00 61.36  ? 70   GLU A O   1 
ATOM   535  C CB  . GLU A 1 75  ? 21.347 -23.536 17.929 1.00 63.76  ? 70   GLU A CB  1 
ATOM   536  C CG  . GLU A 1 75  ? 21.734 -24.251 19.208 1.00 75.95  ? 70   GLU A CG  1 
ATOM   537  C CD  . GLU A 1 75  ? 23.007 -23.715 19.820 1.00 99.15  ? 70   GLU A CD  1 
ATOM   538  O OE1 . GLU A 1 75  ? 23.749 -24.498 20.438 1.00 108.47 ? 70   GLU A OE1 1 
ATOM   539  O OE2 . GLU A 1 75  ? 23.270 -22.509 19.687 1.00 94.79  ? 70   GLU A OE2 1 
ATOM   540  N N   . GLY A 1 76  ? 23.032 -26.209 16.611 1.00 61.83  ? 71   GLY A N   1 
ATOM   541  C CA  . GLY A 1 76  ? 23.000 -27.642 16.307 1.00 62.09  ? 71   GLY A CA  1 
ATOM   542  C C   . GLY A 1 76  ? 23.412 -27.971 14.883 1.00 63.14  ? 71   GLY A C   1 
ATOM   543  O O   . GLY A 1 76  ? 23.346 -29.131 14.473 1.00 63.87  ? 71   GLY A O   1 
ATOM   544  N N   . ALA A 1 77  ? 23.855 -26.940 14.123 1.00 57.25  ? 72   ALA A N   1 
ATOM   545  C CA  . ALA A 1 77  ? 24.323 -26.999 12.729 1.00 55.45  ? 72   ALA A CA  1 
ATOM   546  C C   . ALA A 1 77  ? 25.710 -26.367 12.744 1.00 56.90  ? 72   ALA A C   1 
ATOM   547  O O   . ALA A 1 77  ? 25.857 -25.178 12.472 1.00 55.79  ? 72   ALA A O   1 
ATOM   548  C CB  . ALA A 1 77  ? 23.376 -26.202 11.828 1.00 53.70  ? 72   ALA A CB  1 
ATOM   549  N N   . GLU A 1 78  ? 26.697 -27.154 13.167 1.00 54.22  ? 73   GLU A N   1 
ATOM   550  C CA  . GLU A 1 78  ? 28.101 -26.803 13.399 1.00 54.75  ? 73   GLU A CA  1 
ATOM   551  C C   . GLU A 1 78  ? 28.784 -25.909 12.354 1.00 57.95  ? 73   GLU A C   1 
ATOM   552  O O   . GLU A 1 78  ? 29.229 -24.806 12.686 1.00 54.13  ? 73   GLU A O   1 
ATOM   553  C CB  . GLU A 1 78  ? 28.919 -28.067 13.679 1.00 57.89  ? 73   GLU A CB  1 
ATOM   554  C CG  . GLU A 1 78  ? 30.377 -27.812 14.022 1.00 63.41  ? 73   GLU A CG  1 
ATOM   555  C CD  . GLU A 1 78  ? 31.221 -29.058 14.188 1.00 80.00  ? 73   GLU A CD  1 
ATOM   556  O OE1 . GLU A 1 78  ? 30.984 -30.042 13.451 1.00 69.29  ? 73   GLU A OE1 1 
ATOM   557  O OE2 . GLU A 1 78  ? 32.121 -29.055 15.059 1.00 87.12  ? 73   GLU A OE2 1 
ATOM   558  N N   . LYS A 1 79  ? 28.930 -26.422 11.119 1.00 56.62  ? 74   LYS A N   1 
ATOM   559  C CA  . LYS A 1 79  ? 29.584 -25.693 10.036 1.00 54.91  ? 74   LYS A CA  1 
ATOM   560  C C   . LYS A 1 79  ? 28.899 -24.378 9.699  1.00 57.97  ? 74   LYS A C   1 
ATOM   561  O O   . LYS A 1 79  ? 29.580 -23.380 9.445  1.00 57.02  ? 74   LYS A O   1 
ATOM   562  C CB  . LYS A 1 79  ? 29.709 -26.577 8.801  1.00 56.08  ? 74   LYS A CB  1 
ATOM   563  C CG  . LYS A 1 79  ? 30.851 -27.579 8.847  1.00 56.36  ? 74   LYS A CG  1 
ATOM   564  C CD  . LYS A 1 79  ? 30.663 -28.534 7.681  1.00 63.97  ? 74   LYS A CD  1 
ATOM   565  C CE  . LYS A 1 79  ? 31.856 -29.387 7.370  1.00 78.06  ? 74   LYS A CE  1 
ATOM   566  N NZ  . LYS A 1 79  ? 31.465 -30.555 6.530  1.00 88.63  ? 74   LYS A NZ  1 
ATOM   567  N N   . LYS A 1 80  ? 27.556 -24.363 9.736  1.00 54.13  ? 75   LYS A N   1 
ATOM   568  C CA  . LYS A 1 80  ? 26.776 -23.172 9.394  1.00 51.35  ? 75   LYS A CA  1 
ATOM   569  C C   . LYS A 1 80  ? 26.892 -22.164 10.492 1.00 58.29  ? 75   LYS A C   1 
ATOM   570  O O   . LYS A 1 80  ? 27.071 -20.975 10.196 1.00 58.04  ? 75   LYS A O   1 
ATOM   571  C CB  . LYS A 1 80  ? 25.294 -23.494 9.197  1.00 51.92  ? 75   LYS A CB  1 
ATOM   572  C CG  . LYS A 1 80  ? 24.942 -24.203 7.906  1.00 59.99  ? 75   LYS A CG  1 
ATOM   573  C CD  . LYS A 1 80  ? 23.494 -24.721 7.984  1.00 69.02  ? 75   LYS A CD  1 
ATOM   574  C CE  . LYS A 1 80  ? 22.800 -24.997 6.659  1.00 74.35  ? 75   LYS A CE  1 
ATOM   575  N NZ  . LYS A 1 80  ? 23.403 -26.126 5.901  1.00 81.71  ? 75   LYS A NZ  1 
ATOM   576  N N   . GLN A 1 81  ? 26.738 -22.613 11.760 1.00 55.77  ? 76   GLN A N   1 
ATOM   577  C CA  . GLN A 1 81  ? 26.828 -21.725 12.905 1.00 54.62  ? 76   GLN A CA  1 
ATOM   578  C C   . GLN A 1 81  ? 28.170 -21.034 12.958 1.00 56.80  ? 76   GLN A C   1 
ATOM   579  O O   . GLN A 1 81  ? 28.215 -19.832 13.222 1.00 54.37  ? 76   GLN A O   1 
ATOM   580  C CB  . GLN A 1 81  ? 26.582 -22.469 14.214 1.00 57.57  ? 76   GLN A CB  1 
ATOM   581  C CG  . GLN A 1 81  ? 26.618 -21.512 15.405 1.00 55.93  ? 76   GLN A CG  1 
ATOM   582  C CD  . GLN A 1 81  ? 25.750 -21.910 16.547 1.00 62.53  ? 76   GLN A CD  1 
ATOM   583  O OE1 . GLN A 1 81  ? 24.691 -21.346 16.795 1.00 58.10  ? 76   GLN A OE1 1 
ATOM   584  N NE2 . GLN A 1 81  ? 26.241 -22.815 17.342 1.00 54.28  ? 76   GLN A NE2 1 
ATOM   585  N N   . GLN A 1 82  ? 29.268 -21.794 12.738 1.00 54.07  ? 77   GLN A N   1 
ATOM   586  C CA  . GLN A 1 82  ? 30.598 -21.196 12.798 1.00 54.62  ? 77   GLN A CA  1 
ATOM   587  C C   . GLN A 1 82  ? 30.818 -20.168 11.710 1.00 55.99  ? 77   GLN A C   1 
ATOM   588  O O   . GLN A 1 82  ? 31.485 -19.158 11.943 1.00 55.05  ? 77   GLN A O   1 
ATOM   589  C CB  . GLN A 1 82  ? 31.733 -22.233 12.751 1.00 58.54  ? 77   GLN A CB  1 
ATOM   590  C CG  . GLN A 1 82  ? 33.092 -21.559 13.075 1.00 89.88  ? 77   GLN A CG  1 
ATOM   591  C CD  . GLN A 1 82  ? 34.329 -22.231 12.506 1.00 116.33 ? 77   GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 82  ? 34.399 -23.456 12.366 1.00 105.22 ? 77   GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 82  ? 35.378 -21.448 12.244 1.00 118.78 ? 77   GLN A NE2 1 
ATOM   594  N N   . MET A 1 83  ? 30.317 -20.435 10.515 1.00 51.66  ? 78   MET A N   1 
ATOM   595  C CA  . MET A 1 83  ? 30.497 -19.490 9.430  1.00 50.80  ? 78   MET A CA  1 
ATOM   596  C C   . MET A 1 83  ? 29.786 -18.179 9.761  1.00 54.29  ? 78   MET A C   1 
ATOM   597  O O   . MET A 1 83  ? 30.296 -17.087 9.484  1.00 53.46  ? 78   MET A O   1 
ATOM   598  C CB  . MET A 1 83  ? 29.915 -20.066 8.166  1.00 52.57  ? 78   MET A CB  1 
ATOM   599  C CG  . MET A 1 83  ? 29.860 -19.074 7.039  1.00 55.47  ? 78   MET A CG  1 
ATOM   600  S SD  . MET A 1 83  ? 29.557 -19.923 5.497  1.00 60.40  ? 78   MET A SD  1 
ATOM   601  C CE  . MET A 1 83  ? 30.955 -21.171 5.541  1.00 58.54  ? 78   MET A CE  1 
ATOM   602  N N   . ALA A 1 84  ? 28.585 -18.302 10.312 1.00 49.79  ? 79   ALA A N   1 
ATOM   603  C CA  . ALA A 1 84  ? 27.785 -17.152 10.690 1.00 48.03  ? 79   ALA A CA  1 
ATOM   604  C C   . ALA A 1 84  ? 28.433 -16.388 11.808 1.00 52.37  ? 79   ALA A C   1 
ATOM   605  O O   . ALA A 1 84  ? 28.343 -15.179 11.781 1.00 49.95  ? 79   ALA A O   1 
ATOM   606  C CB  . ALA A 1 84  ? 26.392 -17.592 11.106 1.00 47.83  ? 79   ALA A CB  1 
ATOM   607  N N   . ARG A 1 85  ? 29.092 -17.077 12.772 1.00 51.96  ? 80   ARG A N   1 
ATOM   608  C CA  . ARG A 1 85  ? 29.781 -16.430 13.886 1.00 53.10  ? 80   ARG A CA  1 
ATOM   609  C C   . ARG A 1 85  ? 30.923 -15.593 13.347 1.00 58.05  ? 80   ARG A C   1 
ATOM   610  O O   . ARG A 1 85  ? 31.061 -14.423 13.709 1.00 56.67  ? 80   ARG A O   1 
ATOM   611  C CB  . ARG A 1 85  ? 30.309 -17.466 14.915 1.00 53.90  ? 80   ARG A CB  1 
ATOM   612  C CG  . ARG A 1 85  ? 30.917 -16.854 16.218 1.00 66.28  ? 80   ARG A CG  1 
ATOM   613  C CD  . ARG A 1 85  ? 31.868 -17.827 16.965 1.00 86.42  ? 80   ARG A CD  1 
ATOM   614  N NE  . ARG A 1 85  ? 33.255 -17.450 16.676 1.00 100.76 ? 80   ARG A NE  1 
ATOM   615  C CZ  . ARG A 1 85  ? 34.120 -18.148 15.941 1.00 112.93 ? 80   ARG A CZ  1 
ATOM   616  N NH1 . ARG A 1 85  ? 33.806 -19.368 15.506 1.00 98.32  ? 80   ARG A NH1 1 
ATOM   617  N NH2 . ARG A 1 85  ? 35.324 -17.656 15.682 1.00 97.60  ? 80   ARG A NH2 1 
ATOM   618  N N   . GLU A 1 86  ? 31.732 -16.173 12.481 1.00 55.76  ? 81   GLU A N   1 
ATOM   619  C CA  . GLU A 1 86  ? 32.873 -15.448 11.950 1.00 55.74  ? 81   GLU A CA  1 
ATOM   620  C C   . GLU A 1 86  ? 32.454 -14.239 11.125 1.00 55.45  ? 81   GLU A C   1 
ATOM   621  O O   . GLU A 1 86  ? 33.111 -13.198 11.169 1.00 55.46  ? 81   GLU A O   1 
ATOM   622  C CB  . GLU A 1 86  ? 33.734 -16.412 11.141 1.00 57.99  ? 81   GLU A CB  1 
ATOM   623  C CG  . GLU A 1 86  ? 34.355 -17.504 12.014 1.00 75.32  ? 81   GLU A CG  1 
ATOM   624  C CD  . GLU A 1 86  ? 35.429 -18.388 11.397 1.00 98.87  ? 81   GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 86  ? 35.471 -18.508 10.151 1.00 90.63  ? 81   GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 86  ? 36.228 -18.968 12.168 1.00 99.29  ? 81   GLU A OE2 1 
ATOM   627  N N   . TYR A 1 87  ? 31.368 -14.384 10.366 1.00 49.42  ? 82   TYR A N   1 
ATOM   628  C CA  . TYR A 1 87  ? 30.850 -13.290 9.544  1.00 47.28  ? 82   TYR A CA  1 
ATOM   629  C C   . TYR A 1 87  ? 30.292 -12.199 10.422 1.00 50.44  ? 82   TYR A C   1 
ATOM   630  O O   . TYR A 1 87  ? 30.526 -11.019 10.164 1.00 49.76  ? 82   TYR A O   1 
ATOM   631  C CB  . TYR A 1 87  ? 29.787 -13.789 8.583  1.00 46.07  ? 82   TYR A CB  1 
ATOM   632  C CG  . TYR A 1 87  ? 29.607 -12.857 7.405  1.00 44.44  ? 82   TYR A CG  1 
ATOM   633  C CD1 . TYR A 1 87  ? 30.709 -12.347 6.717  1.00 45.60  ? 82   TYR A CD1 1 
ATOM   634  C CD2 . TYR A 1 87  ? 28.339 -12.489 6.973  1.00 42.26  ? 82   TYR A CD2 1 
ATOM   635  C CE1 . TYR A 1 87  ? 30.551 -11.512 5.619  1.00 43.45  ? 82   TYR A CE1 1 
ATOM   636  C CE2 . TYR A 1 87  ? 28.170 -11.653 5.871  1.00 41.66  ? 82   TYR A CE2 1 
ATOM   637  C CZ  . TYR A 1 87  ? 29.279 -11.186 5.186  1.00 42.67  ? 82   TYR A CZ  1 
ATOM   638  O OH  . TYR A 1 87  ? 29.126 -10.367 4.098  1.00 41.39  ? 82   TYR A OH  1 
ATOM   639  N N   . ARG A 1 88  ? 29.571 -12.590 11.494 1.00 48.30  ? 83   ARG A N   1 
ATOM   640  C CA  . ARG A 1 88  ? 29.079 -11.624 12.480 1.00 48.48  ? 83   ARG A CA  1 
ATOM   641  C C   . ARG A 1 88  ? 30.271 -10.858 13.051 1.00 51.99  ? 83   ARG A C   1 
ATOM   642  O O   . ARG A 1 88  ? 30.181 -9.631  13.164 1.00 50.59  ? 83   ARG A O   1 
ATOM   643  C CB  . ARG A 1 88  ? 28.265 -12.282 13.622 1.00 51.02  ? 83   ARG A CB  1 
ATOM   644  C CG  . ARG A 1 88  ? 27.842 -11.294 14.749 1.00 54.14  ? 83   ARG A CG  1 
ATOM   645  C CD  . ARG A 1 88  ? 27.038 -11.907 15.913 1.00 61.95  ? 83   ARG A CD  1 
ATOM   646  N NE  . ARG A 1 88  ? 27.631 -13.127 16.482 1.00 74.86  ? 83   ARG A NE  1 
ATOM   647  C CZ  . ARG A 1 88  ? 28.669 -13.167 17.315 1.00 80.15  ? 83   ARG A CZ  1 
ATOM   648  N NH1 . ARG A 1 88  ? 29.270 -12.048 17.696 1.00 66.69  ? 83   ARG A NH1 1 
ATOM   649  N NH2 . ARG A 1 88  ? 29.115 -14.327 17.768 1.00 63.17  ? 83   ARG A NH2 1 
ATOM   650  N N   . GLU A 1 89  ? 31.353 -11.556 13.434 1.00 49.60  ? 84   GLU A N   1 
ATOM   651  C CA  . GLU A 1 89  ? 32.534 -10.904 14.002 1.00 51.28  ? 84   GLU A CA  1 
ATOM   652  C C   . GLU A 1 89  ? 33.171 -9.894  13.041 1.00 53.75  ? 84   GLU A C   1 
ATOM   653  O O   . GLU A 1 89  ? 33.620 -8.826  13.465 1.00 54.62  ? 84   GLU A O   1 
ATOM   654  C CB  . GLU A 1 89  ? 33.546 -11.947 14.475 1.00 54.92  ? 84   GLU A CB  1 
ATOM   655  C CG  . GLU A 1 89  ? 33.026 -12.688 15.688 1.00 65.43  ? 84   GLU A CG  1 
ATOM   656  C CD  . GLU A 1 89  ? 33.794 -13.928 16.117 1.00 84.20  ? 84   GLU A CD  1 
ATOM   657  O OE1 . GLU A 1 89  ? 34.691 -14.395 15.374 1.00 69.03  ? 84   GLU A OE1 1 
ATOM   658  O OE2 . GLU A 1 89  ? 33.474 -14.442 17.212 1.00 72.06  ? 84   GLU A OE2 1 
ATOM   659  N N   . LYS A 1 90  ? 33.193 -10.225 11.748 1.00 48.89  ? 85   LYS A N   1 
ATOM   660  C CA  . LYS A 1 90  ? 33.695 -9.313  10.720 1.00 49.12  ? 85   LYS A CA  1 
ATOM   661  C C   . LYS A 1 90  ? 32.816 -8.028  10.636 1.00 50.83  ? 85   LYS A C   1 
ATOM   662  O O   . LYS A 1 90  ? 33.330 -6.917  10.602 1.00 50.77  ? 85   LYS A O   1 
ATOM   663  C CB  . LYS A 1 90  ? 33.673 -10.056 9.383  1.00 51.96  ? 85   LYS A CB  1 
ATOM   664  C CG  . LYS A 1 90  ? 34.026 -9.190  8.166  1.00 60.76  ? 85   LYS A CG  1 
ATOM   665  C CD  . LYS A 1 90  ? 33.871 -10.007 6.904  1.00 66.15  ? 85   LYS A CD  1 
ATOM   666  C CE  . LYS A 1 90  ? 34.167 -9.193  5.664  1.00 76.77  ? 85   LYS A CE  1 
ATOM   667  N NZ  . LYS A 1 90  ? 34.308 -10.065 4.467  1.00 90.76  ? 85   LYS A NZ  1 
ATOM   668  N N   . ILE A 1 91  ? 31.484 -8.199  10.613 1.00 45.73  ? 86   ILE A N   1 
ATOM   669  C CA  . ILE A 1 91  ? 30.565 -7.061  10.569 1.00 42.20  ? 86   ILE A CA  1 
ATOM   670  C C   . ILE A 1 91  ? 30.732 -6.242  11.843 1.00 49.88  ? 86   ILE A C   1 
ATOM   671  O O   . ILE A 1 91  ? 30.735 -5.008  11.767 1.00 50.83  ? 86   ILE A O   1 
ATOM   672  C CB  . ILE A 1 91  ? 29.101 -7.540  10.389 1.00 43.55  ? 86   ILE A CB  1 
ATOM   673  C CG1 . ILE A 1 91  ? 28.937 -8.259  9.028  1.00 42.26  ? 86   ILE A CG1 1 
ATOM   674  C CG2 . ILE A 1 91  ? 28.113 -6.322  10.524 1.00 41.65  ? 86   ILE A CG2 1 
ATOM   675  C CD1 . ILE A 1 91  ? 27.714 -9.168  8.877  1.00 43.89  ? 86   ILE A CD1 1 
ATOM   676  N N   . GLU A 1 92  ? 30.870 -6.917  13.014 1.00 47.64  ? 87   GLU A N   1 
ATOM   677  C CA  . GLU A 1 92  ? 31.058 -6.232  14.303 1.00 48.38  ? 87   GLU A CA  1 
ATOM   678  C C   . GLU A 1 92  ? 32.289 -5.337  14.267 1.00 54.88  ? 87   GLU A C   1 
ATOM   679  O O   . GLU A 1 92  ? 32.230 -4.208  14.749 1.00 54.90  ? 87   GLU A O   1 
ATOM   680  C CB  . GLU A 1 92  ? 31.215 -7.225  15.467 1.00 50.58  ? 87   GLU A CB  1 
ATOM   681  C CG  . GLU A 1 92  ? 29.899 -7.753  15.967 1.00 55.97  ? 87   GLU A CG  1 
ATOM   682  C CD  . GLU A 1 92  ? 29.972 -8.787  17.068 1.00 66.18  ? 87   GLU A CD  1 
ATOM   683  O OE1 . GLU A 1 92  ? 28.901 -9.279  17.486 1.00 60.21  ? 87   GLU A OE1 1 
ATOM   684  O OE2 . GLU A 1 92  ? 31.093 -9.099  17.527 1.00 70.70  ? 87   GLU A OE2 1 
ATOM   685  N N   . THR A 1 93  ? 33.403 -5.851  13.723 1.00 51.97  ? 88   THR A N   1 
ATOM   686  C CA  . THR A 1 93  ? 34.637 -5.078  13.597 1.00 53.01  ? 88   THR A CA  1 
ATOM   687  C C   . THR A 1 93  ? 34.397 -3.802  12.788 1.00 53.76  ? 88   THR A C   1 
ATOM   688  O O   . THR A 1 93  ? 34.786 -2.724  13.227 1.00 53.52  ? 88   THR A O   1 
ATOM   689  C CB  . THR A 1 93  ? 35.751 -5.961  13.038 1.00 58.50  ? 88   THR A CB  1 
ATOM   690  O OG1 . THR A 1 93  ? 36.025 -6.972  14.015 1.00 65.33  ? 88   THR A OG1 1 
ATOM   691  C CG2 . THR A 1 93  ? 37.038 -5.175  12.745 1.00 53.97  ? 88   THR A CG2 1 
ATOM   692  N N   . GLU A 1 94  ? 33.735 -3.916  11.637 1.00 48.75  ? 89   GLU A N   1 
ATOM   693  C CA  . GLU A 1 94  ? 33.416 -2.742  10.835 1.00 49.28  ? 89   GLU A CA  1 
ATOM   694  C C   . GLU A 1 94  ? 32.588 -1.738  11.639 1.00 55.17  ? 89   GLU A C   1 
ATOM   695  O O   . GLU A 1 94  ? 32.870 -0.537  11.608 1.00 55.93  ? 89   GLU A O   1 
ATOM   696  C CB  . GLU A 1 94  ? 32.605 -3.151  9.607  1.00 48.39  ? 89   GLU A CB  1 
ATOM   697  C CG  . GLU A 1 94  ? 33.389 -3.943  8.589  1.00 52.48  ? 89   GLU A CG  1 
ATOM   698  C CD  . GLU A 1 94  ? 32.641 -4.174  7.294  1.00 60.81  ? 89   GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 94  ? 31.521 -3.636  7.129  1.00 50.82  ? 89   GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 94  ? 33.189 -4.886  6.427  1.00 57.75  ? 89   GLU A OE2 1 
ATOM   701  N N   . LEU A 1 95  ? 31.554 -2.230  12.330 1.00 51.21  ? 90   LEU A N   1 
ATOM   702  C CA  . LEU A 1 95  ? 30.650 -1.394  13.111 1.00 50.84  ? 90   LEU A CA  1 
ATOM   703  C C   . LEU A 1 95  ? 31.415 -0.659  14.212 1.00 55.41  ? 90   LEU A C   1 
ATOM   704  O O   . LEU A 1 95  ? 31.207 0.550   14.394 1.00 54.59  ? 90   LEU A O   1 
ATOM   705  C CB  . LEU A 1 95  ? 29.542 -2.271  13.686 1.00 50.12  ? 90   LEU A CB  1 
ATOM   706  C CG  . LEU A 1 95  ? 28.317 -1.589  14.268 1.00 54.64  ? 90   LEU A CG  1 
ATOM   707  C CD1 . LEU A 1 95  ? 27.180 -2.559  14.249 1.00 53.58  ? 90   LEU A CD1 1 
ATOM   708  C CD2 . LEU A 1 95  ? 28.576 -1.216  15.708 1.00 60.20  ? 90   LEU A CD2 1 
ATOM   709  N N   . ARG A 1 96  ? 32.269 -1.383  14.953 1.00 52.78  ? 91   ARG A N   1 
ATOM   710  C CA  . ARG A 1 96  ? 33.048 -0.762  16.018 1.00 54.64  ? 91   ARG A CA  1 
ATOM   711  C C   . ARG A 1 96  ? 33.961 0.320   15.472 1.00 59.09  ? 91   ARG A C   1 
ATOM   712  O O   . ARG A 1 96  ? 34.106 1.369   16.102 1.00 56.69  ? 91   ARG A O   1 
ATOM   713  C CB  . ARG A 1 96  ? 33.862 -1.795  16.767 1.00 57.41  ? 91   ARG A CB  1 
ATOM   714  C CG  . ARG A 1 96  ? 32.978 -2.678  17.649 1.00 69.16  ? 91   ARG A CG  1 
ATOM   715  C CD  . ARG A 1 96  ? 33.693 -3.422  18.785 1.00 78.27  ? 91   ARG A CD  1 
ATOM   716  N NE  . ARG A 1 96  ? 32.846 -4.535  19.209 1.00 80.03  ? 91   ARG A NE  1 
ATOM   717  C CZ  . ARG A 1 96  ? 32.967 -5.762  18.726 1.00 85.07  ? 91   ARG A CZ  1 
ATOM   718  N NH1 . ARG A 1 96  ? 33.960 -6.060  17.893 1.00 68.88  ? 91   ARG A NH1 1 
ATOM   719  N NH2 . ARG A 1 96  ? 32.133 -6.719  19.116 1.00 71.97  ? 91   ARG A NH2 1 
ATOM   720  N N   . ASP A 1 97  ? 34.566 0.084   14.291 1.00 57.77  ? 92   ASP A N   1 
ATOM   721  C CA  . ASP A 1 97  ? 35.462 1.080   13.686 1.00 58.21  ? 92   ASP A CA  1 
ATOM   722  C C   . ASP A 1 97  ? 34.713 2.358   13.318 1.00 58.38  ? 92   ASP A C   1 
ATOM   723  O O   . ASP A 1 97  ? 35.222 3.467   13.542 1.00 59.13  ? 92   ASP A O   1 
ATOM   724  C CB  . ASP A 1 97  ? 36.164 0.508   12.456 1.00 60.39  ? 92   ASP A CB  1 
ATOM   725  C CG  . ASP A 1 97  ? 37.239 -0.500  12.769 1.00 67.60  ? 92   ASP A CG  1 
ATOM   726  O OD1 . ASP A 1 97  ? 37.657 -0.584  13.960 1.00 71.03  ? 92   ASP A OD1 1 
ATOM   727  O OD2 . ASP A 1 97  ? 37.643 -1.226  11.841 1.00 69.30  ? 92   ASP A OD2 1 
ATOM   728  N N   . ILE A 1 98  ? 33.503 2.199   12.796 1.00 50.14  ? 93   ILE A N   1 
ATOM   729  C CA  . ILE A 1 98  ? 32.662 3.328   12.436 1.00 46.37  ? 93   ILE A CA  1 
ATOM   730  C C   . ILE A 1 98  ? 32.304 4.132   13.676 1.00 49.87  ? 93   ILE A C   1 
ATOM   731  O O   . ILE A 1 98  ? 32.479 5.335   13.707 1.00 49.06  ? 93   ILE A O   1 
ATOM   732  C CB  . ILE A 1 98  ? 31.389 2.869   11.721 1.00 45.63  ? 93   ILE A CB  1 
ATOM   733  C CG1 . ILE A 1 98  ? 31.743 2.250   10.375 1.00 45.83  ? 93   ILE A CG1 1 
ATOM   734  C CG2 . ILE A 1 98  ? 30.461 4.029   11.517 1.00 40.81  ? 93   ILE A CG2 1 
ATOM   735  C CD1 . ILE A 1 98  ? 30.609 1.541   9.715  1.00 38.95  ? 93   ILE A CD1 1 
ATOM   736  N N   . CYS A 1 99  ? 31.811 3.454   14.699 1.00 46.87  ? 94   CYS A N   1 
ATOM   737  C CA  . CYS A 1 99  ? 31.480 4.104   15.967 1.00 46.20  ? 94   CYS A CA  1 
ATOM   738  C C   . CYS A 1 99  ? 32.663 4.831   16.541 1.00 52.90  ? 94   CYS A C   1 
ATOM   739  O O   . CYS A 1 99  ? 32.535 5.985   16.958 1.00 53.22  ? 94   CYS A O   1 
ATOM   740  C CB  . CYS A 1 99  ? 30.928 3.093   16.962 1.00 45.71  ? 94   CYS A CB  1 
ATOM   741  S SG  . CYS A 1 99  ? 29.304 2.411   16.498 1.00 46.78  ? 94   CYS A SG  1 
ATOM   742  N N   . ASN A 1 100 ? 33.823 4.186   16.555 1.00 51.04  ? 95   ASN A N   1 
ATOM   743  C CA  . ASN A 1 100 ? 35.021 4.821   17.103 1.00 53.82  ? 95   ASN A CA  1 
ATOM   744  C C   . ASN A 1 100 ? 35.445 6.037   16.313 1.00 58.12  ? 95   ASN A C   1 
ATOM   745  O O   . ASN A 1 100 ? 35.881 6.993   16.908 1.00 58.86  ? 95   ASN A O   1 
ATOM   746  C CB  . ASN A 1 100 ? 36.162 3.808   17.248 1.00 59.04  ? 95   ASN A CB  1 
ATOM   747  C CG  . ASN A 1 100 ? 35.943 2.814   18.368 1.00 80.29  ? 95   ASN A CG  1 
ATOM   748  O OD1 . ASN A 1 100 ? 35.306 3.111   19.379 1.00 75.74  ? 95   ASN A OD1 1 
ATOM   749  N ND2 . ASN A 1 100 ? 36.469 1.606   18.212 1.00 77.24  ? 95   ASN A ND2 1 
ATOM   750  N N   . ASP A 1 101 ? 35.283 6.018   14.993 1.00 56.07  ? 96   ASP A N   1 
ATOM   751  C CA  . ASP A 1 101 ? 35.588 7.148   14.122 1.00 57.00  ? 96   ASP A CA  1 
ATOM   752  C C   . ASP A 1 101 ? 34.684 8.356   14.530 1.00 61.15  ? 96   ASP A C   1 
ATOM   753  O O   . ASP A 1 101 ? 35.208 9.440   14.771 1.00 63.47  ? 96   ASP A O   1 
ATOM   754  C CB  . ASP A 1 101 ? 35.370 6.707   12.657 1.00 57.71  ? 96   ASP A CB  1 
ATOM   755  C CG  . ASP A 1 101 ? 35.513 7.754   11.567 1.00 71.88  ? 96   ASP A CG  1 
ATOM   756  O OD1 . ASP A 1 101 ? 36.320 8.694   11.742 1.00 76.83  ? 96   ASP A OD1 1 
ATOM   757  O OD2 . ASP A 1 101 ? 34.889 7.583   10.496 1.00 74.20  ? 96   ASP A OD2 1 
ATOM   758  N N   . VAL A 1 102 ? 33.358 8.138   14.693 1.00 54.71  ? 97   VAL A N   1 
ATOM   759  C CA  . VAL A 1 102 ? 32.412 9.201   15.081 1.00 53.23  ? 97   VAL A CA  1 
ATOM   760  C C   . VAL A 1 102 ? 32.740 9.706   16.468 1.00 57.20  ? 97   VAL A C   1 
ATOM   761  O O   . VAL A 1 102 ? 32.756 10.916  16.704 1.00 57.36  ? 97   VAL A O   1 
ATOM   762  C CB  . VAL A 1 102 ? 30.931 8.742   15.002 1.00 54.02  ? 97   VAL A CB  1 
ATOM   763  C CG1 . VAL A 1 102 ? 29.986 9.841   15.482 1.00 53.83  ? 97   VAL A CG1 1 
ATOM   764  C CG2 . VAL A 1 102 ? 30.576 8.315   13.600 1.00 51.80  ? 97   VAL A CG2 1 
ATOM   765  N N   . LEU A 1 103 ? 33.003 8.773   17.386 1.00 54.61  ? 98   LEU A N   1 
ATOM   766  C CA  . LEU A 1 103 ? 33.302 9.118   18.767 1.00 55.51  ? 98   LEU A CA  1 
ATOM   767  C C   . LEU A 1 103 ? 34.562 9.951   18.878 1.00 60.37  ? 98   LEU A C   1 
ATOM   768  O O   . LEU A 1 103 ? 34.615 10.865  19.701 1.00 57.86  ? 98   LEU A O   1 
ATOM   769  C CB  . LEU A 1 103 ? 33.324 7.876   19.672 1.00 55.77  ? 98   LEU A CB  1 
ATOM   770  C CG  . LEU A 1 103 ? 31.944 7.232   19.912 1.00 58.39  ? 98   LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 103 ? 32.095 5.837   20.529 1.00 59.29  ? 98   LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 103 ? 31.043 8.149   20.760 1.00 59.43  ? 98   LEU A CD2 1 
ATOM   773  N N   . SER A 1 104 ? 35.542 9.674   18.003 1.00 59.38  ? 99   SER A N   1 
ATOM   774  C CA  . SER A 1 104 ? 36.796 10.404  17.952 1.00 62.08  ? 99   SER A CA  1 
ATOM   775  C C   . SER A 1 104 ? 36.525 11.848  17.442 1.00 66.55  ? 99   SER A C   1 
ATOM   776  O O   . SER A 1 104 ? 37.070 12.806  17.997 1.00 67.50  ? 99   SER A O   1 
ATOM   777  C CB  . SER A 1 104 ? 37.811 9.660   17.088 1.00 66.02  ? 99   SER A CB  1 
ATOM   778  O OG  . SER A 1 104 ? 38.986 10.436  16.939 1.00 84.32  ? 99   SER A OG  1 
ATOM   779  N N   . LEU A 1 105 ? 35.658 12.006  16.431 1.00 59.16  ? 100  LEU A N   1 
ATOM   780  C CA  . LEU A 1 105 ? 35.333 13.345  15.933 1.00 57.68  ? 100  LEU A CA  1 
ATOM   781  C C   . LEU A 1 105 ? 34.642 14.123  17.042 1.00 61.87  ? 100  LEU A C   1 
ATOM   782  O O   . LEU A 1 105 ? 34.900 15.312  17.239 1.00 61.29  ? 100  LEU A O   1 
ATOM   783  C CB  . LEU A 1 105 ? 34.402 13.245  14.711 1.00 54.18  ? 100  LEU A CB  1 
ATOM   784  C CG  . LEU A 1 105 ? 35.012 12.680  13.436 1.00 57.17  ? 100  LEU A CG  1 
ATOM   785  C CD1 . LEU A 1 105 ? 33.932 12.580  12.347 1.00 53.31  ? 100  LEU A CD1 1 
ATOM   786  C CD2 . LEU A 1 105 ? 36.216 13.541  12.952 1.00 58.86  ? 100  LEU A CD2 1 
ATOM   787  N N   . LEU A 1 106 ? 33.731 13.441  17.747 1.00 56.90  ? 101  LEU A N   1 
ATOM   788  C CA  . LEU A 1 106 ? 33.015 14.056  18.841 1.00 55.54  ? 101  LEU A CA  1 
ATOM   789  C C   . LEU A 1 106 ? 33.986 14.563  19.921 1.00 64.50  ? 101  LEU A C   1 
ATOM   790  O O   . LEU A 1 106 ? 33.852 15.699  20.365 1.00 65.70  ? 101  LEU A O   1 
ATOM   791  C CB  . LEU A 1 106 ? 31.964 13.104  19.421 1.00 52.79  ? 101  LEU A CB  1 
ATOM   792  C CG  . LEU A 1 106 ? 30.702 12.934  18.541 1.00 52.24  ? 101  LEU A CG  1 
ATOM   793  C CD1 . LEU A 1 106 ? 29.977 11.622  18.868 1.00 50.03  ? 101  LEU A CD1 1 
ATOM   794  C CD2 . LEU A 1 106 ? 29.711 14.146  18.665 1.00 50.97  ? 101  LEU A CD2 1 
ATOM   795  N N   . GLU A 1 107 ? 34.970 13.747  20.311 1.00 63.04  ? 102  GLU A N   1 
ATOM   796  C CA  . GLU A 1 107 ? 35.917 14.135  21.356 1.00 66.36  ? 102  GLU A CA  1 
ATOM   797  C C   . GLU A 1 107 ? 36.951 15.156  20.940 1.00 73.26  ? 102  GLU A C   1 
ATOM   798  O O   . GLU A 1 107 ? 37.340 15.992  21.761 1.00 74.08  ? 102  GLU A O   1 
ATOM   799  C CB  . GLU A 1 107 ? 36.637 12.921  21.958 1.00 69.38  ? 102  GLU A CB  1 
ATOM   800  C CG  . GLU A 1 107 ? 35.793 12.098  22.908 1.00 81.49  ? 102  GLU A CG  1 
ATOM   801  C CD  . GLU A 1 107 ? 35.065 12.837  24.014 1.00 94.80  ? 102  GLU A CD  1 
ATOM   802  O OE1 . GLU A 1 107 ? 35.734 13.247  24.990 1.00 87.17  ? 102  GLU A OE1 1 
ATOM   803  O OE2 . GLU A 1 107 ? 33.820 12.963  23.926 1.00 70.91  ? 102  GLU A OE2 1 
ATOM   804  N N   . LYS A 1 108 ? 37.456 15.057  19.711 1.00 69.99  ? 103  LYS A N   1 
ATOM   805  C CA  . LYS A 1 108 ? 38.519 15.932  19.236 1.00 71.80  ? 103  LYS A CA  1 
ATOM   806  C C   . LYS A 1 108 ? 38.028 17.263  18.705 1.00 75.19  ? 103  LYS A C   1 
ATOM   807  O O   . LYS A 1 108 ? 38.762 18.253  18.808 1.00 77.31  ? 103  LYS A O   1 
ATOM   808  C CB  . LYS A 1 108 ? 39.355 15.184  18.176 1.00 74.89  ? 103  LYS A CB  1 
ATOM   809  C CG  . LYS A 1 108 ? 40.528 15.961  17.554 1.00 95.07  ? 103  LYS A CG  1 
ATOM   810  C CD  . LYS A 1 108 ? 41.727 15.046  17.227 1.00 107.49 ? 103  LYS A CD  1 
ATOM   811  C CE  . LYS A 1 108 ? 42.697 15.692  16.265 1.00 112.33 ? 103  LYS A CE  1 
ATOM   812  N NZ  . LYS A 1 108 ? 42.391 15.311  14.857 1.00 110.62 ? 103  LYS A NZ  1 
ATOM   813  N N   . PHE A 1 109 ? 36.826 17.296  18.091 1.00 68.47  ? 104  PHE A N   1 
ATOM   814  C CA  . PHE A 1 109 ? 36.361 18.524  17.455 1.00 67.49  ? 104  PHE A CA  1 
ATOM   815  C C   . PHE A 1 109 ? 35.040 19.025  17.903 1.00 70.23  ? 104  PHE A C   1 
ATOM   816  O O   . PHE A 1 109 ? 34.913 20.173  18.298 1.00 71.34  ? 104  PHE A O   1 
ATOM   817  C CB  . PHE A 1 109 ? 36.304 18.350  15.929 1.00 67.64  ? 104  PHE A CB  1 
ATOM   818  C CG  . PHE A 1 109 ? 37.588 17.910  15.279 1.00 70.96  ? 104  PHE A CG  1 
ATOM   819  C CD1 . PHE A 1 109 ? 38.614 18.818  15.045 1.00 75.78  ? 104  PHE A CD1 1 
ATOM   820  C CD2 . PHE A 1 109 ? 37.767 16.592  14.882 1.00 72.19  ? 104  PHE A CD2 1 
ATOM   821  C CE1 . PHE A 1 109 ? 39.795 18.417  14.432 1.00 78.48  ? 104  PHE A CE1 1 
ATOM   822  C CE2 . PHE A 1 109 ? 38.943 16.196  14.249 1.00 76.46  ? 104  PHE A CE2 1 
ATOM   823  C CZ  . PHE A 1 109 ? 39.959 17.112  14.055 1.00 77.32  ? 104  PHE A CZ  1 
ATOM   824  N N   . LEU A 1 110 ? 34.035 18.193  17.765 1.00 64.84  ? 105  LEU A N   1 
ATOM   825  C CA  . LEU A 1 110 ? 32.644 18.586  17.945 1.00 61.88  ? 105  LEU A CA  1 
ATOM   826  C C   . LEU A 1 110 ? 32.251 19.048  19.333 1.00 65.89  ? 105  LEU A C   1 
ATOM   827  O O   . LEU A 1 110 ? 31.753 20.164  19.496 1.00 65.50  ? 105  LEU A O   1 
ATOM   828  C CB  . LEU A 1 110 ? 31.699 17.500  17.417 1.00 58.84  ? 105  LEU A CB  1 
ATOM   829  C CG  . LEU A 1 110 ? 31.947 16.999  15.980 1.00 61.60  ? 105  LEU A CG  1 
ATOM   830  C CD1 . LEU A 1 110 ? 31.131 15.747  15.673 1.00 58.09  ? 105  LEU A CD1 1 
ATOM   831  C CD2 . LEU A 1 110 ? 31.663 18.085  14.969 1.00 63.82  ? 105  LEU A CD2 1 
ATOM   832  N N   . ILE A 1 111 ? 32.446 18.191  20.335 1.00 62.29  ? 106  ILE A N   1 
ATOM   833  C CA  . ILE A 1 111 ? 32.126 18.547  21.722 1.00 62.17  ? 106  ILE A CA  1 
ATOM   834  C C   . ILE A 1 111 ? 32.967 19.717  22.265 1.00 67.18  ? 106  ILE A C   1 
ATOM   835  O O   . ILE A 1 111 ? 32.364 20.661  22.792 1.00 66.64  ? 106  ILE A O   1 
ATOM   836  C CB  . ILE A 1 111 ? 32.108 17.321  22.652 1.00 64.58  ? 106  ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 111 ? 30.953 16.392  22.244 1.00 62.25  ? 106  ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 111 ? 32.041 17.742  24.142 1.00 64.91  ? 106  ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 111 ? 30.929 15.021  22.917 1.00 64.70  ? 106  ILE A CD1 1 
ATOM   840  N N   . PRO A 1 112 ? 34.316 19.720  22.128 1.00 65.21  ? 107  PRO A N   1 
ATOM   841  C CA  . PRO A 1 112 ? 35.068 20.883  22.638 1.00 68.85  ? 107  PRO A CA  1 
ATOM   842  C C   . PRO A 1 112 ? 34.780 22.231  21.937 1.00 76.92  ? 107  PRO A C   1 
ATOM   843  O O   . PRO A 1 112 ? 34.898 23.255  22.585 1.00 79.96  ? 107  PRO A O   1 
ATOM   844  C CB  . PRO A 1 112 ? 36.538 20.471  22.516 1.00 72.03  ? 107  PRO A CB  1 
ATOM   845  C CG  . PRO A 1 112 ? 36.570 19.138  21.959 1.00 74.03  ? 107  PRO A CG  1 
ATOM   846  C CD  . PRO A 1 112 ? 35.214 18.693  21.556 1.00 66.73  ? 107  PRO A CD  1 
ATOM   847  N N   . ASN A 1 113 ? 34.408 22.239  20.644 1.00 73.24  ? 108  ASN A N   1 
ATOM   848  C CA  . ASN A 1 113 ? 34.139 23.472  19.899 1.00 74.23  ? 108  ASN A CA  1 
ATOM   849  C C   . ASN A 1 113 ? 32.686 23.909  20.043 1.00 77.95  ? 108  ASN A C   1 
ATOM   850  O O   . ASN A 1 113 ? 32.335 24.985  19.552 1.00 78.00  ? 108  ASN A O   1 
ATOM   851  C CB  . ASN A 1 113 ? 34.458 23.282  18.409 1.00 79.37  ? 108  ASN A CB  1 
ATOM   852  C CG  . ASN A 1 113 ? 35.918 23.308  18.058 1.00 115.28 ? 108  ASN A CG  1 
ATOM   853  O OD1 . ASN A 1 113 ? 36.387 24.219  17.371 1.00 114.89 ? 108  ASN A OD1 1 
ATOM   854  N ND2 . ASN A 1 113 ? 36.686 22.345  18.541 1.00 110.18 ? 108  ASN A ND2 1 
ATOM   855  N N   . ALA A 1 114 ? 31.816 23.072  20.659 1.00 73.08  ? 109  ALA A N   1 
ATOM   856  C CA  . ALA A 1 114 ? 30.404 23.448  20.768 1.00 70.25  ? 109  ALA A CA  1 
ATOM   857  C C   . ALA A 1 114 ? 30.226 24.604  21.743 1.00 75.21  ? 109  ALA A C   1 
ATOM   858  O O   . ALA A 1 114 ? 30.362 24.452  22.956 1.00 76.89  ? 109  ALA A O   1 
ATOM   859  C CB  . ALA A 1 114 ? 29.531 22.260  21.136 1.00 69.14  ? 109  ALA A CB  1 
ATOM   860  N N   . SER A 1 115 ? 29.965 25.774  21.197 1.00 70.87  ? 110  SER A N   1 
ATOM   861  C CA  . SER A 1 115 ? 29.854 26.989  21.996 1.00 73.11  ? 110  SER A CA  1 
ATOM   862  C C   . SER A 1 115 ? 28.402 27.379  22.298 1.00 77.26  ? 110  SER A C   1 
ATOM   863  O O   . SER A 1 115 ? 28.154 28.418  22.914 1.00 80.32  ? 110  SER A O   1 
ATOM   864  C CB  . SER A 1 115 ? 30.598 28.127  21.292 1.00 77.26  ? 110  SER A CB  1 
ATOM   865  O OG  . SER A 1 115 ? 29.967 28.529  20.086 1.00 84.21  ? 110  SER A OG  1 
ATOM   866  N N   . GLN A 1 116 ? 27.453 26.564  21.832 1.00 69.72  ? 111  GLN A N   1 
ATOM   867  C CA  . GLN A 1 116 ? 26.022 26.811  21.918 1.00 67.40  ? 111  GLN A CA  1 
ATOM   868  C C   . GLN A 1 116 ? 25.358 25.617  22.558 1.00 67.53  ? 111  GLN A C   1 
ATOM   869  O O   . GLN A 1 116 ? 25.688 24.481  22.218 1.00 66.09  ? 111  GLN A O   1 
ATOM   870  C CB  . GLN A 1 116 ? 25.446 27.042  20.505 1.00 66.81  ? 111  GLN A CB  1 
ATOM   871  C CG  . GLN A 1 116 ? 26.099 28.250  19.796 1.00 73.17  ? 111  GLN A CG  1 
ATOM   872  C CD  . GLN A 1 116 ? 25.541 28.549  18.436 1.00 79.45  ? 111  GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 116 ? 24.607 27.898  17.962 1.00 65.13  ? 111  GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 116 ? 26.082 29.578  17.787 1.00 75.75  ? 111  GLN A NE2 1 
ATOM   875  N N   . ALA A 1 117 ? 24.396 25.865  23.457 1.00 62.70  ? 112  ALA A N   1 
ATOM   876  C CA  . ALA A 1 117 ? 23.675 24.813  24.158 1.00 61.90  ? 112  ALA A CA  1 
ATOM   877  C C   . ALA A 1 117 ? 23.079 23.770  23.227 1.00 62.48  ? 112  ALA A C   1 
ATOM   878  O O   . ALA A 1 117 ? 23.226 22.584  23.484 1.00 60.06  ? 112  ALA A O   1 
ATOM   879  C CB  . ALA A 1 117 ? 22.588 25.401  25.041 1.00 62.83  ? 112  ALA A CB  1 
ATOM   880  N N   . GLU A 1 118 ? 22.395 24.216  22.165 1.00 58.66  ? 113  GLU A N   1 
ATOM   881  C CA  . GLU A 1 118 ? 21.722 23.345  21.207 1.00 56.03  ? 113  GLU A CA  1 
ATOM   882  C C   . GLU A 1 118 ? 22.698 22.341  20.574 1.00 57.44  ? 113  GLU A C   1 
ATOM   883  O O   . GLU A 1 118 ? 22.407 21.142  20.508 1.00 54.85  ? 113  GLU A O   1 
ATOM   884  C CB  . GLU A 1 118 ? 21.078 24.197  20.131 1.00 55.79  ? 113  GLU A CB  1 
ATOM   885  C CG  . GLU A 1 118 ? 20.393 23.379  19.070 1.00 61.54  ? 113  GLU A CG  1 
ATOM   886  C CD  . GLU A 1 118 ? 20.027 24.120  17.803 1.00 84.39  ? 113  GLU A CD  1 
ATOM   887  O OE1 . GLU A 1 118 ? 19.540 25.270  17.891 1.00 75.45  ? 113  GLU A OE1 1 
ATOM   888  O OE2 . GLU A 1 118 ? 20.175 23.513  16.717 1.00 82.15  ? 113  GLU A OE2 1 
ATOM   889  N N   . SER A 1 119 ? 23.877 22.839  20.175 1.00 53.65  ? 114  SER A N   1 
ATOM   890  C CA  . SER A 1 119 ? 24.903 22.004  19.574 1.00 54.05  ? 114  SER A CA  1 
ATOM   891  C C   . SER A 1 119 ? 25.538 21.077  20.632 1.00 59.17  ? 114  SER A C   1 
ATOM   892  O O   . SER A 1 119 ? 25.823 19.915  20.329 1.00 58.37  ? 114  SER A O   1 
ATOM   893  C CB  . SER A 1 119 ? 25.914 22.840  18.793 1.00 57.85  ? 114  SER A CB  1 
ATOM   894  O OG  . SER A 1 119 ? 26.797 23.525  19.658 1.00 75.99  ? 114  SER A OG  1 
ATOM   895  N N   . LYS A 1 120 ? 25.690 21.555  21.885 1.00 56.08  ? 115  LYS A N   1 
ATOM   896  C CA  . LYS A 1 120 ? 26.196 20.715  22.971 1.00 57.96  ? 115  LYS A CA  1 
ATOM   897  C C   . LYS A 1 120 ? 25.274 19.509  23.178 1.00 58.27  ? 115  LYS A C   1 
ATOM   898  O O   . LYS A 1 120 ? 25.737 18.376  23.243 1.00 58.91  ? 115  LYS A O   1 
ATOM   899  C CB  . LYS A 1 120 ? 26.339 21.518  24.270 1.00 63.39  ? 115  LYS A CB  1 
ATOM   900  C CG  . LYS A 1 120 ? 27.706 22.179  24.441 1.00 86.58  ? 115  LYS A CG  1 
ATOM   901  C CD  . LYS A 1 120 ? 27.808 22.976  25.757 1.00 100.43 ? 115  LYS A CD  1 
ATOM   902  C CE  . LYS A 1 120 ? 27.158 24.344  25.713 1.00 109.54 ? 115  LYS A CE  1 
ATOM   903  N NZ  . LYS A 1 120 ? 26.335 24.603  26.924 1.00 114.86 ? 115  LYS A NZ  1 
ATOM   904  N N   . VAL A 1 121 ? 23.973 19.755  23.229 1.00 52.05  ? 116  VAL A N   1 
ATOM   905  C CA  . VAL A 1 121 ? 22.972 18.704  23.401 1.00 49.99  ? 116  VAL A CA  1 
ATOM   906  C C   . VAL A 1 121 ? 22.997 17.739  22.224 1.00 52.19  ? 116  VAL A C   1 
ATOM   907  O O   . VAL A 1 121 ? 23.037 16.529  22.428 1.00 51.39  ? 116  VAL A O   1 
ATOM   908  C CB  . VAL A 1 121 ? 21.560 19.302  23.564 1.00 51.48  ? 116  VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 121 ? 20.511 18.185  23.591 1.00 49.09  ? 116  VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 121 ? 21.468 20.127  24.842 1.00 52.67  ? 116  VAL A CG2 1 
ATOM   911  N N   . PHE A 1 122 ? 23.033 18.285  21.002 1.00 46.93  ? 117  PHE A N   1 
ATOM   912  C CA  . PHE A 1 122 ? 23.039 17.463  19.806 1.00 45.86  ? 117  PHE A CA  1 
ATOM   913  C C   . PHE A 1 122 ? 24.211 16.489  19.843 1.00 51.71  ? 117  PHE A C   1 
ATOM   914  O O   . PHE A 1 122 ? 24.022 15.294  19.570 1.00 51.79  ? 117  PHE A O   1 
ATOM   915  C CB  . PHE A 1 122 ? 23.115 18.354  18.558 1.00 46.56  ? 117  PHE A CB  1 
ATOM   916  C CG  . PHE A 1 122 ? 22.976 17.579  17.264 1.00 46.17  ? 117  PHE A CG  1 
ATOM   917  C CD1 . PHE A 1 122 ? 24.063 16.902  16.716 1.00 48.46  ? 117  PHE A CD1 1 
ATOM   918  C CD2 . PHE A 1 122 ? 21.764 17.548  16.579 1.00 47.15  ? 117  PHE A CD2 1 
ATOM   919  C CE1 . PHE A 1 122 ? 23.940 16.219  15.505 1.00 49.13  ? 117  PHE A CE1 1 
ATOM   920  C CE2 . PHE A 1 122 ? 21.635 16.833  15.388 1.00 48.25  ? 117  PHE A CE2 1 
ATOM   921  C CZ  . PHE A 1 122 ? 22.720 16.156  14.869 1.00 46.44  ? 117  PHE A CZ  1 
ATOM   922  N N   . TYR A 1 123 ? 25.420 16.997  20.135 1.00 48.97  ? 118  TYR A N   1 
ATOM   923  C CA  . TYR A 1 123 ? 26.622 16.185  20.125 1.00 50.07  ? 118  TYR A CA  1 
ATOM   924  C C   . TYR A 1 123 ? 26.714 15.196  21.262 1.00 56.00  ? 118  TYR A C   1 
ATOM   925  O O   . TYR A 1 123 ? 27.210 14.081  21.074 1.00 56.25  ? 118  TYR A O   1 
ATOM   926  C CB  . TYR A 1 123 ? 27.876 17.038  20.070 1.00 52.34  ? 118  TYR A CB  1 
ATOM   927  C CG  . TYR A 1 123 ? 27.984 17.856  18.803 1.00 54.14  ? 118  TYR A CG  1 
ATOM   928  C CD1 . TYR A 1 123 ? 27.915 17.249  17.542 1.00 54.59  ? 118  TYR A CD1 1 
ATOM   929  C CD2 . TYR A 1 123 ? 28.269 19.218  18.855 1.00 55.72  ? 118  TYR A CD2 1 
ATOM   930  C CE1 . TYR A 1 123 ? 28.029 18.000  16.373 1.00 55.42  ? 118  TYR A CE1 1 
ATOM   931  C CE2 . TYR A 1 123 ? 28.422 19.971  17.692 1.00 56.20  ? 118  TYR A CE2 1 
ATOM   932  C CZ  . TYR A 1 123 ? 28.269 19.365  16.458 1.00 62.33  ? 118  TYR A CZ  1 
ATOM   933  O OH  . TYR A 1 123 ? 28.432 20.100  15.322 1.00 61.40  ? 118  TYR A OH  1 
ATOM   934  N N   . LEU A 1 124 ? 26.285 15.616  22.458 1.00 51.20  ? 119  LEU A N   1 
ATOM   935  C CA  . LEU A 1 124 ? 26.262 14.706  23.595 1.00 50.65  ? 119  LEU A CA  1 
ATOM   936  C C   . LEU A 1 124 ? 25.243 13.605  23.361 1.00 54.18  ? 119  LEU A C   1 
ATOM   937  O O   . LEU A 1 124 ? 25.536 12.459  23.693 1.00 55.72  ? 119  LEU A O   1 
ATOM   938  C CB  . LEU A 1 124 ? 26.056 15.415  24.948 1.00 51.48  ? 119  LEU A CB  1 
ATOM   939  C CG  . LEU A 1 124 ? 27.232 16.238  25.458 1.00 56.83  ? 119  LEU A CG  1 
ATOM   940  C CD1 . LEU A 1 124 ? 26.758 17.236  26.477 1.00 57.51  ? 119  LEU A CD1 1 
ATOM   941  C CD2 . LEU A 1 124 ? 28.331 15.334  26.018 1.00 58.58  ? 119  LEU A CD2 1 
ATOM   942  N N   . LYS A 1 125 ? 24.095 13.921  22.705 1.00 48.45  ? 120  LYS A N   1 
ATOM   943  C CA  . LYS A 1 125 ? 23.102 12.917  22.324 1.00 46.13  ? 120  LYS A CA  1 
ATOM   944  C C   . LYS A 1 125 ? 23.752 11.928  21.344 1.00 50.28  ? 120  LYS A C   1 
ATOM   945  O O   . LYS A 1 125 ? 23.636 10.732  21.545 1.00 49.79  ? 120  LYS A O   1 
ATOM   946  C CB  . LYS A 1 125 ? 21.884 13.561  21.678 1.00 44.95  ? 120  LYS A CB  1 
ATOM   947  C CG  . LYS A 1 125 ? 20.902 12.511  21.146 1.00 40.96  ? 120  LYS A CG  1 
ATOM   948  C CD  . LYS A 1 125 ? 19.783 13.188  20.374 1.00 43.44  ? 120  LYS A CD  1 
ATOM   949  C CE  . LYS A 1 125 ? 19.129 12.237  19.414 1.00 41.82  ? 120  LYS A CE  1 
ATOM   950  N NZ  . LYS A 1 125 ? 20.100 11.800  18.380 1.00 45.86  ? 120  LYS A NZ  1 
ATOM   951  N N   . MET A 1 126 ? 24.462 12.426  20.327 1.00 47.36  ? 121  MET A N   1 
ATOM   952  C CA  . MET A 1 126 ? 25.165 11.639  19.328 1.00 46.99  ? 121  MET A CA  1 
ATOM   953  C C   . MET A 1 126 ? 26.179 10.704  20.008 1.00 48.75  ? 121  MET A C   1 
ATOM   954  O O   . MET A 1 126 ? 26.253 9.527   19.655 1.00 47.92  ? 121  MET A O   1 
ATOM   955  C CB  . MET A 1 126 ? 25.863 12.609  18.386 1.00 49.96  ? 121  MET A CB  1 
ATOM   956  C CG  . MET A 1 126 ? 26.199 12.024  17.091 1.00 52.62  ? 121  MET A CG  1 
ATOM   957  S SD  . MET A 1 126 ? 26.693 13.325  15.954 1.00 55.82  ? 121  MET A SD  1 
ATOM   958  C CE  . MET A 1 126 ? 27.134 12.315  14.626 1.00 50.10  ? 121  MET A CE  1 
ATOM   959  N N   . LYS A 1 127 ? 26.919 11.211  21.003 1.00 44.69  ? 122  LYS A N   1 
ATOM   960  C CA  . LYS A 1 127 ? 27.872 10.393  21.755 1.00 46.24  ? 122  LYS A CA  1 
ATOM   961  C C   . LYS A 1 127 ? 27.124 9.239   22.467 1.00 53.10  ? 122  LYS A C   1 
ATOM   962  O O   . LYS A 1 127 ? 27.586 8.094   22.390 1.00 53.34  ? 122  LYS A O   1 
ATOM   963  C CB  . LYS A 1 127 ? 28.666 11.277  22.721 1.00 49.45  ? 122  LYS A CB  1 
ATOM   964  C CG  . LYS A 1 127 ? 29.696 10.551  23.561 1.00 57.89  ? 122  LYS A CG  1 
ATOM   965  C CD  . LYS A 1 127 ? 30.453 11.554  24.422 1.00 61.05  ? 122  LYS A CD  1 
ATOM   966  C CE  . LYS A 1 127 ? 31.534 10.901  25.257 1.00 52.32  ? 122  LYS A CE  1 
ATOM   967  N NZ  . LYS A 1 127 ? 32.054 11.855  26.287 1.00 52.01  ? 122  LYS A NZ  1 
ATOM   968  N N   . GLY A 1 128 ? 25.958 9.523   23.067 1.00 50.75  ? 123  GLY A N   1 
ATOM   969  C CA  . GLY A 1 128 ? 25.114 8.526   23.717 1.00 49.38  ? 123  GLY A CA  1 
ATOM   970  C C   . GLY A 1 128 ? 24.682 7.486   22.699 1.00 50.63  ? 123  GLY A C   1 
ATOM   971  O O   . GLY A 1 128 ? 24.779 6.290   22.958 1.00 48.74  ? 123  GLY A O   1 
ATOM   972  N N   . ASP A 1 129 ? 24.244 7.921   21.509 1.00 45.55  ? 124  ASP A N   1 
ATOM   973  C CA  . ASP A 1 129 ? 23.822 7.010   20.454 1.00 41.08  ? 124  ASP A CA  1 
ATOM   974  C C   . ASP A 1 129 ? 24.936 6.079   20.005 1.00 46.78  ? 124  ASP A C   1 
ATOM   975  O O   . ASP A 1 129 ? 24.680 4.892   19.852 1.00 46.10  ? 124  ASP A O   1 
ATOM   976  C CB  . ASP A 1 129 ? 23.342 7.810   19.242 1.00 40.46  ? 124  ASP A CB  1 
ATOM   977  C CG  . ASP A 1 129 ? 22.045 8.586   19.437 1.00 46.79  ? 124  ASP A CG  1 
ATOM   978  O OD1 . ASP A 1 129 ? 21.219 8.182   20.311 1.00 47.96  ? 124  ASP A OD1 1 
ATOM   979  O OD2 . ASP A 1 129 ? 21.852 9.597   18.723 1.00 48.06  ? 124  ASP A OD2 1 
ATOM   980  N N   . TYR A 1 130 ? 26.130 6.598   19.767 1.00 45.63  ? 125  TYR A N   1 
ATOM   981  C CA  . TYR A 1 130 ? 27.195 5.755   19.261 1.00 45.29  ? 125  TYR A CA  1 
ATOM   982  C C   . TYR A 1 130 ? 27.789 4.814   20.297 1.00 54.24  ? 125  TYR A C   1 
ATOM   983  O O   . TYR A 1 130 ? 28.222 3.729   19.951 1.00 56.70  ? 125  TYR A O   1 
ATOM   984  C CB  . TYR A 1 130 ? 28.221 6.552   18.470 1.00 45.51  ? 125  TYR A CB  1 
ATOM   985  C CG  . TYR A 1 130 ? 27.691 6.880   17.098 1.00 45.63  ? 125  TYR A CG  1 
ATOM   986  C CD1 . TYR A 1 130 ? 28.004 6.093   16.008 1.00 46.19  ? 125  TYR A CD1 1 
ATOM   987  C CD2 . TYR A 1 130 ? 26.830 7.944   16.905 1.00 45.13  ? 125  TYR A CD2 1 
ATOM   988  C CE1 . TYR A 1 130 ? 27.508 6.376   14.765 1.00 44.52  ? 125  TYR A CE1 1 
ATOM   989  C CE2 . TYR A 1 130 ? 26.329 8.233   15.665 1.00 44.29  ? 125  TYR A CE2 1 
ATOM   990  C CZ  . TYR A 1 130 ? 26.666 7.445   14.600 1.00 48.40  ? 125  TYR A CZ  1 
ATOM   991  O OH  . TYR A 1 130 ? 26.166 7.729   13.362 1.00 44.97  ? 125  TYR A OH  1 
ATOM   992  N N   . TYR A 1 131 ? 27.771 5.201   21.564 1.00 50.11  ? 126  TYR A N   1 
ATOM   993  C CA  . TYR A 1 131 ? 28.104 4.242   22.611 1.00 51.40  ? 126  TYR A CA  1 
ATOM   994  C C   . TYR A 1 131 ? 26.990 3.197   22.717 1.00 54.98  ? 126  TYR A C   1 
ATOM   995  O O   . TYR A 1 131 ? 27.288 2.017   22.959 1.00 54.21  ? 126  TYR A O   1 
ATOM   996  C CB  . TYR A 1 131 ? 28.401 4.901   23.960 1.00 54.99  ? 126  TYR A CB  1 
ATOM   997  C CG  . TYR A 1 131 ? 29.842 5.352   24.083 1.00 58.47  ? 126  TYR A CG  1 
ATOM   998  C CD1 . TYR A 1 131 ? 30.877 4.428   24.167 1.00 62.06  ? 126  TYR A CD1 1 
ATOM   999  C CD2 . TYR A 1 131 ? 30.170 6.703   24.100 1.00 60.13  ? 126  TYR A CD2 1 
ATOM   1000 C CE1 . TYR A 1 131 ? 32.208 4.838   24.292 1.00 65.07  ? 126  TYR A CE1 1 
ATOM   1001 C CE2 . TYR A 1 131 ? 31.494 7.126   24.229 1.00 63.50  ? 126  TYR A CE2 1 
ATOM   1002 C CZ  . TYR A 1 131 ? 32.512 6.192   24.302 1.00 71.78  ? 126  TYR A CZ  1 
ATOM   1003 O OH  . TYR A 1 131 ? 33.803 6.644   24.411 1.00 73.85  ? 126  TYR A OH  1 
ATOM   1004 N N   . ARG A 1 132 ? 25.714 3.614   22.476 1.00 50.00  ? 127  ARG A N   1 
ATOM   1005 C CA  . ARG A 1 132 ? 24.591 2.670   22.467 1.00 49.52  ? 127  ARG A CA  1 
ATOM   1006 C C   . ARG A 1 132 ? 24.780 1.644   21.331 1.00 53.79  ? 127  ARG A C   1 
ATOM   1007 O O   . ARG A 1 132 ? 24.532 0.462   21.541 1.00 55.10  ? 127  ARG A O   1 
ATOM   1008 C CB  . ARG A 1 132 ? 23.242 3.393   22.331 1.00 44.25  ? 127  ARG A CB  1 
ATOM   1009 C CG  . ARG A 1 132 ? 22.074 2.428   22.158 1.00 49.87  ? 127  ARG A CG  1 
ATOM   1010 C CD  . ARG A 1 132 ? 20.723 3.076   22.418 1.00 47.69  ? 127  ARG A CD  1 
ATOM   1011 N NE  . ARG A 1 132 ? 20.521 4.280   21.606 1.00 47.44  ? 127  ARG A NE  1 
ATOM   1012 C CZ  . ARG A 1 132 ? 19.954 4.300   20.410 1.00 51.29  ? 127  ARG A CZ  1 
ATOM   1013 N NH1 . ARG A 1 132 ? 19.458 3.179   19.880 1.00 37.74  ? 127  ARG A NH1 1 
ATOM   1014 N NH2 . ARG A 1 132 ? 19.823 5.443   19.755 1.00 40.62  ? 127  ARG A NH2 1 
ATOM   1015 N N   . TYR A 1 133 ? 25.256 2.074   20.156 1.00 48.59  ? 128  TYR A N   1 
ATOM   1016 C CA  . TYR A 1 133 ? 25.475 1.123   19.061 1.00 46.99  ? 128  TYR A CA  1 
ATOM   1017 C C   . TYR A 1 133 ? 26.622 0.172   19.417 1.00 52.92  ? 128  TYR A C   1 
ATOM   1018 O O   . TYR A 1 133 ? 26.549 -1.004  19.099 1.00 52.04  ? 128  TYR A O   1 
ATOM   1019 C CB  . TYR A 1 133 ? 25.734 1.844   17.742 1.00 45.08  ? 128  TYR A CB  1 
ATOM   1020 C CG  . TYR A 1 133 ? 24.664 2.841   17.330 1.00 45.54  ? 128  TYR A CG  1 
ATOM   1021 C CD1 . TYR A 1 133 ? 23.329 2.675   17.717 1.00 46.83  ? 128  TYR A CD1 1 
ATOM   1022 C CD2 . TYR A 1 133 ? 24.986 3.963   16.581 1.00 45.11  ? 128  TYR A CD2 1 
ATOM   1023 C CE1 . TYR A 1 133 ? 22.354 3.613   17.378 1.00 46.05  ? 128  TYR A CE1 1 
ATOM   1024 C CE2 . TYR A 1 133 ? 24.014 4.904   16.228 1.00 43.72  ? 128  TYR A CE2 1 
ATOM   1025 C CZ  . TYR A 1 133 ? 22.707 4.733   16.643 1.00 48.39  ? 128  TYR A CZ  1 
ATOM   1026 O OH  . TYR A 1 133 ? 21.755 5.661   16.294 1.00 45.07  ? 128  TYR A OH  1 
ATOM   1027 N N   . LEU A 1 134 ? 27.646 0.661   20.111 1.00 52.21  ? 129  LEU A N   1 
ATOM   1028 C CA  . LEU A 1 134 ? 28.737 -0.205  20.575 1.00 54.34  ? 129  LEU A CA  1 
ATOM   1029 C C   . LEU A 1 134 ? 28.205 -1.189  21.622 1.00 60.39  ? 129  LEU A C   1 
ATOM   1030 O O   . LEU A 1 134 ? 28.546 -2.363  21.588 1.00 61.13  ? 129  LEU A O   1 
ATOM   1031 C CB  . LEU A 1 134 ? 29.872 0.634   21.170 1.00 55.71  ? 129  LEU A CB  1 
ATOM   1032 C CG  . LEU A 1 134 ? 30.838 1.319   20.182 1.00 59.30  ? 129  LEU A CG  1 
ATOM   1033 C CD1 . LEU A 1 134 ? 31.865 2.170   20.918 1.00 60.03  ? 129  LEU A CD1 1 
ATOM   1034 C CD2 . LEU A 1 134 ? 31.520 0.327   19.228 1.00 62.62  ? 129  LEU A CD2 1 
ATOM   1035 N N   . ALA A 1 135 ? 27.316 -0.726  22.509 1.00 57.28  ? 130  ALA A N   1 
ATOM   1036 C CA  . ALA A 1 135 ? 26.726 -1.587  23.532 1.00 57.91  ? 130  ALA A CA  1 
ATOM   1037 C C   . ALA A 1 135 ? 25.899 -2.723  22.903 1.00 60.51  ? 130  ALA A C   1 
ATOM   1038 O O   . ALA A 1 135 ? 25.871 -3.831  23.446 1.00 60.90  ? 130  ALA A O   1 
ATOM   1039 C CB  . ALA A 1 135 ? 25.865 -0.776  24.479 1.00 58.49  ? 130  ALA A CB  1 
ATOM   1040 N N   . GLU A 1 136 ? 25.230 -2.456  21.761 1.00 54.51  ? 131  GLU A N   1 
ATOM   1041 C CA  . GLU A 1 136 ? 24.439 -3.489  21.088 1.00 52.64  ? 131  GLU A CA  1 
ATOM   1042 C C   . GLU A 1 136 ? 25.303 -4.688  20.672 1.00 57.86  ? 131  GLU A C   1 
ATOM   1043 O O   . GLU A 1 136 ? 24.759 -5.758  20.505 1.00 57.66  ? 131  GLU A O   1 
ATOM   1044 C CB  . GLU A 1 136 ? 23.700 -2.916  19.869 1.00 50.74  ? 131  GLU A CB  1 
ATOM   1045 C CG  . GLU A 1 136 ? 22.566 -1.944  20.192 1.00 52.71  ? 131  GLU A CG  1 
ATOM   1046 C CD  . GLU A 1 136 ? 21.904 -1.285  18.982 1.00 60.93  ? 131  GLU A CD  1 
ATOM   1047 O OE1 . GLU A 1 136 ? 22.541 -1.254  17.906 1.00 41.51  ? 131  GLU A OE1 1 
ATOM   1048 O OE2 . GLU A 1 136 ? 20.780 -0.743  19.106 1.00 53.46  ? 131  GLU A OE2 1 
ATOM   1049 N N   . VAL A 1 137 ? 26.620 -4.497  20.478 1.00 56.95  ? 132  VAL A N   1 
ATOM   1050 C CA  . VAL A 1 137 ? 27.571 -5.553  20.054 1.00 58.04  ? 132  VAL A CA  1 
ATOM   1051 C C   . VAL A 1 137 ? 28.688 -5.852  21.052 1.00 69.13  ? 132  VAL A C   1 
ATOM   1052 O O   . VAL A 1 137 ? 29.671 -6.522  20.698 1.00 71.08  ? 132  VAL A O   1 
ATOM   1053 C CB  . VAL A 1 137 ? 28.162 -5.298  18.637 1.00 59.45  ? 132  VAL A CB  1 
ATOM   1054 C CG1 . VAL A 1 137 ? 27.057 -5.189  17.598 1.00 57.16  ? 132  VAL A CG1 1 
ATOM   1055 C CG2 . VAL A 1 137 ? 29.096 -4.088  18.578 1.00 58.94  ? 132  VAL A CG2 1 
ATOM   1056 N N   . ALA A 1 138 ? 28.577 -5.338  22.274 1.00 69.58  ? 133  ALA A N   1 
ATOM   1057 C CA  . ALA A 1 138 ? 29.650 -5.471  23.252 1.00 73.40  ? 133  ALA A CA  1 
ATOM   1058 C C   . ALA A 1 138 ? 29.822 -6.854  23.858 1.00 83.98  ? 133  ALA A C   1 
ATOM   1059 O O   . ALA A 1 138 ? 28.818 -7.507  24.161 1.00 82.56  ? 133  ALA A O   1 
ATOM   1060 C CB  . ALA A 1 138 ? 29.502 -4.435  24.354 1.00 74.71  ? 133  ALA A CB  1 
ATOM   1061 N N   . ALA A 1 139 ? 31.116 -7.270  24.080 1.00 86.20  ? 134  ALA A N   1 
ATOM   1062 C CA  . ALA A 1 139 ? 31.505 -8.488  24.800 1.00 90.13  ? 134  ALA A CA  1 
ATOM   1063 C C   . ALA A 1 139 ? 31.018 -8.278  26.222 1.00 98.45  ? 134  ALA A C   1 
ATOM   1064 O O   . ALA A 1 139 ? 31.143 -7.163  26.743 1.00 98.74  ? 134  ALA A O   1 
ATOM   1065 C CB  . ALA A 1 139 ? 33.031 -8.638  24.810 1.00 93.54  ? 134  ALA A CB  1 
ATOM   1066 N N   . GLY A 1 140 ? 30.474 -9.321  26.846 1.00 96.81  ? 135  GLY A N   1 
ATOM   1067 C CA  . GLY A 1 140 ? 29.982 -9.225  28.217 1.00 98.48  ? 135  GLY A CA  1 
ATOM   1068 C C   . GLY A 1 140 ? 30.924 -8.456  29.123 1.00 105.21 ? 135  GLY A C   1 
ATOM   1069 O O   . GLY A 1 140 ? 30.487 -7.658  29.957 1.00 105.54 ? 135  GLY A O   1 
ATOM   1070 N N   . ASP A 1 141 ? 32.228 -8.641  28.914 1.00 103.03 ? 136  ASP A N   1 
ATOM   1071 C CA  . ASP A 1 141 ? 33.217 -7.983  29.739 1.00 105.16 ? 136  ASP A CA  1 
ATOM   1072 C C   . ASP A 1 141 ? 33.398 -6.488  29.522 1.00 106.08 ? 136  ASP A C   1 
ATOM   1073 O O   . ASP A 1 141 ? 33.704 -5.773  30.477 1.00 107.23 ? 136  ASP A O   1 
ATOM   1074 C CB  . ASP A 1 141 ? 34.528 -8.768  29.742 1.00 110.21 ? 136  ASP A CB  1 
ATOM   1075 C CG  . ASP A 1 141 ? 34.407 -10.111 30.444 1.00 125.81 ? 136  ASP A CG  1 
ATOM   1076 O OD1 . ASP A 1 141 ? 33.669 -10.193 31.459 1.00 127.23 ? 136  ASP A OD1 1 
ATOM   1077 O OD2 . ASP A 1 141 ? 35.065 -11.075 29.997 1.00 135.02 ? 136  ASP A OD2 1 
ATOM   1078 N N   . ASP A 1 142 ? 33.166 -6.004  28.299 1.00 98.61  ? 137  ASP A N   1 
ATOM   1079 C CA  . ASP A 1 142 ? 33.330 -4.587  27.956 1.00 95.92  ? 137  ASP A CA  1 
ATOM   1080 C C   . ASP A 1 142 ? 32.057 -3.826  28.070 1.00 91.82  ? 137  ASP A C   1 
ATOM   1081 O O   . ASP A 1 142 ? 32.080 -2.593  28.125 1.00 90.24  ? 137  ASP A O   1 
ATOM   1082 C CB  . ASP A 1 142 ? 33.809 -4.454  26.512 1.00 96.81  ? 137  ASP A CB  1 
ATOM   1083 C CG  . ASP A 1 142 ? 35.131 -5.131  26.245 1.00 116.58 ? 137  ASP A CG  1 
ATOM   1084 O OD1 . ASP A 1 142 ? 35.910 -5.321  27.209 1.00 120.97 ? 137  ASP A OD1 1 
ATOM   1085 O OD2 . ASP A 1 142 ? 35.391 -5.473  25.076 1.00 124.47 ? 137  ASP A OD2 1 
ATOM   1086 N N   . LYS A 1 143 ? 30.944 -4.553  28.045 1.00 83.66  ? 138  LYS A N   1 
ATOM   1087 C CA  . LYS A 1 143 ? 29.610 -3.979  28.058 1.00 80.38  ? 138  LYS A CA  1 
ATOM   1088 C C   . LYS A 1 143 ? 29.345 -2.965  29.132 1.00 83.12  ? 138  LYS A C   1 
ATOM   1089 O O   . LYS A 1 143 ? 28.841 -1.901  28.795 1.00 81.35  ? 138  LYS A O   1 
ATOM   1090 C CB  . LYS A 1 143 ? 28.510 -5.045  28.023 1.00 81.08  ? 138  LYS A CB  1 
ATOM   1091 C CG  . LYS A 1 143 ? 27.160 -4.489  27.610 1.00 81.39  ? 138  LYS A CG  1 
ATOM   1092 C CD  . LYS A 1 143 ? 26.119 -5.564  27.567 1.00 87.09  ? 138  LYS A CD  1 
ATOM   1093 C CE  . LYS A 1 143 ? 24.785 -4.961  27.320 1.00 84.33  ? 138  LYS A CE  1 
ATOM   1094 N NZ  . LYS A 1 143 ? 23.712 -5.927  27.622 1.00 91.17  ? 138  LYS A NZ  1 
ATOM   1095 N N   . LYS A 1 144 ? 29.679 -3.253  30.401 1.00 80.11  ? 139  LYS A N   1 
ATOM   1096 C CA  . LYS A 1 144 ? 29.391 -2.315  31.482 1.00 80.15  ? 139  LYS A CA  1 
ATOM   1097 C C   . LYS A 1 144 ? 29.941 -0.925  31.220 1.00 80.29  ? 139  LYS A C   1 
ATOM   1098 O O   . LYS A 1 144 ? 29.211 0.045   31.386 1.00 78.37  ? 139  LYS A O   1 
ATOM   1099 C CB  . LYS A 1 144 ? 29.844 -2.850  32.870 1.00 86.08  ? 139  LYS A CB  1 
ATOM   1100 C CG  . LYS A 1 144 ? 29.858 -1.785  33.986 1.00 110.51 ? 139  LYS A CG  1 
ATOM   1101 C CD  . LYS A 1 144 ? 30.374 -2.333  35.315 1.00 126.53 ? 139  LYS A CD  1 
ATOM   1102 C CE  . LYS A 1 144 ? 31.694 -1.739  35.750 1.00 139.99 ? 139  LYS A CE  1 
ATOM   1103 N NZ  . LYS A 1 144 ? 32.228 -2.435  36.947 1.00 152.75 ? 139  LYS A NZ  1 
ATOM   1104 N N   . GLY A 1 145 ? 31.228 -0.845  30.894 1.00 76.76  ? 140  GLY A N   1 
ATOM   1105 C CA  . GLY A 1 145 ? 31.904 0.421   30.654 1.00 75.98  ? 140  GLY A CA  1 
ATOM   1106 C C   . GLY A 1 145 ? 31.262 1.210   29.531 1.00 76.09  ? 140  GLY A C   1 
ATOM   1107 O O   . GLY A 1 145 ? 31.157 2.440   29.616 1.00 75.73  ? 140  GLY A O   1 
ATOM   1108 N N   . ILE A 1 146 ? 30.875 0.500   28.440 1.00 68.58  ? 141  ILE A N   1 
ATOM   1109 C CA  . ILE A 1 146 ? 30.277 1.079   27.239 1.00 66.11  ? 141  ILE A CA  1 
ATOM   1110 C C   . ILE A 1 146 ? 28.887 1.609   27.560 1.00 70.67  ? 141  ILE A C   1 
ATOM   1111 O O   . ILE A 1 146 ? 28.565 2.752   27.223 1.00 70.34  ? 141  ILE A O   1 
ATOM   1112 C CB  . ILE A 1 146 ? 30.287 0.064   26.069 1.00 67.54  ? 141  ILE A CB  1 
ATOM   1113 C CG1 . ILE A 1 146 ? 31.725 -0.153  25.559 1.00 69.23  ? 141  ILE A CG1 1 
ATOM   1114 C CG2 . ILE A 1 146 ? 29.416 0.536   24.924 1.00 64.41  ? 141  ILE A CG2 1 
ATOM   1115 C CD1 . ILE A 1 146 ? 31.894 -1.474  24.786 1.00 79.00  ? 141  ILE A CD1 1 
ATOM   1116 N N   . VAL A 1 147 ? 28.098 0.804   28.273 1.00 67.05  ? 142  VAL A N   1 
ATOM   1117 C CA  . VAL A 1 147 ? 26.778 1.200   28.741 1.00 65.26  ? 142  VAL A CA  1 
ATOM   1118 C C   . VAL A 1 147 ? 26.885 2.458   29.607 1.00 70.45  ? 142  VAL A C   1 
ATOM   1119 O O   . VAL A 1 147 ? 26.100 3.392   29.404 1.00 68.74  ? 142  VAL A O   1 
ATOM   1120 C CB  . VAL A 1 147 ? 26.101 0.026   29.457 1.00 68.77  ? 142  VAL A CB  1 
ATOM   1121 C CG1 . VAL A 1 147 ? 24.849 0.459   30.200 1.00 68.11  ? 142  VAL A CG1 1 
ATOM   1122 C CG2 . VAL A 1 147 ? 25.766 -1.060  28.455 1.00 66.85  ? 142  VAL A CG2 1 
ATOM   1123 N N   . ASP A 1 148 ? 27.867 2.504   30.528 1.00 68.15  ? 143  ASP A N   1 
ATOM   1124 C CA  . ASP A 1 148 ? 28.100 3.674   31.369 1.00 69.26  ? 143  ASP A CA  1 
ATOM   1125 C C   . ASP A 1 148 ? 28.428 4.910   30.560 1.00 69.66  ? 143  ASP A C   1 
ATOM   1126 O O   . ASP A 1 148 ? 27.937 5.984   30.882 1.00 67.93  ? 143  ASP A O   1 
ATOM   1127 C CB  . ASP A 1 148 ? 29.204 3.413   32.409 1.00 75.03  ? 143  ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 148 ? 28.760 2.504   33.535 1.00 100.90 ? 143  ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 148 ? 27.541 2.218   33.624 1.00 102.22 ? 143  ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 148 ? 29.633 2.083   34.348 1.00 114.07 ? 143  ASP A OD2 1 
ATOM   1131 N N   . GLN A 1 149 ? 29.285 4.772   29.539 1.00 66.12  ? 144  GLN A N   1 
ATOM   1132 C CA  . GLN A 1 149 ? 29.640 5.911   28.693 1.00 65.49  ? 144  GLN A CA  1 
ATOM   1133 C C   . GLN A 1 149 ? 28.409 6.431   27.945 1.00 66.45  ? 144  GLN A C   1 
ATOM   1134 O O   . GLN A 1 149 ? 28.254 7.640   27.818 1.00 67.90  ? 144  GLN A O   1 
ATOM   1135 C CB  . GLN A 1 149 ? 30.786 5.573   27.721 1.00 67.39  ? 144  GLN A CB  1 
ATOM   1136 C CG  . GLN A 1 149 ? 32.193 5.581   28.349 1.00 82.63  ? 144  GLN A CG  1 
ATOM   1137 C CD  . GLN A 1 149 ? 32.653 6.979   28.738 1.00 104.52 ? 144  GLN A CD  1 
ATOM   1138 O OE1 . GLN A 1 149 ? 32.848 7.863   27.892 1.00 96.48  ? 144  GLN A OE1 1 
ATOM   1139 N NE2 . GLN A 1 149 ? 32.847 7.210   30.036 1.00 99.56  ? 144  GLN A NE2 1 
ATOM   1140 N N   . SER A 1 150 ? 27.543 5.543   27.451 1.00 58.69  ? 145  SER A N   1 
ATOM   1141 C CA  . SER A 1 150 ? 26.327 5.962   26.742 1.00 55.00  ? 145  SER A CA  1 
ATOM   1142 C C   . SER A 1 150 ? 25.403 6.725   27.679 1.00 60.09  ? 145  SER A C   1 
ATOM   1143 O O   . SER A 1 150 ? 24.972 7.831   27.360 1.00 59.73  ? 145  SER A O   1 
ATOM   1144 C CB  . SER A 1 150 ? 25.604 4.732   26.211 1.00 55.08  ? 145  SER A CB  1 
ATOM   1145 O OG  . SER A 1 150 ? 24.469 5.102   25.444 1.00 58.10  ? 145  SER A OG  1 
ATOM   1146 N N   . GLN A 1 151 ? 25.127 6.146   28.845 1.00 58.61  ? 146  GLN A N   1 
ATOM   1147 C CA  . GLN A 1 151 ? 24.242 6.755   29.823 1.00 58.23  ? 146  GLN A CA  1 
ATOM   1148 C C   . GLN A 1 151 ? 24.738 8.115   30.271 1.00 62.40  ? 146  GLN A C   1 
ATOM   1149 O O   . GLN A 1 151 ? 23.930 9.036   30.351 1.00 59.22  ? 146  GLN A O   1 
ATOM   1150 C CB  . GLN A 1 151 ? 24.061 5.833   31.022 1.00 61.07  ? 146  GLN A CB  1 
ATOM   1151 C CG  . GLN A 1 151 ? 23.009 6.319   32.016 1.00 70.48  ? 146  GLN A CG  1 
ATOM   1152 C CD  . GLN A 1 151 ? 22.556 5.274   33.010 1.00 88.45  ? 146  GLN A CD  1 
ATOM   1153 O OE1 . GLN A 1 151 ? 23.107 4.175   33.125 1.00 85.56  ? 146  GLN A OE1 1 
ATOM   1154 N NE2 . GLN A 1 151 ? 21.508 5.589   33.747 1.00 81.80  ? 146  GLN A NE2 1 
ATOM   1155 N N   . GLN A 1 152 ? 26.043 8.258   30.568 1.00 63.05  ? 147  GLN A N   1 
ATOM   1156 C CA  . GLN A 1 152 ? 26.577 9.551   31.016 1.00 64.98  ? 147  GLN A CA  1 
ATOM   1157 C C   . GLN A 1 152 ? 26.460 10.612  29.934 1.00 68.11  ? 147  GLN A C   1 
ATOM   1158 O O   . GLN A 1 152 ? 26.202 11.771  30.256 1.00 69.87  ? 147  GLN A O   1 
ATOM   1159 C CB  . GLN A 1 152 ? 28.028 9.443   31.495 1.00 68.99  ? 147  GLN A CB  1 
ATOM   1160 C CG  . GLN A 1 152 ? 28.200 8.727   32.832 1.00 87.73  ? 147  GLN A CG  1 
ATOM   1161 C CD  . GLN A 1 152 ? 29.631 8.286   33.053 1.00 114.22 ? 147  GLN A CD  1 
ATOM   1162 O OE1 . GLN A 1 152 ? 30.581 9.064   32.875 1.00 112.49 ? 147  GLN A OE1 1 
ATOM   1163 N NE2 . GLN A 1 152 ? 29.820 7.026   33.460 1.00 106.47 ? 147  GLN A NE2 1 
ATOM   1164 N N   . ALA A 1 153 ? 26.671 10.237  28.656 1.00 61.92  ? 148  ALA A N   1 
ATOM   1165 C CA  . ALA A 1 153 ? 26.576 11.222  27.581 1.00 59.07  ? 148  ALA A CA  1 
ATOM   1166 C C   . ALA A 1 153 ? 25.120 11.672  27.461 1.00 57.43  ? 148  ALA A C   1 
ATOM   1167 O O   . ALA A 1 153 ? 24.868 12.871  27.451 1.00 55.99  ? 148  ALA A O   1 
ATOM   1168 C CB  . ALA A 1 153 ? 27.105 10.666  26.253 1.00 59.07  ? 148  ALA A CB  1 
ATOM   1169 N N   . TYR A 1 154 ? 24.166 10.723  27.454 1.00 50.66  ? 149  TYR A N   1 
ATOM   1170 C CA  . TYR A 1 154 ? 22.745 11.066  27.397 1.00 48.63  ? 149  TYR A CA  1 
ATOM   1171 C C   . TYR A 1 154 ? 22.306 11.887  28.602 1.00 54.17  ? 149  TYR A C   1 
ATOM   1172 O O   . TYR A 1 154 ? 21.576 12.841  28.418 1.00 52.78  ? 149  TYR A O   1 
ATOM   1173 C CB  . TYR A 1 154 ? 21.885 9.805   27.359 1.00 48.73  ? 149  TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 154 ? 21.801 9.069   26.034 1.00 48.91  ? 149  TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 154 ? 21.400 9.726   24.871 1.00 49.45  ? 149  TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 154 ? 21.930 7.686   25.983 1.00 48.87  ? 149  TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 154 ? 21.257 9.040   23.665 1.00 49.84  ? 149  TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 154 ? 21.787 6.991   24.794 1.00 47.95  ? 149  TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 154 ? 21.439 7.668   23.638 1.00 54.47  ? 149  TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 154 ? 21.335 6.965   22.468 1.00 48.61  ? 149  TYR A OH  1 
ATOM   1181 N N   . GLN A 1 155 ? 22.770 11.532  29.816 1.00 53.60  ? 150  GLN A N   1 
ATOM   1182 C CA  . GLN A 1 155 ? 22.406 12.240  31.034 1.00 55.92  ? 150  GLN A CA  1 
ATOM   1183 C C   . GLN A 1 155 ? 22.884 13.681  30.994 1.00 61.17  ? 150  GLN A C   1 
ATOM   1184 O O   . GLN A 1 155 ? 22.110 14.600  31.309 1.00 59.97  ? 150  GLN A O   1 
ATOM   1185 C CB  . GLN A 1 155 ? 22.938 11.515  32.277 1.00 59.59  ? 150  GLN A CB  1 
ATOM   1186 C CG  . GLN A 1 155 ? 22.325 12.050  33.581 1.00 63.07  ? 150  GLN A CG  1 
ATOM   1187 C CD  . GLN A 1 155 ? 20.813 11.914  33.646 1.00 72.23  ? 150  GLN A CD  1 
ATOM   1188 O OE1 . GLN A 1 155 ? 20.237 10.862  33.328 1.00 64.47  ? 150  GLN A OE1 1 
ATOM   1189 N NE2 . GLN A 1 155 ? 20.132 12.986  34.027 1.00 62.87  ? 150  GLN A NE2 1 
ATOM   1190 N N   . GLU A 1 156 ? 24.131 13.897  30.535 1.00 60.04  ? 151  GLU A N   1 
ATOM   1191 C CA  . GLU A 1 156 ? 24.630 15.270  30.426 1.00 62.20  ? 151  GLU A CA  1 
ATOM   1192 C C   . GLU A 1 156 ? 23.835 16.068  29.391 1.00 65.67  ? 151  GLU A C   1 
ATOM   1193 O O   . GLU A 1 156 ? 23.451 17.211  29.662 1.00 66.19  ? 151  GLU A O   1 
ATOM   1194 C CB  . GLU A 1 156 ? 26.123 15.330  30.109 1.00 65.26  ? 151  GLU A CB  1 
ATOM   1195 C CG  . GLU A 1 156 ? 26.599 16.783  30.164 1.00 75.72  ? 151  GLU A CG  1 
ATOM   1196 C CD  . GLU A 1 156 ? 28.071 17.099  29.983 1.00 85.18  ? 151  GLU A CD  1 
ATOM   1197 O OE1 . GLU A 1 156 ? 28.854 16.177  29.669 1.00 70.76  ? 151  GLU A OE1 1 
ATOM   1198 O OE2 . GLU A 1 156 ? 28.439 18.285  30.147 1.00 87.29  ? 151  GLU A OE2 1 
ATOM   1199 N N   . ALA A 1 157 ? 23.540 15.450  28.228 1.00 60.53  ? 152  ALA A N   1 
ATOM   1200 C CA  . ALA A 1 157 ? 22.729 16.109  27.189 1.00 58.13  ? 152  ALA A CA  1 
ATOM   1201 C C   . ALA A 1 157 ? 21.335 16.454  27.766 1.00 62.55  ? 152  ALA A C   1 
ATOM   1202 O O   . ALA A 1 157 ? 20.779 17.513  27.465 1.00 62.36  ? 152  ALA A O   1 
ATOM   1203 C CB  . ALA A 1 157 ? 22.557 15.180  25.986 1.00 56.51  ? 152  ALA A CB  1 
ATOM   1204 N N   . PHE A 1 158 ? 20.754 15.524  28.537 1.00 58.70  ? 153  PHE A N   1 
ATOM   1205 C CA  . PHE A 1 158 ? 19.443 15.648  29.155 1.00 58.31  ? 153  PHE A CA  1 
ATOM   1206 C C   . PHE A 1 158 ? 19.363 16.849  30.094 1.00 62.88  ? 153  PHE A C   1 
ATOM   1207 O O   . PHE A 1 158 ? 18.413 17.618  30.004 1.00 63.15  ? 153  PHE A O   1 
ATOM   1208 C CB  . PHE A 1 158 ? 19.116 14.333  29.879 1.00 60.69  ? 153  PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 158 ? 17.678 14.214  30.279 1.00 62.02  ? 153  PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 158 ? 17.280 14.501  31.576 1.00 67.41  ? 153  PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 158 ? 16.699 13.899  29.337 1.00 61.58  ? 153  PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 158 ? 15.934 14.435  31.939 1.00 68.47  ? 153  PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 158 ? 15.357 13.810  29.703 1.00 64.43  ? 153  PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 158 ? 14.981 14.083  31.001 1.00 65.22  ? 153  PHE A CZ  1 
ATOM   1215 N N   . GLU A 1 159 ? 20.367 17.025  30.955 1.00 60.92  ? 154  GLU A N   1 
ATOM   1216 C CA  . GLU A 1 159 ? 20.424 18.135  31.903 1.00 62.70  ? 154  GLU A CA  1 
ATOM   1217 C C   . GLU A 1 159 ? 20.475 19.446  31.156 1.00 66.82  ? 154  GLU A C   1 
ATOM   1218 O O   . GLU A 1 159 ? 19.741 20.370  31.500 1.00 67.66  ? 154  GLU A O   1 
ATOM   1219 C CB  . GLU A 1 159 ? 21.639 18.027  32.843 1.00 66.76  ? 154  GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 159 ? 21.756 16.741  33.658 1.00 81.65  ? 154  GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 159 ? 20.692 16.380  34.680 1.00 103.59 ? 154  GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 159 ? 19.585 16.969  34.660 1.00 82.33  ? 154  GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 159 ? 20.969 15.468  35.493 1.00 104.23 ? 154  GLU A OE2 1 
ATOM   1224 N N   . ILE A 1 160 ? 21.315 19.529  30.122 1.00 61.17  ? 155  ILE A N   1 
ATOM   1225 C CA  . ILE A 1 160 ? 21.435 20.768  29.372 1.00 59.62  ? 155  ILE A CA  1 
ATOM   1226 C C   . ILE A 1 160 ? 20.143 21.092  28.632 1.00 61.25  ? 155  ILE A C   1 
ATOM   1227 O O   . ILE A 1 160 ? 19.721 22.254  28.618 1.00 58.87  ? 155  ILE A O   1 
ATOM   1228 C CB  . ILE A 1 160 ? 22.644 20.735  28.419 1.00 62.15  ? 155  ILE A CB  1 
ATOM   1229 C CG1 . ILE A 1 160 ? 23.975 20.505  29.185 1.00 64.48  ? 155  ILE A CG1 1 
ATOM   1230 C CG2 . ILE A 1 160 ? 22.700 22.033  27.587 1.00 60.80  ? 155  ILE A CG2 1 
ATOM   1231 C CD1 . ILE A 1 160 ? 25.164 20.216  28.283 1.00 64.69  ? 155  ILE A CD1 1 
ATOM   1232 N N   . SER A 1 161 ? 19.521 20.077  27.982 1.00 56.40  ? 156  SER A N   1 
ATOM   1233 C CA  . SER A 1 161 ? 18.282 20.334  27.249 1.00 53.82  ? 156  SER A CA  1 
ATOM   1234 C C   . SER A 1 161 ? 17.177 20.777  28.177 1.00 59.40  ? 156  SER A C   1 
ATOM   1235 O O   . SER A 1 161 ? 16.384 21.633  27.805 1.00 59.55  ? 156  SER A O   1 
ATOM   1236 C CB  . SER A 1 161 ? 17.826 19.129  26.423 1.00 53.56  ? 156  SER A CB  1 
ATOM   1237 O OG  . SER A 1 161 ? 17.340 18.080  27.241 1.00 61.84  ? 156  SER A OG  1 
ATOM   1238 N N   . LYS A 1 162 ? 17.109 20.187  29.365 1.00 58.92  ? 157  LYS A N   1 
ATOM   1239 C CA  . LYS A 1 162 ? 16.082 20.544  30.335 1.00 60.53  ? 157  LYS A CA  1 
ATOM   1240 C C   . LYS A 1 162 ? 16.245 22.008  30.795 1.00 65.53  ? 157  LYS A C   1 
ATOM   1241 O O   . LYS A 1 162 ? 15.254 22.693  31.035 1.00 64.86  ? 157  LYS A O   1 
ATOM   1242 C CB  . LYS A 1 162 ? 16.123 19.592  31.528 1.00 63.79  ? 157  LYS A CB  1 
ATOM   1243 C CG  . LYS A 1 162 ? 14.746 19.307  32.098 1.00 84.55  ? 157  LYS A CG  1 
ATOM   1244 C CD  . LYS A 1 162 ? 14.726 18.054  32.960 1.00 98.74  ? 157  LYS A CD  1 
ATOM   1245 C CE  . LYS A 1 162 ? 13.317 17.606  33.275 1.00 110.45 ? 157  LYS A CE  1 
ATOM   1246 N NZ  . LYS A 1 162 ? 12.661 16.950  32.113 1.00 117.18 ? 157  LYS A NZ  1 
ATOM   1247 N N   . LYS A 1 163 ? 17.488 22.475  30.913 1.00 62.37  ? 158  LYS A N   1 
ATOM   1248 C CA  . LYS A 1 163 ? 17.758 23.831  31.373 1.00 62.42  ? 158  LYS A CA  1 
ATOM   1249 C C   . LYS A 1 163 ? 17.584 24.865  30.272 1.00 62.28  ? 158  LYS A C   1 
ATOM   1250 O O   . LYS A 1 163 ? 17.019 25.920  30.529 1.00 63.94  ? 158  LYS A O   1 
ATOM   1251 C CB  . LYS A 1 163 ? 19.176 23.900  31.977 1.00 66.49  ? 158  LYS A CB  1 
ATOM   1252 C CG  . LYS A 1 163 ? 19.465 25.135  32.816 1.00 68.91  ? 158  LYS A CG  1 
ATOM   1253 N N   . GLU A 1 164 ? 17.999 24.551  29.041 1.00 55.16  ? 159  GLU A N   1 
ATOM   1254 C CA  . GLU A 1 164 ? 18.070 25.533  27.958 1.00 53.20  ? 159  GLU A CA  1 
ATOM   1255 C C   . GLU A 1 164 ? 16.998 25.544  26.901 1.00 56.19  ? 159  GLU A C   1 
ATOM   1256 O O   . GLU A 1 164 ? 16.866 26.533  26.164 1.00 54.62  ? 159  GLU A O   1 
ATOM   1257 C CB  . GLU A 1 164 ? 19.456 25.459  27.283 1.00 54.17  ? 159  GLU A CB  1 
ATOM   1258 C CG  . GLU A 1 164 ? 20.634 25.470  28.250 1.00 64.86  ? 159  GLU A CG  1 
ATOM   1259 C CD  . GLU A 1 164 ? 20.876 26.725  29.072 1.00 76.68  ? 159  GLU A CD  1 
ATOM   1260 O OE1 . GLU A 1 164 ? 20.211 27.756  28.821 1.00 70.87  ? 159  GLU A OE1 1 
ATOM   1261 O OE2 . GLU A 1 164 ? 21.739 26.672  29.977 1.00 73.10  ? 159  GLU A OE2 1 
ATOM   1262 N N   . MET A 1 165 ? 16.270 24.431  26.777 1.00 51.95  ? 160  MET A N   1 
ATOM   1263 C CA  . MET A 1 165 ? 15.317 24.279  25.698 1.00 49.40  ? 160  MET A CA  1 
ATOM   1264 C C   . MET A 1 165 ? 13.897 24.146  26.181 1.00 52.65  ? 160  MET A C   1 
ATOM   1265 O O   . MET A 1 165 ? 13.653 23.609  27.258 1.00 52.88  ? 160  MET A O   1 
ATOM   1266 C CB  . MET A 1 165 ? 15.680 23.022  24.901 1.00 50.28  ? 160  MET A CB  1 
ATOM   1267 C CG  . MET A 1 165 ? 16.982 23.125  24.177 1.00 53.49  ? 160  MET A CG  1 
ATOM   1268 S SD  . MET A 1 165 ? 17.437 21.581  23.425 1.00 55.96  ? 160  MET A SD  1 
ATOM   1269 C CE  . MET A 1 165 ? 18.713 22.090  22.492 1.00 53.81  ? 160  MET A CE  1 
ATOM   1270 N N   . GLN A 1 166 ? 12.954 24.554  25.341 1.00 48.59  ? 161  GLN A N   1 
ATOM   1271 C CA  . GLN A 1 166 ? 11.551 24.375  25.626 1.00 49.54  ? 161  GLN A CA  1 
ATOM   1272 C C   . GLN A 1 166 ? 11.210 22.867  25.425 1.00 53.87  ? 161  GLN A C   1 
ATOM   1273 O O   . GLN A 1 166 ? 11.898 22.178  24.655 1.00 53.25  ? 161  GLN A O   1 
ATOM   1274 C CB  . GLN A 1 166 ? 10.692 25.322  24.762 1.00 50.47  ? 161  GLN A CB  1 
ATOM   1275 C CG  . GLN A 1 166 ? 10.652 26.712  25.390 1.00 60.21  ? 161  GLN A CG  1 
ATOM   1276 C CD  . GLN A 1 166 ? 9.895  27.751  24.624 1.00 99.50  ? 161  GLN A CD  1 
ATOM   1277 O OE1 . GLN A 1 166 ? 9.991  27.874  23.392 1.00 101.86 ? 161  GLN A OE1 1 
ATOM   1278 N NE2 . GLN A 1 166 ? 9.203  28.598  25.362 1.00 99.00  ? 161  GLN A NE2 1 
ATOM   1279 N N   . PRO A 1 167 ? 10.205 22.344  26.178 1.00 50.36  ? 162  PRO A N   1 
ATOM   1280 C CA  . PRO A 1 167 ? 9.842  20.914  26.072 1.00 47.47  ? 162  PRO A CA  1 
ATOM   1281 C C   . PRO A 1 167 ? 9.460  20.445  24.664 1.00 47.54  ? 162  PRO A C   1 
ATOM   1282 O O   . PRO A 1 167 ? 9.505  19.258  24.396 1.00 45.49  ? 162  PRO A O   1 
ATOM   1283 C CB  . PRO A 1 167 ? 8.639  20.812  27.009 1.00 50.21  ? 162  PRO A CB  1 
ATOM   1284 C CG  . PRO A 1 167 ? 8.814  21.903  27.963 1.00 58.11  ? 162  PRO A CG  1 
ATOM   1285 C CD  . PRO A 1 167 ? 9.337  23.033  27.159 1.00 53.21  ? 162  PRO A CD  1 
ATOM   1286 N N   . THR A 1 168 ? 9.098  21.379  23.766 1.00 43.40  ? 163  THR A N   1 
ATOM   1287 C CA  . THR A 1 168 ? 8.714  21.096  22.371 1.00 41.16  ? 163  THR A CA  1 
ATOM   1288 C C   . THR A 1 168 ? 9.909  21.162  21.415 1.00 45.88  ? 163  THR A C   1 
ATOM   1289 O O   . THR A 1 168 ? 9.746  20.848  20.210 1.00 45.36  ? 163  THR A O   1 
ATOM   1290 C CB  . THR A 1 168 ? 7.675  22.103  21.920 1.00 46.17  ? 163  THR A CB  1 
ATOM   1291 O OG1 . THR A 1 168 ? 8.205  23.414  22.162 1.00 45.17  ? 163  THR A OG1 1 
ATOM   1292 C CG2 . THR A 1 168 ? 6.314  21.915  22.618 1.00 48.74  ? 163  THR A CG2 1 
ATOM   1293 N N   . HIS A 1 169 ? 11.105 21.579  21.914 1.00 44.06  ? 164  HIS A N   1 
ATOM   1294 C CA  . HIS A 1 169 ? 12.274 21.672  21.041 1.00 44.22  ? 164  HIS A CA  1 
ATOM   1295 C C   . HIS A 1 169 ? 12.587 20.283  20.427 1.00 44.98  ? 164  HIS A C   1 
ATOM   1296 O O   . HIS A 1 169 ? 12.764 19.322  21.169 1.00 44.33  ? 164  HIS A O   1 
ATOM   1297 C CB  . HIS A 1 169 ? 13.496 22.247  21.778 1.00 46.98  ? 164  HIS A CB  1 
ATOM   1298 C CG  . HIS A 1 169 ? 14.644 22.566  20.863 1.00 50.61  ? 164  HIS A CG  1 
ATOM   1299 N ND1 . HIS A 1 169 ? 15.189 23.844  20.804 1.00 53.33  ? 164  HIS A ND1 1 
ATOM   1300 C CD2 . HIS A 1 169 ? 15.315 21.765  20.000 1.00 50.98  ? 164  HIS A CD2 1 
ATOM   1301 C CE1 . HIS A 1 169 ? 16.151 23.775  19.899 1.00 52.44  ? 164  HIS A CE1 1 
ATOM   1302 N NE2 . HIS A 1 169 ? 16.262 22.541  19.389 1.00 51.64  ? 164  HIS A NE2 1 
ATOM   1303 N N   . PRO A 1 170 ? 12.679 20.163  19.077 1.00 40.07  ? 165  PRO A N   1 
ATOM   1304 C CA  . PRO A 1 170 ? 12.968 18.839  18.473 1.00 37.73  ? 165  PRO A CA  1 
ATOM   1305 C C   . PRO A 1 170 ? 14.213 18.121  18.963 1.00 42.06  ? 165  PRO A C   1 
ATOM   1306 O O   . PRO A 1 170 ? 14.228 16.893  19.013 1.00 40.90  ? 165  PRO A O   1 
ATOM   1307 C CB  . PRO A 1 170 ? 13.083 19.124  16.965 1.00 38.75  ? 165  PRO A CB  1 
ATOM   1308 C CG  . PRO A 1 170 ? 12.515 20.435  16.748 1.00 44.34  ? 165  PRO A CG  1 
ATOM   1309 C CD  . PRO A 1 170 ? 12.525 21.214  18.043 1.00 40.99  ? 165  PRO A CD  1 
ATOM   1310 N N   . ILE A 1 171 ? 15.281 18.865  19.315 1.00 41.38  ? 166  ILE A N   1 
ATOM   1311 C CA  . ILE A 1 171 ? 16.497 18.206  19.800 1.00 42.73  ? 166  ILE A CA  1 
ATOM   1312 C C   . ILE A 1 171 ? 16.246 17.655  21.188 1.00 45.93  ? 166  ILE A C   1 
ATOM   1313 O O   . ILE A 1 171 ? 16.646 16.535  21.469 1.00 46.59  ? 166  ILE A O   1 
ATOM   1314 C CB  . ILE A 1 171 ? 17.751 19.096  19.704 1.00 47.98  ? 166  ILE A CB  1 
ATOM   1315 C CG1 . ILE A 1 171 ? 18.029 19.394  18.238 1.00 49.34  ? 166  ILE A CG1 1 
ATOM   1316 C CG2 . ILE A 1 171 ? 18.971 18.410  20.349 1.00 47.98  ? 166  ILE A CG2 1 
ATOM   1317 C CD1 . ILE A 1 171 ? 19.112 20.396  18.038 1.00 68.39  ? 166  ILE A CD1 1 
ATOM   1318 N N   . ARG A 1 172 ? 15.491 18.392  22.003 1.00 42.25  ? 167  ARG A N   1 
ATOM   1319 C CA  . ARG A 1 172 ? 15.127 17.946  23.351 1.00 43.51  ? 167  ARG A CA  1 
ATOM   1320 C C   . ARG A 1 172 ? 14.231 16.716  23.251 1.00 46.66  ? 167  ARG A C   1 
ATOM   1321 O O   . ARG A 1 172 ? 14.439 15.736  23.957 1.00 47.39  ? 167  ARG A O   1 
ATOM   1322 C CB  . ARG A 1 172 ? 14.430 19.070  24.146 1.00 45.79  ? 167  ARG A CB  1 
ATOM   1323 C CG  . ARG A 1 172 ? 13.990 18.615  25.515 1.00 45.68  ? 167  ARG A CG  1 
ATOM   1324 C CD  . ARG A 1 172 ? 13.608 19.775  26.415 1.00 50.34  ? 167  ARG A CD  1 
ATOM   1325 N NE  . ARG A 1 172 ? 12.907 19.303  27.619 1.00 50.43  ? 167  ARG A NE  1 
ATOM   1326 C CZ  . ARG A 1 172 ? 12.484 20.089  28.603 1.00 60.21  ? 167  ARG A CZ  1 
ATOM   1327 N NH1 . ARG A 1 172 ? 12.692 21.397  28.551 1.00 52.37  ? 167  ARG A NH1 1 
ATOM   1328 N NH2 . ARG A 1 172 ? 11.844 19.574  29.642 1.00 51.76  ? 167  ARG A NH2 1 
ATOM   1329 N N   . LEU A 1 173 ? 13.263 16.742  22.345 1.00 42.05  ? 168  LEU A N   1 
ATOM   1330 C CA  . LEU A 1 173 ? 12.373 15.591  22.141 1.00 40.01  ? 168  LEU A CA  1 
ATOM   1331 C C   . LEU A 1 173 ? 13.106 14.367  21.604 1.00 41.01  ? 168  LEU A C   1 
ATOM   1332 O O   . LEU A 1 173 ? 12.855 13.267  22.079 1.00 40.50  ? 168  LEU A O   1 
ATOM   1333 C CB  . LEU A 1 173 ? 11.236 15.982  21.188 1.00 39.51  ? 168  LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 173 ? 10.141 16.869  21.799 1.00 44.19  ? 168  LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 173 ? 9.300  17.458  20.697 1.00 42.11  ? 168  LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 173 ? 9.283  16.074  22.815 1.00 45.20  ? 168  LEU A CD2 1 
ATOM   1337 N N   . GLY A 1 174 ? 14.002 14.566  20.634 1.00 38.86  ? 169  GLY A N   1 
ATOM   1338 C CA  . GLY A 1 174 ? 14.774 13.475  20.031 1.00 37.86  ? 169  GLY A CA  1 
ATOM   1339 C C   . GLY A 1 174 ? 15.711 12.830  21.021 1.00 44.70  ? 169  GLY A C   1 
ATOM   1340 O O   . GLY A 1 174 ? 15.882 11.617  21.009 1.00 44.47  ? 169  GLY A O   1 
ATOM   1341 N N   . LEU A 1 175 ? 16.283 13.638  21.912 1.00 43.19  ? 170  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 175 ? 17.109 13.123  22.985 1.00 44.92  ? 170  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 175 ? 16.246 12.268  23.923 1.00 48.61  ? 170  LEU A C   1 
ATOM   1344 O O   . LEU A 1 175 ? 16.669 11.174  24.297 1.00 49.47  ? 170  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 175 ? 17.762 14.274  23.744 1.00 45.68  ? 170  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 175 ? 18.436 13.941  25.082 1.00 51.15  ? 170  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 175 ? 19.586 12.918  24.944 1.00 50.85  ? 170  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 175 ? 18.862 15.226  25.698 1.00 55.61  ? 170  LEU A CD2 1 
ATOM   1349 N N   . ALA A 1 176 ? 15.063 12.758  24.321 1.00 44.42  ? 171  ALA A N   1 
ATOM   1350 C CA  . ALA A 1 176 ? 14.207 11.954  25.195 1.00 44.14  ? 171  ALA A CA  1 
ATOM   1351 C C   . ALA A 1 176 ? 13.846 10.629  24.521 1.00 44.83  ? 171  ALA A C   1 
ATOM   1352 O O   . ALA A 1 176 ? 13.818 9.595   25.174 1.00 44.84  ? 171  ALA A O   1 
ATOM   1353 C CB  . ALA A 1 176 ? 12.945 12.739  25.538 1.00 45.14  ? 171  ALA A CB  1 
ATOM   1354 N N   . LEU A 1 177 ? 13.599 10.658  23.189 1.00 40.50  ? 172  LEU A N   1 
ATOM   1355 C CA  . LEU A 1 177 ? 13.236 9.458   22.481 1.00 38.60  ? 172  LEU A CA  1 
ATOM   1356 C C   . LEU A 1 177 ? 14.369 8.446   22.531 1.00 42.56  ? 172  LEU A C   1 
ATOM   1357 O O   . LEU A 1 177 ? 14.146 7.292   22.881 1.00 43.91  ? 172  LEU A O   1 
ATOM   1358 C CB  . LEU A 1 177 ? 12.865 9.788   21.038 1.00 36.56  ? 172  LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 177 ? 12.481 8.543   20.196 1.00 39.14  ? 172  LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 177 ? 11.093 8.026   20.536 1.00 39.00  ? 172  LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 177 ? 12.626 8.837   18.733 1.00 36.58  ? 172  LEU A CD2 1 
ATOM   1362 N N   . ASN A 1 178 ? 15.580 8.868   22.171 1.00 39.42  ? 173  ASN A N   1 
ATOM   1363 C CA  . ASN A 1 178 ? 16.698 7.928   22.113 1.00 40.16  ? 173  ASN A CA  1 
ATOM   1364 C C   . ASN A 1 178 ? 17.149 7.453   23.493 1.00 45.32  ? 173  ASN A C   1 
ATOM   1365 O O   . ASN A 1 178 ? 17.535 6.292   23.663 1.00 43.50  ? 173  ASN A O   1 
ATOM   1366 C CB  . ASN A 1 178 ? 17.849 8.511   21.301 1.00 39.79  ? 173  ASN A CB  1 
ATOM   1367 C CG  . ASN A 1 178 ? 17.586 8.522   19.819 1.00 45.45  ? 173  ASN A CG  1 
ATOM   1368 O OD1 . ASN A 1 178 ? 16.449 8.355   19.367 1.00 38.65  ? 173  ASN A OD1 1 
ATOM   1369 N ND2 . ASN A 1 178 ? 18.632 8.709   19.029 1.00 37.79  ? 173  ASN A ND2 1 
ATOM   1370 N N   . PHE A 1 179 ? 17.081 8.338   24.480 1.00 43.56  ? 174  PHE A N   1 
ATOM   1371 C CA  . PHE A 1 179 ? 17.474 7.971   25.828 1.00 44.22  ? 174  PHE A CA  1 
ATOM   1372 C C   . PHE A 1 179 ? 16.453 6.972   26.382 1.00 49.41  ? 174  PHE A C   1 
ATOM   1373 O O   . PHE A 1 179 ? 16.841 6.000   27.021 1.00 51.17  ? 174  PHE A O   1 
ATOM   1374 C CB  . PHE A 1 179 ? 17.544 9.229   26.686 1.00 46.59  ? 174  PHE A CB  1 
ATOM   1375 C CG  . PHE A 1 179 ? 18.335 9.163   27.983 1.00 49.95  ? 174  PHE A CG  1 
ATOM   1376 C CD1 . PHE A 1 179 ? 19.021 8.001   28.355 1.00 53.93  ? 174  PHE A CD1 1 
ATOM   1377 C CD2 . PHE A 1 179 ? 18.339 10.238  28.856 1.00 53.29  ? 174  PHE A CD2 1 
ATOM   1378 C CE1 . PHE A 1 179 ? 19.754 7.961   29.554 1.00 58.04  ? 174  PHE A CE1 1 
ATOM   1379 C CE2 . PHE A 1 179 ? 19.058 10.194  30.053 1.00 58.69  ? 174  PHE A CE2 1 
ATOM   1380 C CZ  . PHE A 1 179 ? 19.757 9.060   30.396 1.00 57.86  ? 174  PHE A CZ  1 
ATOM   1381 N N   . SER A 1 180 ? 15.153 7.159   26.076 1.00 45.23  ? 175  SER A N   1 
ATOM   1382 C CA  . SER A 1 180 ? 14.111 6.215   26.525 1.00 44.68  ? 175  SER A CA  1 
ATOM   1383 C C   . SER A 1 180 ? 14.370 4.824   25.899 1.00 48.76  ? 175  SER A C   1 
ATOM   1384 O O   . SER A 1 180 ? 14.251 3.807   26.585 1.00 49.96  ? 175  SER A O   1 
ATOM   1385 C CB  . SER A 1 180 ? 12.715 6.715   26.167 1.00 45.47  ? 175  SER A CB  1 
ATOM   1386 O OG  . SER A 1 180 ? 12.475 6.637   24.771 1.00 52.33  ? 175  SER A OG  1 
ATOM   1387 N N   . VAL A 1 181 ? 14.753 4.784   24.605 1.00 43.30  ? 176  VAL A N   1 
ATOM   1388 C CA  . VAL A 1 181 ? 15.095 3.535   23.918 1.00 41.97  ? 176  VAL A CA  1 
ATOM   1389 C C   . VAL A 1 181 ? 16.330 2.894   24.591 1.00 47.94  ? 176  VAL A C   1 
ATOM   1390 O O   . VAL A 1 181 ? 16.364 1.676   24.809 1.00 45.92  ? 176  VAL A O   1 
ATOM   1391 C CB  . VAL A 1 181 ? 15.266 3.753   22.389 1.00 42.96  ? 176  VAL A CB  1 
ATOM   1392 C CG1 . VAL A 1 181 ? 15.925 2.529   21.744 1.00 43.02  ? 176  VAL A CG1 1 
ATOM   1393 C CG2 . VAL A 1 181 ? 13.917 4.050   21.723 1.00 40.61  ? 176  VAL A CG2 1 
ATOM   1394 N N   . PHE A 1 182 ? 17.313 3.726   24.979 1.00 46.74  ? 177  PHE A N   1 
ATOM   1395 C CA  . PHE A 1 182 ? 18.489 3.243   25.697 1.00 47.79  ? 177  PHE A CA  1 
ATOM   1396 C C   . PHE A 1 182 ? 18.030 2.521   26.982 1.00 54.97  ? 177  PHE A C   1 
ATOM   1397 O O   . PHE A 1 182 ? 18.502 1.424   27.271 1.00 56.83  ? 177  PHE A O   1 
ATOM   1398 C CB  . PHE A 1 182 ? 19.402 4.428   26.025 1.00 49.58  ? 177  PHE A CB  1 
ATOM   1399 C CG  . PHE A 1 182 ? 20.471 4.078   27.016 1.00 52.40  ? 177  PHE A CG  1 
ATOM   1400 C CD1 . PHE A 1 182 ? 21.620 3.409   26.612 1.00 54.60  ? 177  PHE A CD1 1 
ATOM   1401 C CD2 . PHE A 1 182 ? 20.303 4.355   28.366 1.00 56.37  ? 177  PHE A CD2 1 
ATOM   1402 C CE1 . PHE A 1 182 ? 22.607 3.066   27.535 1.00 57.75  ? 177  PHE A CE1 1 
ATOM   1403 C CE2 . PHE A 1 182 ? 21.280 3.981   29.300 1.00 60.84  ? 177  PHE A CE2 1 
ATOM   1404 C CZ  . PHE A 1 182 ? 22.442 3.373   28.874 1.00 58.36  ? 177  PHE A CZ  1 
ATOM   1405 N N   . TYR A 1 183 ? 17.119 3.124   27.748 1.00 53.19  ? 178  TYR A N   1 
ATOM   1406 C CA  . TYR A 1 183 ? 16.643 2.485   28.977 1.00 54.97  ? 178  TYR A CA  1 
ATOM   1407 C C   . TYR A 1 183 ? 15.937 1.167   28.693 1.00 59.31  ? 178  TYR A C   1 
ATOM   1408 O O   . TYR A 1 183 ? 16.177 0.182   29.387 1.00 60.51  ? 178  TYR A O   1 
ATOM   1409 C CB  . TYR A 1 183 ? 15.728 3.412   29.777 1.00 56.22  ? 178  TYR A CB  1 
ATOM   1410 C CG  . TYR A 1 183 ? 16.489 4.367   30.662 1.00 59.80  ? 178  TYR A CG  1 
ATOM   1411 C CD1 . TYR A 1 183 ? 17.251 3.902   31.729 1.00 64.74  ? 178  TYR A CD1 1 
ATOM   1412 C CD2 . TYR A 1 183 ? 16.404 5.740   30.474 1.00 59.99  ? 178  TYR A CD2 1 
ATOM   1413 C CE1 . TYR A 1 183 ? 17.948 4.782   32.560 1.00 68.26  ? 178  TYR A CE1 1 
ATOM   1414 C CE2 . TYR A 1 183 ? 17.076 6.631   31.316 1.00 62.41  ? 178  TYR A CE2 1 
ATOM   1415 C CZ  . TYR A 1 183 ? 17.856 6.146   32.350 1.00 72.57  ? 178  TYR A CZ  1 
ATOM   1416 O OH  . TYR A 1 183 ? 18.516 7.022   33.179 1.00 77.03  ? 178  TYR A OH  1 
ATOM   1417 N N   . TYR A 1 184 ? 15.057 1.161   27.687 1.00 55.19  ? 179  TYR A N   1 
ATOM   1418 C CA  . TYR A 1 184 ? 14.293 -0.026  27.347 1.00 55.42  ? 179  TYR A CA  1 
ATOM   1419 C C   . TYR A 1 184 ? 15.143 -1.167  26.821 1.00 61.37  ? 179  TYR A C   1 
ATOM   1420 O O   . TYR A 1 184 ? 14.976 -2.285  27.289 1.00 63.21  ? 179  TYR A O   1 
ATOM   1421 C CB  . TYR A 1 184 ? 13.184 0.299   26.321 1.00 54.68  ? 179  TYR A CB  1 
ATOM   1422 C CG  . TYR A 1 184 ? 12.186 -0.828  26.154 1.00 55.87  ? 179  TYR A CG  1 
ATOM   1423 C CD1 . TYR A 1 184 ? 12.388 -1.832  25.215 1.00 56.11  ? 179  TYR A CD1 1 
ATOM   1424 C CD2 . TYR A 1 184 ? 11.048 -0.901  26.950 1.00 58.34  ? 179  TYR A CD2 1 
ATOM   1425 C CE1 . TYR A 1 184 ? 11.479 -2.886  25.072 1.00 57.57  ? 179  TYR A CE1 1 
ATOM   1426 C CE2 . TYR A 1 184 ? 10.126 -1.945  26.808 1.00 60.13  ? 179  TYR A CE2 1 
ATOM   1427 C CZ  . TYR A 1 184 ? 10.356 -2.948  25.882 1.00 65.32  ? 179  TYR A CZ  1 
ATOM   1428 O OH  . TYR A 1 184 ? 9.439  -3.967  25.743 1.00 67.42  ? 179  TYR A OH  1 
ATOM   1429 N N   . GLU A 1 185 ? 15.993 -0.914  25.819 1.00 56.81  ? 180  GLU A N   1 
ATOM   1430 C CA  . GLU A 1 185 ? 16.733 -1.959  25.126 1.00 55.92  ? 180  GLU A CA  1 
ATOM   1431 C C   . GLU A 1 185 ? 18.075 -2.285  25.736 1.00 60.98  ? 180  GLU A C   1 
ATOM   1432 O O   . GLU A 1 185 ? 18.486 -3.441  25.728 1.00 62.48  ? 180  GLU A O   1 
ATOM   1433 C CB  . GLU A 1 185 ? 16.921 -1.541  23.664 1.00 54.96  ? 180  GLU A CB  1 
ATOM   1434 C CG  . GLU A 1 185 ? 17.478 -2.621  22.770 1.00 67.75  ? 180  GLU A CG  1 
ATOM   1435 C CD  . GLU A 1 185 ? 17.546 -2.241  21.307 1.00 75.48  ? 180  GLU A CD  1 
ATOM   1436 O OE1 . GLU A 1 185 ? 17.238 -1.073  20.957 1.00 54.81  ? 180  GLU A OE1 1 
ATOM   1437 O OE2 . GLU A 1 185 ? 17.918 -3.131  20.508 1.00 64.70  ? 180  GLU A OE2 1 
ATOM   1438 N N   . ILE A 1 186 ? 18.788 -1.272  26.207 1.00 56.64  ? 181  ILE A N   1 
ATOM   1439 C CA  . ILE A 1 186 ? 20.133 -1.498  26.733 1.00 57.97  ? 181  ILE A CA  1 
ATOM   1440 C C   . ILE A 1 186 ? 20.132 -1.784  28.222 1.00 64.77  ? 181  ILE A C   1 
ATOM   1441 O O   . ILE A 1 186 ? 20.780 -2.736  28.636 1.00 65.76  ? 181  ILE A O   1 
ATOM   1442 C CB  . ILE A 1 186 ? 21.093 -0.337  26.359 1.00 59.75  ? 181  ILE A CB  1 
ATOM   1443 C CG1 . ILE A 1 186 ? 20.995 0.019   24.862 1.00 56.05  ? 181  ILE A CG1 1 
ATOM   1444 C CG2 . ILE A 1 186 ? 22.539 -0.643  26.797 1.00 61.50  ? 181  ILE A CG2 1 
ATOM   1445 C CD1 . ILE A 1 186 ? 21.345 -1.072  23.877 1.00 55.19  ? 181  ILE A CD1 1 
ATOM   1446 N N   . LEU A 1 187 ? 19.444 -0.957  29.033 1.00 62.65  ? 182  LEU A N   1 
ATOM   1447 C CA  A LEU A 1 187 ? 19.408 -1.179  30.489 1.00 64.07  ? 182  LEU A CA  1 
ATOM   1448 C C   . LEU A 1 187 ? 18.311 -2.137  30.933 1.00 68.19  ? 182  LEU A C   1 
ATOM   1449 O O   . LEU A 1 187 ? 18.258 -2.503  32.103 1.00 72.95  ? 182  LEU A O   1 
ATOM   1450 C CB  . LEU A 1 187 ? 19.334 0.139   31.273 1.00 64.18  ? 182  LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 187 ? 20.615 0.969   31.341 1.00 69.87  ? 182  LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 187 ? 20.443 2.129   32.293 1.00 72.01  ? 182  LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 187 ? 21.787 0.157   31.826 1.00 74.80  ? 182  LEU A CD2 1 
ATOM   1454 N N   . ASN A 1 188 ? 17.433 -2.539  30.007 1.00 61.36  ? 183  ASN A N   1 
ATOM   1455 C CA  . ASN A 1 188 ? 16.319 -3.438  30.291 1.00 61.54  ? 183  ASN A CA  1 
ATOM   1456 C C   . ASN A 1 188 ? 15.456 -2.906  31.448 1.00 65.70  ? 183  ASN A C   1 
ATOM   1457 O O   . ASN A 1 188 ? 15.088 -3.651  32.351 1.00 66.70  ? 183  ASN A O   1 
ATOM   1458 C CB  . ASN A 1 188 ? 16.829 -4.874  30.551 1.00 65.21  ? 183  ASN A CB  1 
ATOM   1459 C CG  . ASN A 1 188 ? 15.736 -5.898  30.574 1.00 95.24  ? 183  ASN A CG  1 
ATOM   1460 O OD1 . ASN A 1 188 ? 14.643 -5.672  30.037 1.00 89.20  ? 183  ASN A OD1 1 
ATOM   1461 N ND2 . ASN A 1 188 ? 15.981 -7.022  31.255 1.00 92.50  ? 183  ASN A ND2 1 
ATOM   1462 N N   . SER A 1 189 ? 15.181 -1.598  31.432 1.00 61.18  ? 184  SER A N   1 
ATOM   1463 C CA  . SER A 1 189 ? 14.401 -0.929  32.471 1.00 60.82  ? 184  SER A CA  1 
ATOM   1464 C C   . SER A 1 189 ? 13.208 -0.288  31.785 1.00 61.30  ? 184  SER A C   1 
ATOM   1465 O O   . SER A 1 189 ? 13.212 0.920   31.500 1.00 61.11  ? 184  SER A O   1 
ATOM   1466 C CB  . SER A 1 189 ? 15.242 0.107   33.210 1.00 63.66  ? 184  SER A CB  1 
ATOM   1467 O OG  . SER A 1 189 ? 14.518 0.626   34.313 1.00 74.03  ? 184  SER A OG  1 
ATOM   1468 N N   . PRO A 1 190 ? 12.168 -1.105  31.502 1.00 55.50  ? 185  PRO A N   1 
ATOM   1469 C CA  . PRO A 1 190 ? 11.005 -0.563  30.784 1.00 54.18  ? 185  PRO A CA  1 
ATOM   1470 C C   . PRO A 1 190 ? 10.219 0.542   31.479 1.00 62.87  ? 185  PRO A C   1 
ATOM   1471 O O   . PRO A 1 190 ? 9.696  1.426   30.781 1.00 61.68  ? 185  PRO A O   1 
ATOM   1472 C CB  . PRO A 1 190 ? 10.161 -1.793  30.456 1.00 54.95  ? 185  PRO A CB  1 
ATOM   1473 C CG  . PRO A 1 190 ? 10.610 -2.833  31.363 1.00 60.15  ? 185  PRO A CG  1 
ATOM   1474 C CD  . PRO A 1 190 ? 12.027 -2.558  31.739 1.00 56.85  ? 185  PRO A CD  1 
ATOM   1475 N N   . GLU A 1 191 ? 10.140 0.517   32.836 1.00 62.13  ? 186  GLU A N   1 
ATOM   1476 C CA  . GLU A 1 191 ? 9.440  1.555   33.589 1.00 62.08  ? 186  GLU A CA  1 
ATOM   1477 C C   . GLU A 1 191 ? 10.167 2.900   33.490 1.00 63.28  ? 186  GLU A C   1 
ATOM   1478 O O   . GLU A 1 191 ? 9.493  3.909   33.305 1.00 62.15  ? 186  GLU A O   1 
ATOM   1479 C CB  . GLU A 1 191 ? 9.271  1.150   35.046 1.00 65.94  ? 186  GLU A CB  1 
ATOM   1480 N N   . LYS A 1 192 ? 11.515 2.931   33.583 1.00 58.08  ? 187  LYS A N   1 
ATOM   1481 C CA  . LYS A 1 192 ? 12.227 4.193   33.409 1.00 58.03  ? 187  LYS A CA  1 
ATOM   1482 C C   . LYS A 1 192 ? 12.114 4.624   31.938 1.00 61.55  ? 187  LYS A C   1 
ATOM   1483 O O   . LYS A 1 192 ? 11.967 5.823   31.673 1.00 63.73  ? 187  LYS A O   1 
ATOM   1484 C CB  . LYS A 1 192 ? 13.679 4.059   33.831 1.00 60.46  ? 187  LYS A CB  1 
ATOM   1485 N N   . ALA A 1 193 ? 12.073 3.665   30.984 1.00 54.84  ? 188  ALA A N   1 
ATOM   1486 C CA  . ALA A 1 193 ? 11.887 4.014   29.562 1.00 51.41  ? 188  ALA A CA  1 
ATOM   1487 C C   . ALA A 1 193 ? 10.527 4.715   29.322 1.00 54.88  ? 188  ALA A C   1 
ATOM   1488 O O   . ALA A 1 193 ? 10.448 5.785   28.705 1.00 51.25  ? 188  ALA A O   1 
ATOM   1489 C CB  . ALA A 1 193 ? 11.974 2.759   28.717 1.00 50.69  ? 188  ALA A CB  1 
ATOM   1490 N N   . CYS A 1 194 ? 9.471  4.126   29.876 1.00 55.03  ? 189  CYS A N   1 
ATOM   1491 C CA  . CYS A 1 194 ? 8.112  4.641   29.771 1.00 54.61  ? 189  CYS A CA  1 
ATOM   1492 C C   . CYS A 1 194 ? 7.978  5.974   30.444 1.00 57.61  ? 189  CYS A C   1 
ATOM   1493 O O   . CYS A 1 194 ? 7.339  6.884   29.908 1.00 56.23  ? 189  CYS A O   1 
ATOM   1494 C CB  . CYS A 1 194 ? 7.136  3.637   30.365 1.00 56.04  ? 189  CYS A CB  1 
ATOM   1495 S SG  . CYS A 1 194 ? 6.884  2.187   29.331 1.00 58.36  ? 189  CYS A SG  1 
ATOM   1496 N N   . SER A 1 195 ? 8.557  6.089   31.624 1.00 53.80  ? 190  SER A N   1 
ATOM   1497 C CA  . SER A 1 195 ? 8.489  7.320   32.404 1.00 53.66  ? 190  SER A CA  1 
ATOM   1498 C C   . SER A 1 195 ? 9.147  8.473   31.634 1.00 56.10  ? 190  SER A C   1 
ATOM   1499 O O   . SER A 1 195 ? 8.602  9.575   31.543 1.00 53.93  ? 190  SER A O   1 
ATOM   1500 C CB  . SER A 1 195 ? 9.151  7.077   33.760 1.00 52.61  ? 190  SER A CB  1 
ATOM   1501 O OG  . SER A 1 195 ? 9.493  8.269   34.433 1.00 69.05  ? 190  SER A OG  1 
ATOM   1502 N N   . LEU A 1 196 ? 10.317 8.198   31.089 1.00 53.87  ? 191  LEU A N   1 
ATOM   1503 C CA  . LEU A 1 196 ? 11.062 9.175   30.332 1.00 54.01  ? 191  LEU A CA  1 
ATOM   1504 C C   . LEU A 1 196 ? 10.303 9.620   29.082 1.00 55.31  ? 191  LEU A C   1 
ATOM   1505 O O   . LEU A 1 196 ? 10.255 10.802  28.775 1.00 56.20  ? 191  LEU A O   1 
ATOM   1506 C CB  . LEU A 1 196 ? 12.422 8.598   29.971 1.00 54.92  ? 191  LEU A CB  1 
ATOM   1507 C CG  . LEU A 1 196 ? 13.425 9.486   29.261 1.00 60.50  ? 191  LEU A CG  1 
ATOM   1508 C CD1 . LEU A 1 196 ? 13.251 10.910  29.695 1.00 61.85  ? 191  LEU A CD1 1 
ATOM   1509 C CD2 . LEU A 1 196 ? 14.813 9.002   29.559 1.00 63.37  ? 191  LEU A CD2 1 
ATOM   1510 N N   . ALA A 1 197 ? 9.701  8.671   28.376 1.00 48.83  ? 192  ALA A N   1 
ATOM   1511 C CA  . ALA A 1 197 ? 8.946  8.970   27.149 1.00 46.02  ? 192  ALA A CA  1 
ATOM   1512 C C   . ALA A 1 197 ? 7.633  9.673   27.448 1.00 50.51  ? 192  ALA A C   1 
ATOM   1513 O O   . ALA A 1 197 ? 7.266  10.626  26.742 1.00 48.64  ? 192  ALA A O   1 
ATOM   1514 C CB  . ALA A 1 197 ? 8.701  7.699   26.361 1.00 45.62  ? 192  ALA A CB  1 
ATOM   1515 N N   . LYS A 1 198 ? 6.931  9.237   28.513 1.00 49.67  ? 193  LYS A N   1 
ATOM   1516 C CA  . LYS A 1 198 ? 5.653  9.838   28.909 1.00 49.60  ? 193  LYS A CA  1 
ATOM   1517 C C   . LYS A 1 198 ? 5.824  11.284  29.341 1.00 52.23  ? 193  LYS A C   1 
ATOM   1518 O O   . LYS A 1 198 ? 5.051  12.148  28.902 1.00 51.24  ? 193  LYS A O   1 
ATOM   1519 C CB  . LYS A 1 198 ? 4.969  9.011   30.005 1.00 53.11  ? 193  LYS A CB  1 
ATOM   1520 C CG  . LYS A 1 198 ? 3.623  9.557   30.410 1.00 60.94  ? 193  LYS A CG  1 
ATOM   1521 C CD  . LYS A 1 198 ? 3.120  8.901   31.683 1.00 68.83  ? 193  LYS A CD  1 
ATOM   1522 C CE  . LYS A 1 198 ? 1.614  8.890   31.743 1.00 67.21  ? 193  LYS A CE  1 
ATOM   1523 N NZ  . LYS A 1 198 ? 1.005  10.220  31.547 1.00 63.71  ? 193  LYS A NZ  1 
ATOM   1524 N N   . THR A 1 199 ? 6.831  11.538  30.185 1.00 49.80  ? 194  THR A N   1 
ATOM   1525 C CA  . THR A 1 199 ? 7.108  12.897  30.661 1.00 50.26  ? 194  THR A CA  1 
ATOM   1526 C C   . THR A 1 199 ? 7.421  13.811  29.495 1.00 51.00  ? 194  THR A C   1 
ATOM   1527 O O   . THR A 1 199 ? 6.863  14.901  29.420 1.00 51.69  ? 194  THR A O   1 
ATOM   1528 C CB  . THR A 1 199 ? 8.226  12.869  31.681 1.00 56.26  ? 194  THR A CB  1 
ATOM   1529 O OG1 . THR A 1 199 ? 7.779  12.061  32.755 1.00 63.29  ? 194  THR A OG1 1 
ATOM   1530 C CG2 . THR A 1 199 ? 8.573  14.250  32.213 1.00 53.87  ? 194  THR A CG2 1 
ATOM   1531 N N   . ALA A 1 200 ? 8.293  13.361  28.580 1.00 46.52  ? 195  ALA A N   1 
ATOM   1532 C CA  . ALA A 1 200 ? 8.678  14.158  27.420 1.00 44.93  ? 195  ALA A CA  1 
ATOM   1533 C C   . ALA A 1 200 ? 7.455  14.495  26.579 1.00 46.94  ? 195  ALA A C   1 
ATOM   1534 O O   . ALA A 1 200 ? 7.291  15.647  26.198 1.00 45.92  ? 195  ALA A O   1 
ATOM   1535 C CB  . ALA A 1 200 ? 9.699  13.394  26.575 1.00 44.31  ? 195  ALA A CB  1 
ATOM   1536 N N   . PHE A 1 201 ? 6.585  13.503  26.319 1.00 43.15  ? 196  PHE A N   1 
ATOM   1537 C CA  . PHE A 1 201 ? 5.380  13.719  25.524 1.00 42.24  ? 196  PHE A CA  1 
ATOM   1538 C C   . PHE A 1 201 ? 4.439  14.683  26.231 1.00 46.71  ? 196  PHE A C   1 
ATOM   1539 O O   . PHE A 1 201 ? 3.986  15.657  25.632 1.00 45.84  ? 196  PHE A O   1 
ATOM   1540 C CB  . PHE A 1 201 ? 4.661  12.381  25.248 1.00 43.61  ? 196  PHE A CB  1 
ATOM   1541 C CG  . PHE A 1 201 ? 3.489  12.533  24.290 1.00 43.76  ? 196  PHE A CG  1 
ATOM   1542 C CD1 . PHE A 1 201 ? 2.205  12.810  24.770 1.00 46.71  ? 196  PHE A CD1 1 
ATOM   1543 C CD2 . PHE A 1 201 ? 3.671  12.420  22.906 1.00 42.22  ? 196  PHE A CD2 1 
ATOM   1544 C CE1 . PHE A 1 201 ? 1.125  12.969  23.890 1.00 46.88  ? 196  PHE A CE1 1 
ATOM   1545 C CE2 . PHE A 1 201 ? 2.585  12.560  22.025 1.00 44.43  ? 196  PHE A CE2 1 
ATOM   1546 C CZ  . PHE A 1 201 ? 1.319  12.846  22.522 1.00 43.78  ? 196  PHE A CZ  1 
ATOM   1547 N N   . ASP A 1 202 ? 4.146  14.398  27.502 1.00 45.29  ? 197  ASP A N   1 
ATOM   1548 C CA  . ASP A 1 202 ? 3.236  15.190  28.320 1.00 46.75  ? 197  ASP A CA  1 
ATOM   1549 C C   . ASP A 1 202 ? 3.673  16.625  28.519 1.00 49.35  ? 197  ASP A C   1 
ATOM   1550 O O   . ASP A 1 202 ? 2.830  17.519  28.481 1.00 48.87  ? 197  ASP A O   1 
ATOM   1551 C CB  . ASP A 1 202 ? 2.994  14.509  29.669 1.00 48.94  ? 197  ASP A CB  1 
ATOM   1552 C CG  . ASP A 1 202 ? 2.181  13.226  29.562 1.00 54.52  ? 197  ASP A CG  1 
ATOM   1553 O OD1 . ASP A 1 202 ? 1.617  12.951  28.467 1.00 53.59  ? 197  ASP A OD1 1 
ATOM   1554 O OD2 . ASP A 1 202 ? 2.094  12.504  30.561 1.00 59.62  ? 197  ASP A OD2 1 
ATOM   1555 N N   . GLU A 1 203 ? 4.980  16.840  28.706 1.00 46.94  ? 198  GLU A N   1 
ATOM   1556 C CA  . GLU A 1 203 ? 5.511  18.195  28.909 1.00 49.38  ? 198  GLU A CA  1 
ATOM   1557 C C   . GLU A 1 203 ? 5.456  19.009  27.623 1.00 52.67  ? 198  GLU A C   1 
ATOM   1558 O O   . GLU A 1 203 ? 5.247  20.213  27.666 1.00 54.40  ? 198  GLU A O   1 
ATOM   1559 C CB  . GLU A 1 203 ? 6.896  18.166  29.556 1.00 51.67  ? 198  GLU A CB  1 
ATOM   1560 C CG  . GLU A 1 203 ? 6.818  17.687  30.999 1.00 59.43  ? 198  GLU A CG  1 
ATOM   1561 C CD  . GLU A 1 203 ? 8.131  17.634  31.753 1.00 77.85  ? 198  GLU A CD  1 
ATOM   1562 O OE1 . GLU A 1 203 ? 9.200  17.698  31.107 1.00 72.42  ? 198  GLU A OE1 1 
ATOM   1563 O OE2 . GLU A 1 203 ? 8.090  17.484  32.996 1.00 83.35  ? 198  GLU A OE2 1 
ATOM   1564 N N   . ALA A 1 204 ? 5.534  18.336  26.478 1.00 46.70  ? 199  ALA A N   1 
ATOM   1565 C CA  . ALA A 1 204 ? 5.414  18.975  25.170 1.00 44.17  ? 199  ALA A CA  1 
ATOM   1566 C C   . ALA A 1 204 ? 3.945  19.346  24.892 1.00 49.21  ? 199  ALA A C   1 
ATOM   1567 O O   . ALA A 1 204 ? 3.693  20.476  24.489 1.00 49.72  ? 199  ALA A O   1 
ATOM   1568 C CB  . ALA A 1 204 ? 5.971  18.076  24.075 1.00 41.61  ? 199  ALA A CB  1 
ATOM   1569 N N   . ILE A 1 205 ? 2.987  18.426  25.146 1.00 45.14  ? 200  ILE A N   1 
ATOM   1570 C CA  . ILE A 1 205 ? 1.549  18.688  25.010 1.00 44.61  ? 200  ILE A CA  1 
ATOM   1571 C C   . ILE A 1 205 ? 1.155  19.867  25.880 1.00 48.67  ? 200  ILE A C   1 
ATOM   1572 O O   . ILE A 1 205 ? 0.449  20.769  25.406 1.00 49.26  ? 200  ILE A O   1 
ATOM   1573 C CB  . ILE A 1 205 ? 0.702  17.440  25.395 1.00 48.15  ? 200  ILE A CB  1 
ATOM   1574 C CG1 . ILE A 1 205 ? 0.743  16.415  24.289 1.00 45.94  ? 200  ILE A CG1 1 
ATOM   1575 C CG2 . ILE A 1 205 ? -0.781 17.804  25.731 1.00 51.47  ? 200  ILE A CG2 1 
ATOM   1576 C CD1 . ILE A 1 205 ? 0.150  16.882  22.879 1.00 46.06  ? 200  ILE A CD1 1 
ATOM   1577 N N   . ALA A 1 206 ? 1.614  19.866  27.164 1.00 45.46  ? 201  ALA A N   1 
ATOM   1578 C CA  . ALA A 1 206 ? 1.311  20.932  28.123 1.00 45.52  ? 201  ALA A CA  1 
ATOM   1579 C C   . ALA A 1 206 ? 1.814  22.324  27.701 1.00 51.45  ? 201  ALA A C   1 
ATOM   1580 O O   . ALA A 1 206 ? 1.226  23.321  28.104 1.00 53.01  ? 201  ALA A O   1 
ATOM   1581 C CB  . ALA A 1 206 ? 1.845  20.564  29.487 1.00 47.05  ? 201  ALA A CB  1 
ATOM   1582 N N   . GLU A 1 207 ? 2.826  22.397  26.799 1.00 49.83  ? 202  GLU A N   1 
ATOM   1583 C CA  . GLU A 1 207 ? 3.398  23.664  26.299 1.00 50.52  ? 202  GLU A CA  1 
ATOM   1584 C C   . GLU A 1 207 ? 3.469  23.743  24.801 1.00 53.79  ? 202  GLU A C   1 
ATOM   1585 O O   . GLU A 1 207 ? 4.417  24.298  24.239 1.00 54.17  ? 202  GLU A O   1 
ATOM   1586 C CB  . GLU A 1 207 ? 4.772  23.847  26.889 1.00 52.28  ? 202  GLU A CB  1 
ATOM   1587 C CG  . GLU A 1 207 ? 4.715  23.943  28.408 1.00 67.50  ? 202  GLU A CG  1 
ATOM   1588 C CD  . GLU A 1 207 ? 5.943  24.545  29.046 1.00 86.82  ? 202  GLU A CD  1 
ATOM   1589 O OE1 . GLU A 1 207 ? 6.346  25.639  28.593 1.00 86.73  ? 202  GLU A OE1 1 
ATOM   1590 O OE2 . GLU A 1 207 ? 6.444  23.985  30.049 1.00 80.89  ? 202  GLU A OE2 1 
ATOM   1591 N N   . LEU A 1 208 ? 2.457  23.148  24.150 1.00 50.36  ? 203  LEU A N   1 
ATOM   1592 C CA  . LEU A 1 208 ? 2.335  23.082  22.706 1.00 48.76  ? 203  LEU A CA  1 
ATOM   1593 C C   . LEU A 1 208 ? 2.313  24.458  22.082 1.00 52.23  ? 203  LEU A C   1 
ATOM   1594 O O   . LEU A 1 208 ? 2.685  24.542  20.911 1.00 49.20  ? 203  LEU A O   1 
ATOM   1595 C CB  . LEU A 1 208 ? 1.085  22.266  22.348 1.00 48.37  ? 203  LEU A CB  1 
ATOM   1596 C CG  . LEU A 1 208 ? 1.083  21.465  21.043 1.00 51.55  ? 203  LEU A CG  1 
ATOM   1597 C CD1 . LEU A 1 208 ? 2.159  20.330  21.048 1.00 49.63  ? 203  LEU A CD1 1 
ATOM   1598 C CD2 . LEU A 1 208 ? -0.307 20.926  20.769 1.00 52.28  ? 203  LEU A CD2 1 
ATOM   1599 N N   . ASP A 1 209 ? 1.912  25.531  22.835 1.00 52.09  ? 204  ASP A N   1 
ATOM   1600 C CA  . ASP A 1 209 ? 1.872  26.917  22.315 1.00 54.40  ? 204  ASP A CA  1 
ATOM   1601 C C   . ASP A 1 209 ? 3.296  27.419  22.008 1.00 58.59  ? 204  ASP A C   1 
ATOM   1602 O O   . ASP A 1 209 ? 3.456  28.415  21.304 1.00 60.13  ? 204  ASP A O   1 
ATOM   1603 C CB  . ASP A 1 209 ? 1.199  27.862  23.317 1.00 59.58  ? 204  ASP A CB  1 
ATOM   1604 C CG  . ASP A 1 209 ? 1.990  27.961  24.597 1.00 84.70  ? 204  ASP A CG  1 
ATOM   1605 O OD1 . ASP A 1 209 ? 1.897  27.032  25.425 1.00 88.89  ? 204  ASP A OD1 1 
ATOM   1606 O OD2 . ASP A 1 209 ? 2.742  28.946  24.750 1.00 96.98  ? 204  ASP A OD2 1 
ATOM   1607 N N   . THR A 1 210 ? 4.320  26.724  22.554 1.00 54.24  ? 205  THR A N   1 
ATOM   1608 C CA  . THR A 1 210 ? 5.736  27.020  22.297 1.00 54.15  ? 205  THR A CA  1 
ATOM   1609 C C   . THR A 1 210 ? 6.278  26.411  20.961 1.00 59.35  ? 205  THR A C   1 
ATOM   1610 O O   . THR A 1 210 ? 7.447  26.626  20.611 1.00 59.73  ? 205  THR A O   1 
ATOM   1611 C CB  . THR A 1 210 ? 6.606  26.620  23.489 1.00 53.41  ? 205  THR A CB  1 
ATOM   1612 O OG1 . THR A 1 210 ? 6.741  25.200  23.577 1.00 51.07  ? 205  THR A OG1 1 
ATOM   1613 C CG2 . THR A 1 210 ? 6.135  27.228  24.805 1.00 50.84  ? 205  THR A CG2 1 
ATOM   1614 N N   . LEU A 1 211 ? 5.453  25.635  20.239 1.00 54.52  ? 206  LEU A N   1 
ATOM   1615 C CA  . LEU A 1 211 ? 5.876  25.088  18.944 1.00 52.05  ? 206  LEU A CA  1 
ATOM   1616 C C   . LEU A 1 211 ? 6.128  26.286  18.035 1.00 58.74  ? 206  LEU A C   1 
ATOM   1617 O O   . LEU A 1 211 ? 5.466  27.315  18.198 1.00 55.97  ? 206  LEU A O   1 
ATOM   1618 C CB  . LEU A 1 211 ? 4.754  24.247  18.332 1.00 50.07  ? 206  LEU A CB  1 
ATOM   1619 C CG  . LEU A 1 211 ? 4.511  22.853  18.887 1.00 51.44  ? 206  LEU A CG  1 
ATOM   1620 C CD1 . LEU A 1 211 ? 3.253  22.266  18.266 1.00 48.07  ? 206  LEU A CD1 1 
ATOM   1621 C CD2 . LEU A 1 211 ? 5.673  21.970  18.577 1.00 51.42  ? 206  LEU A CD2 1 
ATOM   1622 N N   . SER A 1 212 ? 7.058  26.159  17.085 1.00 61.57  ? 207  SER A N   1 
ATOM   1623 C CA  . SER A 1 212 ? 7.325  27.241  16.142 1.00 65.43  ? 207  SER A CA  1 
ATOM   1624 C C   . SER A 1 212 ? 6.861  26.790  14.763 1.00 73.81  ? 207  SER A C   1 
ATOM   1625 O O   . SER A 1 212 ? 6.907  25.593  14.478 1.00 73.04  ? 207  SER A O   1 
ATOM   1626 C CB  . SER A 1 212 ? 8.816  27.539  16.105 1.00 71.58  ? 207  SER A CB  1 
ATOM   1627 O OG  . SER A 1 212 ? 9.515  26.407  15.617 1.00 83.12  ? 207  SER A OG  1 
ATOM   1628 N N   . GLU A 1 213 ? 6.454  27.721  13.894 1.00 73.97  ? 208  GLU A N   1 
ATOM   1629 C CA  . GLU A 1 213 ? 6.051  27.346  12.526 1.00 74.11  ? 208  GLU A CA  1 
ATOM   1630 C C   . GLU A 1 213 ? 7.239  26.711  11.703 1.00 77.64  ? 208  GLU A C   1 
ATOM   1631 O O   . GLU A 1 213 ? 7.026  25.933  10.759 1.00 76.92  ? 208  GLU A O   1 
ATOM   1632 C CB  . GLU A 1 213 ? 5.393  28.535  11.824 1.00 76.48  ? 208  GLU A CB  1 
ATOM   1633 C CG  . GLU A 1 213 ? 4.762  28.204  10.486 1.00 89.45  ? 208  GLU A CG  1 
ATOM   1634 C CD  . GLU A 1 213 ? 3.595  27.233  10.489 1.00 112.32 ? 208  GLU A CD  1 
ATOM   1635 O OE1 . GLU A 1 213 ? 2.695  27.362  11.353 1.00 95.08  ? 208  GLU A OE1 1 
ATOM   1636 O OE2 . GLU A 1 213 ? 3.547  26.384  9.570  1.00 113.32 ? 208  GLU A OE2 1 
ATOM   1637 N N   . GLU A 1 214 ? 8.476  26.971  12.146 1.00 74.15  ? 209  GLU A N   1 
ATOM   1638 C CA  . GLU A 1 214 ? 9.700  26.477  11.513 1.00 73.32  ? 209  GLU A CA  1 
ATOM   1639 C C   . GLU A 1 214 ? 9.950  25.019  11.848 1.00 74.26  ? 209  GLU A C   1 
ATOM   1640 O O   . GLU A 1 214 ? 10.556 24.308  11.051 1.00 73.29  ? 209  GLU A O   1 
ATOM   1641 C CB  . GLU A 1 214 ? 10.924 27.302  11.972 1.00 75.66  ? 209  GLU A CB  1 
ATOM   1642 C CG  . GLU A 1 214 ? 10.673 28.803  12.029 1.00 93.66  ? 209  GLU A CG  1 
ATOM   1643 C CD  . GLU A 1 214 ? 10.456 29.417  13.401 1.00 123.08 ? 209  GLU A CD  1 
ATOM   1644 O OE1 . GLU A 1 214 ? 11.269 29.143  14.315 1.00 131.23 ? 209  GLU A OE1 1 
ATOM   1645 O OE2 . GLU A 1 214 ? 9.470  30.172  13.558 1.00 113.23 ? 209  GLU A OE2 1 
ATOM   1646 N N   . SER A 1 215 ? 9.538  24.581  13.033 1.00 68.90  ? 210  SER A N   1 
ATOM   1647 C CA  . SER A 1 215 ? 9.869  23.221  13.452 1.00 67.19  ? 210  SER A CA  1 
ATOM   1648 C C   . SER A 1 215 ? 8.725  22.402  14.063 1.00 65.38  ? 210  SER A C   1 
ATOM   1649 O O   . SER A 1 215 ? 8.978  21.285  14.551 1.00 66.00  ? 210  SER A O   1 
ATOM   1650 C CB  . SER A 1 215 ? 11.061 23.270  14.411 1.00 72.66  ? 210  SER A CB  1 
ATOM   1651 O OG  . SER A 1 215 ? 10.701 23.991  15.579 1.00 82.97  ? 210  SER A OG  1 
ATOM   1652 N N   . TYR A 1 216 ? 7.477  22.920  14.016 1.00 56.24  ? 211  TYR A N   1 
ATOM   1653 C CA  . TYR A 1 216 ? 6.392  22.182  14.623 1.00 53.27  ? 211  TYR A CA  1 
ATOM   1654 C C   . TYR A 1 216 ? 6.189  20.794  14.061 1.00 53.71  ? 211  TYR A C   1 
ATOM   1655 O O   . TYR A 1 216 ? 5.880  19.902  14.841 1.00 53.14  ? 211  TYR A O   1 
ATOM   1656 C CB  . TYR A 1 216 ? 5.110  22.994  14.690 1.00 52.99  ? 211  TYR A CB  1 
ATOM   1657 C CG  . TYR A 1 216 ? 4.196  22.885  13.503 1.00 53.25  ? 211  TYR A CG  1 
ATOM   1658 C CD1 . TYR A 1 216 ? 3.270  21.844  13.408 1.00 53.77  ? 211  TYR A CD1 1 
ATOM   1659 C CD2 . TYR A 1 216 ? 4.118  23.912  12.566 1.00 54.61  ? 211  TYR A CD2 1 
ATOM   1660 C CE1 . TYR A 1 216 ? 2.371  21.766  12.354 1.00 54.05  ? 211  TYR A CE1 1 
ATOM   1661 C CE2 . TYR A 1 216 ? 3.186  23.869  11.527 1.00 55.23  ? 211  TYR A CE2 1 
ATOM   1662 C CZ  . TYR A 1 216 ? 2.326  22.780  11.415 1.00 61.53  ? 211  TYR A CZ  1 
ATOM   1663 O OH  . TYR A 1 216 ? 1.387  22.679  10.424 1.00 59.65  ? 211  TYR A OH  1 
ATOM   1664 N N   . LYS A 1 217 ? 6.377  20.601  12.741 1.00 48.27  ? 212  LYS A N   1 
ATOM   1665 C CA  . LYS A 1 217 ? 6.253  19.270  12.146 1.00 47.46  ? 212  LYS A CA  1 
ATOM   1666 C C   . LYS A 1 217 ? 7.397  18.347  12.585 1.00 48.42  ? 212  LYS A C   1 
ATOM   1667 O O   . LYS A 1 217 ? 7.170  17.150  12.758 1.00 45.95  ? 212  LYS A O   1 
ATOM   1668 C CB  . LYS A 1 217 ? 6.100  19.317  10.619 1.00 48.78  ? 212  LYS A CB  1 
ATOM   1669 C CG  . LYS A 1 217 ? 4.795  19.999  10.189 1.00 68.81  ? 212  LYS A CG  1 
ATOM   1670 C CD  . LYS A 1 217 ? 4.079  19.311  9.033  1.00 89.38  ? 212  LYS A CD  1 
ATOM   1671 C CE  . LYS A 1 217 ? 4.511  19.735  7.633  1.00 105.86 ? 212  LYS A CE  1 
ATOM   1672 N NZ  . LYS A 1 217 ? 3.925  18.859  6.568  1.00 111.00 ? 212  LYS A NZ  1 
ATOM   1673 N N   . ASP A 1 218 ? 8.614  18.907  12.812 1.00 45.61  ? 213  ASP A N   1 
ATOM   1674 C CA  . ASP A 1 218 ? 9.737  18.084  13.315 1.00 46.85  ? 213  ASP A CA  1 
ATOM   1675 C C   . ASP A 1 218 ? 9.411  17.634  14.744 1.00 47.86  ? 213  ASP A C   1 
ATOM   1676 O O   . ASP A 1 218 ? 9.540  16.448  15.047 1.00 50.70  ? 213  ASP A O   1 
ATOM   1677 C CB  . ASP A 1 218 ? 11.054 18.888  13.342 1.00 50.70  ? 213  ASP A CB  1 
ATOM   1678 C CG  . ASP A 1 218 ? 11.572 19.345  11.972 1.00 74.64  ? 213  ASP A CG  1 
ATOM   1679 O OD1 . ASP A 1 218 ? 11.300 18.644  10.957 1.00 78.90  ? 213  ASP A OD1 1 
ATOM   1680 O OD2 . ASP A 1 218 ? 12.285 20.374  11.918 1.00 81.85  ? 213  ASP A OD2 1 
ATOM   1681 N N   . SER A 1 219 ? 8.895  18.567  15.576 1.00 39.87  ? 214  SER A N   1 
ATOM   1682 C CA  . SER A 1 219 ? 8.514  18.270  16.965 1.00 40.16  ? 214  SER A CA  1 
ATOM   1683 C C   . SER A 1 219 ? 7.405  17.245  17.017 1.00 43.91  ? 214  SER A C   1 
ATOM   1684 O O   . SER A 1 219 ? 7.530  16.265  17.733 1.00 42.39  ? 214  SER A O   1 
ATOM   1685 C CB  . SER A 1 219 ? 8.064  19.527  17.697 1.00 39.99  ? 214  SER A CB  1 
ATOM   1686 O OG  . SER A 1 219 ? 9.102  20.484  17.764 1.00 43.05  ? 214  SER A OG  1 
ATOM   1687 N N   . THR A 1 220 ? 6.309  17.465  16.275 1.00 43.94  ? 215  THR A N   1 
ATOM   1688 C CA  . THR A 1 220 ? 5.165  16.551  16.334 1.00 44.08  ? 215  THR A CA  1 
ATOM   1689 C C   . THR A 1 220 ? 5.495  15.188  15.780 1.00 47.97  ? 215  THR A C   1 
ATOM   1690 O O   . THR A 1 220 ? 4.950  14.208  16.279 1.00 47.15  ? 215  THR A O   1 
ATOM   1691 C CB  . THR A 1 220 ? 3.892  17.160  15.765 1.00 46.99  ? 215  THR A CB  1 
ATOM   1692 O OG1 . THR A 1 220 ? 4.084  17.397  14.369 1.00 46.80  ? 215  THR A OG1 1 
ATOM   1693 C CG2 . THR A 1 220 ? 3.481  18.421  16.495 1.00 44.30  ? 215  THR A CG2 1 
ATOM   1694 N N   . LEU A 1 221 ? 6.400  15.089  14.804 1.00 44.65  ? 216  LEU A N   1 
ATOM   1695 C CA  . LEU A 1 221 ? 6.827  13.763  14.329 1.00 44.87  ? 216  LEU A CA  1 
ATOM   1696 C C   . LEU A 1 221 ? 7.513  12.959  15.451 1.00 45.56  ? 216  LEU A C   1 
ATOM   1697 O O   . LEU A 1 221 ? 7.198  11.785  15.656 1.00 46.15  ? 216  LEU A O   1 
ATOM   1698 C CB  . LEU A 1 221 ? 7.752  13.892  13.115 1.00 45.66  ? 216  LEU A CB  1 
ATOM   1699 C CG  . LEU A 1 221 ? 8.288  12.537  12.621 1.00 55.42  ? 216  LEU A CG  1 
ATOM   1700 C CD1 . LEU A 1 221 ? 7.144  11.461  12.385 1.00 57.44  ? 216  LEU A CD1 1 
ATOM   1701 C CD2 . LEU A 1 221 ? 9.144  12.710  11.390 1.00 60.90  ? 216  LEU A CD2 1 
ATOM   1702 N N   . ILE A 1 222 ? 8.420  13.612  16.197 1.00 39.89  ? 217  ILE A N   1 
ATOM   1703 C CA  . ILE A 1 222 ? 9.114  12.957  17.314 1.00 39.59  ? 217  ILE A CA  1 
ATOM   1704 C C   . ILE A 1 222 ? 8.123  12.597  18.434 1.00 42.27  ? 217  ILE A C   1 
ATOM   1705 O O   . ILE A 1 222 ? 8.227  11.534  19.029 1.00 41.58  ? 217  ILE A O   1 
ATOM   1706 C CB  . ILE A 1 222 ? 10.339 13.773  17.829 1.00 41.54  ? 217  ILE A CB  1 
ATOM   1707 C CG1 . ILE A 1 222 ? 11.338 14.073  16.660 1.00 40.48  ? 217  ILE A CG1 1 
ATOM   1708 C CG2 . ILE A 1 222 ? 11.011 12.990  18.955 1.00 40.39  ? 217  ILE A CG2 1 
ATOM   1709 C CD1 . ILE A 1 222 ? 12.366 15.154  16.976 1.00 40.51  ? 217  ILE A CD1 1 
ATOM   1710 N N   . MET A 1 223 ? 7.148  13.462  18.683 1.00 39.34  ? 218  MET A N   1 
ATOM   1711 C CA  . MET A 1 223 ? 6.100  13.185  19.663 1.00 38.32  ? 218  MET A CA  1 
ATOM   1712 C C   . MET A 1 223 ? 5.324  11.941  19.268 1.00 43.28  ? 218  MET A C   1 
ATOM   1713 O O   . MET A 1 223 ? 5.021  11.156  20.124 1.00 45.13  ? 218  MET A O   1 
ATOM   1714 C CB  . MET A 1 223 ? 5.160  14.365  19.770 1.00 39.88  ? 218  MET A CB  1 
ATOM   1715 C CG  . MET A 1 223 ? 5.771  15.540  20.529 1.00 43.57  ? 218  MET A CG  1 
ATOM   1716 S SD  . MET A 1 223 ? 4.765  17.044  20.508 1.00 48.02  ? 218  MET A SD  1 
ATOM   1717 C CE  . MET A 1 223 ? 3.526  16.582  21.715 1.00 46.70  ? 218  MET A CE  1 
ATOM   1718 N N   . GLN A 1 224 ? 5.031  11.740  17.994 1.00 40.08  ? 219  GLN A N   1 
ATOM   1719 C CA  . GLN A 1 224 ? 4.331  10.544  17.516 1.00 40.21  ? 219  GLN A CA  1 
ATOM   1720 C C   . GLN A 1 224 ? 5.171  9.298   17.824 1.00 42.85  ? 219  GLN A C   1 
ATOM   1721 O O   . GLN A 1 224 ? 4.633  8.273   18.219 1.00 41.90  ? 219  GLN A O   1 
ATOM   1722 C CB  . GLN A 1 224 ? 4.124  10.627  15.983 1.00 39.86  ? 219  GLN A CB  1 
ATOM   1723 C CG  . GLN A 1 224 ? 3.086  11.660  15.598 1.00 48.25  ? 219  GLN A CG  1 
ATOM   1724 C CD  . GLN A 1 224 ? 3.001  11.810  14.094 1.00 59.84  ? 219  GLN A CD  1 
ATOM   1725 O OE1 . GLN A 1 224 ? 3.126  10.857  13.311 1.00 49.27  ? 219  GLN A OE1 1 
ATOM   1726 N NE2 . GLN A 1 224 ? 2.842  13.036  13.665 1.00 57.41  ? 219  GLN A NE2 1 
ATOM   1727 N N   . LEU A 1 225 ? 6.490  9.393   17.611 1.00 38.94  ? 220  LEU A N   1 
ATOM   1728 C CA  . LEU A 1 225 ? 7.396  8.276   17.861 1.00 37.54  ? 220  LEU A CA  1 
ATOM   1729 C C   . LEU A 1 225 ? 7.436  7.972   19.329 1.00 41.30  ? 220  LEU A C   1 
ATOM   1730 O O   . LEU A 1 225 ? 7.399  6.803   19.698 1.00 42.48  ? 220  LEU A O   1 
ATOM   1731 C CB  . LEU A 1 225 ? 8.824  8.590   17.353 1.00 37.43  ? 220  LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 225 ? 9.002  8.848   15.825 1.00 41.62  ? 220  LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 225 ? 10.439 9.296   15.502 1.00 40.90  ? 220  LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 225 ? 8.691  7.601   15.026 1.00 39.15  ? 220  LEU A CD2 1 
ATOM   1735 N N   . LEU A 1 226 ? 7.469  9.023   20.184 1.00 36.94  ? 221  LEU A N   1 
ATOM   1736 C CA  . LEU A 1 226 ? 7.459  8.803   21.638 1.00 36.20  ? 221  LEU A CA  1 
ATOM   1737 C C   . LEU A 1 226 ? 6.220  8.050   22.039 1.00 40.55  ? 221  LEU A C   1 
ATOM   1738 O O   . LEU A 1 226 ? 6.314  7.019   22.709 1.00 38.94  ? 221  LEU A O   1 
ATOM   1739 C CB  . LEU A 1 226 ? 7.513  10.130  22.402 1.00 35.16  ? 221  LEU A CB  1 
ATOM   1740 C CG  . LEU A 1 226 ? 8.859  10.821  22.436 1.00 37.56  ? 221  LEU A CG  1 
ATOM   1741 C CD1 . LEU A 1 226 ? 8.701  12.305  22.811 1.00 35.83  ? 221  LEU A CD1 1 
ATOM   1742 C CD2 . LEU A 1 226 ? 9.774  10.156  23.460 1.00 33.16  ? 221  LEU A CD2 1 
ATOM   1743 N N   . ARG A 1 227 ? 5.068  8.496   21.553 1.00 39.73  ? 222  ARG A N   1 
ATOM   1744 C CA  . ARG A 1 227 ? 3.826  7.876   21.961 1.00 41.45  ? 222  ARG A CA  1 
ATOM   1745 C C   . ARG A 1 227 ? 3.684  6.510   21.418 1.00 46.17  ? 222  ARG A C   1 
ATOM   1746 O O   . ARG A 1 227 ? 3.152  5.667   22.109 1.00 48.96  ? 222  ARG A O   1 
ATOM   1747 C CB  . ARG A 1 227 ? 2.630  8.750   21.591 1.00 40.94  ? 222  ARG A CB  1 
ATOM   1748 C CG  . ARG A 1 227 ? 1.421  8.460   22.470 1.00 44.59  ? 222  ARG A CG  1 
ATOM   1749 C CD  . ARG A 1 227 ? 0.270  9.449   22.266 1.00 48.35  ? 222  ARG A CD  1 
ATOM   1750 N NE  . ARG A 1 227 ? -0.324 9.366   20.926 1.00 46.72  ? 222  ARG A NE  1 
ATOM   1751 C CZ  . ARG A 1 227 ? -1.298 8.535   20.580 1.00 57.48  ? 222  ARG A CZ  1 
ATOM   1752 N NH1 . ARG A 1 227 ? -1.844 7.720   21.484 1.00 46.31  ? 222  ARG A NH1 1 
ATOM   1753 N NH2 . ARG A 1 227 ? -1.725 8.496   19.328 1.00 38.30  ? 222  ARG A NH2 1 
ATOM   1754 N N   . ASP A 1 228 ? 4.158  6.263   20.195 1.00 39.85  ? 223  ASP A N   1 
ATOM   1755 C CA  . ASP A 1 228 ? 4.064  4.934   19.601 1.00 38.43  ? 223  ASP A CA  1 
ATOM   1756 C C   . ASP A 1 228 ? 4.909  3.933   20.395 1.00 44.12  ? 223  ASP A C   1 
ATOM   1757 O O   . ASP A 1 228 ? 4.480  2.802   20.625 1.00 42.50  ? 223  ASP A O   1 
ATOM   1758 C CB  . ASP A 1 228 ? 4.505  4.966   18.132 1.00 36.58  ? 223  ASP A CB  1 
ATOM   1759 C CG  . ASP A 1 228 ? 3.454  5.550   17.181 1.00 44.38  ? 223  ASP A CG  1 
ATOM   1760 O OD1 . ASP A 1 228 ? 2.313  5.801   17.629 1.00 43.26  ? 223  ASP A OD1 1 
ATOM   1761 O OD2 . ASP A 1 228 ? 3.768  5.740   15.978 1.00 46.62  ? 223  ASP A OD2 1 
ATOM   1762 N N   . ASN A 1 229 ? 6.099  4.356   20.821 1.00 43.28  ? 224  ASN A N   1 
ATOM   1763 C CA  . ASN A 1 229 ? 6.955  3.493   21.652 1.00 45.30  ? 224  ASN A CA  1 
ATOM   1764 C C   . ASN A 1 229 ? 6.249  3.225   22.976 1.00 51.88  ? 224  ASN A C   1 
ATOM   1765 O O   . ASN A 1 229 ? 6.155  2.078   23.379 1.00 53.09  ? 224  ASN A O   1 
ATOM   1766 C CB  . ASN A 1 229 ? 8.334  4.143   21.904 1.00 44.57  ? 224  ASN A CB  1 
ATOM   1767 C CG  . ASN A 1 229 ? 9.275  4.070   20.735 1.00 46.49  ? 224  ASN A CG  1 
ATOM   1768 O OD1 . ASN A 1 229 ? 8.955  3.484   19.718 1.00 43.32  ? 224  ASN A OD1 1 
ATOM   1769 N ND2 . ASN A 1 229 ? 10.452 4.676   20.841 1.00 37.42  ? 224  ASN A ND2 1 
ATOM   1770 N N   . LEU A 1 230 ? 5.708  4.267   23.587 1.00 50.21  ? 225  LEU A N   1 
ATOM   1771 C CA  . LEU A 1 230 ? 4.964  4.141   24.822 1.00 51.94  ? 225  LEU A CA  1 
ATOM   1772 C C   . LEU A 1 230 ? 3.804  3.161   24.667 1.00 57.15  ? 225  LEU A C   1 
ATOM   1773 O O   . LEU A 1 230 ? 3.587  2.320   25.524 1.00 57.71  ? 225  LEU A O   1 
ATOM   1774 C CB  . LEU A 1 230 ? 4.454  5.508   25.258 1.00 52.27  ? 225  LEU A CB  1 
ATOM   1775 C CG  . LEU A 1 230 ? 4.148  5.709   26.733 1.00 59.10  ? 225  LEU A CG  1 
ATOM   1776 C CD1 . LEU A 1 230 ? 5.358  5.351   27.570 1.00 59.01  ? 225  LEU A CD1 1 
ATOM   1777 C CD2 . LEU A 1 230 ? 3.743  7.144   26.961 1.00 62.04  ? 225  LEU A CD2 1 
ATOM   1778 N N   . THR A 1 231 ? 3.065  3.271   23.571 1.00 53.74  ? 226  THR A N   1 
ATOM   1779 C CA  . THR A 1 231 ? 1.971  2.348   23.302 1.00 54.70  ? 226  THR A CA  1 
ATOM   1780 C C   . THR A 1 231 ? 2.488  0.929   23.245 1.00 60.68  ? 226  THR A C   1 
ATOM   1781 O O   . THR A 1 231 ? 1.906  0.072   23.891 1.00 62.65  ? 226  THR A O   1 
ATOM   1782 C CB  . THR A 1 231 ? 1.246  2.744   22.024 1.00 55.51  ? 226  THR A CB  1 
ATOM   1783 O OG1 . THR A 1 231 ? 0.729  4.049   22.208 1.00 54.10  ? 226  THR A OG1 1 
ATOM   1784 C CG2 . THR A 1 231 ? 0.055  1.831   21.717 1.00 49.80  ? 226  THR A CG2 1 
ATOM   1785 N N   . LEU A 1 232 ? 3.566  0.685   22.478 1.00 56.41  ? 227  LEU A N   1 
ATOM   1786 C CA  . LEU A 1 232 ? 4.176  -0.627  22.334 1.00 56.55  ? 227  LEU A CA  1 
ATOM   1787 C C   . LEU A 1 232 ? 4.581  -1.157  23.692 1.00 61.56  ? 227  LEU A C   1 
ATOM   1788 O O   . LEU A 1 232 ? 4.281  -2.301  24.009 1.00 63.86  ? 227  LEU A O   1 
ATOM   1789 C CB  . LEU A 1 232 ? 5.409  -0.540  21.402 1.00 56.01  ? 227  LEU A CB  1 
ATOM   1790 C CG  . LEU A 1 232 ? 6.057  -1.846  20.945 1.00 63.60  ? 227  LEU A CG  1 
ATOM   1791 C CD1 . LEU A 1 232 ? 5.196  -2.547  19.879 1.00 63.23  ? 227  LEU A CD1 1 
ATOM   1792 C CD2 . LEU A 1 232 ? 7.454  -1.583  20.415 1.00 67.94  ? 227  LEU A CD2 1 
ATOM   1793 N N   . TRP A 1 233 ? 5.221  -0.326  24.503 1.00 56.50  ? 228  TRP A N   1 
ATOM   1794 C CA  . TRP A 1 233 ? 5.796  -0.774  25.753 1.00 56.86  ? 228  TRP A CA  1 
ATOM   1795 C C   . TRP A 1 233 ? 4.822  -0.969  26.900 1.00 65.96  ? 228  TRP A C   1 
ATOM   1796 O O   . TRP A 1 233 ? 5.178  -1.628  27.885 1.00 66.54  ? 228  TRP A O   1 
ATOM   1797 C CB  . TRP A 1 233 ? 6.955  0.141   26.183 1.00 54.22  ? 228  TRP A CB  1 
ATOM   1798 C CG  . TRP A 1 233 ? 8.074  0.345   25.191 1.00 52.32  ? 228  TRP A CG  1 
ATOM   1799 C CD1 . TRP A 1 233 ? 8.524  -0.529  24.248 1.00 54.04  ? 228  TRP A CD1 1 
ATOM   1800 C CD2 . TRP A 1 233 ? 8.960  1.473   25.154 1.00 50.72  ? 228  TRP A CD2 1 
ATOM   1801 N NE1 . TRP A 1 233 ? 9.624  -0.004  23.604 1.00 52.29  ? 228  TRP A NE1 1 
ATOM   1802 C CE2 . TRP A 1 233 ? 9.905  1.236   24.132 1.00 52.83  ? 228  TRP A CE2 1 
ATOM   1803 C CE3 . TRP A 1 233 ? 9.014  2.691   25.861 1.00 51.64  ? 228  TRP A CE3 1 
ATOM   1804 C CZ2 . TRP A 1 233 ? 10.943 2.150   23.840 1.00 50.05  ? 228  TRP A CZ2 1 
ATOM   1805 C CZ3 . TRP A 1 233 ? 10.024 3.596   25.566 1.00 51.62  ? 228  TRP A CZ3 1 
ATOM   1806 C CH2 . TRP A 1 233 ? 10.992 3.308   24.586 1.00 50.58  ? 228  TRP A CH2 1 
ATOM   1807 N N   . THR A 1 234 ? 3.617  -0.378  26.799 1.00 64.73  ? 229  THR A N   1 
ATOM   1808 C CA  . THR A 1 234 ? 2.593  -0.423  27.848 1.00 66.36  ? 229  THR A CA  1 
ATOM   1809 C C   . THR A 1 234 ? 1.480  -1.391  27.469 1.00 72.72  ? 229  THR A C   1 
ATOM   1810 O O   . THR A 1 234 ? 0.478  -1.479  28.175 1.00 76.21  ? 229  THR A O   1 
ATOM   1811 C CB  . THR A 1 234 ? 2.000  0.982   28.105 1.00 66.94  ? 229  THR A CB  1 
ATOM   1812 O OG1 . THR A 1 234 ? 1.470  1.563   26.913 1.00 65.78  ? 229  THR A OG1 1 
ATOM   1813 C CG2 . THR A 1 234 ? 2.971  1.928   28.768 1.00 62.65  ? 229  THR A CG2 1 
ATOM   1814 N N   . SER A 1 235 ? 1.648  -2.096  26.354 1.00 67.55  ? 230  SER A N   1 
ATOM   1815 C CA  . SER A 1 235 ? 0.658  -3.009  25.784 1.00 102.96 ? 230  SER A CA  1 
ATOM   1816 C C   . SER A 1 235 ? 0.918  -4.496  26.058 1.00 132.71 ? 230  SER A C   1 
ATOM   1817 O O   . SER A 1 235 ? 1.116  -4.875  27.209 1.00 96.77  ? 230  SER A O   1 
ATOM   1818 C CB  . SER A 1 235 ? 0.519  -2.753  24.286 1.00 104.62 ? 230  SER A CB  1 
ATOM   1819 O OG  . SER A 1 235 ? 1.510  -3.415  23.514 1.00 112.15 ? 230  SER A OG  1 
ATOM   1820 N N   . LYS B 2 4   ? 13.622 -4.494  12.080 1.00 85.58  ? 1006 LYS B N   1 
ATOM   1821 C CA  . LYS B 2 4   ? 12.721 -5.480  12.658 1.00 85.19  ? 1006 LYS B CA  1 
ATOM   1822 C C   . LYS B 2 4   ? 12.396 -5.149  14.108 1.00 86.69  ? 1006 LYS B C   1 
ATOM   1823 O O   . LYS B 2 4   ? 11.549 -5.791  14.724 1.00 87.39  ? 1006 LYS B O   1 
ATOM   1824 C CB  . LYS B 2 4   ? 13.322 -6.878  12.548 1.00 88.13  ? 1006 LYS B CB  1 
ATOM   1825 C CG  . LYS B 2 4   ? 12.496 -7.969  13.194 1.00 103.98 ? 1006 LYS B CG  1 
ATOM   1826 C CD  . LYS B 2 4   ? 13.013 -9.326  12.771 1.00 115.59 ? 1006 LYS B CD  1 
ATOM   1827 C CE  . LYS B 2 4   ? 12.486 -10.432 13.657 1.00 127.34 ? 1006 LYS B CE  1 
ATOM   1828 N NZ  . LYS B 2 4   ? 13.084 -11.741 13.279 1.00 136.18 ? 1006 LYS B NZ  1 
ATOM   1829 N N   . ARG B 2 5   ? 13.055 -4.134  14.654 1.00 78.80  ? 1007 ARG B N   1 
ATOM   1830 C CA  . ARG B 2 5   ? 12.763 -3.701  16.015 1.00 76.12  ? 1007 ARG B CA  1 
ATOM   1831 C C   . ARG B 2 5   ? 11.471 -2.903  15.971 1.00 74.42  ? 1007 ARG B C   1 
ATOM   1832 O O   . ARG B 2 5   ? 11.309 -2.035  15.119 1.00 74.64  ? 1007 ARG B O   1 
ATOM   1833 C CB  . ARG B 2 5   ? 13.890 -2.839  16.573 1.00 73.87  ? 1007 ARG B CB  1 
ATOM   1834 C CG  . ARG B 2 5   ? 13.717 -2.489  18.035 1.00 73.90  ? 1007 ARG B CG  1 
ATOM   1835 C CD  . ARG B 2 5   ? 14.033 -1.035  18.281 1.00 71.92  ? 1007 ARG B CD  1 
ATOM   1836 N NE  . ARG B 2 5   ? 15.461 -0.776  18.361 1.00 71.66  ? 1007 ARG B NE  1 
ATOM   1837 C CZ  . ARG B 2 5   ? 16.009 0.417   18.185 1.00 70.68  ? 1007 ARG B CZ  1 
ATOM   1838 N NH1 . ARG B 2 5   ? 15.251 1.458   17.895 1.00 60.18  ? 1007 ARG B NH1 1 
ATOM   1839 N NH2 . ARG B 2 5   ? 17.315 0.566   18.282 1.00 47.15  ? 1007 ARG B NH2 1 
ATOM   1840 N N   . GLN B 2 6   ? 10.549 -3.201  16.879 1.00 65.54  ? 1008 GLN B N   1 
ATOM   1841 C CA  . GLN B 2 6   ? 9.245  -2.543  16.897 1.00 62.90  ? 1008 GLN B CA  1 
ATOM   1842 C C   . GLN B 2 6   ? 9.282  -1.077  17.314 1.00 61.53  ? 1008 GLN B C   1 
ATOM   1843 O O   . GLN B 2 6   ? 8.626  -0.247  16.705 1.00 61.19  ? 1008 GLN B O   1 
ATOM   1844 C CB  . GLN B 2 6   ? 8.274  -3.308  17.793 1.00 64.06  ? 1008 GLN B CB  1 
ATOM   1845 C CG  . GLN B 2 6   ? 8.118  -4.765  17.445 1.00 82.36  ? 1008 GLN B CG  1 
ATOM   1846 C CD  . GLN B 2 6   ? 7.292  -4.980  16.205 1.00 109.78 ? 1008 GLN B CD  1 
ATOM   1847 O OE1 . GLN B 2 6   ? 6.236  -5.603  16.257 1.00 109.40 ? 1008 GLN B OE1 1 
ATOM   1848 N NE2 . GLN B 2 6   ? 7.762  -4.462  15.081 1.00 102.77 ? 1008 GLN B NE2 1 
ATOM   1849 N N   . TYR B 2 7   ? 10.038 -0.766  18.358 1.00 54.31  ? 1009 TYR B N   1 
ATOM   1850 C CA  . TYR B 2 7   ? 10.142 0.602   18.838 1.00 53.09  ? 1009 TYR B CA  1 
ATOM   1851 C C   . TYR B 2 7   ? 11.230 1.343   18.076 1.00 54.83  ? 1009 TYR B C   1 
ATOM   1852 O O   . TYR B 2 7   ? 12.184 0.745   17.601 1.00 54.32  ? 1009 TYR B O   1 
ATOM   1853 C CB  . TYR B 2 7   ? 10.377 0.644   20.347 1.00 53.06  ? 1009 TYR B CB  1 
ATOM   1854 C CG  . TYR B 2 7   ? 11.435 -0.306  20.836 1.00 54.04  ? 1009 TYR B CG  1 
ATOM   1855 C CD1 . TYR B 2 7   ? 12.737 0.117   21.018 1.00 55.93  ? 1009 TYR B CD1 1 
ATOM   1856 C CD2 . TYR B 2 7   ? 11.132 -1.626  21.115 1.00 54.61  ? 1009 TYR B CD2 1 
ATOM   1857 C CE1 . TYR B 2 7   ? 13.705 -0.739  21.458 1.00 57.32  ? 1009 TYR B CE1 1 
ATOM   1858 C CE2 . TYR B 2 7   ? 12.098 -2.493  21.557 1.00 55.66  ? 1009 TYR B CE2 1 
ATOM   1859 C CZ  . TYR B 2 7   ? 13.382 -2.041  21.730 1.00 64.73  ? 1009 TYR B CZ  1 
ATOM   1860 O OH  . TYR B 2 7   ? 14.355 -2.892  22.172 1.00 68.69  ? 1009 TYR B OH  1 
ATOM   1861 N N   . LYS B 2 8   ? 11.068 2.651   17.952 1.00 49.02  ? 1010 LYS B N   1 
ATOM   1862 C CA  . LYS B 2 8   ? 11.964 3.466   17.146 1.00 47.78  ? 1010 LYS B CA  1 
ATOM   1863 C C   . LYS B 2 8   ? 12.811 4.466   17.909 1.00 47.83  ? 1010 LYS B C   1 
ATOM   1864 O O   . LYS B 2 8   ? 12.405 4.980   18.937 1.00 48.50  ? 1010 LYS B O   1 
ATOM   1865 C CB  . LYS B 2 8   ? 11.126 4.185   16.041 1.00 49.82  ? 1010 LYS B CB  1 
ATOM   1866 C CG  . LYS B 2 8   ? 10.124 3.237   15.338 1.00 57.15  ? 1010 LYS B CG  1 
ATOM   1867 C CD  . LYS B 2 8   ? 9.286  3.897   14.240 1.00 73.01  ? 1010 LYS B CD  1 
ATOM   1868 C CE  . LYS B 2 8   ? 8.073  3.083   13.813 1.00 86.47  ? 1010 LYS B CE  1 
ATOM   1869 N NZ  . LYS B 2 8   ? 8.413  1.679   13.430 1.00 97.87  ? 1010 LYS B NZ  1 
HETATM 1870 N N   . SEP B 2 9   ? 13.987 4.727   17.387 1.00 41.92  ? 1011 SEP B N   1 
HETATM 1871 C CA  . SEP B 2 9   ? 14.866 5.803   17.789 1.00 42.72  ? 1011 SEP B CA  1 
HETATM 1872 C CB  . SEP B 2 9   ? 16.302 5.221   17.930 1.00 40.22  ? 1011 SEP B CB  1 
HETATM 1873 O OG  . SEP B 2 9   ? 16.658 4.693   16.669 1.00 39.38  ? 1011 SEP B OG  1 
HETATM 1874 C C   . SEP B 2 9   ? 14.684 6.890   16.649 1.00 50.22  ? 1011 SEP B C   1 
HETATM 1875 O O   . SEP B 2 9   ? 13.947 6.656   15.675 1.00 48.98  ? 1011 SEP B O   1 
HETATM 1876 P P   . SEP B 2 9   ? 18.206 4.157   16.572 1.00 40.47  ? 1011 SEP B P   1 
HETATM 1877 O O1P . SEP B 2 9   ? 18.478 3.741   15.181 1.00 38.15  ? 1011 SEP B O1P 1 
HETATM 1878 O O2P . SEP B 2 9   ? 19.264 5.234   16.888 1.00 37.71  ? 1011 SEP B O2P 1 
HETATM 1879 O O3P . SEP B 2 9   ? 18.305 2.883   17.509 1.00 40.51  ? 1011 SEP B O3P 1 
ATOM   1880 N N   . ILE B 2 10  ? 15.368 8.029   16.762 1.00 48.96  ? 1012 ILE B N   1 
ATOM   1881 C CA  . ILE B 2 10  ? 15.323 9.116   15.782 1.00 50.90  ? 1012 ILE B CA  1 
ATOM   1882 C C   . ILE B 2 10  ? 15.733 8.625   14.386 1.00 58.17  ? 1012 ILE B C   1 
ATOM   1883 O O   . ILE B 2 10  ? 16.788 8.006   14.242 1.00 57.78  ? 1012 ILE B O   1 
ATOM   1884 C CB  . ILE B 2 10  ? 16.145 10.362  16.270 1.00 54.03  ? 1012 ILE B CB  1 
ATOM   1885 C CG1 . ILE B 2 10  ? 15.407 11.084  17.405 1.00 53.46  ? 1012 ILE B CG1 1 
ATOM   1886 C CG2 . ILE B 2 10  ? 16.436 11.354  15.121 1.00 56.03  ? 1012 ILE B CG2 1 
ATOM   1887 C CD1 . ILE B 2 10  ? 14.116 11.744  16.971 1.00 50.13  ? 1012 ILE B CD1 1 
ATOM   1888 N N   . LEU B 2 11  ? 14.869 8.877   13.413 1.00 56.08  ? 1013 LEU B N   1 
ATOM   1889 C CA  . LEU B 2 11  ? 15.067 8.449   12.041 1.00 86.37  ? 1013 LEU B CA  1 
ATOM   1890 C C   . LEU B 2 11  ? 14.829 6.948   11.863 1.00 143.56 ? 1013 LEU B C   1 
ATOM   1891 O O   . LEU B 2 11  ? 14.388 6.511   10.803 1.00 120.80 ? 1013 LEU B O   1 
ATOM   1892 C CB  . LEU B 2 11  ? 16.445 8.867   11.538 1.00 86.15  ? 1013 LEU B CB  1 
ATOM   1893 C CG  . LEU B 2 11  ? 16.611 10.383  11.488 1.00 90.89  ? 1013 LEU B CG  1 
ATOM   1894 C CD1 . LEU B 2 11  ? 17.914 10.779  10.824 1.00 90.93  ? 1013 LEU B CD1 1 
ATOM   1895 C CD2 . LEU B 2 11  ? 15.434 11.004  10.766 1.00 93.46  ? 1013 LEU B CD2 1 
HETATM 1896 C C1  . GOL C 3 .   ? 1.428  25.557  16.739 1.00 61.40  ? 301  GOL A C1  1 
HETATM 1897 O O1  . GOL C 3 .   ? 1.376  25.224  15.352 1.00 57.77  ? 301  GOL A O1  1 
HETATM 1898 C C2  . GOL C 3 .   ? 2.133  26.879  16.959 1.00 68.16  ? 301  GOL A C2  1 
HETATM 1899 O O2  . GOL C 3 .   ? 2.632  26.930  18.300 1.00 74.26  ? 301  GOL A O2  1 
HETATM 1900 C C3  . GOL C 3 .   ? 1.289  28.105  16.649 1.00 67.61  ? 301  GOL A C3  1 
HETATM 1901 O O3  . GOL C 3 .   ? 1.123  29.010  17.751 1.00 60.65  ? 301  GOL A O3  1 
HETATM 1902 O O   . HOH D 4 .   ? 9.522  17.370  26.259 1.00 37.99  ? 401  HOH A O   1 
HETATM 1903 O O   . HOH D 4 .   ? 27.101 -4.254  6.531  1.00 39.91  ? 402  HOH A O   1 
HETATM 1904 O O   . HOH D 4 .   ? 25.225 -25.246 17.705 1.00 51.49  ? 403  HOH A O   1 
HETATM 1905 O O   . HOH D 4 .   ? -0.338 5.552   16.582 1.00 45.59  ? 404  HOH A O   1 
HETATM 1906 O O   . HOH D 4 .   ? 25.148 -1.794  16.870 1.00 40.53  ? 405  HOH A O   1 
HETATM 1907 O O   . HOH D 4 .   ? 26.084 -27.035 9.368  1.00 46.74  ? 406  HOH A O   1 
HETATM 1908 O O   . HOH D 4 .   ? 22.767 12.877  15.693 1.00 45.34  ? 407  HOH A O   1 
HETATM 1909 O O   . HOH D 4 .   ? 28.192 -19.085 17.842 1.00 53.43  ? 408  HOH A O   1 
HETATM 1910 O O   . HOH D 4 .   ? 16.990 10.174  33.753 1.00 74.40  ? 409  HOH A O   1 
HETATM 1911 O O   . HOH D 4 .   ? 29.877 6.130   -1.077 1.00 51.58  ? 410  HOH A O   1 
HETATM 1912 O O   . HOH D 4 .   ? 28.429 4.270   -0.011 1.00 47.11  ? 411  HOH A O   1 
HETATM 1913 O O   . HOH D 4 .   ? 21.824 3.718   12.394 1.00 46.41  ? 412  HOH A O   1 
HETATM 1914 O O   . HOH D 4 .   ? 26.949 -2.801  3.991  1.00 47.62  ? 413  HOH A O   1 
HETATM 1915 O O   . HOH D 4 .   ? 33.924 -31.041 16.061 1.00 66.86  ? 414  HOH A O   1 
HETATM 1916 O O   . HOH D 4 .   ? 22.923 -3.784  5.425  1.00 37.94  ? 415  HOH A O   1 
HETATM 1917 O O   . HOH D 4 .   ? 20.740 -1.686  5.008  1.00 47.24  ? 416  HOH A O   1 
HETATM 1918 O O   . HOH D 4 .   ? 22.190 14.069  17.814 1.00 42.34  ? 417  HOH A O   1 
HETATM 1919 O O   . HOH D 4 .   ? 28.574 2.337   3.952  1.00 54.30  ? 418  HOH A O   1 
HETATM 1920 O O   . HOH D 4 .   ? 15.052 15.461  26.916 1.00 49.32  ? 419  HOH A O   1 
HETATM 1921 O O   . HOH D 4 .   ? 25.900 -30.016 13.928 1.00 64.68  ? 420  HOH A O   1 
HETATM 1922 O O   . HOH D 4 .   ? 24.297 9.892   13.415 1.00 48.09  ? 421  HOH A O   1 
HETATM 1923 O O   . HOH D 4 .   ? 33.707 -2.532  32.047 1.00 84.77  ? 422  HOH A O   1 
HETATM 1924 O O   . HOH D 4 .   ? 23.420 20.015  -7.174 1.00 58.40  ? 423  HOH A O   1 
HETATM 1925 O O   . HOH D 4 .   ? 37.799 20.406  -2.055 1.00 93.84  ? 424  HOH A O   1 
HETATM 1926 O O   . HOH D 4 .   ? 24.241 -4.075  15.575 1.00 43.25  ? 425  HOH A O   1 
HETATM 1927 O O   . HOH D 4 .   ? 19.201 9.130   5.336  1.00 60.78  ? 426  HOH A O   1 
HETATM 1928 O O   . HOH D 4 .   ? 17.763 -23.761 16.290 1.00 78.52  ? 427  HOH A O   1 
HETATM 1929 O O   . HOH D 4 .   ? 19.327 10.800  3.234  1.00 51.04  ? 428  HOH A O   1 
HETATM 1930 O O   . HOH D 4 .   ? 17.774 10.474  -4.604 1.00 51.10  ? 429  HOH A O   1 
HETATM 1931 O O   . HOH D 4 .   ? 26.269 2.908   3.896  1.00 53.71  ? 430  HOH A O   1 
HETATM 1932 O O   . HOH D 4 .   ? 15.686 15.312  16.981 1.00 52.72  ? 431  HOH A O   1 
HETATM 1933 O O   . HOH D 4 .   ? 33.345 5.268   8.153  1.00 51.21  ? 432  HOH A O   1 
HETATM 1934 O O   . HOH D 4 .   ? 0.054  16.842  29.069 1.00 59.22  ? 433  HOH A O   1 
HETATM 1935 O O   . HOH D 4 .   ? 22.497 19.243  -4.850 1.00 60.15  ? 434  HOH A O   1 
HETATM 1936 O O   . HOH D 4 .   ? 3.178  31.911  21.122 1.00 64.00  ? 435  HOH A O   1 
HETATM 1937 O O   . HOH D 4 .   ? 21.351 8.716   14.812 1.00 69.82  ? 436  HOH A O   1 
HETATM 1938 O O   . HOH D 4 .   ? 4.154  5.382   32.322 1.00 60.22  ? 437  HOH A O   1 
HETATM 1939 O O   . HOH D 4 .   ? 20.065 17.123  3.450  1.00 58.23  ? 438  HOH A O   1 
HETATM 1940 O O   . HOH D 4 .   ? 26.036 3.876   0.654  1.00 48.73  ? 439  HOH A O   1 
HETATM 1941 O O   . HOH D 4 .   ? 19.505 4.006   8.106  1.00 56.94  ? 440  HOH A O   1 
HETATM 1942 O O   . HOH D 4 .   ? 34.014 28.140  14.952 1.00 64.04  ? 441  HOH A O   1 
HETATM 1943 O O   . HOH D 4 .   ? 41.679 25.034  6.613  1.00 90.22  ? 442  HOH A O   1 
HETATM 1944 O O   . HOH D 4 .   ? 0.369  4.013   26.790 1.00 56.41  ? 443  HOH A O   1 
HETATM 1945 O O   . HOH D 4 .   ? 33.047 12.916  -3.151 1.00 68.81  ? 444  HOH A O   1 
HETATM 1946 O O   . HOH D 4 .   ? 24.974 8.676   34.085 1.00 62.44  ? 445  HOH A O   1 
HETATM 1947 O O   . HOH D 4 .   ? 23.103 10.250  16.430 1.00 41.77  ? 446  HOH A O   1 
HETATM 1948 O O   . HOH D 4 .   ? 24.305 -3.578  3.318  1.00 43.17  ? 447  HOH A O   1 
HETATM 1949 O O   . HOH D 4 .   ? 20.973 -5.640  6.141  1.00 44.05  ? 448  HOH A O   1 
HETATM 1950 O O   . HOH D 4 .   ? 2.807  1.818   18.828 1.00 48.25  ? 449  HOH A O   1 
HETATM 1951 O O   . HOH D 4 .   ? 21.251 16.112  -0.382 1.00 52.24  ? 450  HOH A O   1 
HETATM 1952 O O   . HOH D 4 .   ? 36.402 -13.626 8.757  1.00 63.80  ? 451  HOH A O   1 
HETATM 1953 O O   . HOH D 4 .   ? 2.496  4.090   14.240 1.00 58.69  ? 452  HOH A O   1 
HETATM 1954 O O   . HOH D 4 .   ? 32.073 -16.058 6.620  1.00 74.20  ? 453  HOH A O   1 
HETATM 1955 O O   . HOH D 4 .   ? 12.077 15.532  29.542 1.00 53.07  ? 454  HOH A O   1 
HETATM 1956 O O   . HOH D 4 .   ? 27.110 -27.047 16.837 1.00 60.00  ? 455  HOH A O   1 
HETATM 1957 O O   . HOH D 4 .   ? 35.573 2.732   9.410  1.00 57.66  ? 456  HOH A O   1 
HETATM 1958 O O   . HOH D 4 .   ? 17.838 -6.270  9.856  1.00 63.50  ? 457  HOH A O   1 
HETATM 1959 O O   . HOH D 4 .   ? 10.388 21.795  31.321 1.00 69.19  ? 458  HOH A O   1 
HETATM 1960 O O   . HOH D 4 .   ? 33.758 14.650  26.509 1.00 74.97  ? 459  HOH A O   1 
HETATM 1961 O O   . HOH D 4 .   ? -2.022 14.076  31.231 1.00 73.15  ? 460  HOH A O   1 
HETATM 1962 O O   . HOH D 4 .   ? 3.851  20.120  32.432 1.00 62.73  ? 461  HOH A O   1 
HETATM 1963 O O   . HOH D 4 .   ? 16.631 14.641  0.382  1.00 74.21  ? 462  HOH A O   1 
HETATM 1964 O O   . HOH D 4 .   ? 19.591 0.478   21.095 1.00 44.42  ? 463  HOH A O   1 
HETATM 1965 O O   . HOH D 4 .   ? 24.597 -13.689 17.670 1.00 60.66  ? 464  HOH A O   1 
HETATM 1966 O O   . HOH D 4 .   ? 34.022 -13.926 7.330  1.00 58.63  ? 465  HOH A O   1 
HETATM 1967 O O   . HOH D 4 .   ? 4.084  1.455   16.086 1.00 64.32  ? 466  HOH A O   1 
HETATM 1968 O O   . HOH D 4 .   ? 17.002 -7.036  6.480  1.00 66.86  ? 467  HOH A O   1 
HETATM 1969 O O   . HOH D 4 .   ? 2.693  17.411  32.077 1.00 55.83  ? 468  HOH A O   1 
HETATM 1970 O O   . HOH D 4 .   ? 30.033 12.915  28.225 1.00 66.58  ? 469  HOH A O   1 
HETATM 1971 O O   . HOH D 4 .   ? 1.257  -0.704  18.753 1.00 56.63  ? 470  HOH A O   1 
HETATM 1972 O O   . HOH D 4 .   ? 37.545 -8.496  10.713 1.00 59.97  ? 471  HOH A O   1 
HETATM 1973 O O   . HOH D 4 .   ? 34.943 8.949   23.362 1.00 65.78  ? 472  HOH A O   1 
HETATM 1974 O O   . HOH D 4 .   ? 16.395 16.617  -3.625 1.00 69.03  ? 473  HOH A O   1 
HETATM 1975 O O   . HOH D 4 .   ? 3.629  -4.957  28.170 1.00 83.84  ? 474  HOH A O   1 
HETATM 1976 O O   . HOH D 4 .   ? -1.322 7.171   24.411 1.00 46.24  ? 475  HOH A O   1 
HETATM 1977 O O   . HOH D 4 .   ? -0.431 14.336  27.280 1.00 57.32  ? 476  HOH A O   1 
HETATM 1978 O O   . HOH D 4 .   ? 26.219 -20.106 7.509  1.00 53.46  ? 477  HOH A O   1 
HETATM 1979 O O   . HOH D 4 .   ? 24.417 29.168  24.040 1.00 72.86  ? 478  HOH A O   1 
HETATM 1980 O O   . HOH D 4 .   ? 35.881 -12.789 11.121 1.00 54.99  ? 479  HOH A O   1 
HETATM 1981 O O   . HOH D 4 .   ? 19.937 3.676   35.729 1.00 79.03  ? 480  HOH A O   1 
HETATM 1982 O O   . HOH D 4 .   ? 6.999  -3.852  27.680 1.00 82.50  ? 481  HOH A O   1 
HETATM 1983 O O   . HOH D 4 .   ? 34.293 0.494   8.729  1.00 58.77  ? 482  HOH A O   1 
HETATM 1984 O O   . HOH D 4 .   ? 7.529  22.526  10.445 1.00 61.64  ? 483  HOH A O   1 
HETATM 1985 O O   . HOH D 4 .   ? 27.883 25.201  4.599  1.00 67.01  ? 484  HOH A O   1 
HETATM 1986 O O   . HOH D 4 .   ? 21.695 -5.909  20.294 1.00 57.31  ? 485  HOH A O   1 
HETATM 1987 O O   . HOH D 4 .   ? 31.734 22.014  17.046 1.00 61.96  ? 486  HOH A O   1 
HETATM 1988 O O   . HOH D 4 .   ? 27.761 25.134  0.943  1.00 77.06  ? 487  HOH A O   1 
HETATM 1989 O O   . HOH D 4 .   ? 19.679 0.094   10.818 1.00 63.85  ? 488  HOH A O   1 
HETATM 1990 O O   . HOH D 4 .   ? 33.332 10.882  21.832 1.00 59.89  ? 489  HOH A O   1 
HETATM 1991 O O   . HOH D 4 .   ? -1.208 0.212   24.983 1.00 57.94  ? 490  HOH A O   1 
HETATM 1992 O O   . HOH D 4 .   ? 3.392  13.003  32.729 1.00 58.93  ? 491  HOH A O   1 
HETATM 1993 O O   . HOH D 4 .   ? 22.244 -19.726 20.734 1.00 74.88  ? 492  HOH A O   1 
HETATM 1994 O O   . HOH D 4 .   ? 34.597 -6.361  33.526 1.00 76.08  ? 493  HOH A O   1 
HETATM 1995 O O   . HOH D 4 .   ? 0.016  25.154  25.414 1.00 57.02  ? 494  HOH A O   1 
HETATM 1996 O O   . HOH D 4 .   ? 18.935 -10.620 15.252 1.00 61.27  ? 495  HOH A O   1 
HETATM 1997 O O   . HOH D 4 .   ? 19.542 11.509  15.541 1.00 62.24  ? 496  HOH A O   1 
HETATM 1998 O O   . HOH D 4 .   ? 6.129  5.425   15.314 1.00 48.53  ? 497  HOH A O   1 
HETATM 1999 O O   . HOH D 4 .   ? 20.836 2.192   7.036  1.00 61.00  ? 498  HOH A O   1 
HETATM 2000 O O   . HOH D 4 .   ? 35.803 -6.377  9.711  1.00 57.09  ? 499  HOH A O   1 
HETATM 2001 O O   . HOH D 4 .   ? 17.774 14.276  -6.783 1.00 60.54  ? 500  HOH A O   1 
HETATM 2002 O O   . HOH D 4 .   ? 2.336  31.217  18.764 1.00 66.50  ? 501  HOH A O   1 
HETATM 2003 O O   . HOH D 4 .   ? 22.323 25.864  8.815  1.00 58.47  ? 502  HOH A O   1 
HETATM 2004 O O   . HOH D 4 .   ? 13.165 -4.832  27.832 1.00 74.49  ? 503  HOH A O   1 
HETATM 2005 O O   . HOH D 4 .   ? 18.672 -2.606  18.274 1.00 46.70  ? 504  HOH A O   1 
HETATM 2006 O O   . HOH D 4 .   ? 38.532 20.898  -0.210 1.00 84.84  ? 505  HOH A O   1 
HETATM 2007 O O   . HOH D 4 .   ? 0.624  5.704   24.855 1.00 55.05  ? 506  HOH A O   1 
HETATM 2008 O O   . HOH D 4 .   ? 29.953 22.308  16.308 1.00 66.77  ? 507  HOH A O   1 
HETATM 2009 O O   . HOH D 4 .   ? 25.033 23.181  15.209 1.00 66.91  ? 508  HOH A O   1 
HETATM 2010 O O   . HOH D 4 .   ? 32.111 -16.603 7.791  1.00 60.74  ? 509  HOH A O   1 
HETATM 2011 O O   . HOH D 4 .   ? 37.888 3.566   13.722 1.00 61.14  ? 510  HOH A O   1 
HETATM 2012 O O   . HOH D 4 .   ? 25.673 -8.211  21.988 1.00 75.72  ? 511  HOH A O   1 
HETATM 2013 O O   . HOH D 4 .   ? 5.275  8.186   13.153 1.00 71.79  ? 512  HOH A O   1 
HETATM 2014 O O   . HOH D 4 .   ? 1.862  11.485  10.362 1.00 70.45  ? 513  HOH A O   1 
HETATM 2015 O O   . HOH D 4 .   ? 34.944 20.836  13.495 1.00 60.80  ? 514  HOH A O   1 
HETATM 2016 O O   . HOH D 4 .   ? 25.070 19.922  -4.726 1.00 57.60  ? 515  HOH A O   1 
HETATM 2017 O O   . HOH E 4 .   ? 18.580 7.751   16.237 1.00 39.34  ? 1101 HOH B O   1 
HETATM 2018 O O   . HOH E 4 .   ? 17.270 1.491   14.114 1.00 57.67  ? 1102 HOH B O   1 
HETATM 2019 O O   . HOH E 4 .   ? 14.429 2.507   14.730 1.00 62.16  ? 1103 HOH B O   1 
HETATM 2020 O O   . HOH E 4 .   ? 13.080 0.188   13.793 1.00 69.83  ? 1104 HOH B O   1 
HETATM 2021 O O   . HOH E 4 .   ? 12.677 11.112  13.324 1.00 59.73  ? 1105 HOH B O   1 
HETATM 2022 O O   . HOH E 4 .   ? 11.621 -5.496  18.928 1.00 70.72  ? 1106 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 7   ? 0.8937 0.8910 1.6149 -0.1815 0.1215  -0.0074 2   ASP A N   
2    C CA  . ASP A 7   ? 0.9050 0.8819 1.5914 -0.1808 0.0993  -0.0097 2   ASP A CA  
3    C C   . ASP A 7   ? 0.9185 0.8963 1.5500 -0.1628 0.0765  -0.0042 2   ASP A C   
4    O O   . ASP A 7   ? 0.8867 0.8718 1.4938 -0.1507 0.0848  0.0042  2   ASP A O   
5    C CB  . ASP A 7   ? 0.9717 0.9082 1.6283 -0.1877 0.1232  -0.0046 2   ASP A CB  
6    C CG  . ASP A 7   ? 1.1773 1.0859 1.7620 -0.1732 0.1415  0.0105  2   ASP A CG  
7    O OD1 . ASP A 7   ? 1.2052 1.1152 1.7834 -0.1685 0.1663  0.0187  2   ASP A OD1 
8    O OD2 . ASP A 7   ? 1.2761 1.1608 1.8113 -0.1663 0.1312  0.0138  2   ASP A OD2 
9    N N   . LYS A 8   ? 0.8681 0.8392 1.4831 -0.1618 0.0475  -0.0101 3   LYS A N   
10   C CA  . LYS A 8   ? 0.8420 0.8136 1.4098 -0.1467 0.0239  -0.0070 3   LYS A CA  
11   C C   . LYS A 8   ? 0.8952 0.8498 1.4021 -0.1330 0.0408  0.0061  3   LYS A C   
12   O O   . LYS A 8   ? 0.8913 0.8600 1.3782 -0.1208 0.0343  0.0105  3   LYS A O   
13   C CB  . LYS A 8   ? 0.8768 0.8337 1.4300 -0.1495 -0.0027 -0.0149 3   LYS A CB  
14   C CG  . LYS A 8   ? 1.0358 0.9842 1.5311 -0.1345 -0.0211 -0.0108 3   LYS A CG  
15   C CD  . LYS A 8   ? 1.1895 1.1219 1.6731 -0.1385 -0.0460 -0.0198 3   LYS A CD  
16   C CE  . LYS A 8   ? 1.4267 1.3240 1.8795 -0.1423 -0.0318 -0.0176 3   LYS A CE  
17   N NZ  . LYS A 8   ? 1.5946 1.4756 1.9900 -0.1279 -0.0153 -0.0048 3   LYS A NZ  
18   N N   . ASN A 9   ? 0.8467 0.7705 1.3237 -0.1345 0.0614  0.0121  4   ASN A N   
19   C CA  . ASN A 9   ? 0.8414 0.7483 1.2596 -0.1201 0.0759  0.0242  4   ASN A CA  
20   C C   . ASN A 9   ? 0.8326 0.7547 1.2503 -0.1130 0.0939  0.0314  4   ASN A C   
21   O O   . ASN A 9   ? 0.7976 0.7225 1.1754 -0.0987 0.0908  0.0375  4   ASN A O   
22   C CB  . ASN A 9   ? 0.9168 0.7853 1.3004 -0.1210 0.0929  0.0295  4   ASN A CB  
23   C CG  . ASN A 9   ? 1.4232 1.2730 1.7862 -0.1218 0.0733  0.0242  4   ASN A CG  
24   O OD1 . ASN A 9   ? 1.3937 1.2564 1.7553 -0.1186 0.0460  0.0179  4   ASN A OD1 
25   N ND2 . ASN A 9   ? 1.3962 1.2117 1.7391 -0.1255 0.0877  0.0268  4   ASN A ND2 
26   N N   . GLU A 10  ? 0.7694 0.7031 1.2335 -0.1231 0.1117  0.0295  5   GLU A N   
27   C CA  . GLU A 10  ? 0.7464 0.6948 1.2144 -0.1175 0.1290  0.0348  5   GLU A CA  
28   C C   . GLU A 10  ? 0.7452 0.7244 1.2214 -0.1093 0.1068  0.0316  5   GLU A C   
29   O O   . GLU A 10  ? 0.7247 0.7083 1.1710 -0.0978 0.1123  0.0377  5   GLU A O   
30   C CB  . GLU A 10  ? 0.7749 0.7294 1.2960 -0.1311 0.1529  0.0319  5   GLU A CB  
31   C CG  . GLU A 10  ? 0.9729 0.9027 1.4674 -0.1297 0.1891  0.0419  5   GLU A CG  
32   C CD  . GLU A 10  ? 1.3279 1.2650 1.8744 -0.1424 0.2158  0.0392  5   GLU A CD  
33   O OE1 . GLU A 10  ? 1.3013 1.2196 1.8675 -0.1558 0.2332  0.0376  5   GLU A OE1 
34   O OE2 . GLU A 10  ? 1.2054 1.1662 1.7737 -0.1392 0.2203  0.0383  5   GLU A OE2 
35   N N   . LEU A 11  ? 0.6684 0.6670 1.1827 -0.1147 0.0812  0.0219  6   LEU A N   
36   C CA  . LEU A 11  ? 0.6235 0.6469 1.1432 -0.1066 0.0595  0.0193  6   LEU A CA  
37   C C   . LEU A 11  ? 0.6516 0.6660 1.1119 -0.0932 0.0461  0.0242  6   LEU A C   
38   O O   . LEU A 11  ? 0.6290 0.6563 1.0745 -0.0837 0.0436  0.0270  6   LEU A O   
39   C CB  . LEU A 11  ? 0.6080 0.6494 1.1761 -0.1141 0.0336  0.0081  6   LEU A CB  
40   C CG  . LEU A 11  ? 0.6523 0.7128 1.2895 -0.1259 0.0423  0.0012  6   LEU A CG  
41   C CD1 . LEU A 11  ? 0.6410 0.7134 1.3201 -0.1337 0.0135  -0.0110 6   LEU A CD1 
42   C CD2 . LEU A 11  ? 0.6501 0.7338 1.3079 -0.1198 0.0514  0.0032  6   LEU A CD2 
43   N N   . VAL A 12  ? 0.6126 0.6042 1.0397 -0.0925 0.0397  0.0249  7   VAL A N   
44   C CA  . VAL A 12  ? 0.6036 0.5859 0.9768 -0.0802 0.0291  0.0288  7   VAL A CA  
45   C C   . VAL A 12  ? 0.6326 0.6105 0.9703 -0.0700 0.0495  0.0379  7   VAL A C   
46   O O   . VAL A 12  ? 0.6168 0.6039 0.9290 -0.0597 0.0428  0.0400  7   VAL A O   
47   C CB  . VAL A 12  ? 0.6737 0.6310 1.0233 -0.0823 0.0203  0.0268  7   VAL A CB  
48   C CG1 . VAL A 12  ? 0.6714 0.6182 0.9661 -0.0690 0.0145  0.0313  7   VAL A CG1 
49   C CG2 . VAL A 12  ? 0.6741 0.6364 1.0541 -0.0911 -0.0043 0.0165  7   VAL A CG2 
50   N N   . GLN A 13  ? 0.6179 0.5809 0.9534 -0.0729 0.0742  0.0430  8   GLN A N   
51   C CA  . GLN A 13  ? 0.6153 0.5724 0.9158 -0.0627 0.0930  0.0513  8   GLN A CA  
52   C C   . GLN A 13  ? 0.6059 0.5876 0.9225 -0.0597 0.0967  0.0510  8   GLN A C   
53   O O   . GLN A 13  ? 0.5839 0.5697 0.8686 -0.0488 0.0982  0.0546  8   GLN A O   
54   C CB  . GLN A 13  ? 0.6636 0.5943 0.9543 -0.0661 0.1191  0.0572  8   GLN A CB  
55   C CG  . GLN A 13  ? 0.8498 0.7520 1.1131 -0.0657 0.1163  0.0587  8   GLN A CG  
56   C CD  . GLN A 13  ? 1.0643 0.9618 1.2797 -0.0511 0.1019  0.0612  8   GLN A CD  
57   O OE1 . GLN A 13  ? 0.9357 0.8322 1.1159 -0.0383 0.1085  0.0671  8   GLN A OE1 
58   N NE2 . GLN A 13  ? 1.0540 0.9480 1.2675 -0.0528 0.0820  0.0558  8   GLN A NE2 
59   N N   . LYS A 14  ? 0.5361 0.5347 0.9034 -0.0693 0.0971  0.0458  9   LYS A N   
60   C CA  . LYS A 14  ? 0.5068 0.5285 0.8957 -0.0673 0.0996  0.0443  9   LYS A CA  
61   C C   . LYS A 14  ? 0.5254 0.5623 0.9006 -0.0593 0.0758  0.0418  9   LYS A C   
62   O O   . LYS A 14  ? 0.5249 0.5720 0.8866 -0.0521 0.0795  0.0435  9   LYS A O   
63   C CB  . LYS A 14  ? 0.5385 0.5750 0.9898 -0.0791 0.1031  0.0383  9   LYS A CB  
64   N N   . ALA A 15  ? 0.4590 0.4944 0.8336 -0.0606 0.0523  0.0376  10  ALA A N   
65   C CA  . ALA A 15  ? 0.4373 0.4824 0.7959 -0.0537 0.0310  0.0355  10  ALA A CA  
66   C C   . ALA A 15  ? 0.4875 0.5250 0.7946 -0.0430 0.0352  0.0405  10  ALA A C   
67   O O   . ALA A 15  ? 0.4592 0.5086 0.7548 -0.0367 0.0306  0.0403  10  ALA A O   
68   C CB  . ALA A 15  ? 0.4488 0.4885 0.8124 -0.0573 0.0074  0.0302  10  ALA A CB  
69   N N   . LYS A 16  ? 0.4498 0.4678 0.7280 -0.0406 0.0451  0.0447  11  LYS A N   
70   C CA  . LYS A 16  ? 0.4630 0.4756 0.6952 -0.0292 0.0482  0.0487  11  LYS A CA  
71   C C   . LYS A 16  ? 0.5188 0.5406 0.7442 -0.0242 0.0638  0.0517  11  LYS A C   
72   O O   . LYS A 16  ? 0.5120 0.5420 0.7136 -0.0160 0.0599  0.0515  11  LYS A O   
73   C CB  . LYS A 16  ? 0.4998 0.4883 0.7036 -0.0263 0.0551  0.0527  11  LYS A CB  
74   C CG  . LYS A 16  ? 0.6682 0.6452 0.8691 -0.0294 0.0391  0.0492  11  LYS A CG  
75   C CD  . LYS A 16  ? 0.7730 0.7237 0.9464 -0.0262 0.0491  0.0537  11  LYS A CD  
76   C CE  . LYS A 16  ? 1.0504 0.9856 1.2194 -0.0297 0.0357  0.0499  11  LYS A CE  
77   N NZ  . LYS A 16  ? 1.1982 1.1050 1.3434 -0.0274 0.0475  0.0544  11  LYS A NZ  
78   N N   . LEU A 17  ? 0.4907 0.5105 0.7366 -0.0293 0.0819  0.0536  12  LEU A N   
79   C CA  . LEU A 17  ? 0.4939 0.5197 0.7334 -0.0252 0.0980  0.0559  12  LEU A CA  
80   C C   . LEU A 17  ? 0.5062 0.5553 0.7646 -0.0250 0.0886  0.0511  12  LEU A C   
81   O O   . LEU A 17  ? 0.4805 0.5369 0.7170 -0.0178 0.0899  0.0509  12  LEU A O   
82   C CB  . LEU A 17  ? 0.5162 0.5330 0.7793 -0.0328 0.1199  0.0582  12  LEU A CB  
83   C CG  . LEU A 17  ? 0.5973 0.6051 0.8378 -0.0276 0.1430  0.0630  12  LEU A CG  
84   C CD1 . LEU A 17  ? 0.6335 0.6227 0.8192 -0.0161 0.1451  0.0685  12  LEU A CD1 
85   C CD2 . LEU A 17  ? 0.5896 0.5865 0.8566 -0.0369 0.1657  0.0649  12  LEU A CD2 
86   N N   . ALA A 18  ? 0.4437 0.5036 0.7425 -0.0325 0.0779  0.0467  13  ALA A N   
87   C CA  . ALA A 18  ? 0.4134 0.4922 0.7310 -0.0318 0.0680  0.0426  13  ALA A CA  
88   C C   . ALA A 18  ? 0.4368 0.5185 0.7222 -0.0247 0.0531  0.0415  13  ALA A C   
89   O O   . ALA A 18  ? 0.4048 0.4970 0.6847 -0.0210 0.0539  0.0401  13  ALA A O   
90   C CB  . ALA A 18  ? 0.4086 0.4954 0.7704 -0.0392 0.0549  0.0382  13  ALA A CB  
91   N N   . GLU A 19  ? 0.3969 0.4686 0.6616 -0.0233 0.0407  0.0418  14  GLU A N   
92   C CA  . GLU A 19  ? 0.3841 0.4580 0.6190 -0.0170 0.0289  0.0404  14  GLU A CA  
93   C C   . GLU A 19  ? 0.4505 0.5280 0.6571 -0.0096 0.0401  0.0418  14  GLU A C   
94   O O   . GLU A 19  ? 0.4519 0.5399 0.6500 -0.0066 0.0361  0.0391  14  GLU A O   
95   C CB  . GLU A 19  ? 0.4065 0.4664 0.6215 -0.0159 0.0184  0.0407  14  GLU A CB  
96   C CG  . GLU A 19  ? 0.4212 0.4830 0.6079 -0.0099 0.0079  0.0388  14  GLU A CG  
97   C CD  . GLU A 19  ? 0.4871 0.5341 0.6534 -0.0084 -0.0016 0.0385  14  GLU A CD  
98   O OE1 . GLU A 19  ? 0.5045 0.5379 0.6697 -0.0100 0.0024  0.0406  14  GLU A OE1 
99   O OE2 . GLU A 19  ? 0.4903 0.5374 0.6390 -0.0053 -0.0112 0.0361  14  GLU A OE2 
100  N N   . GLN A 20  ? 0.4298 0.4970 0.6200 -0.0066 0.0534  0.0457  15  GLN A N   
101  C CA  . GLN A 20  ? 0.4326 0.5018 0.5937 0.0017  0.0626  0.0467  15  GLN A CA  
102  C C   . GLN A 20  ? 0.4831 0.5653 0.6554 0.0008  0.0704  0.0442  15  GLN A C   
103  O O   . GLN A 20  ? 0.4722 0.5635 0.6266 0.0060  0.0694  0.0413  15  GLN A O   
104  C CB  . GLN A 20  ? 0.4682 0.5195 0.6104 0.0053  0.0762  0.0524  15  GLN A CB  
105  C CG  . GLN A 20  ? 0.5492 0.5867 0.6676 0.0103  0.0691  0.0545  15  GLN A CG  
106  C CD  . GLN A 20  ? 0.8631 0.9113 0.9591 0.0183  0.0575  0.0510  15  GLN A CD  
107  O OE1 . GLN A 20  ? 0.8446 0.9008 0.9218 0.0258  0.0609  0.0499  15  GLN A OE1 
108  N NE2 . GLN A 20  ? 0.7179 0.7674 0.8170 0.0164  0.0437  0.0483  15  GLN A NE2 
109  N N   . ALA A 21  ? 0.4232 0.5070 0.6274 -0.0059 0.0779  0.0445  16  ALA A N   
110  C CA  . ALA A 21  ? 0.4084 0.5025 0.6276 -0.0071 0.0871  0.0420  16  ALA A CA  
111  C C   . ALA A 21  ? 0.4265 0.5346 0.6613 -0.0087 0.0740  0.0372  16  ALA A C   
112  O O   . ALA A 21  ? 0.4137 0.5296 0.6612 -0.0093 0.0804  0.0347  16  ALA A O   
113  C CB  . ALA A 21  ? 0.4135 0.5036 0.6644 -0.0134 0.1013  0.0439  16  ALA A CB  
114  N N   . GLU A 22  ? 0.3794 0.4875 0.6134 -0.0095 0.0568  0.0363  17  GLU A N   
115  C CA  . GLU A 22  ? 0.3668 0.4822 0.6110 -0.0106 0.0434  0.0329  17  GLU A CA  
116  C C   . GLU A 22  ? 0.3911 0.5119 0.6745 -0.0149 0.0433  0.0320  17  GLU A C   
117  O O   . GLU A 22  ? 0.3788 0.5066 0.6720 -0.0143 0.0413  0.0294  17  GLU A O   
118  C CB  . GLU A 22  ? 0.3777 0.5005 0.6007 -0.0069 0.0445  0.0294  17  GLU A CB  
119  C CG  . GLU A 22  ? 0.5391 0.6600 0.7288 -0.0022 0.0410  0.0289  17  GLU A CG  
120  C CD  . GLU A 22  ? 0.5539 0.6845 0.7278 0.0002  0.0421  0.0239  17  GLU A CD  
121  O OE1 . GLU A 22  ? 0.6719 0.8051 0.8489 -0.0020 0.0346  0.0211  17  GLU A OE1 
122  O OE2 . GLU A 22  ? 0.5946 0.7290 0.7535 0.0039  0.0512  0.0224  17  GLU A OE2 
123  N N   . ARG A 23  ? 0.3576 0.4751 0.6651 -0.0192 0.0459  0.0336  18  ARG A N   
124  C CA  . ARG A 23  ? 0.3444 0.4694 0.6961 -0.0233 0.0455  0.0320  18  ARG A CA  
125  C C   . ARG A 23  ? 0.4104 0.5324 0.7773 -0.0264 0.0258  0.0309  18  ARG A C   
126  O O   . ARG A 23  ? 0.4029 0.5208 0.7872 -0.0314 0.0267  0.0312  18  ARG A O   
127  C CB  . ARG A 23  ? 0.3206 0.4455 0.6923 -0.0267 0.0668  0.0334  18  ARG A CB  
128  C CG  . ARG A 23  ? 0.3458 0.4726 0.7028 -0.0231 0.0852  0.0335  18  ARG A CG  
129  C CD  . ARG A 23  ? 0.3385 0.4593 0.7046 -0.0258 0.1086  0.0358  18  ARG A CD  
130  N NE  . ARG A 23  ? 0.3567 0.4849 0.7741 -0.0320 0.1126  0.0340  18  ARG A NE  
131  C CZ  . ARG A 23  ? 0.4515 0.5900 0.9001 -0.0323 0.1220  0.0312  18  ARG A CZ  
132  N NH1 . ARG A 23  ? 0.2543 0.3944 0.6851 -0.0273 0.1301  0.0300  18  ARG A NH1 
133  N NH2 . ARG A 23  ? 0.3181 0.4655 0.8171 -0.0376 0.1241  0.0288  18  ARG A NH2 
134  N N   . TYR A 24  ? 0.3652 0.4868 0.7219 -0.0234 0.0081  0.0293  19  TYR A N   
135  C CA  . TYR A 24  ? 0.3595 0.4746 0.7194 -0.0248 -0.0131 0.0280  19  TYR A CA  
136  C C   . TYR A 24  ? 0.4119 0.5336 0.8167 -0.0282 -0.0235 0.0251  19  TYR A C   
137  O O   . TYR A 24  ? 0.4417 0.5572 0.8521 -0.0312 -0.0378 0.0233  19  TYR A O   
138  C CB  . TYR A 24  ? 0.3694 0.4777 0.6976 -0.0202 -0.0266 0.0278  19  TYR A CB  
139  C CG  . TYR A 24  ? 0.3926 0.4959 0.6804 -0.0176 -0.0180 0.0293  19  TYR A CG  
140  C CD1 . TYR A 24  ? 0.4243 0.5182 0.6925 -0.0181 -0.0183 0.0305  19  TYR A CD1 
141  C CD2 . TYR A 24  ? 0.4088 0.5176 0.6804 -0.0145 -0.0090 0.0289  19  TYR A CD2 
142  C CE1 . TYR A 24  ? 0.4442 0.5354 0.6783 -0.0142 -0.0112 0.0315  19  TYR A CE1 
143  C CE2 . TYR A 24  ? 0.4204 0.5278 0.6590 -0.0117 -0.0025 0.0290  19  TYR A CE2 
144  C CZ  . TYR A 24  ? 0.5089 0.6084 0.7298 -0.0110 -0.0038 0.0304  19  TYR A CZ  
145  O OH  . TYR A 24  ? 0.5741 0.6740 0.7654 -0.0069 0.0015  0.0300  19  TYR A OH  
146  N N   . ASP A 25  ? 0.3540 0.4885 0.7924 -0.0277 -0.0167 0.0238  20  ASP A N   
147  C CA  . ASP A 25  ? 0.3465 0.4909 0.8348 -0.0305 -0.0263 0.0200  20  ASP A CA  
148  C C   . ASP A 25  ? 0.3993 0.5444 0.9097 -0.0387 -0.0148 0.0192  20  ASP A C   
149  O O   . ASP A 25  ? 0.4133 0.5592 0.9483 -0.0432 -0.0289 0.0155  20  ASP A O   
150  C CB  . ASP A 25  ? 0.3568 0.5152 0.8783 -0.0275 -0.0187 0.0185  20  ASP A CB  
151  C CG  . ASP A 25  ? 0.5055 0.6616 1.0111 -0.0197 -0.0298 0.0190  20  ASP A CG  
152  O OD1 . ASP A 25  ? 0.5251 0.6721 1.0139 -0.0167 -0.0516 0.0189  20  ASP A OD1 
153  O OD2 . ASP A 25  ? 0.6454 0.8075 1.1586 -0.0166 -0.0170 0.0191  20  ASP A OD2 
154  N N   . ASP A 26  ? 0.3548 0.4971 0.8533 -0.0406 0.0103  0.0224  21  ASP A N   
155  C CA  . ASP A 26  ? 0.3724 0.5099 0.8854 -0.0484 0.0242  0.0228  21  ASP A CA  
156  C C   . ASP A 26  ? 0.4159 0.5385 0.9040 -0.0508 0.0107  0.0230  21  ASP A C   
157  O O   . ASP A 26  ? 0.4207 0.5414 0.9344 -0.0582 0.0069  0.0200  21  ASP A O   
158  C CB  . ASP A 26  ? 0.4030 0.5337 0.8934 -0.0478 0.0525  0.0275  21  ASP A CB  
159  C CG  . ASP A 26  ? 0.4767 0.6186 0.9945 -0.0476 0.0719  0.0268  21  ASP A CG  
160  O OD1 . ASP A 26  ? 0.4961 0.6532 1.0579 -0.0484 0.0649  0.0224  21  ASP A OD1 
161  O OD2 . ASP A 26  ? 0.5078 0.6424 1.0038 -0.0462 0.0941  0.0302  21  ASP A OD2 
162  N N   . MET A 27  ? 0.3445 0.4568 0.7850 -0.0448 0.0034  0.0258  22  MET A N   
163  C CA  . MET A 27  ? 0.3460 0.4426 0.7589 -0.0457 -0.0083 0.0260  22  MET A CA  
164  C C   . MET A 27  ? 0.4386 0.5354 0.8730 -0.0490 -0.0330 0.0206  22  MET A C   
165  O O   . MET A 27  ? 0.4637 0.5513 0.9049 -0.0552 -0.0381 0.0181  22  MET A O   
166  C CB  . MET A 27  ? 0.3562 0.4456 0.7194 -0.0378 -0.0118 0.0289  22  MET A CB  
167  C CG  . MET A 27  ? 0.3808 0.4531 0.7112 -0.0374 -0.0162 0.0300  22  MET A CG  
168  S SD  . MET A 27  ? 0.4113 0.4792 0.6919 -0.0283 -0.0223 0.0315  22  MET A SD  
169  C CE  . MET A 27  ? 0.4049 0.4522 0.6567 -0.0283 -0.0278 0.0318  22  MET A CE  
170  N N   . ALA A 28  ? 0.3866 0.4923 0.8311 -0.0447 -0.0486 0.0184  23  ALA A N   
171  C CA  . ALA A 28  ? 0.3993 0.5050 0.8625 -0.0457 -0.0750 0.0130  23  ALA A CA  
172  C C   . ALA A 28  ? 0.4354 0.5525 0.9541 -0.0541 -0.0761 0.0074  23  ALA A C   
173  O O   . ALA A 28  ? 0.4481 0.5588 0.9751 -0.0587 -0.0932 0.0024  23  ALA A O   
174  C CB  . ALA A 28  ? 0.3924 0.5039 0.8547 -0.0379 -0.0890 0.0128  23  ALA A CB  
175  N N   . ALA A 29  ? 0.3780 0.5113 0.9352 -0.0564 -0.0575 0.0074  24  ALA A N   
176  C CA  . ALA A 29  ? 0.3736 0.5205 0.9906 -0.0652 -0.0550 0.0013  24  ALA A CA  
177  C C   . ALA A 29  ? 0.4853 0.6190 1.0988 -0.0749 -0.0461 0.0006  24  ALA A C   
178  O O   . ALA A 29  ? 0.5256 0.6621 1.1723 -0.0826 -0.0590 -0.0065 24  ALA A O   
179  C CB  . ALA A 29  ? 0.3654 0.5286 1.0166 -0.0655 -0.0314 0.0024  24  ALA A CB  
180  N N   . CYS A 30  ? 0.4555 0.5733 1.0270 -0.0742 -0.0258 0.0075  25  CYS A N   
181  C CA  . CYS A 30  ? 0.4584 0.5589 1.0204 -0.0822 -0.0163 0.0079  25  CYS A CA  
182  C C   . CYS A 30  ? 0.4893 0.5773 1.0359 -0.0838 -0.0420 0.0033  25  CYS A C   
183  O O   . CYS A 30  ? 0.4923 0.5754 1.0631 -0.0936 -0.0455 -0.0022 25  CYS A O   
184  C CB  . CYS A 30  ? 0.4697 0.5540 0.9838 -0.0778 0.0065  0.0165  25  CYS A CB  
185  S SG  . CYS A 30  ? 0.5208 0.6130 1.0512 -0.0783 0.0405  0.0211  25  CYS A SG  
186  N N   . MET A 31  ? 0.4333 0.5139 0.9373 -0.0746 -0.0582 0.0054  26  MET A N   
187  C CA  . MET A 31  ? 0.4294 0.4941 0.9092 -0.0747 -0.0811 0.0016  26  MET A CA  
188  C C   . MET A 31  ? 0.4820 0.5555 0.9987 -0.0784 -0.1080 -0.0076 26  MET A C   
189  O O   . MET A 31  ? 0.4807 0.5416 0.9951 -0.0838 -0.1226 -0.0134 26  MET A O   
190  C CB  . MET A 31  ? 0.4426 0.4952 0.8649 -0.0642 -0.0864 0.0066  26  MET A CB  
191  C CG  . MET A 31  ? 0.4695 0.5115 0.8547 -0.0608 -0.0631 0.0140  26  MET A CG  
192  S SD  . MET A 31  ? 0.5223 0.5458 0.9073 -0.0693 -0.0468 0.0146  26  MET A SD  
193  C CE  . MET A 31  ? 0.5033 0.5083 0.8765 -0.0731 -0.0733 0.0071  26  MET A CE  
194  N N   . LYS A 32  ? 0.4242 0.5186 0.9752 -0.0750 -0.1151 -0.0095 27  LYS A N   
195  C CA  . LYS A 32  ? 0.4320 0.5380 1.0246 -0.0774 -0.1415 -0.0188 27  LYS A CA  
196  C C   . LYS A 32  ? 0.5189 0.6332 1.1649 -0.0912 -0.1344 -0.0262 27  LYS A C   
197  O O   . LYS A 32  ? 0.5473 0.6587 1.2100 -0.0970 -0.1564 -0.0352 27  LYS A O   
198  C CB  . LYS A 32  ? 0.4477 0.5743 1.0669 -0.0694 -0.1474 -0.0185 27  LYS A CB  
199  C CG  . LYS A 32  ? 0.5076 0.6496 1.1767 -0.0704 -0.1745 -0.0284 27  LYS A CG  
200  C CD  . LYS A 32  ? 0.5536 0.7130 1.2447 -0.0606 -0.1798 -0.0272 27  LYS A CD  
201  C CE  . LYS A 32  ? 0.5989 0.7737 1.3396 -0.0602 -0.2091 -0.0375 27  LYS A CE  
202  N NZ  . LYS A 32  ? 0.5140 0.7023 1.2713 -0.0482 -0.2177 -0.0361 27  LYS A NZ  
203  N N   . SER A 33  ? 0.4703 0.5925 1.1403 -0.0971 -0.1032 -0.0228 28  SER A N   
204  C CA  . SER A 33  ? 0.4771 0.6047 1.1968 -0.1115 -0.0910 -0.0293 28  SER A CA  
205  C C   . SER A 33  ? 0.5556 0.6579 1.2484 -0.1191 -0.0939 -0.0313 28  SER A C   
206  O O   . SER A 33  ? 0.5586 0.6633 1.2889 -0.1301 -0.1042 -0.0413 28  SER A O   
207  C CB  . SER A 33  ? 0.5103 0.6435 1.2467 -0.1152 -0.0536 -0.0234 28  SER A CB  
208  O OG  . SER A 33  ? 0.6252 0.7809 1.3881 -0.1085 -0.0491 -0.0222 28  SER A OG  
209  N N   . VAL A 34  ? 0.5326 0.6111 1.1618 -0.1129 -0.0863 -0.0230 29  VAL A N   
210  C CA  . VAL A 34  ? 0.5565 0.6083 1.1545 -0.1181 -0.0891 -0.0244 29  VAL A CA  
211  C C   . VAL A 34  ? 0.6359 0.6836 1.2337 -0.1187 -0.1250 -0.0343 29  VAL A C   
212  O O   . VAL A 34  ? 0.6460 0.6855 1.2630 -0.1297 -0.1325 -0.0429 29  VAL A O   
213  C CB  . VAL A 34  ? 0.5985 0.6290 1.1298 -0.1085 -0.0752 -0.0136 29  VAL A CB  
214  C CG1 . VAL A 34  ? 0.6143 0.6161 1.1079 -0.1106 -0.0823 -0.0153 29  VAL A CG1 
215  C CG2 . VAL A 34  ? 0.5916 0.6213 1.1218 -0.1090 -0.0407 -0.0051 29  VAL A CG2 
216  N N   . THR A 35  ? 0.5888 0.6407 1.1640 -0.1072 -0.1465 -0.0334 30  THR A N   
217  C CA  . THR A 35  ? 0.5958 0.6406 1.1623 -0.1055 -0.1815 -0.0418 30  THR A CA  
218  C C   . THR A 35  ? 0.6351 0.6983 1.2668 -0.1152 -0.1996 -0.0547 30  THR A C   
219  O O   . THR A 35  ? 0.6423 0.6934 1.2740 -0.1214 -0.2201 -0.0643 30  THR A O   
220  C CB  . THR A 35  ? 0.5944 0.6406 1.1283 -0.0910 -0.1969 -0.0372 30  THR A CB  
221  O OG1 . THR A 35  ? 0.5468 0.5776 1.0245 -0.0836 -0.1791 -0.0267 30  THR A OG1 
222  C CG2 . THR A 35  ? 0.5386 0.5734 1.0561 -0.0875 -0.2329 -0.0449 30  THR A CG2 
223  N N   . GLU A 36  ? 0.5683 0.6606 1.2563 -0.1168 -0.1912 -0.0558 31  GLU A N   
224  C CA  . GLU A 36  ? 0.5795 0.6958 1.3395 -0.1253 -0.2065 -0.0686 31  GLU A CA  
225  C C   . GLU A 36  ? 0.6842 0.7967 1.4793 -0.1430 -0.1971 -0.0773 31  GLU A C   
226  O O   . GLU A 36  ? 0.7044 0.8329 1.5538 -0.1512 -0.2163 -0.0907 31  GLU A O   
227  C CB  . GLU A 36  ? 0.5694 0.7167 1.3788 -0.1216 -0.1958 -0.0669 31  GLU A CB  
228  C CG  . GLU A 36  ? 0.6352 0.7868 1.4204 -0.1051 -0.2159 -0.0627 31  GLU A CG  
229  C CD  . GLU A 36  ? 0.7392 0.9177 1.5643 -0.0990 -0.2047 -0.0597 31  GLU A CD  
230  O OE1 . GLU A 36  ? 0.6137 0.8021 1.4642 -0.1051 -0.1722 -0.0562 31  GLU A OE1 
231  O OE2 . GLU A 36  ? 0.6685 0.8555 1.4961 -0.0873 -0.2279 -0.0607 31  GLU A OE2 
232  N N   . GLN A 37  ? 0.6631 0.7535 1.4271 -0.1486 -0.1688 -0.0703 32  GLN A N   
233  C CA  . GLN A 37  ? 0.6918 0.7710 1.4795 -0.1655 -0.1578 -0.0775 32  GLN A CA  
234  C C   . GLN A 37  ? 0.7847 0.8461 1.5554 -0.1693 -0.1898 -0.0885 32  GLN A C   
235  O O   . GLN A 37  ? 0.7921 0.8497 1.5965 -0.1846 -0.1912 -0.0995 32  GLN A O   
236  C CB  . GLN A 37  ? 0.7106 0.7655 1.4602 -0.1677 -0.1209 -0.0659 32  GLN A CB  
237  C CG  . GLN A 37  ? 0.7268 0.7973 1.4991 -0.1669 -0.0879 -0.0573 32  GLN A CG  
238  C CD  . GLN A 37  ? 0.9736 1.0187 1.7130 -0.1700 -0.0524 -0.0472 32  GLN A CD  
239  O OE1 . GLN A 37  ? 0.9610 0.9771 1.6661 -0.1738 -0.0504 -0.0468 32  GLN A OE1 
240  N NE2 . GLN A 37  ? 0.8613 0.9153 1.6102 -0.1679 -0.0233 -0.0390 32  GLN A NE2 
241  N N   . GLY A 38  ? 0.7497 0.7994 1.4686 -0.1559 -0.2145 -0.0861 33  GLY A N   
242  C CA  . GLY A 38  ? 0.7728 0.8052 1.4707 -0.1570 -0.2478 -0.0967 33  GLY A CA  
243  C C   . GLY A 38  ? 0.8295 0.8235 1.4673 -0.1586 -0.2423 -0.0945 33  GLY A C   
244  O O   . GLY A 38  ? 0.8640 0.8403 1.4741 -0.1573 -0.2699 -0.1024 33  GLY A O   
245  N N   . ALA A 39  ? 0.7508 0.7299 1.3651 -0.1604 -0.2081 -0.0841 34  ALA A N   
246  C CA  . ALA A 39  ? 0.7625 0.7047 1.3194 -0.1601 -0.2013 -0.0813 34  ALA A CA  
247  C C   . ALA A 39  ? 0.8087 0.7366 1.2968 -0.1428 -0.2036 -0.0707 34  ALA A C   
248  O O   . ALA A 39  ? 0.7815 0.7241 1.2616 -0.1327 -0.1920 -0.0603 34  ALA A O   
249  C CB  . ALA A 39  ? 0.7705 0.7008 1.3324 -0.1686 -0.1647 -0.0751 34  ALA A CB  
250  N N   . GLU A 40  ? 0.7961 0.6948 1.2355 -0.1400 -0.2172 -0.0740 35  GLU A N   
251  C CA  . GLU A 40  ? 0.7991 0.6808 1.1724 -0.1249 -0.2191 -0.0657 35  GLU A CA  
252  C C   . GLU A 40  ? 0.8126 0.6957 1.1634 -0.1172 -0.1863 -0.0508 35  GLU A C   
253  O O   . GLU A 40  ? 0.8201 0.6959 1.1787 -0.1232 -0.1623 -0.0474 35  GLU A O   
254  C CB  . GLU A 40  ? 0.8521 0.6987 1.1833 -0.1267 -0.2300 -0.0723 35  GLU A CB  
255  C CG  . GLU A 40  ? 0.9802 0.8070 1.2449 -0.1123 -0.2348 -0.0667 35  GLU A CG  
256  C CD  . GLU A 40  ? 1.3265 1.1205 1.5537 -0.1137 -0.2541 -0.0765 35  GLU A CD  
257  O OE1 . GLU A 40  ? 1.3093 1.0907 1.5555 -0.1262 -0.2587 -0.0867 35  GLU A OE1 
258  O OE2 . GLU A 40  ? 1.3623 1.1409 1.5380 -0.1022 -0.2624 -0.0739 35  GLU A OE2 
259  N N   . LEU A 41  ? 0.7165 0.6095 1.0421 -0.1041 -0.1857 -0.0425 36  LEU A N   
260  C CA  . LEU A 41  ? 0.6632 0.5609 0.9702 -0.0964 -0.1581 -0.0300 36  LEU A CA  
261  C C   . LEU A 41  ? 0.7361 0.6064 0.9881 -0.0897 -0.1470 -0.0251 36  LEU A C   
262  O O   . LEU A 41  ? 0.7620 0.6135 0.9775 -0.0854 -0.1625 -0.0290 36  LEU A O   
263  C CB  . LEU A 41  ? 0.6205 0.5392 0.9222 -0.0856 -0.1611 -0.0239 36  LEU A CB  
264  C CG  . LEU A 41  ? 0.6330 0.5807 0.9857 -0.0883 -0.1704 -0.0268 36  LEU A CG  
265  C CD1 . LEU A 41  ? 0.5925 0.5544 0.9306 -0.0770 -0.1677 -0.0193 36  LEU A CD1 
266  C CD2 . LEU A 41  ? 0.6436 0.6070 1.0468 -0.0981 -0.1507 -0.0266 36  LEU A CD2 
267  N N   . SER A 42  ? 0.6804 0.5490 0.9234 -0.0867 -0.1201 -0.0162 37  SER A N   
268  C CA  . SER A 42  ? 0.6981 0.5449 0.8908 -0.0773 -0.1083 -0.0104 37  SER A CA  
269  C C   . SER A 42  ? 0.7415 0.5987 0.9039 -0.0641 -0.1116 -0.0054 37  SER A C   
270  O O   . SER A 42  ? 0.7177 0.5978 0.8996 -0.0630 -0.1179 -0.0047 37  SER A O   
271  C CB  . SER A 42  ? 0.7577 0.6014 0.9519 -0.0767 -0.0801 -0.0020 37  SER A CB  
272  O OG  . SER A 42  ? 0.8593 0.7278 1.0648 -0.0713 -0.0684 0.0053  37  SER A OG  
273  N N   . ASN A 43  ? 0.6999 0.5411 0.8171 -0.0542 -0.1055 -0.0020 38  ASN A N   
274  C CA  . ASN A 43  ? 0.6920 0.5417 0.7805 -0.0426 -0.1061 0.0019  38  ASN A CA  
275  C C   . ASN A 43  ? 0.7421 0.6189 0.8481 -0.0389 -0.0920 0.0092  38  ASN A C   
276  O O   . ASN A 43  ? 0.7304 0.6238 0.8376 -0.0353 -0.0977 0.0101  38  ASN A O   
277  C CB  . ASN A 43  ? 0.7234 0.5525 0.7669 -0.0331 -0.0986 0.0037  38  ASN A CB  
278  C CG  . ASN A 43  ? 1.3509 1.1504 1.3747 -0.0367 -0.1109 -0.0039 38  ASN A CG  
279  O OD1 . ASN A 43  ? 1.3037 1.0948 1.3110 -0.0364 -0.1283 -0.0095 38  ASN A OD1 
280  N ND2 . ASN A 43  ? 1.3653 1.1458 1.3896 -0.0407 -0.1022 -0.0046 38  ASN A ND2 
281  N N   . GLU A 44  ? 0.6880 0.5663 0.8052 -0.0400 -0.0733 0.0142  39  GLU A N   
282  C CA  . GLU A 44  ? 0.6561 0.5560 0.7867 -0.0366 -0.0584 0.0207  39  GLU A CA  
283  C C   . GLU A 44  ? 0.6340 0.5556 0.8057 -0.0439 -0.0654 0.0183  39  GLU A C   
284  O O   . GLU A 44  ? 0.5989 0.5394 0.7729 -0.0391 -0.0639 0.0209  39  GLU A O   
285  C CB  . GLU A 44  ? 0.6878 0.5784 0.8194 -0.0369 -0.0376 0.0261  39  GLU A CB  
286  C CG  . GLU A 44  ? 0.8489 0.7589 0.9930 -0.0340 -0.0221 0.0323  39  GLU A CG  
287  C CD  . GLU A 44  ? 1.1234 1.0205 1.2661 -0.0344 -0.0011 0.0381  39  GLU A CD  
288  O OE1 . GLU A 44  ? 1.0889 0.9717 1.2506 -0.0447 0.0026  0.0361  39  GLU A OE1 
289  O OE2 . GLU A 44  ? 0.9580 0.8581 1.0796 -0.0243 0.0117  0.0444  39  GLU A OE2 
290  N N   . GLU A 45  ? 0.5803 0.4996 0.7861 -0.0553 -0.0728 0.0127  40  GLU A N   
291  C CA  . GLU A 45  ? 0.5476 0.4884 0.7986 -0.0621 -0.0802 0.0094  40  GLU A CA  
292  C C   . GLU A 45  ? 0.5908 0.5398 0.8355 -0.0576 -0.1015 0.0062  40  GLU A C   
293  O O   . GLU A 45  ? 0.5658 0.5351 0.8312 -0.0560 -0.1027 0.0074  40  GLU A O   
294  C CB  . GLU A 45  ? 0.5685 0.5045 0.8575 -0.0753 -0.0856 0.0022  40  GLU A CB  
295  C CG  . GLU A 45  ? 0.6732 0.6021 0.9758 -0.0814 -0.0612 0.0059  40  GLU A CG  
296  C CD  . GLU A 45  ? 0.9194 0.8335 1.2460 -0.0946 -0.0641 -0.0015 40  GLU A CD  
297  O OE1 . GLU A 45  ? 0.6273 0.5367 0.9597 -0.0991 -0.0876 -0.0105 40  GLU A OE1 
298  O OE2 . GLU A 45  ? 0.8807 0.7873 1.2212 -0.1010 -0.0425 0.0014  40  GLU A OE2 
299  N N   . ARG A 46  ? 0.5635 0.4939 0.7770 -0.0552 -0.1171 0.0023  41  ARG A N   
300  C CA  . ARG A 46  ? 0.5755 0.5060 0.7737 -0.0503 -0.1371 -0.0003 41  ARG A CA  
301  C C   . ARG A 46  ? 0.6366 0.5790 0.8150 -0.0409 -0.1263 0.0065  41  ARG A C   
302  O O   . ARG A 46  ? 0.6185 0.5747 0.8095 -0.0389 -0.1335 0.0068  41  ARG A O   
303  C CB  . ARG A 46  ? 0.5903 0.4934 0.7488 -0.0484 -0.1490 -0.0045 41  ARG A CB  
304  C CG  . ARG A 46  ? 0.6878 0.5812 0.8314 -0.0466 -0.1739 -0.0099 41  ARG A CG  
305  C CD  . ARG A 46  ? 0.7632 0.6268 0.8586 -0.0432 -0.1781 -0.0126 41  ARG A CD  
306  N NE  . ARG A 46  ? 1.0359 0.8976 1.1009 -0.0353 -0.1569 -0.0058 41  ARG A NE  
307  C CZ  . ARG A 46  ? 1.1414 0.9811 1.1668 -0.0306 -0.1523 -0.0064 41  ARG A CZ  
308  N NH1 . ARG A 46  ? 0.8309 0.6450 0.8378 -0.0335 -0.1664 -0.0135 41  ARG A NH1 
309  N NH2 . ARG A 46  ? 1.0542 0.8977 1.0593 -0.0227 -0.1337 -0.0007 41  ARG A NH2 
310  N N   . ASN A 47  ? 0.5797 0.5177 0.7303 -0.0351 -0.1087 0.0115  42  ASN A N   
311  C CA  . ASN A 47  ? 0.5520 0.5023 0.6854 -0.0271 -0.0979 0.0165  42  ASN A CA  
312  C C   . ASN A 47  ? 0.5344 0.5085 0.7001 -0.0285 -0.0882 0.0196  42  ASN A C   
313  O O   . ASN A 47  ? 0.5120 0.4973 0.6758 -0.0249 -0.0897 0.0207  42  ASN A O   
314  C CB  . ASN A 47  ? 0.5976 0.5401 0.7001 -0.0204 -0.0829 0.0199  42  ASN A CB  
315  C CG  . ASN A 47  ? 1.0764 0.9965 1.1425 -0.0167 -0.0906 0.0169  42  ASN A CG  
316  O OD1 . ASN A 47  ? 1.0051 0.9135 1.0627 -0.0187 -0.1074 0.0124  42  ASN A OD1 
317  N ND2 . ASN A 47  ? 1.0104 0.9231 1.0524 -0.0102 -0.0783 0.0192  42  ASN A ND2 
318  N N   . LEU A 48  ? 0.4668 0.4464 0.6618 -0.0342 -0.0779 0.0206  43  LEU A N   
319  C CA  . LEU A 48  ? 0.4318 0.4319 0.6581 -0.0359 -0.0669 0.0230  43  LEU A CA  
320  C C   . LEU A 48  ? 0.4694 0.4822 0.7255 -0.0385 -0.0818 0.0194  43  LEU A C   
321  O O   . LEU A 48  ? 0.4429 0.4708 0.7080 -0.0355 -0.0768 0.0215  43  LEU A O   
322  C CB  . LEU A 48  ? 0.4290 0.4279 0.6798 -0.0425 -0.0517 0.0244  43  LEU A CB  
323  C CG  . LEU A 48  ? 0.5075 0.4955 0.7296 -0.0376 -0.0330 0.0299  43  LEU A CG  
324  C CD1 . LEU A 48  ? 0.5264 0.5037 0.7662 -0.0449 -0.0197 0.0311  43  LEU A CD1 
325  C CD2 . LEU A 48  ? 0.5218 0.5236 0.7328 -0.0302 -0.0190 0.0347  43  LEU A CD2 
326  N N   . LEU A 49  ? 0.4548 0.4611 0.7275 -0.0439 -0.1005 0.0137  44  LEU A N   
327  C CA  . LEU A 49  ? 0.4517 0.4687 0.7529 -0.0448 -0.1182 0.0097  44  LEU A CA  
328  C C   . LEU A 49  ? 0.4804 0.4950 0.7509 -0.0363 -0.1265 0.0118  44  LEU A C   
329  O O   . LEU A 49  ? 0.4415 0.4696 0.7283 -0.0335 -0.1276 0.0128  44  LEU A O   
330  C CB  . LEU A 49  ? 0.4682 0.4751 0.7833 -0.0507 -0.1401 0.0021  44  LEU A CB  
331  C CG  . LEU A 49  ? 0.5237 0.5391 0.8645 -0.0499 -0.1641 -0.0030 44  LEU A CG  
332  C CD1 . LEU A 49  ? 0.4837 0.5244 0.8806 -0.0536 -0.1574 -0.0040 44  LEU A CD1 
333  C CD2 . LEU A 49  ? 0.5858 0.5870 0.9289 -0.0547 -0.1881 -0.0114 44  LEU A CD2 
334  N N   . SER A 50  ? 0.4520 0.4481 0.6778 -0.0323 -0.1303 0.0123  45  SER A N   
335  C CA  . SER A 50  ? 0.4636 0.4525 0.6552 -0.0252 -0.1358 0.0139  45  SER A CA  
336  C C   . SER A 50  ? 0.5195 0.5232 0.7073 -0.0211 -0.1178 0.0187  45  SER A C   
337  O O   . SER A 50  ? 0.5345 0.5421 0.7218 -0.0178 -0.1222 0.0196  45  SER A O   
338  C CB  . SER A 50  ? 0.5190 0.4848 0.6666 -0.0228 -0.1396 0.0128  45  SER A CB  
339  O OG  . SER A 50  ? 0.6902 0.6458 0.8056 -0.0170 -0.1457 0.0136  45  SER A OG  
340  N N   . VAL A 51  ? 0.4643 0.4750 0.6492 -0.0211 -0.0982 0.0215  46  VAL A N   
341  C CA  . VAL A 51  ? 0.4359 0.4613 0.6180 -0.0176 -0.0814 0.0248  46  VAL A CA  
342  C C   . VAL A 51  ? 0.4416 0.4839 0.6609 -0.0196 -0.0793 0.0251  46  VAL A C   
343  O O   . VAL A 51  ? 0.4402 0.4899 0.6567 -0.0166 -0.0760 0.0260  46  VAL A O   
344  C CB  . VAL A 51  ? 0.4815 0.5092 0.6538 -0.0164 -0.0635 0.0273  46  VAL A CB  
345  C CG1 . VAL A 51  ? 0.4597 0.5044 0.6354 -0.0136 -0.0476 0.0295  46  VAL A CG1 
346  C CG2 . VAL A 51  ? 0.4853 0.4987 0.6199 -0.0120 -0.0640 0.0270  46  VAL A CG2 
347  N N   . ALA A 52  ? 0.3678 0.4158 0.6229 -0.0250 -0.0797 0.0238  47  ALA A N   
348  C CA  . ALA A 52  ? 0.3475 0.4123 0.6419 -0.0267 -0.0759 0.0235  47  ALA A CA  
349  C C   . ALA A 52  ? 0.4130 0.4781 0.7121 -0.0232 -0.0929 0.0219  47  ALA A C   
350  O O   . ALA A 52  ? 0.4071 0.4808 0.7101 -0.0200 -0.0870 0.0234  47  ALA A O   
351  C CB  . ALA A 52  ? 0.3526 0.4219 0.6865 -0.0338 -0.0755 0.0211  47  ALA A CB  
352  N N   . TYR A 53  ? 0.3937 0.4467 0.6889 -0.0234 -0.1147 0.0189  48  TYR A N   
353  C CA  . TYR A 53  ? 0.3960 0.4459 0.6931 -0.0187 -0.1327 0.0178  48  TYR A CA  
354  C C   . TYR A 53  ? 0.4393 0.4785 0.6961 -0.0128 -0.1308 0.0209  48  TYR A C   
355  O O   . TYR A 53  ? 0.4461 0.4875 0.7083 -0.0086 -0.1342 0.0220  48  TYR A O   
356  C CB  . TYR A 53  ? 0.4258 0.4660 0.7318 -0.0199 -0.1582 0.0130  48  TYR A CB  
357  C CG  . TYR A 53  ? 0.4636 0.5219 0.8265 -0.0243 -0.1632 0.0088  48  TYR A CG  
358  C CD1 . TYR A 53  ? 0.4783 0.5498 0.8731 -0.0200 -0.1703 0.0080  48  TYR A CD1 
359  C CD2 . TYR A 53  ? 0.4702 0.5325 0.8573 -0.0327 -0.1592 0.0053  48  TYR A CD2 
360  C CE1 . TYR A 53  ? 0.4840 0.5750 0.9362 -0.0238 -0.1737 0.0033  48  TYR A CE1 
361  C CE2 . TYR A 53  ? 0.4749 0.5551 0.9185 -0.0379 -0.1621 0.0004  48  TYR A CE2 
362  C CZ  . TYR A 53  ? 0.5445 0.6405 1.0221 -0.0334 -0.1694 -0.0008 48  TYR A CZ  
363  O OH  . TYR A 53  ? 0.5406 0.6568 1.0785 -0.0385 -0.1706 -0.0064 48  TYR A OH  
364  N N   . LYS A 54  ? 0.3898 0.4176 0.6080 -0.0124 -0.1237 0.0222  49  LYS A N   
365  C CA  . LYS A 54  ? 0.3853 0.4041 0.5675 -0.0082 -0.1187 0.0243  49  LYS A CA  
366  C C   . LYS A 54  ? 0.4269 0.4621 0.6225 -0.0075 -0.1023 0.0261  49  LYS A C   
367  O O   . LYS A 54  ? 0.4292 0.4590 0.6121 -0.0044 -0.1029 0.0271  49  LYS A O   
368  C CB  . LYS A 54  ? 0.4444 0.4544 0.5925 -0.0085 -0.1100 0.0243  49  LYS A CB  
369  C CG  . LYS A 54  ? 0.4975 0.5005 0.6109 -0.0054 -0.1013 0.0254  49  LYS A CG  
370  C CD  . LYS A 54  ? 0.8005 0.7797 0.8863 -0.0025 -0.1165 0.0253  49  LYS A CD  
371  C CE  . LYS A 54  ? 1.0194 0.9888 1.0705 -0.0006 -0.1061 0.0260  49  LYS A CE  
372  N NZ  . LYS A 54  ? 1.1736 1.1181 1.1999 0.0026  -0.1195 0.0271  49  LYS A NZ  
373  N N   . ASN A 55  ? 0.3546 0.4073 0.5742 -0.0104 -0.0874 0.0262  50  ASN A N   
374  C CA  . ASN A 55  ? 0.3414 0.4085 0.5714 -0.0098 -0.0713 0.0271  50  ASN A CA  
375  C C   . ASN A 55  ? 0.4159 0.4903 0.6793 -0.0087 -0.0761 0.0268  50  ASN A C   
376  O O   . ASN A 55  ? 0.4241 0.5009 0.6855 -0.0064 -0.0701 0.0272  50  ASN A O   
377  C CB  . ASN A 55  ? 0.3257 0.4046 0.5635 -0.0121 -0.0541 0.0275  50  ASN A CB  
378  C CG  . ASN A 55  ? 0.5017 0.5780 0.7058 -0.0106 -0.0452 0.0276  50  ASN A CG  
379  O OD1 . ASN A 55  ? 0.4789 0.5600 0.6688 -0.0089 -0.0367 0.0268  50  ASN A OD1 
380  N ND2 . ASN A 55  ? 0.4012 0.4700 0.5931 -0.0110 -0.0471 0.0280  50  ASN A ND2 
381  N N   . VAL A 56  ? 0.3625 0.4405 0.6580 -0.0103 -0.0872 0.0254  51  VAL A N   
382  C CA  . VAL A 56  ? 0.3421 0.4286 0.6739 -0.0080 -0.0940 0.0243  51  VAL A CA  
383  C C   . VAL A 56  ? 0.4316 0.5034 0.7440 -0.0016 -0.1098 0.0253  51  VAL A C   
384  O O   . VAL A 56  ? 0.4521 0.5267 0.7719 0.0022  -0.1054 0.0263  51  VAL A O   
385  C CB  . VAL A 56  ? 0.3609 0.4560 0.7342 -0.0115 -0.1038 0.0213  51  VAL A CB  
386  C CG1 . VAL A 56  ? 0.3575 0.4629 0.7711 -0.0076 -0.1132 0.0194  51  VAL A CG1 
387  C CG2 . VAL A 56  ? 0.3444 0.4507 0.7355 -0.0179 -0.0841 0.0211  51  VAL A CG2 
388  N N   . VAL A 57  ? 0.3861 0.4397 0.6716 -0.0001 -0.1274 0.0252  52  VAL A N   
389  C CA  . VAL A 57  ? 0.4115 0.4458 0.6715 0.0065  -0.1418 0.0269  52  VAL A CA  
390  C C   . VAL A 57  ? 0.4352 0.4611 0.6601 0.0072  -0.1255 0.0295  52  VAL A C   
391  O O   . VAL A 57  ? 0.4360 0.4511 0.6507 0.0120  -0.1283 0.0315  52  VAL A O   
392  C CB  . VAL A 57  ? 0.4970 0.5094 0.7301 0.0084  -0.1643 0.0259  52  VAL A CB  
393  C CG1 . VAL A 57  ? 0.5281 0.5489 0.7952 0.0062  -0.1807 0.0215  52  VAL A CG1 
394  C CG2 . VAL A 57  ? 0.4802 0.4787 0.6692 0.0054  -0.1561 0.0265  52  VAL A CG2 
395  N N   . GLY A 58  ? 0.3716 0.4007 0.5772 0.0026  -0.1101 0.0292  53  GLY A N   
396  C CA  . GLY A 58  ? 0.3664 0.3904 0.5417 0.0021  -0.0951 0.0300  53  GLY A CA  
397  C C   . GLY A 58  ? 0.4460 0.4800 0.6365 0.0026  -0.0823 0.0301  53  GLY A C   
398  O O   . GLY A 58  ? 0.4677 0.4900 0.6364 0.0037  -0.0775 0.0308  53  GLY A O   
399  N N   . ALA A 59  ? 0.4132 0.4667 0.6404 0.0014  -0.0757 0.0290  54  ALA A N   
400  C CA  . ALA A 59  ? 0.3892 0.4517 0.6324 0.0021  -0.0631 0.0284  54  ALA A CA  
401  C C   . ALA A 59  ? 0.4333 0.4817 0.6784 0.0082  -0.0747 0.0302  54  ALA A C   
402  O O   . ALA A 59  ? 0.4184 0.4597 0.6514 0.0092  -0.0660 0.0304  54  ALA A O   
403  C CB  . ALA A 59  ? 0.3744 0.4574 0.6564 0.0004  -0.0544 0.0270  54  ALA A CB  
404  N N   . ARG A 60  ? 0.4003 0.4425 0.6575 0.0124  -0.0950 0.0313  55  ARG A N   
405  C CA  . ARG A 60  ? 0.4261 0.4530 0.6830 0.0204  -0.1092 0.0335  55  ARG A CA  
406  C C   . ARG A 60  ? 0.4847 0.4830 0.6931 0.0227  -0.1134 0.0364  55  ARG A C   
407  O O   . ARG A 60  ? 0.4857 0.4691 0.6846 0.0279  -0.1139 0.0387  55  ARG A O   
408  C CB  . ARG A 60  ? 0.4542 0.4839 0.7390 0.0250  -0.1326 0.0327  55  ARG A CB  
409  C CG  . ARG A 60  ? 0.4173 0.4717 0.7572 0.0257  -0.1294 0.0301  55  ARG A CG  
410  C CD  . ARG A 60  ? 0.3600 0.4350 0.7186 0.0169  -0.1132 0.0276  55  ARG A CD  
411  N NE  . ARG A 60  ? 0.4320 0.5291 0.8414 0.0166  -0.1052 0.0252  55  ARG A NE  
412  C CZ  . ARG A 60  ? 0.5498 0.6634 0.9796 0.0097  -0.0892 0.0233  55  ARG A CZ  
413  N NH1 . ARG A 60  ? 0.3620 0.4728 0.7662 0.0035  -0.0820 0.0239  55  ARG A NH1 
414  N NH2 . ARG A 60  ? 0.4547 0.5862 0.9295 0.0095  -0.0797 0.0211  55  ARG A NH2 
415  N N   . ARG A 61  ? 0.4547 0.4430 0.6319 0.0193  -0.1160 0.0363  56  ARG A N   
416  C CA  . ARG A 61  ? 0.4754 0.4345 0.6037 0.0207  -0.1170 0.0389  56  ARG A CA  
417  C C   . ARG A 61  ? 0.4993 0.4578 0.6144 0.0168  -0.0945 0.0385  56  ARG A C   
418  O O   . ARG A 61  ? 0.5354 0.4705 0.6250 0.0196  -0.0928 0.0411  56  ARG A O   
419  C CB  . ARG A 61  ? 0.4354 0.3871 0.5362 0.0171  -0.1199 0.0378  56  ARG A CB  
420  C CG  . ARG A 61  ? 0.5116 0.4555 0.6158 0.0210  -0.1447 0.0375  56  ARG A CG  
421  C CD  . ARG A 61  ? 0.5556 0.4917 0.6332 0.0172  -0.1460 0.0358  56  ARG A CD  
422  N NE  . ARG A 61  ? 0.5925 0.4986 0.6184 0.0187  -0.1441 0.0378  56  ARG A NE  
423  C CZ  . ARG A 61  ? 0.6997 0.6015 0.6997 0.0145  -0.1329 0.0363  56  ARG A CZ  
424  N NH1 . ARG A 61  ? 0.5090 0.4338 0.5281 0.0096  -0.1237 0.0333  56  ARG A NH1 
425  N NH2 . ARG A 61  ? 0.6007 0.4739 0.5551 0.0160  -0.1302 0.0378  56  ARG A NH2 
426  N N   . SER A 62  ? 0.4257 0.4083 0.5571 0.0104  -0.0775 0.0349  57  SER A N   
427  C CA  . SER A 62  ? 0.4111 0.3970 0.5337 0.0057  -0.0571 0.0325  57  SER A CA  
428  C C   . SER A 62  ? 0.4676 0.4508 0.6064 0.0088  -0.0532 0.0332  57  SER A C   
429  O O   . SER A 62  ? 0.4799 0.4464 0.5983 0.0080  -0.0445 0.0335  57  SER A O   
430  C CB  . SER A 62  ? 0.4178 0.4305 0.5543 -0.0003 -0.0431 0.0281  57  SER A CB  
431  O OG  . SER A 62  ? 0.5299 0.5486 0.6650 -0.0044 -0.0257 0.0245  57  SER A OG  
432  N N   . SER A 63  ? 0.4316 0.4296 0.6073 0.0125  -0.0587 0.0333  58  SER A N   
433  C CA  . SER A 63  ? 0.4434 0.4385 0.6367 0.0171  -0.0554 0.0338  58  SER A CA  
434  C C   . SER A 63  ? 0.5274 0.4918 0.6980 0.0246  -0.0680 0.0386  58  SER A C   
435  O O   . SER A 63  ? 0.5455 0.4954 0.7059 0.0259  -0.0590 0.0392  58  SER A O   
436  C CB  . SER A 63  ? 0.4528 0.4684 0.6916 0.0207  -0.0611 0.0330  58  SER A CB  
437  O OG  . SER A 63  ? 0.3973 0.4376 0.6547 0.0143  -0.0459 0.0291  58  SER A OG  
438  N N   . TRP A 64  ? 0.4949 0.4465 0.6539 0.0297  -0.0889 0.0418  59  TRP A N   
439  C CA  . TRP A 64  ? 0.5240 0.4427 0.6558 0.0387  -0.1044 0.0469  59  TRP A CA  
440  C C   . TRP A 64  ? 0.5988 0.4905 0.6847 0.0349  -0.0904 0.0487  59  TRP A C   
441  O O   . TRP A 64  ? 0.6224 0.4896 0.6926 0.0403  -0.0894 0.0522  59  TRP A O   
442  C CB  . TRP A 64  ? 0.5087 0.4193 0.6315 0.0433  -0.1290 0.0484  59  TRP A CB  
443  C CG  . TRP A 64  ? 0.5581 0.4344 0.6535 0.0549  -0.1487 0.0537  59  TRP A CG  
444  C CD1 . TRP A 64  ? 0.5996 0.4741 0.7177 0.0664  -0.1694 0.0552  59  TRP A CD1 
445  C CD2 . TRP A 64  ? 0.5971 0.4346 0.6356 0.0567  -0.1495 0.0580  59  TRP A CD2 
446  N NE1 . TRP A 64  ? 0.6419 0.4778 0.7183 0.0763  -0.1847 0.0606  59  TRP A NE1 
447  C CE2 . TRP A 64  ? 0.6797 0.4907 0.7050 0.0702  -0.1719 0.0627  59  TRP A CE2 
448  C CE3 . TRP A 64  ? 0.6300 0.4523 0.6276 0.0485  -0.1329 0.0581  59  TRP A CE3 
449  C CZ2 . TRP A 64  ? 0.7233 0.4897 0.6910 0.0759  -0.1778 0.0682  59  TRP A CZ2 
450  C CZ3 . TRP A 64  ? 0.6939 0.4736 0.6381 0.0531  -0.1363 0.0631  59  TRP A CZ3 
451  C CH2 . TRP A 64  ? 0.7442 0.4947 0.6714 0.0666  -0.1579 0.0686  59  TRP A CH2 
452  N N   . ARG A 65  ? 0.5424 0.4383 0.6083 0.0257  -0.0783 0.0460  60  ARG A N   
453  C CA  . ARG A 65  ? 0.5546 0.4266 0.5800 0.0208  -0.0633 0.0465  60  ARG A CA  
454  C C   . ARG A 65  ? 0.5870 0.4607 0.6205 0.0168  -0.0441 0.0442  60  ARG A C   
455  O O   . ARG A 65  ? 0.6373 0.4808 0.6429 0.0178  -0.0375 0.0470  60  ARG A O   
456  C CB  . ARG A 65  ? 0.5363 0.4177 0.5459 0.0121  -0.0536 0.0428  60  ARG A CB  
457  C CG  . ARG A 65  ? 0.7264 0.5972 0.7170 0.0156  -0.0707 0.0450  60  ARG A CG  
458  C CD  . ARG A 65  ? 0.9415 0.8212 0.9177 0.0081  -0.0596 0.0411  60  ARG A CD  
459  N NE  . ARG A 65  ? 1.1191 1.0349 1.1289 0.0044  -0.0575 0.0367  60  ARG A NE  
460  C CZ  . ARG A 65  ? 1.2801 1.2042 1.2968 0.0059  -0.0700 0.0365  60  ARG A CZ  
461  N NH1 . ARG A 65  ? 1.1047 1.0055 1.0981 0.0108  -0.0871 0.0394  60  ARG A NH1 
462  N NH2 . ARG A 65  ? 1.0331 0.9866 1.0776 0.0025  -0.0653 0.0331  60  ARG A NH2 
463  N N   . VAL A 66  ? 0.4914 0.3972 0.5610 0.0125  -0.0348 0.0390  61  VAL A N   
464  C CA  . VAL A 66  ? 0.4858 0.3951 0.5651 0.0083  -0.0167 0.0352  61  VAL A CA  
465  C C   . VAL A 66  ? 0.5813 0.4683 0.6633 0.0177  -0.0227 0.0399  61  VAL A C   
466  O O   . VAL A 66  ? 0.5681 0.4314 0.6300 0.0162  -0.0111 0.0404  61  VAL A O   
467  C CB  . VAL A 66  ? 0.4957 0.4419 0.6103 0.0032  -0.0071 0.0287  61  VAL A CB  
468  C CG1 . VAL A 66  ? 0.4927 0.4388 0.6185 0.0010  0.0084  0.0247  61  VAL A CG1 
469  C CG2 . VAL A 66  ? 0.4683 0.4333 0.5754 -0.0058 0.0020  0.0234  61  VAL A CG2 
470  N N   . VAL A 67  ? 0.5438 0.4386 0.6525 0.0275  -0.0400 0.0428  62  VAL A N   
471  C CA  . VAL A 67  ? 0.5597 0.4365 0.6758 0.0384  -0.0472 0.0468  62  VAL A CA  
472  C C   . VAL A 67  ? 0.6761 0.5095 0.7483 0.0457  -0.0570 0.0540  62  VAL A C   
473  O O   . VAL A 67  ? 0.6775 0.4860 0.7380 0.0505  -0.0516 0.0568  62  VAL A O   
474  C CB  . VAL A 67  ? 0.5698 0.4693 0.7310 0.0470  -0.0625 0.0468  62  VAL A CB  
475  C CG1 . VAL A 67  ? 0.5858 0.4671 0.7558 0.0601  -0.0713 0.0508  62  VAL A CG1 
476  C CG2 . VAL A 67  ? 0.5237 0.4594 0.7228 0.0398  -0.0477 0.0402  62  VAL A CG2 
477  N N   . SER A 68  ? 0.6690 0.4903 0.7132 0.0461  -0.0692 0.0569  63  SER A N   
478  C CA  . SER A 68  ? 0.7187 0.4951 0.7136 0.0526  -0.0771 0.0638  63  SER A CA  
479  C C   . SER A 68  ? 0.7854 0.5377 0.7476 0.0439  -0.0518 0.0635  63  SER A C   
480  O O   . SER A 68  ? 0.8322 0.5470 0.7666 0.0503  -0.0504 0.0690  63  SER A O   
481  C CB  . SER A 68  ? 0.7572 0.5280 0.7274 0.0521  -0.0906 0.0651  63  SER A CB  
482  O OG  . SER A 68  ? 0.9649 0.7125 0.9211 0.0661  -0.1174 0.0708  63  SER A OG  
483  N N   . SER A 69  ? 0.7101 0.4838 0.6769 0.0295  -0.0317 0.0566  64  SER A N   
484  C CA  . SER A 69  ? 0.7132 0.4705 0.6563 0.0189  -0.0066 0.0539  64  SER A CA  
485  C C   . SER A 69  ? 0.7540 0.5029 0.7096 0.0199  0.0049  0.0530  64  SER A C   
486  O O   . SER A 69  ? 0.7898 0.5040 0.7151 0.0176  0.0182  0.0552  64  SER A O   
487  C CB  . SER A 69  ? 0.7332 0.5238 0.6896 0.0049  0.0087  0.0450  64  SER A CB  
488  O OG  . SER A 69  ? 0.9163 0.7009 0.8641 -0.0065 0.0332  0.0395  64  SER A OG  
489  N N   . ILE A 70  ? 0.6594 0.4373 0.6581 0.0233  0.0009  0.0498  65  ILE A N   
490  C CA  . ILE A 70  ? 0.6480 0.4199 0.6613 0.0245  0.0124  0.0480  65  ILE A CA  
491  C C   . ILE A 70  ? 0.7879 0.5195 0.7807 0.0390  0.0010  0.0571  65  ILE A C   
492  O O   . ILE A 70  ? 0.8314 0.5321 0.8042 0.0383  0.0147  0.0585  65  ILE A O   
493  C CB  . ILE A 70  ? 0.6130 0.4248 0.6762 0.0256  0.0115  0.0424  65  ILE A CB  
494  C CG1 . ILE A 70  ? 0.5584 0.4020 0.6349 0.0106  0.0290  0.0323  65  ILE A CG1 
495  C CG2 . ILE A 70  ? 0.5675 0.3671 0.6473 0.0341  0.0149  0.0433  65  ILE A CG2 
496  C CD1 . ILE A 70  ? 0.5254 0.4074 0.6420 0.0117  0.0252  0.0284  65  ILE A CD1 
497  N N   . GLU A 71  ? 0.7665 0.4975 0.7642 0.0522  -0.0246 0.0631  66  GLU A N   
498  C CA  . GLU A 71  ? 0.8102 0.5051 0.7897 0.0690  -0.0414 0.0720  66  GLU A CA  
499  C C   . GLU A 71  ? 0.9107 0.5534 0.8307 0.0693  -0.0346 0.0786  66  GLU A C   
500  O O   . GLU A 71  ? 0.9543 0.5598 0.8542 0.0800  -0.0361 0.0849  66  GLU A O   
501  C CB  . GLU A 71  ? 0.8215 0.5295 0.8149 0.0801  -0.0711 0.0749  66  GLU A CB  
502  C CG  . GLU A 71  ? 0.9146 0.5958 0.9028 0.1001  -0.0938 0.0825  66  GLU A CG  
503  C CD  . GLU A 71  ? 1.0926 0.7806 1.0821 0.1085  -0.1237 0.0845  66  GLU A CD  
504  O OE1 . GLU A 71  ? 1.0131 0.7214 1.0026 0.0979  -0.1232 0.0807  66  GLU A OE1 
505  O OE2 . GLU A 71  ? 0.9835 0.6562 0.9738 0.1258  -0.1483 0.0895  66  GLU A OE2 
506  N N   . GLN A 72  ? 0.8724 0.5106 0.7636 0.0578  -0.0253 0.0772  67  GLN A N   
507  C CA  . GLN A 72  ? 0.9156 0.5037 0.7490 0.0560  -0.0143 0.0829  67  GLN A CA  
508  C C   . GLN A 72  ? 0.9818 0.5561 0.8097 0.0444  0.0159  0.0790  67  GLN A C   
509  O O   . GLN A 72  ? 1.0351 0.5626 0.8285 0.0498  0.0223  0.0855  67  GLN A O   
510  C CB  . GLN A 72  ? 0.9296 0.5171 0.7355 0.0483  -0.0140 0.0822  67  GLN A CB  
511  C CG  . GLN A 72  ? 1.1326 0.7195 0.9320 0.0615  -0.0455 0.0872  67  GLN A CG  
512  C CD  . GLN A 72  ? 1.5234 1.1286 1.3163 0.0532  -0.0472 0.0834  67  GLN A CD  
513  O OE1 . GLN A 72  ? 1.5101 1.1126 1.2842 0.0401  -0.0256 0.0799  67  GLN A OE1 
514  N NE2 . GLN A 72  ? 1.4289 1.0520 1.2375 0.0612  -0.0734 0.0838  67  GLN A NE2 
515  N N   . LYS A 73  ? 0.8877 0.5019 0.7507 0.0296  0.0330  0.0681  68  LYS A N   
516  C CA  . LYS A 73  ? 0.8859 0.4961 0.7526 0.0166  0.0606  0.0612  68  LYS A CA  
517  C C   . LYS A 73  ? 0.9480 0.5403 0.8252 0.0258  0.0619  0.0635  68  LYS A C   
518  O O   . LYS A 73  ? 0.9644 0.5342 0.8298 0.0178  0.0837  0.0606  68  LYS A O   
519  C CB  . LYS A 73  ? 0.8616 0.5237 0.7667 0.0018  0.0715  0.0486  68  LYS A CB  
520  C CG  . LYS A 73  ? 1.1094 0.7770 0.9971 -0.0132 0.0861  0.0433  68  LYS A CG  
521  C CD  . LYS A 73  ? 1.1958 0.9149 1.1162 -0.0187 0.0808  0.0357  68  LYS A CD  
522  C CE  . LYS A 73  ? 1.3588 1.0841 1.2629 -0.0299 0.0907  0.0316  68  LYS A CE  
523  N NZ  . LYS A 73  ? 1.4515 1.2233 1.3842 -0.0317 0.0818  0.0262  68  LYS A NZ  
524  N N   . THR A 74  ? 0.8919 0.4943 0.7931 0.0425  0.0391  0.0681  69  THR A N   
525  C CA  . THR A 74  ? 0.8849 0.4722 0.8001 0.0545  0.0375  0.0707  69  THR A CA  
526  C C   . THR A 74  ? 0.9836 0.5173 0.8595 0.0726  0.0239  0.0835  69  THR A C   
527  O O   . THR A 74  ? 0.9911 0.5144 0.8808 0.0882  0.0137  0.0875  69  THR A O   
528  C CB  . THR A 74  ? 0.8071 0.4403 0.7787 0.0602  0.0269  0.0657  69  THR A CB  
529  O OG1 . THR A 74  ? 0.7688 0.4211 0.7529 0.0700  0.0005  0.0697  69  THR A OG1 
530  C CG2 . THR A 74  ? 0.7072 0.3821 0.7097 0.0433  0.0451  0.0533  69  THR A CG2 
531  N N   . GLU A 75  ? 0.9807 0.4785 0.8058 0.0710  0.0247  0.0898  70  GLU A N   
532  C CA  . GLU A 75  ? 1.0417 0.4814 0.8193 0.0874  0.0145  0.1022  70  GLU A CA  
533  C C   . GLU A 75  ? 1.0826 0.4875 0.8485 0.0854  0.0379  0.1025  70  GLU A C   
534  O O   . GLU A 75  ? 1.0539 0.4599 0.8178 0.0663  0.0663  0.0950  70  GLU A O   
535  C CB  . GLU A 75  ? 1.0983 0.5046 0.8198 0.0836  0.0156  0.1079  70  GLU A CB  
536  C CG  . GLU A 75  ? 1.2938 0.6348 0.9573 0.1014  0.0046  0.1216  70  GLU A CG  
537  C CD  . GLU A 75  ? 1.5872 0.9268 1.2535 0.1252  -0.0341 0.1288  70  GLU A CD  
538  O OE1 . GLU A 75  ? 1.7186 1.0272 1.3756 0.1436  -0.0453 0.1362  70  GLU A OE1 
539  O OE2 . GLU A 75  ? 1.5183 0.8870 1.1961 0.1258  -0.0537 0.1267  70  GLU A OE2 
540  N N   . GLY A 76  ? 1.0681 0.4478 0.8333 0.1051  0.0250  0.1097  71  GLY A N   
541  C CA  . GLY A 76  ? 1.0866 0.4307 0.8418 0.1064  0.0446  0.1108  71  GLY A CA  
542  C C   . GLY A 76  ? 1.0679 0.4512 0.8799 0.1029  0.0531  0.1007  71  GLY A C   
543  O O   . GLY A 76  ? 1.0866 0.4448 0.8953 0.1019  0.0714  0.0993  71  GLY A O   
544  N N   . ALA A 77  ? 0.9564 0.3995 0.8193 0.1010  0.0405  0.0934  72  ALA A N   
545  C CA  . ALA A 77  ? 0.9004 0.3870 0.8196 0.0981  0.0465  0.0834  72  ALA A CA  
546  C C   . ALA A 77  ? 0.8969 0.4115 0.8535 0.1172  0.0167  0.0867  72  ALA A C   
547  O O   . ALA A 77  ? 0.8586 0.4173 0.8438 0.1129  0.0053  0.0826  72  ALA A O   
548  C CB  . ALA A 77  ? 0.8559 0.3876 0.7969 0.0752  0.0620  0.0712  72  ALA A CB  
549  N N   . GLU A 78  ? 0.8736 0.3595 0.8272 0.1386  0.0036  0.0945  73  GLU A N   
550  C CA  . GLU A 78  ? 0.8641 0.3665 0.8496 0.1606  -0.0269 0.0987  73  GLU A CA  
551  C C   . GLU A 78  ? 0.8616 0.4273 0.9131 0.1580  -0.0332 0.0896  73  GLU A C   
552  O O   . GLU A 78  ? 0.7981 0.3915 0.8669 0.1614  -0.0553 0.0900  73  GLU A O   
553  C CB  . GLU A 78  ? 0.9194 0.3823 0.8977 0.1821  -0.0318 0.1057  73  GLU A CB  
554  C CG  . GLU A 78  ? 0.9736 0.4509 0.9847 0.2070  -0.0652 0.1100  73  GLU A CG  
555  C CD  . GLU A 78  ? 1.1958 0.6381 1.2059 0.2299  -0.0702 0.1161  73  GLU A CD  
556  O OE1 . GLU A 78  ? 1.0639 0.4921 1.0766 0.2253  -0.0445 0.1127  73  GLU A OE1 
557  O OE2 . GLU A 78  ? 1.2918 0.7202 1.2983 0.2532  -0.1006 0.1238  73  GLU A OE2 
558  N N   . LYS A 79  ? 0.8264 0.4116 0.9132 0.1531  -0.0137 0.0815  74  LYS A N   
559  C CA  . LYS A 79  ? 0.7663 0.4067 0.9132 0.1506  -0.0151 0.0730  74  LYS A CA  
560  C C   . LYS A 79  ? 0.7900 0.4685 0.9441 0.1322  -0.0126 0.0671  74  LYS A C   
561  O O   . LYS A 79  ? 0.7521 0.4696 0.9447 0.1346  -0.0270 0.0647  74  LYS A O   
562  C CB  . LYS A 79  ? 0.7707 0.4169 0.9433 0.1477  0.0089  0.0654  74  LYS A CB  
563  C CG  . LYS A 79  ? 0.7743 0.4019 0.9654 0.1700  0.0021  0.0693  74  LYS A CG  
564  C CD  . LYS A 79  ? 0.8684 0.4917 1.0705 0.1634  0.0311  0.0612  74  LYS A CD  
565  C CE  . LYS A 79  ? 1.0375 0.6558 1.2727 0.1837  0.0289  0.0618  74  LYS A CE  
566  N NZ  . LYS A 79  ? 1.1813 0.7777 1.4087 0.1775  0.0581  0.0555  74  LYS A NZ  
567  N N   . LYS A 80  ? 0.7577 0.4239 0.8752 0.1142  0.0051  0.0647  75  LYS A N   
568  C CA  . LYS A 80  ? 0.7098 0.4099 0.8314 0.0969  0.0092  0.0588  75  LYS A CA  
569  C C   . LYS A 80  ? 0.8024 0.5030 0.9092 0.1018  -0.0148 0.0653  75  LYS A C   
570  O O   . LYS A 80  ? 0.7778 0.5164 0.9109 0.0974  -0.0236 0.0618  75  LYS A O   
571  C CB  . LYS A 80  ? 0.7325 0.4193 0.8210 0.0775  0.0339  0.0538  75  LYS A CB  
572  C CG  . LYS A 80  ? 0.8257 0.5225 0.9312 0.0669  0.0589  0.0436  75  LYS A CG  
573  C CD  . LYS A 80  ? 0.9596 0.6345 1.0285 0.0493  0.0809  0.0391  75  LYS A CD  
574  C CE  . LYS A 80  ? 1.0146 0.7108 1.0995 0.0331  0.1038  0.0257  75  LYS A CE  
575  N NZ  . LYS A 80  ? 1.1066 0.7910 1.2070 0.0388  0.1151  0.0221  75  LYS A NZ  
576  N N   . GLN A 81  ? 0.8008 0.4565 0.8617 0.1101  -0.0243 0.0744  76  GLN A N   
577  C CA  . GLN A 81  ? 0.7958 0.4447 0.8346 0.1156  -0.0477 0.0806  76  GLN A CA  
578  C C   . GLN A 81  ? 0.8002 0.4772 0.8808 0.1300  -0.0756 0.0813  76  GLN A C   
579  O O   . GLN A 81  ? 0.7592 0.4592 0.8475 0.1267  -0.0898 0.0800  76  GLN A O   
580  C CB  . GLN A 81  ? 0.8722 0.4626 0.8524 0.1249  -0.0530 0.0909  76  GLN A CB  
581  C CG  . GLN A 81  ? 0.8640 0.4450 0.8160 0.1303  -0.0771 0.0965  76  GLN A CG  
582  C CD  . GLN A 81  ? 0.9880 0.5158 0.8722 0.1290  -0.0710 0.1040  76  GLN A CD  
583  O OE1 . GLN A 81  ? 0.9406 0.4674 0.7995 0.1141  -0.0590 0.1019  76  GLN A OE1 
584  N NE2 . GLN A 81  ? 0.9096 0.3908 0.7619 0.1461  -0.0813 0.1133  76  GLN A NE2 
585  N N   . GLN A 82  ? 0.7570 0.4317 0.8659 0.1462  -0.0833 0.0828  77  GLN A N   
586  C CA  . GLN A 82  ? 0.7391 0.4423 0.8938 0.1604  -0.1099 0.0824  77  GLN A CA  
587  C C   . GLN A 82  ? 0.7205 0.4788 0.9280 0.1488  -0.1040 0.0732  77  GLN A C   
588  O O   . GLN A 82  ? 0.6907 0.4753 0.9255 0.1523  -0.1249 0.0719  77  GLN A O   
589  C CB  . GLN A 82  ? 0.7846 0.4762 0.9633 0.1811  -0.1186 0.0852  77  GLN A CB  
590  C CG  . GLN A 82  ? 1.1570 0.8766 1.3813 0.1967  -0.1510 0.0846  77  GLN A CG  
591  C CD  . GLN A 82  ? 1.4693 1.2040 1.7469 0.2131  -0.1551 0.0824  77  GLN A CD  
592  O OE1 . GLN A 82  ? 1.3414 1.0479 1.6084 0.2223  -0.1444 0.0854  77  GLN A OE1 
593  N NE2 . GLN A 82  ? 1.4663 1.2439 1.8029 0.2182  -0.1720 0.0771  77  GLN A NE2 
594  N N   . MET A 83  ? 0.6555 0.4299 0.8776 0.1358  -0.0762 0.0666  78  MET A N   
595  C CA  . MET A 83  ? 0.6137 0.4360 0.8806 0.1253  -0.0685 0.0585  78  MET A CA  
596  C C   . MET A 83  ? 0.6586 0.4950 0.9092 0.1128  -0.0739 0.0577  78  MET A C   
597  O O   . MET A 83  ? 0.6255 0.4957 0.9100 0.1107  -0.0832 0.0544  78  MET A O   
598  C CB  . MET A 83  ? 0.6315 0.4611 0.9046 0.1136  -0.0378 0.0517  78  MET A CB  
599  C CG  . MET A 83  ? 0.6428 0.5156 0.9492 0.1012  -0.0269 0.0439  78  MET A CG  
600  S SD  . MET A 83  ? 0.6981 0.5785 1.0183 0.0929  0.0052  0.0353  78  MET A SD  
601  C CE  . MET A 83  ? 0.6696 0.5350 1.0197 0.1144  0.0000  0.0380  78  MET A CE  
602  N N   . ALA A 84  ? 0.6274 0.4374 0.8272 0.1040  -0.0658 0.0601  79  ALA A N   
603  C CA  . ALA A 84  ? 0.6092 0.4277 0.7882 0.0927  -0.0689 0.0595  79  ALA A CA  
604  C C   . ALA A 84  ? 0.6670 0.4812 0.8417 0.1029  -0.0987 0.0643  79  ALA A C   
605  O O   . ALA A 84  ? 0.6249 0.4630 0.8100 0.0961  -0.1052 0.0615  79  ALA A O   
606  C CB  . ALA A 84  ? 0.6341 0.4224 0.7608 0.0824  -0.0525 0.0608  79  ALA A CB  
607  N N   . ARG A 85  ? 0.6773 0.4605 0.8363 0.1196  -0.1175 0.0711  80  ARG A N   
608  C CA  . ARG A 85  ? 0.6958 0.4726 0.8491 0.1311  -0.1494 0.0750  80  ARG A CA  
609  C C   . ARG A 85  ? 0.7229 0.5441 0.9387 0.1342  -0.1637 0.0694  80  ARG A C   
610  O O   . ARG A 85  ? 0.6979 0.5352 0.9201 0.1308  -0.1791 0.0674  80  ARG A O   
611  C CB  . ARG A 85  ? 0.7300 0.4635 0.8545 0.1506  -0.1669 0.0832  80  ARG A CB  
612  C CG  . ARG A 85  ? 0.8973 0.6168 1.0043 0.1636  -0.2025 0.0873  80  ARG A CG  
613  C CD  . ARG A 85  ? 1.1651 0.8541 1.2644 0.1873  -0.2252 0.0938  80  ARG A CD  
614  N NE  . ARG A 85  ? 1.3126 1.0394 1.4766 0.1983  -0.2480 0.0889  80  ARG A NE  
615  C CZ  . ARG A 85  ? 1.4446 1.1888 1.6574 0.2077  -0.2451 0.0866  80  ARG A CZ  
616  N NH1 . ARG A 85  ? 1.2716 0.9931 1.4710 0.2099  -0.2230 0.0898  80  ARG A NH1 
617  N NH2 . ARG A 85  ? 1.2169 0.9994 1.4921 0.2155  -0.2643 0.0808  80  ARG A NH2 
618  N N   . GLU A 86  ? 0.6722 0.5123 0.9344 0.1399  -0.1574 0.0664  81  GLU A N   
619  C CA  . GLU A 86  ? 0.6368 0.5187 0.9623 0.1428  -0.1685 0.0607  81  GLU A CA  
620  C C   . GLU A 86  ? 0.6151 0.5318 0.9601 0.1250  -0.1547 0.0545  81  GLU A C   
621  O O   . GLU A 86  ? 0.5953 0.5383 0.9735 0.1241  -0.1693 0.0510  81  GLU A O   
622  C CB  . GLU A 86  ? 0.6475 0.5398 1.0161 0.1523  -0.1597 0.0586  81  GLU A CB  
623  C CG  . GLU A 86  ? 0.8824 0.7419 1.2376 0.1734  -0.1784 0.0649  81  GLU A CG  
624  C CD  . GLU A 86  ? 1.1606 1.0313 1.5645 0.1872  -0.1762 0.0628  81  GLU A CD  
625  O OE1 . GLU A 86  ? 1.0373 0.9318 1.4744 0.1790  -0.1510 0.0570  81  GLU A OE1 
626  O OE2 . GLU A 86  ? 1.1710 1.0244 1.5774 0.2072  -0.1996 0.0669  81  GLU A OE2 
627  N N   . TYR A 87  ? 0.5457 0.4616 0.8703 0.1111  -0.1269 0.0528  82  TYR A N   
628  C CA  . TYR A 87  ? 0.5049 0.4500 0.8416 0.0953  -0.1128 0.0475  82  TYR A CA  
629  C C   . TYR A 87  ? 0.5567 0.4963 0.8636 0.0899  -0.1265 0.0491  82  TYR A C   
630  O O   . TYR A 87  ? 0.5317 0.4970 0.8621 0.0837  -0.1308 0.0456  82  TYR A O   
631  C CB  . TYR A 87  ? 0.4959 0.4395 0.8150 0.0836  -0.0827 0.0448  82  TYR A CB  
632  C CG  . TYR A 87  ? 0.4553 0.4332 0.8001 0.0714  -0.0673 0.0387  82  TYR A CG  
633  C CD1 . TYR A 87  ? 0.4426 0.4502 0.8397 0.0737  -0.0688 0.0352  82  TYR A CD1 
634  C CD2 . TYR A 87  ? 0.4364 0.4161 0.7532 0.0580  -0.0506 0.0362  82  TYR A CD2 
635  C CE1 . TYR A 87  ? 0.4002 0.4345 0.8163 0.0630  -0.0529 0.0304  82  TYR A CE1 
636  C CE2 . TYR A 87  ? 0.4128 0.4208 0.7492 0.0485  -0.0371 0.0312  82  TYR A CE2 
637  C CZ  . TYR A 87  ? 0.4015 0.4347 0.7851 0.0511  -0.0375 0.0288  82  TYR A CZ  
638  O OH  . TYR A 87  ? 0.3724 0.4291 0.7710 0.0424  -0.0229 0.0247  82  TYR A OH  
639  N N   . ARG A 88  ? 0.5594 0.4627 0.8130 0.0924  -0.1326 0.0545  83  ARG A N   
640  C CA  . ARG A 88  ? 0.5763 0.4689 0.7969 0.0891  -0.1468 0.0563  83  ARG A CA  
641  C C   . ARG A 88  ? 0.6068 0.5120 0.8565 0.0979  -0.1763 0.0554  83  ARG A C   
642  O O   . ARG A 88  ? 0.5825 0.5028 0.8367 0.0907  -0.1828 0.0525  83  ARG A O   
643  C CB  . ARG A 88  ? 0.6446 0.4914 0.8025 0.0926  -0.1489 0.0628  83  ARG A CB  
644  C CG  . ARG A 88  ? 0.7015 0.5332 0.8223 0.0911  -0.1648 0.0646  83  ARG A CG  
645  C CD  . ARG A 88  ? 0.8384 0.6216 0.8937 0.0944  -0.1646 0.0712  83  ARG A CD  
646  N NE  . ARG A 88  ? 1.0176 0.7687 1.0580 0.1096  -0.1748 0.0773  83  ARG A NE  
647  C CZ  . ARG A 88  ? 1.0887 0.8269 1.1297 0.1256  -0.2048 0.0805  83  ARG A CZ  
648  N NH1 . ARG A 88  ? 0.9068 0.6626 0.9647 0.1275  -0.2283 0.0773  83  ARG A NH1 
649  N NH2 . ARG A 88  ? 0.8894 0.5965 0.9142 0.1402  -0.2121 0.0866  83  ARG A NH2 
650  N N   . GLU A 89  ? 0.5722 0.4709 0.8414 0.1133  -0.1945 0.0573  84  GLU A N   
651  C CA  . GLU A 89  ? 0.5783 0.4905 0.8794 0.1224  -0.2250 0.0550  84  GLU A CA  
652  C C   . GLU A 89  ? 0.5741 0.5321 0.9359 0.1137  -0.2205 0.0474  84  GLU A C   
653  O O   . GLU A 89  ? 0.5758 0.5468 0.9528 0.1118  -0.2392 0.0439  84  GLU A O   
654  C CB  . GLU A 89  ? 0.6245 0.5233 0.9389 0.1418  -0.2439 0.0579  84  GLU A CB  
655  C CG  . GLU A 89  ? 0.7965 0.6449 1.0448 0.1517  -0.2548 0.0660  84  GLU A CG  
656  C CD  . GLU A 89  ? 1.0417 0.8674 1.2902 0.1719  -0.2689 0.0708  84  GLU A CD  
657  O OE1 . GLU A 89  ? 0.8235 0.6732 1.1260 0.1787  -0.2670 0.0677  84  GLU A OE1 
658  O OE2 . GLU A 89  ? 0.9218 0.7029 1.1134 0.1816  -0.2811 0.0780  84  GLU A OE2 
659  N N   . LYS A 90  ? 0.4947 0.4744 0.8885 0.1078  -0.1949 0.0446  85  LYS A N   
660  C CA  . LYS A 90  ? 0.4672 0.4862 0.9131 0.0985  -0.1848 0.0381  85  LYS A CA  
661  C C   . LYS A 90  ? 0.4941 0.5190 0.9182 0.0836  -0.1776 0.0367  85  LYS A C   
662  O O   . LYS A 90  ? 0.4771 0.5224 0.9297 0.0788  -0.1864 0.0326  85  LYS A O   
663  C CB  . LYS A 90  ? 0.4910 0.5231 0.9600 0.0956  -0.1557 0.0364  85  LYS A CB  
664  C CG  . LYS A 90  ? 0.5755 0.6433 1.0897 0.0849  -0.1385 0.0305  85  LYS A CG  
665  C CD  . LYS A 90  ? 0.6382 0.7121 1.1631 0.0825  -0.1094 0.0289  85  LYS A CD  
666  C CE  . LYS A 90  ? 0.7503 0.8543 1.3123 0.0724  -0.0899 0.0238  85  LYS A CE  
667  N NZ  . LYS A 90  ? 0.9197 1.0297 1.4989 0.0729  -0.0643 0.0214  85  LYS A NZ  
668  N N   . ILE A 91  ? 0.4523 0.4585 0.8266 0.0764  -0.1614 0.0397  86  ILE A N   
669  C CA  . ILE A 91  ? 0.4143 0.4240 0.7653 0.0641  -0.1545 0.0386  86  ILE A CA  
670  C C   . ILE A 91  ? 0.5218 0.5189 0.8545 0.0670  -0.1813 0.0392  86  ILE A C   
671  O O   . ILE A 91  ? 0.5258 0.5371 0.8683 0.0594  -0.1841 0.0360  86  ILE A O   
672  C CB  . ILE A 91  ? 0.4530 0.4452 0.7564 0.0573  -0.1335 0.0408  86  ILE A CB  
673  C CG1 . ILE A 91  ? 0.4256 0.4321 0.7482 0.0533  -0.1073 0.0384  86  ILE A CG1 
674  C CG2 . ILE A 91  ? 0.4371 0.4311 0.7142 0.0468  -0.1295 0.0398  86  ILE A CG2 
675  C CD1 . ILE A 91  ? 0.4656 0.4532 0.7488 0.0491  -0.0886 0.0395  86  ILE A CD1 
676  N N   . GLU A 92  ? 0.5131 0.4808 0.8163 0.0783  -0.2011 0.0433  87  GLU A N   
677  C CA  . GLU A 92  ? 0.5357 0.4867 0.8157 0.0827  -0.2288 0.0437  87  GLU A CA  
678  C C   . GLU A 92  ? 0.5913 0.5697 0.9240 0.0835  -0.2484 0.0376  87  GLU A C   
679  O O   . GLU A 92  ? 0.5937 0.5731 0.9192 0.0782  -0.2601 0.0346  87  GLU A O   
680  C CB  . GLU A 92  ? 0.5879 0.5024 0.8313 0.0973  -0.2479 0.0493  87  GLU A CB  
681  C CG  . GLU A 92  ? 0.6899 0.5685 0.8682 0.0948  -0.2338 0.0551  87  GLU A CG  
682  C CD  . GLU A 92  ? 0.8474 0.6841 0.9830 0.1089  -0.2483 0.0617  87  GLU A CD  
683  O OE1 . GLU A 92  ? 0.8001 0.6051 0.8824 0.1064  -0.2342 0.0665  87  GLU A OE1 
684  O OE2 . GLU A 92  ? 0.8990 0.7334 1.0537 0.1228  -0.2736 0.0620  87  GLU A OE2 
685  N N   . THR A 93  ? 0.5294 0.5293 0.9159 0.0901  -0.2515 0.0350  88  THR A N   
686  C CA  . THR A 93  ? 0.5128 0.5426 0.9586 0.0901  -0.2677 0.0280  88  THR A CA  
687  C C   . THR A 93  ? 0.5076 0.5614 0.9736 0.0740  -0.2509 0.0235  88  THR A C   
688  O O   . THR A 93  ? 0.4979 0.5590 0.9766 0.0698  -0.2671 0.0188  88  THR A O   
689  C CB  . THR A 93  ? 0.5576 0.6068 1.0582 0.0998  -0.2683 0.0261  88  THR A CB  
690  O OG1 . THR A 93  ? 0.6607 0.6835 1.1380 0.1166  -0.2903 0.0303  88  THR A OG1 
691  C CG2 . THR A 93  ? 0.4646 0.5500 1.0361 0.0979  -0.2799 0.0174  88  THR A CG2 
692  N N   . GLU A 94  ? 0.4412 0.5043 0.9067 0.0653  -0.2193 0.0249  89  GLU A N   
693  C CA  . GLU A 94  ? 0.4380 0.5192 0.9153 0.0515  -0.2021 0.0219  89  GLU A CA  
694  C C   . GLU A 94  ? 0.5333 0.5970 0.9660 0.0458  -0.2109 0.0225  89  GLU A C   
695  O O   . GLU A 94  ? 0.5331 0.6085 0.9836 0.0383  -0.2153 0.0183  89  GLU A O   
696  C CB  . GLU A 94  ? 0.4281 0.5143 0.8962 0.0452  -0.1690 0.0241  89  GLU A CB  
697  C CG  . GLU A 94  ? 0.4583 0.5636 0.9720 0.0484  -0.1548 0.0224  89  GLU A CG  
698  C CD  . GLU A 94  ? 0.5648 0.6759 1.0697 0.0412  -0.1228 0.0231  89  GLU A CD  
699  O OE1 . GLU A 94  ? 0.4531 0.5570 0.9208 0.0335  -0.1121 0.0246  89  GLU A OE1 
700  O OE2 . GLU A 94  ? 0.5116 0.6349 1.0478 0.0438  -0.1087 0.0216  89  GLU A OE2 
701  N N   . LEU A 95  ? 0.5119 0.5469 0.8871 0.0488  -0.2113 0.0275  90  LEU A N   
702  C CA  . LEU A 95  ? 0.5295 0.5449 0.8574 0.0443  -0.2166 0.0284  90  LEU A CA  
703  C C   . LEU A 95  ? 0.5880 0.5970 0.9202 0.0478  -0.2478 0.0247  90  LEU A C   
704  O O   . LEU A 95  ? 0.5794 0.5894 0.9054 0.0402  -0.2508 0.0215  90  LEU A O   
705  C CB  . LEU A 95  ? 0.5497 0.5347 0.8201 0.0481  -0.2105 0.0341  90  LEU A CB  
706  C CG  . LEU A 95  ? 0.6307 0.5959 0.8494 0.0426  -0.2061 0.0354  90  LEU A CG  
707  C CD1 . LEU A 95  ? 0.6366 0.5836 0.8157 0.0426  -0.1877 0.0399  90  LEU A CD1 
708  C CD2 . LEU A 95  ? 0.7193 0.6591 0.9088 0.0487  -0.2340 0.0353  90  LEU A CD2 
709  N N   . ARG A 96  ? 0.5547 0.5555 0.8953 0.0597  -0.2717 0.0247  91  ARG A N   
710  C CA  . ARG A 96  ? 0.5787 0.5736 0.9238 0.0642  -0.3047 0.0200  91  ARG A CA  
711  C C   . ARG A 96  ? 0.6045 0.6318 1.0089 0.0558  -0.3083 0.0118  91  ARG A C   
712  O O   . ARG A 96  ? 0.5772 0.6004 0.9764 0.0515  -0.3248 0.0068  91  ARG A O   
713  C CB  . ARG A 96  ? 0.6166 0.5998 0.9650 0.0801  -0.3298 0.0213  91  ARG A CB  
714  C CG  . ARG A 96  ? 0.8027 0.7438 1.0812 0.0887  -0.3315 0.0294  91  ARG A CG  
715  C CD  . ARG A 96  ? 0.9311 0.8487 1.1941 0.1060  -0.3639 0.0310  91  ARG A CD  
716  N NE  . ARG A 96  ? 0.9854 0.8656 1.1900 0.1132  -0.3540 0.0402  91  ARG A NE  
717  C CZ  . ARG A 96  ? 1.0461 0.9253 1.2609 0.1202  -0.3424 0.0448  91  ARG A CZ  
718  N NH1 . ARG A 96  ? 0.8082 0.7207 1.0881 0.1231  -0.3422 0.0411  91  ARG A NH1 
719  N NH2 . ARG A 96  ? 0.9105 0.7535 1.0705 0.1247  -0.3312 0.0528  91  ARG A NH2 
720  N N   . ASP A 97  ? 0.5590 0.6170 1.0190 0.0527  -0.2913 0.0100  92  ASP A N   
721  C CA  . ASP A 97  ? 0.5344 0.6231 1.0542 0.0436  -0.2903 0.0022  92  ASP A CA  
722  C C   . ASP A 97  ? 0.5426 0.6305 1.0450 0.0296  -0.2740 0.0015  92  ASP A C   
723  O O   . ASP A 97  ? 0.5421 0.6379 1.0666 0.0226  -0.2851 -0.0052 92  ASP A O   
724  C CB  . ASP A 97  ? 0.5332 0.6511 1.1102 0.0433  -0.2707 0.0012  92  ASP A CB  
725  C CG  . ASP A 97  ? 0.6096 0.7359 1.2229 0.0569  -0.2897 -0.0007 92  ASP A CG  
726  O OD1 . ASP A 97  ? 0.6606 0.7742 1.2640 0.0662  -0.3228 -0.0028 92  ASP A OD1 
727  O OD2 . ASP A 97  ? 0.6134 0.7572 1.2625 0.0592  -0.2720 -0.0001 92  ASP A OD2 
728  N N   . ILE A 98  ? 0.4553 0.5326 0.9173 0.0261  -0.2487 0.0078  93  ILE A N   
729  C CA  . ILE A 98  ? 0.4158 0.4902 0.8557 0.0151  -0.2322 0.0081  93  ILE A CA  
730  C C   . ILE A 98  ? 0.4811 0.5321 0.8817 0.0148  -0.2531 0.0062  93  ILE A C   
731  O O   . ILE A 98  ? 0.4660 0.5208 0.8771 0.0066  -0.2554 0.0016  93  ILE A O   
732  C CB  . ILE A 98  ? 0.4197 0.4885 0.8253 0.0135  -0.2042 0.0144  93  ILE A CB  
733  C CG1 . ILE A 98  ? 0.4016 0.4936 0.8462 0.0120  -0.1813 0.0150  93  ILE A CG1 
734  C CG2 . ILE A 98  ? 0.3696 0.4327 0.7484 0.0049  -0.1918 0.0146  93  ILE A CG2 
735  C CD1 . ILE A 98  ? 0.3275 0.4122 0.7401 0.0142  -0.1609 0.0202  93  ILE A CD1 
736  N N   . CYS A 99  ? 0.4672 0.4918 0.8218 0.0238  -0.2679 0.0096  94  CYS A N   
737  C CA  . CYS A 99  ? 0.4819 0.4799 0.7935 0.0250  -0.2885 0.0077  94  CYS A CA  
738  C C   . CYS A 99  ? 0.5528 0.5584 0.8985 0.0242  -0.3164 -0.0008 94  CYS A C   
739  O O   . CYS A 99  ? 0.5634 0.5612 0.8975 0.0176  -0.3233 -0.0054 94  CYS A O   
740  C CB  . CYS A 99  ? 0.5039 0.4707 0.7622 0.0359  -0.2985 0.0132  94  CYS A CB  
741  S SG  . CYS A 99  ? 0.5380 0.4913 0.7482 0.0343  -0.2658 0.0215  94  CYS A SG  
742  N N   . ASN A 100 ? 0.5091 0.5307 0.8994 0.0308  -0.3325 -0.0039 95  ASN A N   
743  C CA  . ASN A 100 ? 0.5275 0.5601 0.9574 0.0302  -0.3614 -0.0137 95  ASN A CA  
744  C C   . ASN A 100 ? 0.5582 0.6152 1.0348 0.0156  -0.3493 -0.0204 95  ASN A C   
745  O O   . ASN A 100 ? 0.5655 0.6203 1.0504 0.0106  -0.3683 -0.0285 95  ASN A O   
746  C CB  . ASN A 100 ? 0.5748 0.6218 1.0465 0.0418  -0.3811 -0.0158 95  ASN A CB  
747  C CG  . ASN A 100 ? 0.8712 0.8870 1.2927 0.0575  -0.4031 -0.0109 95  ASN A CG  
748  O OD1 . ASN A 100 ? 0.8440 0.8273 1.2065 0.0598  -0.4159 -0.0096 95  ASN A OD1 
749  N ND2 . ASN A 100 ? 0.8235 0.8458 1.2654 0.0693  -0.4068 -0.0077 95  ASN A ND2 
750  N N   . ASP A 101 ? 0.5168 0.5938 1.0198 0.0088  -0.3174 -0.0171 96  ASP A N   
751  C CA  . ASP A 101 ? 0.5092 0.6053 1.0510 -0.0051 -0.3002 -0.0217 96  ASP A CA  
752  C C   . ASP A 101 ? 0.5849 0.6583 1.0802 -0.0127 -0.2977 -0.0219 96  ASP A C   
753  O O   . ASP A 101 ? 0.6064 0.6824 1.1227 -0.0211 -0.3076 -0.0298 96  ASP A O   
754  C CB  . ASP A 101 ? 0.5054 0.6195 1.0677 -0.0081 -0.2650 -0.0160 96  ASP A CB  
755  C CG  . ASP A 101 ? 0.6696 0.7988 1.2628 -0.0214 -0.2402 -0.0180 96  ASP A CG  
756  O OD1 . ASP A 101 ? 0.7171 0.8552 1.3468 -0.0295 -0.2500 -0.0262 96  ASP A OD1 
757  O OD2 . ASP A 101 ? 0.7012 0.8334 1.2845 -0.0235 -0.2107 -0.0118 96  ASP A OD2 
758  N N   . VAL A 102 ? 0.5316 0.5820 0.9649 -0.0092 -0.2861 -0.0141 97  VAL A N   
759  C CA  . VAL A 102 ? 0.5356 0.5640 0.9230 -0.0145 -0.2820 -0.0139 97  VAL A CA  
760  C C   . VAL A 102 ? 0.5991 0.6074 0.9670 -0.0126 -0.3143 -0.0208 97  VAL A C   
761  O O   . VAL A 102 ? 0.6041 0.6054 0.9698 -0.0207 -0.3180 -0.0264 97  VAL A O   
762  C CB  . VAL A 102 ? 0.5709 0.5814 0.9002 -0.0101 -0.2634 -0.0051 97  VAL A CB  
763  C CG1 . VAL A 102 ? 0.5913 0.5791 0.8750 -0.0140 -0.2607 -0.0056 97  VAL A CG1 
764  C CG2 . VAL A 102 ? 0.5306 0.5602 0.8772 -0.0123 -0.2328 0.0004  97  VAL A CG2 
765  N N   . LEU A 103 ? 0.5754 0.5725 0.9271 -0.0015 -0.3377 -0.0204 98  LEU A N   
766  C CA  . LEU A 103 ? 0.6029 0.5774 0.9290 0.0025  -0.3709 -0.0267 98  LEU A CA  
767  C C   . LEU A 103 ? 0.6401 0.6326 1.0211 -0.0047 -0.3912 -0.0388 98  LEU A C   
768  O O   . LEU A 103 ? 0.6203 0.5956 0.9824 -0.0084 -0.4094 -0.0460 98  LEU A O   
769  C CB  . LEU A 103 ? 0.6230 0.5790 0.9171 0.0174  -0.3910 -0.0228 98  LEU A CB  
770  C CG  . LEU A 103 ? 0.6879 0.6161 0.9147 0.0231  -0.3739 -0.0125 98  LEU A CG  
771  C CD1 . LEU A 103 ? 0.7114 0.6246 0.9168 0.0375  -0.3881 -0.0073 98  LEU A CD1 
772  C CD2 . LEU A 103 ? 0.7314 0.6276 0.8992 0.0203  -0.3760 -0.0138 98  LEU A CD2 
773  N N   . SER A 104 ? 0.5931 0.6201 1.0429 -0.0076 -0.3858 -0.0415 99  SER A N   
774  C CA  . SER A 104 ? 0.5986 0.6483 1.1118 -0.0159 -0.4011 -0.0536 99  SER A CA  
775  C C   . SER A 104 ? 0.6537 0.7027 1.1725 -0.0319 -0.3821 -0.0572 99  SER A C   
776  O O   . SER A 104 ? 0.6619 0.7078 1.1951 -0.0394 -0.4006 -0.0680 99  SER A O   
777  C CB  . SER A 104 ? 0.6128 0.6990 1.1967 -0.0144 -0.3950 -0.0547 99  SER A CB  
778  O OG  . SER A 104 ? 0.8139 0.9249 1.4651 -0.0244 -0.4053 -0.0672 99  SER A OG  
779  N N   . LEU A 105 ? 0.5650 0.6141 1.0688 -0.0364 -0.3465 -0.0484 100 LEU A N   
780  C CA  . LEU A 105 ? 0.5481 0.5922 1.0511 -0.0495 -0.3277 -0.0502 100 LEU A CA  
781  C C   . LEU A 105 ? 0.6316 0.6421 1.0770 -0.0493 -0.3429 -0.0530 100 LEU A C   
782  O O   . LEU A 105 ? 0.6236 0.6276 1.0776 -0.0595 -0.3473 -0.0610 100 LEU A O   
783  C CB  . LEU A 105 ? 0.5080 0.5550 0.9957 -0.0508 -0.2894 -0.0393 100 LEU A CB  
784  C CG  . LEU A 105 ? 0.5179 0.5950 1.0593 -0.0529 -0.2681 -0.0367 100 LEU A CG  
785  C CD1 . LEU A 105 ? 0.4793 0.5536 0.9925 -0.0525 -0.2337 -0.0261 100 LEU A CD1 
786  C CD2 . LEU A 105 ? 0.5103 0.6076 1.1184 -0.0659 -0.2657 -0.0460 100 LEU A CD2 
787  N N   . LEU A 106 ? 0.5963 0.5839 0.9816 -0.0380 -0.3487 -0.0464 101 LEU A N   
788  C CA  . LEU A 106 ? 0.6106 0.5637 0.9360 -0.0363 -0.3615 -0.0485 101 LEU A CA  
789  C C   . LEU A 106 ? 0.7223 0.6682 1.0603 -0.0382 -0.3981 -0.0615 101 LEU A C   
790  O O   . LEU A 106 ? 0.7490 0.6773 1.0700 -0.0455 -0.4034 -0.0683 101 LEU A O   
791  C CB  . LEU A 106 ? 0.6043 0.5345 0.8669 -0.0238 -0.3604 -0.0395 101 LEU A CB  
792  C CG  . LEU A 106 ? 0.6060 0.5361 0.8429 -0.0236 -0.3249 -0.0288 101 LEU A CG  
793  C CD1 . LEU A 106 ? 0.5948 0.5138 0.7924 -0.0121 -0.3223 -0.0203 101 LEU A CD1 
794  C CD2 . LEU A 106 ? 0.6105 0.5189 0.8072 -0.0286 -0.3119 -0.0291 101 LEU A CD2 
795  N N   . GLU A 107 ? 0.6889 0.6487 1.0578 -0.0316 -0.4237 -0.0658 102 GLU A N   
796  C CA  . GLU A 107 ? 0.7282 0.6830 1.1103 -0.0319 -0.4622 -0.0791 102 GLU A CA  
797  C C   . GLU A 107 ? 0.7855 0.7638 1.2343 -0.0469 -0.4656 -0.0917 102 GLU A C   
798  O O   . GLU A 107 ? 0.8015 0.7668 1.2464 -0.0521 -0.4897 -0.1036 102 GLU A O   
799  C CB  . GLU A 107 ? 0.7608 0.7220 1.1535 -0.0178 -0.4913 -0.0799 102 GLU A CB  
800  C CG  . GLU A 107 ? 0.9516 0.8771 1.2674 -0.0028 -0.5011 -0.0716 102 GLU A CG  
801  C CD  . GLU A 107 ? 1.1577 1.0413 1.4030 -0.0025 -0.5128 -0.0745 102 GLU A CD  
802  O OE1 . GLU A 107 ? 1.0660 0.9380 1.3079 -0.0012 -0.5476 -0.0859 102 GLU A OE1 
803  O OE2 . GLU A 107 ? 0.8798 0.7418 1.0726 -0.0027 -0.4877 -0.0659 102 GLU A OE2 
804  N N   . LYS A 108 ? 0.7121 0.7241 1.2229 -0.0539 -0.4427 -0.0900 103 LYS A N   
805  C CA  . LYS A 108 ? 0.7034 0.7398 1.2847 -0.0689 -0.4426 -0.1019 103 LYS A CA  
806  C C   . LYS A 108 ? 0.7533 0.7778 1.3260 -0.0836 -0.4170 -0.1023 103 LYS A C   
807  O O   . LYS A 108 ? 0.7660 0.7953 1.3759 -0.0967 -0.4253 -0.1149 103 LYS A O   
808  C CB  . LYS A 108 ? 0.7054 0.7820 1.3582 -0.0693 -0.4286 -0.1002 103 LYS A CB  
809  C CG  . LYS A 108 ? 0.9237 1.0299 1.6587 -0.0854 -0.4238 -0.1123 103 LYS A CG  
810  C CD  . LYS A 108 ? 1.0432 1.1884 1.8523 -0.0810 -0.4333 -0.1171 103 LYS A CD  
811  C CE  . LYS A 108 ? 1.0671 1.2433 1.9577 -0.0975 -0.4139 -0.1254 103 LYS A CE  
812  N NZ  . LYS A 108 ? 1.0374 1.2257 1.9401 -0.0991 -0.3707 -0.1133 103 LYS A NZ  
813  N N   . PHE A 109 ? 0.6880 0.6979 1.2155 -0.0816 -0.3855 -0.0892 104 PHE A N   
814  C CA  . PHE A 109 ? 0.6815 0.6805 1.2024 -0.0937 -0.3590 -0.0883 104 PHE A CA  
815  C C   . PHE A 109 ? 0.7531 0.7165 1.1990 -0.0897 -0.3518 -0.0824 104 PHE A C   
816  O O   . PHE A 109 ? 0.7794 0.7221 1.2092 -0.0976 -0.3549 -0.0890 104 PHE A O   
817  C CB  . PHE A 109 ? 0.6656 0.6860 1.2183 -0.0977 -0.3213 -0.0791 104 PHE A CB  
818  C CG  . PHE A 109 ? 0.6693 0.7263 1.3006 -0.1028 -0.3203 -0.0843 104 PHE A CG  
819  C CD1 . PHE A 109 ? 0.7065 0.7765 1.3961 -0.1181 -0.3203 -0.0959 104 PHE A CD1 
820  C CD2 . PHE A 109 ? 0.6722 0.7502 1.3205 -0.0925 -0.3176 -0.0780 104 PHE A CD2 
821  C CE1 . PHE A 109 ? 0.7037 0.8089 1.4695 -0.1230 -0.3173 -0.1013 104 PHE A CE1 
822  C CE2 . PHE A 109 ? 0.6903 0.8023 1.4127 -0.0966 -0.3145 -0.0830 104 PHE A CE2 
823  C CZ  . PHE A 109 ? 0.6766 0.8028 1.4583 -0.1117 -0.3149 -0.0949 104 PHE A CZ  
824  N N   . LEU A 110 ? 0.7015 0.6582 1.1040 -0.0781 -0.3394 -0.0702 105 LEU A N   
825  C CA  . LEU A 110 ? 0.6958 0.6236 1.0317 -0.0737 -0.3248 -0.0630 105 LEU A CA  
826  C C   . LEU A 110 ? 0.7755 0.6695 1.0584 -0.0704 -0.3482 -0.0691 105 LEU A C   
827  O O   . LEU A 110 ? 0.7867 0.6587 1.0433 -0.0757 -0.3411 -0.0716 105 LEU A O   
828  C CB  . LEU A 110 ? 0.6647 0.5974 0.9737 -0.0630 -0.3055 -0.0497 105 LEU A CB  
829  C CG  . LEU A 110 ? 0.6750 0.6378 1.0277 -0.0651 -0.2798 -0.0430 105 LEU A CG  
830  C CD1 . LEU A 110 ? 0.6383 0.6049 0.9641 -0.0538 -0.2680 -0.0324 105 LEU A CD1 
831  C CD2 . LEU A 110 ? 0.7004 0.6627 1.0619 -0.0741 -0.2521 -0.0408 105 LEU A CD2 
832  N N   . ILE A 111 ? 0.7389 0.6258 1.0020 -0.0608 -0.3752 -0.0710 106 ILE A N   
833  C CA  . ILE A 111 ? 0.7675 0.6190 0.9755 -0.0566 -0.3990 -0.0770 106 ILE A CA  
834  C C   . ILE A 111 ? 0.8267 0.6705 1.0552 -0.0677 -0.4203 -0.0923 106 ILE A C   
835  O O   . ILE A 111 ? 0.8442 0.6579 1.0301 -0.0704 -0.4192 -0.0958 106 ILE A O   
836  C CB  . ILE A 111 ? 0.8123 0.6535 0.9882 -0.0426 -0.4217 -0.0744 106 ILE A CB  
837  C CG1 . ILE A 111 ? 0.7956 0.6340 0.9357 -0.0334 -0.3963 -0.0599 106 ILE A CG1 
838  C CG2 . ILE A 111 ? 0.8466 0.6502 0.9697 -0.0388 -0.4511 -0.0829 106 ILE A CG2 
839  C CD1 . ILE A 111 ? 0.8380 0.6684 0.9519 -0.0199 -0.4118 -0.0549 106 ILE A CD1 
840  N N   . PRO A 112 ? 0.7712 0.6412 1.0652 -0.0747 -0.4384 -0.1023 107 PRO A N   
841  C CA  . PRO A 112 ? 0.8130 0.6753 1.1276 -0.0869 -0.4578 -0.1182 107 PRO A CA  
842  C C   . PRO A 112 ? 0.9146 0.7700 1.2379 -0.1010 -0.4307 -0.1196 107 PRO A C   
843  O O   . PRO A 112 ? 0.9650 0.7982 1.2749 -0.1086 -0.4432 -0.1306 107 PRO A O   
844  C CB  . PRO A 112 ? 0.8163 0.7141 1.2066 -0.0909 -0.4798 -0.1280 107 PRO A CB  
845  C CG  . PRO A 112 ? 0.8278 0.7496 1.2351 -0.0804 -0.4716 -0.1170 107 PRO A CG  
846  C CD  . PRO A 112 ? 0.7585 0.6656 1.1113 -0.0719 -0.4425 -0.1007 107 PRO A CD  
847  N N   . ASN A 113 ? 0.8562 0.7276 1.1990 -0.1039 -0.3947 -0.1087 108 ASN A N   
848  C CA  . ASN A 113 ? 0.8694 0.7323 1.2186 -0.1157 -0.3677 -0.1085 108 ASN A CA  
849  C C   . ASN A 113 ? 0.9511 0.7814 1.2292 -0.1087 -0.3499 -0.0998 108 ASN A C   
850  O O   . ASN A 113 ? 0.9580 0.7747 1.2309 -0.1160 -0.3291 -0.0992 108 ASN A O   
851  C CB  . ASN A 113 ? 0.9068 0.8002 1.3086 -0.1212 -0.3375 -0.1009 108 ASN A CB  
852  C CG  . ASN A 113 ? 1.3251 1.2490 1.8062 -0.1329 -0.3461 -0.1113 108 ASN A CG  
853  O OD1 . ASN A 113 ? 1.3064 1.2341 1.8249 -0.1471 -0.3292 -0.1154 108 ASN A OD1 
854  N ND2 . ASN A 113 ? 1.2440 1.1890 1.7535 -0.1274 -0.3726 -0.1163 108 ASN A ND2 
855  N N   . ALA A 114 ? 0.9115 0.7291 1.1361 -0.0942 -0.3555 -0.0927 109 ALA A N   
856  C CA  . ALA A 114 ? 0.9058 0.6958 1.0675 -0.0872 -0.3367 -0.0849 109 ALA A CA  
857  C C   . ALA A 114 ? 0.9931 0.7467 1.1177 -0.0913 -0.3492 -0.0952 109 ALA A C   
858  O O   . ALA A 114 ? 1.0309 0.7652 1.1252 -0.0873 -0.3767 -0.1027 109 ALA A O   
859  C CB  . ALA A 114 ? 0.9074 0.6940 1.0258 -0.0724 -0.3363 -0.0752 109 ALA A CB  
860  N N   . SER A 115 ? 0.9413 0.6838 1.0678 -0.0990 -0.3292 -0.0957 110 SER A N   
861  C CA  . SER A 115 ? 0.9914 0.6988 1.0877 -0.1044 -0.3381 -0.1062 110 SER A CA  
862  C C   . SER A 115 ? 1.0769 0.7530 1.1059 -0.0943 -0.3215 -0.0996 110 SER A C   
863  O O   . SER A 115 ? 1.1367 0.7804 1.1349 -0.0974 -0.3247 -0.1073 110 SER A O   
864  C CB  . SER A 115 ? 1.0273 0.7380 1.1702 -0.1205 -0.3279 -0.1128 110 SER A CB  
865  O OG  . SER A 115 ? 1.1131 0.8273 1.2593 -0.1203 -0.2924 -0.1013 110 SER A OG  
866  N N   . GLN A 116 ? 0.9844 0.6710 0.9936 -0.0827 -0.3029 -0.0862 111 GLN A N   
867  C CA  . GLN A 116 ? 0.9801 0.6456 0.9351 -0.0724 -0.2832 -0.0789 111 GLN A CA  
868  C C   . GLN A 116 ? 0.9943 0.6589 0.9125 -0.0600 -0.2890 -0.0734 111 GLN A C   
869  O O   . GLN A 116 ? 0.9591 0.6503 0.9018 -0.0574 -0.2923 -0.0682 111 GLN A O   
870  C CB  . GLN A 116 ? 0.9612 0.6433 0.9339 -0.0711 -0.2504 -0.0677 111 GLN A CB  
871  C CG  . GLN A 116 ? 1.0314 0.7103 1.0383 -0.0835 -0.2410 -0.0718 111 GLN A CG  
872  C CD  . GLN A 116 ? 1.1040 0.7933 1.1214 -0.0810 -0.2097 -0.0606 111 GLN A CD  
873  O OE1 . GLN A 116 ? 0.9244 0.6253 0.9248 -0.0698 -0.1948 -0.0502 111 GLN A OE1 
874  N NE2 . GLN A 116 ? 1.0504 0.7336 1.0941 -0.0914 -0.1988 -0.0629 111 GLN A NE2 
875  N N   . ALA A 117 ? 0.9635 0.5963 0.8226 -0.0522 -0.2881 -0.0745 112 ALA A N   
876  C CA  . ALA A 117 ? 0.9697 0.5952 0.7872 -0.0409 -0.2907 -0.0696 112 ALA A CA  
877  C C   . ALA A 117 ? 0.9620 0.6176 0.7945 -0.0346 -0.2702 -0.0570 112 ALA A C   
878  O O   . ALA A 117 ? 0.9284 0.5938 0.7598 -0.0302 -0.2791 -0.0536 112 ALA A O   
879  C CB  . ALA A 117 ? 1.0150 0.6025 0.7696 -0.0340 -0.2840 -0.0719 112 ALA A CB  
880  N N   . GLU A 118 ? 0.9056 0.5736 0.7498 -0.0337 -0.2435 -0.0504 113 GLU A N   
881  C CA  . GLU A 118 ? 0.8588 0.5545 0.7155 -0.0278 -0.2228 -0.0395 113 GLU A CA  
882  C C   . GLU A 118 ? 0.8501 0.5780 0.7545 -0.0318 -0.2303 -0.0366 113 GLU A C   
883  O O   . GLU A 118 ? 0.8136 0.5552 0.7152 -0.0262 -0.2280 -0.0309 113 GLU A O   
884  C CB  . GLU A 118 ? 0.8505 0.5528 0.7164 -0.0270 -0.1978 -0.0348 113 GLU A CB  
885  C CG  . GLU A 118 ? 0.9091 0.6403 0.7887 -0.0211 -0.1778 -0.0248 113 GLU A CG  
886  C CD  . GLU A 118 ? 1.1892 0.9312 1.0861 -0.0205 -0.1562 -0.0197 113 GLU A CD  
887  O OE1 . GLU A 118 ? 1.0898 0.8106 0.9666 -0.0185 -0.1486 -0.0216 113 GLU A OE1 
888  O OE2 . GLU A 118 ? 1.1412 0.9113 1.0687 -0.0208 -0.1464 -0.0135 113 GLU A OE2 
889  N N   . SER A 119 ? 0.7842 0.5223 0.7321 -0.0419 -0.2393 -0.0415 114 SER A N   
890  C CA  . SER A 119 ? 0.7623 0.5310 0.7605 -0.0461 -0.2461 -0.0402 114 SER A CA  
891  C C   . SER A 119 ? 0.8305 0.5954 0.8224 -0.0435 -0.2740 -0.0446 114 SER A C   
892  O O   . SER A 119 ? 0.8067 0.5929 0.8184 -0.0402 -0.2759 -0.0398 114 SER A O   
893  C CB  . SER A 119 ? 0.7898 0.5704 0.8380 -0.0579 -0.2438 -0.0443 114 SER A CB  
894  O OG  . SER A 119 ? 1.0226 0.7875 1.0772 -0.0658 -0.2674 -0.0562 114 SER A OG  
895  N N   . LYS A 120 ? 0.8121 0.5472 0.7715 -0.0436 -0.2955 -0.0533 115 LYS A N   
896  C CA  . LYS A 120 ? 0.8445 0.5701 0.7878 -0.0389 -0.3233 -0.0571 115 LYS A CA  
897  C C   . LYS A 120 ? 0.8614 0.5840 0.7687 -0.0277 -0.3139 -0.0476 115 LYS A C   
898  O O   . LYS A 120 ? 0.8610 0.5963 0.7811 -0.0236 -0.3245 -0.0446 115 LYS A O   
899  C CB  . LYS A 120 ? 0.9384 0.6273 0.8429 -0.0400 -0.3457 -0.0681 115 LYS A CB  
900  C CG  . LYS A 120 ? 1.2165 0.9106 1.1626 -0.0507 -0.3702 -0.0806 115 LYS A CG  
901  C CD  . LYS A 120 ? 1.4191 1.0744 1.3225 -0.0517 -0.3936 -0.0927 115 LYS A CD  
902  C CE  . LYS A 120 ? 1.5500 1.1818 1.4302 -0.0567 -0.3770 -0.0961 115 LYS A CE  
903  N NZ  . LYS A 120 ? 1.6563 1.2447 1.4632 -0.0492 -0.3826 -0.0992 115 LYS A NZ  
904  N N   . VAL A 121 ? 0.8016 0.5087 0.6673 -0.0228 -0.2928 -0.0429 116 VAL A N   
905  C CA  . VAL A 121 ? 0.7879 0.4915 0.6199 -0.0137 -0.2799 -0.0347 116 VAL A CA  
906  C C   . VAL A 121 ? 0.7903 0.5303 0.6625 -0.0133 -0.2651 -0.0264 116 VAL A C   
907  O O   . VAL A 121 ? 0.7805 0.5243 0.6476 -0.0083 -0.2694 -0.0222 116 VAL A O   
908  C CB  . VAL A 121 ? 0.8277 0.5120 0.6162 -0.0095 -0.2576 -0.0328 116 VAL A CB  
909  C CG1 . VAL A 121 ? 0.8053 0.4916 0.5684 -0.0018 -0.2409 -0.0248 116 VAL A CG1 
910  C CG2 . VAL A 121 ? 0.8722 0.5159 0.6132 -0.0086 -0.2715 -0.0411 116 VAL A CG2 
911  N N   . PHE A 122 ? 0.7029 0.4669 0.6135 -0.0186 -0.2482 -0.0244 117 PHE A N   
912  C CA  . PHE A 122 ? 0.6663 0.4632 0.6130 -0.0185 -0.2328 -0.0172 117 PHE A CA  
913  C C   . PHE A 122 ? 0.7240 0.5365 0.7040 -0.0193 -0.2511 -0.0179 117 PHE A C   
914  O O   . PHE A 122 ? 0.7200 0.5449 0.7030 -0.0147 -0.2454 -0.0120 117 PHE A O   
915  C CB  . PHE A 122 ? 0.6577 0.4727 0.6387 -0.0243 -0.2155 -0.0161 117 PHE A CB  
916  C CG  . PHE A 122 ? 0.6324 0.4783 0.6437 -0.0234 -0.1970 -0.0087 117 PHE A CG  
917  C CD1 . PHE A 122 ? 0.6386 0.5076 0.6950 -0.0271 -0.2032 -0.0084 117 PHE A CD1 
918  C CD2 . PHE A 122 ? 0.6479 0.5000 0.6434 -0.0186 -0.1738 -0.0030 117 PHE A CD2 
919  C CE1 . PHE A 122 ? 0.6300 0.5250 0.7117 -0.0263 -0.1854 -0.0022 117 PHE A CE1 
920  C CE2 . PHE A 122 ? 0.6444 0.5236 0.6653 -0.0178 -0.1582 0.0027  117 PHE A CE2 
921  C CZ  . PHE A 122 ? 0.6013 0.5003 0.6630 -0.0217 -0.1637 0.0032  117 PHE A CZ  
922  N N   . TYR A 123 ? 0.6800 0.4928 0.6878 -0.0252 -0.2723 -0.0255 118 TYR A N   
923  C CA  . TYR A 123 ? 0.6749 0.5056 0.7218 -0.0257 -0.2908 -0.0274 118 TYR A CA  
924  C C   . TYR A 123 ? 0.7666 0.5796 0.7816 -0.0170 -0.3121 -0.0274 118 TYR A C   
925  O O   . TYR A 123 ? 0.7576 0.5859 0.7938 -0.0128 -0.3178 -0.0241 118 TYR A O   
926  C CB  . TYR A 123 ? 0.6860 0.5253 0.7775 -0.0351 -0.3067 -0.0368 118 TYR A CB  
927  C CG  . TYR A 123 ? 0.6897 0.5479 0.8196 -0.0441 -0.2840 -0.0358 118 TYR A CG  
928  C CD1 . TYR A 123 ? 0.6762 0.5617 0.8363 -0.0439 -0.2620 -0.0281 118 TYR A CD1 
929  C CD2 . TYR A 123 ? 0.7107 0.5581 0.8481 -0.0530 -0.2854 -0.0430 118 TYR A CD2 
930  C CE1 . TYR A 123 ? 0.6720 0.5710 0.8627 -0.0513 -0.2408 -0.0266 118 TYR A CE1 
931  C CE2 . TYR A 123 ? 0.7012 0.5622 0.8719 -0.0611 -0.2638 -0.0414 118 TYR A CE2 
932  C CZ  . TYR A 123 ? 0.7626 0.6483 0.9573 -0.0597 -0.2412 -0.0328 118 TYR A CZ  
933  O OH  . TYR A 123 ? 0.7384 0.6337 0.9610 -0.0669 -0.2197 -0.0308 118 TYR A OH  
934  N N   . LEU A 124 ? 0.7348 0.5130 0.6974 -0.0137 -0.3244 -0.0312 119 LEU A N   
935  C CA  . LEU A 124 ? 0.7495 0.5039 0.6710 -0.0043 -0.3429 -0.0303 119 LEU A CA  
936  C C   . LEU A 124 ? 0.8030 0.5568 0.6989 0.0024  -0.3215 -0.0199 119 LEU A C   
937  O O   . LEU A 124 ? 0.8252 0.5764 0.7155 0.0092  -0.3316 -0.0163 119 LEU A O   
938  C CB  . LEU A 124 ? 0.7919 0.5055 0.6587 -0.0022 -0.3605 -0.0372 119 LEU A CB  
939  C CG  . LEU A 124 ? 0.8537 0.5638 0.7419 -0.0076 -0.3905 -0.0493 119 LEU A CG  
940  C CD1 . LEU A 124 ? 0.8930 0.5642 0.7278 -0.0081 -0.3977 -0.0562 119 LEU A CD1 
941  C CD2 . LEU A 124 ? 0.8698 0.5832 0.7726 -0.0016 -0.4223 -0.0521 119 LEU A CD2 
942  N N   . LYS A 125 ? 0.7321 0.4909 0.6178 0.0005  -0.2918 -0.0154 120 LYS A N   
943  C CA  . LYS A 125 ? 0.7063 0.4702 0.5764 0.0050  -0.2693 -0.0069 120 LYS A CA  
944  C C   . LYS A 125 ? 0.7316 0.5281 0.6507 0.0046  -0.2664 -0.0027 120 LYS A C   
945  O O   . LYS A 125 ? 0.7306 0.5234 0.6378 0.0102  -0.2663 0.0021  120 LYS A O   
946  C CB  . LYS A 125 ? 0.6924 0.4620 0.5535 0.0028  -0.2409 -0.0047 120 LYS A CB  
947  C CG  . LYS A 125 ? 0.6403 0.4213 0.4948 0.0060  -0.2179 0.0025  120 LYS A CG  
948  C CD  . LYS A 125 ? 0.6678 0.4604 0.5223 0.0045  -0.1923 0.0036  120 LYS A CD  
949  C CE  . LYS A 125 ? 0.6338 0.4510 0.5043 0.0052  -0.1716 0.0089  120 LYS A CE  
950  N NZ  . LYS A 125 ? 0.6586 0.5046 0.5791 0.0020  -0.1745 0.0106  120 LYS A NZ  
951  N N   . MET A 126 ? 0.6673 0.4926 0.6395 -0.0020 -0.2637 -0.0047 121 MET A N   
952  C CA  . MET A 126 ? 0.6356 0.4921 0.6577 -0.0030 -0.2597 -0.0018 121 MET A CA  
953  C C   . MET A 126 ? 0.6562 0.5090 0.6870 0.0025  -0.2852 -0.0030 121 MET A C   
954  O O   . MET A 126 ? 0.6386 0.5019 0.6801 0.0069  -0.2803 0.0021  121 MET A O   
955  C CB  . MET A 126 ? 0.6491 0.5287 0.7204 -0.0117 -0.2552 -0.0056 121 MET A CB  
956  C CG  . MET A 126 ? 0.6574 0.5683 0.7736 -0.0137 -0.2399 -0.0017 121 MET A CG  
957  S SD  . MET A 126 ? 0.6771 0.6069 0.8369 -0.0240 -0.2267 -0.0047 121 MET A SD  
958  C CE  . MET A 126 ? 0.5792 0.5410 0.7834 -0.0240 -0.2109 0.0001  121 MET A CE  
959  N N   . LYS A 127 ? 0.6126 0.4488 0.6364 0.0031  -0.3129 -0.0100 122 LYS A N   
960  C CA  . LYS A 127 ? 0.6330 0.4630 0.6610 0.0104  -0.3411 -0.0117 122 LYS A CA  
961  C C   . LYS A 127 ? 0.7465 0.5500 0.7209 0.0206  -0.3391 -0.0044 122 LYS A C   
962  O O   . LYS A 127 ? 0.7430 0.5528 0.7307 0.0271  -0.3451 -0.0006 122 LYS A O   
963  C CB  . LYS A 127 ? 0.6797 0.4946 0.7045 0.0090  -0.3717 -0.0219 122 LYS A CB  
964  C CG  . LYS A 127 ? 0.7875 0.5955 0.8164 0.0177  -0.4055 -0.0251 122 LYS A CG  
965  C CD  . LYS A 127 ? 0.8316 0.6273 0.8605 0.0148  -0.4358 -0.0371 122 LYS A CD  
966  C CE  . LYS A 127 ? 0.7207 0.5112 0.7559 0.0244  -0.4733 -0.0417 122 LYS A CE  
967  N NZ  . LYS A 127 ? 0.7286 0.4992 0.7485 0.0225  -0.5044 -0.0540 122 LYS A NZ  
968  N N   . GLY A 128 ? 0.7455 0.5203 0.6626 0.0216  -0.3278 -0.0024 123 GLY A N   
969  C CA  . GLY A 128 ? 0.7550 0.5023 0.6190 0.0293  -0.3204 0.0044  123 GLY A CA  
970  C C   . GLY A 128 ? 0.7561 0.5258 0.6418 0.0291  -0.2961 0.0117  123 GLY A C   
971  O O   . GLY A 128 ? 0.7394 0.4994 0.6130 0.0361  -0.2991 0.0167  123 GLY A O   
972  N N   . ASP A 129 ? 0.6715 0.4702 0.5891 0.0216  -0.2726 0.0121  124 ASP A N   
973  C CA  . ASP A 129 ? 0.6001 0.4215 0.5393 0.0206  -0.2496 0.0176  124 ASP A CA  
974  C C   . ASP A 129 ? 0.6520 0.4920 0.6333 0.0238  -0.2602 0.0189  124 ASP A C   
975  O O   . ASP A 129 ? 0.6462 0.4843 0.6211 0.0278  -0.2514 0.0241  124 ASP A O   
976  C CB  . ASP A 129 ? 0.5735 0.4224 0.5412 0.0128  -0.2274 0.0166  124 ASP A CB  
977  C CG  . ASP A 129 ? 0.6703 0.5063 0.6012 0.0108  -0.2110 0.0162  124 ASP A CG  
978  O OD1 . ASP A 129 ? 0.7099 0.5192 0.5932 0.0147  -0.2073 0.0180  124 ASP A OD1 
979  O OD2 . ASP A 129 ? 0.6752 0.5264 0.6244 0.0058  -0.2011 0.0140  124 ASP A OD2 
980  N N   . TYR A 130 ? 0.6164 0.4746 0.6427 0.0216  -0.2774 0.0138  125 TYR A N   
981  C CA  . TYR A 130 ? 0.5894 0.4689 0.6624 0.0248  -0.2860 0.0142  125 TYR A CA  
982  C C   . TYR A 130 ? 0.7167 0.5745 0.7696 0.0358  -0.3094 0.0158  125 TYR A C   
983  O O   . TYR A 130 ? 0.7391 0.6053 0.8098 0.0411  -0.3069 0.0197  125 TYR A O   
984  C CB  . TYR A 130 ? 0.5616 0.4720 0.6957 0.0179  -0.2904 0.0082  125 TYR A CB  
985  C CG  . TYR A 130 ? 0.5472 0.4819 0.7045 0.0098  -0.2600 0.0102  125 TYR A CG  
986  C CD1 . TYR A 130 ? 0.5347 0.4934 0.7270 0.0100  -0.2445 0.0133  125 TYR A CD1 
987  C CD2 . TYR A 130 ? 0.5493 0.4792 0.6864 0.0037  -0.2458 0.0095  125 TYR A CD2 
988  C CE1 . TYR A 130 ? 0.5021 0.4799 0.7097 0.0037  -0.2176 0.0152  125 TYR A CE1 
989  C CE2 . TYR A 130 ? 0.5267 0.4762 0.6800 -0.0018 -0.2194 0.0118  125 TYR A CE2 
990  C CZ  . TYR A 130 ? 0.5598 0.5326 0.7465 -0.0017 -0.2057 0.0146  125 TYR A CZ  
991  O OH  . TYR A 130 ? 0.5074 0.4968 0.7044 -0.0061 -0.1807 0.0168  125 TYR A OH  
992  N N   . TYR A 131 ? 0.6895 0.5154 0.6992 0.0402  -0.3308 0.0134  126 TYR A N   
993  C CA  . TYR A 131 ? 0.7263 0.5236 0.7031 0.0525  -0.3522 0.0163  126 TYR A CA  
994  C C   . TYR A 131 ? 0.7943 0.5695 0.7254 0.0562  -0.3302 0.0251  126 TYR A C   
995  O O   . TYR A 131 ? 0.7910 0.5546 0.7142 0.0654  -0.3364 0.0301  126 TYR A O   
996  C CB  . TYR A 131 ? 0.7950 0.5611 0.7333 0.0569  -0.3817 0.0111  126 TYR A CB  
997  C CG  . TYR A 131 ? 0.8169 0.6015 0.8031 0.0581  -0.4133 0.0023  126 TYR A CG  
998  C CD1 . TYR A 131 ? 0.8502 0.6432 0.8648 0.0682  -0.4340 0.0027  126 TYR A CD1 
999  C CD2 . TYR A 131 ? 0.8281 0.6225 0.8340 0.0490  -0.4220 -0.0069 126 TYR A CD2 
1000 C CE1 . TYR A 131 ? 0.8651 0.6783 0.9290 0.0693  -0.4638 -0.0067 126 TYR A CE1 
1001 C CE2 . TYR A 131 ? 0.8488 0.6614 0.9024 0.0487  -0.4509 -0.0164 126 TYR A CE2 
1002 C CZ  . TYR A 131 ? 0.9393 0.7635 1.0245 0.0586  -0.4717 -0.0166 126 TYR A CZ  
1003 O OH  . TYR A 131 ? 0.9408 0.7866 1.0786 0.0578  -0.5001 -0.0273 126 TYR A OH  
1004 N N   . ARG A 132 ? 0.7414 0.5121 0.6460 0.0488  -0.3034 0.0268  127 ARG A N   
1005 C CA  . ARG A 132 ? 0.7529 0.5073 0.6213 0.0499  -0.2792 0.0337  127 ARG A CA  
1006 C C   . ARG A 132 ? 0.7840 0.5657 0.6940 0.0492  -0.2641 0.0371  127 ARG A C   
1007 O O   . ARG A 132 ? 0.8136 0.5779 0.7021 0.0546  -0.2582 0.0427  127 ARG A O   
1008 C CB  . ARG A 132 ? 0.6957 0.4471 0.5385 0.0419  -0.2542 0.0329  127 ARG A CB  
1009 C CG  . ARG A 132 ? 0.7787 0.5208 0.5955 0.0409  -0.2267 0.0384  127 ARG A CG  
1010 C CD  . ARG A 132 ? 0.7668 0.4972 0.5480 0.0358  -0.2064 0.0371  127 ARG A CD  
1011 N NE  . ARG A 132 ? 0.7435 0.5033 0.5558 0.0286  -0.1987 0.0323  127 ARG A NE  
1012 C CZ  . ARG A 132 ? 0.7714 0.5626 0.6146 0.0227  -0.1768 0.0319  127 ARG A CZ  
1013 N NH1 . ARG A 132 ? 0.5960 0.3945 0.4436 0.0217  -0.1594 0.0351  127 ARG A NH1 
1014 N NH2 . ARG A 132 ? 0.6217 0.4343 0.4875 0.0178  -0.1719 0.0282  127 ARG A NH2 
1015 N N   . TYR A 133 ? 0.6858 0.5071 0.6531 0.0429  -0.2579 0.0338  128 TYR A N   
1016 C CA  . TYR A 133 ? 0.6447 0.4905 0.6502 0.0425  -0.2435 0.0363  128 TYR A CA  
1017 C C   . TYR A 133 ? 0.7163 0.5569 0.7373 0.0530  -0.2649 0.0380  128 TYR A C   
1018 O O   . TYR A 133 ? 0.7054 0.5439 0.7279 0.0569  -0.2551 0.0424  128 TYR A O   
1019 C CB  . TYR A 133 ? 0.5896 0.4751 0.6481 0.0339  -0.2313 0.0325  128 TYR A CB  
1020 C CG  . TYR A 133 ? 0.5978 0.4893 0.6434 0.0253  -0.2120 0.0309  128 TYR A CG  
1021 C CD1 . TYR A 133 ? 0.6361 0.5081 0.6350 0.0244  -0.1964 0.0333  128 TYR A CD1 
1022 C CD2 . TYR A 133 ? 0.5729 0.4883 0.6527 0.0187  -0.2090 0.0269  128 TYR A CD2 
1023 C CE1 . TYR A 133 ? 0.6275 0.5059 0.6164 0.0182  -0.1804 0.0313  128 TYR A CE1 
1024 C CE2 . TYR A 133 ? 0.5588 0.4774 0.6248 0.0127  -0.1928 0.0258  128 TYR A CE2 
1025 C CZ  . TYR A 133 ? 0.6388 0.5398 0.6601 0.0131  -0.1796 0.0278  128 TYR A CZ  
1026 O OH  . TYR A 133 ? 0.5988 0.5046 0.6092 0.0087  -0.1646 0.0264  128 TYR A OH  
1027 N N   . LEU A 134 ? 0.7052 0.5422 0.7363 0.0581  -0.2947 0.0341  129 LEU A N   
1028 C CA  . LEU A 134 ? 0.7301 0.5606 0.7739 0.0704  -0.3190 0.0352  129 LEU A CA  
1029 C C   . LEU A 134 ? 0.8428 0.6285 0.8231 0.0804  -0.3227 0.0422  129 LEU A C   
1030 O O   . LEU A 134 ? 0.8536 0.6323 0.8368 0.0892  -0.3244 0.0468  129 LEU A O   
1031 C CB  . LEU A 134 ? 0.7381 0.5742 0.8047 0.0732  -0.3522 0.0278  129 LEU A CB  
1032 C CG  . LEU A 134 ? 0.7437 0.6243 0.8852 0.0660  -0.3536 0.0207  129 LEU A CG  
1033 C CD1 . LEU A 134 ? 0.7461 0.6289 0.9061 0.0677  -0.3873 0.0121  129 LEU A CD1 
1034 C CD2 . LEU A 134 ? 0.7599 0.6670 0.9526 0.0698  -0.3454 0.0225  129 LEU A CD2 
1035 N N   . ALA A 135 ? 0.8338 0.5873 0.7554 0.0789  -0.3209 0.0433  130 ALA A N   
1036 C CA  . ALA A 135 ? 0.8793 0.5859 0.7351 0.0873  -0.3209 0.0502  130 ALA A CA  
1037 C C   . ALA A 135 ? 0.9153 0.6197 0.7639 0.0848  -0.2900 0.0565  130 ALA A C   
1038 O O   . ALA A 135 ? 0.9417 0.6148 0.7575 0.0940  -0.2916 0.0629  130 ALA A O   
1039 C CB  . ALA A 135 ? 0.9163 0.5918 0.7141 0.0843  -0.3197 0.0492  130 ALA A CB  
1040 N N   . GLU A 136 ? 0.8191 0.5549 0.6971 0.0726  -0.2623 0.0544  131 GLU A N   
1041 C CA  . GLU A 136 ? 0.7957 0.5330 0.6715 0.0687  -0.2334 0.0584  131 GLU A CA  
1042 C C   . GLU A 136 ? 0.8504 0.5931 0.7548 0.0769  -0.2387 0.0615  131 GLU A C   
1043 O O   . GLU A 136 ? 0.8582 0.5867 0.7460 0.0771  -0.2207 0.0659  131 GLU A O   
1044 C CB  . GLU A 136 ? 0.7490 0.5227 0.6560 0.0554  -0.2075 0.0543  131 GLU A CB  
1045 C CG  . GLU A 136 ? 0.7869 0.5535 0.6624 0.0478  -0.1954 0.0520  131 GLU A CG  
1046 C CD  . GLU A 136 ? 0.8681 0.6714 0.7755 0.0368  -0.1735 0.0477  131 GLU A CD  
1047 O OE1 . GLU A 136 ? 0.5946 0.4308 0.5517 0.0347  -0.1724 0.0457  131 GLU A OE1 
1048 O OE2 . GLU A 136 ? 0.7831 0.5820 0.6660 0.0311  -0.1582 0.0462  131 GLU A OE2 
1049 N N   . VAL A 137 ? 0.8168 0.5807 0.7664 0.0831  -0.2619 0.0586  132 VAL A N   
1050 C CA  . VAL A 137 ? 0.8161 0.5889 0.8002 0.0923  -0.2685 0.0606  132 VAL A CA  
1051 C C   . VAL A 137 ? 0.9654 0.7181 0.9430 0.1084  -0.3037 0.0620  132 VAL A C   
1052 O O   . VAL A 137 ? 0.9725 0.7389 0.9892 0.1172  -0.3139 0.0621  132 VAL A O   
1053 C CB  . VAL A 137 ? 0.7937 0.6160 0.8490 0.0857  -0.2589 0.0554  132 VAL A CB  
1054 C CG1 . VAL A 137 ? 0.7580 0.5974 0.8164 0.0721  -0.2250 0.0544  132 VAL A CG1 
1055 C CG2 . VAL A 137 ? 0.7644 0.6137 0.8612 0.0838  -0.2791 0.0485  132 VAL A CG2 
1056 N N   . ALA A 138 ? 0.9974 0.7189 0.9276 0.1130  -0.3232 0.0625  133 ALA A N   
1057 C CA  . ALA A 138 ? 1.0542 0.7576 0.9770 0.1287  -0.3608 0.0624  133 ALA A CA  
1058 C C   . ALA A 138 ? 1.2128 0.8780 1.1002 0.1445  -0.3678 0.0709  133 ALA A C   
1059 O O   . ALA A 138 ? 1.2243 0.8546 1.0582 0.1432  -0.3469 0.0778  133 ALA A O   
1060 C CB  . ALA A 138 ? 1.0924 0.7729 0.9732 0.1286  -0.3806 0.0592  133 ALA A CB  
1061 N N   . ALA A 139 ? 1.2292 0.8998 1.1462 0.1600  -0.3980 0.0699  134 ALA A N   
1062 C CA  . ALA A 139 ? 1.3032 0.9349 1.1863 0.1791  -0.4132 0.0777  134 ALA A CA  
1063 C C   . ALA A 139 ? 1.4537 1.0318 1.2551 0.1855  -0.4279 0.0818  134 ALA A C   
1064 O O   . ALA A 139 ? 1.4585 1.0400 1.2534 0.1821  -0.4462 0.0754  134 ALA A O   
1065 C CB  . ALA A 139 ? 1.3209 0.9753 1.2578 0.1942  -0.4479 0.0733  134 ALA A CB  
1066 N N   . GLY A 140 ? 1.4710 0.9981 1.2091 0.1942  -0.4190 0.0919  135 GLY A N   
1067 C CA  . GLY A 140 ? 1.5396 1.0092 1.1929 0.2012  -0.4300 0.0969  135 GLY A CA  
1068 C C   . GLY A 140 ? 1.6281 1.0932 1.2763 0.2128  -0.4749 0.0910  135 GLY A C   
1069 O O   . GLY A 140 ? 1.6567 1.0970 1.2563 0.2098  -0.4823 0.0890  135 GLY A O   
1070 N N   . ASP A 141 ? 1.5731 1.0654 1.2763 0.2251  -0.5047 0.0869  136 ASP A N   
1071 C CA  . ASP A 141 ? 1.5993 1.0911 1.3050 0.2367  -0.5505 0.0798  136 ASP A CA  
1072 C C   . ASP A 141 ? 1.5845 1.1157 1.3302 0.2218  -0.5589 0.0671  136 ASP A C   
1073 O O   . ASP A 141 ? 1.6149 1.1281 1.3312 0.2269  -0.5895 0.0617  136 ASP A O   
1074 C CB  . ASP A 141 ? 1.6465 1.1488 1.3922 0.2574  -0.5819 0.0797  136 ASP A CB  
1075 C CG  . ASP A 141 ? 1.8849 1.3292 1.5659 0.2774  -0.5850 0.0928  136 ASP A CG  
1076 O OD1 . ASP A 141 ? 1.9517 1.3379 1.5446 0.2812  -0.5836 0.0997  136 ASP A OD1 
1077 O OD2 . ASP A 141 ? 1.9861 1.4409 1.7032 0.2898  -0.5886 0.0961  136 ASP A OD2 
1078 N N   . ASP A 142 ? 1.4530 1.0337 1.2601 0.2034  -0.5314 0.0623  137 ASP A N   
1079 C CA  . ASP A 142 ? 1.3922 1.0112 1.2413 0.1882  -0.5352 0.0508  137 ASP A CA  
1080 C C   . ASP A 142 ? 1.3606 0.9638 1.1645 0.1727  -0.5090 0.0514  137 ASP A C   
1081 O O   . ASP A 142 ? 1.3309 0.9500 1.1476 0.1624  -0.5157 0.0427  137 ASP A O   
1082 C CB  . ASP A 142 ? 1.3528 1.0327 1.2930 0.1776  -0.5187 0.0455  137 ASP A CB  
1083 C CG  . ASP A 142 ? 1.5753 1.2798 1.5744 0.1917  -0.5418 0.0432  137 ASP A CG  
1084 O OD1 . ASP A 142 ? 1.6426 1.3275 1.6262 0.2088  -0.5804 0.0416  137 ASP A OD1 
1085 O OD2 . ASP A 142 ? 1.6421 1.3849 1.7024 0.1864  -0.5216 0.0425  137 ASP A OD2 
1086 N N   . LYS A 143 ? 1.2831 0.8570 1.0387 0.1703  -0.4774 0.0612  138 LYS A N   
1087 C CA  . LYS A 143 ? 1.2591 0.8199 0.9749 0.1557  -0.4471 0.0624  138 LYS A CA  
1088 C C   . LYS A 143 ? 1.3206 0.8525 0.9849 0.1549  -0.4631 0.0580  138 LYS A C   
1089 O O   . LYS A 143 ? 1.2875 0.8390 0.9644 0.1406  -0.4496 0.0522  138 LYS A O   
1090 C CB  . LYS A 143 ? 1.2940 0.8234 0.9634 0.1549  -0.4136 0.0730  138 LYS A CB  
1091 C CG  . LYS A 143 ? 1.3008 0.8355 0.9559 0.1372  -0.3766 0.0723  138 LYS A CG  
1092 C CD  . LYS A 143 ? 1.3956 0.9021 1.0115 0.1354  -0.3442 0.0812  138 LYS A CD  
1093 C CE  . LYS A 143 ? 1.3646 0.8751 0.9644 0.1195  -0.3115 0.0794  138 LYS A CE  
1094 N NZ  . LYS A 143 ? 1.4810 0.9537 1.0293 0.1179  -0.2825 0.0870  138 LYS A NZ  
1095 N N   . LYS A 144 ? 1.3179 0.8025 0.9235 0.1706  -0.4917 0.0606  139 LYS A N   
1096 C CA  . LYS A 144 ? 1.3483 0.7998 0.8971 0.1704  -0.5065 0.0562  139 LYS A CA  
1097 C C   . LYS A 144 ? 1.3207 0.8109 0.9192 0.1606  -0.5233 0.0430  139 LYS A C   
1098 O O   . LYS A 144 ? 1.3060 0.7902 0.8816 0.1494  -0.5106 0.0391  139 LYS A O   
1099 C CB  . LYS A 144 ? 1.4654 0.8601 0.9449 0.1909  -0.5400 0.0603  139 LYS A CB  
1100 C CG  . LYS A 144 ? 1.8016 1.1665 1.2309 0.1924  -0.5649 0.0528  139 LYS A CG  
1101 C CD  . LYS A 144 ? 2.0463 1.3548 1.4065 0.2142  -0.6008 0.0564  139 LYS A CD  
1102 C CE  . LYS A 144 ? 2.2020 1.5257 1.5913 0.2235  -0.6522 0.0447  139 LYS A CE  
1103 N NZ  . LYS A 144 ? 2.4031 1.6732 1.7273 0.2473  -0.6880 0.0492  139 LYS A NZ  
1104 N N   . GLY A 145 ? 1.2426 0.7683 0.9054 0.1655  -0.5524 0.0361  140 GLY A N   
1105 C CA  . GLY A 145 ? 1.2029 0.7655 0.9185 0.1561  -0.5704 0.0228  140 GLY A CA  
1106 C C   . GLY A 145 ? 1.1774 0.7783 0.9352 0.1359  -0.5353 0.0201  140 GLY A C   
1107 O O   . GLY A 145 ? 1.1689 0.7773 0.9311 0.1255  -0.5380 0.0116  140 GLY A O   
1108 N N   . ILE A 146 ? 1.0635 0.6885 0.8536 0.1310  -0.5032 0.0269  141 ILE A N   
1109 C CA  . ILE A 146 ? 1.0060 0.6684 0.8375 0.1138  -0.4690 0.0254  141 ILE A CA  
1110 C C   . ILE A 146 ? 1.0921 0.7276 0.8654 0.1055  -0.4439 0.0279  141 ILE A C   
1111 O O   . ILE A 146 ? 1.0773 0.7297 0.8654 0.0934  -0.4344 0.0219  141 ILE A O   
1112 C CB  . ILE A 146 ? 0.9998 0.6907 0.8757 0.1129  -0.4451 0.0315  141 ILE A CB  
1113 C CG1 . ILE A 146 ? 0.9843 0.7125 0.9337 0.1183  -0.4672 0.0263  141 ILE A CG1 
1114 C CG2 . ILE A 146 ? 0.9426 0.6619 0.8429 0.0968  -0.4076 0.0316  141 ILE A CG2 
1115 C CD1 . ILE A 146 ? 1.0946 0.8356 1.0716 0.1242  -0.4522 0.0333  141 ILE A CD1 
1116 N N   . VAL A 147 ? 1.0834 0.6749 0.7894 0.1126  -0.4339 0.0365  142 VAL A N   
1117 C CA  . VAL A 147 ? 1.0908 0.6519 0.7367 0.1065  -0.4105 0.0388  142 VAL A CA  
1118 C C   . VAL A 147 ? 1.1719 0.7154 0.7896 0.1050  -0.4310 0.0305  142 VAL A C   
1119 O O   . VAL A 147 ? 1.1501 0.6992 0.7625 0.0940  -0.4119 0.0271  142 VAL A O   
1120 C CB  . VAL A 147 ? 1.1735 0.6867 0.7528 0.1155  -0.3992 0.0492  142 VAL A CB  
1121 C CG1 . VAL A 147 ? 1.2007 0.6757 0.7116 0.1111  -0.3793 0.0506  142 VAL A CG1 
1122 C CG2 . VAL A 147 ? 1.1324 0.6658 0.7418 0.1127  -0.3717 0.0559  142 VAL A CG2 
1123 N N   . ASP A 148 ? 1.1545 0.6781 0.7567 0.1163  -0.4705 0.0265  143 ASP A N   
1124 C CA  . ASP A 148 ? 1.1826 0.6890 0.7598 0.1153  -0.4942 0.0170  143 ASP A CA  
1125 C C   . ASP A 148 ? 1.1514 0.7029 0.7925 0.1012  -0.4929 0.0068  143 ASP A C   
1126 O O   . ASP A 148 ? 1.1412 0.6813 0.7587 0.0939  -0.4886 0.0012  143 ASP A O   
1127 C CB  . ASP A 148 ? 1.2709 0.7526 0.8274 0.1307  -0.5403 0.0134  143 ASP A CB  
1128 C CG  . ASP A 148 ? 1.6478 1.0686 1.1174 0.1453  -0.5441 0.0226  143 ASP A CG  
1129 O OD1 . ASP A 148 ? 1.6890 1.0840 1.1109 0.1416  -0.5100 0.0305  143 ASP A OD1 
1130 O OD2 . ASP A 148 ? 1.8293 1.2270 1.2778 0.1608  -0.5814 0.0217  143 ASP A OD2 
1131 N N   . GLN A 149 ? 1.0641 0.6640 0.7842 0.0979  -0.4964 0.0044  144 GLN A N   
1132 C CA  . GLN A 149 ? 1.0212 0.6631 0.8040 0.0840  -0.4925 -0.0046 144 GLN A CA  
1133 C C   . GLN A 149 ? 1.0316 0.6828 0.8102 0.0716  -0.4519 -0.0013 144 GLN A C   
1134 O O   . GLN A 149 ? 1.0447 0.7032 0.8322 0.0619  -0.4484 -0.0083 144 GLN A O   
1135 C CB  . GLN A 149 ? 1.0011 0.6912 0.8683 0.0832  -0.5008 -0.0073 144 GLN A CB  
1136 C CG  . GLN A 149 ? 1.1844 0.8782 1.0768 0.0920  -0.5456 -0.0160 144 GLN A CG  
1137 C CD  . GLN A 149 ? 1.4563 1.1538 1.3612 0.0835  -0.5662 -0.0296 144 GLN A CD  
1138 O OE1 . GLN A 149 ? 1.3250 1.0568 1.2840 0.0695  -0.5541 -0.0357 144 GLN A OE1 
1139 N NE2 . GLN A 149 ? 1.4235 1.0831 1.2762 0.0917  -0.5978 -0.0348 144 GLN A NE2 
1140 N N   . SER A 150 ? 0.9379 0.5884 0.7039 0.0722  -0.4222 0.0085  145 SER A N   
1141 C CA  . SER A 150 ? 0.8889 0.5494 0.6514 0.0618  -0.3850 0.0112  145 SER A CA  
1142 C C   . SER A 150 ? 0.9874 0.6102 0.6856 0.0607  -0.3801 0.0093  145 SER A C   
1143 O O   . SER A 150 ? 0.9766 0.6097 0.6832 0.0518  -0.3685 0.0046  145 SER A O   
1144 C CB  . SER A 150 ? 0.8913 0.5537 0.6476 0.0636  -0.3581 0.0209  145 SER A CB  
1145 O OG  . SER A 150 ? 0.9236 0.6007 0.6832 0.0540  -0.3241 0.0224  145 SER A OG  
1146 N N   . GLN A 151 ? 1.0059 0.5827 0.6384 0.0704  -0.3889 0.0130  146 GLN A N   
1147 C CA  . GLN A 151 ? 1.0372 0.5730 0.6023 0.0706  -0.3830 0.0116  146 GLN A CA  
1148 C C   . GLN A 151 ? 1.0909 0.6229 0.6570 0.0670  -0.4049 0.0006  146 GLN A C   
1149 O O   . GLN A 151 ? 1.0601 0.5840 0.6058 0.0607  -0.3885 -0.0025 146 GLN A O   
1150 C CB  . GLN A 151 ? 1.1143 0.5982 0.6080 0.0828  -0.3916 0.0176  146 GLN A CB  
1151 C CG  . GLN A 151 ? 1.2736 0.7116 0.6927 0.0831  -0.3788 0.0172  146 GLN A CG  
1152 C CD  . GLN A 151 ? 1.5428 0.9288 0.8891 0.0935  -0.3750 0.0255  146 GLN A CD  
1153 O OE1 . GLN A 151 ? 1.5098 0.8873 0.8537 0.1024  -0.3869 0.0317  146 GLN A OE1 
1154 N NE2 . GLN A 151 ? 1.4920 0.8399 0.7760 0.0927  -0.3561 0.0260  146 GLN A NE2 
1155 N N   . GLN A 152 ? 1.0889 0.6269 0.6797 0.0709  -0.4417 -0.0060 147 GLN A N   
1156 C CA  . GLN A 152 ? 1.1136 0.6477 0.7076 0.0664  -0.4645 -0.0180 147 GLN A CA  
1157 C C   . GLN A 152 ? 1.1218 0.6948 0.7713 0.0523  -0.4462 -0.0228 147 GLN A C   
1158 O O   . GLN A 152 ? 1.1539 0.7143 0.7864 0.0466  -0.4466 -0.0301 147 GLN A O   
1159 C CB  . GLN A 152 ? 1.1558 0.6930 0.7725 0.0729  -0.5084 -0.0253 147 GLN A CB  
1160 C CG  . GLN A 152 ? 1.4325 0.9204 0.9804 0.0882  -0.5343 -0.0231 147 GLN A CG  
1161 C CD  . GLN A 152 ? 1.7522 1.2527 1.3348 0.0971  -0.5755 -0.0281 147 GLN A CD  
1162 O OE1 . GLN A 152 ? 1.7043 1.2316 1.3383 0.0913  -0.5987 -0.0399 147 GLN A OE1 
1163 N NE2 . GLN A 152 ? 1.6694 1.1503 1.2256 0.1116  -0.5855 -0.0197 147 GLN A NE2 
1164 N N   . ALA A 153 ? 1.0073 0.6248 0.7207 0.0473  -0.4303 -0.0189 148 ALA A N   
1165 C CA  . ALA A 153 ? 0.9432 0.5949 0.7063 0.0349  -0.4122 -0.0225 148 ALA A CA  
1166 C C   . ALA A 153 ? 0.9394 0.5779 0.6648 0.0314  -0.3793 -0.0186 148 ALA A C   
1167 O O   . ALA A 153 ? 0.9230 0.5584 0.6461 0.0249  -0.3749 -0.0246 148 ALA A O   
1168 C CB  . ALA A 153 ? 0.9040 0.6024 0.7378 0.0312  -0.4014 -0.0189 148 ALA A CB  
1169 N N   . TYR A 154 ? 0.8675 0.4956 0.5617 0.0362  -0.3574 -0.0094 149 TYR A N   
1170 C CA  . TYR A 154 ? 0.8570 0.4736 0.5170 0.0337  -0.3265 -0.0065 149 TYR A CA  
1171 C C   . TYR A 154 ? 0.9618 0.5356 0.5610 0.0358  -0.3334 -0.0118 149 TYR A C   
1172 O O   . TYR A 154 ? 0.9463 0.5199 0.5393 0.0311  -0.3165 -0.0146 149 TYR A O   
1173 C CB  . TYR A 154 ? 0.8690 0.4782 0.5044 0.0384  -0.3050 0.0029  149 TYR A CB  
1174 C CG  . TYR A 154 ? 0.8405 0.4904 0.5273 0.0349  -0.2858 0.0084  149 TYR A CG  
1175 C CD1 . TYR A 154 ? 0.8227 0.5066 0.5497 0.0272  -0.2655 0.0074  149 TYR A CD1 
1176 C CD2 . TYR A 154 ? 0.8406 0.4895 0.5268 0.0401  -0.2845 0.0151  149 TYR A CD2 
1177 C CE1 . TYR A 154 ? 0.8024 0.5205 0.5706 0.0245  -0.2476 0.0120  149 TYR A CE1 
1178 C CE2 . TYR A 154 ? 0.8034 0.4864 0.5322 0.0368  -0.2658 0.0194  149 TYR A CE2 
1179 C CZ  . TYR A 154 ? 0.8610 0.5787 0.6300 0.0289  -0.2475 0.0176  149 TYR A CZ  
1180 O OH  . TYR A 154 ? 0.7632 0.5126 0.5712 0.0262  -0.2306 0.0212  149 TYR A OH  
1181 N N   . GLN A 155 ? 0.9820 0.5186 0.5358 0.0438  -0.3589 -0.0134 150 GLN A N   
1182 C CA  . GLN A 155 ? 1.0480 0.5390 0.5376 0.0467  -0.3670 -0.0189 150 GLN A CA  
1183 C C   . GLN A 155 ? 1.1054 0.6028 0.6158 0.0394  -0.3802 -0.0299 150 GLN A C   
1184 O O   . GLN A 155 ? 1.1072 0.5852 0.5861 0.0370  -0.3667 -0.0336 150 GLN A O   
1185 C CB  . GLN A 155 ? 1.1256 0.5755 0.5633 0.0576  -0.3949 -0.0183 150 GLN A CB  
1186 C CG  . GLN A 155 ? 1.2146 0.6097 0.5719 0.0619  -0.3967 -0.0222 150 GLN A CG  
1187 C CD  . GLN A 155 ? 1.3498 0.7277 0.6668 0.0614  -0.3571 -0.0160 150 GLN A CD  
1188 O OE1 . GLN A 155 ? 1.2505 0.6333 0.5658 0.0633  -0.3355 -0.0066 150 GLN A OE1 
1189 N NE2 . GLN A 155 ? 1.2476 0.6063 0.5347 0.0584  -0.3460 -0.0220 150 GLN A NE2 
1190 N N   . GLU A 156 ? 1.0626 0.5887 0.6299 0.0355  -0.4039 -0.0354 151 GLU A N   
1191 C CA  . GLU A 156 ? 1.0792 0.6124 0.6716 0.0268  -0.4149 -0.0464 151 GLU A CA  
1192 C C   . GLU A 156 ? 1.1066 0.6628 0.7256 0.0184  -0.3820 -0.0447 151 GLU A C   
1193 O O   . GLU A 156 ? 1.1255 0.6647 0.7247 0.0145  -0.3774 -0.0510 151 GLU A O   
1194 C CB  . GLU A 156 ? 1.0882 0.6498 0.7415 0.0230  -0.4446 -0.0534 151 GLU A CB  
1195 C CG  . GLU A 156 ? 1.2146 0.7762 0.8864 0.0131  -0.4561 -0.0660 151 GLU A CG  
1196 C CD  . GLU A 156 ? 1.3061 0.8926 1.0379 0.0071  -0.4862 -0.0764 151 GLU A CD  
1197 O OE1 . GLU A 156 ? 1.1021 0.7135 0.8730 0.0107  -0.4987 -0.0737 151 GLU A OE1 
1198 O OE2 . GLU A 156 ? 1.3312 0.9124 1.0728 -0.0016 -0.4963 -0.0878 151 GLU A OE2 
1199 N N   . ALA A 157 ? 1.0160 0.6080 0.6758 0.0167  -0.3590 -0.0362 152 ALA A N   
1200 C CA  . ALA A 157 ? 0.9707 0.5845 0.6534 0.0107  -0.3281 -0.0336 152 ALA A CA  
1201 C C   . ALA A 157 ? 1.0565 0.6399 0.6803 0.0146  -0.3068 -0.0322 152 ALA A C   
1202 O O   . ALA A 157 ? 1.0541 0.6373 0.6780 0.0110  -0.2920 -0.0351 152 ALA A O   
1203 C CB  . ALA A 157 ? 0.9235 0.5752 0.6483 0.0103  -0.3085 -0.0246 152 ALA A CB  
1204 N N   . PHE A 158 ? 1.0323 0.5905 0.6077 0.0221  -0.3030 -0.0273 153 PHE A N   
1205 C CA  . PHE A 158 ? 1.0558 0.5846 0.5753 0.0262  -0.2813 -0.0257 153 PHE A CA  
1206 C C   . PHE A 158 ? 1.1396 0.6322 0.6175 0.0262  -0.2907 -0.0347 153 PHE A C   
1207 O O   . PHE A 158 ? 1.1497 0.6365 0.6133 0.0256  -0.2689 -0.0361 153 PHE A O   
1208 C CB  . PHE A 158 ? 1.1079 0.6131 0.5849 0.0335  -0.2796 -0.0192 153 PHE A CB  
1209 C CG  . PHE A 158 ? 1.1475 0.6309 0.5781 0.0365  -0.2499 -0.0161 153 PHE A CG  
1210 C CD1 . PHE A 158 ? 1.2549 0.6889 0.6174 0.0414  -0.2524 -0.0194 153 PHE A CD1 
1211 C CD2 . PHE A 158 ? 1.1235 0.6364 0.5800 0.0342  -0.2186 -0.0110 153 PHE A CD2 
1212 C CE1 . PHE A 158 ? 1.2880 0.7027 0.6107 0.0437  -0.2221 -0.0173 153 PHE A CE1 
1213 C CE2 . PHE A 158 ? 1.1777 0.6735 0.5970 0.0365  -0.1906 -0.0095 153 PHE A CE2 
1214 C CZ  . PHE A 158 ? 1.2256 0.6729 0.5794 0.0410  -0.1914 -0.0125 153 PHE A CZ  
1215 N N   . GLU A 159 ? 1.1281 0.5976 0.5889 0.0272  -0.3235 -0.0415 154 GLU A N   
1216 C CA  . GLU A 159 ? 1.1767 0.6092 0.5965 0.0269  -0.3365 -0.0517 154 GLU A CA  
1217 C C   . GLU A 159 ? 1.2095 0.6613 0.6679 0.0185  -0.3294 -0.0575 154 GLU A C   
1218 O O   . GLU A 159 ? 1.2384 0.6673 0.6650 0.0186  -0.3164 -0.0617 154 GLU A O   
1219 C CB  . GLU A 159 ? 1.2411 0.6512 0.6444 0.0291  -0.3775 -0.0590 154 GLU A CB  
1220 C CG  . GLU A 159 ? 1.4518 0.8375 0.8129 0.0391  -0.3898 -0.0532 154 GLU A CG  
1221 C CD  . GLU A 159 ? 1.7726 1.1103 1.0532 0.0472  -0.3741 -0.0493 154 GLU A CD  
1222 O OE1 . GLU A 159 ? 1.5137 0.8417 0.7727 0.0456  -0.3454 -0.0492 154 GLU A OE1 
1223 O OE2 . GLU A 159 ? 1.8040 1.1132 1.0432 0.0556  -0.3898 -0.0459 154 GLU A OE2 
1224 N N   . ILE A 160 ? 1.1020 0.5943 0.6279 0.0115  -0.3358 -0.0576 155 ILE A N   
1225 C CA  . ILE A 160 ? 1.0647 0.5731 0.6275 0.0032  -0.3283 -0.0625 155 ILE A CA  
1226 C C   . ILE A 160 ? 1.0820 0.6009 0.6442 0.0047  -0.2919 -0.0562 155 ILE A C   
1227 O O   . ILE A 160 ? 1.0595 0.5657 0.6118 0.0028  -0.2821 -0.0609 155 ILE A O   
1228 C CB  . ILE A 160 ? 1.0595 0.6075 0.6944 -0.0048 -0.3411 -0.0637 155 ILE A CB  
1229 C CG1 . ILE A 160 ? 1.0898 0.6296 0.7306 -0.0060 -0.3801 -0.0721 155 ILE A CG1 
1230 C CG2 . ILE A 160 ? 1.0264 0.5874 0.6963 -0.0137 -0.3290 -0.0677 155 ILE A CG2 
1231 C CD1 . ILE A 160 ? 1.0539 0.6354 0.7684 -0.0126 -0.3916 -0.0727 155 ILE A CD1 
1232 N N   . SER A 161 ? 1.0083 0.5512 0.5832 0.0085  -0.2721 -0.0460 156 SER A N   
1233 C CA  . SER A 161 ? 0.9704 0.5266 0.5481 0.0106  -0.2394 -0.0409 156 SER A CA  
1234 C C   . SER A 161 ? 1.0728 0.5927 0.5914 0.0166  -0.2262 -0.0435 156 SER A C   
1235 O O   . SER A 161 ? 1.0745 0.5956 0.5926 0.0177  -0.2068 -0.0443 156 SER A O   
1236 C CB  . SER A 161 ? 0.9483 0.5365 0.5502 0.0129  -0.2224 -0.0312 156 SER A CB  
1237 O OG  . SER A 161 ? 1.0733 0.6420 0.6344 0.0186  -0.2201 -0.0278 156 SER A OG  
1238 N N   . LYS A 162 ? 1.0949 0.5812 0.5627 0.0212  -0.2357 -0.0445 157 LYS A N   
1239 C CA  . LYS A 162 ? 1.1482 0.5961 0.5556 0.0270  -0.2218 -0.0472 157 LYS A CA  
1240 C C   . LYS A 162 ? 1.2264 0.6479 0.6154 0.0250  -0.2298 -0.0573 157 LYS A C   
1241 O O   . LYS A 162 ? 1.2328 0.6372 0.5942 0.0288  -0.2097 -0.0594 157 LYS A O   
1242 C CB  . LYS A 162 ? 1.2191 0.6321 0.5726 0.0321  -0.2320 -0.0461 157 LYS A CB  
1243 C CG  . LYS A 162 ? 1.5059 0.8955 0.8112 0.0383  -0.2035 -0.0434 157 LYS A CG  
1244 C CD  . LYS A 162 ? 1.7089 1.0722 0.9707 0.0429  -0.2071 -0.0386 157 LYS A CD  
1245 C CE  . LYS A 162 ? 1.8731 1.2228 1.1007 0.0471  -0.1731 -0.0347 157 LYS A CE  
1246 N NZ  . LYS A 162 ? 1.9265 1.3222 1.2037 0.0448  -0.1491 -0.0278 157 LYS A NZ  
1247 N N   . LYS A 163 ? 1.1815 0.6004 0.5878 0.0190  -0.2586 -0.0640 158 LYS A N   
1248 C CA  . LYS A 163 ? 1.1963 0.5888 0.5866 0.0156  -0.2685 -0.0747 158 LYS A CA  
1249 C C   . LYS A 163 ? 1.1721 0.5884 0.6058 0.0109  -0.2527 -0.0749 158 LYS A C   
1250 O O   . LYS A 163 ? 1.2090 0.6021 0.6184 0.0124  -0.2420 -0.0800 158 LYS A O   
1251 C CB  . LYS A 163 ? 1.2512 0.6312 0.6441 0.0103  -0.3072 -0.0834 158 LYS A CB  
1252 C CG  . LYS A 163 ? 1.3055 0.6470 0.6659 0.0072  -0.3221 -0.0966 158 LYS A CG  
1253 N N   . GLU A 164 ? 1.0472 0.5072 0.5413 0.0064  -0.2491 -0.0688 159 GLU A N   
1254 C CA  . GLU A 164 ? 1.0016 0.4819 0.5379 0.0014  -0.2378 -0.0688 159 GLU A CA  
1255 C C   . GLU A 164 ? 1.0249 0.5306 0.5793 0.0065  -0.2068 -0.0601 159 GLU A C   
1256 O O   . GLU A 164 ? 0.9964 0.5080 0.5708 0.0050  -0.1954 -0.0604 159 GLU A O   
1257 C CB  . GLU A 164 ? 0.9860 0.4933 0.5790 -0.0086 -0.2568 -0.0702 159 GLU A CB  
1258 C CG  . GLU A 164 ? 1.1306 0.6184 0.7152 -0.0140 -0.2911 -0.0803 159 GLU A CG  
1259 C CD  . GLU A 164 ? 1.3028 0.7525 0.8583 -0.0181 -0.3037 -0.0929 159 GLU A CD  
1260 O OE1 . GLU A 164 ? 1.2364 0.6740 0.7822 -0.0177 -0.2848 -0.0941 159 GLU A OE1 
1261 O OE2 . GLU A 164 ? 1.2683 0.6994 0.8099 -0.0211 -0.3335 -0.1021 159 GLU A OE2 
1262 N N   . MET A 165 ? 0.9678 0.4890 0.5170 0.0126  -0.1937 -0.0525 160 MET A N   
1263 C CA  . MET A 165 ? 0.9178 0.4690 0.4902 0.0172  -0.1673 -0.0448 160 MET A CA  
1264 C C   . MET A 165 ? 0.9760 0.5143 0.5102 0.0264  -0.1457 -0.0438 160 MET A C   
1265 O O   . MET A 165 ? 1.0011 0.5144 0.4938 0.0291  -0.1487 -0.0456 160 MET A O   
1266 C CB  . MET A 165 ? 0.9037 0.4922 0.5144 0.0150  -0.1682 -0.0373 160 MET A CB  
1267 C CG  . MET A 165 ? 0.9217 0.5308 0.5798 0.0064  -0.1836 -0.0374 160 MET A CG  
1268 S SD  . MET A 165 ? 0.9276 0.5746 0.6242 0.0049  -0.1855 -0.0297 160 MET A SD  
1269 C CE  . MET A 165 ? 0.8754 0.5434 0.6259 -0.0044 -0.1960 -0.0309 160 MET A CE  
1270 N N   . GLN A 166 ? 0.9131 0.4703 0.4630 0.0318  -0.1231 -0.0405 161 GLN A N   
1271 C CA  . GLN A 166 ? 0.9345 0.4884 0.4595 0.0406  -0.1003 -0.0397 161 GLN A CA  
1272 C C   . GLN A 166 ? 0.9777 0.5560 0.5130 0.0408  -0.0934 -0.0337 161 GLN A C   
1273 O O   . GLN A 166 ? 0.9485 0.5546 0.5201 0.0358  -0.1016 -0.0290 161 GLN A O   
1274 C CB  . GLN A 166 ? 0.9360 0.5038 0.4777 0.0474  -0.0810 -0.0388 161 GLN A CB  
1275 C CG  . GLN A 166 ? 1.0815 0.6122 0.5938 0.0498  -0.0824 -0.0459 161 GLN A CG  
1276 C CD  . GLN A 166 ? 1.5726 1.1106 1.0971 0.0578  -0.0655 -0.0451 161 GLN A CD  
1277 O OE1 . GLN A 166 ? 1.5799 1.1473 1.1429 0.0583  -0.0617 -0.0397 161 GLN A OE1 
1278 N NE2 . GLN A 166 ? 1.5884 1.0956 1.0776 0.0647  -0.0560 -0.0509 161 GLN A NE2 
1279 N N   . PRO A 167 ? 0.9491 0.5137 0.4507 0.0458  -0.0782 -0.0344 162 PRO A N   
1280 C CA  . PRO A 167 ? 0.9042 0.4872 0.4124 0.0451  -0.0699 -0.0294 162 PRO A CA  
1281 C C   . PRO A 167 ? 0.8723 0.5034 0.4307 0.0452  -0.0580 -0.0243 162 PRO A C   
1282 O O   . PRO A 167 ? 0.8355 0.4848 0.4081 0.0423  -0.0565 -0.0203 162 PRO A O   
1283 C CB  . PRO A 167 ? 0.9608 0.5201 0.4268 0.0508  -0.0494 -0.0324 162 PRO A CB  
1284 C CG  . PRO A 167 ? 1.0882 0.6060 0.5139 0.0530  -0.0566 -0.0389 162 PRO A CG  
1285 C CD  . PRO A 167 ? 1.0118 0.5420 0.4679 0.0521  -0.0657 -0.0401 162 PRO A CD  
1286 N N   . THR A 168 ? 0.8054 0.4549 0.3886 0.0491  -0.0502 -0.0246 163 THR A N   
1287 C CA  . THR A 168 ? 0.7477 0.4408 0.3753 0.0507  -0.0403 -0.0204 163 THR A CA  
1288 C C   . THR A 168 ? 0.7897 0.5006 0.4528 0.0447  -0.0557 -0.0166 163 THR A C   
1289 O O   . THR A 168 ? 0.7601 0.5053 0.4583 0.0455  -0.0492 -0.0127 163 THR A O   
1290 C CB  . THR A 168 ? 0.8075 0.5077 0.4391 0.0600  -0.0242 -0.0226 163 THR A CB  
1291 O OG1 . THR A 168 ? 0.8078 0.4821 0.4263 0.0608  -0.0332 -0.0251 163 THR A OG1 
1292 C CG2 . THR A 168 ? 0.8499 0.5436 0.4583 0.0665  -0.0039 -0.0266 163 THR A CG2 
1293 N N   . HIS A 169 ? 0.7768 0.4651 0.4321 0.0388  -0.0756 -0.0183 164 HIS A N   
1294 C CA  . HIS A 169 ? 0.7609 0.4661 0.4530 0.0323  -0.0886 -0.0155 164 HIS A CA  
1295 C C   . HIS A 169 ? 0.7515 0.4862 0.4713 0.0287  -0.0897 -0.0105 164 HIS A C   
1296 O O   . HIS A 169 ? 0.7514 0.4772 0.4558 0.0267  -0.0961 -0.0104 164 HIS A O   
1297 C CB  . HIS A 169 ? 0.8084 0.4862 0.4905 0.0257  -0.1107 -0.0199 164 HIS A CB  
1298 C CG  . HIS A 169 ? 0.8353 0.5295 0.5582 0.0187  -0.1207 -0.0183 164 HIS A CG  
1299 N ND1 . HIS A 169 ? 0.8738 0.5522 0.6001 0.0153  -0.1265 -0.0222 164 HIS A ND1 
1300 C CD2 . HIS A 169 ? 0.8175 0.5410 0.5785 0.0142  -0.1239 -0.0138 164 HIS A CD2 
1301 C CE1 . HIS A 169 ? 0.8420 0.5411 0.6092 0.0086  -0.1318 -0.0196 164 HIS A CE1 
1302 N NE2 . HIS A 169 ? 0.8155 0.5422 0.6044 0.0081  -0.1305 -0.0145 164 HIS A NE2 
1303 N N   . PRO A 170 ? 0.6658 0.4329 0.4239 0.0282  -0.0835 -0.0062 165 PRO A N   
1304 C CA  . PRO A 170 ? 0.6189 0.4125 0.4023 0.0249  -0.0837 -0.0021 165 PRO A CA  
1305 C C   . PRO A 170 ? 0.6742 0.4609 0.4631 0.0181  -0.1028 -0.0018 165 PRO A C   
1306 O O   . PRO A 170 ? 0.6552 0.4512 0.4474 0.0171  -0.1027 0.0006  165 PRO A O   
1307 C CB  . PRO A 170 ? 0.6100 0.4323 0.4299 0.0252  -0.0767 0.0016  165 PRO A CB  
1308 C CG  . PRO A 170 ? 0.6868 0.5004 0.4977 0.0309  -0.0688 0.0003  165 PRO A CG  
1309 C CD  . PRO A 170 ? 0.6678 0.4454 0.4443 0.0313  -0.0757 -0.0048 165 PRO A CD  
1310 N N   . ILE A 171 ? 0.6700 0.4406 0.4617 0.0136  -0.1196 -0.0046 166 ILE A N   
1311 C CA  . ILE A 171 ? 0.6858 0.4517 0.4859 0.0082  -0.1403 -0.0054 166 ILE A CA  
1312 C C   . ILE A 171 ? 0.7503 0.4876 0.5071 0.0110  -0.1481 -0.0075 166 ILE A C   
1313 O O   . ILE A 171 ? 0.7580 0.4969 0.5152 0.0106  -0.1561 -0.0053 166 ILE A O   
1314 C CB  . ILE A 171 ? 0.7465 0.5077 0.5688 0.0017  -0.1565 -0.0091 166 ILE A CB  
1315 C CG1 . ILE A 171 ? 0.7399 0.5296 0.6051 -0.0012 -0.1457 -0.0054 166 ILE A CG1 
1316 C CG2 . ILE A 171 ? 0.7454 0.5016 0.5760 -0.0024 -0.1805 -0.0113 166 ILE A CG2 
1317 C CD1 . ILE A 171 ? 0.9749 0.7598 0.8638 -0.0086 -0.1560 -0.0091 166 ILE A CD1 
1318 N N   . ARG A 172 ? 0.7258 0.4360 0.4434 0.0148  -0.1431 -0.0113 167 ARG A N   
1319 C CA  . ARG A 172 ? 0.7686 0.4467 0.4379 0.0181  -0.1470 -0.0132 167 ARG A CA  
1320 C C   . ARG A 172 ? 0.8070 0.4962 0.4698 0.0210  -0.1300 -0.0085 167 ARG A C   
1321 O O   . ARG A 172 ? 0.8278 0.5026 0.4703 0.0214  -0.1370 -0.0068 167 ARG A O   
1322 C CB  . ARG A 172 ? 0.8211 0.4682 0.4506 0.0217  -0.1413 -0.0186 167 ARG A CB  
1323 C CG  . ARG A 172 ? 0.8497 0.4609 0.4250 0.0254  -0.1422 -0.0205 167 ARG A CG  
1324 C CD  . ARG A 172 ? 0.9344 0.5097 0.4687 0.0283  -0.1416 -0.0272 167 ARG A CD  
1325 N NE  . ARG A 172 ? 0.9650 0.5064 0.4445 0.0329  -0.1346 -0.0282 167 ARG A NE  
1326 C CZ  . ARG A 172 ? 1.1169 0.6207 0.5501 0.0364  -0.1321 -0.0340 167 ARG A CZ  
1327 N NH1 . ARG A 172 ? 1.0198 0.5148 0.4552 0.0357  -0.1373 -0.0397 167 ARG A NH1 
1328 N NH2 . ARG A 172 ? 1.0370 0.5096 0.4200 0.0405  -0.1231 -0.0343 167 ARG A NH2 
1329 N N   . LEU A 173 ? 0.7339 0.4486 0.4151 0.0230  -0.1084 -0.0065 168 LEU A N   
1330 C CA  . LEU A 173 ? 0.7032 0.4325 0.3846 0.0244  -0.0910 -0.0034 168 LEU A CA  
1331 C C   . LEU A 173 ? 0.7003 0.4490 0.4089 0.0206  -0.0981 0.0011  168 LEU A C   
1332 O O   . LEU A 173 ? 0.7022 0.4426 0.3941 0.0206  -0.0941 0.0031  168 LEU A O   
1333 C CB  . LEU A 173 ? 0.6813 0.4377 0.3823 0.0277  -0.0694 -0.0038 168 LEU A CB  
1334 C CG  . LEU A 173 ? 0.7563 0.4949 0.4278 0.0334  -0.0558 -0.0082 168 LEU A CG  
1335 C CD1 . LEU A 173 ? 0.7111 0.4792 0.4095 0.0380  -0.0407 -0.0086 168 LEU A CD1 
1336 C CD2 . LEU A 173 ? 0.7876 0.5066 0.4234 0.0347  -0.0429 -0.0094 168 LEU A CD2 
1337 N N   . GLY A 174 ? 0.6518 0.4238 0.4008 0.0174  -0.1071 0.0025  169 GLY A N   
1338 C CA  . GLY A 174 ? 0.6226 0.4145 0.4016 0.0142  -0.1134 0.0064  169 GLY A CA  
1339 C C   . GLY A 174 ? 0.7227 0.4913 0.4845 0.0138  -0.1336 0.0068  169 GLY A C   
1340 O O   . GLY A 174 ? 0.7172 0.4898 0.4825 0.0138  -0.1339 0.0102  169 GLY A O   
1341 N N   . LEU A 175 ? 0.7194 0.4617 0.4601 0.0141  -0.1509 0.0030  170 LEU A N   
1342 C CA  . LEU A 175 ? 0.7578 0.4737 0.4753 0.0155  -0.1729 0.0024  170 LEU A CA  
1343 C C   . LEU A 175 ? 0.8294 0.5185 0.4990 0.0198  -0.1632 0.0047  170 LEU A C   
1344 O O   . LEU A 175 ? 0.8462 0.5263 0.5072 0.0216  -0.1715 0.0081  170 LEU A O   
1345 C CB  . LEU A 175 ? 0.7804 0.4728 0.4826 0.0148  -0.1928 -0.0038 170 LEU A CB  
1346 C CG  . LEU A 175 ? 0.8738 0.5309 0.5388 0.0180  -0.2173 -0.0061 170 LEU A CG  
1347 C CD1 . LEU A 175 ? 0.8570 0.5261 0.5491 0.0185  -0.2365 -0.0035 170 LEU A CD1 
1348 C CD2 . LEU A 175 ? 0.9420 0.5782 0.5927 0.0163  -0.2332 -0.0138 170 LEU A CD2 
1349 N N   . ALA A 176 ? 0.7916 0.4664 0.4298 0.0217  -0.1451 0.0028  171 ALA A N   
1350 C CA  . ALA A 176 ? 0.8117 0.4603 0.4053 0.0247  -0.1322 0.0048  171 ALA A CA  
1351 C C   . ALA A 176 ? 0.8061 0.4768 0.4205 0.0231  -0.1175 0.0099  171 ALA A C   
1352 O O   . ALA A 176 ? 0.8224 0.4716 0.4095 0.0247  -0.1170 0.0132  171 ALA A O   
1353 C CB  . ALA A 176 ? 0.8370 0.4740 0.4039 0.0266  -0.1114 0.0012  171 ALA A CB  
1354 N N   . LEU A 177 ? 0.7217 0.4338 0.3834 0.0200  -0.1058 0.0103  172 LEU A N   
1355 C CA  . LEU A 177 ? 0.6831 0.4173 0.3661 0.0177  -0.0919 0.0137  172 LEU A CA  
1356 C C   . LEU A 177 ? 0.7313 0.4622 0.4235 0.0177  -0.1090 0.0178  172 LEU A C   
1357 O O   . LEU A 177 ? 0.7584 0.4766 0.4336 0.0182  -0.1026 0.0211  172 LEU A O   
1358 C CB  . LEU A 177 ? 0.6276 0.4046 0.3569 0.0153  -0.0799 0.0126  172 LEU A CB  
1359 C CG  . LEU A 177 ? 0.6438 0.4459 0.3976 0.0123  -0.0658 0.0147  172 LEU A CG  
1360 C CD1 . LEU A 177 ? 0.6506 0.4475 0.3836 0.0116  -0.0424 0.0129  172 LEU A CD1 
1361 C CD2 . LEU A 177 ? 0.5827 0.4241 0.3828 0.0106  -0.0628 0.0142  172 LEU A CD2 
1362 N N   . ASN A 178 ? 0.6785 0.4205 0.3989 0.0174  -0.1298 0.0174  173 ASN A N   
1363 C CA  . ASN A 178 ? 0.6817 0.4256 0.4185 0.0183  -0.1463 0.0208  173 ASN A CA  
1364 C C   . ASN A 178 ? 0.7760 0.4784 0.4677 0.0236  -0.1637 0.0223  173 ASN A C   
1365 O O   . ASN A 178 ? 0.7568 0.4514 0.4447 0.0264  -0.1684 0.0266  173 ASN A O   
1366 C CB  . ASN A 178 ? 0.6525 0.4224 0.4369 0.0160  -0.1616 0.0191  173 ASN A CB  
1367 C CG  . ASN A 178 ? 0.6963 0.5057 0.5251 0.0120  -0.1449 0.0197  173 ASN A CG  
1368 O OD1 . ASN A 178 ? 0.6079 0.4277 0.4329 0.0109  -0.1232 0.0199  173 ASN A OD1 
1369 N ND2 . ASN A 178 ? 0.5775 0.4092 0.4490 0.0097  -0.1547 0.0194  173 ASN A ND2 
1370 N N   . PHE A 179 ? 0.7756 0.4491 0.4304 0.0258  -0.1730 0.0188  174 PHE A N   
1371 C CA  . PHE A 179 ? 0.8149 0.4451 0.4202 0.0318  -0.1905 0.0198  174 PHE A CA  
1372 C C   . PHE A 179 ? 0.9031 0.5082 0.4659 0.0337  -0.1694 0.0244  174 PHE A C   
1373 O O   . PHE A 179 ? 0.9426 0.5222 0.4792 0.0387  -0.1786 0.0289  174 PHE A O   
1374 C CB  . PHE A 179 ? 0.8636 0.4686 0.4380 0.0330  -0.2031 0.0138  174 PHE A CB  
1375 C CG  . PHE A 179 ? 0.9342 0.4982 0.4653 0.0394  -0.2314 0.0125  174 PHE A CG  
1376 C CD1 . PHE A 179 ? 0.9921 0.5429 0.5140 0.0453  -0.2466 0.0174  174 PHE A CD1 
1377 C CD2 . PHE A 179 ? 0.9977 0.5336 0.4935 0.0406  -0.2426 0.0063  174 PHE A CD2 
1378 C CE1 . PHE A 179 ? 1.0712 0.5832 0.5509 0.0528  -0.2752 0.0159  174 PHE A CE1 
1379 C CE2 . PHE A 179 ? 1.0934 0.5903 0.5464 0.0470  -0.2706 0.0042  174 PHE A CE2 
1380 C CZ  . PHE A 179 ? 1.0894 0.5748 0.5343 0.0534  -0.2874 0.0090  174 PHE A CZ  
1381 N N   . SER A 180 ? 0.8485 0.4623 0.4078 0.0299  -0.1404 0.0233  175 SER A N   
1382 C CA  . SER A 180 ? 0.8598 0.4530 0.3849 0.0297  -0.1166 0.0266  175 SER A CA  
1383 C C   . SER A 180 ? 0.8984 0.5064 0.4480 0.0284  -0.1123 0.0319  175 SER A C   
1384 O O   . SER A 180 ? 0.9359 0.5127 0.4499 0.0310  -0.1080 0.0366  175 SER A O   
1385 C CB  . SER A 180 ? 0.8634 0.4718 0.3926 0.0254  -0.0871 0.0229  175 SER A CB  
1386 O OG  . SER A 180 ? 0.9155 0.5721 0.5007 0.0206  -0.0764 0.0219  175 SER A OG  
1387 N N   . VAL A 181 ? 0.7950 0.4476 0.4028 0.0247  -0.1131 0.0312  176 VAL A N   
1388 C CA  . VAL A 181 ? 0.7638 0.4322 0.3986 0.0236  -0.1102 0.0353  176 VAL A CA  
1389 C C   . VAL A 181 ? 0.8529 0.4960 0.4727 0.0308  -0.1365 0.0397  176 VAL A C   
1390 O O   . VAL A 181 ? 0.8378 0.4640 0.4429 0.0331  -0.1324 0.0448  176 VAL A O   
1391 C CB  . VAL A 181 ? 0.7386 0.4579 0.4357 0.0187  -0.1058 0.0330  176 VAL A CB  
1392 C CG1 . VAL A 181 ? 0.7258 0.4582 0.4507 0.0188  -0.1084 0.0368  176 VAL A CG1 
1393 C CG2 . VAL A 181 ? 0.6975 0.4397 0.4059 0.0131  -0.0787 0.0292  176 VAL A CG2 
1394 N N   . PHE A 182 ? 0.8388 0.4769 0.4601 0.0348  -0.1637 0.0374  177 PHE A N   
1395 C CA  . PHE A 182 ? 0.8647 0.4793 0.4717 0.0430  -0.1923 0.0401  177 PHE A CA  
1396 C C   . PHE A 182 ? 0.9962 0.5578 0.5345 0.0490  -0.1892 0.0448  177 PHE A C   
1397 O O   . PHE A 182 ? 1.0301 0.5735 0.5558 0.0551  -0.1969 0.0504  177 PHE A O   
1398 C CB  . PHE A 182 ? 0.8842 0.5000 0.4996 0.0448  -0.2201 0.0345  177 PHE A CB  
1399 C CG  . PHE A 182 ? 0.9383 0.5239 0.5287 0.0544  -0.2519 0.0357  177 PHE A CG  
1400 C CD1 . PHE A 182 ? 0.9477 0.5505 0.5763 0.0587  -0.2708 0.0373  177 PHE A CD1 
1401 C CD2 . PHE A 182 ? 1.0258 0.5640 0.5521 0.0601  -0.2628 0.0351  177 PHE A CD2 
1402 C CE1 . PHE A 182 ? 1.0039 0.5799 0.6106 0.0692  -0.3024 0.0380  177 PHE A CE1 
1403 C CE2 . PHE A 182 ? 1.1014 0.6097 0.6007 0.0706  -0.2945 0.0361  177 PHE A CE2 
1404 C CZ  . PHE A 182 ? 1.0490 0.5779 0.5906 0.0753  -0.3154 0.0372  177 PHE A CZ  
1405 N N   . TYR A 183 ? 0.9978 0.5328 0.4905 0.0479  -0.1770 0.0428  178 TYR A N   
1406 C CA  . TYR A 183 ? 1.0615 0.5426 0.4847 0.0532  -0.1709 0.0474  178 TYR A CA  
1407 C C   . TYR A 183 ? 1.1191 0.5961 0.5383 0.0504  -0.1443 0.0532  178 TYR A C   
1408 O O   . TYR A 183 ? 1.1596 0.5991 0.5403 0.0570  -0.1485 0.0596  178 TYR A O   
1409 C CB  . TYR A 183 ? 1.1012 0.5562 0.4789 0.0518  -0.1586 0.0434  178 TYR A CB  
1410 C CG  . TYR A 183 ? 1.1643 0.5946 0.5133 0.0579  -0.1886 0.0393  178 TYR A CG  
1411 C CD1 . TYR A 183 ? 1.2572 0.6438 0.5588 0.0681  -0.2137 0.0427  178 TYR A CD1 
1412 C CD2 . TYR A 183 ? 1.1554 0.6030 0.5210 0.0540  -0.1919 0.0318  178 TYR A CD2 
1413 C CE1 . TYR A 183 ? 1.3185 0.6820 0.5929 0.0736  -0.2434 0.0374  178 TYR A CE1 
1414 C CE2 . TYR A 183 ? 1.2035 0.6264 0.5415 0.0587  -0.2192 0.0267  178 TYR A CE2 
1415 C CZ  . TYR A 183 ? 1.3606 0.7427 0.6541 0.0681  -0.2456 0.0290  178 TYR A CZ  
1416 O OH  . TYR A 183 ? 1.4342 0.7922 0.7003 0.0725  -0.2743 0.0227  178 TYR A OH  
1417 N N   . TYR A 184 ? 1.0418 0.5558 0.4993 0.0409  -0.1173 0.0506  179 TYR A N   
1418 C CA  . TYR A 184 ? 1.0445 0.5582 0.5030 0.0360  -0.0901 0.0540  179 TYR A CA  
1419 C C   . TYR A 184 ? 1.1085 0.6306 0.5926 0.0390  -0.1001 0.0589  179 TYR A C   
1420 O O   . TYR A 184 ? 1.1532 0.6430 0.6056 0.0412  -0.0911 0.0647  179 TYR A O   
1421 C CB  . TYR A 184 ? 1.0076 0.5637 0.5063 0.0254  -0.0623 0.0482  179 TYR A CB  
1422 C CG  . TYR A 184 ? 1.0260 0.5774 0.5195 0.0188  -0.0315 0.0496  179 TYR A CG  
1423 C CD1 . TYR A 184 ? 1.0085 0.5838 0.5396 0.0153  -0.0263 0.0510  179 TYR A CD1 
1424 C CD2 . TYR A 184 ? 1.0813 0.6030 0.5322 0.0157  -0.0065 0.0488  179 TYR A CD2 
1425 C CE1 . TYR A 184 ? 1.0304 0.5999 0.5572 0.0080  0.0019  0.0512  179 TYR A CE1 
1426 C CE2 . TYR A 184 ? 1.1062 0.6235 0.5551 0.0081  0.0231  0.0491  179 TYR A CE2 
1427 C CZ  . TYR A 184 ? 1.1514 0.6922 0.6381 0.0040  0.0266  0.0502  179 TYR A CZ  
1428 O OH  . TYR A 184 ? 1.1805 0.7158 0.6655 -0.0046 0.0561  0.0493  179 TYR A OH  
1429 N N   . GLU A 185 ? 1.0177 0.5819 0.5590 0.0386  -0.1156 0.0567  180 GLU A N   
1430 C CA  . GLU A 185 ? 0.9904 0.5695 0.5648 0.0407  -0.1214 0.0602  180 GLU A CA  
1431 C C   . GLU A 185 ? 1.0655 0.6227 0.6288 0.0526  -0.1537 0.0645  180 GLU A C   
1432 O O   . GLU A 185 ? 1.0896 0.6338 0.6504 0.0576  -0.1556 0.0699  180 GLU A O   
1433 C CB  . GLU A 185 ? 0.9366 0.5725 0.5790 0.0341  -0.1185 0.0552  180 GLU A CB  
1434 C CG  . GLU A 185 ? 1.0796 0.7351 0.7596 0.0343  -0.1173 0.0576  180 GLU A CG  
1435 C CD  . GLU A 185 ? 1.1398 0.8476 0.8806 0.0275  -0.1106 0.0527  180 GLU A CD  
1436 O OE1 . GLU A 185 ? 0.8655 0.5955 0.6214 0.0234  -0.1091 0.0479  180 GLU A OE1 
1437 O OE2 . GLU A 185 ? 0.9878 0.7119 0.7587 0.0270  -0.1065 0.0539  180 GLU A OE2 
1438 N N   . ILE A 186 ? 1.0121 0.5674 0.5726 0.0573  -0.1797 0.0614  181 ILE A N   
1439 C CA  . ILE A 186 ? 1.0348 0.5753 0.5925 0.0689  -0.2141 0.0636  181 ILE A CA  
1440 C C   . ILE A 186 ? 1.1655 0.6463 0.6493 0.0790  -0.2261 0.0681  181 ILE A C   
1441 O O   . ILE A 186 ? 1.1918 0.6482 0.6585 0.0893  -0.2402 0.0740  181 ILE A O   
1442 C CB  . ILE A 186 ? 1.0313 0.6049 0.6339 0.0684  -0.2390 0.0567  181 ILE A CB  
1443 C CG1 . ILE A 186 ? 0.9437 0.5725 0.6135 0.0582  -0.2234 0.0527  181 ILE A CG1 
1444 C CG2 . ILE A 186 ? 1.0533 0.6190 0.6644 0.0803  -0.2754 0.0575  181 ILE A CG2 
1445 C CD1 . ILE A 186 ? 0.9110 0.5639 0.6221 0.0581  -0.2153 0.0558  181 ILE A CD1 
1446 N N   . LEU A 187 ? 1.1624 0.6176 0.6005 0.0771  -0.2213 0.0655  182 LEU A N   
1447 C CA  A LEU A 187 ? 1.2268 0.6204 0.5872 0.0869  -0.2316 0.0697  182 LEU A CA  
1448 C C   . LEU A 187 ? 1.3086 0.6639 0.6185 0.0853  -0.1998 0.0764  182 LEU A C   
1449 O O   . LEU A 187 ? 1.4104 0.7098 0.6516 0.0939  -0.2047 0.0815  182 LEU A O   
1450 C CB  . LEU A 187 ? 1.2438 0.6214 0.5732 0.0873  -0.2444 0.0633  182 LEU A CB  
1451 C CG  . LEU A 187 ? 1.3015 0.6952 0.6581 0.0923  -0.2841 0.0570  182 LEU A CG  
1452 C CD1 . LEU A 187 ? 1.3529 0.7187 0.6647 0.0932  -0.2951 0.0510  182 LEU A CD1 
1453 C CD2 . LEU A 187 ? 1.3736 0.7478 0.7209 0.1062  -0.3162 0.0612  182 LEU A CD2 
1454 N N   . ASN A 188 ? 1.2015 0.5855 0.5443 0.0741  -0.1670 0.0761  183 ASN A N   
1455 C CA  . ASN A 188 ? 1.2263 0.5805 0.5315 0.0695  -0.1329 0.0809  183 ASN A CA  
1456 C C   . ASN A 188 ? 1.3165 0.6257 0.5543 0.0694  -0.1200 0.0804  183 ASN A C   
1457 O O   . ASN A 188 ? 1.3673 0.6233 0.5436 0.0736  -0.1087 0.0869  183 ASN A O   
1458 C CB  . ASN A 188 ? 1.2906 0.6129 0.5743 0.0780  -0.1373 0.0900  183 ASN A CB  
1459 C CG  . ASN A 188 ? 1.6862 0.9862 0.9462 0.0707  -0.0995 0.0942  183 ASN A CG  
1460 O OD1 . ASN A 188 ? 1.5943 0.9192 0.8758 0.0574  -0.0693 0.0890  183 ASN A OD1 
1461 N ND2 . ASN A 188 ? 1.6840 0.9339 0.8968 0.0795  -0.1003 0.1033  183 ASN A ND2 
1462 N N   . SER A 189 ? 1.2497 0.5778 0.4973 0.0653  -0.1220 0.0728  184 SER A N   
1463 C CA  . SER A 189 ? 1.2777 0.5671 0.4661 0.0654  -0.1105 0.0709  184 SER A CA  
1464 C C   . SER A 189 ? 1.2605 0.5865 0.4821 0.0529  -0.0793 0.0640  184 SER A C   
1465 O O   . SER A 189 ? 1.2408 0.5941 0.4871 0.0507  -0.0868 0.0570  184 SER A O   
1466 C CB  . SER A 189 ? 1.3275 0.5998 0.4913 0.0741  -0.1453 0.0674  184 SER A CB  
1467 O OG  . SER A 189 ? 1.4964 0.7228 0.5936 0.0755  -0.1335 0.0661  184 SER A OG  
1468 N N   . PRO A 190 ? 1.1859 0.5131 0.4098 0.0447  -0.0440 0.0655  185 PRO A N   
1469 C CA  . PRO A 190 ? 1.1436 0.5101 0.4048 0.0335  -0.0152 0.0581  185 PRO A CA  
1470 C C   . PRO A 190 ? 1.2695 0.6203 0.4988 0.0329  -0.0037 0.0527  185 PRO A C   
1471 O O   . PRO A 190 ? 1.2267 0.6193 0.4977 0.0275  0.0044  0.0454  185 PRO A O   
1472 C CB  . PRO A 190 ? 1.1515 0.5174 0.4188 0.0253  0.0173  0.0604  185 PRO A CB  
1473 C CG  . PRO A 190 ? 1.2552 0.5643 0.4658 0.0323  0.0128  0.0697  185 PRO A CG  
1474 C CD  . PRO A 190 ? 1.2219 0.5178 0.4202 0.0451  -0.0293 0.0733  185 PRO A CD  
1475 N N   . GLU A 191 ? 1.3055 0.5951 0.4600 0.0392  -0.0031 0.0561  186 GLU A N   
1476 C CA  . GLU A 191 ? 1.3241 0.5927 0.4420 0.0396  0.0079  0.0508  186 GLU A CA  
1477 C C   . GLU A 191 ? 1.3276 0.6147 0.4620 0.0442  -0.0223 0.0452  186 GLU A C   
1478 O O   . GLU A 191 ? 1.3019 0.6085 0.4511 0.0407  -0.0102 0.0381  186 GLU A O   
1479 C CB  . GLU A 191 ? 1.4268 0.6219 0.4568 0.0459  0.0149  0.0561  186 GLU A CB  
1480 N N   . LYS A 192 ? 1.2630 0.5456 0.3982 0.0517  -0.0606 0.0476  187 LYS A N   
1481 C CA  . LYS A 192 ? 1.2481 0.5511 0.4057 0.0541  -0.0882 0.0413  187 LYS A CA  
1482 C C   . LYS A 192 ? 1.2429 0.6136 0.4822 0.0462  -0.0829 0.0369  187 LYS A C   
1483 O O   . LYS A 192 ? 1.2571 0.6483 0.5160 0.0444  -0.0852 0.0302  187 LYS A O   
1484 C CB  . LYS A 192 ? 1.2892 0.5743 0.4337 0.0632  -0.1297 0.0438  187 LYS A CB  
1485 N N   . ALA A 193 ? 1.1325 0.5353 0.4159 0.0416  -0.0728 0.0404  188 ALA A N   
1486 C CA  . ALA A 193 ? 1.0443 0.5086 0.4004 0.0345  -0.0657 0.0363  188 ALA A CA  
1487 C C   . ALA A 193 ? 1.0799 0.5611 0.4441 0.0289  -0.0360 0.0302  188 ALA A C   
1488 O O   . ALA A 193 ? 1.0123 0.5251 0.4100 0.0275  -0.0391 0.0248  188 ALA A O   
1489 C CB  . ALA A 193 ? 1.0157 0.5032 0.4071 0.0308  -0.0576 0.0406  188 ALA A CB  
1490 N N   . CYS A 194 ? 1.1011 0.5578 0.4320 0.0263  -0.0072 0.0311  189 CYS A N   
1491 C CA  . CYS A 194 ? 1.0895 0.5594 0.4262 0.0215  0.0232  0.0250  189 CYS A CA  
1492 C C   . CYS A 194 ? 1.1429 0.5947 0.4514 0.0262  0.0180  0.0201  189 CYS A C   
1493 O O   . CYS A 194 ? 1.1053 0.5875 0.4435 0.0246  0.0281  0.0139  189 CYS A O   
1494 C CB  . CYS A 194 ? 1.1282 0.5695 0.4317 0.0174  0.0547  0.0270  189 CYS A CB  
1495 S SG  . CYS A 194 ? 1.1317 0.6049 0.4810 0.0088  0.0704  0.0293  189 CYS A SG  
1496 N N   . SER A 195 ? 1.1315 0.5321 0.3805 0.0326  0.0020  0.0227  190 SER A N   
1497 C CA  . SER A 195 ? 1.1501 0.5253 0.3634 0.0373  -0.0042 0.0176  190 SER A CA  
1498 C C   . SER A 195 ? 1.1535 0.5655 0.4125 0.0378  -0.0271 0.0129  190 SER A C   
1499 O O   . SER A 195 ? 1.1204 0.5424 0.3863 0.0380  -0.0190 0.0068  190 SER A O   
1500 C CB  . SER A 195 ? 1.1820 0.4944 0.3224 0.0445  -0.0220 0.0215  190 SER A CB  
1501 O OG  . SER A 195 ? 1.4080 0.6975 0.5180 0.0494  -0.0392 0.0161  190 SER A OG  
1502 N N   . LEU A 196 ? 1.1089 0.5395 0.3986 0.0383  -0.0545 0.0158  191 LEU A N   
1503 C CA  . LEU A 196 ? 1.0852 0.5484 0.4185 0.0378  -0.0751 0.0117  191 LEU A CA  
1504 C C   . LEU A 196 ? 1.0654 0.5803 0.4558 0.0329  -0.0550 0.0088  191 LEU A C   
1505 O O   . LEU A 196 ? 1.0678 0.5955 0.4721 0.0335  -0.0561 0.0036  191 LEU A O   
1506 C CB  . LEU A 196 ? 1.0866 0.5581 0.4419 0.0391  -0.1061 0.0155  191 LEU A CB  
1507 C CG  . LEU A 196 ? 1.1275 0.6351 0.5360 0.0374  -0.1290 0.0127  191 LEU A CG  
1508 C CD1 . LEU A 196 ? 1.1418 0.6538 0.5545 0.0367  -0.1306 0.0057  191 LEU A CD1 
1509 C CD2 . LEU A 196 ? 1.1720 0.6631 0.5727 0.0415  -0.1625 0.0145  191 LEU A CD2 
1510 N N   . ALA A 197 ? 0.9651 0.5061 0.3841 0.0286  -0.0362 0.0115  192 ALA A N   
1511 C CA  . ALA A 197 ? 0.8955 0.4857 0.3674 0.0248  -0.0190 0.0082  192 ALA A CA  
1512 C C   . ALA A 197 ? 0.9580 0.5450 0.4159 0.0258  0.0060  0.0026  192 ALA A C   
1513 O O   . ALA A 197 ? 0.9145 0.5305 0.4032 0.0268  0.0094  -0.0017 192 ALA A O   
1514 C CB  . ALA A 197 ? 0.8713 0.4876 0.3745 0.0198  -0.0064 0.0113  192 ALA A CB  
1515 N N   . LYS A 198 ? 0.9760 0.5255 0.3859 0.0262  0.0239  0.0026  193 LYS A N   
1516 C CA  . LYS A 198 ? 0.9821 0.5256 0.3768 0.0273  0.0504  -0.0032 193 LYS A CA  
1517 C C   . LYS A 198 ? 1.0270 0.5549 0.4027 0.0331  0.0395  -0.0076 193 LYS A C   
1518 O O   . LYS A 198 ? 0.9993 0.5501 0.3974 0.0351  0.0523  -0.0130 193 LYS A O   
1519 C CB  . LYS A 198 ? 1.0573 0.5593 0.4015 0.0259  0.0730  -0.0018 193 LYS A CB  
1520 C CG  . LYS A 198 ? 1.1621 0.6592 0.4941 0.0267  0.1033  -0.0084 193 LYS A CG  
1521 C CD  . LYS A 198 ? 1.2996 0.7447 0.5709 0.0259  0.1243  -0.0067 193 LYS A CD  
1522 C CE  . LYS A 198 ? 1.2721 0.7283 0.5531 0.0228  0.1630  -0.0131 193 LYS A CE  
1523 N NZ  . LYS A 198 ? 1.2158 0.6910 0.5140 0.0280  0.1686  -0.0209 193 LYS A NZ  
1524 N N   . THR A 199 ? 1.0227 0.5118 0.3577 0.0363  0.0152  -0.0057 194 THR A N   
1525 C CA  . THR A 199 ? 1.0421 0.5118 0.3558 0.0409  0.0024  -0.0107 194 THR A CA  
1526 C C   . THR A 199 ? 1.0187 0.5315 0.3875 0.0406  -0.0084 -0.0130 194 THR A C   
1527 O O   . THR A 199 ? 1.0252 0.5418 0.3969 0.0438  0.0001  -0.0182 194 THR A O   
1528 C CB  . THR A 199 ? 1.1493 0.5736 0.4148 0.0436  -0.0252 -0.0090 194 THR A CB  
1529 O OG1 . THR A 199 ? 1.2716 0.6524 0.4806 0.0450  -0.0112 -0.0063 194 THR A OG1 
1530 C CG2 . THR A 199 ? 1.1345 0.5361 0.3764 0.0473  -0.0403 -0.0153 194 THR A CG2 
1531 N N   . ALA A 200 ? 0.9377 0.4810 0.3489 0.0372  -0.0254 -0.0091 195 ALA A N   
1532 C CA  . ALA A 200 ? 0.8877 0.4696 0.3499 0.0365  -0.0351 -0.0104 195 ALA A CA  
1533 C C   . ALA A 200 ? 0.8910 0.5074 0.3850 0.0377  -0.0101 -0.0131 195 ALA A C   
1534 O O   . ALA A 200 ? 0.8704 0.4967 0.3777 0.0409  -0.0103 -0.0165 195 ALA A O   
1535 C CB  . ALA A 200 ? 0.8578 0.4665 0.3593 0.0324  -0.0520 -0.0054 195 ALA A CB  
1536 N N   . PHE A 201 ? 0.8337 0.4670 0.3390 0.0354  0.0112  -0.0121 196 PHE A N   
1537 C CA  . PHE A 201 ? 0.7993 0.4682 0.3376 0.0368  0.0338  -0.0158 196 PHE A CA  
1538 C C   . PHE A 201 ? 0.8713 0.5209 0.3826 0.0427  0.0497  -0.0217 196 PHE A C   
1539 O O   . PHE A 201 ? 0.8456 0.5161 0.3798 0.0477  0.0537  -0.0252 196 PHE A O   
1540 C CB  . PHE A 201 ? 0.8055 0.4926 0.3589 0.0318  0.0530  -0.0150 196 PHE A CB  
1541 C CG  . PHE A 201 ? 0.7789 0.5095 0.3743 0.0330  0.0725  -0.0200 196 PHE A CG  
1542 C CD1 . PHE A 201 ? 0.8208 0.5481 0.4060 0.0359  0.0971  -0.0261 196 PHE A CD1 
1543 C CD2 . PHE A 201 ? 0.7283 0.5028 0.3733 0.0321  0.0658  -0.0192 196 PHE A CD2 
1544 C CE1 . PHE A 201 ? 0.7948 0.5645 0.4218 0.0382  0.1127  -0.0318 196 PHE A CE1 
1545 C CE2 . PHE A 201 ? 0.7307 0.5449 0.4125 0.0344  0.0812  -0.0245 196 PHE A CE2 
1546 C CZ  . PHE A 201 ? 0.7254 0.5382 0.3997 0.0378  0.1034  -0.0310 196 PHE A CZ  
1547 N N   . ASP A 202 ? 0.8841 0.4917 0.3450 0.0428  0.0593  -0.0225 197 ASP A N   
1548 C CA  . ASP A 202 ? 0.9212 0.5047 0.3504 0.0482  0.0774  -0.0284 197 ASP A CA  
1549 C C   . ASP A 202 ? 0.9641 0.5312 0.3797 0.0539  0.0628  -0.0314 197 ASP A C   
1550 O O   . ASP A 202 ? 0.9552 0.5272 0.3746 0.0600  0.0774  -0.0367 197 ASP A O   
1551 C CB  . ASP A 202 ? 0.9839 0.5199 0.3558 0.0466  0.0897  -0.0278 197 ASP A CB  
1552 C CG  . ASP A 202 ? 1.0460 0.5956 0.4298 0.0409  0.1142  -0.0267 197 ASP A CG  
1553 O OD1 . ASP A 202 ? 0.9999 0.5983 0.4378 0.0387  0.1237  -0.0284 197 ASP A OD1 
1554 O OD2 . ASP A 202 ? 1.1390 0.6493 0.4771 0.0387  0.1240  -0.0246 197 ASP A OD2 
1555 N N   . GLU A 203 ? 0.9440 0.4928 0.3467 0.0522  0.0342  -0.0286 198 GLU A N   
1556 C CA  . GLU A 203 ? 0.9851 0.5159 0.3752 0.0559  0.0187  -0.0322 198 GLU A CA  
1557 C C   . GLU A 203 ? 0.9960 0.5676 0.4377 0.0581  0.0169  -0.0327 198 GLU A C   
1558 O O   . GLU A 203 ? 1.0226 0.5854 0.4588 0.0634  0.0182  -0.0369 198 GLU A O   
1559 C CB  . GLU A 203 ? 1.0339 0.5330 0.3961 0.0528  -0.0114 -0.0307 198 GLU A CB  
1560 C CG  . GLU A 203 ? 1.1709 0.6189 0.4684 0.0538  -0.0090 -0.0314 198 GLU A CG  
1561 C CD  . GLU A 203 ? 1.4266 0.8402 0.6911 0.0524  -0.0406 -0.0309 198 GLU A CD  
1562 O OE1 . GLU A 203 ? 1.3393 0.7737 0.6385 0.0489  -0.0648 -0.0292 198 GLU A OE1 
1563 O OE2 . GLU A 203 ? 1.5327 0.8979 0.7364 0.0549  -0.0410 -0.0324 198 GLU A OE2 
1564 N N   . ALA A 204 ? 0.8903 0.5045 0.3795 0.0550  0.0165  -0.0286 199 ALA A N   
1565 C CA  . ALA A 204 ? 0.8295 0.4828 0.3659 0.0578  0.0164  -0.0282 199 ALA A CA  
1566 C C   . ALA A 204 ? 0.8832 0.5553 0.4315 0.0652  0.0418  -0.0325 199 ALA A C   
1567 O O   . ALA A 204 ? 0.8845 0.5619 0.4426 0.0721  0.0430  -0.0348 199 ALA A O   
1568 C CB  . ALA A 204 ? 0.7708 0.4606 0.3496 0.0522  0.0082  -0.0228 199 ALA A CB  
1569 N N   . ILE A 205 ? 0.8292 0.5096 0.3765 0.0642  0.0623  -0.0341 200 ILE A N   
1570 C CA  . ILE A 205 ? 0.8120 0.5109 0.3722 0.0710  0.0874  -0.0397 200 ILE A CA  
1571 C C   . ILE A 205 ? 0.8863 0.5516 0.4116 0.0787  0.0944  -0.0448 200 ILE A C   
1572 O O   . ILE A 205 ? 0.8820 0.5638 0.4259 0.0878  0.1029  -0.0484 200 ILE A O   
1573 C CB  . ILE A 205 ? 0.8554 0.5600 0.4141 0.0660  0.1088  -0.0415 200 ILE A CB  
1574 C CG1 . ILE A 205 ? 0.7983 0.5455 0.4018 0.0603  0.1067  -0.0387 200 ILE A CG1 
1575 C CG2 . ILE A 205 ? 0.8950 0.6054 0.4551 0.0726  0.1371  -0.0492 200 ILE A CG2 
1576 C CD1 . ILE A 205 ? 0.7656 0.5631 0.4215 0.0666  0.1085  -0.0413 200 ILE A CD1 
1577 N N   . ALA A 206 ? 0.8795 0.4959 0.3521 0.0760  0.0904  -0.0452 201 ALA A N   
1578 C CA  . ALA A 206 ? 0.9069 0.4843 0.3384 0.0826  0.0968  -0.0506 201 ALA A CA  
1579 C C   . ALA A 206 ? 0.9809 0.5550 0.4191 0.0882  0.0817  -0.0517 201 ALA A C   
1580 O O   . ALA A 206 ? 1.0124 0.5687 0.4332 0.0963  0.0925  -0.0570 201 ALA A O   
1581 C CB  . ALA A 206 ? 0.9633 0.4887 0.3356 0.0782  0.0915  -0.0504 201 ALA A CB  
1582 N N   . GLU A 207 ? 0.9442 0.5375 0.4115 0.0841  0.0595  -0.0468 202 GLU A N   
1583 C CA  . GLU A 207 ? 0.9509 0.5410 0.4276 0.0876  0.0456  -0.0470 202 GLU A CA  
1584 C C   . GLU A 207 ? 0.9600 0.5948 0.4890 0.0891  0.0416  -0.0427 202 GLU A C   
1585 O O   . GLU A 207 ? 0.9604 0.5955 0.5022 0.0866  0.0244  -0.0399 202 GLU A O   
1586 C CB  . GLU A 207 ? 0.9931 0.5497 0.4435 0.0801  0.0206  -0.0464 202 GLU A CB  
1587 C CG  . GLU A 207 ? 1.2224 0.7287 0.6136 0.0802  0.0227  -0.0515 202 GLU A CG  
1588 C CD  . GLU A 207 ? 1.4893 0.9582 0.8512 0.0754  -0.0028 -0.0540 202 GLU A CD  
1589 O OE1 . GLU A 207 ? 1.4837 0.9523 0.8594 0.0764  -0.0117 -0.0558 202 GLU A OE1 
1590 O OE2 . GLU A 207 ? 1.4376 0.8752 0.7606 0.0712  -0.0131 -0.0548 202 GLU A OE2 
1591 N N   . LEU A 208 ? 0.8939 0.5663 0.4532 0.0930  0.0581  -0.0425 203 LEU A N   
1592 C CA  . LEU A 208 ? 0.8432 0.5598 0.4499 0.0958  0.0565  -0.0391 203 LEU A CA  
1593 C C   . LEU A 208 ? 0.8845 0.6005 0.4996 0.1053  0.0536  -0.0391 203 LEU A C   
1594 O O   . LEU A 208 ? 0.8274 0.5688 0.4734 0.1058  0.0455  -0.0345 203 LEU A O   
1595 C CB  . LEU A 208 ? 0.8182 0.5701 0.4496 0.0990  0.0760  -0.0418 203 LEU A CB  
1596 C CG  . LEU A 208 ? 0.8283 0.6261 0.5043 0.0965  0.0726  -0.0383 203 LEU A CG  
1597 C CD1 . LEU A 208 ? 0.8045 0.6005 0.4807 0.0834  0.0592  -0.0331 203 LEU A CD1 
1598 C CD2 . LEU A 208 ? 0.8185 0.6493 0.5186 0.1010  0.0925  -0.0438 203 LEU A CD2 
1599 N N   . ASP A 209 ? 0.9028 0.5876 0.4888 0.1129  0.0605  -0.0439 204 ASP A N   
1600 C CA  . ASP A 209 ? 0.9332 0.6112 0.5228 0.1228  0.0589  -0.0439 204 ASP A CA  
1601 C C   . ASP A 209 ? 0.9922 0.6535 0.5804 0.1148  0.0379  -0.0396 204 ASP A C   
1602 O O   . ASP A 209 ? 1.0090 0.6689 0.6069 0.1206  0.0351  -0.0376 204 ASP A O   
1603 C CB  . ASP A 209 ? 1.0217 0.6653 0.5769 0.1316  0.0713  -0.0507 204 ASP A CB  
1604 C CG  . ASP A 209 ? 1.3705 0.9669 0.8807 0.1226  0.0623  -0.0536 204 ASP A CG  
1605 O OD1 . ASP A 209 ? 1.4330 1.0207 0.9238 0.1163  0.0663  -0.0552 204 ASP A OD1 
1606 O OD2 . ASP A 209 ? 1.5412 1.1085 1.0350 0.1215  0.0504  -0.0543 204 ASP A OD2 
1607 N N   . THR A 210 ? 0.9455 0.5933 0.5221 0.1016  0.0237  -0.0385 205 THR A N   
1608 C CA  . THR A 210 ? 0.9465 0.5831 0.5280 0.0921  0.0032  -0.0355 205 THR A CA  
1609 C C   . THR A 210 ? 0.9851 0.6601 0.6098 0.0876  -0.0036 -0.0284 205 THR A C   
1610 O O   . THR A 210 ? 0.9878 0.6583 0.6234 0.0796  -0.0184 -0.0257 205 THR A O   
1611 C CB  . THR A 210 ? 0.9580 0.5629 0.5086 0.0817  -0.0110 -0.0384 205 THR A CB  
1612 O OG1 . THR A 210 ? 0.9197 0.5424 0.4782 0.0753  -0.0134 -0.0355 205 THR A OG1 
1613 C CG2 . THR A 210 ? 0.9551 0.5183 0.4583 0.0859  -0.0046 -0.0456 205 THR A CG2 
1614 N N   . LEU A 211 ? 0.9034 0.6155 0.5526 0.0922  0.0075  -0.0261 206 LEU A N   
1615 C CA  . LEU A 211 ? 0.8482 0.5948 0.5348 0.0892  0.0026  -0.0201 206 LEU A CA  
1616 C C   . LEU A 211 ? 0.9303 0.6745 0.6273 0.0950  0.0009  -0.0170 206 LEU A C   
1617 O O   . LEU A 211 ? 0.9048 0.6340 0.5876 0.1054  0.0089  -0.0196 206 LEU A O   
1618 C CB  . LEU A 211 ? 0.8033 0.5878 0.5116 0.0951  0.0159  -0.0202 206 LEU A CB  
1619 C CG  . LEU A 211 ? 0.8178 0.6121 0.5248 0.0881  0.0198  -0.0218 206 LEU A CG  
1620 C CD1 . LEU A 211 ? 0.7549 0.5861 0.4854 0.0947  0.0347  -0.0240 206 LEU A CD1 
1621 C CD2 . LEU A 211 ? 0.8106 0.6121 0.5312 0.0765  0.0060  -0.0172 206 LEU A CD2 
1622 N N   . SER A 212 ? 0.9538 0.7110 0.6746 0.0889  -0.0080 -0.0116 207 SER A N   
1623 C CA  . SER A 212 ? 1.0012 0.7543 0.7307 0.0939  -0.0077 -0.0076 207 SER A CA  
1624 C C   . SER A 212 ? 1.0859 0.8759 0.8427 0.1005  -0.0018 -0.0027 207 SER A C   
1625 O O   . SER A 212 ? 1.0615 0.8778 0.8357 0.0952  -0.0032 -0.0017 207 SER A O   
1626 C CB  . SER A 212 ? 1.0830 0.8188 0.8178 0.0812  -0.0209 -0.0057 207 SER A CB  
1627 O OG  . SER A 212 ? 1.2128 0.9730 0.9723 0.0718  -0.0276 -0.0024 207 SER A OG  
1628 N N   . GLU A 213 ? 1.0871 0.8772 0.8461 0.1122  0.0039  0.0005  208 GLU A N   
1629 C CA  . GLU A 213 ? 1.0706 0.8932 0.8519 0.1195  0.0075  0.0052  208 GLU A CA  
1630 C C   . GLU A 213 ? 1.1046 0.9387 0.9065 0.1074  0.0004  0.0107  208 GLU A C   
1631 O O   . GLU A 213 ? 1.0793 0.9433 0.8998 0.1092  0.0019  0.0131  208 GLU A O   
1632 C CB  . GLU A 213 ? 1.1056 0.9206 0.8796 0.1362  0.0140  0.0078  208 GLU A CB  
1633 C CG  . GLU A 213 ? 1.2534 1.1006 1.0448 0.1472  0.0168  0.0113  208 GLU A CG  
1634 C CD  . GLU A 213 ? 1.5262 1.4098 1.3317 0.1530  0.0206  0.0058  208 GLU A CD  
1635 O OE1 . GLU A 213 ? 1.3108 1.1930 1.1087 0.1590  0.0266  -0.0006 208 GLU A OE1 
1636 O OE2 . GLU A 213 ? 1.5224 1.4358 1.3473 0.1521  0.0187  0.0074  208 GLU A OE2 
1637 N N   . GLU A 214 ? 1.0690 0.8800 0.8683 0.0947  -0.0074 0.0113  209 GLU A N   
1638 C CA  . GLU A 214 ? 1.0489 0.8675 0.8693 0.0826  -0.0135 0.0155  209 GLU A CA  
1639 C C   . GLU A 214 ? 1.0492 0.8893 0.8832 0.0734  -0.0191 0.0136  209 GLU A C   
1640 O O   . GLU A 214 ? 1.0234 0.8822 0.8791 0.0677  -0.0207 0.0171  209 GLU A O   
1641 C CB  . GLU A 214 ? 1.0903 0.8776 0.9069 0.0719  -0.0206 0.0150  209 GLU A CB  
1642 C CG  . GLU A 214 ? 1.3352 1.0919 1.1317 0.0795  -0.0153 0.0151  209 GLU A CG  
1643 C CD  . GLU A 214 ? 1.7262 1.4536 1.4966 0.0794  -0.0187 0.0081  209 GLU A CD  
1644 O OE1 . GLU A 214 ? 1.8339 1.5494 1.6026 0.0670  -0.0298 0.0035  209 GLU A OE1 
1645 O OE2 . GLU A 214 ? 1.6118 1.3276 1.3627 0.0925  -0.0106 0.0069  209 GLU A OE2 
1646 N N   . SER A 215 ? 0.9880 0.8223 0.8075 0.0719  -0.0214 0.0082  210 SER A N   
1647 C CA  . SER A 215 ? 0.9590 0.8069 0.7872 0.0629  -0.0270 0.0069  210 SER A CA  
1648 C C   . SER A 215 ? 0.9354 0.7948 0.7540 0.0671  -0.0201 0.0029  210 SER A C   
1649 O O   . SER A 215 ? 0.9406 0.8055 0.7613 0.0597  -0.0240 0.0019  210 SER A O   
1650 C CB  . SER A 215 ? 1.0384 0.8621 0.8601 0.0514  -0.0406 0.0049  210 SER A CB  
1651 O OG  . SER A 215 ? 1.1889 0.9833 0.9802 0.0540  -0.0418 0.0000  210 SER A OG  
1652 N N   . TYR A 216 ? 0.8213 0.6846 0.6309 0.0790  -0.0093 0.0004  211 TYR A N   
1653 C CA  . TYR A 216 ? 0.7822 0.6563 0.5856 0.0819  -0.0006 -0.0044 211 TYR A CA  
1654 C C   . TYR A 216 ? 0.7696 0.6758 0.5951 0.0777  0.0018  -0.0041 211 TYR A C   
1655 O O   . TYR A 216 ? 0.7648 0.6710 0.5833 0.0731  0.0053  -0.0073 211 TYR A O   
1656 C CB  . TYR A 216 ? 0.7815 0.6561 0.5759 0.0957  0.0108  -0.0081 211 TYR A CB  
1657 C CG  . TYR A 216 ? 0.7659 0.6748 0.5827 0.1060  0.0177  -0.0079 211 TYR A CG  
1658 C CD1 . TYR A 216 ? 0.7576 0.6961 0.5893 0.1066  0.0253  -0.0123 211 TYR A CD1 
1659 C CD2 . TYR A 216 ? 0.7819 0.6909 0.6020 0.1167  0.0173  -0.0044 211 TYR A CD2 
1660 C CE1 . TYR A 216 ? 0.7432 0.7143 0.5961 0.1167  0.0297  -0.0139 211 TYR A CE1 
1661 C CE2 . TYR A 216 ? 0.7742 0.7131 0.6112 0.1286  0.0219  -0.0050 211 TYR A CE2 
1662 C CZ  . TYR A 216 ? 0.8372 0.8087 0.6919 0.1284  0.0270  -0.0102 211 TYR A CZ  
1663 O OH  . TYR A 216 ? 0.7967 0.7999 0.6699 0.1398  0.0295  -0.0125 211 TYR A OH  
1664 N N   . LYS A 217 ? 0.6849 0.6152 0.5341 0.0790  0.0008  -0.0004 212 LYS A N   
1665 C CA  . LYS A 217 ? 0.6579 0.6174 0.5279 0.0743  0.0026  -0.0007 212 LYS A CA  
1666 C C   . LYS A 217 ? 0.6720 0.6234 0.5442 0.0613  -0.0059 0.0015  212 LYS A C   
1667 O O   . LYS A 217 ? 0.6346 0.5984 0.5128 0.0562  -0.0031 -0.0004 212 LYS A O   
1668 C CB  . LYS A 217 ? 0.6591 0.6445 0.5497 0.0803  0.0037  0.0018  212 LYS A CB  
1669 C CG  . LYS A 217 ? 0.9085 0.9071 0.7988 0.0950  0.0111  -0.0014 212 LYS A CG  
1670 C CD  . LYS A 217 ? 1.1499 1.1847 1.0615 0.0998  0.0139  -0.0038 212 LYS A CD  
1671 C CE  . LYS A 217 ? 1.3542 1.3956 1.2724 0.1052  0.0097  0.0018  212 LYS A CE  
1672 N NZ  . LYS A 217 ? 1.4017 1.4771 1.3386 0.1078  0.0106  -0.0014 212 LYS A NZ  
1673 N N   . ASP A 218 ? 0.6452 0.5746 0.5130 0.0561  -0.0165 0.0049  213 ASP A N   
1674 C CA  . ASP A 218 ? 0.6625 0.5838 0.5336 0.0451  -0.0268 0.0064  213 ASP A CA  
1675 C C   . ASP A 218 ? 0.6903 0.5922 0.5360 0.0429  -0.0274 0.0028  213 ASP A C   
1676 O O   . ASP A 218 ? 0.7242 0.6306 0.5717 0.0376  -0.0282 0.0028  213 ASP A O   
1677 C CB  . ASP A 218 ? 0.7166 0.6190 0.5907 0.0402  -0.0385 0.0090  213 ASP A CB  
1678 C CG  . ASP A 218 ? 1.0078 0.9234 0.9047 0.0408  -0.0366 0.0133  213 ASP A CG  
1679 O OD1 . ASP A 218 ? 1.0474 0.9888 0.9617 0.0424  -0.0305 0.0151  213 ASP A OD1 
1680 O OD2 . ASP A 218 ? 1.1050 1.0034 1.0015 0.0392  -0.0409 0.0147  213 ASP A OD2 
1681 N N   . SER A 219 ? 0.6051 0.4844 0.4252 0.0479  -0.0248 -0.0003 214 SER A N   
1682 C CA  . SER A 219 ? 0.6268 0.4827 0.4165 0.0468  -0.0232 -0.0039 214 SER A CA  
1683 C C   . SER A 219 ? 0.6678 0.5414 0.4593 0.0479  -0.0089 -0.0063 214 SER A C   
1684 O O   . SER A 219 ? 0.6557 0.5198 0.4353 0.0425  -0.0093 -0.0064 214 SER A O   
1685 C CB  . SER A 219 ? 0.6422 0.4721 0.4051 0.0530  -0.0204 -0.0074 214 SER A CB  
1686 O OG  . SER A 219 ? 0.6888 0.4986 0.4483 0.0504  -0.0337 -0.0064 214 SER A OG  
1687 N N   . THR A 220 ? 0.6550 0.5532 0.4613 0.0552  0.0038  -0.0086 215 THR A N   
1688 C CA  . THR A 220 ? 0.6486 0.5657 0.4607 0.0555  0.0185  -0.0128 215 THR A CA  
1689 C C   . THR A 220 ? 0.6842 0.6216 0.5167 0.0478  0.0173  -0.0110 215 THR A C   
1690 O O   . THR A 220 ? 0.6749 0.6136 0.5028 0.0436  0.0267  -0.0137 215 THR A O   
1691 C CB  . THR A 220 ? 0.6739 0.6130 0.4984 0.0660  0.0305  -0.0172 215 THR A CB  
1692 O OG1 . THR A 220 ? 0.6544 0.6188 0.5051 0.0698  0.0254  -0.0145 215 THR A OG1 
1693 C CG2 . THR A 220 ? 0.6558 0.5707 0.4566 0.0741  0.0341  -0.0196 215 THR A CG2 
1694 N N   . LEU A 221 ? 0.6310 0.5811 0.4842 0.0454  0.0071  -0.0066 216 LEU A N   
1695 C CA  . LEU A 221 ? 0.6228 0.5886 0.4936 0.0379  0.0057  -0.0050 216 LEU A CA  
1696 C C   . LEU A 221 ? 0.6468 0.5865 0.4977 0.0306  -0.0001 -0.0031 216 LEU A C   
1697 O O   . LEU A 221 ? 0.6528 0.5966 0.5040 0.0259  0.0069  -0.0042 216 LEU A O   
1698 C CB  . LEU A 221 ? 0.6197 0.6006 0.5144 0.0371  -0.0032 -0.0007 216 LEU A CB  
1699 C CG  . LEU A 221 ? 0.7328 0.7276 0.6453 0.0298  -0.0048 0.0009  216 LEU A CG  
1700 C CD1 . LEU A 221 ? 0.7482 0.7648 0.6695 0.0283  0.0085  -0.0043 216 LEU A CD1 
1701 C CD2 . LEU A 221 ? 0.7898 0.7991 0.7252 0.0296  -0.0107 0.0047  216 LEU A CD2 
1702 N N   . ILE A 222 ? 0.5907 0.5020 0.4228 0.0300  -0.0130 -0.0006 217 ILE A N   
1703 C CA  . ILE A 222 ? 0.6039 0.4873 0.4131 0.0251  -0.0217 0.0011  217 ILE A CA  
1704 C C   . ILE A 222 ? 0.6548 0.5188 0.4324 0.0258  -0.0090 -0.0022 217 ILE A C   
1705 O O   . ILE A 222 ? 0.6547 0.5062 0.4188 0.0217  -0.0077 -0.0009 217 ILE A O   
1706 C CB  . ILE A 222 ? 0.6402 0.4992 0.4388 0.0243  -0.0409 0.0029  217 ILE A CB  
1707 C CG1 . ILE A 222 ? 0.6083 0.4875 0.4421 0.0223  -0.0503 0.0059  217 ILE A CG1 
1708 C CG2 . ILE A 222 ? 0.6429 0.4744 0.4172 0.0209  -0.0519 0.0043  217 ILE A CG2 
1709 C CD1 . ILE A 222 ? 0.6162 0.4764 0.4466 0.0213  -0.0658 0.0059  217 ILE A CD1 
1710 N N   . MET A 223 ? 0.6223 0.4838 0.3888 0.0314  0.0020  -0.0063 218 MET A N   
1711 C CA  . MET A 223 ? 0.6235 0.4690 0.3633 0.0323  0.0181  -0.0101 218 MET A CA  
1712 C C   . MET A 223 ? 0.6729 0.5414 0.4302 0.0280  0.0336  -0.0120 218 MET A C   
1713 O O   . MET A 223 ? 0.7102 0.5594 0.4450 0.0243  0.0426  -0.0124 218 MET A O   
1714 C CB  . MET A 223 ? 0.6453 0.4910 0.3791 0.0400  0.0283  -0.0148 218 MET A CB  
1715 C CG  . MET A 223 ? 0.7127 0.5249 0.4178 0.0433  0.0164  -0.0144 218 MET A CG  
1716 S SD  . MET A 223 ? 0.7708 0.5826 0.4712 0.0540  0.0275  -0.0196 218 MET A SD  
1717 C CE  . MET A 223 ? 0.7702 0.5638 0.4403 0.0548  0.0499  -0.0249 218 MET A CE  
1718 N N   . GLN A 224 ? 0.6069 0.5138 0.4022 0.0282  0.0365  -0.0132 219 GLN A N   
1719 C CA  . GLN A 224 ? 0.5937 0.5247 0.4094 0.0231  0.0497  -0.0163 219 GLN A CA  
1720 C C   . GLN A 224 ? 0.6348 0.5508 0.4426 0.0153  0.0441  -0.0117 219 GLN A C   
1721 O O   . GLN A 224 ? 0.6263 0.5379 0.4278 0.0100  0.0574  -0.0135 219 GLN A O   
1722 C CB  . GLN A 224 ? 0.5619 0.5348 0.4179 0.0254  0.0483  -0.0182 219 GLN A CB  
1723 C CG  . GLN A 224 ? 0.6585 0.6499 0.5249 0.0343  0.0556  -0.0235 219 GLN A CG  
1724 C CD  . GLN A 224 ? 0.7822 0.8096 0.6817 0.0382  0.0510  -0.0244 219 GLN A CD  
1725 O OE1 . GLN A 224 ? 0.6347 0.6826 0.5549 0.0330  0.0507  -0.0250 219 GLN A OE1 
1726 N NE2 . GLN A 224 ? 0.7492 0.7813 0.6510 0.0480  0.0470  -0.0241 219 GLN A NE2 
1727 N N   . LEU A 225 ? 0.5870 0.4955 0.3969 0.0149  0.0250  -0.0059 220 LEU A N   
1728 C CA  . LEU A 225 ? 0.5756 0.4705 0.3803 0.0096  0.0171  -0.0012 220 LEU A CA  
1729 C C   . LEU A 225 ? 0.6513 0.5049 0.4129 0.0089  0.0181  0.0005  220 LEU A C   
1730 O O   . LEU A 225 ? 0.6737 0.5156 0.4248 0.0046  0.0243  0.0021  220 LEU A O   
1731 C CB  . LEU A 225 ? 0.5685 0.4655 0.3882 0.0102  -0.0040 0.0037  220 LEU A CB  
1732 C CG  . LEU A 225 ? 0.5960 0.5297 0.4557 0.0109  -0.0055 0.0034  220 LEU A CG  
1733 C CD1 . LEU A 225 ? 0.5838 0.5145 0.4556 0.0110  -0.0241 0.0078  220 LEU A CD1 
1734 C CD2 . LEU A 225 ? 0.5496 0.5064 0.4314 0.0063  0.0038  0.0020  220 LEU A CD2 
1735 N N   . LEU A 226 ? 0.6139 0.4425 0.3470 0.0135  0.0130  -0.0001 221 LEU A N   
1736 C CA  . LEU A 226 ? 0.6353 0.4200 0.3202 0.0138  0.0141  0.0011  221 LEU A CA  
1737 C C   . LEU A 226 ? 0.6956 0.4766 0.3685 0.0107  0.0396  -0.0020 221 LEU A C   
1738 O O   . LEU A 226 ? 0.6916 0.4478 0.3403 0.0074  0.0440  0.0010  221 LEU A O   
1739 C CB  . LEU A 226 ? 0.6394 0.4000 0.2965 0.0193  0.0073  -0.0008 221 LEU A CB  
1740 C CG  . LEU A 226 ? 0.6730 0.4237 0.3304 0.0210  -0.0192 0.0018  221 LEU A CG  
1741 C CD1 . LEU A 226 ? 0.6606 0.3981 0.3025 0.0257  -0.0223 -0.0020 221 LEU A CD1 
1742 C CD2 . LEU A 226 ? 0.6405 0.3550 0.2646 0.0204  -0.0349 0.0057  221 LEU A CD2 
1743 N N   . ARG A 227 ? 0.6698 0.4769 0.3628 0.0117  0.0568  -0.0081 222 ARG A N   
1744 C CA  . ARG A 227 ? 0.6945 0.5000 0.3803 0.0081  0.0828  -0.0127 222 ARG A CA  
1745 C C   . ARG A 227 ? 0.7418 0.5637 0.4488 0.0004  0.0913  -0.0126 222 ARG A C   
1746 O O   . ARG A 227 ? 0.7904 0.5926 0.4773 -0.0045 0.1085  -0.0132 222 ARG A O   
1747 C CB  . ARG A 227 ? 0.6724 0.5045 0.3786 0.0122  0.0976  -0.0204 222 ARG A CB  
1748 C CG  . ARG A 227 ? 0.7302 0.5474 0.4167 0.0100  0.1244  -0.0257 222 ARG A CG  
1749 C CD  . ARG A 227 ? 0.7642 0.6043 0.4686 0.0161  0.1381  -0.0338 222 ARG A CD  
1750 N NE  . ARG A 227 ? 0.7082 0.6009 0.4660 0.0162  0.1406  -0.0392 222 ARG A NE  
1751 C CZ  . ARG A 227 ? 0.8269 0.7454 0.6118 0.0102  0.1593  -0.0461 222 ARG A CZ  
1752 N NH1 . ARG A 227 ? 0.6996 0.5957 0.4641 0.0028  0.1804  -0.0481 222 ARG A NH1 
1753 N NH2 . ARG A 227 ? 0.5530 0.5182 0.3841 0.0111  0.1571  -0.0513 222 ARG A NH2 
1754 N N   . ASP A 228 ? 0.6376 0.4931 0.3836 -0.0009 0.0807  -0.0119 223 ASP A N   
1755 C CA  . ASP A 228 ? 0.6072 0.4784 0.3745 -0.0084 0.0883  -0.0125 223 ASP A CA  
1756 C C   . ASP A 228 ? 0.7023 0.5356 0.4385 -0.0114 0.0827  -0.0053 223 ASP A C   
1757 O O   . ASP A 228 ? 0.6868 0.5110 0.4170 -0.0180 0.0981  -0.0059 223 ASP A O   
1758 C CB  . ASP A 228 ? 0.5559 0.4671 0.3668 -0.0081 0.0768  -0.0131 223 ASP A CB  
1759 C CG  . ASP A 228 ? 0.6298 0.5821 0.4743 -0.0058 0.0857  -0.0212 223 ASP A CG  
1760 O OD1 . ASP A 228 ? 0.6164 0.5705 0.4567 -0.0054 0.1025  -0.0274 223 ASP A OD1 
1761 O OD2 . ASP A 228 ? 0.6380 0.6202 0.5129 -0.0039 0.0762  -0.0216 223 ASP A OD2 
1762 N N   . ASN A 229 ? 0.7058 0.5163 0.4224 -0.0063 0.0604  0.0012  224 ASN A N   
1763 C CA  . ASN A 229 ? 0.7551 0.5272 0.4391 -0.0066 0.0515  0.0082  224 ASN A CA  
1764 C C   . ASN A 229 ? 0.8682 0.5991 0.5038 -0.0073 0.0682  0.0084  224 ASN A C   
1765 O O   . ASN A 229 ? 0.8966 0.6061 0.5144 -0.0114 0.0785  0.0112  224 ASN A O   
1766 C CB  . ASN A 229 ? 0.7538 0.5114 0.4283 -0.0002 0.0224  0.0133  224 ASN A CB  
1767 C CG  . ASN A 229 ? 0.7533 0.5424 0.4706 -0.0003 0.0067  0.0150  224 ASN A CG  
1768 O OD1 . ASN A 229 ? 0.6917 0.5114 0.4426 -0.0046 0.0162  0.0128  224 ASN A OD1 
1769 N ND2 . ASN A 229 ? 0.6406 0.4229 0.3583 0.0040  -0.0171 0.0180  224 ASN A ND2 
1770 N N   . LEU A 230 ? 0.8583 0.5771 0.4722 -0.0036 0.0732  0.0052  225 LEU A N   
1771 C CA  . LEU A 230 ? 0.9089 0.5886 0.4760 -0.0040 0.0923  0.0045  225 LEU A CA  
1772 C C   . LEU A 230 ? 0.9674 0.6574 0.5468 -0.0125 0.1222  0.0003  225 LEU A C   
1773 O O   . LEU A 230 ? 0.9994 0.6517 0.5416 -0.0157 0.1359  0.0034  225 LEU A O   
1774 C CB  . LEU A 230 ? 0.9151 0.5961 0.4746 0.0008  0.0968  -0.0008 225 LEU A CB  
1775 C CG  . LEU A 230 ? 1.0372 0.6692 0.5390 0.0053  0.0986  0.0003  225 LEU A CG  
1776 C CD1 . LEU A 230 ? 1.0673 0.6522 0.5226 0.0075  0.0814  0.0084  225 LEU A CD1 
1777 C CD2 . LEU A 230 ? 1.0709 0.7103 0.5759 0.0119  0.0877  -0.0034 225 LEU A CD2 
1778 N N   . THR A 231 ? 0.8905 0.6300 0.5213 -0.0163 0.1321  -0.0069 226 THR A N   
1779 C CA  . THR A 231 ? 0.8907 0.6462 0.5416 -0.0255 0.1594  -0.0129 226 THR A CA  
1780 C C   . THR A 231 ? 0.9731 0.7136 0.6188 -0.0318 0.1599  -0.0078 226 THR A C   
1781 O O   . THR A 231 ? 1.0138 0.7290 0.6376 -0.0383 0.1821  -0.0081 226 THR A O   
1782 C CB  . THR A 231 ? 0.8624 0.6758 0.5708 -0.0268 0.1633  -0.0219 226 THR A CB  
1783 O OG1 . THR A 231 ? 0.8424 0.6634 0.5499 -0.0197 0.1645  -0.0261 226 THR A OG1 
1784 C CG2 . THR A 231 ? 0.7744 0.6087 0.5090 -0.0372 0.1907  -0.0306 226 THR A CG2 
1785 N N   . LEU A 232 ? 0.9076 0.6623 0.5734 -0.0298 0.1370  -0.0032 227 LEU A N   
1786 C CA  . LEU A 232 ? 0.9143 0.6561 0.5781 -0.0341 0.1348  0.0019  227 LEU A CA  
1787 C C   . LEU A 232 ? 1.0175 0.6996 0.6219 -0.0317 0.1359  0.0101  227 LEU A C   
1788 O O   . LEU A 232 ? 1.0590 0.7191 0.6483 -0.0380 0.1529  0.0117  227 LEU A O   
1789 C CB  . LEU A 232 ? 0.8908 0.6547 0.5825 -0.0296 0.1074  0.0058  227 LEU A CB  
1790 C CG  . LEU A 232 ? 0.9846 0.7456 0.6864 -0.0332 0.1042  0.0097  227 LEU A CG  
1791 C CD1 . LEU A 232 ? 0.9536 0.7517 0.6971 -0.0430 0.1227  0.0013  227 LEU A CD1 
1792 C CD2 . LEU A 232 ? 1.0311 0.8017 0.7486 -0.0263 0.0755  0.0151  227 LEU A CD2 
1793 N N   . TRP A 233 ? 0.9745 0.6288 0.5435 -0.0227 0.1183  0.0148  228 TRP A N   
1794 C CA  . TRP A 233 ? 1.0182 0.6145 0.5278 -0.0181 0.1126  0.0232  228 TRP A CA  
1795 C C   . TRP A 233 ? 1.1631 0.7183 0.6248 -0.0209 0.1398  0.0226  228 TRP A C   
1796 O O   . TRP A 233 ? 1.2053 0.7085 0.6146 -0.0181 0.1400  0.0301  228 TRP A O   
1797 C CB  . TRP A 233 ? 0.9965 0.5775 0.4861 -0.0074 0.0801  0.0277  228 TRP A CB  
1798 C CG  . TRP A 233 ? 0.9470 0.5616 0.4792 -0.0042 0.0528  0.0290  228 TRP A CG  
1799 C CD1 . TRP A 233 ? 0.9485 0.5874 0.5175 -0.0073 0.0492  0.0305  228 TRP A CD1 
1800 C CD2 . TRP A 233 ? 0.9223 0.5442 0.4605 0.0027  0.0257  0.0292  228 TRP A CD2 
1801 N NE1 . TRP A 233 ? 0.9088 0.5707 0.5072 -0.0025 0.0227  0.0316  228 TRP A NE1 
1802 C CE2 . TRP A 233 ? 0.9241 0.5771 0.5060 0.0031  0.0081  0.0307  228 TRP A CE2 
1803 C CE3 . TRP A 233 ? 0.9483 0.5535 0.4603 0.0079  0.0162  0.0273  228 TRP A CE3 
1804 C CZ2 . TRP A 233 ? 0.8781 0.5449 0.4786 0.0080  -0.0185 0.0308  228 TRP A CZ2 
1805 C CZ3 . TRP A 233 ? 0.9375 0.5563 0.4675 0.0125  -0.0111 0.0271  228 TRP A CZ3 
1806 C CH2 . TRP A 233 ? 0.8996 0.5484 0.4737 0.0123  -0.0280 0.0290  228 TRP A CH2 
1807 N N   . THR A 234 ? 1.1351 0.7116 0.6128 -0.0254 0.1625  0.0140  229 THR A N   
1808 C CA  . THR A 234 ? 1.1807 0.7225 0.6181 -0.0285 0.1919  0.0118  229 THR A CA  
1809 C C   . THR A 234 ? 1.2469 0.8051 0.7108 -0.0412 0.2254  0.0058  229 THR A C   
1810 O O   . THR A 234 ? 1.3051 0.8429 0.7474 -0.0461 0.2551  0.0021  229 THR A O   
1811 C CB  . THR A 234 ? 1.1850 0.7371 0.6215 -0.0239 0.1953  0.0054  229 THR A CB  
1812 O OG1 . THR A 234 ? 1.1286 0.7421 0.6288 -0.0262 0.1965  -0.0034 229 THR A OG1 
1813 C CG2 . THR A 234 ? 1.1527 0.6765 0.5512 -0.0127 0.1670  0.0104  229 THR A CG2 
1814 N N   . SER A 235 ? 1.1534 0.7484 0.6650 -0.0470 0.2212  0.0039  230 SER A N   
1815 C CA  . SER A 235 ? 1.5819 1.2010 1.1290 -0.0601 0.2490  -0.0038 230 SER A CA  
1816 C C   . SER A 235 ? 1.9781 1.5618 1.5026 -0.0667 0.2596  0.0023  230 SER A C   
1817 O O   . SER A 235 ? 1.5621 1.0877 1.0269 -0.0641 0.2664  0.0104  230 SER A O   
1818 C CB  . SER A 235 ? 1.5576 1.2433 1.1741 -0.0626 0.2392  -0.0121 230 SER A CB  
1819 O OG  . SER A 235 ? 1.6439 1.3395 1.2778 -0.0620 0.2190  -0.0072 230 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4   ?    ?   ?   A . n 
A 1 2   PRO 2   -3   ?    ?   ?   A . n 
A 1 3   LEU 3   -2   ?    ?   ?   A . n 
A 1 4   GLY 4   -1   ?    ?   ?   A . n 
A 1 5   SER 5   0    ?    ?   ?   A . n 
A 1 6   MET 6   1    ?    ?   ?   A . n 
A 1 7   ASP 7   2    2    ASP ASP A . n 
A 1 8   LYS 8   3    3    LYS LYS A . n 
A 1 9   ASN 9   4    4    ASN ASN A . n 
A 1 10  GLU 10  5    5    GLU GLU A . n 
A 1 11  LEU 11  6    6    LEU LEU A . n 
A 1 12  VAL 12  7    7    VAL VAL A . n 
A 1 13  GLN 13  8    8    GLN GLN A . n 
A 1 14  LYS 14  9    9    LYS LYS A . n 
A 1 15  ALA 15  10   10   ALA ALA A . n 
A 1 16  LYS 16  11   11   LYS LYS A . n 
A 1 17  LEU 17  12   12   LEU LEU A . n 
A 1 18  ALA 18  13   13   ALA ALA A . n 
A 1 19  GLU 19  14   14   GLU GLU A . n 
A 1 20  GLN 20  15   15   GLN GLN A . n 
A 1 21  ALA 21  16   16   ALA ALA A . n 
A 1 22  GLU 22  17   17   GLU GLU A . n 
A 1 23  ARG 23  18   18   ARG ARG A . n 
A 1 24  TYR 24  19   19   TYR TYR A . n 
A 1 25  ASP 25  20   20   ASP ASP A . n 
A 1 26  ASP 26  21   21   ASP ASP A . n 
A 1 27  MET 27  22   22   MET MET A . n 
A 1 28  ALA 28  23   23   ALA ALA A . n 
A 1 29  ALA 29  24   24   ALA ALA A . n 
A 1 30  CYS 30  25   25   CYS CYS A . n 
A 1 31  MET 31  26   26   MET MET A . n 
A 1 32  LYS 32  27   27   LYS LYS A . n 
A 1 33  SER 33  28   28   SER SER A . n 
A 1 34  VAL 34  29   29   VAL VAL A . n 
A 1 35  THR 35  30   30   THR THR A . n 
A 1 36  GLU 36  31   31   GLU GLU A . n 
A 1 37  GLN 37  32   32   GLN GLN A . n 
A 1 38  GLY 38  33   33   GLY GLY A . n 
A 1 39  ALA 39  34   34   ALA ALA A . n 
A 1 40  GLU 40  35   35   GLU GLU A . n 
A 1 41  LEU 41  36   36   LEU LEU A . n 
A 1 42  SER 42  37   37   SER SER A . n 
A 1 43  ASN 43  38   38   ASN ASN A . n 
A 1 44  GLU 44  39   39   GLU GLU A . n 
A 1 45  GLU 45  40   40   GLU GLU A . n 
A 1 46  ARG 46  41   41   ARG ARG A . n 
A 1 47  ASN 47  42   42   ASN ASN A . n 
A 1 48  LEU 48  43   43   LEU LEU A . n 
A 1 49  LEU 49  44   44   LEU LEU A . n 
A 1 50  SER 50  45   45   SER SER A . n 
A 1 51  VAL 51  46   46   VAL VAL A . n 
A 1 52  ALA 52  47   47   ALA ALA A . n 
A 1 53  TYR 53  48   48   TYR TYR A . n 
A 1 54  LYS 54  49   49   LYS LYS A . n 
A 1 55  ASN 55  50   50   ASN ASN A . n 
A 1 56  VAL 56  51   51   VAL VAL A . n 
A 1 57  VAL 57  52   52   VAL VAL A . n 
A 1 58  GLY 58  53   53   GLY GLY A . n 
A 1 59  ALA 59  54   54   ALA ALA A . n 
A 1 60  ARG 60  55   55   ARG ARG A . n 
A 1 61  ARG 61  56   56   ARG ARG A . n 
A 1 62  SER 62  57   57   SER SER A . n 
A 1 63  SER 63  58   58   SER SER A . n 
A 1 64  TRP 64  59   59   TRP TRP A . n 
A 1 65  ARG 65  60   60   ARG ARG A . n 
A 1 66  VAL 66  61   61   VAL VAL A . n 
A 1 67  VAL 67  62   62   VAL VAL A . n 
A 1 68  SER 68  63   63   SER SER A . n 
A 1 69  SER 69  64   64   SER SER A . n 
A 1 70  ILE 70  65   65   ILE ILE A . n 
A 1 71  GLU 71  66   66   GLU GLU A . n 
A 1 72  GLN 72  67   67   GLN GLN A . n 
A 1 73  LYS 73  68   68   LYS LYS A . n 
A 1 74  THR 74  69   69   THR THR A . n 
A 1 75  GLU 75  70   70   GLU GLU A . n 
A 1 76  GLY 76  71   71   GLY GLY A . n 
A 1 77  ALA 77  72   72   ALA ALA A . n 
A 1 78  GLU 78  73   73   GLU GLU A . n 
A 1 79  LYS 79  74   74   LYS LYS A . n 
A 1 80  LYS 80  75   75   LYS LYS A . n 
A 1 81  GLN 81  76   76   GLN GLN A . n 
A 1 82  GLN 82  77   77   GLN GLN A . n 
A 1 83  MET 83  78   78   MET MET A . n 
A 1 84  ALA 84  79   79   ALA ALA A . n 
A 1 85  ARG 85  80   80   ARG ARG A . n 
A 1 86  GLU 86  81   81   GLU GLU A . n 
A 1 87  TYR 87  82   82   TYR TYR A . n 
A 1 88  ARG 88  83   83   ARG ARG A . n 
A 1 89  GLU 89  84   84   GLU GLU A . n 
A 1 90  LYS 90  85   85   LYS LYS A . n 
A 1 91  ILE 91  86   86   ILE ILE A . n 
A 1 92  GLU 92  87   87   GLU GLU A . n 
A 1 93  THR 93  88   88   THR THR A . n 
A 1 94  GLU 94  89   89   GLU GLU A . n 
A 1 95  LEU 95  90   90   LEU LEU A . n 
A 1 96  ARG 96  91   91   ARG ARG A . n 
A 1 97  ASP 97  92   92   ASP ASP A . n 
A 1 98  ILE 98  93   93   ILE ILE A . n 
A 1 99  CYS 99  94   94   CYS CYS A . n 
A 1 100 ASN 100 95   95   ASN ASN A . n 
A 1 101 ASP 101 96   96   ASP ASP A . n 
A 1 102 VAL 102 97   97   VAL VAL A . n 
A 1 103 LEU 103 98   98   LEU LEU A . n 
A 1 104 SER 104 99   99   SER SER A . n 
A 1 105 LEU 105 100  100  LEU LEU A . n 
A 1 106 LEU 106 101  101  LEU LEU A . n 
A 1 107 GLU 107 102  102  GLU GLU A . n 
A 1 108 LYS 108 103  103  LYS LYS A . n 
A 1 109 PHE 109 104  104  PHE PHE A . n 
A 1 110 LEU 110 105  105  LEU LEU A . n 
A 1 111 ILE 111 106  106  ILE ILE A . n 
A 1 112 PRO 112 107  107  PRO PRO A . n 
A 1 113 ASN 113 108  108  ASN ASN A . n 
A 1 114 ALA 114 109  109  ALA ALA A . n 
A 1 115 SER 115 110  110  SER SER A . n 
A 1 116 GLN 116 111  111  GLN GLN A . n 
A 1 117 ALA 117 112  112  ALA ALA A . n 
A 1 118 GLU 118 113  113  GLU GLU A . n 
A 1 119 SER 119 114  114  SER SER A . n 
A 1 120 LYS 120 115  115  LYS LYS A . n 
A 1 121 VAL 121 116  116  VAL VAL A . n 
A 1 122 PHE 122 117  117  PHE PHE A . n 
A 1 123 TYR 123 118  118  TYR TYR A . n 
A 1 124 LEU 124 119  119  LEU LEU A . n 
A 1 125 LYS 125 120  120  LYS LYS A . n 
A 1 126 MET 126 121  121  MET MET A . n 
A 1 127 LYS 127 122  122  LYS LYS A . n 
A 1 128 GLY 128 123  123  GLY GLY A . n 
A 1 129 ASP 129 124  124  ASP ASP A . n 
A 1 130 TYR 130 125  125  TYR TYR A . n 
A 1 131 TYR 131 126  126  TYR TYR A . n 
A 1 132 ARG 132 127  127  ARG ARG A . n 
A 1 133 TYR 133 128  128  TYR TYR A . n 
A 1 134 LEU 134 129  129  LEU LEU A . n 
A 1 135 ALA 135 130  130  ALA ALA A . n 
A 1 136 GLU 136 131  131  GLU GLU A . n 
A 1 137 VAL 137 132  132  VAL VAL A . n 
A 1 138 ALA 138 133  133  ALA ALA A . n 
A 1 139 ALA 139 134  134  ALA ALA A . n 
A 1 140 GLY 140 135  135  GLY GLY A . n 
A 1 141 ASP 141 136  136  ASP ASP A . n 
A 1 142 ASP 142 137  137  ASP ASP A . n 
A 1 143 LYS 143 138  138  LYS LYS A . n 
A 1 144 LYS 144 139  139  LYS LYS A . n 
A 1 145 GLY 145 140  140  GLY GLY A . n 
A 1 146 ILE 146 141  141  ILE ILE A . n 
A 1 147 VAL 147 142  142  VAL VAL A . n 
A 1 148 ASP 148 143  143  ASP ASP A . n 
A 1 149 GLN 149 144  144  GLN GLN A . n 
A 1 150 SER 150 145  145  SER SER A . n 
A 1 151 GLN 151 146  146  GLN GLN A . n 
A 1 152 GLN 152 147  147  GLN GLN A . n 
A 1 153 ALA 153 148  148  ALA ALA A . n 
A 1 154 TYR 154 149  149  TYR TYR A . n 
A 1 155 GLN 155 150  150  GLN GLN A . n 
A 1 156 GLU 156 151  151  GLU GLU A . n 
A 1 157 ALA 157 152  152  ALA ALA A . n 
A 1 158 PHE 158 153  153  PHE PHE A . n 
A 1 159 GLU 159 154  154  GLU GLU A . n 
A 1 160 ILE 160 155  155  ILE ILE A . n 
A 1 161 SER 161 156  156  SER SER A . n 
A 1 162 LYS 162 157  157  LYS LYS A . n 
A 1 163 LYS 163 158  158  LYS LYS A . n 
A 1 164 GLU 164 159  159  GLU GLU A . n 
A 1 165 MET 165 160  160  MET MET A . n 
A 1 166 GLN 166 161  161  GLN GLN A . n 
A 1 167 PRO 167 162  162  PRO PRO A . n 
A 1 168 THR 168 163  163  THR THR A . n 
A 1 169 HIS 169 164  164  HIS HIS A . n 
A 1 170 PRO 170 165  165  PRO PRO A . n 
A 1 171 ILE 171 166  166  ILE ILE A . n 
A 1 172 ARG 172 167  167  ARG ARG A . n 
A 1 173 LEU 173 168  168  LEU LEU A . n 
A 1 174 GLY 174 169  169  GLY GLY A . n 
A 1 175 LEU 175 170  170  LEU LEU A . n 
A 1 176 ALA 176 171  171  ALA ALA A . n 
A 1 177 LEU 177 172  172  LEU LEU A . n 
A 1 178 ASN 178 173  173  ASN ASN A . n 
A 1 179 PHE 179 174  174  PHE PHE A . n 
A 1 180 SER 180 175  175  SER SER A . n 
A 1 181 VAL 181 176  176  VAL VAL A . n 
A 1 182 PHE 182 177  177  PHE PHE A . n 
A 1 183 TYR 183 178  178  TYR TYR A . n 
A 1 184 TYR 184 179  179  TYR TYR A . n 
A 1 185 GLU 185 180  180  GLU GLU A . n 
A 1 186 ILE 186 181  181  ILE ILE A . n 
A 1 187 LEU 187 182  182  LEU LEU A . n 
A 1 188 ASN 188 183  183  ASN ASN A . n 
A 1 189 SER 189 184  184  SER SER A . n 
A 1 190 PRO 190 185  185  PRO PRO A . n 
A 1 191 GLU 191 186  186  GLU ALA A . n 
A 1 192 LYS 192 187  187  LYS ALA A . n 
A 1 193 ALA 193 188  188  ALA ALA A . n 
A 1 194 CYS 194 189  189  CYS CYS A . n 
A 1 195 SER 195 190  190  SER SER A . n 
A 1 196 LEU 196 191  191  LEU LEU A . n 
A 1 197 ALA 197 192  192  ALA ALA A . n 
A 1 198 LYS 198 193  193  LYS LYS A . n 
A 1 199 THR 199 194  194  THR THR A . n 
A 1 200 ALA 200 195  195  ALA ALA A . n 
A 1 201 PHE 201 196  196  PHE PHE A . n 
A 1 202 ASP 202 197  197  ASP ASP A . n 
A 1 203 GLU 203 198  198  GLU GLU A . n 
A 1 204 ALA 204 199  199  ALA ALA A . n 
A 1 205 ILE 205 200  200  ILE ILE A . n 
A 1 206 ALA 206 201  201  ALA ALA A . n 
A 1 207 GLU 207 202  202  GLU GLU A . n 
A 1 208 LEU 208 203  203  LEU LEU A . n 
A 1 209 ASP 209 204  204  ASP ASP A . n 
A 1 210 THR 210 205  205  THR THR A . n 
A 1 211 LEU 211 206  206  LEU LEU A . n 
A 1 212 SER 212 207  207  SER SER A . n 
A 1 213 GLU 213 208  208  GLU GLU A . n 
A 1 214 GLU 214 209  209  GLU GLU A . n 
A 1 215 SER 215 210  210  SER SER A . n 
A 1 216 TYR 216 211  211  TYR TYR A . n 
A 1 217 LYS 217 212  212  LYS LYS A . n 
A 1 218 ASP 218 213  213  ASP ASP A . n 
A 1 219 SER 219 214  214  SER SER A . n 
A 1 220 THR 220 215  215  THR THR A . n 
A 1 221 LEU 221 216  216  LEU LEU A . n 
A 1 222 ILE 222 217  217  ILE ILE A . n 
A 1 223 MET 223 218  218  MET MET A . n 
A 1 224 GLN 224 219  219  GLN GLN A . n 
A 1 225 LEU 225 220  220  LEU LEU A . n 
A 1 226 LEU 226 221  221  LEU LEU A . n 
A 1 227 ARG 227 222  222  ARG ARG A . n 
A 1 228 ASP 228 223  223  ASP ASP A . n 
A 1 229 ASN 229 224  224  ASN ASN A . n 
A 1 230 LEU 230 225  225  LEU LEU A . n 
A 1 231 THR 231 226  226  THR THR A . n 
A 1 232 LEU 232 227  227  LEU LEU A . n 
A 1 233 TRP 233 228  228  TRP TRP A . n 
A 1 234 THR 234 229  229  THR THR A . n 
A 1 235 SER 235 230  230  SER SER A . n 
A 1 236 ASP 236 231  ?    ?   ?   A . n 
A 1 237 THR 237 232  ?    ?   ?   A . n 
A 1 238 GLN 238 233  ?    ?   ?   A . n 
A 1 239 GLY 239 234  ?    ?   ?   A . n 
A 1 240 ASP 240 235  ?    ?   ?   A . n 
A 1 241 GLU 241 236  ?    ?   ?   A . n 
A 1 242 ALA 242 237  ?    ?   ?   A . n 
A 1 243 GLU 243 238  ?    ?   ?   A . n 
A 1 244 ALA 244 239  ?    ?   ?   A . n 
A 1 245 GLY 245 240  ?    ?   ?   A . n 
A 1 246 GLU 246 241  ?    ?   ?   A . n 
A 1 247 GLY 247 242  ?    ?   ?   A . n 
A 1 248 GLY 248 243  ?    ?   ?   A . n 
A 1 249 GLU 249 244  ?    ?   ?   A . n 
A 1 250 ASN 250 245  ?    ?   ?   A . n 
B 2 1   GLY 1   1003 ?    ?   ?   B . n 
B 2 2   PHE 2   1004 ?    ?   ?   B . n 
B 2 3   PHE 3   1005 ?    ?   ?   B . n 
B 2 4   LYS 4   1006 1006 LYS LYS B . n 
B 2 5   ARG 5   1007 1007 ARG ARG B . n 
B 2 6   GLN 6   1008 1008 GLN GLN B . n 
B 2 7   TYR 7   1009 1009 TYR TYR B . n 
B 2 8   LYS 8   1010 1010 LYS LYS B . n 
B 2 9   SEP 9   1011 1011 SEP SEP B . n 
B 2 10  ILE 10  1012 1012 ILE ILE B . n 
B 2 11  LEU 11  1013 1013 LEU LEU B . n 
B 2 12  GLN 12  1014 ?    ?   ?   B . n 
B 2 13  GLU 13  1015 ?    ?   ?   B . n 
B 2 14  GLU 14  1016 ?    ?   ?   B . n 
B 2 15  ASN 15  1017 ?    ?   ?   B . n 
B 2 16  ARG 16  1018 ?    ?   ?   B . n 
B 2 17  ARG 17  1019 ?    ?   ?   B . n 
B 2 18  ASP 18  1020 ?    ?   ?   B . n 
B 2 19  SER 19  1021 ?    ?   ?   B . n 
B 2 20  TRP 20  1022 ?    ?   ?   B . n 
B 2 21  SER 21  1023 ?    ?   ?   B . n 
B 2 22  TYR 22  1024 ?    ?   ?   B . n 
B 2 23  ILE 23  1025 ?    ?   ?   B . n 
B 2 24  ASN 24  1026 ?    ?   ?   B . n 
B 2 25  SER 25  1027 ?    ?   ?   B . n 
B 2 26  LYS 26  1028 ?    ?   ?   B . n 
B 2 27  SER 27  1029 ?    ?   ?   B . n 
B 2 28  ASN 28  1030 ?    ?   ?   B . n 
B 2 29  ASP 29  1031 ?    ?   ?   B . n 
B 2 30  ASP 30  1032 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1   301  1  GOL GOL A . 
D 4 HOH 1   401  2  HOH HOH A . 
D 4 HOH 2   402  3  HOH HOH A . 
D 4 HOH 3   403  4  HOH HOH A . 
D 4 HOH 4   404  5  HOH HOH A . 
D 4 HOH 5   405  6  HOH HOH A . 
D 4 HOH 6   406  7  HOH HOH A . 
D 4 HOH 7   407  8  HOH HOH A . 
D 4 HOH 8   408  9  HOH HOH A . 
D 4 HOH 9   409  1  HOH HOH A . 
D 4 HOH 10  410  1  HOH HOH A . 
D 4 HOH 11  411  1  HOH HOH A . 
D 4 HOH 12  412  1  HOH HOH A . 
D 4 HOH 13  413  1  HOH HOH A . 
D 4 HOH 14  414  1  HOH HOH A . 
D 4 HOH 15  415  1  HOH HOH A . 
D 4 HOH 16  416  1  HOH HOH A . 
D 4 HOH 17  417  2  HOH HOH A . 
D 4 HOH 18  418  2  HOH HOH A . 
D 4 HOH 19  419  2  HOH HOH A . 
D 4 HOH 20  420  2  HOH HOH A . 
D 4 HOH 21  421  2  HOH HOH A . 
D 4 HOH 22  422  2  HOH HOH A . 
D 4 HOH 23  423  2  HOH HOH A . 
D 4 HOH 24  424  2  HOH HOH A . 
D 4 HOH 25  425  2  HOH HOH A . 
D 4 HOH 26  426  2  HOH HOH A . 
D 4 HOH 27  427  3  HOH HOH A . 
D 4 HOH 28  428  3  HOH HOH A . 
D 4 HOH 29  429  3  HOH HOH A . 
D 4 HOH 30  430  3  HOH HOH A . 
D 4 HOH 31  431  3  HOH HOH A . 
D 4 HOH 32  432  3  HOH HOH A . 
D 4 HOH 33  433  3  HOH HOH A . 
D 4 HOH 34  434  3  HOH HOH A . 
D 4 HOH 35  435  3  HOH HOH A . 
D 4 HOH 36  436  3  HOH HOH A . 
D 4 HOH 37  437  4  HOH HOH A . 
D 4 HOH 38  438  4  HOH HOH A . 
D 4 HOH 39  439  4  HOH HOH A . 
D 4 HOH 40  440  4  HOH HOH A . 
D 4 HOH 41  441  4  HOH HOH A . 
D 4 HOH 42  442  4  HOH HOH A . 
D 4 HOH 43  443  4  HOH HOH A . 
D 4 HOH 44  444  4  HOH HOH A . 
D 4 HOH 45  445  4  HOH HOH A . 
D 4 HOH 46  446  4  HOH HOH A . 
D 4 HOH 47  447  5  HOH HOH A . 
D 4 HOH 48  448  5  HOH HOH A . 
D 4 HOH 49  449  5  HOH HOH A . 
D 4 HOH 50  450  5  HOH HOH A . 
D 4 HOH 51  451  5  HOH HOH A . 
D 4 HOH 52  452  5  HOH HOH A . 
D 4 HOH 53  453  5  HOH HOH A . 
D 4 HOH 54  454  5  HOH HOH A . 
D 4 HOH 55  455  5  HOH HOH A . 
D 4 HOH 56  456  6  HOH HOH A . 
D 4 HOH 57  457  6  HOH HOH A . 
D 4 HOH 58  458  6  HOH HOH A . 
D 4 HOH 59  459  6  HOH HOH A . 
D 4 HOH 60  460  6  HOH HOH A . 
D 4 HOH 61  461  6  HOH HOH A . 
D 4 HOH 62  462  6  HOH HOH A . 
D 4 HOH 63  463  6  HOH HOH A . 
D 4 HOH 64  464  6  HOH HOH A . 
D 4 HOH 65  465  7  HOH HOH A . 
D 4 HOH 66  466  7  HOH HOH A . 
D 4 HOH 67  467  7  HOH HOH A . 
D 4 HOH 68  468  7  HOH HOH A . 
D 4 HOH 69  469  7  HOH HOH A . 
D 4 HOH 70  470  7  HOH HOH A . 
D 4 HOH 71  471  7  HOH HOH A . 
D 4 HOH 72  472  7  HOH HOH A . 
D 4 HOH 73  473  7  HOH HOH A . 
D 4 HOH 74  474  7  HOH HOH A . 
D 4 HOH 75  475  8  HOH HOH A . 
D 4 HOH 76  476  8  HOH HOH A . 
D 4 HOH 77  477  8  HOH HOH A . 
D 4 HOH 78  478  8  HOH HOH A . 
D 4 HOH 79  479  8  HOH HOH A . 
D 4 HOH 80  480  8  HOH HOH A . 
D 4 HOH 81  481  8  HOH HOH A . 
D 4 HOH 82  482  8  HOH HOH A . 
D 4 HOH 83  483  8  HOH HOH A . 
D 4 HOH 84  484  8  HOH HOH A . 
D 4 HOH 85  485  9  HOH HOH A . 
D 4 HOH 86  486  9  HOH HOH A . 
D 4 HOH 87  487  9  HOH HOH A . 
D 4 HOH 88  488  9  HOH HOH A . 
D 4 HOH 89  489  9  HOH HOH A . 
D 4 HOH 90  490  9  HOH HOH A . 
D 4 HOH 91  491  9  HOH HOH A . 
D 4 HOH 92  492  9  HOH HOH A . 
D 4 HOH 93  493  9  HOH HOH A . 
D 4 HOH 94  494  9  HOH HOH A . 
D 4 HOH 95  495  10 HOH HOH A . 
D 4 HOH 96  496  10 HOH HOH A . 
D 4 HOH 97  497  10 HOH HOH A . 
D 4 HOH 98  498  10 HOH HOH A . 
D 4 HOH 99  499  10 HOH HOH A . 
D 4 HOH 100 500  10 HOH HOH A . 
D 4 HOH 101 501  10 HOH HOH A . 
D 4 HOH 102 502  10 HOH HOH A . 
D 4 HOH 103 503  10 HOH HOH A . 
D 4 HOH 104 504  10 HOH HOH A . 
D 4 HOH 105 505  11 HOH HOH A . 
D 4 HOH 106 506  11 HOH HOH A . 
D 4 HOH 107 507  11 HOH HOH A . 
D 4 HOH 108 508  11 HOH HOH A . 
D 4 HOH 109 509  11 HOH HOH A . 
D 4 HOH 110 510  11 HOH HOH A . 
D 4 HOH 111 511  11 HOH HOH A . 
D 4 HOH 112 512  11 HOH HOH A . 
D 4 HOH 113 513  11 HOH HOH A . 
D 4 HOH 114 514  11 HOH HOH A . 
D 4 HOH 115 515  12 HOH HOH A . 
E 4 HOH 1   1101 1  HOH HOH B . 
E 4 HOH 2   1102 1  HOH HOH B . 
E 4 HOH 3   1103 1  HOH HOH B . 
E 4 HOH 4   1104 5  HOH HOH B . 
E 4 HOH 5   1105 6  HOH HOH B . 
E 4 HOH 6   1106 12 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     9 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      1011 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1300  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  12620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-06-26 
2 'Structure model' 1 1 2014-03-19 
3 'Structure model' 1 2 2018-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Experimental preparation' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.pdbx_details' 
2 3 'Structure model' '_exptl_crystal_grow.temp'         
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         22.1337 
_pdbx_refine_tls.origin_y         7.8900 
_pdbx_refine_tls.origin_z         17.4031 
_pdbx_refine_tls.T[1][1]          -0.0376 
_pdbx_refine_tls.T[2][2]          -0.1533 
_pdbx_refine_tls.T[3][3]          -0.0456 
_pdbx_refine_tls.T[1][2]          0.0065 
_pdbx_refine_tls.T[1][3]          -0.1870 
_pdbx_refine_tls.T[2][3]          0.0198 
_pdbx_refine_tls.L[1][1]          0.8825 
_pdbx_refine_tls.L[2][2]          2.6943 
_pdbx_refine_tls.L[3][3]          1.5350 
_pdbx_refine_tls.L[1][2]          -0.3647 
_pdbx_refine_tls.L[1][3]          -0.4773 
_pdbx_refine_tls.L[2][3]          0.6138 
_pdbx_refine_tls.S[1][1]          -0.0858 
_pdbx_refine_tls.S[1][2]          -0.1571 
_pdbx_refine_tls.S[1][3]          0.0414 
_pdbx_refine_tls.S[2][1]          0.7998 
_pdbx_refine_tls.S[2][2]          0.0807 
_pdbx_refine_tls.S[2][3]          -0.6837 
_pdbx_refine_tls.S[3][1]          -0.0055 
_pdbx_refine_tls.S[3][2]          0.1525 
_pdbx_refine_tls.S[3][3]          0.0051 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     2 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     230 
_pdbx_refine_tls_group.selection_details   '{ A|2 - A|230 }' 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
ADSC   'data collection' Quantum ? 1 ? ? ? ? 
PHASER phasing           .       ? 2 ? ? ? ? 
BUSTER refinement        2.10.0  ? 3 ? ? ? ? 
MOSFLM 'data reduction'  .       ? 4 ? ? ? ? 
SCALA  'data scaling'    .       ? 5 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 453 ? ? O A HOH 509 ? ? 1.29 
2 1 O A HOH 486 ? ? O A HOH 507 ? ? 1.95 
3 1 O A HOH 424 ? ? O A HOH 505 ? ? 2.05 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 18  ? ? -113.24 78.98  
2 1 PHE A 104 ? ? -124.88 -57.53 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 9   ? CG  ? A LYS 14  CG  
2  1 Y 1 A LYS 9   ? CD  ? A LYS 14  CD  
3  1 Y 1 A LYS 9   ? CE  ? A LYS 14  CE  
4  1 Y 1 A LYS 9   ? NZ  ? A LYS 14  NZ  
5  1 Y 1 A LYS 158 ? CD  ? A LYS 163 CD  
6  1 Y 1 A LYS 158 ? CE  ? A LYS 163 CE  
7  1 Y 1 A LYS 158 ? NZ  ? A LYS 163 NZ  
8  1 Y 1 A GLU 186 ? CG  ? A GLU 191 CG  
9  1 Y 1 A GLU 186 ? CD  ? A GLU 191 CD  
10 1 Y 1 A GLU 186 ? OE1 ? A GLU 191 OE1 
11 1 Y 1 A GLU 186 ? OE2 ? A GLU 191 OE2 
12 1 Y 1 A LYS 187 ? CG  ? A LYS 192 CG  
13 1 Y 1 A LYS 187 ? CD  ? A LYS 192 CD  
14 1 Y 1 A LYS 187 ? CE  ? A LYS 192 CE  
15 1 Y 1 A LYS 187 ? NZ  ? A LYS 192 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -4   ? A GLY 1   
2  1 Y 1 A PRO -3   ? A PRO 2   
3  1 Y 1 A LEU -2   ? A LEU 3   
4  1 Y 1 A GLY -1   ? A GLY 4   
5  1 Y 1 A SER 0    ? A SER 5   
6  1 Y 1 A MET 1    ? A MET 6   
7  1 Y 1 A ASP 231  ? A ASP 236 
8  1 Y 1 A THR 232  ? A THR 237 
9  1 Y 1 A GLN 233  ? A GLN 238 
10 1 Y 1 A GLY 234  ? A GLY 239 
11 1 Y 1 A ASP 235  ? A ASP 240 
12 1 Y 1 A GLU 236  ? A GLU 241 
13 1 Y 1 A ALA 237  ? A ALA 242 
14 1 Y 1 A GLU 238  ? A GLU 243 
15 1 Y 1 A ALA 239  ? A ALA 244 
16 1 Y 1 A GLY 240  ? A GLY 245 
17 1 Y 1 A GLU 241  ? A GLU 246 
18 1 Y 1 A GLY 242  ? A GLY 247 
19 1 Y 1 A GLY 243  ? A GLY 248 
20 1 Y 1 A GLU 244  ? A GLU 249 
21 1 Y 1 A ASN 245  ? A ASN 250 
22 1 Y 1 B GLY 1003 ? B GLY 1   
23 1 Y 1 B PHE 1004 ? B PHE 2   
24 1 Y 1 B PHE 1005 ? B PHE 3   
25 1 Y 1 B GLN 1014 ? B GLN 12  
26 1 Y 1 B GLU 1015 ? B GLU 13  
27 1 Y 1 B GLU 1016 ? B GLU 14  
28 1 Y 1 B ASN 1017 ? B ASN 15  
29 1 Y 1 B ARG 1018 ? B ARG 16  
30 1 Y 1 B ARG 1019 ? B ARG 17  
31 1 Y 1 B ASP 1020 ? B ASP 18  
32 1 Y 1 B SER 1021 ? B SER 19  
33 1 Y 1 B TRP 1022 ? B TRP 20  
34 1 Y 1 B SER 1023 ? B SER 21  
35 1 Y 1 B TYR 1024 ? B TYR 22  
36 1 Y 1 B ILE 1025 ? B ILE 23  
37 1 Y 1 B ASN 1026 ? B ASN 24  
38 1 Y 1 B SER 1027 ? B SER 25  
39 1 Y 1 B LYS 1028 ? B LYS 26  
40 1 Y 1 B SER 1029 ? B SER 27  
41 1 Y 1 B ASN 1030 ? B ASN 28  
42 1 Y 1 B ASP 1031 ? B ASP 29  
43 1 Y 1 B ASP 1032 ? B ASP 30  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
#