data_4HXG
# 
_entry.id   4HXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HXG         
RCSB  RCSB076041   
WWPDB D_1000076041 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4HXE . unspecified 
PDB 4HXG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4HXG 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kiss-Szeman, A.' 1  
'Menyhard, D.K.'  2  
'Tichy-Racs, E.'  3  
'Hornung, B.'     4  
'Radi, K.'        5  
'Szeltner, Z.'    6  
'Domokos, K.'     7  
'Szamosi, I.'     8  
'Naray-Szabo, G.' 9  
'Polgar, L.'      10 
'Harmat, V.'      11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'A Self-compartmentalizing Hexamer Serine Protease from Pyrococcus Horikoshii: SUBSTRATE SELECTION ACHIEVED THROUGH MULTIMERIZATION.' 
J.Biol.Chem.         288  17884 17894 2013 JBCHA3 US 0021-9258 0071 ? 23632025 10.1074/jbc.M113.451534      
1       'Characterization of a novel acylaminoacyl peptidase with hexameric structure and endopeptidase activity.' 
Biochim.Biophys.Acta 1794 1204  1210  2009 BBACAQ NE 0006-3002 0113 ? 19303951 10.1016/j.bbapap.2009.03.004 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Menyhard, D.K.'  1  
primary 'Kiss-Szeman, A.' 2  
primary 'Tichy-Racs, E.'  3  
primary 'Hornung, B.'     4  
primary 'Radi, K.'        5  
primary 'Szeltner, Z.'    6  
primary 'Domokos, K.'     7  
primary 'Szamosi, I.'     8  
primary 'Naray-Szabo, G.' 9  
primary 'Polgar, L.'      10 
primary 'Harmat, V.'      11 
1       'Szeltner, Z.'    12 
1       'Kiss, A.L.'      13 
1       'Domokos, K.'     14 
1       'Harmat, V.'      15 
1       'Naray-Szabo, G.' 16 
1       'Polgar, L.'      17 
# 
_cell.entry_id           4HXG 
_cell.length_a           183.310 
_cell.length_b           183.800 
_cell.length_c           275.740 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4HXG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Putative uncharacterized protein PH0594' 73320.281 12   3.4.19.1 S466A ? ? 
2 non-polymer syn HEXANE-1,6-DIOL                           118.174   26   ?        ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION'                           24.305    21   ?        ?     ? ? 
4 non-polymer syn 'CHLORIDE ION'                            35.453    2    ?        ?     ? ? 
5 water       nat water                                     18.015    1147 ?        ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENLEDGSRKFIEDASMPRISPDGKKIAFMRFNE
EKKTAQIWVADLKTLSAKKVLEAKNIRSIEWNQDSRRLLAVGFKRREDEDFIFEDDVPAWFDNMGFFDGEKTTFWVIDTE
GEEVIEQFEKPRFSSGIWHGDSIVVSVPHRDVIPRYFKYWDIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPEKKYV
SEHDKIYIYDGEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVREIAKGKHWIMGFDADERLIYLKETAT
RPAELYLWDGEERQLTDYNGLIFKKLKTFEPRHFRFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEM
QLMASKGYYIVYVNPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLRLEPQADRERIGITGIAYGGYMTNWALTQSD
LFKAGISENGISYWLTSYAFSDIGLWFDKEVIGDNPLENENYRKLSPLFYAKNVKAPLLLIHSLEDYRCPLDQSLMFYHV
LKDLGKEVYIAIFKKGAHGHSIRGSPRHRMKRYKLFMEFFERKLKKYEEGFDVEKILKEEKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENLEDGSRKFIEDASMPRISPDGKKIAFMRFNE
EKKTAQIWVADLKTLSAKKVLEAKNIRSIEWNQDSRRLLAVGFKRREDEDFIFEDDVPAWFDNMGFFDGEKTTFWVIDTE
GEEVIEQFEKPRFSSGIWHGDSIVVSVPHRDVIPRYFKYWDIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPEKKYV
SEHDKIYIYDGEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVREIAKGKHWIMGFDADERLIYLKETAT
RPAELYLWDGEERQLTDYNGLIFKKLKTFEPRHFRFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEM
QLMASKGYYIVYVNPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLRLEPQADRERIGITGIAYGGYMTNWALTQSD
LFKAGISENGISYWLTSYAFSDIGLWFDKEVIGDNPLENENYRKLSPLFYAKNVKAPLLLIHSLEDYRCPLDQSLMFYHV
LKDLGKEVYIAIFKKGAHGHSIRGSPRHRMKRYKLFMEFFERKLKKYEEGFDVEKILKEEKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   SER n 
1 4   ILE n 
1 5   GLU n 
1 6   TRP n 
1 7   ASP n 
1 8   GLU n 
1 9   LYS n 
1 10  THR n 
1 11  PHE n 
1 12  THR n 
1 13  LYS n 
1 14  PHE n 
1 15  ALA n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  ASP n 
1 20  PRO n 
1 21  ARG n 
1 22  THR n 
1 23  ARG n 
1 24  LYS n 
1 25  ASN n 
1 26  LEU n 
1 27  VAL n 
1 28  ALA n 
1 29  TYR n 
1 30  VAL n 
1 31  LEU n 
1 32  THR n 
1 33  LYS n 
1 34  ALA n 
1 35  ASN n 
1 36  LEU n 
1 37  GLU n 
1 38  SER n 
1 39  ASN n 
1 40  LYS n 
1 41  TYR n 
1 42  GLU n 
1 43  ASN n 
1 44  THR n 
1 45  ILE n 
1 46  VAL n 
1 47  ILE n 
1 48  GLU n 
1 49  ASN n 
1 50  LEU n 
1 51  GLU n 
1 52  ASP n 
1 53  GLY n 
1 54  SER n 
1 55  ARG n 
1 56  LYS n 
1 57  PHE n 
1 58  ILE n 
1 59  GLU n 
1 60  ASP n 
1 61  ALA n 
1 62  SER n 
1 63  MET n 
1 64  PRO n 
1 65  ARG n 
1 66  ILE n 
1 67  SER n 
1 68  PRO n 
1 69  ASP n 
1 70  GLY n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  ALA n 
1 75  PHE n 
1 76  MET n 
1 77  ARG n 
1 78  PHE n 
1 79  ASN n 
1 80  GLU n 
1 81  GLU n 
1 82  LYS n 
1 83  LYS n 
1 84  THR n 
1 85  ALA n 
1 86  GLN n 
1 87  ILE n 
1 88  TRP n 
1 89  VAL n 
1 90  ALA n 
1 91  ASP n 
1 92  LEU n 
1 93  LYS n 
1 94  THR n 
1 95  LEU n 
1 96  SER n 
1 97  ALA n 
1 98  LYS n 
1 99  LYS n 
1 100 VAL n 
1 101 LEU n 
1 102 GLU n 
1 103 ALA n 
1 104 LYS n 
1 105 ASN n 
1 106 ILE n 
1 107 ARG n 
1 108 SER n 
1 109 ILE n 
1 110 GLU n 
1 111 TRP n 
1 112 ASN n 
1 113 GLN n 
1 114 ASP n 
1 115 SER n 
1 116 ARG n 
1 117 ARG n 
1 118 LEU n 
1 119 LEU n 
1 120 ALA n 
1 121 VAL n 
1 122 GLY n 
1 123 PHE n 
1 124 LYS n 
1 125 ARG n 
1 126 ARG n 
1 127 GLU n 
1 128 ASP n 
1 129 GLU n 
1 130 ASP n 
1 131 PHE n 
1 132 ILE n 
1 133 PHE n 
1 134 GLU n 
1 135 ASP n 
1 136 ASP n 
1 137 VAL n 
1 138 PRO n 
1 139 ALA n 
1 140 TRP n 
1 141 PHE n 
1 142 ASP n 
1 143 ASN n 
1 144 MET n 
1 145 GLY n 
1 146 PHE n 
1 147 PHE n 
1 148 ASP n 
1 149 GLY n 
1 150 GLU n 
1 151 LYS n 
1 152 THR n 
1 153 THR n 
1 154 PHE n 
1 155 TRP n 
1 156 VAL n 
1 157 ILE n 
1 158 ASP n 
1 159 THR n 
1 160 GLU n 
1 161 GLY n 
1 162 GLU n 
1 163 GLU n 
1 164 VAL n 
1 165 ILE n 
1 166 GLU n 
1 167 GLN n 
1 168 PHE n 
1 169 GLU n 
1 170 LYS n 
1 171 PRO n 
1 172 ARG n 
1 173 PHE n 
1 174 SER n 
1 175 SER n 
1 176 GLY n 
1 177 ILE n 
1 178 TRP n 
1 179 HIS n 
1 180 GLY n 
1 181 ASP n 
1 182 SER n 
1 183 ILE n 
1 184 VAL n 
1 185 VAL n 
1 186 SER n 
1 187 VAL n 
1 188 PRO n 
1 189 HIS n 
1 190 ARG n 
1 191 ASP n 
1 192 VAL n 
1 193 ILE n 
1 194 PRO n 
1 195 ARG n 
1 196 TYR n 
1 197 PHE n 
1 198 LYS n 
1 199 TYR n 
1 200 TRP n 
1 201 ASP n 
1 202 ILE n 
1 203 TYR n 
1 204 LEU n 
1 205 TRP n 
1 206 LYS n 
1 207 ASP n 
1 208 GLY n 
1 209 GLU n 
1 210 GLU n 
1 211 GLU n 
1 212 LYS n 
1 213 LEU n 
1 214 PHE n 
1 215 GLU n 
1 216 LYS n 
1 217 VAL n 
1 218 SER n 
1 219 PHE n 
1 220 TYR n 
1 221 ALA n 
1 222 ILE n 
1 223 ASP n 
1 224 SER n 
1 225 ASP n 
1 226 GLY n 
1 227 GLU n 
1 228 ARG n 
1 229 ILE n 
1 230 LEU n 
1 231 LEU n 
1 232 TYR n 
1 233 GLY n 
1 234 LYS n 
1 235 PRO n 
1 236 GLU n 
1 237 LYS n 
1 238 LYS n 
1 239 TYR n 
1 240 VAL n 
1 241 SER n 
1 242 GLU n 
1 243 HIS n 
1 244 ASP n 
1 245 LYS n 
1 246 ILE n 
1 247 TYR n 
1 248 ILE n 
1 249 TYR n 
1 250 ASP n 
1 251 GLY n 
1 252 GLU n 
1 253 VAL n 
1 254 LYS n 
1 255 GLY n 
1 256 ILE n 
1 257 LEU n 
1 258 ASP n 
1 259 ASP n 
1 260 ILE n 
1 261 ASP n 
1 262 ARG n 
1 263 GLU n 
1 264 VAL n 
1 265 ALA n 
1 266 GLN n 
1 267 ALA n 
1 268 LYS n 
1 269 ILE n 
1 270 ARG n 
1 271 ASN n 
1 272 GLY n 
1 273 LYS n 
1 274 VAL n 
1 275 TYR n 
1 276 PHE n 
1 277 THR n 
1 278 LEU n 
1 279 PHE n 
1 280 GLU n 
1 281 GLU n 
1 282 GLY n 
1 283 SER n 
1 284 VAL n 
1 285 ASN n 
1 286 LEU n 
1 287 TYR n 
1 288 LEU n 
1 289 TRP n 
1 290 ASP n 
1 291 GLY n 
1 292 GLU n 
1 293 VAL n 
1 294 ARG n 
1 295 GLU n 
1 296 ILE n 
1 297 ALA n 
1 298 LYS n 
1 299 GLY n 
1 300 LYS n 
1 301 HIS n 
1 302 TRP n 
1 303 ILE n 
1 304 MET n 
1 305 GLY n 
1 306 PHE n 
1 307 ASP n 
1 308 ALA n 
1 309 ASP n 
1 310 GLU n 
1 311 ARG n 
1 312 LEU n 
1 313 ILE n 
1 314 TYR n 
1 315 LEU n 
1 316 LYS n 
1 317 GLU n 
1 318 THR n 
1 319 ALA n 
1 320 THR n 
1 321 ARG n 
1 322 PRO n 
1 323 ALA n 
1 324 GLU n 
1 325 LEU n 
1 326 TYR n 
1 327 LEU n 
1 328 TRP n 
1 329 ASP n 
1 330 GLY n 
1 331 GLU n 
1 332 GLU n 
1 333 ARG n 
1 334 GLN n 
1 335 LEU n 
1 336 THR n 
1 337 ASP n 
1 338 TYR n 
1 339 ASN n 
1 340 GLY n 
1 341 LEU n 
1 342 ILE n 
1 343 PHE n 
1 344 LYS n 
1 345 LYS n 
1 346 LEU n 
1 347 LYS n 
1 348 THR n 
1 349 PHE n 
1 350 GLU n 
1 351 PRO n 
1 352 ARG n 
1 353 HIS n 
1 354 PHE n 
1 355 ARG n 
1 356 PHE n 
1 357 LYS n 
1 358 SER n 
1 359 ILE n 
1 360 ASP n 
1 361 LEU n 
1 362 GLU n 
1 363 LEU n 
1 364 ASP n 
1 365 GLY n 
1 366 TRP n 
1 367 TYR n 
1 368 ILE n 
1 369 LYS n 
1 370 PRO n 
1 371 GLU n 
1 372 ILE n 
1 373 LYS n 
1 374 GLU n 
1 375 GLY n 
1 376 GLU n 
1 377 LYS n 
1 378 ALA n 
1 379 PRO n 
1 380 VAL n 
1 381 ILE n 
1 382 VAL n 
1 383 PHE n 
1 384 VAL n 
1 385 HIS n 
1 386 GLY n 
1 387 GLY n 
1 388 PRO n 
1 389 LYS n 
1 390 GLY n 
1 391 MET n 
1 392 TYR n 
1 393 GLY n 
1 394 TYR n 
1 395 TYR n 
1 396 PHE n 
1 397 LYS n 
1 398 TYR n 
1 399 GLU n 
1 400 MET n 
1 401 GLN n 
1 402 LEU n 
1 403 MET n 
1 404 ALA n 
1 405 SER n 
1 406 LYS n 
1 407 GLY n 
1 408 TYR n 
1 409 TYR n 
1 410 ILE n 
1 411 VAL n 
1 412 TYR n 
1 413 VAL n 
1 414 ASN n 
1 415 PRO n 
1 416 ARG n 
1 417 GLY n 
1 418 SER n 
1 419 ASN n 
1 420 GLY n 
1 421 TYR n 
1 422 SER n 
1 423 GLU n 
1 424 ASP n 
1 425 PHE n 
1 426 ALA n 
1 427 LEU n 
1 428 ARG n 
1 429 VAL n 
1 430 LEU n 
1 431 GLU n 
1 432 ARG n 
1 433 THR n 
1 434 GLY n 
1 435 LEU n 
1 436 GLU n 
1 437 ASP n 
1 438 PHE n 
1 439 GLN n 
1 440 ASP n 
1 441 ILE n 
1 442 LEU n 
1 443 ASN n 
1 444 GLY n 
1 445 ILE n 
1 446 GLU n 
1 447 GLU n 
1 448 PHE n 
1 449 LEU n 
1 450 ARG n 
1 451 LEU n 
1 452 GLU n 
1 453 PRO n 
1 454 GLN n 
1 455 ALA n 
1 456 ASP n 
1 457 ARG n 
1 458 GLU n 
1 459 ARG n 
1 460 ILE n 
1 461 GLY n 
1 462 ILE n 
1 463 THR n 
1 464 GLY n 
1 465 ILE n 
1 466 ALA n 
1 467 TYR n 
1 468 GLY n 
1 469 GLY n 
1 470 TYR n 
1 471 MET n 
1 472 THR n 
1 473 ASN n 
1 474 TRP n 
1 475 ALA n 
1 476 LEU n 
1 477 THR n 
1 478 GLN n 
1 479 SER n 
1 480 ASP n 
1 481 LEU n 
1 482 PHE n 
1 483 LYS n 
1 484 ALA n 
1 485 GLY n 
1 486 ILE n 
1 487 SER n 
1 488 GLU n 
1 489 ASN n 
1 490 GLY n 
1 491 ILE n 
1 492 SER n 
1 493 TYR n 
1 494 TRP n 
1 495 LEU n 
1 496 THR n 
1 497 SER n 
1 498 TYR n 
1 499 ALA n 
1 500 PHE n 
1 501 SER n 
1 502 ASP n 
1 503 ILE n 
1 504 GLY n 
1 505 LEU n 
1 506 TRP n 
1 507 PHE n 
1 508 ASP n 
1 509 LYS n 
1 510 GLU n 
1 511 VAL n 
1 512 ILE n 
1 513 GLY n 
1 514 ASP n 
1 515 ASN n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 ASN n 
1 520 GLU n 
1 521 ASN n 
1 522 TYR n 
1 523 ARG n 
1 524 LYS n 
1 525 LEU n 
1 526 SER n 
1 527 PRO n 
1 528 LEU n 
1 529 PHE n 
1 530 TYR n 
1 531 ALA n 
1 532 LYS n 
1 533 ASN n 
1 534 VAL n 
1 535 LYS n 
1 536 ALA n 
1 537 PRO n 
1 538 LEU n 
1 539 LEU n 
1 540 LEU n 
1 541 ILE n 
1 542 HIS n 
1 543 SER n 
1 544 LEU n 
1 545 GLU n 
1 546 ASP n 
1 547 TYR n 
1 548 ARG n 
1 549 CYS n 
1 550 PRO n 
1 551 LEU n 
1 552 ASP n 
1 553 GLN n 
1 554 SER n 
1 555 LEU n 
1 556 MET n 
1 557 PHE n 
1 558 TYR n 
1 559 HIS n 
1 560 VAL n 
1 561 LEU n 
1 562 LYS n 
1 563 ASP n 
1 564 LEU n 
1 565 GLY n 
1 566 LYS n 
1 567 GLU n 
1 568 VAL n 
1 569 TYR n 
1 570 ILE n 
1 571 ALA n 
1 572 ILE n 
1 573 PHE n 
1 574 LYS n 
1 575 LYS n 
1 576 GLY n 
1 577 ALA n 
1 578 HIS n 
1 579 GLY n 
1 580 HIS n 
1 581 SER n 
1 582 ILE n 
1 583 ARG n 
1 584 GLY n 
1 585 SER n 
1 586 PRO n 
1 587 ARG n 
1 588 HIS n 
1 589 ARG n 
1 590 MET n 
1 591 LYS n 
1 592 ARG n 
1 593 TYR n 
1 594 LYS n 
1 595 LEU n 
1 596 PHE n 
1 597 MET n 
1 598 GLU n 
1 599 PHE n 
1 600 PHE n 
1 601 GLU n 
1 602 ARG n 
1 603 LYS n 
1 604 LEU n 
1 605 LYS n 
1 606 LYS n 
1 607 TYR n 
1 608 GLU n 
1 609 GLU n 
1 610 GLY n 
1 611 PHE n 
1 612 ASP n 
1 613 VAL n 
1 614 GLU n 
1 615 LYS n 
1 616 ILE n 
1 617 LEU n 
1 618 LYS n 
1 619 GLU n 
1 620 GLU n 
1 621 LYS n 
1 622 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PH0594 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus horikoshii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     70601 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O58323_PYRHO 
_struct_ref.pdbx_db_accession          O58323 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTSIEWDEKTFTKFAYLSDPRTRKNLVAYVLTKANLESNKYENTIVIENLEDGSRKFIEDASMPRISPDGKKIAFMRFNE
EKKTAQIWVADLKTLSAKKVLEAKNIRSIEWNQDSRRLLAVGFKRREDEDFIFEDDVPAWFDNMGFFDGEKTTFWVIDTE
GEEVIEQFEKPRFSSGIWHGDSIVVSVPHRDVIPRYFKYWDIYLWKDGEEEKLFEKVSFYAIDSDGERILLYGKPEKKYV
SEHDKIYIYDGEVKGILDDIDREVAQAKIRNGKVYFTLFEEGSVNLYLWDGEVREIAKGKHWIMGFDADERLIYLKETAT
RPAELYLWDGEERQLTDYNGLIFKKLKTFEPRHFRFKSIDLELDGWYIKPEIKEGEKAPVIVFVHGGPKGMYGYYFKYEM
QLMASKGYYIVYVNPRGSNGYSEDFALRVLERTGLEDFQDILNGIEEFLRLEPQADRERIGITGISYGGYMTNWALTQSD
LFKAGISENGISYWLTSYAFSDIGLWFDKEVIGDNPLENENYRKLSPLFYAKNVKAPLLLIHSLEDYRCPLDQSLMFYHV
LKDLGKEVYIAIFKKGAHGHSIRGSPRHRMKRYKLFMEFFERKLKKYEEGFDVEKILKEEKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4HXG A 1 ? 622 ? O58323 1 ? 622 ? 1 622 
2  1 4HXG B 1 ? 622 ? O58323 1 ? 622 ? 1 622 
3  1 4HXG C 1 ? 622 ? O58323 1 ? 622 ? 1 622 
4  1 4HXG D 1 ? 622 ? O58323 1 ? 622 ? 1 622 
5  1 4HXG E 1 ? 622 ? O58323 1 ? 622 ? 1 622 
6  1 4HXG F 1 ? 622 ? O58323 1 ? 622 ? 1 622 
7  1 4HXG G 1 ? 622 ? O58323 1 ? 622 ? 1 622 
8  1 4HXG H 1 ? 622 ? O58323 1 ? 622 ? 1 622 
9  1 4HXG I 1 ? 622 ? O58323 1 ? 622 ? 1 622 
10 1 4HXG J 1 ? 622 ? O58323 1 ? 622 ? 1 622 
11 1 4HXG K 1 ? 622 ? O58323 1 ? 622 ? 1 622 
12 1 4HXG L 1 ? 622 ? O58323 1 ? 622 ? 1 622 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4HXG ALA A 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 1  
2  4HXG ALA B 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 2  
3  4HXG ALA C 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 3  
4  4HXG ALA D 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 4  
5  4HXG ALA E 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 5  
6  4HXG ALA F 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 6  
7  4HXG ALA G 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 7  
8  4HXG ALA H 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 8  
9  4HXG ALA I 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 9  
10 4HXG ALA J 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 10 
11 4HXG ALA K 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 11 
12 4HXG ALA L 466 ? UNP O58323 SER 466 'ENGINEERED MUTATION' 466 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HEZ non-polymer         . HEXANE-1,6-DIOL ? 'C6 H14 O2'      118.174 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4HXG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-06-29 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0715 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0715 
# 
_reflns.entry_id                     4HXG 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   255208 
_reflns.number_all                   255208 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.47 
_reflns.B_iso_Wilson_estimate        50.89 
_reflns.pdbx_redundancy              4.39 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.72 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.69 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.36 
_reflns_shell.pdbx_redundancy        4.335 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      19084 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4HXG 
_refine.ls_number_reflns_obs                     222127 
_refine.ls_number_reflns_all                     222127 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.980 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    87.59 
_refine.ls_R_factor_obs                          0.2002 
_refine.ls_R_factor_all                          0.2002 
_refine.ls_R_factor_R_work                       0.1999 
_refine.ls_R_factor_R_free                       0.2407 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.79 
_refine.ls_number_reflns_R_free                  1751 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -10.7705 
_refine.aniso_B[2][2]                            -8.7263 
_refine.aniso_B[3][3]                            -21.1662 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.276 
_refine.solvent_model_param_bsol                 40.004 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.95 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'Ramachandran restraints were applied' 
_refine.pdbx_starting_model                      'PDB ENTRY 4HXF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'thin shells' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.pdbx_overall_phase_error                 24.85 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        58377 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         231 
_refine_hist.number_atoms_solvent             1147 
_refine_hist.number_atoms_total               59755 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        19.980 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.005  ? ? 60324 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.979  ? ? 81727 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.136 ? ? 21378 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.077  ? ? 8515  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 10492 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.7000 2.7728  14464 0.3393 76.00 0.3845 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 2.7728 2.8542  15080 0.3227 78.00 0.3787 . . 74  . . . . 'X-RAY DIFFRACTION' 
. 2.8542 2.9460  15350 0.3043 80.00 0.3724 . . 154 . . . . 'X-RAY DIFFRACTION' 
. 2.9460 3.0510  16076 0.2674 83.00 0.2931 . . 86  . . . . 'X-RAY DIFFRACTION' 
. 3.0510 3.1727  16648 0.2349 87.00 0.2871 . . 181 . . . . 'X-RAY DIFFRACTION' 
. 3.1727 3.3165  17115 0.2235 89.00 0.2572 . . 86  . . . . 'X-RAY DIFFRACTION' 
. 3.3165 3.4904  17458 0.2138 91.00 0.2551 . . 183 . . . . 'X-RAY DIFFRACTION' 
. 3.4904 3.7078  17761 0.2101 92.00 0.2452 . . 92  . . . . 'X-RAY DIFFRACTION' 
. 3.7078 3.9920  17905 0.1901 92.00 0.2589 . . 190 . . . . 'X-RAY DIFFRACTION' 
. 3.9920 4.3899  18048 0.1588 93.00 0.1964 . . 91  . . . . 'X-RAY DIFFRACTION' 
. 4.3899 5.0163  18119 0.1368 93.00 0.1675 . . 192 . . . . 'X-RAY DIFFRACTION' 
. 5.0163 6.2872  18159 0.1752 93.00 0.2384 . . 94  . . . . 'X-RAY DIFFRACTION' 
. 6.2872 19.9807 18193 0.1718 91.00 0.2015 . . 185 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4HXG 
_struct.title                     'Pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form)' 
_struct.pdbx_descriptor           'Putative uncharacterized protein PH0594 (E.C.3.4.19.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HXG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'self-compartmentalization, beta-propeller, alpha/beta hyrdolase fold, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 4 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 2 ? 
WA N N 3 ? 
XA N N 3 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 3 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 2 ? 
GB N N 2 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 5 ? 
KB N N 5 ? 
LB N N 5 ? 
MB N N 5 ? 
NB N N 5 ? 
OB N N 5 ? 
PB N N 5 ? 
QB N N 5 ? 
RB N N 5 ? 
SB N N 5 ? 
TB N N 5 ? 
UB N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LYS A 9   ? PHE A 14  ? LYS A 9   PHE A 14  5 ? 6  
HELX_P HELX_P2   2   ASN A 339 ? LYS A 345 ? ASN A 339 LYS A 345 1 ? 7  
HELX_P HELX_P3   3   LYS A 397 ? LYS A 406 ? LYS A 397 LYS A 406 1 ? 10 
HELX_P HELX_P4   4   SER A 422 ? ARG A 428 ? SER A 422 ARG A 428 1 ? 7  
HELX_P HELX_P5   5   LEU A 435 ? GLU A 452 ? LEU A 435 GLU A 452 1 ? 18 
HELX_P HELX_P6   6   ALA A 466 ? SER A 479 ? ALA A 466 SER A 479 1 ? 14 
HELX_P HELX_P7   7   TYR A 493 ? SER A 501 ? TYR A 493 SER A 501 1 ? 9  
HELX_P HELX_P8   8   ILE A 503 ? ILE A 512 ? ILE A 503 ILE A 512 1 ? 10 
HELX_P HELX_P9   9   GLU A 520 ? LEU A 525 ? GLU A 520 LEU A 525 1 ? 6  
HELX_P HELX_P10  10  SER A 526 ? VAL A 534 ? SER A 526 VAL A 534 5 ? 9  
HELX_P HELX_P11  11  LEU A 551 ? LEU A 564 ? LEU A 551 LEU A 564 1 ? 14 
HELX_P HELX_P12  12  GLY A 579 ? GLY A 584 ? GLY A 579 GLY A 584 1 ? 6  
HELX_P HELX_P13  13  SER A 585 ? LEU A 604 ? SER A 585 LEU A 604 1 ? 20 
HELX_P HELX_P14  14  ASP A 612 ? LEU A 617 ? ASP A 612 LEU A 617 1 ? 6  
HELX_P HELX_P15  15  LYS B 9   ? PHE B 14  ? LYS B 9   PHE B 14  5 ? 6  
HELX_P HELX_P16  16  ASN B 339 ? LYS B 345 ? ASN B 339 LYS B 345 1 ? 7  
HELX_P HELX_P17  17  LYS B 397 ? LYS B 406 ? LYS B 397 LYS B 406 1 ? 10 
HELX_P HELX_P18  18  SER B 422 ? ARG B 428 ? SER B 422 ARG B 428 1 ? 7  
HELX_P HELX_P19  19  LEU B 435 ? GLU B 452 ? LEU B 435 GLU B 452 1 ? 18 
HELX_P HELX_P20  20  ALA B 466 ? SER B 479 ? ALA B 466 SER B 479 1 ? 14 
HELX_P HELX_P21  21  TYR B 493 ? SER B 501 ? TYR B 493 SER B 501 1 ? 9  
HELX_P HELX_P22  22  ILE B 503 ? ILE B 512 ? ILE B 503 ILE B 512 1 ? 10 
HELX_P HELX_P23  23  GLU B 520 ? LEU B 525 ? GLU B 520 LEU B 525 1 ? 6  
HELX_P HELX_P24  24  SER B 526 ? VAL B 534 ? SER B 526 VAL B 534 5 ? 9  
HELX_P HELX_P25  25  LEU B 551 ? LEU B 564 ? LEU B 551 LEU B 564 1 ? 14 
HELX_P HELX_P26  26  GLY B 579 ? GLY B 584 ? GLY B 579 GLY B 584 1 ? 6  
HELX_P HELX_P27  27  SER B 585 ? LEU B 604 ? SER B 585 LEU B 604 1 ? 20 
HELX_P HELX_P28  28  ASP B 612 ? LYS B 618 ? ASP B 612 LYS B 618 1 ? 7  
HELX_P HELX_P29  29  LYS C 9   ? PHE C 14  ? LYS C 9   PHE C 14  5 ? 6  
HELX_P HELX_P30  30  ASN C 339 ? LYS C 345 ? ASN C 339 LYS C 345 1 ? 7  
HELX_P HELX_P31  31  LYS C 397 ? LYS C 406 ? LYS C 397 LYS C 406 1 ? 10 
HELX_P HELX_P32  32  SER C 422 ? ARG C 428 ? SER C 422 ARG C 428 1 ? 7  
HELX_P HELX_P33  33  LEU C 435 ? GLU C 452 ? LEU C 435 GLU C 452 1 ? 18 
HELX_P HELX_P34  34  ALA C 466 ? SER C 479 ? ALA C 466 SER C 479 1 ? 14 
HELX_P HELX_P35  35  TYR C 493 ? PHE C 500 ? TYR C 493 PHE C 500 1 ? 8  
HELX_P HELX_P36  36  ILE C 503 ? ILE C 512 ? ILE C 503 ILE C 512 1 ? 10 
HELX_P HELX_P37  37  GLU C 520 ? LEU C 525 ? GLU C 520 LEU C 525 1 ? 6  
HELX_P HELX_P38  38  SER C 526 ? VAL C 534 ? SER C 526 VAL C 534 5 ? 9  
HELX_P HELX_P39  39  PRO C 550 ? LEU C 564 ? PRO C 550 LEU C 564 1 ? 15 
HELX_P HELX_P40  40  GLY C 579 ? GLY C 584 ? GLY C 579 GLY C 584 1 ? 6  
HELX_P HELX_P41  41  SER C 585 ? LEU C 604 ? SER C 585 LEU C 604 1 ? 20 
HELX_P HELX_P42  42  ASP C 612 ? LYS C 618 ? ASP C 612 LYS C 618 1 ? 7  
HELX_P HELX_P43  43  LYS D 9   ? PHE D 14  ? LYS D 9   PHE D 14  5 ? 6  
HELX_P HELX_P44  44  ASN D 339 ? LYS D 345 ? ASN D 339 LYS D 345 1 ? 7  
HELX_P HELX_P45  45  LYS D 397 ? LYS D 406 ? LYS D 397 LYS D 406 1 ? 10 
HELX_P HELX_P46  46  SER D 422 ? ARG D 428 ? SER D 422 ARG D 428 1 ? 7  
HELX_P HELX_P47  47  LEU D 435 ? GLU D 452 ? LEU D 435 GLU D 452 1 ? 18 
HELX_P HELX_P48  48  ALA D 466 ? SER D 479 ? ALA D 466 SER D 479 1 ? 14 
HELX_P HELX_P49  49  TYR D 493 ? SER D 501 ? TYR D 493 SER D 501 1 ? 9  
HELX_P HELX_P50  50  ILE D 503 ? ILE D 512 ? ILE D 503 ILE D 512 1 ? 10 
HELX_P HELX_P51  51  GLU D 520 ? LEU D 525 ? GLU D 520 LEU D 525 1 ? 6  
HELX_P HELX_P52  52  SER D 526 ? VAL D 534 ? SER D 526 VAL D 534 5 ? 9  
HELX_P HELX_P53  53  LEU D 551 ? LEU D 564 ? LEU D 551 LEU D 564 1 ? 14 
HELX_P HELX_P54  54  GLY D 579 ? GLY D 584 ? GLY D 579 GLY D 584 1 ? 6  
HELX_P HELX_P55  55  SER D 585 ? LEU D 604 ? SER D 585 LEU D 604 1 ? 20 
HELX_P HELX_P56  56  ASP D 612 ? LEU D 617 ? ASP D 612 LEU D 617 1 ? 6  
HELX_P HELX_P57  57  LYS E 9   ? PHE E 14  ? LYS E 9   PHE E 14  5 ? 6  
HELX_P HELX_P58  58  LEU E 341 ? LYS E 345 ? LEU E 341 LYS E 345 5 ? 5  
HELX_P HELX_P59  59  LYS E 397 ? LYS E 406 ? LYS E 397 LYS E 406 1 ? 10 
HELX_P HELX_P60  60  SER E 422 ? ARG E 428 ? SER E 422 ARG E 428 1 ? 7  
HELX_P HELX_P61  61  LEU E 435 ? GLU E 452 ? LEU E 435 GLU E 452 1 ? 18 
HELX_P HELX_P62  62  ALA E 466 ? SER E 479 ? ALA E 466 SER E 479 1 ? 14 
HELX_P HELX_P63  63  TYR E 493 ? SER E 501 ? TYR E 493 SER E 501 1 ? 9  
HELX_P HELX_P64  64  ILE E 503 ? ILE E 512 ? ILE E 503 ILE E 512 1 ? 10 
HELX_P HELX_P65  65  GLU E 520 ? LEU E 525 ? GLU E 520 LEU E 525 1 ? 6  
HELX_P HELX_P66  66  SER E 526 ? VAL E 534 ? SER E 526 VAL E 534 5 ? 9  
HELX_P HELX_P67  67  LEU E 551 ? LEU E 564 ? LEU E 551 LEU E 564 1 ? 14 
HELX_P HELX_P68  68  GLY E 579 ? GLY E 584 ? GLY E 579 GLY E 584 1 ? 6  
HELX_P HELX_P69  69  SER E 585 ? LEU E 604 ? SER E 585 LEU E 604 1 ? 20 
HELX_P HELX_P70  70  ASP E 612 ? LEU E 617 ? ASP E 612 LEU E 617 1 ? 6  
HELX_P HELX_P71  71  LYS F 9   ? PHE F 14  ? LYS F 9   PHE F 14  5 ? 6  
HELX_P HELX_P72  72  LEU F 341 ? LYS F 345 ? LEU F 341 LYS F 345 5 ? 5  
HELX_P HELX_P73  73  LYS F 397 ? LYS F 406 ? LYS F 397 LYS F 406 1 ? 10 
HELX_P HELX_P74  74  SER F 422 ? ARG F 428 ? SER F 422 ARG F 428 1 ? 7  
HELX_P HELX_P75  75  LEU F 435 ? GLU F 452 ? LEU F 435 GLU F 452 1 ? 18 
HELX_P HELX_P76  76  ALA F 466 ? SER F 479 ? ALA F 466 SER F 479 1 ? 14 
HELX_P HELX_P77  77  TYR F 493 ? SER F 501 ? TYR F 493 SER F 501 1 ? 9  
HELX_P HELX_P78  78  ILE F 503 ? ILE F 512 ? ILE F 503 ILE F 512 1 ? 10 
HELX_P HELX_P79  79  GLU F 520 ? LEU F 525 ? GLU F 520 LEU F 525 1 ? 6  
HELX_P HELX_P80  80  SER F 526 ? VAL F 534 ? SER F 526 VAL F 534 5 ? 9  
HELX_P HELX_P81  81  LEU F 551 ? LEU F 564 ? LEU F 551 LEU F 564 1 ? 14 
HELX_P HELX_P82  82  GLY F 579 ? GLY F 584 ? GLY F 579 GLY F 584 1 ? 6  
HELX_P HELX_P83  83  SER F 585 ? LEU F 604 ? SER F 585 LEU F 604 1 ? 20 
HELX_P HELX_P84  84  ASP F 612 ? LEU F 617 ? ASP F 612 LEU F 617 1 ? 6  
HELX_P HELX_P85  85  LYS G 9   ? PHE G 14  ? LYS G 9   PHE G 14  5 ? 6  
HELX_P HELX_P86  86  LEU G 341 ? LYS G 345 ? LEU G 341 LYS G 345 5 ? 5  
HELX_P HELX_P87  87  LYS G 397 ? LYS G 406 ? LYS G 397 LYS G 406 1 ? 10 
HELX_P HELX_P88  88  SER G 422 ? ARG G 428 ? SER G 422 ARG G 428 1 ? 7  
HELX_P HELX_P89  89  LEU G 435 ? GLU G 452 ? LEU G 435 GLU G 452 1 ? 18 
HELX_P HELX_P90  90  ALA G 466 ? SER G 479 ? ALA G 466 SER G 479 1 ? 14 
HELX_P HELX_P91  91  TYR G 493 ? SER G 501 ? TYR G 493 SER G 501 1 ? 9  
HELX_P HELX_P92  92  ILE G 503 ? ILE G 512 ? ILE G 503 ILE G 512 1 ? 10 
HELX_P HELX_P93  93  GLU G 520 ? LEU G 525 ? GLU G 520 LEU G 525 1 ? 6  
HELX_P HELX_P94  94  SER G 526 ? VAL G 534 ? SER G 526 VAL G 534 5 ? 9  
HELX_P HELX_P95  95  LEU G 551 ? GLY G 565 ? LEU G 551 GLY G 565 1 ? 15 
HELX_P HELX_P96  96  GLY G 579 ? GLY G 584 ? GLY G 579 GLY G 584 1 ? 6  
HELX_P HELX_P97  97  SER G 585 ? LEU G 604 ? SER G 585 LEU G 604 1 ? 20 
HELX_P HELX_P98  98  ASP G 612 ? LEU G 617 ? ASP G 612 LEU G 617 1 ? 6  
HELX_P HELX_P99  99  LYS H 9   ? PHE H 14  ? LYS H 9   PHE H 14  5 ? 6  
HELX_P HELX_P100 100 LEU H 341 ? LYS H 345 ? LEU H 341 LYS H 345 5 ? 5  
HELX_P HELX_P101 101 LYS H 397 ? LYS H 406 ? LYS H 397 LYS H 406 1 ? 10 
HELX_P HELX_P102 102 SER H 422 ? ARG H 428 ? SER H 422 ARG H 428 1 ? 7  
HELX_P HELX_P103 103 LEU H 435 ? GLU H 452 ? LEU H 435 GLU H 452 1 ? 18 
HELX_P HELX_P104 104 ALA H 466 ? SER H 479 ? ALA H 466 SER H 479 1 ? 14 
HELX_P HELX_P105 105 TYR H 493 ? PHE H 500 ? TYR H 493 PHE H 500 1 ? 8  
HELX_P HELX_P106 106 ILE H 503 ? ILE H 512 ? ILE H 503 ILE H 512 1 ? 10 
HELX_P HELX_P107 107 GLU H 520 ? LEU H 525 ? GLU H 520 LEU H 525 1 ? 6  
HELX_P HELX_P108 108 SER H 526 ? VAL H 534 ? SER H 526 VAL H 534 5 ? 9  
HELX_P HELX_P109 109 LEU H 551 ? LEU H 564 ? LEU H 551 LEU H 564 1 ? 14 
HELX_P HELX_P110 110 GLY H 579 ? GLY H 584 ? GLY H 579 GLY H 584 1 ? 6  
HELX_P HELX_P111 111 SER H 585 ? LYS H 603 ? SER H 585 LYS H 603 1 ? 19 
HELX_P HELX_P112 112 ASP H 612 ? LEU H 617 ? ASP H 612 LEU H 617 1 ? 6  
HELX_P HELX_P113 113 LYS I 9   ? PHE I 14  ? LYS I 9   PHE I 14  5 ? 6  
HELX_P HELX_P114 114 LEU I 341 ? LYS I 345 ? LEU I 341 LYS I 345 5 ? 5  
HELX_P HELX_P115 115 LYS I 397 ? LYS I 406 ? LYS I 397 LYS I 406 1 ? 10 
HELX_P HELX_P116 116 SER I 422 ? ARG I 428 ? SER I 422 ARG I 428 1 ? 7  
HELX_P HELX_P117 117 LEU I 435 ? GLU I 452 ? LEU I 435 GLU I 452 1 ? 18 
HELX_P HELX_P118 118 ALA I 466 ? SER I 479 ? ALA I 466 SER I 479 1 ? 14 
HELX_P HELX_P119 119 TYR I 493 ? SER I 501 ? TYR I 493 SER I 501 1 ? 9  
HELX_P HELX_P120 120 ILE I 503 ? ILE I 512 ? ILE I 503 ILE I 512 1 ? 10 
HELX_P HELX_P121 121 GLU I 520 ? LEU I 525 ? GLU I 520 LEU I 525 1 ? 6  
HELX_P HELX_P122 122 SER I 526 ? VAL I 534 ? SER I 526 VAL I 534 5 ? 9  
HELX_P HELX_P123 123 LEU I 551 ? LEU I 564 ? LEU I 551 LEU I 564 1 ? 14 
HELX_P HELX_P124 124 GLY I 579 ? GLY I 584 ? GLY I 579 GLY I 584 1 ? 6  
HELX_P HELX_P125 125 SER I 585 ? LEU I 604 ? SER I 585 LEU I 604 1 ? 20 
HELX_P HELX_P126 126 ASP I 612 ? LEU I 617 ? ASP I 612 LEU I 617 1 ? 6  
HELX_P HELX_P127 127 LYS J 9   ? PHE J 14  ? LYS J 9   PHE J 14  5 ? 6  
HELX_P HELX_P128 128 ASN J 339 ? LEU J 346 ? ASN J 339 LEU J 346 1 ? 8  
HELX_P HELX_P129 129 LYS J 397 ? LYS J 406 ? LYS J 397 LYS J 406 1 ? 10 
HELX_P HELX_P130 130 SER J 422 ? ARG J 428 ? SER J 422 ARG J 428 1 ? 7  
HELX_P HELX_P131 131 LEU J 435 ? GLU J 452 ? LEU J 435 GLU J 452 1 ? 18 
HELX_P HELX_P132 132 ALA J 466 ? SER J 479 ? ALA J 466 SER J 479 1 ? 14 
HELX_P HELX_P133 133 TYR J 493 ? SER J 501 ? TYR J 493 SER J 501 1 ? 9  
HELX_P HELX_P134 134 ILE J 503 ? ILE J 512 ? ILE J 503 ILE J 512 1 ? 10 
HELX_P HELX_P135 135 GLU J 520 ? LEU J 525 ? GLU J 520 LEU J 525 1 ? 6  
HELX_P HELX_P136 136 SER J 526 ? VAL J 534 ? SER J 526 VAL J 534 5 ? 9  
HELX_P HELX_P137 137 LEU J 551 ? LEU J 564 ? LEU J 551 LEU J 564 1 ? 14 
HELX_P HELX_P138 138 GLY J 579 ? GLY J 584 ? GLY J 579 GLY J 584 1 ? 6  
HELX_P HELX_P139 139 SER J 585 ? LEU J 604 ? SER J 585 LEU J 604 1 ? 20 
HELX_P HELX_P140 140 ASP J 612 ? LEU J 617 ? ASP J 612 LEU J 617 1 ? 6  
HELX_P HELX_P141 141 LYS K 9   ? LYS K 13  ? LYS K 9   LYS K 13  5 ? 5  
HELX_P HELX_P142 142 ASN K 339 ? LYS K 344 ? ASN K 339 LYS K 344 1 ? 6  
HELX_P HELX_P143 143 LYS K 397 ? LYS K 406 ? LYS K 397 LYS K 406 1 ? 10 
HELX_P HELX_P144 144 SER K 422 ? ARG K 428 ? SER K 422 ARG K 428 1 ? 7  
HELX_P HELX_P145 145 LEU K 435 ? GLU K 452 ? LEU K 435 GLU K 452 1 ? 18 
HELX_P HELX_P146 146 ALA K 466 ? SER K 479 ? ALA K 466 SER K 479 1 ? 14 
HELX_P HELX_P147 147 TYR K 493 ? SER K 501 ? TYR K 493 SER K 501 1 ? 9  
HELX_P HELX_P148 148 ILE K 503 ? ILE K 512 ? ILE K 503 ILE K 512 1 ? 10 
HELX_P HELX_P149 149 GLU K 520 ? LEU K 525 ? GLU K 520 LEU K 525 1 ? 6  
HELX_P HELX_P150 150 SER K 526 ? VAL K 534 ? SER K 526 VAL K 534 5 ? 9  
HELX_P HELX_P151 151 LEU K 551 ? LEU K 564 ? LEU K 551 LEU K 564 1 ? 14 
HELX_P HELX_P152 152 GLY K 579 ? GLY K 584 ? GLY K 579 GLY K 584 1 ? 6  
HELX_P HELX_P153 153 SER K 585 ? LEU K 604 ? SER K 585 LEU K 604 1 ? 20 
HELX_P HELX_P154 154 ASP K 612 ? LYS K 618 ? ASP K 612 LYS K 618 1 ? 7  
HELX_P HELX_P155 155 LYS L 9   ? PHE L 14  ? LYS L 9   PHE L 14  5 ? 6  
HELX_P HELX_P156 156 ASN L 339 ? LYS L 345 ? ASN L 339 LYS L 345 1 ? 7  
HELX_P HELX_P157 157 LYS L 397 ? LYS L 406 ? LYS L 397 LYS L 406 1 ? 10 
HELX_P HELX_P158 158 SER L 422 ? ARG L 428 ? SER L 422 ARG L 428 1 ? 7  
HELX_P HELX_P159 159 LEU L 435 ? GLU L 452 ? LEU L 435 GLU L 452 1 ? 18 
HELX_P HELX_P160 160 ALA L 466 ? SER L 479 ? ALA L 466 SER L 479 1 ? 14 
HELX_P HELX_P161 161 TYR L 493 ? SER L 501 ? TYR L 493 SER L 501 1 ? 9  
HELX_P HELX_P162 162 ILE L 503 ? ILE L 512 ? ILE L 503 ILE L 512 1 ? 10 
HELX_P HELX_P163 163 GLU L 520 ? LEU L 525 ? GLU L 520 LEU L 525 1 ? 6  
HELX_P HELX_P164 164 SER L 526 ? VAL L 534 ? SER L 526 VAL L 534 5 ? 9  
HELX_P HELX_P165 165 LEU L 551 ? LEU L 564 ? LEU L 551 LEU L 564 1 ? 14 
HELX_P HELX_P166 166 GLY L 579 ? GLY L 584 ? GLY L 579 GLY L 584 1 ? 6  
HELX_P HELX_P167 167 SER L 585 ? LEU L 604 ? SER L 585 LEU L 604 1 ? 20 
HELX_P HELX_P168 168 ASP L 612 ? LYS L 618 ? ASP L 612 LYS L 618 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? G  GLU 162 OE1 ? ? ? 1_555 WA MG  . MG ? ? G GLU 162 G MG  702  1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc2   metalc ? ? D  GLU 162 OE1 ? ? ? 1_555 GA MG  . MG ? ? D GLU 162 D MG  710  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc3   metalc ? ? F  GLU 162 OE1 ? ? ? 1_555 SA MG  . MG ? ? F GLU 162 F MG  705  1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc4   metalc ? ? A  LYS 99  O   ? ? ? 1_555 P  MG  . MG ? ? A LYS 99  A MG  704  1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc5   metalc ? ? I  ASP 244 OD2 ? ? ? 1_555 EB MG  . MG ? ? I ASP 244 I MG  704  1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc6   metalc ? ? F  LYS 99  O   ? ? ? 1_555 SA MG  . MG ? ? F LYS 99  F MG  705  1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc7   metalc ? ? H  LYS 99  O   ? ? ? 1_555 AB MG  . MG ? ? H LYS 99  H MG  703  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc8   metalc ? ? E  GLU 162 OE1 ? ? ? 1_555 MA MG  . MG ? ? E GLU 162 E MG  705  1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc9   metalc ? ? I  GLU 162 OE1 ? ? ? 1_555 DB MG  . MG ? ? I GLU 162 I MG  703  1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc10  metalc ? ? B  LYS 99  O   ? ? ? 1_555 T  MG  . MG ? ? B LYS 99  B MG  703  1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc11  metalc ? ? B  GLU 162 OE1 ? ? ? 1_555 T  MG  . MG ? ? B GLU 162 B MG  703  1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc12  metalc ? ? D  ASP 244 OD2 ? ? ? 1_555 FA MG  . MG ? ? D ASP 244 D MG  709  1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc13  metalc ? ? H  GLU 162 OE1 ? ? ? 1_555 AB MG  . MG ? ? H GLU 162 H MG  703  1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc14  metalc ? ? C  GLU 263 OE2 ? ? ? 1_555 W  MG  . MG ? ? C GLU 263 C MG  703  1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc15  metalc ? ? C  GLU 162 OE1 ? ? ? 1_555 V  MG  . MG ? ? C GLU 162 C MG  702  1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc16  metalc ? ? H  ASP 244 OD2 ? ? ? 1_555 ZA MG  . MG ? ? H ASP 244 H MG  702  1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc17  metalc ? ? E  ASP 244 OD2 ? ? ? 1_555 LA MG  . MG ? ? E ASP 244 E MG  704  1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc18  metalc ? ? I  LYS 99  O   ? ? ? 1_555 DB MG  . MG ? ? I LYS 99  I MG  703  1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc19  metalc ? ? E  LYS 99  O   ? ? ? 1_555 MA MG  . MG ? ? E LYS 99  E MG  705  1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc20  metalc ? ? A  GLU 162 OE1 ? ? ? 1_555 P  MG  . MG ? ? A GLU 162 A MG  704  1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc21  metalc ? ? C  ASP 244 OD2 ? ? ? 1_555 W  MG  . MG ? ? C ASP 244 C MG  703  1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc22  metalc ? ? F  ASP 244 OD2 ? ? ? 1_555 RA MG  . MG ? ? F ASP 244 F MG  704  1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc23  metalc ? ? G  LYS 99  O   ? ? ? 1_555 WA MG  . MG ? ? G LYS 99  G MG  702  1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc24  metalc ? ? A  ASP 244 OD2 ? ? ? 1_555 Q  MG  . MG ? ? A ASP 244 A MG  705  1_555 ? ? ? ? ? ? ? 2.666 ? 
metalc25  metalc ? ? H  GLU 263 OE2 ? ? ? 1_555 ZA MG  . MG ? ? H GLU 263 H MG  702  1_555 ? ? ? ? ? ? ? 2.694 ? 
metalc26  metalc ? ? L  LYS 99  O   ? ? ? 1_555 IB MG  . MG ? ? L LYS 99  L MG  703  1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc27  metalc ? ? E  GLU 263 OE2 ? ? ? 1_555 LA MG  . MG ? ? E GLU 263 E MG  704  1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc28  metalc ? ? C  LYS 99  O   ? ? ? 1_555 V  MG  . MG ? ? C LYS 99  C MG  702  1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc29  metalc ? ? I  GLU 263 OE2 ? ? ? 1_555 EB MG  . MG ? ? I GLU 263 I MG  704  1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc30  metalc ? ? L  GLU 162 OE1 ? ? ? 1_555 IB MG  . MG ? ? L GLU 162 L MG  703  1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc31  metalc ? ? H  GLU 263 OE1 ? ? ? 1_555 ZA MG  . MG ? ? H GLU 263 H MG  702  1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc32  metalc ? ? H  GLU 42  OE1 ? ? ? 1_555 DB MG  . MG ? ? H GLU 42  I MG  703  1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc33  metalc ? ? G  ASP 244 OD2 ? ? ? 1_555 XA MG  . MG ? ? G ASP 244 G MG  703  1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc34  metalc ? ? L  GLU 263 OE1 ? ? ? 1_555 HB MG  . MG ? ? L GLU 263 L MG  702  1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc35  metalc ? ? L  GLU 162 OE2 ? ? ? 1_555 IB MG  . MG ? ? L GLU 162 L MG  703  1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc36  metalc ? ? A  GLU 263 OE2 ? ? ? 1_555 Q  MG  . MG ? ? A GLU 263 A MG  705  1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc37  metalc ? ? D  GLU 263 OE1 ? ? ? 1_555 FA MG  . MG ? ? D GLU 263 D MG  709  1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc38  metalc ? ? E  GLU 263 OE1 ? ? ? 1_555 LA MG  . MG ? ? E GLU 263 E MG  704  1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc39  metalc ? ? G  GLU 263 OE2 ? ? ? 1_555 XA MG  . MG ? ? G GLU 263 G MG  703  1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc40  metalc ? ? B  GLU 42  OE1 ? ? ? 1_555 V  MG  . MG ? ? B GLU 42  C MG  702  1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc41  metalc ? ? F  GLU 263 OE2 ? ? ? 1_555 RA MG  . MG ? ? F GLU 263 F MG  704  1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc42  metalc ? ? D  GLU 263 OE2 ? ? ? 1_555 FA MG  . MG ? ? D GLU 263 D MG  709  1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc43  metalc ? ? DB MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? I MG  703 I HOH 834  1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc44  metalc ? ? T  MG  .   MG  ? ? ? 1_555 JB HOH . O  ? ? B MG  703 A HOH 854  1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc45  metalc ? ? MA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? E MG  705 F HOH 872  1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc46  metalc ? ? V  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? C MG  702 C HOH 801  1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc47  metalc ? ? HB MG  .   MG  ? ? ? 1_555 UB HOH . O  ? ? L MG  702 L HOH 851  1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc48  metalc ? ? MA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  705 E HOH 919  1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc49  metalc ? ? GA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? D MG  710 D HOH 1021 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc50  metalc ? ? P  MG  .   MG  ? ? ? 1_555 JB HOH . O  ? ? A MG  704 A HOH 938  1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc51  metalc ? ? FA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? D MG  709 D HOH 802  1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc52  metalc ? ? SA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? F MG  705 D HOH 856  1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc53  metalc ? ? SA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? F MG  705 F HOH 879  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc54  metalc ? ? SA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? F MG  705 D HOH 939  1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc55  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 JB HOH . O  ? ? A MG  705 A HOH 947  1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc56  metalc ? ? IB MG  .   MG  ? ? ? 1_555 SB HOH . O  ? ? L MG  703 J HOH 707  1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc57  metalc ? ? DB MG  .   MG  ? ? ? 1_555 RB HOH . O  B ? I MG  703 I HOH 833  1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc58  metalc ? ? SA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? F MG  705 D HOH 940  1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc59  metalc ? ? P  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? A MG  704 C HOH 858  1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc60  metalc ? ? AB MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  703 H HOH 801  1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc61  metalc ? ? P  MG  .   MG  ? ? ? 1_555 JB HOH . O  ? ? A MG  704 A HOH 949  1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc62  metalc ? ? Q  MG  .   MG  ? ? ? 1_555 JB HOH . O  ? ? A MG  705 A HOH 812  1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc63  metalc ? ? WA MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? G MG  702 I HOH 875  1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc64  metalc ? ? RA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? F MG  704 F HOH 802  1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc65  metalc ? ? RA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? F MG  704 F HOH 878  1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc66  metalc ? ? W  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? C MG  703 C HOH 802  1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc67  metalc ? ? AB MG  .   MG  ? ? ? 1_555 PB HOH . O  ? ? H MG  703 G HOH 876  1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc68  metalc ? ? AB MG  .   MG  ? ? ? 1_555 PB HOH . O  ? ? H MG  703 G HOH 828  1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc69  metalc ? ? P  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? A MG  704 C HOH 841  1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc70  metalc ? ? NA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  706 E HOH 946  1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc71  metalc ? ? V  MG  .   MG  ? ? ? 1_555 KB HOH . O  ? ? C MG  702 B HOH 829  1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc72  metalc ? ? W  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? C MG  703 C HOH 810  1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc73  metalc ? ? NA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  706 E HOH 901  1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc74  metalc ? ? W  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? C MG  703 C HOH 859  1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc75  metalc ? ? MA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? E MG  705 F HOH 871  1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc76  metalc ? ? TA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? F MG  706 E HOH 988  1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc77  metalc ? ? GA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? D MG  710 E HOH 902  1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc78  metalc ? ? ZA MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  702 H HOH 857  1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc79  metalc ? ? WA MG  .   MG  ? ? ? 1_555 PB HOH . O  ? ? G MG  702 G HOH 827  1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc80  metalc ? ? TA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? F MG  706 E HOH 841  1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc81  metalc ? ? DB MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? I MG  703 H HOH 858  1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc82  metalc ? ? RA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? F MG  704 F HOH 954  1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc83  metalc ? ? T  MG  .   MG  ? ? ? 1_555 JB HOH . O  B ? B MG  703 A HOH 853  1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc84  metalc ? ? LA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  704 E HOH 987  1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc85  metalc ? ? EB MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? I MG  704 I HOH 871  1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc86  metalc ? ? T  MG  .   MG  ? ? ? 1_555 KB HOH . O  ? ? B MG  703 B HOH 828  1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc87  metalc ? ? ZA MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  702 H HOH 856  1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc88  metalc ? ? ZA MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  702 H HOH 802  1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc89  metalc ? ? AB MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  703 H HOH 808  1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc90  metalc ? ? TA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? F MG  706 F HOH 955  1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc91  metalc ? ? WA MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? G MG  702 I HOH 808  1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc92  metalc ? ? IB MG  .   MG  ? ? ? 1_555 SB HOH . O  ? ? L MG  703 J HOH 706  1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc93  metalc ? ? NA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  706 E HOH 896  1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc94  metalc ? ? MA MG  .   MG  ? ? ? 1_555 OB HOH . O  ? ? E MG  705 F HOH 873  1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc95  metalc ? ? TA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? F MG  706 E HOH 979  1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc96  metalc ? ? W  MG  .   MG  ? ? ? 1_555 LB HOH . O  ? ? C MG  703 C HOH 857  1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc97  metalc ? ? HB MG  .   MG  ? ? ? 1_555 UB HOH . O  ? ? L MG  702 L HOH 820  1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc98  metalc ? ? LA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  704 E HOH 842  1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc99  metalc ? ? FA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? D MG  709 D HOH 936  1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc100 metalc ? ? WA MG  .   MG  ? ? ? 1_555 PB HOH . O  ? ? G MG  702 G HOH 875  1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc101 metalc ? ? NA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? E MG  706 D HOH 915  1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc102 metalc ? ? NA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? E MG  706 D HOH 1006 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc103 metalc ? ? EB MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? I MG  704 I HOH 803  1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc104 metalc ? ? EB MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? I MG  704 I HOH 876  1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc105 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 QB HOH . O  ? ? H MG  702 H HOH 818  1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc106 metalc ? ? XA MG  .   MG  ? ? ? 1_555 PB HOH . O  ? ? G MG  703 G HOH 804  1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc107 metalc ? ? FA MG  .   MG  ? ? ? 1_555 MB HOH . O  ? ? D MG  709 D HOH 935  1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc108 metalc ? ? XA MG  .   MG  ? ? ? 1_555 PB HOH . O  B ? G MG  703 G HOH 810  1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc109 metalc ? ? EB MG  .   MG  ? ? ? 1_555 RB HOH . O  ? ? I MG  704 I HOH 877  1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc110 metalc ? ? HB MG  .   MG  ? ? ? 1_555 UB HOH . O  ? ? L MG  702 L HOH 809  1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc111 metalc ? ? LA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? E MG  704 E HOH 801  1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc112 metalc ? ? GA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? D MG  710 E HOH 832  1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc113 metalc ? ? TA MG  .   MG  ? ? ? 1_555 NB HOH . O  ? ? F MG  706 E HOH 840  1_555 ? ? ? ? ? ? ? 2.935 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  VAL 137 A . ? VAL 137 A PRO 138 A ? PRO 138 A 1 -4.63  
2  GLY 387 A . ? GLY 387 A PRO 388 A ? PRO 388 A 1 6.65   
3  VAL 137 B . ? VAL 137 B PRO 138 B ? PRO 138 B 1 -5.93  
4  GLY 387 B . ? GLY 387 B PRO 388 B ? PRO 388 B 1 4.67   
5  VAL 137 C . ? VAL 137 C PRO 138 C ? PRO 138 C 1 -9.33  
6  GLY 387 C . ? GLY 387 C PRO 388 C ? PRO 388 C 1 9.57   
7  VAL 137 D . ? VAL 137 D PRO 138 D ? PRO 138 D 1 -8.48  
8  GLY 387 D . ? GLY 387 D PRO 388 D ? PRO 388 D 1 5.80   
9  VAL 137 E . ? VAL 137 E PRO 138 E ? PRO 138 E 1 -8.13  
10 GLY 387 E . ? GLY 387 E PRO 388 E ? PRO 388 E 1 2.79   
11 VAL 137 F . ? VAL 137 F PRO 138 F ? PRO 138 F 1 -3.96  
12 GLY 387 F . ? GLY 387 F PRO 388 F ? PRO 388 F 1 8.66   
13 VAL 137 G . ? VAL 137 G PRO 138 G ? PRO 138 G 1 -5.64  
14 GLY 387 G . ? GLY 387 G PRO 388 G ? PRO 388 G 1 7.51   
15 VAL 137 H . ? VAL 137 H PRO 138 H ? PRO 138 H 1 -6.01  
16 GLY 387 H . ? GLY 387 H PRO 388 H ? PRO 388 H 1 4.65   
17 VAL 137 I . ? VAL 137 I PRO 138 I ? PRO 138 I 1 -10.60 
18 GLY 387 I . ? GLY 387 I PRO 388 I ? PRO 388 I 1 5.34   
19 VAL 137 J . ? VAL 137 J PRO 138 J ? PRO 138 J 1 -8.16  
20 GLY 387 J . ? GLY 387 J PRO 388 J ? PRO 388 J 1 6.18   
21 VAL 137 K . ? VAL 137 K PRO 138 K ? PRO 138 K 1 -7.73  
22 GLY 387 K . ? GLY 387 K PRO 388 K ? PRO 388 K 1 7.49   
23 VAL 137 L . ? VAL 137 L PRO 138 L ? PRO 138 L 1 -2.69  
24 GLY 387 L . ? GLY 387 L PRO 388 L ? PRO 388 L 1 5.40   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 9 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 4 ? 
J  ? 9 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 9 ? 
O  ? 2 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 4 ? 
T  ? 9 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 4 ? 
X  ? 9 ? 
Y  ? 2 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 9 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 4 ? 
AH ? 2 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 4 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 4 ? 
AO ? 4 ? 
AP ? 2 ? 
AQ ? 4 ? 
AR ? 4 ? 
AS ? 4 ? 
AT ? 4 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 4 ? 
AX ? 2 ? 
AY ? 4 ? 
AZ ? 4 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 4 ? 
BF ? 8 ? 
BG ? 2 ? 
BH ? 7 ? 
BI ? 4 ? 
BJ ? 4 ? 
BK ? 9 ? 
BL ? 4 ? 
BM ? 4 ? 
BN ? 4 ? 
BO ? 9 ? 
BP ? 2 ? 
BQ ? 4 ? 
BR ? 4 ? 
BS ? 4 ? 
BT ? 3 ? 
BU ? 4 ? 
BV ? 9 ? 
BW ? 4 ? 
BX ? 4 ? 
BY ? 4 ? 
BZ ? 9 ? 
CA ? 2 ? 
CB ? 4 ? 
CC ? 4 ? 
CD ? 4 ? 
CE ? 4 ? 
CF ? 9 ? 
CG ? 4 ? 
CH ? 4 ? 
CI ? 4 ? 
CJ ? 2 ? 
CK ? 4 ? 
CL ? 4 ? 
CM ? 4 ? 
CN ? 4 ? 
CO ? 2 ? 
CP ? 4 ? 
CQ ? 4 ? 
CR ? 4 ? 
CS ? 2 ? 
CT ? 4 ? 
CU ? 4 ? 
CV ? 4 ? 
CW ? 4 ? 
CX ? 4 ? 
CY ? 4 ? 
CZ ? 4 ? 
DA ? 2 ? 
DB ? 7 ? 
DC ? 4 ? 
DD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? parallel      
D  3 4 ? parallel      
D  4 5 ? parallel      
D  5 6 ? parallel      
D  6 7 ? parallel      
D  7 8 ? anti-parallel 
D  8 9 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? parallel      
J  4 5 ? parallel      
J  5 6 ? parallel      
J  6 7 ? parallel      
J  7 8 ? parallel      
J  8 9 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? parallel      
N  4 5 ? parallel      
N  5 6 ? parallel      
N  6 7 ? parallel      
N  7 8 ? anti-parallel 
N  8 9 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? parallel      
T  4 5 ? parallel      
T  5 6 ? parallel      
T  6 7 ? parallel      
T  7 8 ? parallel      
T  8 9 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? parallel      
X  3 4 ? parallel      
X  4 5 ? parallel      
X  5 6 ? parallel      
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
X  8 9 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AD 5 6 ? parallel      
AD 6 7 ? parallel      
AD 7 8 ? parallel      
AD 8 9 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? parallel      
BF 3 4 ? parallel      
BF 4 5 ? parallel      
BF 5 6 ? parallel      
BF 6 7 ? parallel      
BF 7 8 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BH 4 5 ? anti-parallel 
BH 5 6 ? anti-parallel 
BH 6 7 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? parallel      
BK 4 5 ? parallel      
BK 5 6 ? parallel      
BK 6 7 ? parallel      
BK 7 8 ? parallel      
BK 8 9 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? parallel      
BO 3 4 ? parallel      
BO 4 5 ? parallel      
BO 5 6 ? parallel      
BO 6 7 ? parallel      
BO 7 8 ? anti-parallel 
BO 8 9 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BS 3 4 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BU 3 4 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? parallel      
BV 4 5 ? parallel      
BV 5 6 ? parallel      
BV 6 7 ? parallel      
BV 7 8 ? parallel      
BV 8 9 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BX 2 3 ? anti-parallel 
BX 3 4 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? parallel      
BZ 3 4 ? parallel      
BZ 4 5 ? parallel      
BZ 5 6 ? parallel      
BZ 6 7 ? parallel      
BZ 7 8 ? anti-parallel 
BZ 8 9 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CF 3 4 ? parallel      
CF 4 5 ? parallel      
CF 5 6 ? parallel      
CF 6 7 ? parallel      
CF 7 8 ? parallel      
CF 8 9 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CG 3 4 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? anti-parallel 
CH 3 4 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CK 1 2 ? anti-parallel 
CK 2 3 ? anti-parallel 
CK 3 4 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CM 3 4 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? anti-parallel 
CN 3 4 ? anti-parallel 
CO 1 2 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? anti-parallel 
CP 3 4 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CQ 2 3 ? anti-parallel 
CQ 3 4 ? anti-parallel 
CR 1 2 ? anti-parallel 
CR 2 3 ? anti-parallel 
CR 3 4 ? anti-parallel 
CS 1 2 ? anti-parallel 
CT 1 2 ? anti-parallel 
CT 2 3 ? anti-parallel 
CT 3 4 ? anti-parallel 
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CU 3 4 ? anti-parallel 
CV 1 2 ? anti-parallel 
CV 2 3 ? anti-parallel 
CV 3 4 ? anti-parallel 
CW 1 2 ? anti-parallel 
CW 2 3 ? anti-parallel 
CW 3 4 ? anti-parallel 
CX 1 2 ? anti-parallel 
CX 2 3 ? anti-parallel 
CX 3 4 ? anti-parallel 
CY 1 2 ? anti-parallel 
CY 2 3 ? anti-parallel 
CY 3 4 ? anti-parallel 
CZ 1 2 ? anti-parallel 
CZ 2 3 ? anti-parallel 
CZ 3 4 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
DB 5 6 ? anti-parallel 
DB 6 7 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 TYR A 16  ? ARG A 23  ? TYR A 16  ARG A 23  
A  2 LEU A 26  ? ASN A 35  ? LEU A 26  ASN A 35  
A  3 LYS A 40  ? ASN A 49  ? LYS A 40  ASN A 49  
A  4 ARG A 55  ? GLU A 59  ? ARG A 55  GLU A 59  
B  1 SER A 62  ? ILE A 66  ? SER A 62  ILE A 66  
B  2 LYS A 72  ? ARG A 77  ? LYS A 72  ARG A 77  
B  3 GLN A 86  ? ASP A 91  ? GLN A 86  ASP A 91  
B  4 ALA A 97  ? GLU A 102 ? ALA A 97  GLU A 102 
C  1 ILE A 106 ? TRP A 111 ? ILE A 106 TRP A 111 
C  2 ARG A 117 ? LYS A 124 ? ARG A 117 LYS A 124 
C  3 LYS A 151 ? ASP A 158 ? LYS A 151 ASP A 158 
C  4 GLU A 163 ? LYS A 170 ? GLU A 163 LYS A 170 
D  1 PHE A 131 ? GLU A 134 ? PHE A 131 GLU A 134 
D  2 VAL D 568 ? PHE D 573 ? VAL D 568 PHE D 573 
D  3 LEU D 538 ? SER D 543 ? LEU D 538 SER D 543 
D  4 ALA D 484 ? GLU D 488 ? ALA D 484 GLU D 488 
D  5 ALA D 455 ? ILE D 465 ? ALA D 455 ILE D 465 
D  6 ALA D 378 ? VAL D 384 ? ALA D 378 VAL D 384 
D  7 TYR D 409 ? VAL D 413 ? TYR D 409 VAL D 413 
D  8 LEU D 361 ? ILE D 368 ? LEU D 361 ILE D 368 
D  9 ARG D 352 ? SER D 358 ? ARG D 352 SER D 358 
E  1 TRP A 140 ? PHE A 141 ? TRP A 140 PHE A 141 
E  2 GLY A 145 ? PHE A 146 ? GLY A 145 PHE A 146 
F  1 SER A 175 ? HIS A 179 ? SER A 175 HIS A 179 
F  2 SER A 182 ? PRO A 188 ? SER A 182 PRO A 188 
F  3 TRP A 200 ? LYS A 206 ? TRP A 200 LYS A 206 
F  4 GLU A 209 ? VAL A 217 ? GLU A 209 VAL A 217 
G  1 PHE A 219 ? SER A 224 ? PHE A 219 SER A 224 
G  2 ILE A 229 ? GLY A 233 ? ILE A 229 GLY A 233 
G  3 LYS A 245 ? TYR A 249 ? LYS A 245 TYR A 249 
G  4 VAL A 253 ? GLY A 255 ? VAL A 253 GLY A 255 
H  1 GLU A 263 ? ARG A 270 ? GLU A 263 ARG A 270 
H  2 LYS A 273 ? GLU A 280 ? LYS A 273 GLU A 280 
H  3 SER A 283 ? TRP A 289 ? SER A 283 TRP A 289 
H  4 VAL A 293 ? ALA A 297 ? VAL A 293 ALA A 297 
I  1 TRP A 302 ? ALA A 308 ? TRP A 302 ALA A 308 
I  2 LEU A 312 ? GLU A 317 ? LEU A 312 GLU A 317 
I  3 GLU A 324 ? TRP A 328 ? GLU A 324 TRP A 328 
I  4 GLU A 332 ? GLN A 334 ? GLU A 332 GLN A 334 
J  1 ARG A 352 ? SER A 358 ? ARG A 352 SER A 358 
J  2 LEU A 361 ? ILE A 368 ? LEU A 361 ILE A 368 
J  3 TYR A 409 ? VAL A 413 ? TYR A 409 VAL A 413 
J  4 ALA A 378 ? VAL A 384 ? ALA A 378 VAL A 384 
J  5 ALA A 455 ? ILE A 465 ? ALA A 455 ILE A 465 
J  6 ALA A 484 ? GLU A 488 ? ALA A 484 GLU A 488 
J  7 LEU A 538 ? SER A 543 ? LEU A 538 SER A 543 
J  8 VAL A 568 ? PHE A 573 ? VAL A 568 PHE A 573 
J  9 PHE D 131 ? GLU D 134 ? PHE D 131 GLU D 134 
K  1 TYR B 16  ? ARG B 23  ? TYR B 16  ARG B 23  
K  2 LEU B 26  ? ASN B 35  ? LEU B 26  ASN B 35  
K  3 LYS B 40  ? ASN B 49  ? LYS B 40  ASN B 49  
K  4 ARG B 55  ? GLU B 59  ? ARG B 55  GLU B 59  
L  1 SER B 62  ? ILE B 66  ? SER B 62  ILE B 66  
L  2 LYS B 72  ? ARG B 77  ? LYS B 72  ARG B 77  
L  3 ALA B 85  ? ASP B 91  ? ALA B 85  ASP B 91  
L  4 ALA B 97  ? ALA B 103 ? ALA B 97  ALA B 103 
M  1 ILE B 106 ? TRP B 111 ? ILE B 106 TRP B 111 
M  2 ARG B 117 ? LYS B 124 ? ARG B 117 LYS B 124 
M  3 LYS B 151 ? ASP B 158 ? LYS B 151 ASP B 158 
M  4 GLU B 163 ? LYS B 170 ? GLU B 163 LYS B 170 
N  1 PHE B 131 ? GLU B 134 ? PHE B 131 GLU B 134 
N  2 VAL E 568 ? PHE E 573 ? VAL E 568 PHE E 573 
N  3 LEU E 538 ? SER E 543 ? LEU E 538 SER E 543 
N  4 ALA E 484 ? GLU E 488 ? ALA E 484 GLU E 488 
N  5 ALA E 455 ? ILE E 465 ? ALA E 455 ILE E 465 
N  6 ALA E 378 ? VAL E 384 ? ALA E 378 VAL E 384 
N  7 TYR E 409 ? ASN E 414 ? TYR E 409 ASN E 414 
N  8 LEU E 361 ? ILE E 368 ? LEU E 361 ILE E 368 
N  9 ARG E 352 ? SER E 358 ? ARG E 352 SER E 358 
O  1 TRP B 140 ? PHE B 141 ? TRP B 140 PHE B 141 
O  2 GLY B 145 ? PHE B 146 ? GLY B 145 PHE B 146 
P  1 SER B 175 ? HIS B 179 ? SER B 175 HIS B 179 
P  2 SER B 182 ? ARG B 190 ? SER B 182 ARG B 190 
P  3 PRO B 194 ? LYS B 206 ? PRO B 194 LYS B 206 
P  4 GLU B 209 ? VAL B 217 ? GLU B 209 VAL B 217 
Q  1 PHE B 219 ? SER B 224 ? PHE B 219 SER B 224 
Q  2 ILE B 229 ? GLY B 233 ? ILE B 229 GLY B 233 
Q  3 LYS B 245 ? TYR B 249 ? LYS B 245 TYR B 249 
Q  4 VAL B 253 ? GLY B 255 ? VAL B 253 GLY B 255 
R  1 VAL B 264 ? ARG B 270 ? VAL B 264 ARG B 270 
R  2 LYS B 273 ? GLU B 280 ? LYS B 273 GLU B 280 
R  3 SER B 283 ? TRP B 289 ? SER B 283 TRP B 289 
R  4 VAL B 293 ? ALA B 297 ? VAL B 293 ALA B 297 
S  1 TRP B 302 ? ALA B 308 ? TRP B 302 ALA B 308 
S  2 LEU B 312 ? GLU B 317 ? LEU B 312 GLU B 317 
S  3 GLU B 324 ? TRP B 328 ? GLU B 324 TRP B 328 
S  4 GLU B 332 ? GLN B 334 ? GLU B 332 GLN B 334 
T  1 ARG B 352 ? SER B 358 ? ARG B 352 SER B 358 
T  2 LEU B 361 ? ILE B 368 ? LEU B 361 ILE B 368 
T  3 TYR B 409 ? VAL B 413 ? TYR B 409 VAL B 413 
T  4 ALA B 378 ? VAL B 384 ? ALA B 378 VAL B 384 
T  5 ALA B 455 ? ILE B 465 ? ALA B 455 ILE B 465 
T  6 ALA B 484 ? GLU B 488 ? ALA B 484 GLU B 488 
T  7 LEU B 538 ? SER B 543 ? LEU B 538 SER B 543 
T  8 VAL B 568 ? PHE B 573 ? VAL B 568 PHE B 573 
T  9 PHE E 131 ? GLU E 134 ? PHE E 131 GLU E 134 
U  1 TYR C 16  ? ARG C 23  ? TYR C 16  ARG C 23  
U  2 LEU C 26  ? ASN C 35  ? LEU C 26  ASN C 35  
U  3 LYS C 40  ? ASN C 49  ? LYS C 40  ASN C 49  
U  4 ARG C 55  ? GLU C 59  ? ARG C 55  GLU C 59  
V  1 SER C 62  ? ILE C 66  ? SER C 62  ILE C 66  
V  2 LYS C 72  ? PHE C 78  ? LYS C 72  PHE C 78  
V  3 ALA C 85  ? ASP C 91  ? ALA C 85  ASP C 91  
V  4 ALA C 97  ? GLU C 102 ? ALA C 97  GLU C 102 
W  1 ILE C 106 ? TRP C 111 ? ILE C 106 TRP C 111 
W  2 ARG C 117 ? LYS C 124 ? ARG C 117 LYS C 124 
W  3 LYS C 151 ? ASP C 158 ? LYS C 151 ASP C 158 
W  4 GLU C 163 ? LYS C 170 ? GLU C 163 LYS C 170 
X  1 PHE C 131 ? GLU C 134 ? PHE C 131 GLU C 134 
X  2 VAL F 568 ? PHE F 573 ? VAL F 568 PHE F 573 
X  3 LEU F 538 ? SER F 543 ? LEU F 538 SER F 543 
X  4 ALA F 484 ? GLU F 488 ? ALA F 484 GLU F 488 
X  5 ALA F 455 ? ILE F 465 ? ALA F 455 ILE F 465 
X  6 ALA F 378 ? VAL F 384 ? ALA F 378 VAL F 384 
X  7 TYR F 409 ? VAL F 413 ? TYR F 409 VAL F 413 
X  8 LEU F 361 ? ILE F 368 ? LEU F 361 ILE F 368 
X  9 ARG F 352 ? SER F 358 ? ARG F 352 SER F 358 
Y  1 TRP C 140 ? PHE C 141 ? TRP C 140 PHE C 141 
Y  2 GLY C 145 ? PHE C 146 ? GLY C 145 PHE C 146 
Z  1 SER C 175 ? HIS C 179 ? SER C 175 HIS C 179 
Z  2 SER C 182 ? ARG C 190 ? SER C 182 ARG C 190 
Z  3 PRO C 194 ? LYS C 206 ? PRO C 194 LYS C 206 
Z  4 GLU C 209 ? VAL C 217 ? GLU C 209 VAL C 217 
AA 1 TYR C 220 ? SER C 224 ? TYR C 220 SER C 224 
AA 2 ILE C 229 ? GLY C 233 ? ILE C 229 GLY C 233 
AA 3 LYS C 245 ? TYR C 249 ? LYS C 245 TYR C 249 
AA 4 VAL C 253 ? GLY C 255 ? VAL C 253 GLY C 255 
AB 1 GLU C 263 ? ARG C 270 ? GLU C 263 ARG C 270 
AB 2 LYS C 273 ? GLU C 280 ? LYS C 273 GLU C 280 
AB 3 SER C 283 ? TRP C 289 ? SER C 283 TRP C 289 
AB 4 VAL C 293 ? ALA C 297 ? VAL C 293 ALA C 297 
AC 1 TRP C 302 ? ALA C 308 ? TRP C 302 ALA C 308 
AC 2 LEU C 312 ? GLU C 317 ? LEU C 312 GLU C 317 
AC 3 GLU C 324 ? TRP C 328 ? GLU C 324 TRP C 328 
AC 4 GLU C 332 ? GLN C 334 ? GLU C 332 GLN C 334 
AD 1 ARG C 352 ? SER C 358 ? ARG C 352 SER C 358 
AD 2 LEU C 361 ? ILE C 368 ? LEU C 361 ILE C 368 
AD 3 TYR C 409 ? VAL C 413 ? TYR C 409 VAL C 413 
AD 4 ALA C 378 ? VAL C 384 ? ALA C 378 VAL C 384 
AD 5 ALA C 455 ? ILE C 465 ? ALA C 455 ILE C 465 
AD 6 ALA C 484 ? GLU C 488 ? ALA C 484 GLU C 488 
AD 7 LEU C 538 ? SER C 543 ? LEU C 538 SER C 543 
AD 8 VAL C 568 ? PHE C 573 ? VAL C 568 PHE C 573 
AD 9 PHE F 131 ? GLU F 134 ? PHE F 131 GLU F 134 
AE 1 TYR D 16  ? ARG D 23  ? TYR D 16  ARG D 23  
AE 2 LEU D 26  ? ASN D 35  ? LEU D 26  ASN D 35  
AE 3 LYS D 40  ? ASN D 49  ? LYS D 40  ASN D 49  
AE 4 SER D 54  ? GLU D 59  ? SER D 54  GLU D 59  
AF 1 SER D 62  ? ILE D 66  ? SER D 62  ILE D 66  
AF 2 LYS D 72  ? PHE D 78  ? LYS D 72  PHE D 78  
AF 3 ALA D 85  ? ASP D 91  ? ALA D 85  ASP D 91  
AF 4 ALA D 97  ? GLU D 102 ? ALA D 97  GLU D 102 
AG 1 ILE D 106 ? TRP D 111 ? ILE D 106 TRP D 111 
AG 2 ARG D 117 ? LYS D 124 ? ARG D 117 LYS D 124 
AG 3 LYS D 151 ? ASP D 158 ? LYS D 151 ASP D 158 
AG 4 GLU D 163 ? LYS D 170 ? GLU D 163 LYS D 170 
AH 1 TRP D 140 ? PHE D 141 ? TRP D 140 PHE D 141 
AH 2 GLY D 145 ? PHE D 146 ? GLY D 145 PHE D 146 
AI 1 SER D 175 ? HIS D 179 ? SER D 175 HIS D 179 
AI 2 SER D 182 ? PRO D 188 ? SER D 182 PRO D 188 
AI 3 TRP D 200 ? LYS D 206 ? TRP D 200 LYS D 206 
AI 4 GLU D 209 ? VAL D 217 ? GLU D 209 VAL D 217 
AJ 1 PHE D 219 ? SER D 224 ? PHE D 219 SER D 224 
AJ 2 ILE D 229 ? GLY D 233 ? ILE D 229 GLY D 233 
AJ 3 LYS D 245 ? TYR D 249 ? LYS D 245 TYR D 249 
AJ 4 VAL D 253 ? GLY D 255 ? VAL D 253 GLY D 255 
AK 1 VAL D 264 ? ARG D 270 ? VAL D 264 ARG D 270 
AK 2 LYS D 273 ? GLU D 280 ? LYS D 273 GLU D 280 
AK 3 SER D 283 ? TRP D 289 ? SER D 283 TRP D 289 
AK 4 VAL D 293 ? ALA D 297 ? VAL D 293 ALA D 297 
AL 1 TRP D 302 ? ALA D 308 ? TRP D 302 ALA D 308 
AL 2 LEU D 312 ? GLU D 317 ? LEU D 312 GLU D 317 
AL 3 GLU D 324 ? TRP D 328 ? GLU D 324 TRP D 328 
AL 4 GLU D 332 ? GLN D 334 ? GLU D 332 GLN D 334 
AM 1 TYR E 16  ? ARG E 23  ? TYR E 16  ARG E 23  
AM 2 LEU E 26  ? ASN E 35  ? LEU E 26  ASN E 35  
AM 3 LYS E 40  ? ASN E 49  ? LYS E 40  ASN E 49  
AM 4 ARG E 55  ? GLU E 59  ? ARG E 55  GLU E 59  
AN 1 SER E 62  ? ILE E 66  ? SER E 62  ILE E 66  
AN 2 LYS E 72  ? ARG E 77  ? LYS E 72  ARG E 77  
AN 3 ALA E 85  ? ASP E 91  ? ALA E 85  ASP E 91  
AN 4 ALA E 97  ? ALA E 103 ? ALA E 97  ALA E 103 
AO 1 ILE E 106 ? TRP E 111 ? ILE E 106 TRP E 111 
AO 2 ARG E 117 ? LYS E 124 ? ARG E 117 LYS E 124 
AO 3 LYS E 151 ? ASP E 158 ? LYS E 151 ASP E 158 
AO 4 GLU E 163 ? LYS E 170 ? GLU E 163 LYS E 170 
AP 1 TRP E 140 ? PHE E 141 ? TRP E 140 PHE E 141 
AP 2 GLY E 145 ? PHE E 146 ? GLY E 145 PHE E 146 
AQ 1 SER E 175 ? HIS E 179 ? SER E 175 HIS E 179 
AQ 2 SER E 182 ? PRO E 188 ? SER E 182 PRO E 188 
AQ 3 TRP E 200 ? LYS E 206 ? TRP E 200 LYS E 206 
AQ 4 GLU E 209 ? VAL E 217 ? GLU E 209 VAL E 217 
AR 1 PHE E 219 ? SER E 224 ? PHE E 219 SER E 224 
AR 2 ILE E 229 ? GLY E 233 ? ILE E 229 GLY E 233 
AR 3 LYS E 245 ? TYR E 249 ? LYS E 245 TYR E 249 
AR 4 VAL E 253 ? GLY E 255 ? VAL E 253 GLY E 255 
AS 1 GLU E 263 ? ARG E 270 ? GLU E 263 ARG E 270 
AS 2 LYS E 273 ? GLU E 280 ? LYS E 273 GLU E 280 
AS 3 SER E 283 ? TRP E 289 ? SER E 283 TRP E 289 
AS 4 VAL E 293 ? ALA E 297 ? VAL E 293 ALA E 297 
AT 1 TRP E 302 ? ALA E 308 ? TRP E 302 ALA E 308 
AT 2 LEU E 312 ? GLU E 317 ? LEU E 312 GLU E 317 
AT 3 GLU E 324 ? TRP E 328 ? GLU E 324 TRP E 328 
AT 4 GLU E 332 ? GLN E 334 ? GLU E 332 GLN E 334 
AU 1 TYR F 16  ? ARG F 23  ? TYR F 16  ARG F 23  
AU 2 LEU F 26  ? ASN F 35  ? LEU F 26  ASN F 35  
AU 3 LYS F 40  ? ASN F 49  ? LYS F 40  ASN F 49  
AU 4 ARG F 55  ? GLU F 59  ? ARG F 55  GLU F 59  
AV 1 SER F 62  ? ILE F 66  ? SER F 62  ILE F 66  
AV 2 LYS F 72  ? ARG F 77  ? LYS F 72  ARG F 77  
AV 3 GLN F 86  ? ASP F 91  ? GLN F 86  ASP F 91  
AV 4 ALA F 97  ? GLU F 102 ? ALA F 97  GLU F 102 
AW 1 ILE F 106 ? TRP F 111 ? ILE F 106 TRP F 111 
AW 2 ARG F 117 ? LYS F 124 ? ARG F 117 LYS F 124 
AW 3 LYS F 151 ? ASP F 158 ? LYS F 151 ASP F 158 
AW 4 VAL F 164 ? LYS F 170 ? VAL F 164 LYS F 170 
AX 1 TRP F 140 ? PHE F 141 ? TRP F 140 PHE F 141 
AX 2 GLY F 145 ? PHE F 146 ? GLY F 145 PHE F 146 
AY 1 SER F 175 ? HIS F 179 ? SER F 175 HIS F 179 
AY 2 SER F 182 ? PRO F 188 ? SER F 182 PRO F 188 
AY 3 TRP F 200 ? LYS F 206 ? TRP F 200 LYS F 206 
AY 4 GLU F 209 ? VAL F 217 ? GLU F 209 VAL F 217 
AZ 1 PHE F 219 ? SER F 224 ? PHE F 219 SER F 224 
AZ 2 ILE F 229 ? GLY F 233 ? ILE F 229 GLY F 233 
AZ 3 LYS F 245 ? TYR F 249 ? LYS F 245 TYR F 249 
AZ 4 VAL F 253 ? GLY F 255 ? VAL F 253 GLY F 255 
BA 1 VAL F 264 ? ARG F 270 ? VAL F 264 ARG F 270 
BA 2 LYS F 273 ? GLU F 280 ? LYS F 273 GLU F 280 
BA 3 SER F 283 ? TRP F 289 ? SER F 283 TRP F 289 
BA 4 VAL F 293 ? ALA F 297 ? VAL F 293 ALA F 297 
BB 1 TRP F 302 ? ALA F 308 ? TRP F 302 ALA F 308 
BB 2 LEU F 312 ? GLU F 317 ? LEU F 312 GLU F 317 
BB 3 GLU F 324 ? TRP F 328 ? GLU F 324 TRP F 328 
BB 4 GLU F 332 ? GLN F 334 ? GLU F 332 GLN F 334 
BC 1 TYR G 16  ? ARG G 23  ? TYR G 16  ARG G 23  
BC 2 LEU G 26  ? ASN G 35  ? LEU G 26  ASN G 35  
BC 3 LYS G 40  ? ASN G 49  ? LYS G 40  ASN G 49  
BC 4 ARG G 55  ? GLU G 59  ? ARG G 55  GLU G 59  
BD 1 SER G 62  ? ILE G 66  ? SER G 62  ILE G 66  
BD 2 LYS G 72  ? ARG G 77  ? LYS G 72  ARG G 77  
BD 3 ALA G 85  ? ASP G 91  ? ALA G 85  ASP G 91  
BD 4 ALA G 97  ? ALA G 103 ? ALA G 97  ALA G 103 
BE 1 ILE G 106 ? TRP G 111 ? ILE G 106 TRP G 111 
BE 2 ARG G 117 ? LYS G 124 ? ARG G 117 LYS G 124 
BE 3 LYS G 151 ? ASP G 158 ? LYS G 151 ASP G 158 
BE 4 GLU G 163 ? LYS G 170 ? GLU G 163 LYS G 170 
BF 1 PHE G 131 ? GLU G 134 ? PHE G 131 GLU G 134 
BF 2 VAL J 568 ? PHE J 573 ? VAL J 568 PHE J 573 
BF 3 LEU J 538 ? SER J 543 ? LEU J 538 SER J 543 
BF 4 ALA J 484 ? GLU J 488 ? ALA J 484 GLU J 488 
BF 5 ALA J 455 ? ILE J 465 ? ALA J 455 ILE J 465 
BF 6 ALA J 378 ? VAL J 384 ? ALA J 378 VAL J 384 
BF 7 TYR J 409 ? VAL J 413 ? TYR J 409 VAL J 413 
BF 8 GLY J 365 ? ILE J 368 ? GLY J 365 ILE J 368 
BG 1 TRP G 140 ? PHE G 141 ? TRP G 140 PHE G 141 
BG 2 GLY G 145 ? PHE G 146 ? GLY G 145 PHE G 146 
BH 1 SER G 175 ? HIS G 179 ? SER G 175 HIS G 179 
BH 2 SER G 182 ? PRO G 188 ? SER G 182 PRO G 188 
BH 3 TRP G 200 ? LYS G 206 ? TRP G 200 LYS G 206 
BH 4 GLU G 209 ? SER G 224 ? GLU G 209 SER G 224 
BH 5 ILE G 229 ? LYS G 234 ? ILE G 229 LYS G 234 
BH 6 LYS G 245 ? TYR G 249 ? LYS G 245 TYR G 249 
BH 7 VAL G 253 ? GLY G 255 ? VAL G 253 GLY G 255 
BI 1 VAL G 264 ? ARG G 270 ? VAL G 264 ARG G 270 
BI 2 LYS G 273 ? GLU G 280 ? LYS G 273 GLU G 280 
BI 3 SER G 283 ? TRP G 289 ? SER G 283 TRP G 289 
BI 4 VAL G 293 ? ALA G 297 ? VAL G 293 ALA G 297 
BJ 1 TRP G 302 ? ALA G 308 ? TRP G 302 ALA G 308 
BJ 2 LEU G 312 ? THR G 318 ? LEU G 312 THR G 318 
BJ 3 ARG G 321 ? TRP G 328 ? ARG G 321 TRP G 328 
BJ 4 GLU G 332 ? GLN G 334 ? GLU G 332 GLN G 334 
BK 1 ARG G 352 ? SER G 358 ? ARG G 352 SER G 358 
BK 2 LEU G 361 ? ILE G 368 ? LEU G 361 ILE G 368 
BK 3 TYR G 409 ? VAL G 413 ? TYR G 409 VAL G 413 
BK 4 VAL G 380 ? VAL G 384 ? VAL G 380 VAL G 384 
BK 5 ILE G 460 ? ILE G 465 ? ILE G 460 ILE G 465 
BK 6 ALA G 484 ? GLU G 488 ? ALA G 484 GLU G 488 
BK 7 LEU G 538 ? SER G 543 ? LEU G 538 SER G 543 
BK 8 VAL G 568 ? PHE G 573 ? VAL G 568 PHE G 573 
BK 9 PHE J 131 ? GLU J 134 ? PHE J 131 GLU J 134 
BL 1 TYR H 16  ? ARG H 23  ? TYR H 16  ARG H 23  
BL 2 LEU H 26  ? ASN H 35  ? LEU H 26  ASN H 35  
BL 3 LYS H 40  ? ASN H 49  ? LYS H 40  ASN H 49  
BL 4 SER H 54  ? GLU H 59  ? SER H 54  GLU H 59  
BM 1 SER H 62  ? ILE H 66  ? SER H 62  ILE H 66  
BM 2 LYS H 72  ? ARG H 77  ? LYS H 72  ARG H 77  
BM 3 ALA H 85  ? ASP H 91  ? ALA H 85  ASP H 91  
BM 4 ALA H 97  ? ALA H 103 ? ALA H 97  ALA H 103 
BN 1 ILE H 106 ? TRP H 111 ? ILE H 106 TRP H 111 
BN 2 ARG H 117 ? LYS H 124 ? ARG H 117 LYS H 124 
BN 3 LYS H 151 ? ASP H 158 ? LYS H 151 ASP H 158 
BN 4 GLU H 163 ? LYS H 170 ? GLU H 163 LYS H 170 
BO 1 PHE H 131 ? GLU H 134 ? PHE H 131 GLU H 134 
BO 2 VAL K 568 ? PHE K 573 ? VAL K 568 PHE K 573 
BO 3 LEU K 538 ? SER K 543 ? LEU K 538 SER K 543 
BO 4 ALA K 484 ? GLU K 488 ? ALA K 484 GLU K 488 
BO 5 ALA K 455 ? ILE K 465 ? ALA K 455 ILE K 465 
BO 6 ALA K 378 ? VAL K 384 ? ALA K 378 VAL K 384 
BO 7 TYR K 409 ? VAL K 413 ? TYR K 409 VAL K 413 
BO 8 LEU K 361 ? ILE K 368 ? LEU K 361 ILE K 368 
BO 9 ARG K 352 ? SER K 358 ? ARG K 352 SER K 358 
BP 1 TRP H 140 ? PHE H 141 ? TRP H 140 PHE H 141 
BP 2 GLY H 145 ? PHE H 146 ? GLY H 145 PHE H 146 
BQ 1 SER H 175 ? HIS H 179 ? SER H 175 HIS H 179 
BQ 2 SER H 182 ? PRO H 188 ? SER H 182 PRO H 188 
BQ 3 TRP H 200 ? LYS H 206 ? TRP H 200 LYS H 206 
BQ 4 GLU H 209 ? VAL H 217 ? GLU H 209 VAL H 217 
BR 1 PHE H 219 ? SER H 224 ? PHE H 219 SER H 224 
BR 2 ILE H 229 ? GLY H 233 ? ILE H 229 GLY H 233 
BR 3 LYS H 245 ? TYR H 249 ? LYS H 245 TYR H 249 
BR 4 VAL H 253 ? GLY H 255 ? VAL H 253 GLY H 255 
BS 1 GLU H 263 ? ARG H 270 ? GLU H 263 ARG H 270 
BS 2 LYS H 273 ? GLU H 280 ? LYS H 273 GLU H 280 
BS 3 SER H 283 ? TRP H 289 ? SER H 283 TRP H 289 
BS 4 VAL H 293 ? ALA H 297 ? VAL H 293 ALA H 297 
BT 1 TRP H 302 ? ILE H 303 ? TRP H 302 ILE H 303 
BT 2 LEU H 312 ? GLU H 317 ? LEU H 312 GLU H 317 
BT 3 ASP H 307 ? ALA H 308 ? ASP H 307 ALA H 308 
BU 1 TRP H 302 ? ILE H 303 ? TRP H 302 ILE H 303 
BU 2 LEU H 312 ? GLU H 317 ? LEU H 312 GLU H 317 
BU 3 GLU H 324 ? TRP H 328 ? GLU H 324 TRP H 328 
BU 4 GLU H 332 ? GLN H 334 ? GLU H 332 GLN H 334 
BV 1 ARG H 352 ? SER H 358 ? ARG H 352 SER H 358 
BV 2 LEU H 361 ? ILE H 368 ? LEU H 361 ILE H 368 
BV 3 TYR H 409 ? VAL H 413 ? TYR H 409 VAL H 413 
BV 4 ALA H 378 ? VAL H 384 ? ALA H 378 VAL H 384 
BV 5 ALA H 455 ? ILE H 465 ? ALA H 455 ILE H 465 
BV 6 ALA H 484 ? GLU H 488 ? ALA H 484 GLU H 488 
BV 7 LEU H 538 ? SER H 543 ? LEU H 538 SER H 543 
BV 8 VAL H 568 ? PHE H 573 ? VAL H 568 PHE H 573 
BV 9 PHE K 131 ? GLU K 134 ? PHE K 131 GLU K 134 
BW 1 TYR I 16  ? ARG I 23  ? TYR I 16  ARG I 23  
BW 2 LEU I 26  ? ASN I 35  ? LEU I 26  ASN I 35  
BW 3 LYS I 40  ? ASN I 49  ? LYS I 40  ASN I 49  
BW 4 ARG I 55  ? GLU I 59  ? ARG I 55  GLU I 59  
BX 1 SER I 62  ? ILE I 66  ? SER I 62  ILE I 66  
BX 2 LYS I 72  ? ARG I 77  ? LYS I 72  ARG I 77  
BX 3 ALA I 85  ? ASP I 91  ? ALA I 85  ASP I 91  
BX 4 ALA I 97  ? ALA I 103 ? ALA I 97  ALA I 103 
BY 1 ILE I 106 ? TRP I 111 ? ILE I 106 TRP I 111 
BY 2 ARG I 117 ? LYS I 124 ? ARG I 117 LYS I 124 
BY 3 LYS I 151 ? ASP I 158 ? LYS I 151 ASP I 158 
BY 4 GLU I 163 ? LYS I 170 ? GLU I 163 LYS I 170 
BZ 1 PHE I 131 ? GLU I 134 ? PHE I 131 GLU I 134 
BZ 2 VAL L 568 ? PHE L 573 ? VAL L 568 PHE L 573 
BZ 3 LEU L 538 ? SER L 543 ? LEU L 538 SER L 543 
BZ 4 ALA L 484 ? GLU L 488 ? ALA L 484 GLU L 488 
BZ 5 ALA L 455 ? ILE L 465 ? ALA L 455 ILE L 465 
BZ 6 ALA L 378 ? VAL L 384 ? ALA L 378 VAL L 384 
BZ 7 TYR L 409 ? VAL L 413 ? TYR L 409 VAL L 413 
BZ 8 LEU L 361 ? ILE L 368 ? LEU L 361 ILE L 368 
BZ 9 ARG L 352 ? SER L 358 ? ARG L 352 SER L 358 
CA 1 TRP I 140 ? PHE I 141 ? TRP I 140 PHE I 141 
CA 2 GLY I 145 ? PHE I 146 ? GLY I 145 PHE I 146 
CB 1 SER I 175 ? HIS I 179 ? SER I 175 HIS I 179 
CB 2 SER I 182 ? PRO I 188 ? SER I 182 PRO I 188 
CB 3 TRP I 200 ? LYS I 206 ? TRP I 200 LYS I 206 
CB 4 GLU I 209 ? VAL I 217 ? GLU I 209 VAL I 217 
CC 1 PHE I 219 ? SER I 224 ? PHE I 219 SER I 224 
CC 2 ILE I 229 ? GLY I 233 ? ILE I 229 GLY I 233 
CC 3 LYS I 245 ? TYR I 249 ? LYS I 245 TYR I 249 
CC 4 VAL I 253 ? GLY I 255 ? VAL I 253 GLY I 255 
CD 1 VAL I 264 ? ARG I 270 ? VAL I 264 ARG I 270 
CD 2 LYS I 273 ? GLU I 280 ? LYS I 273 GLU I 280 
CD 3 SER I 283 ? TRP I 289 ? SER I 283 TRP I 289 
CD 4 VAL I 293 ? ALA I 297 ? VAL I 293 ALA I 297 
CE 1 TRP I 302 ? ALA I 308 ? TRP I 302 ALA I 308 
CE 2 LEU I 312 ? GLU I 317 ? LEU I 312 GLU I 317 
CE 3 GLU I 324 ? TRP I 328 ? GLU I 324 TRP I 328 
CE 4 GLU I 332 ? GLN I 334 ? GLU I 332 GLN I 334 
CF 1 ARG I 352 ? SER I 358 ? ARG I 352 SER I 358 
CF 2 LEU I 361 ? ILE I 368 ? LEU I 361 ILE I 368 
CF 3 TYR I 409 ? VAL I 413 ? TYR I 409 VAL I 413 
CF 4 ALA I 378 ? VAL I 384 ? ALA I 378 VAL I 384 
CF 5 ALA I 455 ? ILE I 465 ? ALA I 455 ILE I 465 
CF 6 ALA I 484 ? GLU I 488 ? ALA I 484 GLU I 488 
CF 7 LEU I 538 ? SER I 543 ? LEU I 538 SER I 543 
CF 8 VAL I 568 ? PHE I 573 ? VAL I 568 PHE I 573 
CF 9 PHE L 131 ? GLU L 134 ? PHE L 131 GLU L 134 
CG 1 TYR J 16  ? ARG J 23  ? TYR J 16  ARG J 23  
CG 2 LEU J 26  ? ASN J 35  ? LEU J 26  ASN J 35  
CG 3 LYS J 40  ? ASN J 49  ? LYS J 40  ASN J 49  
CG 4 ARG J 55  ? GLU J 59  ? ARG J 55  GLU J 59  
CH 1 SER J 62  ? ILE J 66  ? SER J 62  ILE J 66  
CH 2 LYS J 72  ? ARG J 77  ? LYS J 72  ARG J 77  
CH 3 GLN J 86  ? ASP J 91  ? GLN J 86  ASP J 91  
CH 4 ALA J 97  ? GLU J 102 ? ALA J 97  GLU J 102 
CI 1 ILE J 106 ? TRP J 111 ? ILE J 106 TRP J 111 
CI 2 ARG J 117 ? LYS J 124 ? ARG J 117 LYS J 124 
CI 3 LYS J 151 ? ASP J 158 ? LYS J 151 ASP J 158 
CI 4 GLU J 163 ? LYS J 170 ? GLU J 163 LYS J 170 
CJ 1 TRP J 140 ? PHE J 141 ? TRP J 140 PHE J 141 
CJ 2 GLY J 145 ? PHE J 146 ? GLY J 145 PHE J 146 
CK 1 TRP J 178 ? HIS J 179 ? TRP J 178 HIS J 179 
CK 2 SER J 182 ? PRO J 188 ? SER J 182 PRO J 188 
CK 3 TRP J 200 ? LYS J 206 ? TRP J 200 LYS J 206 
CK 4 GLU J 209 ? GLU J 210 ? GLU J 209 GLU J 210 
CL 1 PHE J 219 ? SER J 224 ? PHE J 219 SER J 224 
CL 2 ILE J 229 ? GLY J 233 ? ILE J 229 GLY J 233 
CL 3 LYS J 245 ? TYR J 249 ? LYS J 245 TYR J 249 
CL 4 VAL J 253 ? GLY J 255 ? VAL J 253 GLY J 255 
CM 1 VAL J 264 ? ARG J 270 ? VAL J 264 ARG J 270 
CM 2 LYS J 273 ? GLU J 280 ? LYS J 273 GLU J 280 
CM 3 SER J 283 ? TRP J 289 ? SER J 283 TRP J 289 
CM 4 VAL J 293 ? ALA J 297 ? VAL J 293 ALA J 297 
CN 1 TRP J 302 ? ALA J 308 ? TRP J 302 ALA J 308 
CN 2 LEU J 312 ? GLU J 317 ? LEU J 312 GLU J 317 
CN 3 GLU J 324 ? TRP J 328 ? GLU J 324 TRP J 328 
CN 4 GLU J 332 ? GLN J 334 ? GLU J 332 GLN J 334 
CO 1 PHE J 356 ? SER J 358 ? PHE J 356 SER J 358 
CO 2 LEU J 361 ? LEU J 363 ? LEU J 361 LEU J 363 
CP 1 ALA K 15  ? ARG K 23  ? ALA K 15  ARG K 23  
CP 2 LEU K 26  ? ASN K 35  ? LEU K 26  ASN K 35  
CP 3 LYS K 40  ? ASN K 49  ? LYS K 40  ASN K 49  
CP 4 ARG K 55  ? GLU K 59  ? ARG K 55  GLU K 59  
CQ 1 SER K 62  ? ILE K 66  ? SER K 62  ILE K 66  
CQ 2 LYS K 72  ? ARG K 77  ? LYS K 72  ARG K 77  
CQ 3 GLN K 86  ? ASP K 91  ? GLN K 86  ASP K 91  
CQ 4 SER K 96  ? GLU K 102 ? SER K 96  GLU K 102 
CR 1 ILE K 106 ? TRP K 111 ? ILE K 106 TRP K 111 
CR 2 ARG K 117 ? LYS K 124 ? ARG K 117 LYS K 124 
CR 3 LYS K 151 ? ASP K 158 ? LYS K 151 ASP K 158 
CR 4 GLU K 163 ? LYS K 170 ? GLU K 163 LYS K 170 
CS 1 TRP K 140 ? PHE K 141 ? TRP K 140 PHE K 141 
CS 2 GLY K 145 ? PHE K 146 ? GLY K 145 PHE K 146 
CT 1 SER K 175 ? HIS K 179 ? SER K 175 HIS K 179 
CT 2 SER K 182 ? ARG K 190 ? SER K 182 ARG K 190 
CT 3 PRO K 194 ? LYS K 206 ? PRO K 194 LYS K 206 
CT 4 GLU K 209 ? GLU K 215 ? GLU K 209 GLU K 215 
CU 1 PHE K 219 ? SER K 224 ? PHE K 219 SER K 224 
CU 2 ILE K 229 ? GLY K 233 ? ILE K 229 GLY K 233 
CU 3 LYS K 245 ? TYR K 249 ? LYS K 245 TYR K 249 
CU 4 VAL K 253 ? GLY K 255 ? VAL K 253 GLY K 255 
CV 1 GLU K 263 ? ARG K 270 ? GLU K 263 ARG K 270 
CV 2 LYS K 273 ? GLU K 280 ? LYS K 273 GLU K 280 
CV 3 SER K 283 ? TRP K 289 ? SER K 283 TRP K 289 
CV 4 VAL K 293 ? ALA K 297 ? VAL K 293 ALA K 297 
CW 1 TRP K 302 ? ALA K 308 ? TRP K 302 ALA K 308 
CW 2 LEU K 312 ? GLU K 317 ? LEU K 312 GLU K 317 
CW 3 GLU K 324 ? TRP K 328 ? GLU K 324 TRP K 328 
CW 4 GLU K 332 ? GLN K 334 ? GLU K 332 GLN K 334 
CX 1 TYR L 16  ? ARG L 23  ? TYR L 16  ARG L 23  
CX 2 LEU L 26  ? ASN L 35  ? LEU L 26  ASN L 35  
CX 3 LYS L 40  ? ASN L 49  ? LYS L 40  ASN L 49  
CX 4 ARG L 55  ? GLU L 59  ? ARG L 55  GLU L 59  
CY 1 SER L 62  ? ILE L 66  ? SER L 62  ILE L 66  
CY 2 LYS L 72  ? ARG L 77  ? LYS L 72  ARG L 77  
CY 3 GLN L 86  ? ASP L 91  ? GLN L 86  ASP L 91  
CY 4 ALA L 97  ? GLU L 102 ? ALA L 97  GLU L 102 
CZ 1 ILE L 106 ? TRP L 111 ? ILE L 106 TRP L 111 
CZ 2 ARG L 117 ? LYS L 124 ? ARG L 117 LYS L 124 
CZ 3 LYS L 151 ? ASP L 158 ? LYS L 151 ASP L 158 
CZ 4 GLU L 163 ? LYS L 170 ? GLU L 163 LYS L 170 
DA 1 TRP L 140 ? PHE L 141 ? TRP L 140 PHE L 141 
DA 2 GLY L 145 ? PHE L 146 ? GLY L 145 PHE L 146 
DB 1 SER L 175 ? HIS L 179 ? SER L 175 HIS L 179 
DB 2 SER L 182 ? PRO L 188 ? SER L 182 PRO L 188 
DB 3 TRP L 200 ? LYS L 206 ? TRP L 200 LYS L 206 
DB 4 GLU L 209 ? SER L 224 ? GLU L 209 SER L 224 
DB 5 ILE L 229 ? LYS L 234 ? ILE L 229 LYS L 234 
DB 6 LYS L 245 ? TYR L 249 ? LYS L 245 TYR L 249 
DB 7 VAL L 253 ? LYS L 254 ? VAL L 253 LYS L 254 
DC 1 GLU L 263 ? ARG L 270 ? GLU L 263 ARG L 270 
DC 2 LYS L 273 ? GLU L 280 ? LYS L 273 GLU L 280 
DC 3 SER L 283 ? TRP L 289 ? SER L 283 TRP L 289 
DC 4 VAL L 293 ? ALA L 297 ? VAL L 293 ALA L 297 
DD 1 TRP L 302 ? ALA L 308 ? TRP L 302 ALA L 308 
DD 2 LEU L 312 ? GLU L 317 ? LEU L 312 GLU L 317 
DD 3 GLU L 324 ? TRP L 328 ? GLU L 324 TRP L 328 
DD 4 GLU L 332 ? GLN L 334 ? GLU L 332 GLN L 334 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N SER A 18  ? N SER A 18  O VAL A 30  ? O VAL A 30  
A  2 3 N VAL A 27  ? N VAL A 27  O GLU A 48  ? O GLU A 48  
A  3 4 N ILE A 45  ? N ILE A 45  O ILE A 58  ? O ILE A 58  
B  1 2 N ARG A 65  ? N ARG A 65  O ALA A 74  ? O ALA A 74  
B  2 3 N ILE A 73  ? N ILE A 73  O ALA A 90  ? O ALA A 90  
B  3 4 N ILE A 87  ? N ILE A 87  O LEU A 101 ? O LEU A 101 
C  1 2 N GLU A 110 ? N GLU A 110 O LEU A 119 ? O LEU A 119 
C  2 3 N ALA A 120 ? N ALA A 120 O TRP A 155 ? O TRP A 155 
C  3 4 N PHE A 154 ? N PHE A 154 O PHE A 168 ? O PHE A 168 
D  1 2 N ILE A 132 ? N ILE A 132 O ILE D 572 ? O ILE D 572 
D  2 3 O PHE D 573 ? O PHE D 573 N HIS D 542 ? N HIS D 542 
D  3 4 O LEU D 539 ? O LEU D 539 N SER D 487 ? N SER D 487 
D  4 5 O GLU D 488 ? O GLU D 488 N GLY D 464 ? N GLY D 464 
D  5 6 O GLY D 461 ? O GLY D 461 N VAL D 380 ? N VAL D 380 
D  6 7 N PRO D 379 ? N PRO D 379 O TYR D 409 ? O TYR D 409 
D  7 8 O TYR D 412 ? O TYR D 412 N TRP D 366 ? N TRP D 366 
D  8 9 O LEU D 361 ? O LEU D 361 N SER D 358 ? N SER D 358 
E  1 2 N PHE A 141 ? N PHE A 141 O GLY A 145 ? O GLY A 145 
F  1 2 N HIS A 179 ? N HIS A 179 O SER A 182 ? O SER A 182 
F  2 3 N ILE A 183 ? N ILE A 183 O TRP A 205 ? O TRP A 205 
F  3 4 N LYS A 206 ? N LYS A 206 O GLU A 209 ? O GLU A 209 
G  1 2 N TYR A 220 ? N TYR A 220 O TYR A 232 ? O TYR A 232 
G  2 3 N LEU A 231 ? N LEU A 231 O TYR A 247 ? O TYR A 247 
G  3 4 N ILE A 248 ? N ILE A 248 O LYS A 254 ? O LYS A 254 
H  1 2 N LYS A 268 ? N LYS A 268 O TYR A 275 ? O TYR A 275 
H  2 3 N PHE A 276 ? N PHE A 276 O TYR A 287 ? O TYR A 287 
H  3 4 N LEU A 286 ? N LEU A 286 O ALA A 297 ? O ALA A 297 
I  1 2 N TRP A 302 ? N TRP A 302 O GLU A 317 ? O GLU A 317 
I  2 3 N TYR A 314 ? N TYR A 314 O TYR A 326 ? O TYR A 326 
I  3 4 N LEU A 327 ? N LEU A 327 O ARG A 333 ? O ARG A 333 
J  1 2 N ARG A 352 ? N ARG A 352 O TYR A 367 ? O TYR A 367 
J  2 3 N ILE A 368 ? N ILE A 368 O ILE A 410 ? O ILE A 410 
J  3 4 O TYR A 409 ? O TYR A 409 N ILE A 381 ? N ILE A 381 
J  4 5 N VAL A 380 ? N VAL A 380 O GLY A 461 ? O GLY A 461 
J  5 6 N ILE A 462 ? N ILE A 462 O ILE A 486 ? O ILE A 486 
J  6 7 N SER A 487 ? N SER A 487 O ILE A 541 ? O ILE A 541 
J  7 8 N LEU A 540 ? N LEU A 540 O TYR A 569 ? O TYR A 569 
J  8 9 N ILE A 572 ? N ILE A 572 O ILE D 132 ? O ILE D 132 
K  1 2 N ARG B 21  ? N ARG B 21  O ALA B 28  ? O ALA B 28  
K  2 3 N LEU B 31  ? N LEU B 31  O THR B 44  ? O THR B 44  
K  3 4 N ILE B 45  ? N ILE B 45  O ILE B 58  ? O ILE B 58  
L  1 2 N ARG B 65  ? N ARG B 65  O ALA B 74  ? O ALA B 74  
L  2 3 N ILE B 73  ? N ILE B 73  O ALA B 90  ? O ALA B 90  
L  3 4 N ALA B 85  ? N ALA B 85  O ALA B 103 ? O ALA B 103 
M  1 2 N GLU B 110 ? N GLU B 110 O LEU B 119 ? O LEU B 119 
M  2 3 N LEU B 118 ? N LEU B 118 O ILE B 157 ? O ILE B 157 
M  3 4 N VAL B 156 ? N VAL B 156 O GLU B 166 ? O GLU B 166 
N  1 2 N ILE B 132 ? N ILE B 132 O ILE E 572 ? O ILE E 572 
N  2 3 O ALA E 571 ? O ALA E 571 N LEU E 540 ? N LEU E 540 
N  3 4 O LEU E 539 ? O LEU E 539 N SER E 487 ? N SER E 487 
N  4 5 O GLU E 488 ? O GLU E 488 N GLY E 464 ? N GLY E 464 
N  5 6 O GLY E 461 ? O GLY E 461 N VAL E 380 ? N VAL E 380 
N  6 7 N PRO E 379 ? N PRO E 379 O TYR E 409 ? O TYR E 409 
N  7 8 O TYR E 412 ? O TYR E 412 N TRP E 366 ? N TRP E 366 
N  8 9 O TYR E 367 ? O TYR E 367 N ARG E 352 ? N ARG E 352 
O  1 2 N PHE B 141 ? N PHE B 141 O GLY B 145 ? O GLY B 145 
P  1 2 N HIS B 179 ? N HIS B 179 O SER B 182 ? O SER B 182 
P  2 3 N VAL B 185 ? N VAL B 185 O TYR B 203 ? O TYR B 203 
P  3 4 N LEU B 204 ? N LEU B 204 O GLU B 211 ? O GLU B 211 
Q  1 2 N TYR B 220 ? N TYR B 220 O TYR B 232 ? O TYR B 232 
Q  2 3 N GLY B 233 ? N GLY B 233 O LYS B 245 ? O LYS B 245 
Q  3 4 N ILE B 248 ? N ILE B 248 O LYS B 254 ? O LYS B 254 
R  1 2 N LYS B 268 ? N LYS B 268 O TYR B 275 ? O TYR B 275 
R  2 3 N PHE B 276 ? N PHE B 276 O TYR B 287 ? O TYR B 287 
R  3 4 N LEU B 288 ? N LEU B 288 O ARG B 294 ? O ARG B 294 
S  1 2 N ASP B 307 ? N ASP B 307 O ILE B 313 ? O ILE B 313 
S  2 3 N TYR B 314 ? N TYR B 314 O TYR B 326 ? O TYR B 326 
S  3 4 N LEU B 327 ? N LEU B 327 O ARG B 333 ? O ARG B 333 
T  1 2 N ARG B 352 ? N ARG B 352 O TYR B 367 ? O TYR B 367 
T  2 3 N TRP B 366 ? N TRP B 366 O TYR B 412 ? O TYR B 412 
T  3 4 O TYR B 409 ? O TYR B 409 N PRO B 379 ? N PRO B 379 
T  4 5 N VAL B 382 ? N VAL B 382 O THR B 463 ? O THR B 463 
T  5 6 N GLY B 464 ? N GLY B 464 O GLU B 488 ? O GLU B 488 
T  6 7 N SER B 487 ? N SER B 487 O ILE B 541 ? O ILE B 541 
T  7 8 N LEU B 540 ? N LEU B 540 O TYR B 569 ? O TYR B 569 
T  8 9 N ILE B 572 ? N ILE B 572 O ILE E 132 ? O ILE E 132 
U  1 2 N SER C 18  ? N SER C 18  O VAL C 30  ? O VAL C 30  
U  2 3 N VAL C 27  ? N VAL C 27  O GLU C 48  ? O GLU C 48  
U  3 4 N ILE C 45  ? N ILE C 45  O ILE C 58  ? O ILE C 58  
V  1 2 N ARG C 65  ? N ARG C 65  O ALA C 74  ? O ALA C 74  
V  2 3 N PHE C 75  ? N PHE C 75  O TRP C 88  ? O TRP C 88  
V  3 4 N ILE C 87  ? N ILE C 87  O LEU C 101 ? O LEU C 101 
W  1 2 N GLU C 110 ? N GLU C 110 O LEU C 119 ? O LEU C 119 
W  2 3 N ALA C 120 ? N ALA C 120 O TRP C 155 ? O TRP C 155 
W  3 4 N ASP C 158 ? N ASP C 158 O GLU C 163 ? O GLU C 163 
X  1 2 N ILE C 132 ? N ILE C 132 O ILE F 572 ? O ILE F 572 
X  2 3 O TYR F 569 ? O TYR F 569 N LEU F 540 ? N LEU F 540 
X  3 4 O ILE F 541 ? O ILE F 541 N SER F 487 ? N SER F 487 
X  4 5 O GLU F 488 ? O GLU F 488 N GLY F 464 ? N GLY F 464 
X  5 6 O GLY F 461 ? O GLY F 461 N VAL F 380 ? N VAL F 380 
X  6 7 N PRO F 379 ? N PRO F 379 O TYR F 409 ? O TYR F 409 
X  7 8 O TYR F 412 ? O TYR F 412 N TRP F 366 ? N TRP F 366 
X  8 9 O LEU F 361 ? O LEU F 361 N SER F 358 ? N SER F 358 
Y  1 2 N PHE C 141 ? N PHE C 141 O GLY C 145 ? O GLY C 145 
Z  1 2 N HIS C 179 ? N HIS C 179 O SER C 182 ? O SER C 182 
Z  2 3 N HIS C 189 ? N HIS C 189 O ARG C 195 ? O ARG C 195 
Z  3 4 N TRP C 200 ? N TRP C 200 O VAL C 217 ? O VAL C 217 
AA 1 2 N TYR C 220 ? N TYR C 220 O TYR C 232 ? O TYR C 232 
AA 2 3 N ILE C 229 ? N ILE C 229 O TYR C 249 ? O TYR C 249 
AA 3 4 N ILE C 248 ? N ILE C 248 O LYS C 254 ? O LYS C 254 
AB 1 2 N ARG C 270 ? N ARG C 270 O LYS C 273 ? O LYS C 273 
AB 2 3 N PHE C 276 ? N PHE C 276 O TYR C 287 ? O TYR C 287 
AB 3 4 N LEU C 288 ? N LEU C 288 O ARG C 294 ? O ARG C 294 
AC 1 2 N TRP C 302 ? N TRP C 302 O GLU C 317 ? O GLU C 317 
AC 2 3 N TYR C 314 ? N TYR C 314 O TYR C 326 ? O TYR C 326 
AC 3 4 N LEU C 327 ? N LEU C 327 O ARG C 333 ? O ARG C 333 
AD 1 2 N ARG C 352 ? N ARG C 352 O TYR C 367 ? O TYR C 367 
AD 2 3 N ILE C 368 ? N ILE C 368 O ILE C 410 ? O ILE C 410 
AD 3 4 O TYR C 409 ? O TYR C 409 N ILE C 381 ? N ILE C 381 
AD 4 5 N VAL C 380 ? N VAL C 380 O GLY C 461 ? O GLY C 461 
AD 5 6 N GLY C 464 ? N GLY C 464 O GLU C 488 ? O GLU C 488 
AD 6 7 N SER C 487 ? N SER C 487 O ILE C 541 ? O ILE C 541 
AD 7 8 N HIS C 542 ? N HIS C 542 O PHE C 573 ? O PHE C 573 
AD 8 9 N ILE C 572 ? N ILE C 572 O ILE F 132 ? O ILE F 132 
AE 1 2 N ARG D 23  ? N ARG D 23  O LEU D 26  ? O LEU D 26  
AE 2 3 N LEU D 31  ? N LEU D 31  O THR D 44  ? O THR D 44  
AE 3 4 N ILE D 47  ? N ILE D 47  O LYS D 56  ? O LYS D 56  
AF 1 2 N ARG D 65  ? N ARG D 65  O ALA D 74  ? O ALA D 74  
AF 2 3 N PHE D 75  ? N PHE D 75  O TRP D 88  ? O TRP D 88  
AF 3 4 N VAL D 89  ? N VAL D 89  O LYS D 98  ? O LYS D 98  
AG 1 2 N GLU D 110 ? N GLU D 110 O LEU D 119 ? O LEU D 119 
AG 2 3 N ALA D 120 ? N ALA D 120 O TRP D 155 ? O TRP D 155 
AG 3 4 N PHE D 154 ? N PHE D 154 O PHE D 168 ? O PHE D 168 
AH 1 2 N PHE D 141 ? N PHE D 141 O GLY D 145 ? O GLY D 145 
AI 1 2 N HIS D 179 ? N HIS D 179 O SER D 182 ? O SER D 182 
AI 2 3 N VAL D 187 ? N VAL D 187 O ASP D 201 ? O ASP D 201 
AI 3 4 N LEU D 204 ? N LEU D 204 O GLU D 211 ? O GLU D 211 
AJ 1 2 N ASP D 223 ? N ASP D 223 O LEU D 230 ? O LEU D 230 
AJ 2 3 N ILE D 229 ? N ILE D 229 O TYR D 249 ? O TYR D 249 
AJ 3 4 N ILE D 248 ? N ILE D 248 O LYS D 254 ? O LYS D 254 
AK 1 2 N LYS D 268 ? N LYS D 268 O TYR D 275 ? O TYR D 275 
AK 2 3 N GLU D 280 ? N GLU D 280 O SER D 283 ? O SER D 283 
AK 3 4 N LEU D 286 ? N LEU D 286 O ILE D 296 ? O ILE D 296 
AL 1 2 N TRP D 302 ? N TRP D 302 O GLU D 317 ? O GLU D 317 
AL 2 3 N LEU D 312 ? N LEU D 312 O TRP D 328 ? O TRP D 328 
AL 3 4 N LEU D 327 ? N LEU D 327 O ARG D 333 ? O ARG D 333 
AM 1 2 N ARG E 21  ? N ARG E 21  O ALA E 28  ? O ALA E 28  
AM 2 3 N VAL E 27  ? N VAL E 27  O GLU E 48  ? O GLU E 48  
AM 3 4 N ILE E 45  ? N ILE E 45  O ILE E 58  ? O ILE E 58  
AN 1 2 N ARG E 65  ? N ARG E 65  O ALA E 74  ? O ALA E 74  
AN 2 3 N ILE E 73  ? N ILE E 73  O ALA E 90  ? O ALA E 90  
AN 3 4 N ILE E 87  ? N ILE E 87  O LEU E 101 ? O LEU E 101 
AO 1 2 N GLU E 110 ? N GLU E 110 O LEU E 119 ? O LEU E 119 
AO 2 3 N LEU E 118 ? N LEU E 118 O ILE E 157 ? O ILE E 157 
AO 3 4 N ASP E 158 ? N ASP E 158 O GLU E 163 ? O GLU E 163 
AP 1 2 N PHE E 141 ? N PHE E 141 O GLY E 145 ? O GLY E 145 
AQ 1 2 N HIS E 179 ? N HIS E 179 O SER E 182 ? O SER E 182 
AQ 2 3 N VAL E 187 ? N VAL E 187 O ASP E 201 ? O ASP E 201 
AQ 3 4 N LYS E 206 ? N LYS E 206 O GLU E 209 ? O GLU E 209 
AR 1 2 N TYR E 220 ? N TYR E 220 O TYR E 232 ? O TYR E 232 
AR 2 3 N LEU E 231 ? N LEU E 231 O TYR E 247 ? O TYR E 247 
AR 3 4 N ILE E 248 ? N ILE E 248 O LYS E 254 ? O LYS E 254 
AS 1 2 N LYS E 268 ? N LYS E 268 O TYR E 275 ? O TYR E 275 
AS 2 3 N VAL E 274 ? N VAL E 274 O TRP E 289 ? O TRP E 289 
AS 3 4 N LEU E 288 ? N LEU E 288 O ARG E 294 ? O ARG E 294 
AT 1 2 N TRP E 302 ? N TRP E 302 O GLU E 317 ? O GLU E 317 
AT 2 3 N LEU E 312 ? N LEU E 312 O TRP E 328 ? O TRP E 328 
AT 3 4 N LEU E 327 ? N LEU E 327 O ARG E 333 ? O ARG E 333 
AU 1 2 N ARG F 23  ? N ARG F 23  O LEU F 26  ? O LEU F 26  
AU 2 3 N LEU F 31  ? N LEU F 31  O THR F 44  ? O THR F 44  
AU 3 4 N ILE F 47  ? N ILE F 47  O LYS F 56  ? O LYS F 56  
AV 1 2 N ARG F 65  ? N ARG F 65  O ALA F 74  ? O ALA F 74  
AV 2 3 N ILE F 73  ? N ILE F 73  O ALA F 90  ? O ALA F 90  
AV 3 4 N ILE F 87  ? N ILE F 87  O LEU F 101 ? O LEU F 101 
AW 1 2 N GLU F 110 ? N GLU F 110 O LEU F 119 ? O LEU F 119 
AW 2 3 N LEU F 118 ? N LEU F 118 O ILE F 157 ? O ILE F 157 
AW 3 4 N VAL F 156 ? N VAL F 156 O GLU F 166 ? O GLU F 166 
AX 1 2 N PHE F 141 ? N PHE F 141 O GLY F 145 ? O GLY F 145 
AY 1 2 N HIS F 179 ? N HIS F 179 O SER F 182 ? O SER F 182 
AY 2 3 N ILE F 183 ? N ILE F 183 O TRP F 205 ? O TRP F 205 
AY 3 4 N LEU F 204 ? N LEU F 204 O GLU F 211 ? O GLU F 211 
AZ 1 2 N ASP F 223 ? N ASP F 223 O LEU F 230 ? O LEU F 230 
AZ 2 3 N LEU F 231 ? N LEU F 231 O TYR F 247 ? O TYR F 247 
AZ 3 4 N ILE F 248 ? N ILE F 248 O LYS F 254 ? O LYS F 254 
BA 1 2 N LYS F 268 ? N LYS F 268 O TYR F 275 ? O TYR F 275 
BA 2 3 N PHE F 276 ? N PHE F 276 O TYR F 287 ? O TYR F 287 
BA 3 4 N LEU F 288 ? N LEU F 288 O ARG F 294 ? O ARG F 294 
BB 1 2 N TRP F 302 ? N TRP F 302 O GLU F 317 ? O GLU F 317 
BB 2 3 N TYR F 314 ? N TYR F 314 O TYR F 326 ? O TYR F 326 
BB 3 4 N LEU F 327 ? N LEU F 327 O ARG F 333 ? O ARG F 333 
BC 1 2 N TYR G 16  ? N TYR G 16  O THR G 32  ? O THR G 32  
BC 2 3 N LEU G 31  ? N LEU G 31  O THR G 44  ? O THR G 44  
BC 3 4 N ILE G 45  ? N ILE G 45  O ILE G 58  ? O ILE G 58  
BD 1 2 N ARG G 65  ? N ARG G 65  O ALA G 74  ? O ALA G 74  
BD 2 3 N ARG G 77  ? N ARG G 77  O GLN G 86  ? O GLN G 86  
BD 3 4 N ILE G 87  ? N ILE G 87  O LEU G 101 ? O LEU G 101 
BE 1 2 N GLU G 110 ? N GLU G 110 O LEU G 119 ? O LEU G 119 
BE 2 3 N ALA G 120 ? N ALA G 120 O TRP G 155 ? O TRP G 155 
BE 3 4 N PHE G 154 ? N PHE G 154 O PHE G 168 ? O PHE G 168 
BF 1 2 N ILE G 132 ? N ILE G 132 O ILE J 572 ? O ILE J 572 
BF 2 3 O TYR J 569 ? O TYR J 569 N LEU J 540 ? N LEU J 540 
BF 3 4 O ILE J 541 ? O ILE J 541 N SER J 487 ? N SER J 487 
BF 4 5 O ILE J 486 ? O ILE J 486 N ILE J 462 ? N ILE J 462 
BF 5 6 O GLY J 461 ? O GLY J 461 N VAL J 382 ? N VAL J 382 
BF 6 7 N PRO J 379 ? N PRO J 379 O TYR J 409 ? O TYR J 409 
BF 7 8 O TYR J 412 ? O TYR J 412 N TRP J 366 ? N TRP J 366 
BG 1 2 N PHE G 141 ? N PHE G 141 O GLY G 145 ? O GLY G 145 
BH 1 2 N HIS G 179 ? N HIS G 179 O SER G 182 ? O SER G 182 
BH 2 3 N VAL G 187 ? N VAL G 187 O ASP G 201 ? O ASP G 201 
BH 3 4 N LYS G 206 ? N LYS G 206 O GLU G 209 ? O GLU G 209 
BH 4 5 N TYR G 220 ? N TYR G 220 O TYR G 232 ? O TYR G 232 
BH 5 6 N LEU G 231 ? N LEU G 231 O TYR G 247 ? O TYR G 247 
BH 6 7 N ILE G 248 ? N ILE G 248 O LYS G 254 ? O LYS G 254 
BI 1 2 N LYS G 268 ? N LYS G 268 O TYR G 275 ? O TYR G 275 
BI 2 3 N PHE G 276 ? N PHE G 276 O TYR G 287 ? O TYR G 287 
BI 3 4 N LEU G 286 ? N LEU G 286 O ILE G 296 ? O ILE G 296 
BJ 1 2 N TRP G 302 ? N TRP G 302 O GLU G 317 ? O GLU G 317 
BJ 2 3 N TYR G 314 ? N TYR G 314 O TYR G 326 ? O TYR G 326 
BJ 3 4 N LEU G 327 ? N LEU G 327 O ARG G 333 ? O ARG G 333 
BK 1 2 N ARG G 352 ? N ARG G 352 O TYR G 367 ? O TYR G 367 
BK 2 3 N TRP G 366 ? N TRP G 366 O TYR G 412 ? O TYR G 412 
BK 3 4 O TYR G 409 ? O TYR G 409 N ILE G 381 ? N ILE G 381 
BK 4 5 N VAL G 380 ? N VAL G 380 O GLY G 461 ? O GLY G 461 
BK 5 6 N GLY G 464 ? N GLY G 464 O GLU G 488 ? O GLU G 488 
BK 6 7 N SER G 487 ? N SER G 487 O LEU G 539 ? O LEU G 539 
BK 7 8 N HIS G 542 ? N HIS G 542 O PHE G 573 ? O PHE G 573 
BK 8 9 N ILE G 572 ? N ILE G 572 O ILE J 132 ? O ILE J 132 
BL 1 2 N SER H 18  ? N SER H 18  O VAL H 30  ? O VAL H 30  
BL 2 3 N VAL H 27  ? N VAL H 27  O GLU H 48  ? O GLU H 48  
BL 3 4 N ILE H 47  ? N ILE H 47  O LYS H 56  ? O LYS H 56  
BM 1 2 N ARG H 65  ? N ARG H 65  O ALA H 74  ? O ALA H 74  
BM 2 3 N PHE H 75  ? N PHE H 75  O TRP H 88  ? O TRP H 88  
BM 3 4 N ILE H 87  ? N ILE H 87  O VAL H 100 ? O VAL H 100 
BN 1 2 N GLU H 110 ? N GLU H 110 O LEU H 119 ? O LEU H 119 
BN 2 3 N ALA H 120 ? N ALA H 120 O TRP H 155 ? O TRP H 155 
BN 3 4 N ASP H 158 ? N ASP H 158 O GLU H 163 ? O GLU H 163 
BO 1 2 N ILE H 132 ? N ILE H 132 O ILE K 572 ? O ILE K 572 
BO 2 3 O PHE K 573 ? O PHE K 573 N HIS K 542 ? N HIS K 542 
BO 3 4 O ILE K 541 ? O ILE K 541 N SER K 487 ? N SER K 487 
BO 4 5 O ILE K 486 ? O ILE K 486 N ILE K 462 ? N ILE K 462 
BO 5 6 O GLY K 461 ? O GLY K 461 N VAL K 380 ? N VAL K 380 
BO 6 7 N ILE K 381 ? N ILE K 381 O TYR K 409 ? O TYR K 409 
BO 7 8 O TYR K 412 ? O TYR K 412 N TRP K 366 ? N TRP K 366 
BO 8 9 O LEU K 363 ? O LEU K 363 N PHE K 356 ? N PHE K 356 
BP 1 2 N PHE H 141 ? N PHE H 141 O GLY H 145 ? O GLY H 145 
BQ 1 2 N HIS H 179 ? N HIS H 179 O SER H 182 ? O SER H 182 
BQ 2 3 N VAL H 187 ? N VAL H 187 O ASP H 201 ? O ASP H 201 
BQ 3 4 N LYS H 206 ? N LYS H 206 O GLU H 209 ? O GLU H 209 
BR 1 2 N ILE H 222 ? N ILE H 222 O LEU H 230 ? O LEU H 230 
BR 2 3 N LEU H 231 ? N LEU H 231 O TYR H 247 ? O TYR H 247 
BR 3 4 N ILE H 248 ? N ILE H 248 O LYS H 254 ? O LYS H 254 
BS 1 2 N ARG H 270 ? N ARG H 270 O LYS H 273 ? O LYS H 273 
BS 2 3 N PHE H 276 ? N PHE H 276 O TYR H 287 ? O TYR H 287 
BS 3 4 N LEU H 288 ? N LEU H 288 O ARG H 294 ? O ARG H 294 
BT 1 2 N TRP H 302 ? N TRP H 302 O GLU H 317 ? O GLU H 317 
BT 2 3 O ILE H 313 ? O ILE H 313 N ASP H 307 ? N ASP H 307 
BU 1 2 N TRP H 302 ? N TRP H 302 O GLU H 317 ? O GLU H 317 
BU 2 3 N TYR H 314 ? N TYR H 314 O TYR H 326 ? O TYR H 326 
BU 3 4 N LEU H 327 ? N LEU H 327 O ARG H 333 ? O ARG H 333 
BV 1 2 N PHE H 356 ? N PHE H 356 O LEU H 363 ? O LEU H 363 
BV 2 3 N ILE H 368 ? N ILE H 368 O ILE H 410 ? O ILE H 410 
BV 3 4 O TYR H 409 ? O TYR H 409 N ILE H 381 ? N ILE H 381 
BV 4 5 N VAL H 380 ? N VAL H 380 O GLY H 461 ? O GLY H 461 
BV 5 6 N GLY H 464 ? N GLY H 464 O GLU H 488 ? O GLU H 488 
BV 6 7 N SER H 487 ? N SER H 487 O ILE H 541 ? O ILE H 541 
BV 7 8 N LEU H 540 ? N LEU H 540 O TYR H 569 ? O TYR H 569 
BV 8 9 N ILE H 572 ? N ILE H 572 O ILE K 132 ? O ILE K 132 
BW 1 2 N ARG I 21  ? N ARG I 21  O ALA I 28  ? O ALA I 28  
BW 2 3 N LEU I 31  ? N LEU I 31  O THR I 44  ? O THR I 44  
BW 3 4 N ILE I 45  ? N ILE I 45  O ILE I 58  ? O ILE I 58  
BX 1 2 N ARG I 65  ? N ARG I 65  O ALA I 74  ? O ALA I 74  
BX 2 3 N PHE I 75  ? N PHE I 75  O TRP I 88  ? O TRP I 88  
BX 3 4 N ILE I 87  ? N ILE I 87  O LEU I 101 ? O LEU I 101 
BY 1 2 N GLU I 110 ? N GLU I 110 O LEU I 119 ? O LEU I 119 
BY 2 3 N ALA I 120 ? N ALA I 120 O TRP I 155 ? O TRP I 155 
BY 3 4 N VAL I 156 ? N VAL I 156 O GLU I 166 ? O GLU I 166 
BZ 1 2 N ILE I 132 ? N ILE I 132 O ILE L 572 ? O ILE L 572 
BZ 2 3 O TYR L 569 ? O TYR L 569 N LEU L 540 ? N LEU L 540 
BZ 3 4 O ILE L 541 ? O ILE L 541 N SER L 487 ? N SER L 487 
BZ 4 5 O GLU L 488 ? O GLU L 488 N GLY L 464 ? N GLY L 464 
BZ 5 6 O GLY L 461 ? O GLY L 461 N VAL L 380 ? N VAL L 380 
BZ 6 7 N ILE L 381 ? N ILE L 381 O TYR L 409 ? O TYR L 409 
BZ 7 8 O TYR L 412 ? O TYR L 412 N TRP L 366 ? N TRP L 366 
BZ 8 9 O GLY L 365 ? O GLY L 365 N PHE L 354 ? N PHE L 354 
CA 1 2 N PHE I 141 ? N PHE I 141 O GLY I 145 ? O GLY I 145 
CB 1 2 N HIS I 179 ? N HIS I 179 O SER I 182 ? O SER I 182 
CB 2 3 N ILE I 183 ? N ILE I 183 O TRP I 205 ? O TRP I 205 
CB 3 4 N LYS I 206 ? N LYS I 206 O GLU I 209 ? O GLU I 209 
CC 1 2 N ASP I 223 ? N ASP I 223 O LEU I 230 ? O LEU I 230 
CC 2 3 N LEU I 231 ? N LEU I 231 O TYR I 247 ? O TYR I 247 
CC 3 4 N ILE I 248 ? N ILE I 248 O LYS I 254 ? O LYS I 254 
CD 1 2 N ARG I 270 ? N ARG I 270 O LYS I 273 ? O LYS I 273 
CD 2 3 N GLU I 280 ? N GLU I 280 O SER I 283 ? O SER I 283 
CD 3 4 N LEU I 286 ? N LEU I 286 O ILE I 296 ? O ILE I 296 
CE 1 2 N TRP I 302 ? N TRP I 302 O GLU I 317 ? O GLU I 317 
CE 2 3 N TYR I 314 ? N TYR I 314 O TYR I 326 ? O TYR I 326 
CE 3 4 N LEU I 327 ? N LEU I 327 O ARG I 333 ? O ARG I 333 
CF 1 2 N ARG I 352 ? N ARG I 352 O TYR I 367 ? O TYR I 367 
CF 2 3 N ILE I 368 ? N ILE I 368 O ILE I 410 ? O ILE I 410 
CF 3 4 O TYR I 409 ? O TYR I 409 N PRO I 379 ? N PRO I 379 
CF 4 5 N VAL I 380 ? N VAL I 380 O GLY I 461 ? O GLY I 461 
CF 5 6 N GLY I 464 ? N GLY I 464 O GLU I 488 ? O GLU I 488 
CF 6 7 N SER I 487 ? N SER I 487 O ILE I 541 ? O ILE I 541 
CF 7 8 N HIS I 542 ? N HIS I 542 O PHE I 573 ? O PHE I 573 
CF 8 9 N ILE I 572 ? N ILE I 572 O ILE L 132 ? O ILE L 132 
CG 1 2 N TYR J 16  ? N TYR J 16  O THR J 32  ? O THR J 32  
CG 2 3 N VAL J 27  ? N VAL J 27  O GLU J 48  ? O GLU J 48  
CG 3 4 N ILE J 45  ? N ILE J 45  O ILE J 58  ? O ILE J 58  
CH 1 2 N SER J 62  ? N SER J 62  O MET J 76  ? O MET J 76  
CH 2 3 N ILE J 73  ? N ILE J 73  O ALA J 90  ? O ALA J 90  
CH 3 4 N ILE J 87  ? N ILE J 87  O LEU J 101 ? O LEU J 101 
CI 1 2 N GLU J 110 ? N GLU J 110 O LEU J 119 ? O LEU J 119 
CI 2 3 N LYS J 124 ? N LYS J 124 O LYS J 151 ? O LYS J 151 
CI 3 4 N VAL J 156 ? N VAL J 156 O GLU J 166 ? O GLU J 166 
CJ 1 2 N PHE J 141 ? N PHE J 141 O GLY J 145 ? O GLY J 145 
CK 1 2 N HIS J 179 ? N HIS J 179 O SER J 182 ? O SER J 182 
CK 2 3 N VAL J 187 ? N VAL J 187 O ASP J 201 ? O ASP J 201 
CK 3 4 N LYS J 206 ? N LYS J 206 O GLU J 209 ? O GLU J 209 
CL 1 2 N ASP J 223 ? N ASP J 223 O LEU J 230 ? O LEU J 230 
CL 2 3 N LEU J 231 ? N LEU J 231 O TYR J 247 ? O TYR J 247 
CL 3 4 N ILE J 248 ? N ILE J 248 O LYS J 254 ? O LYS J 254 
CM 1 2 N ARG J 270 ? N ARG J 270 O LYS J 273 ? O LYS J 273 
CM 2 3 N GLU J 280 ? N GLU J 280 O SER J 283 ? O SER J 283 
CM 3 4 N LEU J 288 ? N LEU J 288 O ARG J 294 ? O ARG J 294 
CN 1 2 N TRP J 302 ? N TRP J 302 O GLU J 317 ? O GLU J 317 
CN 2 3 N TYR J 314 ? N TYR J 314 O TYR J 326 ? O TYR J 326 
CN 3 4 N LEU J 327 ? N LEU J 327 O ARG J 333 ? O ARG J 333 
CO 1 2 N SER J 358 ? N SER J 358 O LEU J 361 ? O LEU J 361 
CP 1 2 N ARG K 21  ? N ARG K 21  O ALA K 28  ? O ALA K 28  
CP 2 3 N LYS K 33  ? N LYS K 33  O GLU K 42  ? O GLU K 42  
CP 3 4 N ILE K 45  ? N ILE K 45  O ILE K 58  ? O ILE K 58  
CQ 1 2 N ARG K 65  ? N ARG K 65  O ALA K 74  ? O ALA K 74  
CQ 2 3 N ILE K 73  ? N ILE K 73  O ALA K 90  ? O ALA K 90  
CQ 3 4 N ILE K 87  ? N ILE K 87  O LEU K 101 ? O LEU K 101 
CR 1 2 N GLU K 110 ? N GLU K 110 O LEU K 119 ? O LEU K 119 
CR 2 3 N ALA K 120 ? N ALA K 120 O TRP K 155 ? O TRP K 155 
CR 3 4 N PHE K 154 ? N PHE K 154 O PHE K 168 ? O PHE K 168 
CS 1 2 N PHE K 141 ? N PHE K 141 O GLY K 145 ? O GLY K 145 
CT 1 2 N HIS K 179 ? N HIS K 179 O SER K 182 ? O SER K 182 
CT 2 3 N ILE K 183 ? N ILE K 183 O TRP K 205 ? O TRP K 205 
CT 3 4 N LYS K 206 ? N LYS K 206 O GLU K 209 ? O GLU K 209 
CU 1 2 N TYR K 220 ? N TYR K 220 O TYR K 232 ? O TYR K 232 
CU 2 3 N LEU K 231 ? N LEU K 231 O TYR K 247 ? O TYR K 247 
CU 3 4 N ILE K 248 ? N ILE K 248 O LYS K 254 ? O LYS K 254 
CV 1 2 N ARG K 270 ? N ARG K 270 O LYS K 273 ? O LYS K 273 
CV 2 3 N VAL K 274 ? N VAL K 274 O TRP K 289 ? O TRP K 289 
CV 3 4 N LEU K 286 ? N LEU K 286 O ALA K 297 ? O ALA K 297 
CW 1 2 N TRP K 302 ? N TRP K 302 O GLU K 317 ? O GLU K 317 
CW 2 3 N TYR K 314 ? N TYR K 314 O TYR K 326 ? O TYR K 326 
CW 3 4 N LEU K 327 ? N LEU K 327 O ARG K 333 ? O ARG K 333 
CX 1 2 N ARG L 21  ? N ARG L 21  O ALA L 28  ? O ALA L 28  
CX 2 3 N LEU L 31  ? N LEU L 31  O THR L 44  ? O THR L 44  
CX 3 4 N ILE L 47  ? N ILE L 47  O LYS L 56  ? O LYS L 56  
CY 1 2 N ARG L 65  ? N ARG L 65  O ALA L 74  ? O ALA L 74  
CY 2 3 N ILE L 73  ? N ILE L 73  O ALA L 90  ? O ALA L 90  
CY 3 4 N ILE L 87  ? N ILE L 87  O LEU L 101 ? O LEU L 101 
CZ 1 2 N GLU L 110 ? N GLU L 110 O LEU L 119 ? O LEU L 119 
CZ 2 3 N GLY L 122 ? N GLY L 122 O THR L 153 ? O THR L 153 
CZ 3 4 N PHE L 154 ? N PHE L 154 O PHE L 168 ? O PHE L 168 
DA 1 2 N PHE L 141 ? N PHE L 141 O GLY L 145 ? O GLY L 145 
DB 1 2 N HIS L 179 ? N HIS L 179 O SER L 182 ? O SER L 182 
DB 2 3 N VAL L 187 ? N VAL L 187 O ASP L 201 ? O ASP L 201 
DB 3 4 N LEU L 204 ? N LEU L 204 O GLU L 211 ? O GLU L 211 
DB 4 5 N TYR L 220 ? N TYR L 220 O TYR L 232 ? O TYR L 232 
DB 5 6 N GLY L 233 ? N GLY L 233 O LYS L 245 ? O LYS L 245 
DB 6 7 N ILE L 248 ? N ILE L 248 O LYS L 254 ? O LYS L 254 
DC 1 2 N LYS L 268 ? N LYS L 268 O TYR L 275 ? O TYR L 275 
DC 2 3 N GLU L 280 ? N GLU L 280 O SER L 283 ? O SER L 283 
DC 3 4 N LEU L 288 ? N LEU L 288 O ARG L 294 ? O ARG L 294 
DD 1 2 N TRP L 302 ? N TRP L 302 O GLU L 317 ? O GLU L 317 
DD 2 3 N LYS L 316 ? N LYS L 316 O GLU L 324 ? O GLU L 324 
DD 3 4 N LEU L 327 ? N LEU L 327 O ARG L 333 ? O ARG L 333 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE HEZ A 701' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE HEZ A 702' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE HEZ A 703' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 704'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 705'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ B 701' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ B 702' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 703'  
AC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE HEZ C 701' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG C 702'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG C 703'  
BC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HEZ D 701' 
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ D 702' 
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE HEZ D 703' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE HEZ D 704' 
BC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE HEZ D 705' 
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE HEZ D 706' 
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE HEZ D 707' 
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE HEZ D 708' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG D 709'  
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 710'  
CC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D 711'  
CC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE HEZ E 701' 
CC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ E 702' 
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE HEZ E 703' 
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG E 704'  
CC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG E 705'  
DC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG E 706'  
DC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE HEZ F 701' 
DC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE HEZ F 702' 
DC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE HEZ F 703' 
DC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG F 704'  
DC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG F 705'  
DC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG F 706'  
DC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL F 707'  
DC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE HEZ G 701' 
EC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG G 702'  
EC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG G 703'  
EC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE HEZ H 701' 
EC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG H 702'  
EC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG H 703'  
EC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE HEZ I 701' 
EC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE HEZ I 702' 
EC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG I 703'  
EC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG I 704'  
FC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ K 701' 
FC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE HEZ L 701' 
FC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG L 702'  
FC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG L 703'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  GLY A  387 ? GLY A 387  . ? 1_555 ? 
2   AC1 8  ALA A  466 ? ALA A 466  . ? 1_555 ? 
3   AC1 8  TYR A  467 ? TYR A 467  . ? 1_555 ? 
4   AC1 8  ILE A  491 ? ILE A 491  . ? 1_555 ? 
5   AC1 8  SER A  497 ? SER A 497  . ? 1_555 ? 
6   AC1 8  SER A  501 ? SER A 501  . ? 1_555 ? 
7   AC1 8  ARG A  548 ? ARG A 548  . ? 1_555 ? 
8   AC1 8  CYS A  549 ? CYS A 549  . ? 1_555 ? 
9   AC2 2  LYS A  397 ? LYS A 397  . ? 1_555 ? 
10  AC2 2  HOH JB .   ? HOH A 807  . ? 1_555 ? 
11  AC3 2  GLN A  266 ? GLN A 266  . ? 1_555 ? 
12  AC3 2  TRP A  302 ? TRP A 302  . ? 1_555 ? 
13  AC4 7  LYS A  99  ? LYS A 99   . ? 1_555 ? 
14  AC4 7  GLU A  162 ? GLU A 162  . ? 1_555 ? 
15  AC4 7  HOH JB .   ? HOH A 938  . ? 1_555 ? 
16  AC4 7  HOH JB .   ? HOH A 949  . ? 1_555 ? 
17  AC4 7  GLU C  42  ? GLU C 42   . ? 1_555 ? 
18  AC4 7  HOH LB .   ? HOH C 841  . ? 1_555 ? 
19  AC4 7  HOH LB .   ? HOH C 858  . ? 1_555 ? 
20  AC5 4  ASP A  244 ? ASP A 244  . ? 1_555 ? 
21  AC5 4  GLU A  263 ? GLU A 263  . ? 1_555 ? 
22  AC5 4  HOH JB .   ? HOH A 812  . ? 1_555 ? 
23  AC5 4  HOH JB .   ? HOH A 947  . ? 1_555 ? 
24  AC6 7  GLY B  386 ? GLY B 386  . ? 1_555 ? 
25  AC6 7  GLY B  387 ? GLY B 387  . ? 1_555 ? 
26  AC6 7  ALA B  466 ? ALA B 466  . ? 1_555 ? 
27  AC6 7  TYR B  467 ? TYR B 467  . ? 1_555 ? 
28  AC6 7  SER B  497 ? SER B 497  . ? 1_555 ? 
29  AC6 7  SER B  501 ? SER B 501  . ? 1_555 ? 
30  AC6 7  ARG B  548 ? ARG B 548  . ? 1_555 ? 
31  AC7 7  LEU B  544 ? LEU B 544  . ? 1_555 ? 
32  AC7 7  ASP B  546 ? ASP B 546  . ? 1_555 ? 
33  AC7 7  LEU B  551 ? LEU B 551  . ? 1_555 ? 
34  AC7 7  LEU E  544 ? LEU E 544  . ? 1_555 ? 
35  AC7 7  ASP E  546 ? ASP E 546  . ? 1_555 ? 
36  AC7 7  PRO E  550 ? PRO E 550  . ? 1_555 ? 
37  AC7 7  LEU E  551 ? LEU E 551  . ? 1_555 ? 
38  AC8 6  GLU A  42  ? GLU A 42   . ? 1_555 ? 
39  AC8 6  HOH JB .   ? HOH A 853  . ? 1_555 ? 
40  AC8 6  HOH JB .   ? HOH A 854  . ? 1_555 ? 
41  AC8 6  LYS B  99  ? LYS B 99   . ? 1_555 ? 
42  AC8 6  GLU B  162 ? GLU B 162  . ? 1_555 ? 
43  AC8 6  HOH KB .   ? HOH B 828  . ? 1_555 ? 
44  AC9 9  GLY C  387 ? GLY C 387  . ? 1_555 ? 
45  AC9 9  ALA C  466 ? ALA C 466  . ? 1_555 ? 
46  AC9 9  TYR C  467 ? TYR C 467  . ? 1_555 ? 
47  AC9 9  SER C  497 ? SER C 497  . ? 1_555 ? 
48  AC9 9  SER C  501 ? SER C 501  . ? 1_555 ? 
49  AC9 9  ILE C  503 ? ILE C 503  . ? 1_555 ? 
50  AC9 9  PHE C  507 ? PHE C 507  . ? 1_555 ? 
51  AC9 9  ASP C  508 ? ASP C 508  . ? 1_555 ? 
52  AC9 9  ARG C  548 ? ARG C 548  . ? 1_555 ? 
53  BC1 5  GLU B  42  ? GLU B 42   . ? 1_555 ? 
54  BC1 5  HOH KB .   ? HOH B 829  . ? 1_555 ? 
55  BC1 5  LYS C  99  ? LYS C 99   . ? 1_555 ? 
56  BC1 5  GLU C  162 ? GLU C 162  . ? 1_555 ? 
57  BC1 5  HOH LB .   ? HOH C 801  . ? 1_555 ? 
58  BC2 6  ASP C  244 ? ASP C 244  . ? 1_555 ? 
59  BC2 6  GLU C  263 ? GLU C 263  . ? 1_555 ? 
60  BC2 6  HOH LB .   ? HOH C 802  . ? 1_555 ? 
61  BC2 6  HOH LB .   ? HOH C 810  . ? 1_555 ? 
62  BC2 6  HOH LB .   ? HOH C 857  . ? 1_555 ? 
63  BC2 6  HOH LB .   ? HOH C 859  . ? 1_555 ? 
64  BC3 10 GLY D  387 ? GLY D 387  . ? 1_555 ? 
65  BC3 10 ALA D  466 ? ALA D 466  . ? 1_555 ? 
66  BC3 10 TYR D  467 ? TYR D 467  . ? 1_555 ? 
67  BC3 10 ILE D  491 ? ILE D 491  . ? 1_555 ? 
68  BC3 10 SER D  497 ? SER D 497  . ? 1_555 ? 
69  BC3 10 SER D  501 ? SER D 501  . ? 1_555 ? 
70  BC3 10 ARG D  548 ? ARG D 548  . ? 1_555 ? 
71  BC3 10 HIS D  578 ? HIS D 578  . ? 1_555 ? 
72  BC3 10 HEZ DA .   ? HEZ D 707  . ? 1_555 ? 
73  BC3 10 HOH MB .   ? HOH D 1013 . ? 1_555 ? 
74  BC4 7  LEU A  544 ? LEU A 544  . ? 1_555 ? 
75  BC4 7  ASP A  546 ? ASP A 546  . ? 1_555 ? 
76  BC4 7  PRO A  550 ? PRO A 550  . ? 1_555 ? 
77  BC4 7  LEU A  551 ? LEU A 551  . ? 1_555 ? 
78  BC4 7  LEU D  544 ? LEU D 544  . ? 1_555 ? 
79  BC4 7  ASP D  546 ? ASP D 546  . ? 1_555 ? 
80  BC4 7  LEU D  551 ? LEU D 551  . ? 1_555 ? 
81  BC5 6  TYR D  239 ? TYR D 239  . ? 1_555 ? 
82  BC5 6  ASP D  424 ? ASP D 424  . ? 1_555 ? 
83  BC5 6  LEU D  427 ? LEU D 427  . ? 1_555 ? 
84  BC5 6  ARG D  428 ? ARG D 428  . ? 1_555 ? 
85  BC5 6  HOH MB .   ? HOH D 869  . ? 1_555 ? 
86  BC5 6  HOH MB .   ? HOH D 900  . ? 1_555 ? 
87  BC6 4  TYR D  16  ? TYR D 16   . ? 1_555 ? 
88  BC6 4  TYR D  41  ? TYR D 41   . ? 1_555 ? 
89  BC6 4  ARG D  583 ? ARG D 583  . ? 1_555 ? 
90  BC6 4  ARG D  589 ? ARG D 589  . ? 1_555 ? 
91  BC7 2  LYS D  535 ? LYS D 535  . ? 1_555 ? 
92  BC7 2  TYR D  607 ? TYR D 607  . ? 1_555 ? 
93  BC8 6  TYR D  220 ? TYR D 220  . ? 1_555 ? 
94  BC8 6  ALA D  265 ? ALA D 265  . ? 1_555 ? 
95  BC8 6  GLN D  266 ? GLN D 266  . ? 1_555 ? 
96  BC8 6  ALA D  267 ? ALA D 267  . ? 1_555 ? 
97  BC8 6  HOH MB .   ? HOH D 826  . ? 1_555 ? 
98  BC8 6  HOH MB .   ? HOH D 920  . ? 1_555 ? 
99  BC9 4  ALA D  466 ? ALA D 466  . ? 1_555 ? 
100 BC9 4  HIS D  578 ? HIS D 578  . ? 1_555 ? 
101 BC9 4  SER D  581 ? SER D 581  . ? 1_555 ? 
102 BC9 4  HEZ X  .   ? HEZ D 701  . ? 1_555 ? 
103 CC1 6  SER D  241 ? SER D 241  . ? 1_555 ? 
104 CC1 6  PRO D  388 ? PRO D 388  . ? 1_555 ? 
105 CC1 6  LYS D  389 ? LYS D 389  . ? 1_555 ? 
106 CC1 6  PHE D  507 ? PHE D 507  . ? 1_555 ? 
107 CC1 6  VAL D  511 ? VAL D 511  . ? 1_555 ? 
108 CC1 6  HOH MB .   ? HOH D 938  . ? 1_555 ? 
109 CC2 5  ASP D  244 ? ASP D 244  . ? 1_555 ? 
110 CC2 5  GLU D  263 ? GLU D 263  . ? 1_555 ? 
111 CC2 5  HOH MB .   ? HOH D 802  . ? 1_555 ? 
112 CC2 5  HOH MB .   ? HOH D 935  . ? 1_555 ? 
113 CC2 5  HOH MB .   ? HOH D 936  . ? 1_555 ? 
114 CC3 6  LYS D  99  ? LYS D 99   . ? 1_555 ? 
115 CC3 6  GLU D  162 ? GLU D 162  . ? 1_555 ? 
116 CC3 6  HOH MB .   ? HOH D 1021 . ? 1_555 ? 
117 CC3 6  GLU E  42  ? GLU E 42   . ? 1_555 ? 
118 CC3 6  HOH NB .   ? HOH E 832  . ? 1_555 ? 
119 CC3 6  HOH NB .   ? HOH E 902  . ? 1_555 ? 
120 CC4 2  ARG D  55  ? ARG D 55   . ? 1_555 ? 
121 CC4 2  GLU F  160 ? GLU F 160  . ? 1_555 ? 
122 CC5 8  GLY E  386 ? GLY E 386  . ? 1_555 ? 
123 CC5 8  GLY E  387 ? GLY E 387  . ? 1_555 ? 
124 CC5 8  ALA E  466 ? ALA E 466  . ? 1_555 ? 
125 CC5 8  TYR E  467 ? TYR E 467  . ? 1_555 ? 
126 CC5 8  ILE E  491 ? ILE E 491  . ? 1_555 ? 
127 CC5 8  SER E  497 ? SER E 497  . ? 1_555 ? 
128 CC5 8  SER E  501 ? SER E 501  . ? 1_555 ? 
129 CC5 8  ARG E  548 ? ARG E 548  . ? 1_555 ? 
130 CC6 7  LYS E  316 ? LYS E 316  . ? 1_555 ? 
131 CC6 7  GLU E  317 ? GLU E 317  . ? 1_555 ? 
132 CC6 7  ARG E  321 ? ARG E 321  . ? 1_555 ? 
133 CC6 7  PRO E  322 ? PRO E 322  . ? 1_555 ? 
134 CC6 7  GLU E  324 ? GLU E 324  . ? 1_555 ? 
135 CC6 7  TYR E  326 ? TYR E 326  . ? 1_555 ? 
136 CC6 7  GLN E  334 ? GLN E 334  . ? 1_555 ? 
137 CC7 2  TYR E  16  ? TYR E 16   . ? 1_555 ? 
138 CC7 2  ARG E  589 ? ARG E 589  . ? 1_555 ? 
139 CC8 6  TYR E  232 ? TYR E 232  . ? 1_555 ? 
140 CC8 6  ASP E  244 ? ASP E 244  . ? 1_555 ? 
141 CC8 6  GLU E  263 ? GLU E 263  . ? 1_555 ? 
142 CC8 6  HOH NB .   ? HOH E 801  . ? 1_555 ? 
143 CC8 6  HOH NB .   ? HOH E 842  . ? 1_555 ? 
144 CC8 6  HOH NB .   ? HOH E 987  . ? 1_555 ? 
145 CC9 7  LYS E  99  ? LYS E 99   . ? 1_555 ? 
146 CC9 7  GLU E  162 ? GLU E 162  . ? 1_555 ? 
147 CC9 7  HOH NB .   ? HOH E 919  . ? 1_555 ? 
148 CC9 7  GLU F  42  ? GLU F 42   . ? 1_555 ? 
149 CC9 7  HOH OB .   ? HOH F 871  . ? 1_555 ? 
150 CC9 7  HOH OB .   ? HOH F 872  . ? 1_555 ? 
151 CC9 7  HOH OB .   ? HOH F 873  . ? 1_555 ? 
152 DC1 5  HOH MB .   ? HOH D 915  . ? 1_555 ? 
153 DC1 5  HOH MB .   ? HOH D 1006 . ? 1_555 ? 
154 DC1 5  HOH NB .   ? HOH E 896  . ? 1_555 ? 
155 DC1 5  HOH NB .   ? HOH E 901  . ? 1_555 ? 
156 DC1 5  HOH NB .   ? HOH E 946  . ? 1_555 ? 
157 DC2 9  GLY F  387 ? GLY F 387  . ? 1_555 ? 
158 DC2 9  ALA F  466 ? ALA F 466  . ? 1_555 ? 
159 DC2 9  TYR F  467 ? TYR F 467  . ? 1_555 ? 
160 DC2 9  ILE F  491 ? ILE F 491  . ? 1_555 ? 
161 DC2 9  SER F  497 ? SER F 497  . ? 1_555 ? 
162 DC2 9  SER F  501 ? SER F 501  . ? 1_555 ? 
163 DC2 9  PHE F  507 ? PHE F 507  . ? 1_555 ? 
164 DC2 9  ASP F  508 ? ASP F 508  . ? 1_555 ? 
165 DC2 9  ARG F  548 ? ARG F 548  . ? 1_555 ? 
166 DC3 5  LEU C  544 ? LEU C 544  . ? 1_555 ? 
167 DC3 5  LEU F  544 ? LEU F 544  . ? 1_555 ? 
168 DC3 5  ASP F  546 ? ASP F 546  . ? 1_555 ? 
169 DC3 5  PRO F  550 ? PRO F 550  . ? 1_555 ? 
170 DC3 5  LEU F  551 ? LEU F 551  . ? 1_555 ? 
171 DC4 5  TYR F  220 ? TYR F 220  . ? 1_555 ? 
172 DC4 5  TYR F  232 ? TYR F 232  . ? 1_555 ? 
173 DC4 5  ALA F  265 ? ALA F 265  . ? 1_555 ? 
174 DC4 5  GLN F  266 ? GLN F 266  . ? 1_555 ? 
175 DC4 5  ALA F  267 ? ALA F 267  . ? 1_555 ? 
176 DC5 5  ASP F  244 ? ASP F 244  . ? 1_555 ? 
177 DC5 5  GLU F  263 ? GLU F 263  . ? 1_555 ? 
178 DC5 5  HOH OB .   ? HOH F 802  . ? 1_555 ? 
179 DC5 5  HOH OB .   ? HOH F 878  . ? 1_555 ? 
180 DC5 5  HOH OB .   ? HOH F 954  . ? 1_555 ? 
181 DC6 7  GLU D  42  ? GLU D 42   . ? 1_555 ? 
182 DC6 7  HOH MB .   ? HOH D 856  . ? 1_555 ? 
183 DC6 7  HOH MB .   ? HOH D 939  . ? 1_555 ? 
184 DC6 7  HOH MB .   ? HOH D 940  . ? 1_555 ? 
185 DC6 7  LYS F  99  ? LYS F 99   . ? 1_555 ? 
186 DC6 7  GLU F  162 ? GLU F 162  . ? 1_555 ? 
187 DC6 7  HOH OB .   ? HOH F 879  . ? 1_555 ? 
188 DC7 7  GLU E  163 ? GLU E 163  . ? 1_555 ? 
189 DC7 7  HOH NB .   ? HOH E 840  . ? 1_555 ? 
190 DC7 7  HOH NB .   ? HOH E 841  . ? 1_555 ? 
191 DC7 7  HOH NB .   ? HOH E 979  . ? 1_555 ? 
192 DC7 7  HOH NB .   ? HOH E 988  . ? 1_555 ? 
193 DC7 7  GLU F  37  ? GLU F 37   . ? 1_555 ? 
194 DC7 7  HOH OB .   ? HOH F 955  . ? 1_555 ? 
195 DC8 2  LYS E  98  ? LYS E 98   . ? 1_555 ? 
196 DC8 2  ARG F  55  ? ARG F 55   . ? 1_555 ? 
197 DC9 8  GLY G  387 ? GLY G 387  . ? 1_555 ? 
198 DC9 8  ALA G  466 ? ALA G 466  . ? 1_555 ? 
199 DC9 8  TYR G  467 ? TYR G 467  . ? 1_555 ? 
200 DC9 8  ILE G  491 ? ILE G 491  . ? 1_555 ? 
201 DC9 8  SER G  497 ? SER G 497  . ? 1_555 ? 
202 DC9 8  SER G  501 ? SER G 501  . ? 1_555 ? 
203 DC9 8  PHE G  507 ? PHE G 507  . ? 1_555 ? 
204 DC9 8  ARG G  548 ? ARG G 548  . ? 1_555 ? 
205 EC1 7  LYS G  99  ? LYS G 99   . ? 1_555 ? 
206 EC1 7  GLU G  162 ? GLU G 162  . ? 1_555 ? 
207 EC1 7  HOH PB .   ? HOH G 827  . ? 1_555 ? 
208 EC1 7  HOH PB .   ? HOH G 875  . ? 1_555 ? 
209 EC1 7  GLU I  42  ? GLU I 42   . ? 1_555 ? 
210 EC1 7  HOH RB .   ? HOH I 808  . ? 1_555 ? 
211 EC1 7  HOH RB .   ? HOH I 875  . ? 1_555 ? 
212 EC2 4  ASP G  244 ? ASP G 244  . ? 1_555 ? 
213 EC2 4  GLU G  263 ? GLU G 263  . ? 1_555 ? 
214 EC2 4  HOH PB .   ? HOH G 804  . ? 1_555 ? 
215 EC2 4  HOH PB .   ? HOH G 810  . ? 1_555 ? 
216 EC3 9  GLY H  386 ? GLY H 386  . ? 1_555 ? 
217 EC3 9  GLY H  387 ? GLY H 387  . ? 1_555 ? 
218 EC3 9  ALA H  466 ? ALA H 466  . ? 1_555 ? 
219 EC3 9  TYR H  467 ? TYR H 467  . ? 1_555 ? 
220 EC3 9  SER H  497 ? SER H 497  . ? 1_555 ? 
221 EC3 9  SER H  501 ? SER H 501  . ? 1_555 ? 
222 EC3 9  PHE H  507 ? PHE H 507  . ? 1_555 ? 
223 EC3 9  ASP H  508 ? ASP H 508  . ? 1_555 ? 
224 EC3 9  ARG H  548 ? ARG H 548  . ? 1_555 ? 
225 EC4 6  ASP H  244 ? ASP H 244  . ? 1_555 ? 
226 EC4 6  GLU H  263 ? GLU H 263  . ? 1_555 ? 
227 EC4 6  HOH QB .   ? HOH H 802  . ? 1_555 ? 
228 EC4 6  HOH QB .   ? HOH H 818  . ? 1_555 ? 
229 EC4 6  HOH QB .   ? HOH H 856  . ? 1_555 ? 
230 EC4 6  HOH QB .   ? HOH H 857  . ? 1_555 ? 
231 EC5 7  GLU G  42  ? GLU G 42   . ? 1_555 ? 
232 EC5 7  HOH PB .   ? HOH G 828  . ? 1_555 ? 
233 EC5 7  HOH PB .   ? HOH G 876  . ? 1_555 ? 
234 EC5 7  LYS H  99  ? LYS H 99   . ? 1_555 ? 
235 EC5 7  GLU H  162 ? GLU H 162  . ? 1_555 ? 
236 EC5 7  HOH QB .   ? HOH H 801  . ? 1_555 ? 
237 EC5 7  HOH QB .   ? HOH H 808  . ? 1_555 ? 
238 EC6 8  GLY I  387 ? GLY I 387  . ? 1_555 ? 
239 EC6 8  ALA I  466 ? ALA I 466  . ? 1_555 ? 
240 EC6 8  TYR I  467 ? TYR I 467  . ? 1_555 ? 
241 EC6 8  ILE I  491 ? ILE I 491  . ? 1_555 ? 
242 EC6 8  SER I  497 ? SER I 497  . ? 1_555 ? 
243 EC6 8  SER I  501 ? SER I 501  . ? 1_555 ? 
244 EC6 8  PHE I  507 ? PHE I 507  . ? 1_555 ? 
245 EC6 8  ARG I  548 ? ARG I 548  . ? 1_555 ? 
246 EC7 4  ASP I  480 ? ASP I 480  . ? 1_555 ? 
247 EC7 4  LYS I  483 ? LYS I 483  . ? 1_555 ? 
248 EC7 4  LYS I  535 ? LYS I 535  . ? 1_555 ? 
249 EC7 4  TYR I  607 ? TYR I 607  . ? 1_555 ? 
250 EC8 6  GLU H  42  ? GLU H 42   . ? 1_555 ? 
251 EC8 6  HOH QB .   ? HOH H 858  . ? 1_555 ? 
252 EC8 6  LYS I  99  ? LYS I 99   . ? 1_555 ? 
253 EC8 6  GLU I  162 ? GLU I 162  . ? 1_555 ? 
254 EC8 6  HOH RB .   ? HOH I 833  . ? 1_555 ? 
255 EC8 6  HOH RB .   ? HOH I 834  . ? 1_555 ? 
256 EC9 6  ASP I  244 ? ASP I 244  . ? 1_555 ? 
257 EC9 6  GLU I  263 ? GLU I 263  . ? 1_555 ? 
258 EC9 6  HOH RB .   ? HOH I 803  . ? 1_555 ? 
259 EC9 6  HOH RB .   ? HOH I 871  . ? 1_555 ? 
260 EC9 6  HOH RB .   ? HOH I 876  . ? 1_555 ? 
261 EC9 6  HOH RB .   ? HOH I 877  . ? 1_555 ? 
262 FC1 7  GLY K  386 ? GLY K 386  . ? 1_555 ? 
263 FC1 7  GLY K  387 ? GLY K 387  . ? 1_555 ? 
264 FC1 7  ALA K  466 ? ALA K 466  . ? 1_555 ? 
265 FC1 7  TYR K  467 ? TYR K 467  . ? 1_555 ? 
266 FC1 7  SER K  497 ? SER K 497  . ? 1_555 ? 
267 FC1 7  SER K  501 ? SER K 501  . ? 1_555 ? 
268 FC1 7  ARG K  548 ? ARG K 548  . ? 1_555 ? 
269 FC2 7  GLY L  387 ? GLY L 387  . ? 1_555 ? 
270 FC2 7  ALA L  466 ? ALA L 466  . ? 1_555 ? 
271 FC2 7  TYR L  467 ? TYR L 467  . ? 1_555 ? 
272 FC2 7  SER L  497 ? SER L 497  . ? 1_555 ? 
273 FC2 7  SER L  501 ? SER L 501  . ? 1_555 ? 
274 FC2 7  PHE L  507 ? PHE L 507  . ? 1_555 ? 
275 FC2 7  ARG L  548 ? ARG L 548  . ? 1_555 ? 
276 FC3 5  ASP L  244 ? ASP L 244  . ? 1_555 ? 
277 FC3 5  GLU L  263 ? GLU L 263  . ? 1_555 ? 
278 FC3 5  HOH UB .   ? HOH L 809  . ? 1_555 ? 
279 FC3 5  HOH UB .   ? HOH L 820  . ? 1_555 ? 
280 FC3 5  HOH UB .   ? HOH L 851  . ? 1_555 ? 
281 FC4 6  THR J  44  ? THR J 44   . ? 1_555 ? 
282 FC4 6  GLU J  59  ? GLU J 59   . ? 1_555 ? 
283 FC4 6  HOH SB .   ? HOH J 706  . ? 1_555 ? 
284 FC4 6  HOH SB .   ? HOH J 707  . ? 1_555 ? 
285 FC4 6  LYS L  99  ? LYS L 99   . ? 1_555 ? 
286 FC4 6  GLU L  162 ? GLU L 162  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4HXG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4HXG 
_atom_sites.fract_transf_matrix[1][1]   0.005455 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005441 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ILE A  1 4   ? 32.791  -2.445  -41.247 1.00 81.59  ? 4    ILE A N   1 
ATOM   2     C  CA  . ILE A  1 4   ? 33.846  -1.802  -40.472 1.00 81.33  ? 4    ILE A CA  1 
ATOM   3     C  C   . ILE A  1 4   ? 34.448  -0.662  -41.287 1.00 80.56  ? 4    ILE A C   1 
ATOM   4     O  O   . ILE A  1 4   ? 34.547  -0.745  -42.516 1.00 81.92  ? 4    ILE A O   1 
ATOM   5     C  CB  . ILE A  1 4   ? 34.957  -2.803  -40.066 1.00 56.70  ? 4    ILE A CB  1 
ATOM   6     C  CG1 . ILE A  1 4   ? 34.352  -4.055  -39.430 1.00 59.59  ? 4    ILE A CG1 1 
ATOM   7     C  CG2 . ILE A  1 4   ? 35.937  -2.162  -39.106 1.00 54.02  ? 4    ILE A CG2 1 
ATOM   8     N  N   . GLU A  1 5   ? 34.839  0.408   -40.606 1.00 77.50  ? 5    GLU A N   1 
ATOM   9     C  CA  . GLU A  1 5   ? 35.417  1.555   -41.292 1.00 74.25  ? 5    GLU A CA  1 
ATOM   10    C  C   . GLU A  1 5   ? 36.848  1.801   -40.831 1.00 70.21  ? 5    GLU A C   1 
ATOM   11    O  O   . GLU A  1 5   ? 37.253  1.372   -39.743 1.00 69.36  ? 5    GLU A O   1 
ATOM   12    C  CB  . GLU A  1 5   ? 34.562  2.808   -41.087 1.00 74.48  ? 5    GLU A CB  1 
ATOM   13    N  N   . TRP A  1 6   ? 37.614  2.471   -41.684 1.00 64.41  ? 6    TRP A N   1 
ATOM   14    C  CA  . TRP A  1 6   ? 38.991  2.796   -41.374 1.00 55.78  ? 6    TRP A CA  1 
ATOM   15    C  C   . TRP A  1 6   ? 39.039  4.133   -40.649 1.00 53.82  ? 6    TRP A C   1 
ATOM   16    O  O   . TRP A  1 6   ? 38.636  5.163   -41.194 1.00 54.75  ? 6    TRP A O   1 
ATOM   17    C  CB  . TRP A  1 6   ? 39.816  2.886   -42.656 1.00 50.77  ? 6    TRP A CB  1 
ATOM   18    C  CG  . TRP A  1 6   ? 40.206  1.566   -43.270 1.00 50.14  ? 6    TRP A CG  1 
ATOM   19    C  CD1 . TRP A  1 6   ? 39.545  0.886   -44.263 1.00 48.55  ? 6    TRP A CD1 1 
ATOM   20    C  CD2 . TRP A  1 6   ? 41.367  0.782   -42.957 1.00 48.28  ? 6    TRP A CD2 1 
ATOM   21    N  NE1 . TRP A  1 6   ? 40.219  -0.274  -44.572 1.00 45.19  ? 6    TRP A NE1 1 
ATOM   22    C  CE2 . TRP A  1 6   ? 41.338  -0.362  -43.786 1.00 46.10  ? 6    TRP A CE2 1 
ATOM   23    C  CE3 . TRP A  1 6   ? 42.421  0.932   -42.052 1.00 47.21  ? 6    TRP A CE3 1 
ATOM   24    C  CZ2 . TRP A  1 6   ? 42.323  -1.346  -43.734 1.00 45.88  ? 6    TRP A CZ2 1 
ATOM   25    C  CZ3 . TRP A  1 6   ? 43.400  -0.048  -42.004 1.00 47.88  ? 6    TRP A CZ3 1 
ATOM   26    C  CH2 . TRP A  1 6   ? 43.344  -1.172  -42.840 1.00 47.66  ? 6    TRP A CH2 1 
ATOM   27    N  N   . ASP A  1 7   ? 39.546  4.113   -39.423 1.00 49.94  ? 7    ASP A N   1 
ATOM   28    C  CA  . ASP A  1 7   ? 39.749  5.331   -38.656 1.00 47.23  ? 7    ASP A CA  1 
ATOM   29    C  C   . ASP A  1 7   ? 41.008  5.172   -37.819 1.00 46.61  ? 7    ASP A C   1 
ATOM   30    O  O   . ASP A  1 7   ? 41.763  4.212   -37.995 1.00 48.55  ? 7    ASP A O   1 
ATOM   31    C  CB  . ASP A  1 7   ? 38.548  5.621   -37.760 1.00 46.76  ? 7    ASP A CB  1 
ATOM   32    C  CG  . ASP A  1 7   ? 38.288  4.517   -36.760 1.00 47.60  ? 7    ASP A CG  1 
ATOM   33    O  OD1 . ASP A  1 7   ? 39.227  3.750   -36.449 1.00 46.11  ? 7    ASP A OD1 1 
ATOM   34    O  OD2 . ASP A  1 7   ? 37.138  4.421   -36.282 1.00 49.25  ? 7    ASP A OD2 1 
ATOM   35    N  N   . GLU A  1 8   ? 41.234  6.118   -36.916 1.00 40.52  ? 8    GLU A N   1 
ATOM   36    C  CA  . GLU A  1 8   ? 42.416  6.102   -36.075 1.00 36.65  ? 8    GLU A CA  1 
ATOM   37    C  C   . GLU A  1 8   ? 42.509  4.877   -35.163 1.00 38.60  ? 8    GLU A C   1 
ATOM   38    O  O   . GLU A  1 8   ? 43.593  4.553   -34.684 1.00 40.70  ? 8    GLU A O   1 
ATOM   39    C  CB  . GLU A  1 8   ? 42.438  7.342   -35.203 1.00 36.89  ? 8    GLU A CB  1 
ATOM   40    C  CG  . GLU A  1 8   ? 41.340  7.352   -34.171 1.00 41.36  ? 8    GLU A CG  1 
ATOM   41    C  CD  . GLU A  1 8   ? 40.096  8.047   -34.664 1.00 48.25  ? 8    GLU A CD  1 
ATOM   42    O  OE1 . GLU A  1 8   ? 39.129  8.178   -33.880 1.00 50.39  ? 8    GLU A OE1 1 
ATOM   43    O  OE2 . GLU A  1 8   ? 40.091  8.475   -35.835 1.00 50.67  ? 8    GLU A OE2 1 
ATOM   44    N  N   . LYS A  1 9   ? 41.381  4.231   -34.871 1.00 36.91  ? 9    LYS A N   1 
ATOM   45    C  CA  . LYS A  1 9   ? 41.394  3.123   -33.913 1.00 39.16  ? 9    LYS A CA  1 
ATOM   46    C  C   . LYS A  1 9   ? 41.558  1.734   -34.516 1.00 41.38  ? 9    LYS A C   1 
ATOM   47    O  O   . LYS A  1 9   ? 41.765  0.767   -33.789 1.00 43.96  ? 9    LYS A O   1 
ATOM   48    C  CB  . LYS A  1 9   ? 40.121  3.137   -33.058 1.00 43.09  ? 9    LYS A CB  1 
ATOM   49    C  CG  . LYS A  1 9   ? 39.882  4.459   -32.357 1.00 47.05  ? 9    LYS A CG  1 
ATOM   50    C  CD  . LYS A  1 9   ? 38.575  4.494   -31.573 1.00 48.80  ? 9    LYS A CD  1 
ATOM   51    C  CE  . LYS A  1 9   ? 38.473  5.835   -30.848 1.00 51.76  ? 9    LYS A CE  1 
ATOM   52    N  NZ  . LYS A  1 9   ? 37.350  5.950   -29.878 1.00 53.87  ? 9    LYS A NZ  1 
ATOM   53    N  N   . THR A  1 10  ? 41.466  1.623   -35.833 1.00 41.55  ? 10   THR A N   1 
ATOM   54    C  CA  . THR A  1 10  ? 41.291  0.309   -36.441 1.00 42.38  ? 10   THR A CA  1 
ATOM   55    C  C   . THR A  1 10  ? 42.482  -0.629  -36.233 1.00 41.70  ? 10   THR A C   1 
ATOM   56    O  O   . THR A  1 10  ? 42.337  -1.855  -36.296 1.00 41.78  ? 10   THR A O   1 
ATOM   57    C  CB  . THR A  1 10  ? 40.976  0.420   -37.949 1.00 44.46  ? 10   THR A CB  1 
ATOM   58    O  OG1 . THR A  1 10  ? 39.796  1.212   -38.138 1.00 46.96  ? 10   THR A OG1 1 
ATOM   59    C  CG2 . THR A  1 10  ? 40.742  -0.959  -38.535 1.00 43.26  ? 10   THR A CG2 1 
ATOM   60    N  N   . PHE A  1 11  ? 43.656  -0.055  -35.992 1.00 39.71  ? 11   PHE A N   1 
ATOM   61    C  CA  . PHE A  1 11  ? 44.872  -0.850  -35.926 1.00 37.82  ? 11   PHE A CA  1 
ATOM   62    C  C   . PHE A  1 11  ? 44.840  -1.782  -34.727 1.00 39.26  ? 11   PHE A C   1 
ATOM   63    O  O   . PHE A  1 11  ? 45.585  -2.762  -34.666 1.00 40.20  ? 11   PHE A O   1 
ATOM   64    C  CB  . PHE A  1 11  ? 46.100  0.051   -35.865 1.00 36.17  ? 11   PHE A CB  1 
ATOM   65    C  CG  . PHE A  1 11  ? 46.268  0.750   -34.552 1.00 37.22  ? 11   PHE A CG  1 
ATOM   66    C  CD1 . PHE A  1 11  ? 45.531  1.892   -34.256 1.00 36.79  ? 11   PHE A CD1 1 
ATOM   67    C  CD2 . PHE A  1 11  ? 47.159  0.267   -33.611 1.00 36.50  ? 11   PHE A CD2 1 
ATOM   68    C  CE1 . PHE A  1 11  ? 45.679  2.535   -33.046 1.00 35.98  ? 11   PHE A CE1 1 
ATOM   69    C  CE2 . PHE A  1 11  ? 47.308  0.903   -32.398 1.00 37.63  ? 11   PHE A CE2 1 
ATOM   70    C  CZ  . PHE A  1 11  ? 46.567  2.039   -32.113 1.00 37.07  ? 11   PHE A CZ  1 
ATOM   71    N  N   . THR A  1 12  ? 43.958  -1.480  -33.782 1.00 39.75  ? 12   THR A N   1 
ATOM   72    C  CA  . THR A  1 12  ? 43.848  -2.275  -32.567 1.00 43.18  ? 12   THR A CA  1 
ATOM   73    C  C   . THR A  1 12  ? 43.073  -3.573  -32.778 1.00 44.68  ? 12   THR A C   1 
ATOM   74    O  O   . THR A  1 12  ? 43.190  -4.494  -31.983 1.00 46.96  ? 12   THR A O   1 
ATOM   75    C  CB  . THR A  1 12  ? 43.199  -1.472  -31.418 1.00 46.20  ? 12   THR A CB  1 
ATOM   76    O  OG1 . THR A  1 12  ? 41.856  -1.119  -31.773 1.00 48.44  ? 12   THR A OG1 1 
ATOM   77    C  CG2 . THR A  1 12  ? 44.004  -0.206  -31.119 1.00 43.56  ? 12   THR A CG2 1 
ATOM   78    N  N   . LYS A  1 13  ? 42.309  -3.657  -33.862 1.00 47.68  ? 13   LYS A N   1 
ATOM   79    C  CA  . LYS A  1 13  ? 41.496  -4.849  -34.140 1.00 49.64  ? 13   LYS A CA  1 
ATOM   80    C  C   . LYS A  1 13  ? 42.290  -5.985  -34.805 1.00 48.83  ? 13   LYS A C   1 
ATOM   81    O  O   . LYS A  1 13  ? 41.752  -7.052  -35.059 1.00 49.80  ? 13   LYS A O   1 
ATOM   82    C  CB  . LYS A  1 13  ? 40.277  -4.494  -35.009 1.00 50.88  ? 13   LYS A CB  1 
ATOM   83    C  CG  . LYS A  1 13  ? 39.317  -3.476  -34.398 1.00 50.83  ? 13   LYS A CG  1 
ATOM   84    C  CD  . LYS A  1 13  ? 38.213  -3.091  -35.380 1.00 49.90  ? 13   LYS A CD  1 
ATOM   85    N  N   . PHE A  1 14  ? 43.568  -5.751  -35.081 1.00 48.13  ? 14   PHE A N   1 
ATOM   86    C  CA  . PHE A  1 14  ? 44.414  -6.743  -35.743 1.00 45.56  ? 14   PHE A CA  1 
ATOM   87    C  C   . PHE A  1 14  ? 45.194  -7.604  -34.777 1.00 46.60  ? 14   PHE A C   1 
ATOM   88    O  O   . PHE A  1 14  ? 45.613  -7.147  -33.721 1.00 51.13  ? 14   PHE A O   1 
ATOM   89    C  CB  . PHE A  1 14  ? 45.424  -6.065  -36.656 1.00 43.41  ? 14   PHE A CB  1 
ATOM   90    C  CG  . PHE A  1 14  ? 44.807  -5.183  -37.673 1.00 40.04  ? 14   PHE A CG  1 
ATOM   91    C  CD1 . PHE A  1 14  ? 45.480  -4.075  -38.151 1.00 37.31  ? 14   PHE A CD1 1 
ATOM   92    C  CD2 . PHE A  1 14  ? 43.547  -5.457  -38.148 1.00 39.79  ? 14   PHE A CD2 1 
ATOM   93    C  CE1 . PHE A  1 14  ? 44.903  -3.261  -39.085 1.00 38.61  ? 14   PHE A CE1 1 
ATOM   94    C  CE2 . PHE A  1 14  ? 42.963  -4.649  -39.087 1.00 40.95  ? 14   PHE A CE2 1 
ATOM   95    C  CZ  . PHE A  1 14  ? 43.638  -3.548  -39.558 1.00 40.54  ? 14   PHE A CZ  1 
ATOM   96    N  N   . ALA A  1 15  ? 45.380  -8.863  -35.149 1.00 44.76  ? 15   ALA A N   1 
ATOM   97    C  CA  . ALA A  1 15  ? 46.274  -9.751  -34.425 1.00 43.14  ? 15   ALA A CA  1 
ATOM   98    C  C   . ALA A  1 15  ? 47.689  -9.621  -34.983 1.00 43.42  ? 15   ALA A C   1 
ATOM   99    O  O   . ALA A  1 15  ? 47.910  -9.725  -36.194 1.00 45.76  ? 15   ALA A O   1 
ATOM   100   C  CB  . ALA A  1 15  ? 45.792  -11.181 -34.520 1.00 43.69  ? 15   ALA A CB  1 
ATOM   101   N  N   . TYR A  1 16  ? 48.643  -9.383  -34.092 1.00 40.30  ? 16   TYR A N   1 
ATOM   102   C  CA  . TYR A  1 16  ? 50.028  -9.204  -34.486 1.00 37.18  ? 16   TYR A CA  1 
ATOM   103   C  C   . TYR A  1 16  ? 50.900  -10.361 -34.019 1.00 37.98  ? 16   TYR A C   1 
ATOM   104   O  O   . TYR A  1 16  ? 51.181  -10.499 -32.837 1.00 42.56  ? 16   TYR A O   1 
ATOM   105   C  CB  . TYR A  1 16  ? 50.554  -7.901  -33.901 1.00 35.37  ? 16   TYR A CB  1 
ATOM   106   C  CG  . TYR A  1 16  ? 49.860  -6.676  -34.430 1.00 37.46  ? 16   TYR A CG  1 
ATOM   107   C  CD1 . TYR A  1 16  ? 48.783  -6.116  -33.756 1.00 41.71  ? 16   TYR A CD1 1 
ATOM   108   C  CD2 . TYR A  1 16  ? 50.276  -6.081  -35.611 1.00 38.26  ? 16   TYR A CD2 1 
ATOM   109   C  CE1 . TYR A  1 16  ? 48.143  -4.990  -34.245 1.00 44.28  ? 16   TYR A CE1 1 
ATOM   110   C  CE2 . TYR A  1 16  ? 49.645  -4.961  -36.108 1.00 41.50  ? 16   TYR A CE2 1 
ATOM   111   C  CZ  . TYR A  1 16  ? 48.580  -4.420  -35.421 1.00 45.78  ? 16   TYR A CZ  1 
ATOM   112   O  OH  . TYR A  1 16  ? 47.955  -3.303  -35.914 1.00 49.50  ? 16   TYR A OH  1 
ATOM   113   N  N   . LEU A  1 17  ? 51.358  -11.171 -34.960 1.00 39.06  ? 17   LEU A N   1 
ATOM   114   C  CA  . LEU A  1 17  ? 52.188  -12.322 -34.634 1.00 40.91  ? 17   LEU A CA  1 
ATOM   115   C  C   . LEU A  1 17  ? 53.672  -11.981 -34.736 1.00 44.84  ? 17   LEU A C   1 
ATOM   116   O  O   . LEU A  1 17  ? 54.077  -11.195 -35.591 1.00 46.95  ? 17   LEU A O   1 
ATOM   117   C  CB  . LEU A  1 17  ? 51.860  -13.486 -35.563 1.00 40.80  ? 17   LEU A CB  1 
ATOM   118   C  CG  . LEU A  1 17  ? 50.377  -13.741 -35.833 1.00 40.36  ? 17   LEU A CG  1 
ATOM   119   C  CD1 . LEU A  1 17  ? 50.189  -15.072 -36.563 1.00 40.53  ? 17   LEU A CD1 1 
ATOM   120   C  CD2 . LEU A  1 17  ? 49.581  -13.713 -34.541 1.00 38.96  ? 17   LEU A CD2 1 
ATOM   121   N  N   . SER A  1 18  ? 54.476  -12.564 -33.852 1.00 46.19  ? 18   SER A N   1 
ATOM   122   C  CA  . SER A  1 18  ? 55.915  -12.330 -33.854 1.00 47.03  ? 18   SER A CA  1 
ATOM   123   C  C   . SER A  1 18  ? 56.699  -13.499 -33.261 1.00 49.99  ? 18   SER A C   1 
ATOM   124   O  O   . SER A  1 18  ? 56.142  -14.329 -32.546 1.00 52.38  ? 18   SER A O   1 
ATOM   125   C  CB  . SER A  1 18  ? 56.237  -11.070 -33.055 1.00 48.22  ? 18   SER A CB  1 
ATOM   126   O  OG  . SER A  1 18  ? 56.159  -11.316 -31.658 1.00 50.29  ? 18   SER A OG  1 
ATOM   127   N  N   . ASP A  1 19  ? 57.996  -13.542 -33.567 1.00 50.47  ? 19   ASP A N   1 
ATOM   128   C  CA  . ASP A  1 19  ? 58.953  -14.451 -32.929 1.00 49.50  ? 19   ASP A CA  1 
ATOM   129   C  C   . ASP A  1 19  ? 58.626  -15.946 -33.068 1.00 47.41  ? 19   ASP A C   1 
ATOM   130   O  O   . ASP A  1 19  ? 58.492  -16.649 -32.063 1.00 45.95  ? 19   ASP A O   1 
ATOM   131   C  CB  . ASP A  1 19  ? 59.109  -14.082 -31.451 1.00 51.08  ? 19   ASP A CB  1 
ATOM   132   C  CG  . ASP A  1 19  ? 60.370  -14.654 -30.832 1.00 54.29  ? 19   ASP A CG  1 
ATOM   133   O  OD1 . ASP A  1 19  ? 61.241  -15.153 -31.575 1.00 53.65  ? 19   ASP A OD1 1 
ATOM   134   O  OD2 . ASP A  1 19  ? 60.497  -14.588 -29.593 1.00 57.78  ? 19   ASP A OD2 1 
ATOM   135   N  N   . PRO A  1 20  ? 58.522  -16.440 -34.315 1.00 45.75  ? 20   PRO A N   1 
ATOM   136   C  CA  . PRO A  1 20  ? 58.217  -17.855 -34.554 1.00 46.18  ? 20   PRO A CA  1 
ATOM   137   C  C   . PRO A  1 20  ? 59.359  -18.766 -34.127 1.00 48.30  ? 20   PRO A C   1 
ATOM   138   O  O   . PRO A  1 20  ? 60.527  -18.385 -34.204 1.00 50.78  ? 20   PRO A O   1 
ATOM   139   C  CB  . PRO A  1 20  ? 58.014  -17.921 -36.071 1.00 45.40  ? 20   PRO A CB  1 
ATOM   140   C  CG  . PRO A  1 20  ? 58.770  -16.767 -36.610 1.00 44.24  ? 20   PRO A CG  1 
ATOM   141   C  CD  . PRO A  1 20  ? 58.659  -15.688 -35.574 1.00 44.39  ? 20   PRO A CD  1 
ATOM   142   N  N   . ARG A  1 21  ? 59.005  -19.955 -33.658 1.00 49.28  ? 21   ARG A N   1 
ATOM   143   C  CA  . ARG A  1 21  ? 59.968  -20.915 -33.133 1.00 51.18  ? 21   ARG A CA  1 
ATOM   144   C  C   . ARG A  1 21  ? 59.465  -22.336 -33.371 1.00 54.98  ? 21   ARG A C   1 
ATOM   145   O  O   . ARG A  1 21  ? 58.264  -22.597 -33.268 1.00 58.61  ? 21   ARG A O   1 
ATOM   146   C  CB  . ARG A  1 21  ? 60.148  -20.688 -31.633 1.00 48.83  ? 21   ARG A CB  1 
ATOM   147   C  CG  . ARG A  1 21  ? 60.682  -19.323 -31.276 1.00 48.03  ? 21   ARG A CG  1 
ATOM   148   C  CD  . ARG A  1 21  ? 62.192  -19.314 -31.314 1.00 50.56  ? 21   ARG A CD  1 
ATOM   149   N  NE  . ARG A  1 21  ? 62.723  -17.958 -31.268 1.00 55.02  ? 21   ARG A NE  1 
ATOM   150   C  CZ  . ARG A  1 21  ? 63.972  -17.661 -30.923 1.00 60.74  ? 21   ARG A CZ  1 
ATOM   151   N  NH1 . ARG A  1 21  ? 64.814  -18.629 -30.582 1.00 63.99  ? 21   ARG A NH1 1 
ATOM   152   N  NH2 . ARG A  1 21  ? 64.376  -16.398 -30.910 1.00 61.20  ? 21   ARG A NH2 1 
ATOM   153   N  N   . THR A  1 22  ? 60.368  -23.263 -33.665 1.00 53.46  ? 22   THR A N   1 
ATOM   154   C  CA  . THR A  1 22  ? 59.930  -24.626 -33.926 1.00 54.72  ? 22   THR A CA  1 
ATOM   155   C  C   . THR A  1 22  ? 60.935  -25.692 -33.478 1.00 55.54  ? 22   THR A C   1 
ATOM   156   O  O   . THR A  1 22  ? 62.145  -25.492 -33.547 1.00 55.04  ? 22   THR A O   1 
ATOM   157   C  CB  . THR A  1 22  ? 59.546  -24.811 -35.422 1.00 58.65  ? 22   THR A CB  1 
ATOM   158   O  OG1 . THR A  1 22  ? 58.889  -26.070 -35.615 1.00 59.33  ? 22   THR A OG1 1 
ATOM   159   C  CG2 . THR A  1 22  ? 60.774  -24.726 -36.315 1.00 58.21  ? 22   THR A CG2 1 
ATOM   160   N  N   . ARG A  1 23  ? 60.407  -26.805 -32.983 1.00 57.04  ? 23   ARG A N   1 
ATOM   161   C  CA  . ARG A  1 23  ? 61.179  -28.018 -32.747 1.00 60.50  ? 23   ARG A CA  1 
ATOM   162   C  C   . ARG A  1 23  ? 60.225  -29.179 -32.978 1.00 65.39  ? 23   ARG A C   1 
ATOM   163   O  O   . ARG A  1 23  ? 59.032  -29.074 -32.676 1.00 65.61  ? 23   ARG A O   1 
ATOM   164   C  CB  . ARG A  1 23  ? 61.744  -28.070 -31.323 1.00 60.13  ? 23   ARG A CB  1 
ATOM   165   C  CG  . ARG A  1 23  ? 63.261  -27.865 -31.216 1.00 61.29  ? 23   ARG A CG  1 
ATOM   166   C  CD  . ARG A  1 23  ? 63.628  -26.383 -31.100 1.00 62.75  ? 23   ARG A CD  1 
ATOM   167   N  NE  . ARG A  1 23  ? 65.044  -26.167 -30.800 1.00 61.65  ? 23   ARG A NE  1 
ATOM   168   N  N   . LYS A  1 24  ? 60.739  -30.269 -33.539 1.00 69.75  ? 24   LYS A N   1 
ATOM   169   C  CA  . LYS A  1 24  ? 59.930  -31.464 -33.783 1.00 72.05  ? 24   LYS A CA  1 
ATOM   170   C  C   . LYS A  1 24  ? 58.633  -31.148 -34.536 1.00 69.20  ? 24   LYS A C   1 
ATOM   171   O  O   . LYS A  1 24  ? 58.655  -30.601 -35.637 1.00 67.15  ? 24   LYS A O   1 
ATOM   172   C  CB  . LYS A  1 24  ? 59.593  -32.160 -32.459 1.00 75.50  ? 24   LYS A CB  1 
ATOM   173   C  CG  . LYS A  1 24  ? 60.721  -32.168 -31.432 1.00 76.43  ? 24   LYS A CG  1 
ATOM   174   C  CD  . LYS A  1 24  ? 61.916  -32.958 -31.921 1.00 76.89  ? 24   LYS A CD  1 
ATOM   175   C  CE  . LYS A  1 24  ? 63.028  -32.962 -30.889 1.00 77.29  ? 24   LYS A CE  1 
ATOM   176   N  NZ  . LYS A  1 24  ? 64.226  -33.675 -31.410 1.00 78.07  ? 24   LYS A NZ  1 
ATOM   177   N  N   . ASN A  1 25  ? 57.509  -31.540 -33.941 1.00 69.24  ? 25   ASN A N   1 
ATOM   178   C  CA  . ASN A  1 25  ? 56.176  -31.258 -34.478 1.00 69.86  ? 25   ASN A CA  1 
ATOM   179   C  C   . ASN A  1 25  ? 55.491  -30.021 -33.871 1.00 67.91  ? 25   ASN A C   1 
ATOM   180   O  O   . ASN A  1 25  ? 54.312  -29.757 -34.141 1.00 66.59  ? 25   ASN A O   1 
ATOM   181   C  CB  . ASN A  1 25  ? 55.277  -32.492 -34.371 1.00 71.12  ? 25   ASN A CB  1 
ATOM   182   N  N   . LEU A  1 26  ? 56.219  -29.304 -33.016 1.00 65.84  ? 26   LEU A N   1 
ATOM   183   C  CA  . LEU A  1 26  ? 55.693  -28.124 -32.326 1.00 64.86  ? 26   LEU A CA  1 
ATOM   184   C  C   . LEU A  1 26  ? 56.097  -26.799 -32.968 1.00 63.36  ? 26   LEU A C   1 
ATOM   185   O  O   . LEU A  1 26  ? 57.210  -26.649 -33.470 1.00 65.42  ? 26   LEU A O   1 
ATOM   186   C  CB  . LEU A  1 26  ? 56.148  -28.112 -30.866 1.00 65.57  ? 26   LEU A CB  1 
ATOM   187   C  CG  . LEU A  1 26  ? 55.496  -29.149 -29.960 1.00 68.57  ? 26   LEU A CG  1 
ATOM   188   C  CD1 . LEU A  1 26  ? 56.160  -29.159 -28.598 1.00 68.63  ? 26   LEU A CD1 1 
ATOM   189   C  CD2 . LEU A  1 26  ? 54.001  -28.879 -29.841 1.00 70.68  ? 26   LEU A CD2 1 
ATOM   190   N  N   . VAL A  1 27  ? 55.183  -25.837 -32.940 1.00 59.17  ? 27   VAL A N   1 
ATOM   191   C  CA  . VAL A  1 27  ? 55.500  -24.471 -33.323 1.00 57.97  ? 27   VAL A CA  1 
ATOM   192   C  C   . VAL A  1 27  ? 54.929  -23.513 -32.284 1.00 55.35  ? 27   VAL A C   1 
ATOM   193   O  O   . VAL A  1 27  ? 53.776  -23.640 -31.893 1.00 55.43  ? 27   VAL A O   1 
ATOM   194   C  CB  . VAL A  1 27  ? 54.922  -24.131 -34.705 1.00 61.74  ? 27   VAL A CB  1 
ATOM   195   C  CG1 . VAL A  1 27  ? 55.120  -22.653 -35.024 1.00 60.34  ? 27   VAL A CG1 1 
ATOM   196   C  CG2 . VAL A  1 27  ? 55.563  -25.010 -35.773 1.00 65.87  ? 27   VAL A CG2 1 
ATOM   197   N  N   . ALA A  1 28  ? 55.740  -22.567 -31.822 1.00 52.92  ? 28   ALA A N   1 
ATOM   198   C  CA  . ALA A  1 28  ? 55.265  -21.547 -30.893 1.00 48.51  ? 28   ALA A CA  1 
ATOM   199   C  C   . ALA A  1 28  ? 55.565  -20.166 -31.443 1.00 47.70  ? 28   ALA A C   1 
ATOM   200   O  O   . ALA A  1 28  ? 56.579  -19.960 -32.095 1.00 49.36  ? 28   ALA A O   1 
ATOM   201   C  CB  . ALA A  1 28  ? 55.907  -21.720 -29.538 1.00 48.07  ? 28   ALA A CB  1 
ATOM   202   N  N   . TYR A  1 29  ? 54.671  -19.221 -31.187 1.00 46.80  ? 29   TYR A N   1 
ATOM   203   C  CA  . TYR A  1 29  ? 54.880  -17.840 -31.605 1.00 44.63  ? 29   TYR A CA  1 
ATOM   204   C  C   . TYR A  1 29  ? 54.183  -16.907 -30.619 1.00 43.37  ? 29   TYR A C   1 
ATOM   205   O  O   . TYR A  1 29  ? 53.533  -17.368 -29.680 1.00 44.90  ? 29   TYR A O   1 
ATOM   206   C  CB  . TYR A  1 29  ? 54.330  -17.625 -33.018 1.00 42.66  ? 29   TYR A CB  1 
ATOM   207   C  CG  . TYR A  1 29  ? 52.900  -18.084 -33.169 1.00 43.80  ? 29   TYR A CG  1 
ATOM   208   C  CD1 . TYR A  1 29  ? 52.611  -19.383 -33.563 1.00 46.25  ? 29   TYR A CD1 1 
ATOM   209   C  CD2 . TYR A  1 29  ? 51.836  -17.227 -32.900 1.00 43.52  ? 29   TYR A CD2 1 
ATOM   210   C  CE1 . TYR A  1 29  ? 51.303  -19.819 -33.698 1.00 47.93  ? 29   TYR A CE1 1 
ATOM   211   C  CE2 . TYR A  1 29  ? 50.522  -17.656 -33.028 1.00 45.77  ? 29   TYR A CE2 1 
ATOM   212   C  CZ  . TYR A  1 29  ? 50.263  -18.956 -33.427 1.00 48.42  ? 29   TYR A CZ  1 
ATOM   213   O  OH  . TYR A  1 29  ? 48.967  -19.401 -33.562 1.00 49.94  ? 29   TYR A OH  1 
ATOM   214   N  N   . VAL A  1 30  ? 54.297  -15.602 -30.843 1.00 39.09  ? 30   VAL A N   1 
ATOM   215   C  CA  . VAL A  1 30  ? 53.662  -14.644 -29.957 1.00 37.66  ? 30   VAL A CA  1 
ATOM   216   C  C   . VAL A  1 30  ? 52.511  -13.912 -30.622 1.00 42.69  ? 30   VAL A C   1 
ATOM   217   O  O   . VAL A  1 30  ? 52.687  -13.248 -31.638 1.00 45.14  ? 30   VAL A O   1 
ATOM   218   C  CB  . VAL A  1 30  ? 54.651  -13.597 -29.450 1.00 34.96  ? 30   VAL A CB  1 
ATOM   219   C  CG1 . VAL A  1 30  ? 53.951  -12.645 -28.489 1.00 33.59  ? 30   VAL A CG1 1 
ATOM   220   C  CG2 . VAL A  1 30  ? 55.820  -14.264 -28.768 1.00 36.16  ? 30   VAL A CG2 1 
ATOM   221   N  N   . LEU A  1 31  ? 51.329  -14.039 -30.031 1.00 44.32  ? 31   LEU A N   1 
ATOM   222   C  CA  . LEU A  1 31  ? 50.164  -13.264 -30.435 1.00 43.18  ? 31   LEU A CA  1 
ATOM   223   C  C   . LEU A  1 31  ? 50.113  -11.998 -29.601 1.00 44.85  ? 31   LEU A C   1 
ATOM   224   O  O   . LEU A  1 31  ? 50.116  -12.071 -28.371 1.00 49.20  ? 31   LEU A O   1 
ATOM   225   C  CB  . LEU A  1 31  ? 48.897  -14.077 -30.199 1.00 42.06  ? 31   LEU A CB  1 
ATOM   226   C  CG  . LEU A  1 31  ? 47.566  -13.330 -30.220 1.00 39.53  ? 31   LEU A CG  1 
ATOM   227   C  CD1 . LEU A  1 31  ? 47.291  -12.767 -31.602 1.00 39.94  ? 31   LEU A CD1 1 
ATOM   228   C  CD2 . LEU A  1 31  ? 46.449  -14.263 -29.784 1.00 36.86  ? 31   LEU A CD2 1 
ATOM   229   N  N   . THR A  1 32  ? 50.072  -10.845 -30.266 1.00 41.72  ? 32   THR A N   1 
ATOM   230   C  CA  . THR A  1 32  ? 50.055  -9.556  -29.576 1.00 41.30  ? 32   THR A CA  1 
ATOM   231   C  C   . THR A  1 32  ? 48.835  -8.731  -29.958 1.00 41.51  ? 32   THR A C   1 
ATOM   232   O  O   . THR A  1 32  ? 48.524  -8.602  -31.141 1.00 43.06  ? 32   THR A O   1 
ATOM   233   C  CB  . THR A  1 32  ? 51.322  -8.715  -29.881 1.00 32.70  ? 32   THR A CB  1 
ATOM   234   O  OG1 . THR A  1 32  ? 52.484  -9.384  -29.376 1.00 32.68  ? 32   THR A OG1 1 
ATOM   235   C  CG2 . THR A  1 32  ? 51.220  -7.333  -29.219 1.00 31.25  ? 32   THR A CG2 1 
ATOM   236   N  N   . LYS A  1 33  ? 48.151  -8.170  -28.960 1.00 40.57  ? 33   LYS A N   1 
ATOM   237   C  CA  . LYS A  1 33  ? 46.995  -7.308  -29.216 1.00 40.38  ? 33   LYS A CA  1 
ATOM   238   C  C   . LYS A  1 33  ? 47.183  -5.936  -28.607 1.00 44.59  ? 33   LYS A C   1 
ATOM   239   O  O   . LYS A  1 33  ? 47.848  -5.794  -27.587 1.00 48.43  ? 33   LYS A O   1 
ATOM   240   C  CB  . LYS A  1 33  ? 45.707  -7.936  -28.686 1.00 37.98  ? 33   LYS A CB  1 
ATOM   241   C  CG  . LYS A  1 33  ? 45.203  -9.088  -29.532 1.00 39.12  ? 33   LYS A CG  1 
ATOM   242   C  CD  . LYS A  1 33  ? 44.738  -8.620  -30.901 1.00 40.29  ? 33   LYS A CD  1 
ATOM   243   C  CE  . LYS A  1 33  ? 43.219  -8.502  -30.965 1.00 43.14  ? 33   LYS A CE  1 
ATOM   244   N  NZ  . LYS A  1 33  ? 42.652  -7.548  -29.976 1.00 45.37  ? 33   LYS A NZ  1 
ATOM   245   N  N   . ALA A  1 34  ? 46.595  -4.919  -29.231 1.00 44.99  ? 34   ALA A N   1 
ATOM   246   C  CA  . ALA A  1 34  ? 46.676  -3.570  -28.684 1.00 41.54  ? 34   ALA A CA  1 
ATOM   247   C  C   . ALA A  1 34  ? 45.371  -3.207  -28.001 1.00 42.66  ? 34   ALA A C   1 
ATOM   248   O  O   . ALA A  1 34  ? 44.362  -2.946  -28.653 1.00 46.07  ? 34   ALA A O   1 
ATOM   249   C  CB  . ALA A  1 34  ? 46.989  -2.575  -29.771 1.00 40.65  ? 34   ALA A CB  1 
ATOM   250   N  N   . ASN A  1 35  ? 45.417  -3.149  -26.676 1.00 42.37  ? 35   ASN A N   1 
ATOM   251   C  CA  . ASN A  1 35  ? 44.240  -2.861  -25.882 1.00 44.41  ? 35   ASN A CA  1 
ATOM   252   C  C   . ASN A  1 35  ? 44.182  -1.368  -25.615 1.00 45.97  ? 35   ASN A C   1 
ATOM   253   O  O   . ASN A  1 35  ? 45.006  -0.820  -24.880 1.00 45.81  ? 35   ASN A O   1 
ATOM   254   C  CB  . ASN A  1 35  ? 44.300  -3.641  -24.571 1.00 46.15  ? 35   ASN A CB  1 
ATOM   255   C  CG  . ASN A  1 35  ? 43.098  -3.395  -23.690 1.00 45.91  ? 35   ASN A CG  1 
ATOM   256   O  OD1 . ASN A  1 35  ? 42.622  -2.266  -23.560 1.00 46.80  ? 35   ASN A OD1 1 
ATOM   257   N  ND2 . ASN A  1 35  ? 42.597  -4.458  -23.074 1.00 44.75  ? 35   ASN A ND2 1 
ATOM   258   N  N   . LEU A  1 36  ? 43.190  -0.719  -26.208 1.00 46.53  ? 36   LEU A N   1 
ATOM   259   C  CA  . LEU A  1 36  ? 43.086  0.731   -26.153 1.00 44.71  ? 36   LEU A CA  1 
ATOM   260   C  C   . LEU A  1 36  ? 42.563  1.231   -24.801 1.00 47.03  ? 36   LEU A C   1 
ATOM   261   O  O   . LEU A  1 36  ? 42.949  2.307   -24.328 1.00 45.86  ? 36   LEU A O   1 
ATOM   262   C  CB  . LEU A  1 36  ? 42.189  1.231   -27.286 1.00 38.47  ? 36   LEU A CB  1 
ATOM   263   C  CG  . LEU A  1 36  ? 42.218  2.741   -27.493 1.00 37.48  ? 36   LEU A CG  1 
ATOM   264   C  CD1 . LEU A  1 36  ? 43.653  3.232   -27.540 1.00 38.12  ? 36   LEU A CD1 1 
ATOM   265   C  CD2 . LEU A  1 36  ? 41.482  3.109   -28.759 1.00 38.17  ? 36   LEU A CD2 1 
ATOM   266   N  N   . GLU A  1 37  ? 41.688  0.448   -24.180 1.00 47.29  ? 37   GLU A N   1 
ATOM   267   C  CA  . GLU A  1 37  ? 41.043  0.888   -22.954 1.00 48.62  ? 37   GLU A CA  1 
ATOM   268   C  C   . GLU A  1 37  ? 41.981  0.783   -21.756 1.00 47.44  ? 37   GLU A C   1 
ATOM   269   O  O   . GLU A  1 37  ? 41.928  1.611   -20.843 1.00 44.57  ? 37   GLU A O   1 
ATOM   270   C  CB  . GLU A  1 37  ? 39.750  0.108   -22.718 1.00 53.17  ? 37   GLU A CB  1 
ATOM   271   C  CG  . GLU A  1 37  ? 38.699  0.299   -23.814 1.00 59.01  ? 37   GLU A CG  1 
ATOM   272   C  CD  . GLU A  1 37  ? 38.997  -0.505  -25.072 1.00 65.58  ? 37   GLU A CD  1 
ATOM   273   O  OE1 . GLU A  1 37  ? 39.830  -1.438  -25.006 1.00 68.19  ? 37   GLU A OE1 1 
ATOM   274   O  OE2 . GLU A  1 37  ? 38.393  -0.206  -26.126 1.00 66.92  ? 37   GLU A OE2 1 
ATOM   275   N  N   . SER A  1 38  ? 42.836  -0.236  -21.764 1.00 48.20  ? 38   SER A N   1 
ATOM   276   C  CA  . SER A  1 38  ? 43.835  -0.406  -20.718 1.00 47.21  ? 38   SER A CA  1 
ATOM   277   C  C   . SER A  1 38  ? 45.108  0.311   -21.119 1.00 51.34  ? 38   SER A C   1 
ATOM   278   O  O   . SER A  1 38  ? 46.031  0.462   -20.313 1.00 53.09  ? 38   SER A O   1 
ATOM   279   C  CB  . SER A  1 38  ? 44.157  -1.880  -20.532 1.00 44.17  ? 38   SER A CB  1 
ATOM   280   O  OG  . SER A  1 38  ? 45.011  -2.323  -21.569 1.00 44.70  ? 38   SER A OG  1 
ATOM   281   N  N   . ASN A  1 39  ? 45.144  0.756   -22.373 1.00 50.89  ? 39   ASN A N   1 
ATOM   282   C  CA  . ASN A  1 39  ? 46.329  1.383   -22.944 1.00 48.79  ? 39   ASN A CA  1 
ATOM   283   C  C   . ASN A  1 39  ? 47.584  0.532   -22.757 1.00 49.23  ? 39   ASN A C   1 
ATOM   284   O  O   . ASN A  1 39  ? 48.663  1.045   -22.469 1.00 51.53  ? 39   ASN A O   1 
ATOM   285   C  CB  . ASN A  1 39  ? 46.537  2.778   -22.361 1.00 46.40  ? 39   ASN A CB  1 
ATOM   286   C  CG  . ASN A  1 39  ? 47.563  3.574   -23.127 1.00 48.76  ? 39   ASN A CG  1 
ATOM   287   O  OD1 . ASN A  1 39  ? 47.838  3.297   -24.296 1.00 48.65  ? 39   ASN A OD1 1 
ATOM   288   N  ND2 . ASN A  1 39  ? 48.142  4.569   -22.471 1.00 51.67  ? 39   ASN A ND2 1 
ATOM   289   N  N   . LYS A  1 40  ? 47.438  -0.774  -22.930 1.00 47.50  ? 40   LYS A N   1 
ATOM   290   C  CA  . LYS A  1 40  ? 48.560  -1.689  -22.777 1.00 46.87  ? 40   LYS A CA  1 
ATOM   291   C  C   . LYS A  1 40  ? 48.594  -2.677  -23.937 1.00 40.82  ? 40   LYS A C   1 
ATOM   292   O  O   . LYS A  1 40  ? 47.567  -2.939  -24.553 1.00 41.57  ? 40   LYS A O   1 
ATOM   293   C  CB  . LYS A  1 40  ? 48.470  -2.422  -21.428 1.00 49.34  ? 40   LYS A CB  1 
ATOM   294   C  CG  . LYS A  1 40  ? 48.681  -1.506  -20.213 1.00 52.08  ? 40   LYS A CG  1 
ATOM   295   C  CD  . LYS A  1 40  ? 48.778  -2.269  -18.892 1.00 52.72  ? 40   LYS A CD  1 
ATOM   296   N  N   . TYR A  1 41  ? 49.773  -3.199  -24.255 1.00 36.22  ? 41   TYR A N   1 
ATOM   297   C  CA  . TYR A  1 41  ? 49.874  -4.294  -25.210 1.00 36.13  ? 41   TYR A CA  1 
ATOM   298   C  C   . TYR A  1 41  ? 49.725  -5.584  -24.426 1.00 39.57  ? 41   TYR A C   1 
ATOM   299   O  O   . TYR A  1 41  ? 50.243  -5.708  -23.312 1.00 43.92  ? 41   TYR A O   1 
ATOM   300   C  CB  . TYR A  1 41  ? 51.215  -4.279  -25.949 1.00 35.86  ? 41   TYR A CB  1 
ATOM   301   C  CG  . TYR A  1 41  ? 51.326  -3.210  -27.021 1.00 37.11  ? 41   TYR A CG  1 
ATOM   302   C  CD1 . TYR A  1 41  ? 51.835  -1.953  -26.729 1.00 33.58  ? 41   TYR A CD1 1 
ATOM   303   C  CD2 . TYR A  1 41  ? 50.919  -3.462  -28.327 1.00 38.80  ? 41   TYR A CD2 1 
ATOM   304   C  CE1 . TYR A  1 41  ? 51.930  -0.981  -27.703 1.00 32.89  ? 41   TYR A CE1 1 
ATOM   305   C  CE2 . TYR A  1 41  ? 51.013  -2.494  -29.306 1.00 36.05  ? 41   TYR A CE2 1 
ATOM   306   C  CZ  . TYR A  1 41  ? 51.517  -1.257  -28.990 1.00 34.42  ? 41   TYR A CZ  1 
ATOM   307   O  OH  . TYR A  1 41  ? 51.611  -0.295  -29.970 1.00 35.38  ? 41   TYR A OH  1 
ATOM   308   N  N   . GLU A  1 42  ? 48.994  -6.533  -24.995 1.00 37.01  ? 42   GLU A N   1 
ATOM   309   C  CA  . GLU A  1 42  ? 48.818  -7.832  -24.374 1.00 35.19  ? 42   GLU A CA  1 
ATOM   310   C  C   . GLU A  1 42  ? 49.604  -8.848  -25.189 1.00 38.10  ? 42   GLU A C   1 
ATOM   311   O  O   . GLU A  1 42  ? 49.605  -8.810  -26.425 1.00 39.76  ? 42   GLU A O   1 
ATOM   312   C  CB  . GLU A  1 42  ? 47.330  -8.208  -24.316 1.00 37.87  ? 42   GLU A CB  1 
ATOM   313   C  CG  . GLU A  1 42  ? 46.481  -7.293  -23.426 1.00 41.10  ? 42   GLU A CG  1 
ATOM   314   C  CD  . GLU A  1 42  ? 44.976  -7.542  -23.537 1.00 43.61  ? 42   GLU A CD  1 
ATOM   315   O  OE1 . GLU A  1 42  ? 44.546  -8.372  -24.364 1.00 44.47  ? 42   GLU A OE1 1 
ATOM   316   O  OE2 . GLU A  1 42  ? 44.216  -6.893  -22.790 1.00 44.70  ? 42   GLU A OE2 1 
ATOM   317   N  N   . ASN A  1 43  ? 50.296  -9.742  -24.496 1.00 37.80  ? 43   ASN A N   1 
ATOM   318   C  CA  . ASN A  1 43  ? 51.030  -10.804 -25.158 1.00 35.63  ? 43   ASN A CA  1 
ATOM   319   C  C   . ASN A  1 43  ? 50.567  -12.165 -24.683 1.00 37.98  ? 43   ASN A C   1 
ATOM   320   O  O   . ASN A  1 43  ? 50.320  -12.373 -23.498 1.00 38.97  ? 43   ASN A O   1 
ATOM   321   C  CB  . ASN A  1 43  ? 52.528  -10.650 -24.924 1.00 38.17  ? 43   ASN A CB  1 
ATOM   322   C  CG  . ASN A  1 43  ? 53.104  -9.438  -25.624 1.00 39.76  ? 43   ASN A CG  1 
ATOM   323   O  OD1 . ASN A  1 43  ? 52.663  -9.072  -26.711 1.00 44.08  ? 43   ASN A OD1 1 
ATOM   324   N  ND2 . ASN A  1 43  ? 54.094  -8.811  -25.007 1.00 36.46  ? 43   ASN A ND2 1 
ATOM   325   N  N   . THR A  1 44  ? 50.420  -13.085 -25.627 1.00 40.95  ? 44   THR A N   1 
ATOM   326   C  CA  . THR A  1 44  ? 50.073  -14.458 -25.320 1.00 42.20  ? 44   THR A CA  1 
ATOM   327   C  C   . THR A  1 44  ? 50.925  -15.374 -26.163 1.00 47.46  ? 44   THR A C   1 
ATOM   328   O  O   . THR A  1 44  ? 50.944  -15.251 -27.385 1.00 53.24  ? 44   THR A O   1 
ATOM   329   C  CB  . THR A  1 44  ? 48.630  -14.751 -25.680 1.00 41.18  ? 44   THR A CB  1 
ATOM   330   O  OG1 . THR A  1 44  ? 47.770  -13.898 -24.918 1.00 40.55  ? 44   THR A OG1 1 
ATOM   331   C  CG2 . THR A  1 44  ? 48.309  -16.208 -25.388 1.00 41.59  ? 44   THR A CG2 1 
ATOM   332   N  N   . ILE A  1 45  ? 51.639  -16.289 -25.525 1.00 45.63  ? 45   ILE A N   1 
ATOM   333   C  CA  . ILE A  1 45  ? 52.355  -17.284 -26.289 1.00 46.05  ? 45   ILE A CA  1 
ATOM   334   C  C   . ILE A  1 45  ? 51.360  -18.348 -26.702 1.00 50.59  ? 45   ILE A C   1 
ATOM   335   O  O   . ILE A  1 45  ? 50.515  -18.763 -25.908 1.00 52.39  ? 45   ILE A O   1 
ATOM   336   C  CB  . ILE A  1 45  ? 53.482  -17.923 -25.482 1.00 46.24  ? 45   ILE A CB  1 
ATOM   337   C  CG1 . ILE A  1 45  ? 54.599  -16.915 -25.250 1.00 47.43  ? 45   ILE A CG1 1 
ATOM   338   C  CG2 . ILE A  1 45  ? 54.035  -19.140 -26.209 1.00 45.00  ? 45   ILE A CG2 1 
ATOM   339   C  CD1 . ILE A  1 45  ? 55.791  -17.509 -24.540 1.00 48.78  ? 45   ILE A CD1 1 
ATOM   340   N  N   . VAL A  1 46  ? 51.454  -18.770 -27.957 1.00 52.32  ? 46   VAL A N   1 
ATOM   341   C  CA  . VAL A  1 46  ? 50.603  -19.824 -28.488 1.00 51.88  ? 46   VAL A CA  1 
ATOM   342   C  C   . VAL A  1 46  ? 51.471  -20.961 -28.995 1.00 53.33  ? 46   VAL A C   1 
ATOM   343   O  O   . VAL A  1 46  ? 52.247  -20.782 -29.934 1.00 53.85  ? 46   VAL A O   1 
ATOM   344   C  CB  . VAL A  1 46  ? 49.760  -19.320 -29.663 1.00 49.18  ? 46   VAL A CB  1 
ATOM   345   C  CG1 . VAL A  1 46  ? 48.853  -20.420 -30.163 1.00 48.89  ? 46   VAL A CG1 1 
ATOM   346   C  CG2 . VAL A  1 46  ? 48.956  -18.106 -29.251 1.00 47.41  ? 46   VAL A CG2 1 
ATOM   347   N  N   . ILE A  1 47  ? 51.354  -22.124 -28.367 1.00 53.90  ? 47   ILE A N   1 
ATOM   348   C  CA  . ILE A  1 47  ? 52.057  -23.300 -28.858 1.00 56.09  ? 47   ILE A CA  1 
ATOM   349   C  C   . ILE A  1 47  ? 51.099  -24.112 -29.694 1.00 58.10  ? 47   ILE A C   1 
ATOM   350   O  O   . ILE A  1 47  ? 50.039  -24.512 -29.220 1.00 57.85  ? 47   ILE A O   1 
ATOM   351   C  CB  . ILE A  1 47  ? 52.610  -24.187 -27.735 1.00 54.43  ? 47   ILE A CB  1 
ATOM   352   C  CG1 . ILE A  1 47  ? 53.688  -23.441 -26.953 1.00 52.93  ? 47   ILE A CG1 1 
ATOM   353   C  CG2 . ILE A  1 47  ? 53.176  -25.488 -28.318 1.00 52.53  ? 47   ILE A CG2 1 
ATOM   354   C  CD1 . ILE A  1 47  ? 53.141  -22.448 -25.994 1.00 52.61  ? 47   ILE A CD1 1 
ATOM   355   N  N   . GLU A  1 48  ? 51.474  -24.343 -30.944 1.00 60.72  ? 48   GLU A N   1 
ATOM   356   C  CA  . GLU A  1 48  ? 50.584  -24.988 -31.891 1.00 64.78  ? 48   GLU A CA  1 
ATOM   357   C  C   . GLU A  1 48  ? 51.165  -26.309 -32.350 1.00 67.50  ? 48   GLU A C   1 
ATOM   358   O  O   . GLU A  1 48  ? 52.378  -26.456 -32.512 1.00 65.56  ? 48   GLU A O   1 
ATOM   359   C  CB  . GLU A  1 48  ? 50.316  -24.070 -33.081 1.00 66.78  ? 48   GLU A CB  1 
ATOM   360   C  CG  . GLU A  1 48  ? 49.154  -24.483 -33.950 1.00 68.52  ? 48   GLU A CG  1 
ATOM   361   C  CD  . GLU A  1 48  ? 48.676  -23.344 -34.819 1.00 70.10  ? 48   GLU A CD  1 
ATOM   362   O  OE1 . GLU A  1 48  ? 48.308  -23.601 -35.984 1.00 70.41  ? 48   GLU A OE1 1 
ATOM   363   O  OE2 . GLU A  1 48  ? 48.669  -22.190 -34.334 1.00 69.41  ? 48   GLU A OE2 1 
ATOM   364   N  N   . ASN A  1 49  ? 50.277  -27.274 -32.543 1.00 73.31  ? 49   ASN A N   1 
ATOM   365   C  CA  . ASN A  1 49  ? 50.668  -28.614 -32.934 1.00 78.48  ? 49   ASN A CA  1 
ATOM   366   C  C   . ASN A  1 49  ? 50.411  -28.854 -34.419 1.00 79.68  ? 49   ASN A C   1 
ATOM   367   O  O   . ASN A  1 49  ? 49.258  -28.905 -34.859 1.00 78.62  ? 49   ASN A O   1 
ATOM   368   C  CB  . ASN A  1 49  ? 49.922  -29.646 -32.084 1.00 79.87  ? 49   ASN A CB  1 
ATOM   369   C  CG  . ASN A  1 49  ? 50.186  -31.063 -32.529 1.00 81.44  ? 49   ASN A CG  1 
ATOM   370   O  OD1 . ASN A  1 49  ? 51.097  -31.724 -32.032 1.00 82.24  ? 49   ASN A OD1 1 
ATOM   371   N  ND2 . ASN A  1 49  ? 49.392  -31.537 -33.480 1.00 81.98  ? 49   ASN A ND2 1 
ATOM   372   N  N   . LEU A  1 50  ? 51.494  -28.994 -35.180 1.00 80.96  ? 50   LEU A N   1 
ATOM   373   C  CA  . LEU A  1 50  ? 51.402  -29.311 -36.599 1.00 82.42  ? 50   LEU A CA  1 
ATOM   374   C  C   . LEU A  1 50  ? 50.647  -30.630 -36.726 1.00 85.25  ? 50   LEU A C   1 
ATOM   375   O  O   . LEU A  1 50  ? 50.759  -31.493 -35.854 1.00 87.05  ? 50   LEU A O   1 
ATOM   376   C  CB  . LEU A  1 50  ? 52.800  -29.375 -37.210 1.00 81.01  ? 50   LEU A CB  1 
ATOM   377   C  CG  . LEU A  1 50  ? 53.601  -28.104 -36.896 1.00 80.71  ? 50   LEU A CG  1 
ATOM   378   C  CD1 . LEU A  1 50  ? 55.066  -28.204 -37.303 1.00 82.58  ? 50   LEU A CD1 1 
ATOM   379   C  CD2 . LEU A  1 50  ? 52.948  -26.893 -37.543 1.00 79.33  ? 50   LEU A CD2 1 
ATOM   380   N  N   . GLU A  1 51  ? 49.899  -30.795 -37.814 1.00 85.51  ? 51   GLU A N   1 
ATOM   381   C  CA  . GLU A  1 51  ? 48.728  -31.672 -37.806 1.00 87.53  ? 51   GLU A CA  1 
ATOM   382   C  C   . GLU A  1 51  ? 47.708  -31.081 -36.824 1.00 91.01  ? 51   GLU A C   1 
ATOM   383   O  O   . GLU A  1 51  ? 47.280  -29.937 -36.994 1.00 93.57  ? 51   GLU A O   1 
ATOM   384   C  CB  . GLU A  1 51  ? 49.107  -33.102 -37.411 1.00 87.53  ? 51   GLU A CB  1 
ATOM   385   N  N   . ASP A  1 52  ? 47.293  -31.846 -35.820 1.00 90.48  ? 52   ASP A N   1 
ATOM   386   C  CA  . ASP A  1 52  ? 46.424  -31.296 -34.777 1.00 86.61  ? 52   ASP A CA  1 
ATOM   387   C  C   . ASP A  1 52  ? 46.382  -32.188 -33.545 1.00 85.35  ? 52   ASP A C   1 
ATOM   388   O  O   . ASP A  1 52  ? 45.368  -32.248 -32.854 1.00 84.95  ? 52   ASP A O   1 
ATOM   389   C  CB  . ASP A  1 52  ? 45.006  -31.064 -35.307 1.00 84.23  ? 52   ASP A CB  1 
ATOM   390   N  N   . SER A  1 54  ? 45.334  -28.763 -31.277 1.00 59.52  ? 54   SER A N   1 
ATOM   391   C  CA  . SER A  1 54  ? 46.046  -27.827 -32.139 1.00 62.57  ? 54   SER A CA  1 
ATOM   392   C  C   . SER A  1 54  ? 46.781  -26.724 -31.358 1.00 61.96  ? 54   SER A C   1 
ATOM   393   O  O   . SER A  1 54  ? 47.991  -26.565 -31.523 1.00 64.30  ? 54   SER A O   1 
ATOM   394   C  CB  . SER A  1 54  ? 45.109  -27.221 -33.190 1.00 63.27  ? 54   SER A CB  1 
ATOM   395   O  OG  . SER A  1 54  ? 45.852  -26.504 -34.164 1.00 62.49  ? 54   SER A OG  1 
ATOM   396   N  N   . ARG A  1 55  ? 46.069  -25.970 -30.515 1.00 56.53  ? 55   ARG A N   1 
ATOM   397   C  CA  . ARG A  1 55  ? 46.703  -24.876 -29.763 1.00 52.96  ? 55   ARG A CA  1 
ATOM   398   C  C   . ARG A  1 55  ? 46.645  -24.980 -28.239 1.00 52.56  ? 55   ARG A C   1 
ATOM   399   O  O   . ARG A  1 55  ? 45.618  -25.335 -27.677 1.00 54.01  ? 55   ARG A O   1 
ATOM   400   C  CB  . ARG A  1 55  ? 46.085  -23.541 -30.149 1.00 48.16  ? 55   ARG A CB  1 
ATOM   401   C  CG  . ARG A  1 55  ? 46.071  -23.283 -31.609 1.00 45.19  ? 55   ARG A CG  1 
ATOM   402   C  CD  . ARG A  1 55  ? 45.608  -21.883 -31.859 1.00 43.45  ? 55   ARG A CD  1 
ATOM   403   N  NE  . ARG A  1 55  ? 45.833  -21.508 -33.245 1.00 44.86  ? 55   ARG A NE  1 
ATOM   404   C  CZ  . ARG A  1 55  ? 45.089  -20.630 -33.905 1.00 42.75  ? 55   ARG A CZ  1 
ATOM   405   N  NH1 . ARG A  1 55  ? 44.070  -20.033 -33.295 1.00 36.34  ? 55   ARG A NH1 1 
ATOM   406   N  NH2 . ARG A  1 55  ? 45.364  -20.350 -35.174 1.00 44.75  ? 55   ARG A NH2 1 
ATOM   407   N  N   . LYS A  1 56  ? 47.750  -24.640 -27.581 1.00 52.09  ? 56   LYS A N   1 
ATOM   408   C  CA  . LYS A  1 56  ? 47.739  -24.370 -26.149 1.00 55.44  ? 56   LYS A CA  1 
ATOM   409   C  C   . LYS A  1 56  ? 48.190  -22.920 -25.934 1.00 57.00  ? 56   LYS A C   1 
ATOM   410   O  O   . LYS A  1 56  ? 48.568  -22.235 -26.888 1.00 57.91  ? 56   LYS A O   1 
ATOM   411   C  CB  . LYS A  1 56  ? 48.667  -25.328 -25.391 1.00 56.03  ? 56   LYS A CB  1 
ATOM   412   C  CG  . LYS A  1 56  ? 48.876  -26.688 -26.043 1.00 57.71  ? 56   LYS A CG  1 
ATOM   413   C  CD  . LYS A  1 56  ? 50.087  -27.406 -25.432 1.00 59.55  ? 56   LYS A CD  1 
ATOM   414   C  CE  . LYS A  1 56  ? 50.691  -28.447 -26.382 1.00 59.87  ? 56   LYS A CE  1 
ATOM   415   N  NZ  . LYS A  1 56  ? 51.899  -29.143 -25.836 1.00 59.51  ? 56   LYS A NZ  1 
ATOM   416   N  N   . PHE A  1 57  ? 48.189  -22.460 -24.688 1.00 55.98  ? 57   PHE A N   1 
ATOM   417   C  CA  . PHE A  1 57  ? 48.500  -21.062 -24.417 1.00 56.33  ? 57   PHE A CA  1 
ATOM   418   C  C   . PHE A  1 57  ? 49.340  -20.852 -23.163 1.00 54.34  ? 57   PHE A C   1 
ATOM   419   O  O   . PHE A  1 57  ? 49.154  -21.529 -22.153 1.00 55.44  ? 57   PHE A O   1 
ATOM   420   C  CB  . PHE A  1 57  ? 47.209  -20.249 -24.292 1.00 58.39  ? 57   PHE A CB  1 
ATOM   421   C  CG  . PHE A  1 57  ? 46.236  -20.487 -25.405 1.00 58.68  ? 57   PHE A CG  1 
ATOM   422   C  CD1 . PHE A  1 57  ? 45.211  -21.401 -25.255 1.00 58.82  ? 57   PHE A CD1 1 
ATOM   423   C  CD2 . PHE A  1 57  ? 46.353  -19.806 -26.606 1.00 57.86  ? 57   PHE A CD2 1 
ATOM   424   C  CE1 . PHE A  1 57  ? 44.316  -21.628 -26.280 1.00 58.70  ? 57   PHE A CE1 1 
ATOM   425   C  CE2 . PHE A  1 57  ? 45.462  -20.029 -27.635 1.00 57.79  ? 57   PHE A CE2 1 
ATOM   426   C  CZ  . PHE A  1 57  ? 44.442  -20.940 -27.473 1.00 58.03  ? 57   PHE A CZ  1 
ATOM   427   N  N   . ILE A  1 58  ? 50.266  -19.904 -23.237 1.00 50.32  ? 58   ILE A N   1 
ATOM   428   C  CA  . ILE A  1 58  ? 50.918  -19.393 -22.045 1.00 47.55  ? 58   ILE A CA  1 
ATOM   429   C  C   . ILE A  1 58  ? 50.596  -17.921 -21.992 1.00 48.90  ? 58   ILE A C   1 
ATOM   430   O  O   . ILE A  1 58  ? 51.062  -17.151 -22.828 1.00 54.64  ? 58   ILE A O   1 
ATOM   431   C  CB  . ILE A  1 58  ? 52.432  -19.589 -22.100 1.00 45.20  ? 58   ILE A CB  1 
ATOM   432   C  CG1 . ILE A  1 58  ? 52.767  -21.071 -22.304 1.00 46.49  ? 58   ILE A CG1 1 
ATOM   433   C  CG2 . ILE A  1 58  ? 53.086  -19.063 -20.832 1.00 40.79  ? 58   ILE A CG2 1 
ATOM   434   C  CD1 . ILE A  1 58  ? 54.251  -21.347 -22.428 1.00 47.17  ? 58   ILE A CD1 1 
ATOM   435   N  N   . GLU A  1 59  ? 49.795  -17.533 -21.008 1.00 46.21  ? 59   GLU A N   1 
ATOM   436   C  CA  . GLU A  1 59  ? 49.218  -16.193 -20.972 1.00 45.38  ? 59   GLU A CA  1 
ATOM   437   C  C   . GLU A  1 59  ? 50.174  -15.139 -20.405 1.00 47.73  ? 59   GLU A C   1 
ATOM   438   O  O   . GLU A  1 59  ? 51.000  -15.438 -19.539 1.00 50.81  ? 59   GLU A O   1 
ATOM   439   C  CB  . GLU A  1 59  ? 47.897  -16.203 -20.200 1.00 41.49  ? 59   GLU A CB  1 
ATOM   440   C  CG  . GLU A  1 59  ? 47.167  -14.872 -20.188 1.00 42.01  ? 59   GLU A CG  1 
ATOM   441   C  CD  . GLU A  1 59  ? 46.767  -14.402 -21.579 1.00 42.95  ? 59   GLU A CD  1 
ATOM   442   O  OE1 . GLU A  1 59  ? 45.561  -14.163 -21.804 1.00 39.17  ? 59   GLU A OE1 1 
ATOM   443   O  OE2 . GLU A  1 59  ? 47.659  -14.261 -22.441 1.00 45.87  ? 59   GLU A OE2 1 
ATOM   444   N  N   . ASP A  1 60  ? 50.071  -13.914 -20.921 1.00 45.90  ? 60   ASP A N   1 
ATOM   445   C  CA  . ASP A  1 60  ? 50.884  -12.788 -20.451 1.00 45.30  ? 60   ASP A CA  1 
ATOM   446   C  C   . ASP A  1 60  ? 52.359  -13.147 -20.396 1.00 45.93  ? 60   ASP A C   1 
ATOM   447   O  O   . ASP A  1 60  ? 52.999  -13.013 -19.361 1.00 49.45  ? 60   ASP A O   1 
ATOM   448   C  CB  . ASP A  1 60  ? 50.399  -12.263 -19.091 1.00 43.71  ? 60   ASP A CB  1 
ATOM   449   N  N   . ALA A  1 61  ? 52.883  -13.627 -21.515 1.00 45.45  ? 61   ALA A N   1 
ATOM   450   C  CA  . ALA A  1 61  ? 54.285  -14.014 -21.616 1.00 46.33  ? 61   ALA A CA  1 
ATOM   451   C  C   . ALA A  1 61  ? 54.777  -13.772 -23.030 1.00 46.50  ? 61   ALA A C   1 
ATOM   452   O  O   . ALA A  1 61  ? 53.979  -13.570 -23.944 1.00 48.44  ? 61   ALA A O   1 
ATOM   453   C  CB  . ALA A  1 61  ? 54.464  -15.475 -21.246 1.00 46.74  ? 61   ALA A CB  1 
ATOM   454   N  N   . SER A  1 62  ? 56.092  -13.765 -23.201 1.00 43.42  ? 62   SER A N   1 
ATOM   455   C  CA  . SER A  1 62  ? 56.680  -13.693 -24.528 1.00 44.28  ? 62   SER A CA  1 
ATOM   456   C  C   . SER A  1 62  ? 58.084  -14.274 -24.534 1.00 45.53  ? 62   SER A C   1 
ATOM   457   O  O   . SER A  1 62  ? 58.523  -14.865 -23.548 1.00 46.65  ? 62   SER A O   1 
ATOM   458   C  CB  . SER A  1 62  ? 56.699  -12.257 -25.038 1.00 46.29  ? 62   SER A CB  1 
ATOM   459   O  OG  . SER A  1 62  ? 57.548  -11.466 -24.233 1.00 50.30  ? 62   SER A OG  1 
ATOM   460   N  N   . MET A  1 63  ? 58.779  -14.088 -25.652 1.00 47.21  ? 63   MET A N   1 
ATOM   461   C  CA  . MET A  1 63  ? 60.086  -14.691 -25.888 1.00 48.93  ? 63   MET A CA  1 
ATOM   462   C  C   . MET A  1 63  ? 60.078  -16.193 -25.648 1.00 48.62  ? 63   MET A C   1 
ATOM   463   O  O   . MET A  1 63  ? 60.817  -16.699 -24.807 1.00 50.84  ? 63   MET A O   1 
ATOM   464   C  CB  . MET A  1 63  ? 61.158  -14.034 -25.025 1.00 49.25  ? 63   MET A CB  1 
ATOM   465   C  CG  . MET A  1 63  ? 61.528  -12.636 -25.466 1.00 51.01  ? 63   MET A CG  1 
ATOM   466   S  SD  . MET A  1 63  ? 62.843  -11.999 -24.422 1.00 80.51  ? 63   MET A SD  1 
ATOM   467   C  CE  . MET A  1 63  ? 64.076  -13.270 -24.676 1.00 41.65  ? 63   MET A CE  1 
ATOM   468   N  N   . PRO A  1 64  ? 59.236  -16.914 -26.392 1.00 45.49  ? 64   PRO A N   1 
ATOM   469   C  CA  . PRO A  1 64  ? 59.186  -18.369 -26.245 1.00 45.39  ? 64   PRO A CA  1 
ATOM   470   C  C   . PRO A  1 64  ? 60.484  -18.999 -26.737 1.00 46.94  ? 64   PRO A C   1 
ATOM   471   O  O   . PRO A  1 64  ? 60.976  -18.655 -27.812 1.00 42.87  ? 64   PRO A O   1 
ATOM   472   C  CB  . PRO A  1 64  ? 58.028  -18.763 -27.157 1.00 46.26  ? 64   PRO A CB  1 
ATOM   473   C  CG  . PRO A  1 64  ? 58.031  -17.709 -28.218 1.00 46.75  ? 64   PRO A CG  1 
ATOM   474   C  CD  . PRO A  1 64  ? 58.442  -16.436 -27.536 1.00 45.10  ? 64   PRO A CD  1 
ATOM   475   N  N   . ARG A  1 65  ? 61.039  -19.904 -25.941 1.00 50.63  ? 65   ARG A N   1 
ATOM   476   C  CA  . ARG A  1 65  ? 62.205  -20.666 -26.354 1.00 52.28  ? 65   ARG A CA  1 
ATOM   477   C  C   . ARG A  1 65  ? 61.971  -22.131 -26.048 1.00 55.06  ? 65   ARG A C   1 
ATOM   478   O  O   . ARG A  1 65  ? 61.863  -22.508 -24.885 1.00 58.04  ? 65   ARG A O   1 
ATOM   479   C  CB  . ARG A  1 65  ? 63.443  -20.190 -25.603 1.00 51.89  ? 65   ARG A CB  1 
ATOM   480   C  CG  . ARG A  1 65  ? 63.800  -18.752 -25.869 1.00 53.50  ? 65   ARG A CG  1 
ATOM   481   C  CD  . ARG A  1 65  ? 64.065  -18.512 -27.342 1.00 55.71  ? 65   ARG A CD  1 
ATOM   482   N  NE  . ARG A  1 65  ? 64.392  -17.112 -27.579 1.00 56.70  ? 65   ARG A NE  1 
ATOM   483   C  CZ  . ARG A  1 65  ? 63.489  -16.170 -27.823 1.00 55.10  ? 65   ARG A CZ  1 
ATOM   484   N  NH1 . ARG A  1 65  ? 62.204  -16.485 -27.875 1.00 53.35  ? 65   ARG A NH1 1 
ATOM   485   N  NH2 . ARG A  1 65  ? 63.870  -14.915 -28.022 1.00 54.57  ? 65   ARG A NH2 1 
ATOM   486   N  N   . ILE A  1 66  ? 61.920  -22.959 -27.087 1.00 54.94  ? 66   ILE A N   1 
ATOM   487   C  CA  . ILE A  1 66  ? 61.679  -24.386 -26.908 1.00 54.65  ? 66   ILE A CA  1 
ATOM   488   C  C   . ILE A  1 66  ? 62.989  -25.136 -26.751 1.00 54.73  ? 66   ILE A C   1 
ATOM   489   O  O   . ILE A  1 66  ? 63.924  -24.946 -27.533 1.00 54.31  ? 66   ILE A O   1 
ATOM   490   C  CB  . ILE A  1 66  ? 60.926  -25.000 -28.095 1.00 55.46  ? 66   ILE A CB  1 
ATOM   491   C  CG1 . ILE A  1 66  ? 59.763  -24.110 -28.519 1.00 56.08  ? 66   ILE A CG1 1 
ATOM   492   C  CG2 . ILE A  1 66  ? 60.416  -26.379 -27.732 1.00 57.32  ? 66   ILE A CG2 1 
ATOM   493   C  CD1 . ILE A  1 66  ? 58.988  -24.665 -29.693 1.00 57.95  ? 66   ILE A CD1 1 
ATOM   494   N  N   . SER A  1 67  ? 63.046  -25.999 -25.744 1.00 54.56  ? 67   SER A N   1 
ATOM   495   C  CA  . SER A  1 67  ? 64.244  -26.777 -25.468 1.00 55.41  ? 67   SER A CA  1 
ATOM   496   C  C   . SER A  1 67  ? 64.562  -27.731 -26.618 1.00 56.75  ? 67   SER A C   1 
ATOM   497   O  O   . SER A  1 67  ? 63.656  -28.316 -27.211 1.00 56.49  ? 67   SER A O   1 
ATOM   498   C  CB  . SER A  1 67  ? 64.068  -27.558 -24.169 1.00 55.68  ? 67   SER A CB  1 
ATOM   499   O  OG  . SER A  1 67  ? 62.893  -28.348 -24.218 1.00 56.60  ? 67   SER A OG  1 
ATOM   500   N  N   . PRO A  1 68  ? 65.855  -27.901 -26.928 1.00 57.23  ? 68   PRO A N   1 
ATOM   501   C  CA  . PRO A  1 68  ? 66.260  -28.741 -28.052 1.00 58.73  ? 68   PRO A CA  1 
ATOM   502   C  C   . PRO A  1 68  ? 65.546  -30.084 -28.030 1.00 62.86  ? 68   PRO A C   1 
ATOM   503   O  O   . PRO A  1 68  ? 65.097  -30.544 -29.087 1.00 64.30  ? 68   PRO A O   1 
ATOM   504   C  CB  . PRO A  1 68  ? 67.749  -28.939 -27.795 1.00 57.18  ? 68   PRO A CB  1 
ATOM   505   C  CG  . PRO A  1 68  ? 68.163  -27.674 -27.189 1.00 57.34  ? 68   PRO A CG  1 
ATOM   506   C  CD  . PRO A  1 68  ? 67.013  -27.237 -26.310 1.00 57.91  ? 68   PRO A CD  1 
ATOM   507   N  N   . ASP A  1 69  ? 65.416  -30.691 -26.853 1.00 63.21  ? 69   ASP A N   1 
ATOM   508   C  CA  . ASP A  1 69  ? 64.798  -32.010 -26.762 1.00 65.59  ? 69   ASP A CA  1 
ATOM   509   C  C   . ASP A  1 69  ? 63.279  -31.956 -26.921 1.00 66.41  ? 69   ASP A C   1 
ATOM   510   O  O   . ASP A  1 69  ? 62.613  -32.989 -26.969 1.00 67.77  ? 69   ASP A O   1 
ATOM   511   C  CB  . ASP A  1 69  ? 65.212  -32.744 -25.484 1.00 67.44  ? 69   ASP A CB  1 
ATOM   512   C  CG  . ASP A  1 69  ? 64.646  -32.118 -24.232 1.00 69.36  ? 69   ASP A CG  1 
ATOM   513   O  OD1 . ASP A  1 69  ? 63.639  -31.386 -24.324 1.00 71.26  ? 69   ASP A OD1 1 
ATOM   514   O  OD2 . ASP A  1 69  ? 65.207  -32.374 -23.146 1.00 69.22  ? 69   ASP A OD2 1 
ATOM   515   N  N   . GLY A  1 70  ? 62.739  -30.743 -26.989 1.00 64.69  ? 70   GLY A N   1 
ATOM   516   C  CA  . GLY A  1 70  ? 61.331  -30.542 -27.282 1.00 62.72  ? 70   GLY A CA  1 
ATOM   517   C  C   . GLY A  1 70  ? 60.408  -30.820 -26.114 1.00 60.82  ? 70   GLY A C   1 
ATOM   518   O  O   . GLY A  1 70  ? 59.191  -30.697 -26.236 1.00 59.70  ? 70   GLY A O   1 
ATOM   519   N  N   . LYS A  1 71  ? 60.987  -31.189 -24.977 1.00 61.30  ? 71   LYS A N   1 
ATOM   520   C  CA  . LYS A  1 71  ? 60.199  -31.573 -23.809 1.00 63.70  ? 71   LYS A CA  1 
ATOM   521   C  C   . LYS A  1 71  ? 59.699  -30.380 -22.986 1.00 65.16  ? 71   LYS A C   1 
ATOM   522   O  O   . LYS A  1 71  ? 58.780  -30.529 -22.171 1.00 66.06  ? 71   LYS A O   1 
ATOM   523   C  CB  . LYS A  1 71  ? 60.994  -32.535 -22.917 1.00 63.74  ? 71   LYS A CB  1 
ATOM   524   N  N   . LYS A  1 72  ? 60.290  -29.203 -23.198 1.00 62.45  ? 72   LYS A N   1 
ATOM   525   C  CA  . LYS A  1 72  ? 59.942  -28.033 -22.387 1.00 59.45  ? 72   LYS A CA  1 
ATOM   526   C  C   . LYS A  1 72  ? 60.226  -26.665 -23.033 1.00 59.09  ? 72   LYS A C   1 
ATOM   527   O  O   . LYS A  1 72  ? 61.007  -26.552 -23.979 1.00 59.09  ? 72   LYS A O   1 
ATOM   528   C  CB  . LYS A  1 72  ? 60.596  -28.131 -21.003 1.00 55.59  ? 72   LYS A CB  1 
ATOM   529   C  CG  . LYS A  1 72  ? 62.043  -28.552 -21.034 1.00 54.06  ? 72   LYS A CG  1 
ATOM   530   C  CD  . LYS A  1 72  ? 62.645  -28.641 -19.644 1.00 55.04  ? 72   LYS A CD  1 
ATOM   531   C  CE  . LYS A  1 72  ? 64.110  -29.046 -19.721 1.00 58.44  ? 72   LYS A CE  1 
ATOM   532   N  NZ  . LYS A  1 72  ? 64.850  -28.751 -18.465 1.00 61.84  ? 72   LYS A NZ  1 
ATOM   533   N  N   . ILE A  1 73  ? 59.582  -25.630 -22.496 1.00 57.34  ? 73   ILE A N   1 
ATOM   534   C  CA  . ILE A  1 73  ? 59.625  -24.290 -23.071 1.00 53.84  ? 73   ILE A CA  1 
ATOM   535   C  C   . ILE A  1 73  ? 59.957  -23.206 -22.033 1.00 51.49  ? 73   ILE A C   1 
ATOM   536   O  O   . ILE A  1 73  ? 59.352  -23.142 -20.961 1.00 50.10  ? 73   ILE A O   1 
ATOM   537   C  CB  . ILE A  1 73  ? 58.281  -23.959 -23.760 1.00 53.61  ? 73   ILE A CB  1 
ATOM   538   C  CG1 . ILE A  1 73  ? 58.335  -22.598 -24.453 1.00 53.38  ? 73   ILE A CG1 1 
ATOM   539   C  CG2 . ILE A  1 73  ? 57.138  -23.996 -22.756 1.00 54.32  ? 73   ILE A CG2 1 
ATOM   540   C  CD1 . ILE A  1 73  ? 57.039  -22.242 -25.165 1.00 54.29  ? 73   ILE A CD1 1 
ATOM   541   N  N   . ALA A  1 74  ? 60.928  -22.359 -22.363 1.00 49.97  ? 74   ALA A N   1 
ATOM   542   C  CA  . ALA A  1 74  ? 61.309  -21.245 -21.504 1.00 49.89  ? 74   ALA A CA  1 
ATOM   543   C  C   . ALA A  1 74  ? 60.641  -19.981 -22.011 1.00 51.74  ? 74   ALA A C   1 
ATOM   544   O  O   . ALA A  1 74  ? 60.570  -19.764 -23.220 1.00 54.77  ? 74   ALA A O   1 
ATOM   545   C  CB  . ALA A  1 74  ? 62.818  -21.075 -21.499 1.00 47.26  ? 74   ALA A CB  1 
ATOM   546   N  N   . PHE A  1 75  ? 60.147  -19.149 -21.100 1.00 50.46  ? 75   PHE A N   1 
ATOM   547   C  CA  . PHE A  1 75  ? 59.533  -17.891 -21.511 1.00 50.48  ? 75   PHE A CA  1 
ATOM   548   C  C   . PHE A  1 75  ? 59.763  -16.769 -20.508 1.00 54.11  ? 75   PHE A C   1 
ATOM   549   O  O   . PHE A  1 75  ? 60.364  -16.975 -19.449 1.00 55.07  ? 75   PHE A O   1 
ATOM   550   C  CB  . PHE A  1 75  ? 58.033  -18.074 -21.755 1.00 47.81  ? 75   PHE A CB  1 
ATOM   551   C  CG  . PHE A  1 75  ? 57.259  -18.507 -20.534 1.00 45.99  ? 75   PHE A CG  1 
ATOM   552   C  CD1 . PHE A  1 75  ? 56.957  -19.844 -20.323 1.00 43.90  ? 75   PHE A CD1 1 
ATOM   553   C  CD2 . PHE A  1 75  ? 56.815  -17.573 -19.608 1.00 46.13  ? 75   PHE A CD2 1 
ATOM   554   C  CE1 . PHE A  1 75  ? 56.235  -20.244 -19.206 1.00 43.05  ? 75   PHE A CE1 1 
ATOM   555   C  CE2 . PHE A  1 75  ? 56.089  -17.968 -18.486 1.00 45.47  ? 75   PHE A CE2 1 
ATOM   556   C  CZ  . PHE A  1 75  ? 55.800  -19.308 -18.289 1.00 43.24  ? 75   PHE A CZ  1 
ATOM   557   N  N   . MET A  1 76  ? 59.266  -15.582 -20.845 1.00 53.63  ? 76   MET A N   1 
ATOM   558   C  CA  . MET A  1 76  ? 59.444  -14.411 -20.001 1.00 54.15  ? 76   MET A CA  1 
ATOM   559   C  C   . MET A  1 76  ? 58.111  -13.832 -19.576 1.00 58.60  ? 76   MET A C   1 
ATOM   560   O  O   . MET A  1 76  ? 57.105  -14.004 -20.270 1.00 60.39  ? 76   MET A O   1 
ATOM   561   C  CB  . MET A  1 76  ? 60.218  -13.333 -20.750 1.00 54.93  ? 76   MET A CB  1 
ATOM   562   C  CG  . MET A  1 76  ? 61.661  -13.666 -21.022 1.00 57.39  ? 76   MET A CG  1 
ATOM   563   S  SD  . MET A  1 76  ? 62.758  -12.784 -19.900 1.00 98.40  ? 76   MET A SD  1 
ATOM   564   C  CE  . MET A  1 76  ? 64.150  -12.509 -20.990 1.00 82.95  ? 76   MET A CE  1 
ATOM   565   N  N   . ARG A  1 77  ? 58.113  -13.158 -18.428 1.00 60.41  ? 77   ARG A N   1 
ATOM   566   C  CA  . ARG A  1 77  ? 57.011  -12.301 -18.010 1.00 61.02  ? 77   ARG A CA  1 
ATOM   567   C  C   . ARG A  1 77  ? 57.603  -11.034 -17.426 1.00 65.91  ? 77   ARG A C   1 
ATOM   568   O  O   . ARG A  1 77  ? 58.456  -11.096 -16.542 1.00 66.17  ? 77   ARG A O   1 
ATOM   569   C  CB  . ARG A  1 77  ? 56.117  -12.989 -16.984 1.00 58.21  ? 77   ARG A CB  1 
ATOM   570   C  CG  . ARG A  1 77  ? 55.077  -13.895 -17.596 1.00 57.34  ? 77   ARG A CG  1 
ATOM   571   C  CD  . ARG A  1 77  ? 54.137  -14.463 -16.544 1.00 56.96  ? 77   ARG A CD  1 
ATOM   572   N  NE  . ARG A  1 77  ? 53.222  -15.448 -17.118 1.00 56.96  ? 77   ARG A NE  1 
ATOM   573   C  CZ  . ARG A  1 77  ? 53.120  -16.709 -16.704 1.00 56.67  ? 77   ARG A CZ  1 
ATOM   574   N  NH1 . ARG A  1 77  ? 53.868  -17.145 -15.696 1.00 54.35  ? 77   ARG A NH1 1 
ATOM   575   N  NH2 . ARG A  1 77  ? 52.261  -17.533 -17.292 1.00 57.24  ? 77   ARG A NH2 1 
ATOM   576   N  N   . PHE A  1 78  ? 57.148  -9.886  -17.917 1.00 70.97  ? 78   PHE A N   1 
ATOM   577   C  CA  . PHE A  1 78  ? 57.754  -8.606  -17.556 1.00 74.33  ? 78   PHE A CA  1 
ATOM   578   C  C   . PHE A  1 78  ? 56.919  -7.828  -16.540 1.00 74.27  ? 78   PHE A C   1 
ATOM   579   O  O   . PHE A  1 78  ? 55.882  -8.321  -16.083 1.00 73.17  ? 78   PHE A O   1 
ATOM   580   C  CB  . PHE A  1 78  ? 58.016  -7.762  -18.808 1.00 76.50  ? 78   PHE A CB  1 
ATOM   581   C  CG  . PHE A  1 78  ? 59.056  -8.349  -19.734 1.00 79.36  ? 78   PHE A CG  1 
ATOM   582   C  CD1 . PHE A  1 78  ? 58.714  -9.323  -20.664 1.00 79.95  ? 78   PHE A CD1 1 
ATOM   583   C  CD2 . PHE A  1 78  ? 60.377  -7.917  -19.676 1.00 80.39  ? 78   PHE A CD2 1 
ATOM   584   C  CE1 . PHE A  1 78  ? 59.677  -9.857  -21.515 1.00 80.27  ? 78   PHE A CE1 1 
ATOM   585   C  CE2 . PHE A  1 78  ? 61.344  -8.448  -20.524 1.00 79.98  ? 78   PHE A CE2 1 
ATOM   586   C  CZ  . PHE A  1 78  ? 60.994  -9.417  -21.442 1.00 79.75  ? 78   PHE A CZ  1 
ATOM   587   N  N   . ASN A  1 79  ? 57.384  -6.624  -16.191 1.00 74.64  ? 79   ASN A N   1 
ATOM   588   C  CA  . ASN A  1 79  ? 56.743  -5.786  -15.170 1.00 74.25  ? 79   ASN A CA  1 
ATOM   589   C  C   . ASN A  1 79  ? 55.931  -6.583  -14.144 1.00 73.77  ? 79   ASN A C   1 
ATOM   590   O  O   . ASN A  1 79  ? 55.251  -6.012  -13.290 1.00 72.65  ? 79   ASN A O   1 
ATOM   591   C  CB  . ASN A  1 79  ? 55.872  -4.702  -15.818 1.00 73.00  ? 79   ASN A CB  1 
ATOM   592   N  N   . THR A  1 84  ? 59.467  -5.966  -12.769 1.00 75.81  ? 84   THR A N   1 
ATOM   593   C  CA  . THR A  1 84  ? 60.717  -6.587  -13.201 1.00 77.79  ? 84   THR A CA  1 
ATOM   594   C  C   . THR A  1 84  ? 60.475  -7.906  -13.947 1.00 75.15  ? 84   THR A C   1 
ATOM   595   O  O   . THR A  1 84  ? 59.493  -8.603  -13.686 1.00 78.18  ? 84   THR A O   1 
ATOM   596   C  CB  . THR A  1 84  ? 61.651  -6.840  -12.002 1.00 81.38  ? 84   THR A CB  1 
ATOM   597   O  OG1 . THR A  1 84  ? 62.883  -7.415  -12.460 1.00 83.44  ? 84   THR A OG1 1 
ATOM   598   C  CG2 . THR A  1 84  ? 60.989  -7.779  -10.998 1.00 82.27  ? 84   THR A CG2 1 
ATOM   599   N  N   . ALA A  1 85  ? 61.381  -8.245  -14.863 1.00 67.81  ? 85   ALA A N   1 
ATOM   600   C  CA  . ALA A  1 85  ? 61.236  -9.430  -15.709 1.00 62.47  ? 85   ALA A CA  1 
ATOM   601   C  C   . ALA A  1 85  ? 61.702  -10.719 -15.041 1.00 57.37  ? 85   ALA A C   1 
ATOM   602   O  O   . ALA A  1 85  ? 62.712  -10.739 -14.347 1.00 57.34  ? 85   ALA A O   1 
ATOM   603   C  CB  . ALA A  1 85  ? 61.973  -9.230  -17.023 1.00 63.58  ? 85   ALA A CB  1 
ATOM   604   N  N   . GLN A  1 86  ? 60.971  -11.802 -15.277 1.00 53.78  ? 86   GLN A N   1 
ATOM   605   C  CA  . GLN A  1 86  ? 61.293  -13.087 -14.673 1.00 52.72  ? 86   GLN A CA  1 
ATOM   606   C  C   . GLN A  1 86  ? 61.297  -14.197 -15.717 1.00 50.31  ? 86   GLN A C   1 
ATOM   607   O  O   . GLN A  1 86  ? 60.432  -14.231 -16.596 1.00 50.88  ? 86   GLN A O   1 
ATOM   608   C  CB  . GLN A  1 86  ? 60.301  -13.404 -13.547 1.00 54.38  ? 86   GLN A CB  1 
ATOM   609   C  CG  . GLN A  1 86  ? 58.851  -13.407 -13.991 1.00 57.28  ? 86   GLN A CG  1 
ATOM   610   C  CD  . GLN A  1 86  ? 57.880  -13.066 -12.872 1.00 59.24  ? 86   GLN A CD  1 
ATOM   611   O  OE1 . GLN A  1 86  ? 56.681  -13.354 -12.964 1.00 57.30  ? 86   GLN A OE1 1 
ATOM   612   N  NE2 . GLN A  1 86  ? 58.391  -12.440 -11.814 1.00 58.70  ? 86   GLN A NE2 1 
ATOM   613   N  N   . ILE A  1 87  ? 62.273  -15.098 -15.620 1.00 46.52  ? 87   ILE A N   1 
ATOM   614   C  CA  . ILE A  1 87  ? 62.363  -16.229 -16.537 1.00 43.66  ? 87   ILE A CA  1 
ATOM   615   C  C   . ILE A  1 87  ? 61.641  -17.465 -16.014 1.00 44.36  ? 87   ILE A C   1 
ATOM   616   O  O   . ILE A  1 87  ? 61.909  -17.931 -14.912 1.00 45.63  ? 87   ILE A O   1 
ATOM   617   C  CB  . ILE A  1 87  ? 63.817  -16.637 -16.805 1.00 41.85  ? 87   ILE A CB  1 
ATOM   618   C  CG1 . ILE A  1 87  ? 64.618  -15.468 -17.372 1.00 42.14  ? 87   ILE A CG1 1 
ATOM   619   C  CG2 . ILE A  1 87  ? 63.855  -17.806 -17.772 1.00 40.42  ? 87   ILE A CG2 1 
ATOM   620   C  CD1 . ILE A  1 87  ? 66.064  -15.812 -17.683 1.00 41.56  ? 87   ILE A CD1 1 
ATOM   621   N  N   . TRP A  1 88  ? 60.759  -18.020 -16.835 1.00 45.06  ? 88   TRP A N   1 
ATOM   622   C  CA  . TRP A  1 88  ? 60.035  -19.233 -16.481 1.00 47.15  ? 88   TRP A CA  1 
ATOM   623   C  C   . TRP A  1 88  ? 60.423  -20.402 -17.376 1.00 49.65  ? 88   TRP A C   1 
ATOM   624   O  O   . TRP A  1 88  ? 60.900  -20.223 -18.503 1.00 49.90  ? 88   TRP A O   1 
ATOM   625   C  CB  . TRP A  1 88  ? 58.534  -19.025 -16.620 1.00 48.56  ? 88   TRP A CB  1 
ATOM   626   C  CG  . TRP A  1 88  ? 57.937  -18.110 -15.628 1.00 51.82  ? 88   TRP A CG  1 
ATOM   627   C  CD1 . TRP A  1 88  ? 58.081  -16.759 -15.573 1.00 52.17  ? 88   TRP A CD1 1 
ATOM   628   C  CD2 . TRP A  1 88  ? 57.061  -18.466 -14.559 1.00 54.36  ? 88   TRP A CD2 1 
ATOM   629   N  NE1 . TRP A  1 88  ? 57.361  -16.251 -14.525 1.00 52.36  ? 88   TRP A NE1 1 
ATOM   630   C  CE2 . TRP A  1 88  ? 56.725  -17.280 -13.885 1.00 54.07  ? 88   TRP A CE2 1 
ATOM   631   C  CE3 . TRP A  1 88  ? 56.533  -19.678 -14.100 1.00 57.51  ? 88   TRP A CE3 1 
ATOM   632   C  CZ2 . TRP A  1 88  ? 55.888  -17.265 -12.777 1.00 57.64  ? 88   TRP A CZ2 1 
ATOM   633   C  CZ3 . TRP A  1 88  ? 55.700  -19.663 -12.999 1.00 58.51  ? 88   TRP A CZ3 1 
ATOM   634   C  CH2 . TRP A  1 88  ? 55.385  -18.464 -12.349 1.00 59.28  ? 88   TRP A CH2 1 
ATOM   635   N  N   . VAL A  1 89  ? 60.230  -21.604 -16.852 1.00 50.52  ? 89   VAL A N   1 
ATOM   636   C  CA  . VAL A  1 89  ? 60.315  -22.809 -17.656 1.00 51.27  ? 89   VAL A CA  1 
ATOM   637   C  C   . VAL A  1 89  ? 59.057  -23.638 -17.458 1.00 52.56  ? 89   VAL A C   1 
ATOM   638   O  O   . VAL A  1 89  ? 58.690  -23.964 -16.327 1.00 54.40  ? 89   VAL A O   1 
ATOM   639   C  CB  . VAL A  1 89  ? 61.512  -23.670 -17.258 1.00 50.81  ? 89   VAL A CB  1 
ATOM   640   C  CG1 . VAL A  1 89  ? 61.444  -25.000 -17.977 1.00 52.93  ? 89   VAL A CG1 1 
ATOM   641   C  CG2 . VAL A  1 89  ? 62.811  -22.950 -17.575 1.00 49.07  ? 89   VAL A CG2 1 
ATOM   642   N  N   . ALA A  1 90  ? 58.395  -23.981 -18.556 1.00 51.28  ? 90   ALA A N   1 
ATOM   643   C  CA  . ALA A  1 90  ? 57.237  -24.858 -18.484 1.00 49.35  ? 90   ALA A CA  1 
ATOM   644   C  C   . ALA A  1 90  ? 57.505  -26.163 -19.213 1.00 51.04  ? 90   ALA A C   1 
ATOM   645   O  O   . ALA A  1 90  ? 58.247  -26.202 -20.195 1.00 48.11  ? 90   ALA A O   1 
ATOM   646   C  CB  . ALA A  1 90  ? 56.021  -24.179 -19.063 1.00 47.10  ? 90   ALA A CB  1 
ATOM   647   N  N   . ASP A  1 91  ? 56.905  -27.236 -18.716 1.00 55.73  ? 91   ASP A N   1 
ATOM   648   C  CA  . ASP A  1 91  ? 56.930  -28.509 -19.415 1.00 59.95  ? 91   ASP A CA  1 
ATOM   649   C  C   . ASP A  1 91  ? 55.840  -28.505 -20.490 1.00 60.77  ? 91   ASP A C   1 
ATOM   650   O  O   . ASP A  1 91  ? 54.695  -28.138 -20.231 1.00 56.31  ? 91   ASP A O   1 
ATOM   651   C  CB  . ASP A  1 91  ? 56.759  -29.665 -18.427 1.00 63.54  ? 91   ASP A CB  1 
ATOM   652   C  CG  . ASP A  1 91  ? 55.513  -30.473 -18.681 1.00 68.17  ? 91   ASP A CG  1 
ATOM   653   O  OD1 . ASP A  1 91  ? 55.545  -31.342 -19.574 1.00 72.74  ? 91   ASP A OD1 1 
ATOM   654   O  OD2 . ASP A  1 91  ? 54.505  -30.248 -17.983 1.00 68.43  ? 91   ASP A OD2 1 
ATOM   655   N  N   . LEU A  1 92  ? 56.209  -28.898 -21.703 1.00 65.88  ? 92   LEU A N   1 
ATOM   656   C  CA  . LEU A  1 92  ? 55.325  -28.747 -22.856 1.00 67.99  ? 92   LEU A CA  1 
ATOM   657   C  C   . LEU A  1 92  ? 54.076  -29.626 -22.847 1.00 68.36  ? 92   LEU A C   1 
ATOM   658   O  O   . LEU A  1 92  ? 53.058  -29.254 -23.431 1.00 67.65  ? 92   LEU A O   1 
ATOM   659   C  CB  . LEU A  1 92  ? 56.101  -28.955 -24.154 1.00 69.65  ? 92   LEU A CB  1 
ATOM   660   C  CG  . LEU A  1 92  ? 56.699  -27.678 -24.736 1.00 70.80  ? 92   LEU A CG  1 
ATOM   661   C  CD1 . LEU A  1 92  ? 57.748  -27.995 -25.789 1.00 72.17  ? 92   LEU A CD1 1 
ATOM   662   C  CD2 . LEU A  1 92  ? 55.593  -26.811 -25.311 1.00 70.26  ? 92   LEU A CD2 1 
ATOM   663   N  N   . LYS A  1 93  ? 54.148  -30.799 -22.223 1.00 68.57  ? 93   LYS A N   1 
ATOM   664   C  CA  . LYS A  1 93  ? 52.968  -31.657 -22.167 1.00 66.48  ? 93   LYS A CA  1 
ATOM   665   C  C   . LYS A  1 93  ? 51.819  -31.021 -21.381 1.00 66.23  ? 93   LYS A C   1 
ATOM   666   O  O   . LYS A  1 93  ? 50.745  -30.784 -21.937 1.00 67.12  ? 93   LYS A O   1 
ATOM   667   C  CB  . LYS A  1 93  ? 53.317  -33.030 -21.579 1.00 64.35  ? 93   LYS A CB  1 
ATOM   668   N  N   . THR A  1 94  ? 52.047  -30.746 -20.095 1.00 64.83  ? 94   THR A N   1 
ATOM   669   C  CA  . THR A  1 94  ? 51.046  -30.083 -19.242 1.00 63.62  ? 94   THR A CA  1 
ATOM   670   C  C   . THR A  1 94  ? 51.015  -28.559 -19.332 1.00 61.72  ? 94   THR A C   1 
ATOM   671   O  O   . THR A  1 94  ? 49.964  -27.947 -19.158 1.00 62.62  ? 94   THR A O   1 
ATOM   672   C  CB  . THR A  1 94  ? 51.153  -30.479 -17.757 1.00 63.61  ? 94   THR A CB  1 
ATOM   673   O  OG1 . THR A  1 94  ? 52.162  -29.685 -17.121 1.00 63.00  ? 94   THR A OG1 1 
ATOM   674   C  CG2 . THR A  1 94  ? 51.469  -31.963 -17.605 1.00 64.98  ? 94   THR A CG2 1 
ATOM   675   N  N   . LEU A  1 95  ? 52.178  -27.955 -19.561 1.00 59.67  ? 95   LEU A N   1 
ATOM   676   C  CA  . LEU A  1 95  ? 52.316  -26.498 -19.509 1.00 57.19  ? 95   LEU A CA  1 
ATOM   677   C  C   . LEU A  1 95  ? 52.462  -25.953 -18.086 1.00 56.21  ? 95   LEU A C   1 
ATOM   678   O  O   . LEU A  1 95  ? 52.591  -24.747 -17.888 1.00 55.47  ? 95   LEU A O   1 
ATOM   679   C  CB  . LEU A  1 95  ? 51.219  -25.774 -20.298 1.00 55.32  ? 95   LEU A CB  1 
ATOM   680   C  CG  . LEU A  1 95  ? 51.590  -25.626 -21.777 1.00 53.89  ? 95   LEU A CG  1 
ATOM   681   C  CD1 . LEU A  1 95  ? 50.614  -24.734 -22.538 1.00 52.74  ? 95   LEU A CD1 1 
ATOM   682   C  CD2 . LEU A  1 95  ? 53.009  -25.090 -21.884 1.00 53.47  ? 95   LEU A CD2 1 
ATOM   683   N  N   . SER A  1 96  ? 52.404  -26.842 -17.100 1.00 57.05  ? 96   SER A N   1 
ATOM   684   C  CA  . SER A  1 96  ? 52.750  -26.470 -15.734 1.00 58.73  ? 96   SER A CA  1 
ATOM   685   C  C   . SER A  1 96  ? 54.139  -25.846 -15.750 1.00 58.03  ? 96   SER A C   1 
ATOM   686   O  O   . SER A  1 96  ? 55.021  -26.309 -16.473 1.00 58.69  ? 96   SER A O   1 
ATOM   687   C  CB  . SER A  1 96  ? 52.729  -27.692 -14.811 1.00 61.77  ? 96   SER A CB  1 
ATOM   688   O  OG  . SER A  1 96  ? 53.770  -28.602 -15.132 1.00 64.94  ? 96   SER A OG  1 
ATOM   689   N  N   . ALA A  1 97  ? 54.332  -24.786 -14.973 1.00 56.70  ? 97   ALA A N   1 
ATOM   690   C  CA  . ALA A  1 97  ? 55.584  -24.040 -15.031 1.00 56.02  ? 97   ALA A CA  1 
ATOM   691   C  C   . ALA A  1 97  ? 56.120  -23.631 -13.666 1.00 54.90  ? 97   ALA A C   1 
ATOM   692   O  O   . ALA A  1 97  ? 55.373  -23.510 -12.701 1.00 54.48  ? 97   ALA A O   1 
ATOM   693   C  CB  . ALA A  1 97  ? 55.416  -22.812 -15.910 1.00 55.99  ? 97   ALA A CB  1 
ATOM   694   N  N   . LYS A  1 98  ? 57.428  -23.409 -13.600 1.00 54.28  ? 98   LYS A N   1 
ATOM   695   C  CA  . LYS A  1 98  ? 58.057  -22.887 -12.396 1.00 51.62  ? 98   LYS A CA  1 
ATOM   696   C  C   . LYS A  1 98  ? 58.913  -21.670 -12.736 1.00 52.05  ? 98   LYS A C   1 
ATOM   697   O  O   . LYS A  1 98  ? 59.547  -21.613 -13.797 1.00 48.75  ? 98   LYS A O   1 
ATOM   698   C  CB  . LYS A  1 98  ? 58.919  -23.958 -11.722 1.00 50.25  ? 98   LYS A CB  1 
ATOM   699   C  CG  . LYS A  1 98  ? 60.161  -24.334 -12.508 1.00 47.94  ? 98   LYS A CG  1 
ATOM   700   C  CD  . LYS A  1 98  ? 61.088  -25.264 -11.746 1.00 46.17  ? 98   LYS A CD  1 
ATOM   701   C  CE  . LYS A  1 98  ? 62.356  -25.496 -12.555 1.00 48.69  ? 98   LYS A CE  1 
ATOM   702   N  NZ  . LYS A  1 98  ? 63.301  -26.462 -11.940 1.00 51.01  ? 98   LYS A NZ  1 
ATOM   703   N  N   . LYS A  1 99  ? 58.910  -20.692 -11.835 1.00 54.26  ? 99   LYS A N   1 
ATOM   704   C  CA  . LYS A  1 99  ? 59.729  -19.495 -11.981 1.00 55.13  ? 99   LYS A CA  1 
ATOM   705   C  C   . LYS A  1 99  ? 61.196  -19.870 -11.750 1.00 54.62  ? 99   LYS A C   1 
ATOM   706   O  O   . LYS A  1 99  ? 61.523  -20.528 -10.770 1.00 53.09  ? 99   LYS A O   1 
ATOM   707   C  CB  . LYS A  1 99  ? 59.261  -18.438 -10.974 1.00 56.89  ? 99   LYS A CB  1 
ATOM   708   C  CG  . LYS A  1 99  ? 59.512  -16.984 -11.367 1.00 59.01  ? 99   LYS A CG  1 
ATOM   709   C  CD  . LYS A  1 99  ? 60.915  -16.518 -10.995 1.00 60.21  ? 99   LYS A CD  1 
ATOM   710   N  N   . VAL A  1 100 ? 62.077  -19.472 -12.660 1.00 55.53  ? 100  VAL A N   1 
ATOM   711   C  CA  . VAL A  1 100 ? 63.478  -19.879 -12.578 1.00 57.16  ? 100  VAL A CA  1 
ATOM   712   C  C   . VAL A  1 100 ? 64.406  -18.782 -12.070 1.00 61.60  ? 100  VAL A C   1 
ATOM   713   O  O   . VAL A  1 100 ? 65.035  -18.932 -11.028 1.00 66.02  ? 100  VAL A O   1 
ATOM   714   C  CB  . VAL A  1 100 ? 64.004  -20.387 -13.926 1.00 56.47  ? 100  VAL A CB  1 
ATOM   715   C  CG1 . VAL A  1 100 ? 65.490  -20.697 -13.827 1.00 56.22  ? 100  VAL A CG1 1 
ATOM   716   C  CG2 . VAL A  1 100 ? 63.229  -21.612 -14.366 1.00 57.50  ? 100  VAL A CG2 1 
ATOM   717   N  N   . LEU A  1 101 ? 64.522  -17.697 -12.827 1.00 62.72  ? 101  LEU A N   1 
ATOM   718   C  CA  . LEU A  1 101 ? 65.342  -16.567 -12.402 1.00 63.93  ? 101  LEU A CA  1 
ATOM   719   C  C   . LEU A  1 101 ? 64.643  -15.225 -12.603 1.00 66.78  ? 101  LEU A C   1 
ATOM   720   O  O   . LEU A  1 101 ? 64.008  -14.984 -13.626 1.00 67.28  ? 101  LEU A O   1 
ATOM   721   C  CB  . LEU A  1 101 ? 66.680  -16.553 -13.139 1.00 63.22  ? 101  LEU A CB  1 
ATOM   722   C  CG  . LEU A  1 101 ? 67.684  -15.570 -12.533 1.00 62.18  ? 101  LEU A CG  1 
ATOM   723   C  CD1 . LEU A  1 101 ? 68.291  -16.165 -11.273 1.00 63.43  ? 101  LEU A CD1 1 
ATOM   724   C  CD2 . LEU A  1 101 ? 68.773  -15.198 -13.518 1.00 59.96  ? 101  LEU A CD2 1 
ATOM   725   N  N   . GLU A  1 102 ? 64.778  -14.347 -11.619 1.00 69.74  ? 102  GLU A N   1 
ATOM   726   C  CA  . GLU A  1 102 ? 64.195  -13.021 -11.705 1.00 72.95  ? 102  GLU A CA  1 
ATOM   727   C  C   . GLU A  1 102 ? 65.294  -12.035 -12.037 1.00 74.24  ? 102  GLU A C   1 
ATOM   728   O  O   . GLU A  1 102 ? 66.171  -11.789 -11.213 1.00 75.29  ? 102  GLU A O   1 
ATOM   729   C  CB  . GLU A  1 102 ? 63.563  -12.646 -10.371 1.00 76.32  ? 102  GLU A CB  1 
ATOM   730   C  CG  . GLU A  1 102 ? 62.662  -11.437 -10.448 1.00 80.47  ? 102  GLU A CG  1 
ATOM   731   C  CD  . GLU A  1 102 ? 61.287  -11.729 -9.904  1.00 84.08  ? 102  GLU A CD  1 
ATOM   732   O  OE1 . GLU A  1 102 ? 60.308  -11.113 -10.382 1.00 84.96  ? 102  GLU A OE1 1 
ATOM   733   O  OE2 . GLU A  1 102 ? 61.194  -12.584 -8.997  1.00 85.14  ? 102  GLU A OE2 1 
ATOM   734   N  N   . ALA A  1 103 ? 65.262  -11.483 -13.246 1.00 74.92  ? 103  ALA A N   1 
ATOM   735   C  CA  . ALA A  1 103 ? 66.331  -10.587 -13.678 1.00 75.35  ? 103  ALA A CA  1 
ATOM   736   C  C   . ALA A  1 103 ? 65.889  -9.369  -14.490 1.00 74.52  ? 103  ALA A C   1 
ATOM   737   O  O   . ALA A  1 103 ? 65.205  -9.490  -15.512 1.00 73.29  ? 103  ALA A O   1 
ATOM   738   C  CB  . ALA A  1 103 ? 67.385  -11.366 -14.441 1.00 76.34  ? 103  ALA A CB  1 
ATOM   739   N  N   . LYS A  1 104 ? 66.321  -8.196  -14.040 1.00 73.50  ? 104  LYS A N   1 
ATOM   740   C  CA  . LYS A  1 104 ? 66.177  -6.980  -14.822 1.00 71.11  ? 104  LYS A CA  1 
ATOM   741   C  C   . LYS A  1 104 ? 67.221  -6.991  -15.931 1.00 68.07  ? 104  LYS A C   1 
ATOM   742   O  O   . LYS A  1 104 ? 68.269  -7.624  -15.802 1.00 67.27  ? 104  LYS A O   1 
ATOM   743   C  CB  . LYS A  1 104 ? 66.377  -5.748  -13.937 1.00 69.87  ? 104  LYS A CB  1 
ATOM   744   N  N   . ASN A  1 105 ? 66.929  -6.294  -17.022 1.00 65.73  ? 105  ASN A N   1 
ATOM   745   C  CA  . ASN A  1 105 ? 67.914  -6.077  -18.079 1.00 62.89  ? 105  ASN A CA  1 
ATOM   746   C  C   . ASN A  1 105 ? 68.433  -7.332  -18.766 1.00 60.46  ? 105  ASN A C   1 
ATOM   747   O  O   . ASN A  1 105 ? 69.643  -7.504  -18.917 1.00 62.45  ? 105  ASN A O   1 
ATOM   748   C  CB  . ASN A  1 105 ? 69.102  -5.290  -17.530 1.00 62.45  ? 105  ASN A CB  1 
ATOM   749   C  CG  . ASN A  1 105 ? 68.682  -4.013  -16.851 1.00 61.68  ? 105  ASN A CG  1 
ATOM   750   O  OD1 . ASN A  1 105 ? 67.596  -3.491  -17.108 1.00 62.68  ? 105  ASN A OD1 1 
ATOM   751   N  ND2 . ASN A  1 105 ? 69.540  -3.495  -15.980 1.00 59.39  ? 105  ASN A ND2 1 
ATOM   752   N  N   . ILE A  1 106 ? 67.523  -8.207  -19.176 1.00 56.94  ? 106  ILE A N   1 
ATOM   753   C  CA  . ILE A  1 106 ? 67.892  -9.366  -19.972 1.00 55.75  ? 106  ILE A CA  1 
ATOM   754   C  C   . ILE A  1 106 ? 67.346  -9.179  -21.371 1.00 58.49  ? 106  ILE A C   1 
ATOM   755   O  O   . ILE A  1 106 ? 66.136  -9.198  -21.568 1.00 62.98  ? 106  ILE A O   1 
ATOM   756   C  CB  . ILE A  1 106 ? 67.271  -10.646 -19.414 1.00 54.21  ? 106  ILE A CB  1 
ATOM   757   C  CG1 . ILE A  1 106 ? 67.768  -10.908 -17.995 1.00 52.66  ? 106  ILE A CG1 1 
ATOM   758   C  CG2 . ILE A  1 106 ? 67.593  -11.819 -20.317 1.00 56.27  ? 106  ILE A CG2 1 
ATOM   759   C  CD1 . ILE A  1 106 ? 69.258  -10.996 -17.893 1.00 51.66  ? 106  ILE A CD1 1 
ATOM   760   N  N   . ARG A  1 107 ? 68.222  -8.958  -22.341 1.00 56.50  ? 107  ARG A N   1 
ATOM   761   C  CA  . ARG A  1 107 ? 67.763  -8.778  -23.712 1.00 56.88  ? 107  ARG A CA  1 
ATOM   762   C  C   . ARG A  1 107 ? 67.528  -10.070 -24.508 1.00 58.05  ? 107  ARG A C   1 
ATOM   763   O  O   . ARG A  1 107 ? 66.785  -10.062 -25.487 1.00 59.87  ? 107  ARG A O   1 
ATOM   764   C  CB  . ARG A  1 107 ? 68.694  -7.824  -24.469 1.00 60.24  ? 107  ARG A CB  1 
ATOM   765   C  CG  . ARG A  1 107 ? 68.720  -6.406  -23.899 1.00 62.82  ? 107  ARG A CG  1 
ATOM   766   C  CD  . ARG A  1 107 ? 69.527  -5.451  -24.766 1.00 64.49  ? 107  ARG A CD  1 
ATOM   767   N  NE  . ARG A  1 107 ? 69.446  -4.070  -24.292 1.00 66.00  ? 107  ARG A NE  1 
ATOM   768   C  CZ  . ARG A  1 107 ? 70.489  -3.363  -23.864 1.00 65.99  ? 107  ARG A CZ  1 
ATOM   769   N  NH1 . ARG A  1 107 ? 71.701  -3.905  -23.856 1.00 64.56  ? 107  ARG A NH1 1 
ATOM   770   N  NH2 . ARG A  1 107 ? 70.322  -2.112  -23.449 1.00 65.01  ? 107  ARG A NH2 1 
ATOM   771   N  N   . SER A  1 108 ? 68.157  -11.172 -24.105 1.00 57.71  ? 108  SER A N   1 
ATOM   772   C  CA  . SER A  1 108 ? 68.027  -12.423 -24.858 1.00 55.83  ? 108  SER A CA  1 
ATOM   773   C  C   . SER A  1 108 ? 68.221  -13.681 -24.013 1.00 56.32  ? 108  SER A C   1 
ATOM   774   O  O   . SER A  1 108 ? 69.020  -13.686 -23.076 1.00 58.91  ? 108  SER A O   1 
ATOM   775   C  CB  . SER A  1 108 ? 69.027  -12.445 -26.010 1.00 55.45  ? 108  SER A CB  1 
ATOM   776   O  OG  . SER A  1 108 ? 70.350  -12.530 -25.511 1.00 56.25  ? 108  SER A OG  1 
ATOM   777   N  N   . ILE A  1 109 ? 67.510  -14.752 -24.367 1.00 54.18  ? 109  ILE A N   1 
ATOM   778   C  CA  . ILE A  1 109 ? 67.734  -16.069 -23.765 1.00 51.49  ? 109  ILE A CA  1 
ATOM   779   C  C   . ILE A  1 109 ? 67.706  -17.173 -24.817 1.00 52.77  ? 109  ILE A C   1 
ATOM   780   O  O   . ILE A  1 109 ? 66.818  -17.214 -25.672 1.00 50.84  ? 109  ILE A O   1 
ATOM   781   C  CB  . ILE A  1 109 ? 66.711  -16.421 -22.659 1.00 46.39  ? 109  ILE A CB  1 
ATOM   782   C  CG1 . ILE A  1 109 ? 65.291  -16.439 -23.223 1.00 44.77  ? 109  ILE A CG1 1 
ATOM   783   C  CG2 . ILE A  1 109 ? 66.825  -15.461 -21.493 1.00 45.40  ? 109  ILE A CG2 1 
ATOM   784   C  CD1 . ILE A  1 109 ? 64.336  -17.259 -22.393 1.00 45.40  ? 109  ILE A CD1 1 
ATOM   785   N  N   . GLU A  1 110 ? 68.678  -18.075 -24.726 1.00 56.28  ? 110  GLU A N   1 
ATOM   786   C  CA  . GLU A  1 110 ? 68.865  -19.143 -25.700 1.00 58.40  ? 110  GLU A CA  1 
ATOM   787   C  C   . GLU A  1 110 ? 69.278  -20.447 -25.000 1.00 56.31  ? 110  GLU A C   1 
ATOM   788   O  O   . GLU A  1 110 ? 70.157  -20.444 -24.135 1.00 55.89  ? 110  GLU A O   1 
ATOM   789   C  CB  . GLU A  1 110 ? 69.926  -18.707 -26.714 1.00 63.22  ? 110  GLU A CB  1 
ATOM   790   C  CG  . GLU A  1 110 ? 70.404  -19.796 -27.658 1.00 71.02  ? 110  GLU A CG  1 
ATOM   791   C  CD  . GLU A  1 110 ? 71.708  -19.432 -28.361 1.00 75.43  ? 110  GLU A CD  1 
ATOM   792   O  OE1 . GLU A  1 110 ? 72.383  -18.478 -27.911 1.00 75.81  ? 110  GLU A OE1 1 
ATOM   793   O  OE2 . GLU A  1 110 ? 72.056  -20.102 -29.360 1.00 77.38  ? 110  GLU A OE2 1 
ATOM   794   N  N   . TRP A  1 111 ? 68.634  -21.554 -25.365 1.00 54.73  ? 111  TRP A N   1 
ATOM   795   C  CA  . TRP A  1 111 ? 68.961  -22.871 -24.811 1.00 53.34  ? 111  TRP A CA  1 
ATOM   796   C  C   . TRP A  1 111 ? 70.336  -23.400 -25.243 1.00 53.40  ? 111  TRP A C   1 
ATOM   797   O  O   . TRP A  1 111 ? 70.827  -23.092 -26.329 1.00 52.04  ? 111  TRP A O   1 
ATOM   798   C  CB  . TRP A  1 111 ? 67.923  -23.900 -25.248 1.00 52.99  ? 111  TRP A CB  1 
ATOM   799   C  CG  . TRP A  1 111 ? 66.613  -23.855 -24.531 1.00 53.81  ? 111  TRP A CG  1 
ATOM   800   C  CD1 . TRP A  1 111 ? 65.416  -23.441 -25.037 1.00 52.54  ? 111  TRP A CD1 1 
ATOM   801   C  CD2 . TRP A  1 111 ? 66.358  -24.276 -23.189 1.00 55.67  ? 111  TRP A CD2 1 
ATOM   802   N  NE1 . TRP A  1 111 ? 64.432  -23.567 -24.089 1.00 51.06  ? 111  TRP A NE1 1 
ATOM   803   C  CE2 . TRP A  1 111 ? 64.984  -24.076 -22.943 1.00 54.18  ? 111  TRP A CE2 1 
ATOM   804   C  CE3 . TRP A  1 111 ? 67.158  -24.797 -22.168 1.00 58.83  ? 111  TRP A CE3 1 
ATOM   805   C  CZ2 . TRP A  1 111 ? 64.392  -24.376 -21.715 1.00 56.22  ? 111  TRP A CZ2 1 
ATOM   806   C  CZ3 . TRP A  1 111 ? 66.568  -25.094 -20.946 1.00 60.51  ? 111  TRP A CZ3 1 
ATOM   807   C  CH2 . TRP A  1 111 ? 65.199  -24.882 -20.732 1.00 58.34  ? 111  TRP A CH2 1 
ATOM   808   N  N   . ASN A  1 112 ? 70.940  -24.219 -24.390 1.00 52.94  ? 112  ASN A N   1 
ATOM   809   C  CA  . ASN A  1 112 ? 72.112  -24.997 -24.766 1.00 52.20  ? 112  ASN A CA  1 
ATOM   810   C  C   . ASN A  1 112 ? 71.643  -26.341 -25.321 1.00 52.86  ? 112  ASN A C   1 
ATOM   811   O  O   . ASN A  1 112 ? 70.445  -26.612 -25.367 1.00 51.26  ? 112  ASN A O   1 
ATOM   812   C  CB  . ASN A  1 112 ? 73.016  -25.200 -23.545 1.00 53.20  ? 112  ASN A CB  1 
ATOM   813   C  CG  . ASN A  1 112 ? 74.238  -26.053 -23.843 1.00 53.11  ? 112  ASN A CG  1 
ATOM   814   O  OD1 . ASN A  1 112 ? 74.204  -27.279 -23.711 1.00 51.41  ? 112  ASN A OD1 1 
ATOM   815   N  ND2 . ASN A  1 112 ? 75.331  -25.405 -24.226 1.00 54.66  ? 112  ASN A ND2 1 
ATOM   816   N  N   . GLN A  1 113 ? 72.581  -27.182 -25.738 1.00 54.75  ? 113  GLN A N   1 
ATOM   817   C  CA  . GLN A  1 113 ? 72.243  -28.475 -26.324 1.00 56.22  ? 113  GLN A CA  1 
ATOM   818   C  C   . GLN A  1 113 ? 71.637  -29.412 -25.283 1.00 53.94  ? 113  GLN A C   1 
ATOM   819   O  O   . GLN A  1 113 ? 70.756  -30.221 -25.589 1.00 52.26  ? 113  GLN A O   1 
ATOM   820   C  CB  . GLN A  1 113 ? 73.487  -29.115 -26.954 1.00 58.25  ? 113  GLN A CB  1 
ATOM   821   N  N   . ASP A  1 114 ? 72.111  -29.291 -24.048 1.00 53.74  ? 114  ASP A N   1 
ATOM   822   C  CA  . ASP A  1 114 ? 71.720  -30.209 -22.982 1.00 56.21  ? 114  ASP A CA  1 
ATOM   823   C  C   . ASP A  1 114 ? 70.254  -30.095 -22.556 1.00 57.48  ? 114  ASP A C   1 
ATOM   824   O  O   . ASP A  1 114 ? 69.759  -30.924 -21.791 1.00 58.11  ? 114  ASP A O   1 
ATOM   825   C  CB  . ASP A  1 114 ? 72.654  -30.072 -21.769 1.00 58.99  ? 114  ASP A CB  1 
ATOM   826   C  CG  . ASP A  1 114 ? 72.748  -28.642 -21.244 1.00 60.74  ? 114  ASP A CG  1 
ATOM   827   O  OD1 . ASP A  1 114 ? 71.812  -27.845 -21.481 1.00 59.69  ? 114  ASP A OD1 1 
ATOM   828   O  OD2 . ASP A  1 114 ? 73.761  -28.323 -20.579 1.00 61.19  ? 114  ASP A OD2 1 
ATOM   829   N  N   . SER A  1 115 ? 69.567  -29.070 -23.054 1.00 58.57  ? 115  SER A N   1 
ATOM   830   C  CA  . SER A  1 115 ? 68.194  -28.785 -22.644 1.00 58.98  ? 115  SER A CA  1 
ATOM   831   C  C   . SER A  1 115 ? 68.140  -28.531 -21.140 1.00 60.25  ? 115  SER A C   1 
ATOM   832   O  O   . SER A  1 115 ? 67.112  -28.736 -20.492 1.00 61.99  ? 115  SER A O   1 
ATOM   833   C  CB  . SER A  1 115 ? 67.242  -29.921 -23.030 1.00 59.03  ? 115  SER A CB  1 
ATOM   834   O  OG  . SER A  1 115 ? 67.183  -30.097 -24.436 1.00 61.00  ? 115  SER A OG  1 
ATOM   835   N  N   . ARG A  1 116 ? 69.259  -28.074 -20.593 1.00 58.18  ? 116  ARG A N   1 
ATOM   836   C  CA  . ARG A  1 116 ? 69.332  -27.743 -19.182 1.00 56.50  ? 116  ARG A CA  1 
ATOM   837   C  C   . ARG A  1 116 ? 69.695  -26.283 -18.989 1.00 55.24  ? 116  ARG A C   1 
ATOM   838   O  O   . ARG A  1 116 ? 68.931  -25.527 -18.400 1.00 55.40  ? 116  ARG A O   1 
ATOM   839   C  CB  . ARG A  1 116 ? 70.331  -28.636 -18.451 1.00 58.17  ? 116  ARG A CB  1 
ATOM   840   C  CG  . ARG A  1 116 ? 70.462  -28.311 -16.971 1.00 59.94  ? 116  ARG A CG  1 
ATOM   841   C  CD  . ARG A  1 116 ? 71.160  -29.428 -16.234 1.00 61.95  ? 116  ARG A CD  1 
ATOM   842   N  NE  . ARG A  1 116 ? 71.169  -29.228 -14.790 1.00 63.12  ? 116  ARG A NE  1 
ATOM   843   C  CZ  . ARG A  1 116 ? 71.699  -30.095 -13.939 1.00 65.09  ? 116  ARG A CZ  1 
ATOM   844   N  NH1 . ARG A  1 116 ? 72.251  -31.207 -14.404 1.00 66.24  ? 116  ARG A NH1 1 
ATOM   845   N  NH2 . ARG A  1 116 ? 71.681  -29.858 -12.635 1.00 65.09  ? 116  ARG A NH2 1 
ATOM   846   N  N   . ARG A  1 117 ? 70.880  -25.901 -19.449 1.00 55.13  ? 117  ARG A N   1 
ATOM   847   C  CA  . ARG A  1 117 ? 71.358  -24.533 -19.285 1.00 56.65  ? 117  ARG A CA  1 
ATOM   848   C  C   . ARG A  1 117 ? 70.764  -23.533 -20.278 1.00 57.80  ? 117  ARG A C   1 
ATOM   849   O  O   . ARG A  1 117 ? 70.384  -23.889 -21.400 1.00 60.16  ? 117  ARG A O   1 
ATOM   850   C  CB  . ARG A  1 117 ? 72.879  -24.490 -19.376 1.00 58.61  ? 117  ARG A CB  1 
ATOM   851   C  CG  . ARG A  1 117 ? 73.585  -25.121 -18.199 1.00 60.69  ? 117  ARG A CG  1 
ATOM   852   C  CD  . ARG A  1 117 ? 75.058  -25.277 -18.505 1.00 62.57  ? 117  ARG A CD  1 
ATOM   853   N  NE  . ARG A  1 117 ? 75.284  -26.243 -19.576 1.00 63.45  ? 117  ARG A NE  1 
ATOM   854   C  CZ  . ARG A  1 117 ? 76.344  -26.233 -20.376 1.00 64.21  ? 117  ARG A CZ  1 
ATOM   855   N  NH1 . ARG A  1 117 ? 77.273  -25.295 -20.240 1.00 63.03  ? 117  ARG A NH1 1 
ATOM   856   N  NH2 . ARG A  1 117 ? 76.470  -27.156 -21.320 1.00 65.60  ? 117  ARG A NH2 1 
ATOM   857   N  N   . LEU A  1 118 ? 70.695  -22.277 -19.843 1.00 53.36  ? 118  LEU A N   1 
ATOM   858   C  CA  . LEU A  1 118 ? 70.304  -21.172 -20.700 1.00 49.01  ? 118  LEU A CA  1 
ATOM   859   C  C   . LEU A  1 118 ? 71.466  -20.210 -20.846 1.00 49.68  ? 118  LEU A C   1 
ATOM   860   O  O   . LEU A  1 118 ? 72.305  -20.091 -19.953 1.00 50.46  ? 118  LEU A O   1 
ATOM   861   C  CB  . LEU A  1 118 ? 69.134  -20.415 -20.090 1.00 46.46  ? 118  LEU A CB  1 
ATOM   862   C  CG  . LEU A  1 118 ? 67.739  -21.012 -20.223 1.00 46.84  ? 118  LEU A CG  1 
ATOM   863   C  CD1 . LEU A  1 118 ? 66.748  -20.241 -19.344 1.00 46.40  ? 118  LEU A CD1 1 
ATOM   864   C  CD2 . LEU A  1 118 ? 67.295  -21.024 -21.681 1.00 44.64  ? 118  LEU A CD2 1 
ATOM   865   N  N   . LEU A  1 119 ? 71.511  -19.519 -21.978 1.00 49.70  ? 119  LEU A N   1 
ATOM   866   C  CA  . LEU A  1 119 ? 72.414  -18.394 -22.130 1.00 49.48  ? 119  LEU A CA  1 
ATOM   867   C  C   . LEU A  1 119 ? 71.584  -17.131 -22.128 1.00 49.68  ? 119  LEU A C   1 
ATOM   868   O  O   . LEU A  1 119 ? 70.727  -16.947 -22.990 1.00 49.97  ? 119  LEU A O   1 
ATOM   869   C  CB  . LEU A  1 119 ? 73.208  -18.476 -23.434 1.00 49.96  ? 119  LEU A CB  1 
ATOM   870   C  CG  . LEU A  1 119 ? 74.104  -17.246 -23.640 1.00 51.30  ? 119  LEU A CG  1 
ATOM   871   C  CD1 . LEU A  1 119 ? 74.930  -16.971 -22.390 1.00 51.85  ? 119  LEU A CD1 1 
ATOM   872   C  CD2 . LEU A  1 119 ? 75.010  -17.385 -24.854 1.00 51.90  ? 119  LEU A CD2 1 
ATOM   873   N  N   . ALA A  1 120 ? 71.830  -16.259 -21.160 1.00 49.90  ? 120  ALA A N   1 
ATOM   874   C  CA  . ALA A  1 120 ? 71.144  -14.978 -21.141 1.00 51.81  ? 120  ALA A CA  1 
ATOM   875   C  C   . ALA A  1 120 ? 72.116  -13.822 -21.303 1.00 52.31  ? 120  ALA A C   1 
ATOM   876   O  O   . ALA A  1 120 ? 73.101  -13.715 -20.570 1.00 54.18  ? 120  ALA A O   1 
ATOM   877   C  CB  . ALA A  1 120 ? 70.341  -14.821 -19.869 1.00 53.03  ? 120  ALA A CB  1 
ATOM   878   N  N   . VAL A  1 121 ? 71.831  -12.958 -22.269 1.00 50.13  ? 121  VAL A N   1 
ATOM   879   C  CA  . VAL A  1 121 ? 72.617  -11.749 -22.463 1.00 47.53  ? 121  VAL A CA  1 
ATOM   880   C  C   . VAL A  1 121 ? 71.794  -10.566 -21.975 1.00 48.30  ? 121  VAL A C   1 
ATOM   881   O  O   . VAL A  1 121 ? 70.571  -10.567 -22.090 1.00 48.44  ? 121  VAL A O   1 
ATOM   882   C  CB  . VAL A  1 121 ? 73.025  -11.569 -23.930 1.00 44.14  ? 121  VAL A CB  1 
ATOM   883   C  CG1 . VAL A  1 121 ? 73.848  -10.299 -24.103 1.00 41.46  ? 121  VAL A CG1 1 
ATOM   884   C  CG2 . VAL A  1 121 ? 73.809  -12.791 -24.399 1.00 43.66  ? 121  VAL A CG2 1 
ATOM   885   N  N   . GLY A  1 122 ? 72.472  -9.557  -21.438 1.00 48.60  ? 122  GLY A N   1 
ATOM   886   C  CA  . GLY A  1 122 ? 71.821  -8.498  -20.691 1.00 49.23  ? 122  GLY A CA  1 
ATOM   887   C  C   . GLY A  1 122 ? 72.757  -7.319  -20.551 1.00 51.68  ? 122  GLY A C   1 
ATOM   888   O  O   . GLY A  1 122 ? 73.736  -7.213  -21.293 1.00 55.53  ? 122  GLY A O   1 
ATOM   889   N  N   . PHE A  1 123 ? 72.437  -6.402  -19.645 1.00 49.34  ? 123  PHE A N   1 
ATOM   890   C  CA  . PHE A  1 123 ? 73.316  -5.264  -19.399 1.00 48.54  ? 123  PHE A CA  1 
ATOM   891   C  C   . PHE A  1 123 ? 73.366  -4.825  -17.935 1.00 51.43  ? 123  PHE A C   1 
ATOM   892   O  O   . PHE A  1 123 ? 72.555  -5.256  -17.117 1.00 52.18  ? 123  PHE A O   1 
ATOM   893   C  CB  . PHE A  1 123 ? 72.938  -4.091  -20.297 1.00 45.84  ? 123  PHE A CB  1 
ATOM   894   C  CG  . PHE A  1 123 ? 71.510  -3.666  -20.169 1.00 47.05  ? 123  PHE A CG  1 
ATOM   895   C  CD1 . PHE A  1 123 ? 70.510  -4.347  -20.842 1.00 50.17  ? 123  PHE A CD1 1 
ATOM   896   C  CD2 . PHE A  1 123 ? 71.165  -2.575  -19.386 1.00 49.54  ? 123  PHE A CD2 1 
ATOM   897   C  CE1 . PHE A  1 123 ? 69.182  -3.948  -20.734 1.00 52.42  ? 123  PHE A CE1 1 
ATOM   898   C  CE2 . PHE A  1 123 ? 69.844  -2.168  -19.272 1.00 51.28  ? 123  PHE A CE2 1 
ATOM   899   C  CZ  . PHE A  1 123 ? 68.850  -2.856  -19.946 1.00 52.47  ? 123  PHE A CZ  1 
ATOM   900   N  N   . LYS A  1 124 ? 74.355  -3.995  -17.610 1.00 52.03  ? 124  LYS A N   1 
ATOM   901   C  CA  . LYS A  1 124 ? 74.475  -3.399  -16.285 1.00 50.32  ? 124  LYS A CA  1 
ATOM   902   C  C   . LYS A  1 124 ? 74.932  -1.956  -16.426 1.00 48.80  ? 124  LYS A C   1 
ATOM   903   O  O   . LYS A  1 124 ? 75.891  -1.681  -17.140 1.00 48.62  ? 124  LYS A O   1 
ATOM   904   C  CB  . LYS A  1 124 ? 75.476  -4.176  -15.424 1.00 49.79  ? 124  LYS A CB  1 
ATOM   905   N  N   . ARG A  1 125 ? 74.258  -1.039  -15.736 1.00 48.48  ? 125  ARG A N   1 
ATOM   906   C  CA  . ARG A  1 125 ? 74.625  0.374   -15.792 1.00 46.53  ? 125  ARG A CA  1 
ATOM   907   C  C   . ARG A  1 125 ? 74.980  0.901   -14.424 1.00 46.92  ? 125  ARG A C   1 
ATOM   908   O  O   . ARG A  1 125 ? 74.863  0.186   -13.432 1.00 48.51  ? 125  ARG A O   1 
ATOM   909   C  CB  . ARG A  1 125 ? 73.467  1.192   -16.335 1.00 45.09  ? 125  ARG A CB  1 
ATOM   910   C  CG  . ARG A  1 125 ? 72.985  0.688   -17.649 1.00 46.44  ? 125  ARG A CG  1 
ATOM   911   C  CD  . ARG A  1 125 ? 71.937  1.581   -18.226 1.00 46.24  ? 125  ARG A CD  1 
ATOM   912   N  NE  . ARG A  1 125 ? 71.682  1.189   -19.599 1.00 47.07  ? 125  ARG A NE  1 
ATOM   913   C  CZ  . ARG A  1 125 ? 70.583  1.504   -20.265 1.00 50.86  ? 125  ARG A CZ  1 
ATOM   914   N  NH1 . ARG A  1 125 ? 69.629  2.226   -19.682 1.00 51.15  ? 125  ARG A NH1 1 
ATOM   915   N  NH2 . ARG A  1 125 ? 70.441  1.093   -21.516 1.00 52.80  ? 125  ARG A NH2 1 
ATOM   916   N  N   . ARG A  1 126 ? 75.382  2.167   -14.368 1.00 44.79  ? 126  ARG A N   1 
ATOM   917   C  CA  . ARG A  1 126 ? 75.729  2.792   -13.096 1.00 43.94  ? 126  ARG A CA  1 
ATOM   918   C  C   . ARG A  1 126 ? 74.510  2.973   -12.171 1.00 48.85  ? 126  ARG A C   1 
ATOM   919   O  O   . ARG A  1 126 ? 74.615  2.773   -10.963 1.00 49.51  ? 126  ARG A O   1 
ATOM   920   C  CB  . ARG A  1 126 ? 76.475  4.107   -13.330 1.00 38.70  ? 126  ARG A CB  1 
ATOM   921   C  CG  . ARG A  1 126 ? 77.927  3.892   -13.721 1.00 38.83  ? 126  ARG A CG  1 
ATOM   922   C  CD  . ARG A  1 126 ? 78.621  5.179   -14.149 1.00 40.34  ? 126  ARG A CD  1 
ATOM   923   N  NE  . ARG A  1 126 ? 80.032  4.946   -14.455 1.00 44.83  ? 126  ARG A NE  1 
ATOM   924   C  CZ  . ARG A  1 126 ? 80.552  4.971   -15.682 1.00 51.40  ? 126  ARG A CZ  1 
ATOM   925   N  NH1 . ARG A  1 126 ? 81.848  4.741   -15.865 1.00 51.62  ? 126  ARG A NH1 1 
ATOM   926   N  NH2 . ARG A  1 126 ? 79.784  5.235   -16.732 1.00 55.31  ? 126  ARG A NH2 1 
ATOM   927   N  N   . GLU A  1 127 ? 73.367  3.342   -12.751 1.00 51.08  ? 127  GLU A N   1 
ATOM   928   C  CA  . GLU A  1 127 ? 72.070  3.383   -12.057 1.00 52.33  ? 127  GLU A CA  1 
ATOM   929   C  C   . GLU A  1 127 ? 71.898  4.394   -10.908 1.00 50.23  ? 127  GLU A C   1 
ATOM   930   O  O   . GLU A  1 127 ? 71.079  4.173   -10.014 1.00 50.30  ? 127  GLU A O   1 
ATOM   931   C  CB  . GLU A  1 127 ? 71.669  1.981   -11.572 1.00 56.71  ? 127  GLU A CB  1 
ATOM   932   C  CG  . GLU A  1 127 ? 71.661  0.894   -12.643 1.00 63.77  ? 127  GLU A CG  1 
ATOM   933   C  CD  . GLU A  1 127 ? 70.575  1.082   -13.694 1.00 69.77  ? 127  GLU A CD  1 
ATOM   934   O  OE1 . GLU A  1 127 ? 70.155  2.237   -13.923 1.00 73.28  ? 127  GLU A OE1 1 
ATOM   935   O  OE2 . GLU A  1 127 ? 70.141  0.069   -14.292 1.00 69.72  ? 127  GLU A OE2 1 
ATOM   936   N  N   . ASP A  1 128 ? 72.635  5.500   -10.926 1.00 47.38  ? 128  ASP A N   1 
ATOM   937   C  CA  . ASP A  1 128 ? 72.411  6.530   -9.914  1.00 46.66  ? 128  ASP A CA  1 
ATOM   938   C  C   . ASP A  1 128 ? 71.074  7.229   -10.146 1.00 47.40  ? 128  ASP A C   1 
ATOM   939   O  O   . ASP A  1 128 ? 70.739  7.593   -11.266 1.00 49.05  ? 128  ASP A O   1 
ATOM   940   C  CB  . ASP A  1 128 ? 73.537  7.561   -9.892  1.00 47.84  ? 128  ASP A CB  1 
ATOM   941   C  CG  . ASP A  1 128 ? 73.286  8.672   -8.885  1.00 50.05  ? 128  ASP A CG  1 
ATOM   942   O  OD1 . ASP A  1 128 ? 73.772  8.563   -7.739  1.00 48.31  ? 128  ASP A OD1 1 
ATOM   943   O  OD2 . ASP A  1 128 ? 72.593  9.652   -9.234  1.00 53.46  ? 128  ASP A OD2 1 
ATOM   944   N  N   . GLU A  1 129 ? 70.317  7.425   -9.074  1.00 47.97  ? 129  GLU A N   1 
ATOM   945   C  CA  . GLU A  1 129 ? 68.968  7.969   -9.179  1.00 45.21  ? 129  GLU A CA  1 
ATOM   946   C  C   . GLU A  1 129 ? 68.950  9.365   -9.793  1.00 44.83  ? 129  GLU A C   1 
ATOM   947   O  O   . GLU A  1 129 ? 68.083  9.672   -10.604 1.00 48.54  ? 129  GLU A O   1 
ATOM   948   C  CB  . GLU A  1 129 ? 68.273  7.975   -7.814  1.00 41.97  ? 129  GLU A CB  1 
ATOM   949   N  N   . ASP A  1 130 ? 69.882  10.218  -9.385  1.00 41.72  ? 130  ASP A N   1 
ATOM   950   C  CA  . ASP A  1 130 ? 69.922  11.618  -9.822  1.00 40.13  ? 130  ASP A CA  1 
ATOM   951   C  C   . ASP A  1 130 ? 70.566  11.945  -11.171 1.00 38.84  ? 130  ASP A C   1 
ATOM   952   O  O   . ASP A  1 130 ? 70.134  12.867  -11.866 1.00 36.93  ? 130  ASP A O   1 
ATOM   953   C  CB  . ASP A  1 130 ? 70.516  12.471  -8.728  1.00 40.14  ? 130  ASP A CB  1 
ATOM   954   C  CG  . ASP A  1 130 ? 69.817  12.264  -7.432  1.00 45.16  ? 130  ASP A CG  1 
ATOM   955   O  OD1 . ASP A  1 130 ? 68.571  12.223  -7.452  1.00 45.36  ? 130  ASP A OD1 1 
ATOM   956   O  OD2 . ASP A  1 130 ? 70.514  12.103  -6.411  1.00 47.89  ? 130  ASP A OD2 1 
ATOM   957   N  N   . PHE A  1 131 ? 71.642  11.248  -11.506 1.00 35.72  ? 131  PHE A N   1 
ATOM   958   C  CA  . PHE A  1 131 ? 72.368  11.622  -12.701 1.00 35.76  ? 131  PHE A CA  1 
ATOM   959   C  C   . PHE A  1 131 ? 73.015  10.449  -13.412 1.00 38.79  ? 131  PHE A C   1 
ATOM   960   O  O   . PHE A  1 131 ? 73.288  9.398   -12.818 1.00 38.94  ? 131  PHE A O   1 
ATOM   961   C  CB  . PHE A  1 131 ? 73.411  12.698  -12.391 1.00 34.38  ? 131  PHE A CB  1 
ATOM   962   C  CG  . PHE A  1 131 ? 74.639  12.167  -11.718 1.00 33.52  ? 131  PHE A CG  1 
ATOM   963   C  CD1 . PHE A  1 131 ? 74.741  12.155  -10.336 1.00 32.88  ? 131  PHE A CD1 1 
ATOM   964   C  CD2 . PHE A  1 131 ? 75.689  11.674  -12.463 1.00 32.67  ? 131  PHE A CD2 1 
ATOM   965   C  CE1 . PHE A  1 131 ? 75.861  11.668  -9.710  1.00 32.14  ? 131  PHE A CE1 1 
ATOM   966   C  CE2 . PHE A  1 131 ? 76.815  11.180  -11.842 1.00 34.26  ? 131  PHE A CE2 1 
ATOM   967   C  CZ  . PHE A  1 131 ? 76.901  11.178  -10.461 1.00 33.62  ? 131  PHE A CZ  1 
ATOM   968   N  N   . ILE A  1 132 ? 73.240  10.663  -14.704 1.00 37.57  ? 132  ILE A N   1 
ATOM   969   C  CA  . ILE A  1 132 ? 73.869  9.716   -15.599 1.00 36.10  ? 132  ILE A CA  1 
ATOM   970   C  C   . ILE A  1 132 ? 75.284  10.216  -15.807 1.00 38.11  ? 132  ILE A C   1 
ATOM   971   O  O   . ILE A  1 132 ? 75.506  11.421  -15.878 1.00 42.14  ? 132  ILE A O   1 
ATOM   972   C  CB  . ILE A  1 132 ? 73.141  9.742   -16.943 1.00 35.80  ? 132  ILE A CB  1 
ATOM   973   C  CG1 . ILE A  1 132 ? 71.785  9.053   -16.817 1.00 35.88  ? 132  ILE A CG1 1 
ATOM   974   C  CG2 . ILE A  1 132 ? 73.968  9.099   -18.031 1.00 35.84  ? 132  ILE A CG2 1 
ATOM   975   C  CD1 . ILE A  1 132 ? 70.753  9.625   -17.748 1.00 35.00  ? 132  ILE A CD1 1 
ATOM   976   N  N   . PHE A  1 133 ? 76.244  9.306   -15.891 1.00 36.39  ? 133  PHE A N   1 
ATOM   977   C  CA  . PHE A  1 133 ? 77.625  9.703   -16.082 1.00 39.88  ? 133  PHE A CA  1 
ATOM   978   C  C   . PHE A  1 133 ? 78.243  8.901   -17.209 1.00 45.31  ? 133  PHE A C   1 
ATOM   979   O  O   . PHE A  1 133 ? 78.231  7.674   -17.176 1.00 47.60  ? 133  PHE A O   1 
ATOM   980   C  CB  . PHE A  1 133 ? 78.413  9.477   -14.803 1.00 41.35  ? 133  PHE A CB  1 
ATOM   981   C  CG  . PHE A  1 133 ? 79.790  10.045  -14.844 1.00 42.86  ? 133  PHE A CG  1 
ATOM   982   C  CD1 . PHE A  1 133 ? 79.991  11.415  -14.740 1.00 43.29  ? 133  PHE A CD1 1 
ATOM   983   C  CD2 . PHE A  1 133 ? 80.892  9.213   -14.981 1.00 42.19  ? 133  PHE A CD2 1 
ATOM   984   C  CE1 . PHE A  1 133 ? 81.271  11.942  -14.769 1.00 42.77  ? 133  PHE A CE1 1 
ATOM   985   C  CE2 . PHE A  1 133 ? 82.174  9.731   -15.014 1.00 41.04  ? 133  PHE A CE2 1 
ATOM   986   C  CZ  . PHE A  1 133 ? 82.366  11.097  -14.906 1.00 41.92  ? 133  PHE A CZ  1 
ATOM   987   N  N   . GLU A  1 134 ? 78.795  9.588   -18.202 1.00 47.51  ? 134  GLU A N   1 
ATOM   988   C  CA  . GLU A  1 134 ? 79.280  8.897   -19.388 1.00 47.81  ? 134  GLU A CA  1 
ATOM   989   C  C   . GLU A  1 134 ? 80.722  9.227   -19.719 1.00 50.18  ? 134  GLU A C   1 
ATOM   990   O  O   . GLU A  1 134 ? 81.054  10.390  -19.953 1.00 52.37  ? 134  GLU A O   1 
ATOM   991   C  CB  . GLU A  1 134 ? 78.395  9.221   -20.586 1.00 45.27  ? 134  GLU A CB  1 
ATOM   992   C  CG  . GLU A  1 134 ? 78.753  8.427   -21.823 1.00 44.78  ? 134  GLU A CG  1 
ATOM   993   C  CD  . GLU A  1 134 ? 78.652  6.940   -21.594 1.00 46.99  ? 134  GLU A CD  1 
ATOM   994   O  OE1 . GLU A  1 134 ? 79.699  6.268   -21.665 1.00 48.48  ? 134  GLU A OE1 1 
ATOM   995   O  OE2 . GLU A  1 134 ? 77.532  6.443   -21.346 1.00 47.15  ? 134  GLU A OE2 1 
ATOM   996   N  N   . ASP A  1 135 ? 81.580  8.209   -19.686 1.00 49.82  ? 135  ASP A N   1 
ATOM   997   C  CA  . ASP A  1 135 ? 82.955  8.335   -20.169 1.00 49.55  ? 135  ASP A CA  1 
ATOM   998   C  C   . ASP A  1 135 ? 83.236  7.813   -21.590 1.00 48.83  ? 135  ASP A C   1 
ATOM   999   O  O   . ASP A  1 135 ? 84.350  7.955   -22.092 1.00 50.63  ? 135  ASP A O   1 
ATOM   1000  C  CB  . ASP A  1 135 ? 83.944  7.729   -19.167 1.00 51.03  ? 135  ASP A CB  1 
ATOM   1001  C  CG  . ASP A  1 135 ? 83.462  6.418   -18.580 1.00 53.70  ? 135  ASP A CG  1 
ATOM   1002  O  OD1 . ASP A  1 135 ? 84.080  5.953   -17.593 1.00 57.61  ? 135  ASP A OD1 1 
ATOM   1003  O  OD2 . ASP A  1 135 ? 82.467  5.860   -19.089 1.00 50.99  ? 135  ASP A OD2 1 
ATOM   1004  N  N   . ASP A  1 136 ? 82.228  7.239   -22.241 1.00 47.63  ? 136  ASP A N   1 
ATOM   1005  C  CA  . ASP A  1 136 ? 82.406  6.575   -23.541 1.00 48.61  ? 136  ASP A CA  1 
ATOM   1006  C  C   . ASP A  1 136 ? 81.433  7.186   -24.556 1.00 48.42  ? 136  ASP A C   1 
ATOM   1007  O  O   . ASP A  1 136 ? 80.829  8.224   -24.273 1.00 51.00  ? 136  ASP A O   1 
ATOM   1008  C  CB  . ASP A  1 136 ? 82.193  5.057   -23.425 1.00 49.72  ? 136  ASP A CB  1 
ATOM   1009  C  CG  . ASP A  1 136 ? 82.988  4.261   -24.465 1.00 50.76  ? 136  ASP A CG  1 
ATOM   1010  O  OD1 . ASP A  1 136 ? 83.516  4.866   -25.420 1.00 51.22  ? 136  ASP A OD1 1 
ATOM   1011  O  OD2 . ASP A  1 136 ? 83.083  3.022   -24.332 1.00 50.83  ? 136  ASP A OD2 1 
ATOM   1012  N  N   . VAL A  1 137 ? 81.330  6.596   -25.749 1.00 45.07  ? 137  VAL A N   1 
ATOM   1013  C  CA  . VAL A  1 137 ? 80.365  7.062   -26.753 1.00 42.36  ? 137  VAL A CA  1 
ATOM   1014  C  C   . VAL A  1 137 ? 79.578  5.919   -27.381 1.00 45.44  ? 137  VAL A C   1 
ATOM   1015  O  O   . VAL A  1 137 ? 80.100  4.811   -27.531 1.00 49.25  ? 137  VAL A O   1 
ATOM   1016  C  CB  . VAL A  1 137 ? 81.047  7.814   -27.893 1.00 36.57  ? 137  VAL A CB  1 
ATOM   1017  C  CG1 . VAL A  1 137 ? 81.753  9.034   -27.367 1.00 34.54  ? 137  VAL A CG1 1 
ATOM   1018  C  CG2 . VAL A  1 137 ? 82.013  6.898   -28.593 1.00 38.68  ? 137  VAL A CG2 1 
ATOM   1019  N  N   . PRO A  1 138 ? 78.314  6.182   -27.752 1.00 43.28  ? 138  PRO A N   1 
ATOM   1020  C  CA  . PRO A  1 138 ? 77.606  7.448   -27.513 1.00 41.67  ? 138  PRO A CA  1 
ATOM   1021  C  C   . PRO A  1 138 ? 77.007  7.509   -26.112 1.00 41.76  ? 138  PRO A C   1 
ATOM   1022  O  O   . PRO A  1 138 ? 77.142  6.561   -25.345 1.00 44.28  ? 138  PRO A O   1 
ATOM   1023  C  CB  . PRO A  1 138 ? 76.484  7.409   -28.547 1.00 39.95  ? 138  PRO A CB  1 
ATOM   1024  C  CG  . PRO A  1 138 ? 76.190  5.963   -28.705 1.00 40.82  ? 138  PRO A CG  1 
ATOM   1025  C  CD  . PRO A  1 138 ? 77.508  5.247   -28.559 1.00 41.90  ? 138  PRO A CD  1 
ATOM   1026  N  N   . ALA A  1 139 ? 76.354  8.614   -25.778 1.00 39.82  ? 139  ALA A N   1 
ATOM   1027  C  CA  . ALA A  1 139 ? 75.785  8.765   -24.445 1.00 37.21  ? 139  ALA A CA  1 
ATOM   1028  C  C   . ALA A  1 139 ? 74.421  8.080   -24.325 1.00 37.10  ? 139  ALA A C   1 
ATOM   1029  O  O   . ALA A  1 139 ? 73.969  7.757   -23.223 1.00 34.95  ? 139  ALA A O   1 
ATOM   1030  C  CB  . ALA A  1 139 ? 75.694  10.236  -24.068 1.00 35.06  ? 139  ALA A CB  1 
ATOM   1031  N  N   . TRP A  1 140 ? 73.779  7.845   -25.464 1.00 37.63  ? 140  TRP A N   1 
ATOM   1032  C  CA  . TRP A  1 140 ? 72.458  7.223   -25.489 1.00 39.82  ? 140  TRP A CA  1 
ATOM   1033  C  C   . TRP A  1 140 ? 72.246  6.508   -26.808 1.00 42.87  ? 140  TRP A C   1 
ATOM   1034  O  O   . TRP A  1 140 ? 72.896  6.822   -27.805 1.00 46.13  ? 140  TRP A O   1 
ATOM   1035  C  CB  . TRP A  1 140 ? 71.367  8.279   -25.307 1.00 41.13  ? 140  TRP A CB  1 
ATOM   1036  C  CG  . TRP A  1 140 ? 71.446  9.424   -26.295 1.00 42.40  ? 140  TRP A CG  1 
ATOM   1037  C  CD1 . TRP A  1 140 ? 72.214  9.488   -27.425 1.00 42.04  ? 140  TRP A CD1 1 
ATOM   1038  C  CD2 . TRP A  1 140 ? 70.737  10.670  -26.224 1.00 42.89  ? 140  TRP A CD2 1 
ATOM   1039  N  NE1 . TRP A  1 140 ? 72.021  10.691  -28.063 1.00 41.27  ? 140  TRP A NE1 1 
ATOM   1040  C  CE2 . TRP A  1 140 ? 71.121  11.435  -27.348 1.00 42.32  ? 140  TRP A CE2 1 
ATOM   1041  C  CE3 . TRP A  1 140 ? 69.815  11.212  -25.321 1.00 41.04  ? 140  TRP A CE3 1 
ATOM   1042  C  CZ2 . TRP A  1 140 ? 70.615  12.712  -27.590 1.00 41.33  ? 140  TRP A CZ2 1 
ATOM   1043  C  CZ3 . TRP A  1 140 ? 69.313  12.480  -25.565 1.00 38.70  ? 140  TRP A CZ3 1 
ATOM   1044  C  CH2 . TRP A  1 140 ? 69.715  13.215  -26.690 1.00 39.97  ? 140  TRP A CH2 1 
ATOM   1045  N  N   . PHE A  1 141 ? 71.332  5.548   -26.821 1.00 42.13  ? 141  PHE A N   1 
ATOM   1046  C  CA  . PHE A  1 141 ? 70.999  4.848   -28.058 1.00 41.97  ? 141  PHE A CA  1 
ATOM   1047  C  C   . PHE A  1 141 ? 69.493  4.710   -28.155 1.00 40.96  ? 141  PHE A C   1 
ATOM   1048  O  O   . PHE A  1 141 ? 68.821  4.534   -27.140 1.00 42.51  ? 141  PHE A O   1 
ATOM   1049  C  CB  . PHE A  1 141 ? 71.664  3.471   -28.111 1.00 43.26  ? 141  PHE A CB  1 
ATOM   1050  C  CG  . PHE A  1 141 ? 71.758  2.899   -29.497 1.00 44.06  ? 141  PHE A CG  1 
ATOM   1051  C  CD1 . PHE A  1 141 ? 72.910  3.062   -30.250 1.00 43.04  ? 141  PHE A CD1 1 
ATOM   1052  C  CD2 . PHE A  1 141 ? 70.691  2.210   -30.053 1.00 44.62  ? 141  PHE A CD2 1 
ATOM   1053  C  CE1 . PHE A  1 141 ? 73.001  2.541   -31.528 1.00 43.50  ? 141  PHE A CE1 1 
ATOM   1054  C  CE2 . PHE A  1 141 ? 70.772  1.691   -31.331 1.00 45.16  ? 141  PHE A CE2 1 
ATOM   1055  C  CZ  . PHE A  1 141 ? 71.933  1.857   -32.070 1.00 44.63  ? 141  PHE A CZ  1 
ATOM   1056  N  N   . ASP A  1 142 ? 68.956  4.802   -29.366 1.00 39.22  ? 142  ASP A N   1 
ATOM   1057  C  CA  . ASP A  1 142 ? 67.510  4.793   -29.519 1.00 37.91  ? 142  ASP A CA  1 
ATOM   1058  C  C   . ASP A  1 142 ? 66.891  3.509   -28.995 1.00 40.64  ? 142  ASP A C   1 
ATOM   1059  O  O   . ASP A  1 142 ? 67.359  2.414   -29.293 1.00 38.85  ? 142  ASP A O   1 
ATOM   1060  C  CB  . ASP A  1 142 ? 67.103  5.008   -30.965 1.00 39.31  ? 142  ASP A CB  1 
ATOM   1061  C  CG  . ASP A  1 142 ? 65.603  4.987   -31.146 1.00 41.11  ? 142  ASP A CG  1 
ATOM   1062  O  OD1 . ASP A  1 142 ? 64.942  5.974   -30.750 1.00 39.58  ? 142  ASP A OD1 1 
ATOM   1063  O  OD2 . ASP A  1 142 ? 65.089  3.986   -31.693 1.00 43.30  ? 142  ASP A OD2 1 
ATOM   1064  N  N   . ASN A  1 143 ? 65.842  3.664   -28.193 1.00 46.82  ? 143  ASN A N   1 
ATOM   1065  C  CA  . ASN A  1 143 ? 65.096  2.537   -27.648 1.00 49.77  ? 143  ASN A CA  1 
ATOM   1066  C  C   . ASN A  1 143 ? 65.796  1.831   -26.480 1.00 50.30  ? 143  ASN A C   1 
ATOM   1067  O  O   . ASN A  1 143 ? 65.191  0.989   -25.822 1.00 52.07  ? 143  ASN A O   1 
ATOM   1068  C  CB  . ASN A  1 143 ? 64.773  1.529   -28.756 1.00 51.71  ? 143  ASN A CB  1 
ATOM   1069  C  CG  . ASN A  1 143 ? 63.608  0.621   -28.404 1.00 55.11  ? 143  ASN A CG  1 
ATOM   1070  O  OD1 . ASN A  1 143 ? 62.602  1.061   -27.843 1.00 56.54  ? 143  ASN A OD1 1 
ATOM   1071  N  ND2 . ASN A  1 143 ? 63.738  -0.657  -28.738 1.00 55.91  ? 143  ASN A ND2 1 
ATOM   1072  N  N   . MET A  1 144 ? 67.083  2.105   -26.279 1.00 48.54  ? 144  MET A N   1 
ATOM   1073  C  CA  . MET A  1 144 ? 67.784  1.681   -25.065 1.00 45.12  ? 144  MET A CA  1 
ATOM   1074  C  C   . MET A  1 144 ? 67.977  2.753   -23.985 1.00 47.32  ? 144  MET A C   1 
ATOM   1075  O  O   . MET A  1 144 ? 68.468  2.449   -22.900 1.00 50.30  ? 144  MET A O   1 
ATOM   1076  C  CB  . MET A  1 144 ? 69.123  1.046   -25.430 1.00 41.92  ? 144  MET A CB  1 
ATOM   1077  C  CG  . MET A  1 144 ? 68.970  -0.161  -26.339 1.00 41.84  ? 144  MET A CG  1 
ATOM   1078  S  SD  . MET A  1 144 ? 70.424  -0.471  -27.351 1.00 78.70  ? 144  MET A SD  1 
ATOM   1079  C  CE  . MET A  1 144 ? 69.791  -1.748  -28.439 1.00 126.17 ? 144  MET A CE  1 
ATOM   1080  N  N   . GLY A  1 145 ? 67.583  3.993   -24.261 1.00 45.46  ? 145  GLY A N   1 
ATOM   1081  C  CA  . GLY A  1 145 ? 67.813  5.081   -23.317 1.00 42.16  ? 145  GLY A CA  1 
ATOM   1082  C  C   . GLY A  1 145 ? 69.277  5.446   -23.109 1.00 40.75  ? 145  GLY A C   1 
ATOM   1083  O  O   . GLY A  1 145 ? 70.139  5.050   -23.890 1.00 41.27  ? 145  GLY A O   1 
ATOM   1084  N  N   . PHE A  1 146 ? 69.556  6.214   -22.057 1.00 41.29  ? 146  PHE A N   1 
ATOM   1085  C  CA  . PHE A  1 146 ? 70.924  6.617   -21.720 1.00 40.94  ? 146  PHE A CA  1 
ATOM   1086  C  C   . PHE A  1 146 ? 71.760  5.417   -21.279 1.00 44.02  ? 146  PHE A C   1 
ATOM   1087  O  O   . PHE A  1 146 ? 71.331  4.643   -20.426 1.00 48.40  ? 146  PHE A O   1 
ATOM   1088  C  CB  . PHE A  1 146 ? 70.925  7.676   -20.609 1.00 38.69  ? 146  PHE A CB  1 
ATOM   1089  C  CG  . PHE A  1 146 ? 70.570  9.061   -21.078 1.00 38.04  ? 146  PHE A CG  1 
ATOM   1090  C  CD1 . PHE A  1 146 ? 69.258  9.521   -21.017 1.00 36.26  ? 146  PHE A CD1 1 
ATOM   1091  C  CD2 . PHE A  1 146 ? 71.550  9.911   -21.571 1.00 38.80  ? 146  PHE A CD2 1 
ATOM   1092  C  CE1 . PHE A  1 146 ? 68.929  10.799  -21.443 1.00 35.59  ? 146  PHE A CE1 1 
ATOM   1093  C  CE2 . PHE A  1 146 ? 71.227  11.194  -22.002 1.00 38.51  ? 146  PHE A CE2 1 
ATOM   1094  C  CZ  . PHE A  1 146 ? 69.912  11.636  -21.937 1.00 37.43  ? 146  PHE A CZ  1 
ATOM   1095  N  N   . PHE A  1 147 ? 72.954  5.272   -21.851 1.00 41.76  ? 147  PHE A N   1 
ATOM   1096  C  CA  . PHE A  1 147 ? 73.801  4.120   -21.558 1.00 42.41  ? 147  PHE A CA  1 
ATOM   1097  C  C   . PHE A  1 147 ? 74.272  4.128   -20.102 1.00 42.13  ? 147  PHE A C   1 
ATOM   1098  O  O   . PHE A  1 147 ? 74.362  3.078   -19.474 1.00 44.61  ? 147  PHE A O   1 
ATOM   1099  C  CB  . PHE A  1 147 ? 75.007  4.057   -22.516 1.00 45.99  ? 147  PHE A CB  1 
ATOM   1100  C  CG  . PHE A  1 147 ? 74.753  3.274   -23.795 1.00 46.69  ? 147  PHE A CG  1 
ATOM   1101  C  CD1 . PHE A  1 147 ? 75.077  3.820   -25.035 1.00 46.99  ? 147  PHE A CD1 1 
ATOM   1102  C  CD2 . PHE A  1 147 ? 74.225  1.993   -23.757 1.00 46.84  ? 147  PHE A CD2 1 
ATOM   1103  C  CE1 . PHE A  1 147 ? 74.861  3.116   -26.217 1.00 46.41  ? 147  PHE A CE1 1 
ATOM   1104  C  CE2 . PHE A  1 147 ? 74.006  1.279   -24.941 1.00 48.38  ? 147  PHE A CE2 1 
ATOM   1105  C  CZ  . PHE A  1 147 ? 74.328  1.848   -26.172 1.00 47.19  ? 147  PHE A CZ  1 
ATOM   1106  N  N   . ASP A  1 148 ? 74.568  5.308   -19.568 1.00 41.20  ? 148  ASP A N   1 
ATOM   1107  C  CA  . ASP A  1 148 ? 75.027  5.427   -18.187 1.00 40.68  ? 148  ASP A CA  1 
ATOM   1108  C  C   . ASP A  1 148 ? 76.119  4.403   -17.887 1.00 42.24  ? 148  ASP A C   1 
ATOM   1109  O  O   . ASP A  1 148 ? 76.056  3.692   -16.881 1.00 42.20  ? 148  ASP A O   1 
ATOM   1110  C  CB  . ASP A  1 148 ? 73.859  5.271   -17.207 1.00 41.22  ? 148  ASP A CB  1 
ATOM   1111  C  CG  . ASP A  1 148 ? 74.189  5.786   -15.809 1.00 44.46  ? 148  ASP A CG  1 
ATOM   1112  O  OD1 . ASP A  1 148 ? 75.055  6.675   -15.684 1.00 45.20  ? 148  ASP A OD1 1 
ATOM   1113  O  OD2 . ASP A  1 148 ? 73.573  5.309   -14.831 1.00 45.43  ? 148  ASP A OD2 1 
ATOM   1114  N  N   . GLY A  1 149 ? 77.113  4.329   -18.771 1.00 43.46  ? 149  GLY A N   1 
ATOM   1115  C  CA  . GLY A  1 149 ? 78.254  3.445   -18.587 1.00 45.51  ? 149  GLY A CA  1 
ATOM   1116  C  C   . GLY A  1 149 ? 77.970  1.965   -18.783 1.00 49.22  ? 149  GLY A C   1 
ATOM   1117  O  O   . GLY A  1 149 ? 78.659  1.108   -18.222 1.00 51.01  ? 149  GLY A O   1 
ATOM   1118  N  N   . GLU A  1 150 ? 76.961  1.664   -19.594 1.00 49.34  ? 150  GLU A N   1 
ATOM   1119  C  CA  . GLU A  1 150 ? 76.523  0.289   -19.812 1.00 49.12  ? 150  GLU A CA  1 
ATOM   1120  C  C   . GLU A  1 150 ? 77.649  -0.657  -20.229 1.00 49.33  ? 150  GLU A C   1 
ATOM   1121  O  O   . GLU A  1 150 ? 78.533  -0.302  -21.010 1.00 50.02  ? 150  GLU A O   1 
ATOM   1122  C  CB  . GLU A  1 150 ? 75.396  0.249   -20.850 1.00 47.22  ? 150  GLU A CB  1 
ATOM   1123  C  CG  . GLU A  1 150 ? 74.968  -1.153  -21.254 1.00 45.94  ? 150  GLU A CG  1 
ATOM   1124  C  CD  . GLU A  1 150 ? 73.736  -1.145  -22.130 1.00 46.61  ? 150  GLU A CD  1 
ATOM   1125  O  OE1 . GLU A  1 150 ? 72.895  -0.242  -21.939 1.00 47.68  ? 150  GLU A OE1 1 
ATOM   1126  O  OE2 . GLU A  1 150 ? 73.611  -2.028  -23.011 1.00 46.16  ? 150  GLU A OE2 1 
ATOM   1127  N  N   . LYS A  1 151 ? 77.611  -1.860  -19.672 1.00 48.58  ? 151  LYS A N   1 
ATOM   1128  C  CA  . LYS A  1 151 ? 78.477  -2.946  -20.095 1.00 50.69  ? 151  LYS A CA  1 
ATOM   1129  C  C   . LYS A  1 151 ? 77.559  -4.115  -20.416 1.00 49.44  ? 151  LYS A C   1 
ATOM   1130  O  O   . LYS A  1 151 ? 76.452  -4.208  -19.876 1.00 51.61  ? 151  LYS A O   1 
ATOM   1131  C  CB  . LYS A  1 151 ? 79.457  -3.334  -18.981 1.00 54.79  ? 151  LYS A CB  1 
ATOM   1132  C  CG  . LYS A  1 151 ? 80.345  -2.199  -18.480 1.00 58.49  ? 151  LYS A CG  1 
ATOM   1133  C  CD  . LYS A  1 151 ? 81.268  -1.690  -19.572 1.00 62.62  ? 151  LYS A CD  1 
ATOM   1134  C  CE  . LYS A  1 151 ? 82.519  -2.547  -19.700 1.00 66.09  ? 151  LYS A CE  1 
ATOM   1135  N  NZ  . LYS A  1 151 ? 83.412  -2.398  -18.515 1.00 67.33  ? 151  LYS A NZ  1 
ATOM   1136  N  N   . THR A  1 152 ? 78.004  -4.998  -21.300 1.00 44.27  ? 152  THR A N   1 
ATOM   1137  C  CA  . THR A  1 152 ? 77.213  -6.163  -21.658 1.00 44.31  ? 152  THR A CA  1 
ATOM   1138  C  C   . THR A  1 152 ? 77.508  -7.293  -20.679 1.00 44.95  ? 152  THR A C   1 
ATOM   1139  O  O   . THR A  1 152 ? 78.662  -7.546  -20.351 1.00 45.55  ? 152  THR A O   1 
ATOM   1140  C  CB  . THR A  1 152 ? 77.523  -6.621  -23.095 1.00 46.02  ? 152  THR A CB  1 
ATOM   1141  O  OG1 . THR A  1 152 ? 77.370  -5.514  -23.997 1.00 48.16  ? 152  THR A OG1 1 
ATOM   1142  C  CG2 . THR A  1 152 ? 76.602  -7.762  -23.512 1.00 43.22  ? 152  THR A CG2 1 
ATOM   1143  N  N   . THR A  1 153 ? 76.464  -7.962  -20.203 1.00 45.79  ? 153  THR A N   1 
ATOM   1144  C  CA  . THR A  1 153 ? 76.629  -9.063  -19.260 1.00 49.82  ? 153  THR A CA  1 
ATOM   1145  C  C   . THR A  1 153 ? 76.206  -10.385 -19.886 1.00 51.23  ? 153  THR A C   1 
ATOM   1146  O  O   . THR A  1 153 ? 75.266  -10.429 -20.682 1.00 53.46  ? 153  THR A O   1 
ATOM   1147  C  CB  . THR A  1 153 ? 75.782  -8.848  -18.000 1.00 53.54  ? 153  THR A CB  1 
ATOM   1148  O  OG1 . THR A  1 153 ? 74.451  -8.494  -18.390 1.00 56.96  ? 153  THR A OG1 1 
ATOM   1149  C  CG2 . THR A  1 153 ? 76.359  -7.734  -17.143 1.00 53.34  ? 153  THR A CG2 1 
ATOM   1150  N  N   . PHE A  1 154 ? 76.893  -11.461 -19.515 1.00 48.49  ? 154  PHE A N   1 
ATOM   1151  C  CA  . PHE A  1 154 ? 76.543  -12.790 -20.000 1.00 46.27  ? 154  PHE A CA  1 
ATOM   1152  C  C   . PHE A  1 154 ? 76.305  -13.747 -18.852 1.00 48.72  ? 154  PHE A C   1 
ATOM   1153  O  O   . PHE A  1 154 ? 77.145  -13.891 -17.970 1.00 52.74  ? 154  PHE A O   1 
ATOM   1154  C  CB  . PHE A  1 154 ? 77.642  -13.331 -20.902 1.00 44.97  ? 154  PHE A CB  1 
ATOM   1155  C  CG  . PHE A  1 154 ? 77.843  -12.528 -22.146 1.00 47.57  ? 154  PHE A CG  1 
ATOM   1156  C  CD1 . PHE A  1 154 ? 78.609  -11.382 -22.123 1.00 47.54  ? 154  PHE A CD1 1 
ATOM   1157  C  CD2 . PHE A  1 154 ? 77.254  -12.913 -23.337 1.00 50.04  ? 154  PHE A CD2 1 
ATOM   1158  C  CE1 . PHE A  1 154 ? 78.792  -10.639 -23.266 1.00 49.88  ? 154  PHE A CE1 1 
ATOM   1159  C  CE2 . PHE A  1 154 ? 77.436  -12.173 -24.484 1.00 50.99  ? 154  PHE A CE2 1 
ATOM   1160  C  CZ  . PHE A  1 154 ? 78.208  -11.033 -24.449 1.00 50.59  ? 154  PHE A CZ  1 
ATOM   1161  N  N   . TRP A  1 155 ? 75.155  -14.405 -18.860 1.00 48.90  ? 155  TRP A N   1 
ATOM   1162  C  CA  A TRP A  1 155 ? 74.838  -15.360 -17.814 0.50 50.35  ? 155  TRP A CA  1 
ATOM   1163  C  CA  B TRP A  1 155 ? 74.810  -15.353 -17.808 0.50 50.51  ? 155  TRP A CA  1 
ATOM   1164  C  C   . TRP A  1 155 ? 74.577  -16.744 -18.375 1.00 51.76  ? 155  TRP A C   1 
ATOM   1165  O  O   . TRP A  1 155 ? 73.978  -16.895 -19.442 1.00 54.44  ? 155  TRP A O   1 
ATOM   1166  C  CB  A TRP A  1 155 ? 73.617  -14.905 -17.021 0.50 50.47  ? 155  TRP A CB  1 
ATOM   1167  C  CB  B TRP A  1 155 ? 73.543  -14.912 -17.070 0.50 50.64  ? 155  TRP A CB  1 
ATOM   1168  C  CG  A TRP A  1 155 ? 73.823  -13.652 -16.251 0.50 51.00  ? 155  TRP A CG  1 
ATOM   1169  C  CG  B TRP A  1 155 ? 73.675  -13.646 -16.292 0.50 50.63  ? 155  TRP A CG  1 
ATOM   1170  C  CD1 A TRP A  1 155 ? 74.477  -13.519 -15.063 0.50 50.92  ? 155  TRP A CD1 1 
ATOM   1171  C  CD1 B TRP A  1 155 ? 74.805  -12.904 -16.119 0.50 51.14  ? 155  TRP A CD1 1 
ATOM   1172  C  CD2 A TRP A  1 155 ? 73.353  -12.346 -16.601 0.50 50.90  ? 155  TRP A CD2 1 
ATOM   1173  C  CD2 B TRP A  1 155 ? 72.634  -12.967 -15.578 0.50 50.22  ? 155  TRP A CD2 1 
ATOM   1174  N  NE1 A TRP A  1 155 ? 74.451  -12.206 -14.652 0.50 52.15  ? 155  TRP A NE1 1 
ATOM   1175  N  NE1 B TRP A  1 155 ? 74.534  -11.803 -15.339 0.50 52.23  ? 155  TRP A NE1 1 
ATOM   1176  C  CE2 A TRP A  1 155 ? 73.765  -11.465 -15.579 0.50 52.45  ? 155  TRP A CE2 1 
ATOM   1177  C  CE2 B TRP A  1 155 ? 73.208  -11.819 -14.994 0.50 51.71  ? 155  TRP A CE2 1 
ATOM   1178  C  CE3 A TRP A  1 155 ? 72.628  -11.833 -17.682 0.50 50.88  ? 155  TRP A CE3 1 
ATOM   1179  C  CE3 B TRP A  1 155 ? 71.273  -13.218 -15.374 0.50 49.46  ? 155  TRP A CE3 1 
ATOM   1180  C  CZ2 A TRP A  1 155 ? 73.472  -10.100 -15.606 0.50 54.17  ? 155  TRP A CZ2 1 
ATOM   1181  C  CZ2 B TRP A  1 155 ? 72.466  -10.923 -14.220 0.50 48.92  ? 155  TRP A CZ2 1 
ATOM   1182  C  CZ3 A TRP A  1 155 ? 72.340  -10.479 -17.708 0.50 52.03  ? 155  TRP A CZ3 1 
ATOM   1183  C  CZ3 B TRP A  1 155 ? 70.541  -12.327 -14.605 0.50 47.94  ? 155  TRP A CZ3 1 
ATOM   1184  C  CH2 A TRP A  1 155 ? 72.755  -9.629  -16.674 0.50 53.62  ? 155  TRP A CH2 1 
ATOM   1185  C  CH2 B TRP A  1 155 ? 71.138  -11.196 -14.039 0.50 47.55  ? 155  TRP A CH2 1 
ATOM   1186  N  N   . VAL A  1 156 ? 75.039  -17.752 -17.647 1.00 50.99  ? 156  VAL A N   1 
ATOM   1187  C  CA  . VAL A  1 156 ? 74.726  -19.137 -17.962 1.00 49.78  ? 156  VAL A CA  1 
ATOM   1188  C  C   . VAL A  1 156 ? 73.924  -19.675 -16.783 1.00 52.14  ? 156  VAL A C   1 
ATOM   1189  O  O   . VAL A  1 156 ? 74.438  -19.778 -15.663 1.00 54.80  ? 156  VAL A O   1 
ATOM   1190  C  CB  . VAL A  1 156 ? 75.991  -19.993 -18.155 1.00 46.37  ? 156  VAL A CB  1 
ATOM   1191  C  CG1 . VAL A  1 156 ? 75.611  -21.421 -18.501 1.00 45.17  ? 156  VAL A CG1 1 
ATOM   1192  C  CG2 . VAL A  1 156 ? 76.869  -19.402 -19.241 1.00 46.21  ? 156  VAL A CG2 1 
ATOM   1193  N  N   . ILE A  1 157 ? 72.661  -20.002 -17.030 1.00 49.26  ? 157  ILE A N   1 
ATOM   1194  C  CA  . ILE A  1 157 ? 71.768  -20.409 -15.958 1.00 48.88  ? 157  ILE A CA  1 
ATOM   1195  C  C   . ILE A  1 157 ? 71.404  -21.885 -16.049 1.00 51.86  ? 157  ILE A C   1 
ATOM   1196  O  O   . ILE A  1 157 ? 71.014  -22.362 -17.108 1.00 53.49  ? 157  ILE A O   1 
ATOM   1197  C  CB  . ILE A  1 157 ? 70.468  -19.583 -15.991 1.00 48.39  ? 157  ILE A CB  1 
ATOM   1198  C  CG1 . ILE A  1 157 ? 70.782  -18.086 -15.936 1.00 45.76  ? 157  ILE A CG1 1 
ATOM   1199  C  CG2 . ILE A  1 157 ? 69.537  -19.987 -14.848 1.00 48.25  ? 157  ILE A CG2 1 
ATOM   1200  C  CD1 . ILE A  1 157 ? 69.636  -17.218 -16.386 1.00 44.04  ? 157  ILE A CD1 1 
ATOM   1201  N  N   . ASP A  1 158 ? 71.533  -22.602 -14.934 1.00 53.49  ? 158  ASP A N   1 
ATOM   1202  C  CA  . ASP A  1 158 ? 71.028  -23.965 -14.848 1.00 53.77  ? 158  ASP A CA  1 
ATOM   1203  C  C   . ASP A  1 158 ? 69.566  -23.867 -14.470 1.00 54.96  ? 158  ASP A C   1 
ATOM   1204  O  O   . ASP A  1 158 ? 69.226  -23.313 -13.426 1.00 56.48  ? 158  ASP A O   1 
ATOM   1205  C  CB  . ASP A  1 158 ? 71.790  -24.766 -13.790 1.00 55.99  ? 158  ASP A CB  1 
ATOM   1206  C  CG  . ASP A  1 158 ? 71.109  -26.087 -13.449 1.00 59.90  ? 158  ASP A CG  1 
ATOM   1207  O  OD1 . ASP A  1 158 ? 70.443  -26.667 -14.335 1.00 60.95  ? 158  ASP A OD1 1 
ATOM   1208  O  OD2 . ASP A  1 158 ? 71.241  -26.546 -12.291 1.00 61.09  ? 158  ASP A OD2 1 
ATOM   1209  N  N   . THR A  1 159 ? 68.695  -24.391 -15.323 1.00 54.34  ? 159  THR A N   1 
ATOM   1210  C  CA  . THR A  1 159 ? 67.261  -24.276 -15.086 1.00 51.85  ? 159  THR A CA  1 
ATOM   1211  C  C   . THR A  1 159 ? 66.744  -25.326 -14.113 1.00 52.10  ? 159  THR A C   1 
ATOM   1212  O  O   . THR A  1 159 ? 65.597  -25.268 -13.670 1.00 51.88  ? 159  THR A O   1 
ATOM   1213  C  CB  . THR A  1 159 ? 66.469  -24.367 -16.392 1.00 49.82  ? 159  THR A CB  1 
ATOM   1214  O  OG1 . THR A  1 159 ? 66.735  -25.625 -17.029 1.00 48.38  ? 159  THR A OG1 1 
ATOM   1215  C  CG2 . THR A  1 159 ? 66.865  -23.227 -17.314 1.00 50.30  ? 159  THR A CG2 1 
ATOM   1216  N  N   . GLU A  1 160 ? 67.589  -26.291 -13.785 1.00 53.07  ? 160  GLU A N   1 
ATOM   1217  C  CA  . GLU A  1 160 ? 67.206  -27.318 -12.831 1.00 56.03  ? 160  GLU A CA  1 
ATOM   1218  C  C   . GLU A  1 160 ? 67.360  -26.793 -11.412 1.00 54.92  ? 160  GLU A C   1 
ATOM   1219  O  O   . GLU A  1 160 ? 66.383  -26.708 -10.672 1.00 51.60  ? 160  GLU A O   1 
ATOM   1220  C  CB  . GLU A  1 160 ? 68.003  -28.600 -13.053 1.00 59.32  ? 160  GLU A CB  1 
ATOM   1221  C  CG  . GLU A  1 160 ? 67.803  -29.183 -14.430 1.00 59.65  ? 160  GLU A CG  1 
ATOM   1222  C  CD  . GLU A  1 160 ? 68.149  -30.644 -14.487 1.00 60.23  ? 160  GLU A CD  1 
ATOM   1223  O  OE1 . GLU A  1 160 ? 68.230  -31.268 -13.409 1.00 61.04  ? 160  GLU A OE1 1 
ATOM   1224  O  OE2 . GLU A  1 160 ? 68.337  -31.162 -15.609 1.00 59.97  ? 160  GLU A OE2 1 
ATOM   1225  N  N   . GLY A  1 161 ? 68.593  -26.461 -11.035 1.00 56.92  ? 161  GLY A N   1 
ATOM   1226  C  CA  . GLY A  1 161 ? 68.861  -25.866 -9.736  1.00 58.18  ? 161  GLY A CA  1 
ATOM   1227  C  C   . GLY A  1 161 ? 68.537  -24.381 -9.646  1.00 57.35  ? 161  GLY A C   1 
ATOM   1228  O  O   . GLY A  1 161 ? 68.569  -23.793 -8.559  1.00 54.96  ? 161  GLY A O   1 
ATOM   1229  N  N   . GLU A  1 162 ? 68.233  -23.775 -10.791 1.00 56.90  ? 162  GLU A N   1 
ATOM   1230  C  CA  . GLU A  1 162 ? 67.820  -22.375 -10.847 1.00 54.96  ? 162  GLU A CA  1 
ATOM   1231  C  C   . GLU A  1 162 ? 68.871  -21.425 -10.261 1.00 55.58  ? 162  GLU A C   1 
ATOM   1232  O  O   . GLU A  1 162 ? 68.578  -20.566 -9.429  1.00 55.85  ? 162  GLU A O   1 
ATOM   1233  C  CB  . GLU A  1 162 ? 66.472  -22.211 -10.151 1.00 53.22  ? 162  GLU A CB  1 
ATOM   1234  C  CG  . GLU A  1 162 ? 65.551  -23.393 -10.381 1.00 53.18  ? 162  GLU A CG  1 
ATOM   1235  C  CD  . GLU A  1 162 ? 64.150  -23.150 -9.882  1.00 56.07  ? 162  GLU A CD  1 
ATOM   1236  O  OE1 . GLU A  1 162 ? 63.851  -22.013 -9.463  1.00 56.63  ? 162  GLU A OE1 1 
ATOM   1237  O  OE2 . GLU A  1 162 ? 63.347  -24.101 -9.912  1.00 57.95  ? 162  GLU A OE2 1 
ATOM   1238  N  N   . GLU A  1 163 ? 70.103  -21.590 -10.719 1.00 56.78  ? 163  GLU A N   1 
ATOM   1239  C  CA  . GLU A  1 163 ? 71.199  -20.724 -10.317 1.00 57.46  ? 163  GLU A CA  1 
ATOM   1240  C  C   . GLU A  1 163 ? 72.002  -20.287 -11.544 1.00 60.43  ? 163  GLU A C   1 
ATOM   1241  O  O   . GLU A  1 163 ? 71.934  -20.933 -12.594 1.00 60.93  ? 163  GLU A O   1 
ATOM   1242  C  CB  . GLU A  1 163 ? 72.094  -21.460 -9.325  1.00 57.16  ? 163  GLU A CB  1 
ATOM   1243  C  CG  . GLU A  1 163 ? 71.552  -21.457 -7.921  1.00 59.39  ? 163  GLU A CG  1 
ATOM   1244  C  CD  . GLU A  1 163 ? 71.618  -20.083 -7.316  1.00 62.10  ? 163  GLU A CD  1 
ATOM   1245  O  OE1 . GLU A  1 163 ? 72.663  -19.417 -7.488  1.00 61.82  ? 163  GLU A OE1 1 
ATOM   1246  O  OE2 . GLU A  1 163 ? 70.624  -19.659 -6.692  1.00 64.17  ? 163  GLU A OE2 1 
ATOM   1247  N  N   . VAL A  1 164 ? 72.748  -19.190 -11.409 1.00 61.29  ? 164  VAL A N   1 
ATOM   1248  C  CA  . VAL A  1 164 ? 73.646  -18.726 -12.465 1.00 61.35  ? 164  VAL A CA  1 
ATOM   1249  C  C   . VAL A  1 164 ? 75.004  -19.338 -12.179 1.00 62.01  ? 164  VAL A C   1 
ATOM   1250  O  O   . VAL A  1 164 ? 75.649  -18.997 -11.191 1.00 61.66  ? 164  VAL A O   1 
ATOM   1251  C  CB  . VAL A  1 164 ? 73.818  -17.184 -12.439 1.00 34.63  ? 164  VAL A CB  1 
ATOM   1252  C  CG1 . VAL A  1 164 ? 75.028  -16.765 -13.264 1.00 36.02  ? 164  VAL A CG1 1 
ATOM   1253  C  CG2 . VAL A  1 164 ? 72.566  -16.475 -12.917 1.00 31.21  ? 164  VAL A CG2 1 
ATOM   1254  N  N   . ILE A  1 165 ? 75.434  -20.264 -13.024 1.00 64.27  ? 165  ILE A N   1 
ATOM   1255  C  CA  . ILE A  1 165 ? 76.687  -20.953 -12.767 1.00 65.13  ? 165  ILE A CA  1 
ATOM   1256  C  C   . ILE A  1 165 ? 77.903  -20.283 -13.415 1.00 65.55  ? 165  ILE A C   1 
ATOM   1257  O  O   . ILE A  1 165 ? 79.044  -20.577 -13.059 1.00 65.14  ? 165  ILE A O   1 
ATOM   1258  C  CB  . ILE A  1 165 ? 76.579  -22.411 -13.226 1.00 65.38  ? 165  ILE A CB  1 
ATOM   1259  C  CG1 . ILE A  1 165 ? 76.490  -22.477 -14.748 1.00 67.54  ? 165  ILE A CG1 1 
ATOM   1260  C  CG2 . ILE A  1 165 ? 75.345  -23.067 -12.609 1.00 62.26  ? 165  ILE A CG2 1 
ATOM   1261  C  CD1 . ILE A  1 165 ? 76.350  -23.883 -15.278 1.00 69.78  ? 165  ILE A CD1 1 
ATOM   1262  N  N   . GLU A  1 166 ? 77.649  -19.366 -14.345 1.00 67.48  ? 166  GLU A N   1 
ATOM   1263  C  CA  . GLU A  1 166 ? 78.712  -18.655 -15.053 1.00 69.63  ? 166  GLU A CA  1 
ATOM   1264  C  C   . GLU A  1 166 ? 78.315  -17.222 -15.379 1.00 66.26  ? 166  GLU A C   1 
ATOM   1265  O  O   . GLU A  1 166 ? 77.213  -16.973 -15.876 1.00 65.08  ? 166  GLU A O   1 
ATOM   1266  C  CB  . GLU A  1 166 ? 79.046  -19.370 -16.363 1.00 75.81  ? 166  GLU A CB  1 
ATOM   1267  C  CG  . GLU A  1 166 ? 79.832  -20.654 -16.210 1.00 82.18  ? 166  GLU A CG  1 
ATOM   1268  C  CD  . GLU A  1 166 ? 81.274  -20.398 -15.845 1.00 88.11  ? 166  GLU A CD  1 
ATOM   1269  O  OE1 . GLU A  1 166 ? 81.997  -21.379 -15.576 1.00 91.41  ? 166  GLU A OE1 1 
ATOM   1270  O  OE2 . GLU A  1 166 ? 81.686  -19.217 -15.830 1.00 89.29  ? 166  GLU A OE2 1 
ATOM   1271  N  N   . GLN A  1 167 ? 79.215  -16.279 -15.141 1.00 64.04  ? 167  GLN A N   1 
ATOM   1272  C  CA  . GLN A  1 167 ? 78.968  -14.926 -15.613 1.00 63.24  ? 167  GLN A CA  1 
ATOM   1273  C  C   . GLN A  1 167 ? 80.233  -14.135 -15.889 1.00 61.84  ? 167  GLN A C   1 
ATOM   1274  O  O   . GLN A  1 167 ? 81.262  -14.325 -15.240 1.00 61.78  ? 167  GLN A O   1 
ATOM   1275  C  CB  . GLN A  1 167 ? 78.063  -14.166 -14.649 1.00 65.17  ? 167  GLN A CB  1 
ATOM   1276  C  CG  . GLN A  1 167 ? 78.585  -14.071 -13.229 1.00 67.57  ? 167  GLN A CG  1 
ATOM   1277  C  CD  . GLN A  1 167 ? 77.558  -13.457 -12.291 1.00 71.55  ? 167  GLN A CD  1 
ATOM   1278  O  OE1 . GLN A  1 167 ? 76.933  -12.444 -12.616 1.00 72.18  ? 167  GLN A OE1 1 
ATOM   1279  N  NE2 . GLN A  1 167 ? 77.365  -14.076 -11.130 1.00 72.76  ? 167  GLN A NE2 1 
ATOM   1280  N  N   . PHE A  1 168 ? 80.135  -13.253 -16.876 1.00 59.77  ? 168  PHE A N   1 
ATOM   1281  C  CA  . PHE A  1 168 ? 81.210  -12.348 -17.242 1.00 56.51  ? 168  PHE A CA  1 
ATOM   1282  C  C   . PHE A  1 168 ? 80.601  -11.171 -17.972 1.00 54.60  ? 168  PHE A C   1 
ATOM   1283  O  O   . PHE A  1 168 ? 79.448  -11.235 -18.414 1.00 52.81  ? 168  PHE A O   1 
ATOM   1284  C  CB  . PHE A  1 168 ? 82.233  -13.041 -18.135 1.00 56.40  ? 168  PHE A CB  1 
ATOM   1285  C  CG  . PHE A  1 168 ? 81.660  -13.583 -19.410 1.00 55.97  ? 168  PHE A CG  1 
ATOM   1286  C  CD1 . PHE A  1 168 ? 81.148  -14.864 -19.464 1.00 56.98  ? 168  PHE A CD1 1 
ATOM   1287  C  CD2 . PHE A  1 168 ? 81.643  -12.813 -20.556 1.00 57.23  ? 168  PHE A CD2 1 
ATOM   1288  C  CE1 . PHE A  1 168 ? 80.629  -15.371 -20.640 1.00 58.45  ? 168  PHE A CE1 1 
ATOM   1289  C  CE2 . PHE A  1 168 ? 81.126  -13.310 -21.734 1.00 58.86  ? 168  PHE A CE2 1 
ATOM   1290  C  CZ  . PHE A  1 168 ? 80.618  -14.595 -21.778 1.00 58.94  ? 168  PHE A CZ  1 
ATOM   1291  N  N   . GLU A  1 169 ? 81.367  -10.093 -18.089 1.00 54.90  ? 169  GLU A N   1 
ATOM   1292  C  CA  . GLU A  1 169 ? 80.887  -8.924  -18.811 1.00 55.87  ? 169  GLU A CA  1 
ATOM   1293  C  C   . GLU A  1 169 ? 81.822  -8.510  -19.950 1.00 55.43  ? 169  GLU A C   1 
ATOM   1294  O  O   . GLU A  1 169 ? 83.037  -8.660  -19.854 1.00 56.52  ? 169  GLU A O   1 
ATOM   1295  C  CB  . GLU A  1 169 ? 80.629  -7.757  -17.853 1.00 55.88  ? 169  GLU A CB  1 
ATOM   1296  C  CG  . GLU A  1 169 ? 81.870  -7.127  -17.251 1.00 58.40  ? 169  GLU A CG  1 
ATOM   1297  C  CD  . GLU A  1 169 ? 81.543  -5.866  -16.468 1.00 61.27  ? 169  GLU A CD  1 
ATOM   1298  O  OE1 . GLU A  1 169 ? 82.272  -4.866  -16.634 1.00 60.79  ? 169  GLU A OE1 1 
ATOM   1299  O  OE2 . GLU A  1 169 ? 80.558  -5.876  -15.688 1.00 61.58  ? 169  GLU A OE2 1 
ATOM   1300  N  N   . LYS A  1 170 ? 81.240  -8.013  -21.037 1.00 52.80  ? 170  LYS A N   1 
ATOM   1301  C  CA  . LYS A  1 170 ? 82.018  -7.484  -22.148 1.00 50.23  ? 170  LYS A CA  1 
ATOM   1302  C  C   . LYS A  1 170 ? 81.636  -6.031  -22.358 1.00 50.14  ? 170  LYS A C   1 
ATOM   1303  O  O   . LYS A  1 170 ? 80.739  -5.524  -21.692 1.00 53.41  ? 170  LYS A O   1 
ATOM   1304  C  CB  . LYS A  1 170 ? 81.741  -8.285  -23.418 1.00 48.68  ? 170  LYS A CB  1 
ATOM   1305  C  CG  . LYS A  1 170 ? 82.355  -9.669  -23.418 1.00 49.94  ? 170  LYS A CG  1 
ATOM   1306  C  CD  . LYS A  1 170 ? 83.873  -9.598  -23.407 1.00 51.98  ? 170  LYS A CD  1 
ATOM   1307  C  CE  . LYS A  1 170 ? 84.489  -10.989 -23.327 1.00 54.56  ? 170  LYS A CE  1 
ATOM   1308  N  NZ  . LYS A  1 170 ? 85.971  -10.959 -23.489 1.00 55.41  ? 170  LYS A NZ  1 
ATOM   1309  N  N   . PRO A  1 171 ? 82.297  -5.354  -23.299 1.00 47.17  ? 171  PRO A N   1 
ATOM   1310  C  CA  . PRO A  1 171 ? 81.958  -3.951  -23.545 1.00 45.94  ? 171  PRO A CA  1 
ATOM   1311  C  C   . PRO A  1 171 ? 80.553  -3.778  -24.082 1.00 48.84  ? 171  PRO A C   1 
ATOM   1312  O  O   . PRO A  1 171 ? 79.894  -4.740  -24.459 1.00 50.81  ? 171  PRO A O   1 
ATOM   1313  C  CB  . PRO A  1 171 ? 82.981  -3.522  -24.590 1.00 42.05  ? 171  PRO A CB  1 
ATOM   1314  C  CG  . PRO A  1 171 ? 84.153  -4.384  -24.313 1.00 43.02  ? 171  PRO A CG  1 
ATOM   1315  C  CD  . PRO A  1 171 ? 83.589  -5.716  -23.903 1.00 45.74  ? 171  PRO A CD  1 
ATOM   1316  N  N   . ARG A  1 172 ? 80.098  -2.535  -24.056 1.00 49.38  ? 172  ARG A N   1 
ATOM   1317  C  CA  . ARG A  1 172 ? 78.786  -2.143  -24.536 1.00 50.29  ? 172  ARG A CA  1 
ATOM   1318  C  C   . ARG A  1 172 ? 78.526  -2.655  -25.951 1.00 52.87  ? 172  ARG A C   1 
ATOM   1319  O  O   . ARG A  1 172 ? 79.399  -2.580  -26.816 1.00 53.43  ? 172  ARG A O   1 
ATOM   1320  C  CB  . ARG A  1 172 ? 78.742  -0.621  -24.537 1.00 49.20  ? 172  ARG A CB  1 
ATOM   1321  C  CG  . ARG A  1 172 ? 77.395  -0.015  -24.716 1.00 50.73  ? 172  ARG A CG  1 
ATOM   1322  C  CD  . ARG A  1 172 ? 77.547  1.489   -24.697 1.00 53.21  ? 172  ARG A CD  1 
ATOM   1323  N  NE  . ARG A  1 172 ? 78.199  1.948   -23.474 1.00 52.33  ? 172  ARG A NE  1 
ATOM   1324  C  CZ  . ARG A  1 172 ? 78.590  3.200   -23.269 1.00 48.04  ? 172  ARG A CZ  1 
ATOM   1325  N  NH1 . ARG A  1 172 ? 78.398  4.111   -24.209 1.00 46.63  ? 172  ARG A NH1 1 
ATOM   1326  N  NH2 . ARG A  1 172 ? 79.174  3.537   -22.128 1.00 44.92  ? 172  ARG A NH2 1 
ATOM   1327  N  N   . PHE A  1 173 ? 77.313  -3.153  -26.185 1.00 53.19  ? 173  PHE A N   1 
ATOM   1328  C  CA  . PHE A  1 173 ? 76.916  -3.665  -27.497 1.00 52.31  ? 173  PHE A CA  1 
ATOM   1329  C  C   . PHE A  1 173 ? 77.646  -4.925  -27.930 1.00 50.86  ? 173  PHE A C   1 
ATOM   1330  O  O   . PHE A  1 173 ? 77.799  -5.180  -29.120 1.00 50.40  ? 173  PHE A O   1 
ATOM   1331  C  CB  . PHE A  1 173 ? 77.107  -2.596  -28.573 1.00 53.17  ? 173  PHE A CB  1 
ATOM   1332  C  CG  . PHE A  1 173 ? 75.848  -1.882  -28.933 1.00 56.98  ? 173  PHE A CG  1 
ATOM   1333  C  CD1 . PHE A  1 173 ? 75.747  -1.186  -30.124 1.00 58.09  ? 173  PHE A CD1 1 
ATOM   1334  C  CD2 . PHE A  1 173 ? 74.757  -1.906  -28.075 1.00 59.56  ? 173  PHE A CD2 1 
ATOM   1335  C  CE1 . PHE A  1 173 ? 74.580  -0.527  -30.461 1.00 59.00  ? 173  PHE A CE1 1 
ATOM   1336  C  CE2 . PHE A  1 173 ? 73.587  -1.248  -28.401 1.00 60.66  ? 173  PHE A CE2 1 
ATOM   1337  C  CZ  . PHE A  1 173 ? 73.499  -0.556  -29.601 1.00 60.61  ? 173  PHE A CZ  1 
ATOM   1338  N  N   . SER A  1 174 ? 78.108  -5.703  -26.963 1.00 51.76  ? 174  SER A N   1 
ATOM   1339  C  CA  . SER A  1 174 ? 78.603  -7.046  -27.236 1.00 52.97  ? 174  SER A CA  1 
ATOM   1340  C  C   . SER A  1 174 ? 77.441  -8.011  -27.388 1.00 52.66  ? 174  SER A C   1 
ATOM   1341  O  O   . SER A  1 174 ? 76.341  -7.757  -26.895 1.00 53.82  ? 174  SER A O   1 
ATOM   1342  C  CB  . SER A  1 174 ? 79.550  -7.532  -26.140 1.00 54.56  ? 174  SER A CB  1 
ATOM   1343  O  OG  . SER A  1 174 ? 80.741  -6.768  -26.133 1.00 55.52  ? 174  SER A OG  1 
ATOM   1344  N  N   . SER A  1 175 ? 77.690  -9.107  -28.091 1.00 52.13  ? 175  SER A N   1 
ATOM   1345  C  CA  A SER A  1 175 ? 76.682  -10.130 -28.334 0.50 51.02  ? 175  SER A CA  1 
ATOM   1346  C  CA  B SER A  1 175 ? 76.673  -10.132 -28.289 0.50 51.15  ? 175  SER A CA  1 
ATOM   1347  C  C   . SER A  1 175 ? 77.264  -11.508 -28.022 1.00 50.13  ? 175  SER A C   1 
ATOM   1348  O  O   . SER A  1 175 ? 78.484  -11.656 -27.908 1.00 48.81  ? 175  SER A O   1 
ATOM   1349  C  CB  A SER A  1 175 ? 76.232  -10.067 -29.796 0.50 50.95  ? 175  SER A CB  1 
ATOM   1350  C  CB  B SER A  1 175 ? 76.101  -10.063 -29.709 0.50 51.09  ? 175  SER A CB  1 
ATOM   1351  O  OG  A SER A  1 175 ? 75.259  -11.052 -30.087 0.50 51.95  ? 175  SER A OG  1 
ATOM   1352  O  OG  B SER A  1 175 ? 77.098  -10.315 -30.684 0.50 50.13  ? 175  SER A OG  1 
ATOM   1353  N  N   . GLY A  1 176 ? 76.400  -12.515 -27.888 1.00 47.93  ? 176  GLY A N   1 
ATOM   1354  C  CA  . GLY A  1 176 ? 76.886  -13.877 -27.749 1.00 47.84  ? 176  GLY A CA  1 
ATOM   1355  C  C   . GLY A  1 176 ? 75.878  -14.983 -28.002 1.00 48.29  ? 176  GLY A C   1 
ATOM   1356  O  O   . GLY A  1 176 ? 74.675  -14.825 -27.768 1.00 46.54  ? 176  GLY A O   1 
ATOM   1357  N  N   . ILE A  1 177 ? 76.389  -16.137 -28.426 1.00 49.87  ? 177  ILE A N   1 
ATOM   1358  C  CA  . ILE A  1 177 ? 75.538  -17.267 -28.776 1.00 52.55  ? 177  ILE A CA  1 
ATOM   1359  C  C   . ILE A  1 177 ? 76.212  -18.569 -28.415 1.00 55.07  ? 177  ILE A C   1 
ATOM   1360  O  O   . ILE A  1 177 ? 77.440  -18.646 -28.347 1.00 56.10  ? 177  ILE A O   1 
ATOM   1361  C  CB  . ILE A  1 177 ? 75.226  -17.326 -30.286 1.00 53.83  ? 177  ILE A CB  1 
ATOM   1362  C  CG1 . ILE A  1 177 ? 76.446  -17.832 -31.065 1.00 53.94  ? 177  ILE A CG1 1 
ATOM   1363  C  CG2 . ILE A  1 177 ? 74.749  -15.978 -30.795 1.00 52.86  ? 177  ILE A CG2 1 
ATOM   1364  C  CD1 . ILE A  1 177 ? 76.168  -18.107 -32.513 1.00 50.97  ? 177  ILE A CD1 1 
ATOM   1365  N  N   . TRP A  1 178 ? 75.400  -19.595 -28.193 1.00 59.00  ? 178  TRP A N   1 
ATOM   1366  C  CA  . TRP A  1 178 ? 75.920  -20.927 -27.929 1.00 62.84  ? 178  TRP A CA  1 
ATOM   1367  C  C   . TRP A  1 178 ? 76.611  -21.474 -29.173 1.00 63.53  ? 178  TRP A C   1 
ATOM   1368  O  O   . TRP A  1 178 ? 76.078  -21.384 -30.285 1.00 62.80  ? 178  TRP A O   1 
ATOM   1369  C  CB  . TRP A  1 178 ? 74.801  -21.894 -27.515 1.00 62.17  ? 178  TRP A CB  1 
ATOM   1370  C  CG  . TRP A  1 178 ? 74.386  -21.832 -26.073 1.00 60.38  ? 178  TRP A CG  1 
ATOM   1371  C  CD1 . TRP A  1 178 ? 73.146  -21.539 -25.596 1.00 61.66  ? 178  TRP A CD1 1 
ATOM   1372  C  CD2 . TRP A  1 178 ? 75.206  -22.089 -24.925 1.00 59.32  ? 178  TRP A CD2 1 
ATOM   1373  N  NE1 . TRP A  1 178 ? 73.139  -21.587 -24.224 1.00 62.56  ? 178  TRP A NE1 1 
ATOM   1374  C  CE2 . TRP A  1 178 ? 74.393  -21.921 -23.787 1.00 61.00  ? 178  TRP A CE2 1 
ATOM   1375  C  CE3 . TRP A  1 178 ? 76.548  -22.433 -24.748 1.00 58.10  ? 178  TRP A CE3 1 
ATOM   1376  C  CZ2 . TRP A  1 178 ? 74.876  -22.088 -22.493 1.00 60.51  ? 178  TRP A CZ2 1 
ATOM   1377  C  CZ3 . TRP A  1 178 ? 77.025  -22.601 -23.463 1.00 58.66  ? 178  TRP A CZ3 1 
ATOM   1378  C  CH2 . TRP A  1 178 ? 76.192  -22.427 -22.352 1.00 59.71  ? 178  TRP A CH2 1 
ATOM   1379  N  N   . HIS A  1 179 ? 77.814  -22.003 -28.978 1.00 63.65  ? 179  HIS A N   1 
ATOM   1380  C  CA  . HIS A  1 179 ? 78.418  -22.910 -29.939 1.00 62.95  ? 179  HIS A CA  1 
ATOM   1381  C  C   . HIS A  1 179 ? 78.855  -24.141 -29.158 1.00 59.38  ? 179  HIS A C   1 
ATOM   1382  O  O   . HIS A  1 179 ? 79.839  -24.091 -28.419 1.00 57.88  ? 179  HIS A O   1 
ATOM   1383  C  CB  . HIS A  1 179 ? 79.638  -22.241 -30.562 1.00 65.05  ? 179  HIS A CB  1 
ATOM   1384  C  CG  . HIS A  1 179 ? 80.281  -23.042 -31.646 1.00 68.69  ? 179  HIS A CG  1 
ATOM   1385  N  ND1 . HIS A  1 179 ? 79.646  -23.327 -32.835 1.00 69.88  ? 179  HIS A ND1 1 
ATOM   1386  C  CD2 . HIS A  1 179 ? 81.508  -23.610 -31.728 1.00 70.37  ? 179  HIS A CD2 1 
ATOM   1387  C  CE1 . HIS A  1 179 ? 80.452  -24.039 -33.602 1.00 71.20  ? 179  HIS A CE1 1 
ATOM   1388  N  NE2 . HIS A  1 179 ? 81.588  -24.225 -32.954 1.00 70.97  ? 179  HIS A NE2 1 
ATOM   1389  N  N   . GLY A  1 180 ? 78.176  -25.263 -29.374 1.00 57.90  ? 180  GLY A N   1 
ATOM   1390  C  CA  . GLY A  1 180 ? 78.420  -26.446 -28.567 1.00 59.52  ? 180  GLY A CA  1 
ATOM   1391  C  C   . GLY A  1 180 ? 78.303  -26.147 -27.080 1.00 62.84  ? 180  GLY A C   1 
ATOM   1392  O  O   . GLY A  1 180 ? 77.277  -25.636 -26.615 1.00 62.06  ? 180  GLY A O   1 
ATOM   1393  N  N   . ASP A  1 181 ? 79.346  -26.496 -26.330 1.00 65.05  ? 181  ASP A N   1 
ATOM   1394  C  CA  . ASP A  1 181 ? 79.432  -26.138 -24.918 1.00 66.67  ? 181  ASP A CA  1 
ATOM   1395  C  C   . ASP A  1 181 ? 80.226  -24.850 -24.693 1.00 65.96  ? 181  ASP A C   1 
ATOM   1396  O  O   . ASP A  1 181 ? 80.471  -24.457 -23.557 1.00 68.84  ? 181  ASP A O   1 
ATOM   1397  C  CB  . ASP A  1 181 ? 80.002  -27.290 -24.081 1.00 69.84  ? 181  ASP A CB  1 
ATOM   1398  C  CG  . ASP A  1 181 ? 78.978  -28.393 -23.823 1.00 71.90  ? 181  ASP A CG  1 
ATOM   1399  O  OD1 . ASP A  1 181 ? 77.760  -28.106 -23.846 1.00 70.96  ? 181  ASP A OD1 1 
ATOM   1400  O  OD2 . ASP A  1 181 ? 79.391  -29.549 -23.592 1.00 73.63  ? 181  ASP A OD2 1 
ATOM   1401  N  N   . SER A  1 182 ? 80.653  -24.207 -25.773 1.00 63.89  ? 182  SER A N   1 
ATOM   1402  C  CA  . SER A  1 182 ? 81.317  -22.915 -25.651 1.00 64.53  ? 182  SER A CA  1 
ATOM   1403  C  C   . SER A  1 182 ? 80.377  -21.797 -26.070 1.00 63.91  ? 182  SER A C   1 
ATOM   1404  O  O   . SER A  1 182 ? 79.249  -22.051 -26.487 1.00 65.50  ? 182  SER A O   1 
ATOM   1405  C  CB  . SER A  1 182 ? 82.593  -22.869 -26.495 1.00 68.16  ? 182  SER A CB  1 
ATOM   1406  O  OG  . SER A  1 182 ? 83.558  -23.801 -26.032 1.00 71.13  ? 182  SER A OG  1 
ATOM   1407  N  N   . ILE A  1 183 ? 80.856  -20.561 -25.975 1.00 61.59  ? 183  ILE A N   1 
ATOM   1408  C  CA  . ILE A  1 183 ? 80.054  -19.395 -26.315 1.00 58.71  ? 183  ILE A CA  1 
ATOM   1409  C  C   . ILE A  1 183 ? 80.832  -18.477 -27.228 1.00 58.09  ? 183  ILE A C   1 
ATOM   1410  O  O   . ILE A  1 183 ? 81.944  -18.067 -26.899 1.00 62.00  ? 183  ILE A O   1 
ATOM   1411  C  CB  . ILE A  1 183 ? 79.691  -18.577 -25.066 1.00 58.28  ? 183  ILE A CB  1 
ATOM   1412  C  CG1 . ILE A  1 183 ? 78.929  -19.434 -24.052 1.00 54.61  ? 183  ILE A CG1 1 
ATOM   1413  C  CG2 . ILE A  1 183 ? 78.893  -17.335 -25.457 1.00 58.35  ? 183  ILE A CG2 1 
ATOM   1414  C  CD1 . ILE A  1 183 ? 78.528  -18.674 -22.825 1.00 51.56  ? 183  ILE A CD1 1 
ATOM   1415  N  N   . VAL A  1 184 ? 80.251  -18.149 -28.374 1.00 53.70  ? 184  VAL A N   1 
ATOM   1416  C  CA  . VAL A  1 184 ? 80.889  -17.225 -29.297 1.00 49.28  ? 184  VAL A CA  1 
ATOM   1417  C  C   . VAL A  1 184 ? 80.528  -15.812 -28.887 1.00 46.02  ? 184  VAL A C   1 
ATOM   1418  O  O   . VAL A  1 184 ? 79.354  -15.493 -28.723 1.00 45.07  ? 184  VAL A O   1 
ATOM   1419  C  CB  . VAL A  1 184 ? 80.424  -17.467 -30.737 1.00 47.66  ? 184  VAL A CB  1 
ATOM   1420  C  CG1 . VAL A  1 184 ? 81.268  -16.661 -31.711 1.00 46.43  ? 184  VAL A CG1 1 
ATOM   1421  C  CG2 . VAL A  1 184 ? 80.494  -18.939 -31.060 1.00 47.40  ? 184  VAL A CG2 1 
ATOM   1422  N  N   . VAL A  1 185 ? 81.534  -14.965 -28.716 1.00 46.33  ? 185  VAL A N   1 
ATOM   1423  C  CA  . VAL A  1 185 ? 81.295  -13.603 -28.250 1.00 49.44  ? 185  VAL A CA  1 
ATOM   1424  C  C   . VAL A  1 185 ? 81.745  -12.567 -29.279 1.00 53.70  ? 185  VAL A C   1 
ATOM   1425  O  O   . VAL A  1 185 ? 82.936  -12.433 -29.545 1.00 57.07  ? 185  VAL A O   1 
ATOM   1426  C  CB  . VAL A  1 185 ? 82.027  -13.336 -26.915 1.00 46.70  ? 185  VAL A CB  1 
ATOM   1427  C  CG1 . VAL A  1 185 ? 81.857  -11.886 -26.487 1.00 44.42  ? 185  VAL A CG1 1 
ATOM   1428  C  CG2 . VAL A  1 185 ? 81.530  -14.286 -25.834 1.00 46.25  ? 185  VAL A CG2 1 
ATOM   1429  N  N   . SER A  1 186 ? 80.795  -11.833 -29.853 1.00 52.36  ? 186  SER A N   1 
ATOM   1430  C  CA  . SER A  1 186 ? 81.120  -10.768 -30.797 1.00 50.71  ? 186  SER A CA  1 
ATOM   1431  C  C   . SER A  1 186 ? 81.202  -9.434  -30.073 1.00 50.06  ? 186  SER A C   1 
ATOM   1432  O  O   . SER A  1 186 ? 80.239  -9.001  -29.455 1.00 49.79  ? 186  SER A O   1 
ATOM   1433  C  CB  . SER A  1 186 ? 80.053  -10.667 -31.888 1.00 52.01  ? 186  SER A CB  1 
ATOM   1434  O  OG  . SER A  1 186 ? 79.808  -11.916 -32.507 1.00 55.06  ? 186  SER A OG  1 
ATOM   1435  N  N   . VAL A  1 187 ? 82.341  -8.763  -30.174 1.00 52.15  ? 187  VAL A N   1 
ATOM   1436  C  CA  . VAL A  1 187 ? 82.524  -7.477  -29.501 1.00 50.41  ? 187  VAL A CA  1 
ATOM   1437  C  C   . VAL A  1 187 ? 82.909  -6.377  -30.488 1.00 51.26  ? 187  VAL A C   1 
ATOM   1438  O  O   . VAL A  1 187 ? 83.699  -6.604  -31.405 1.00 49.86  ? 187  VAL A O   1 
ATOM   1439  C  CB  . VAL A  1 187 ? 83.641  -7.575  -28.435 1.00 45.72  ? 187  VAL A CB  1 
ATOM   1440  C  CG1 . VAL A  1 187 ? 83.834  -6.249  -27.729 1.00 41.19  ? 187  VAL A CG1 1 
ATOM   1441  C  CG2 . VAL A  1 187 ? 83.332  -8.685  -27.446 1.00 46.64  ? 187  VAL A CG2 1 
ATOM   1442  N  N   . PRO A  1 188 ? 82.359  -5.171  -30.294 1.00 52.99  ? 188  PRO A N   1 
ATOM   1443  C  CA  . PRO A  1 188 ? 82.756  -4.029  -31.123 1.00 55.39  ? 188  PRO A CA  1 
ATOM   1444  C  C   . PRO A  1 188 ? 84.252  -3.759  -31.003 1.00 58.48  ? 188  PRO A C   1 
ATOM   1445  O  O   . PRO A  1 188 ? 84.813  -3.957  -29.927 1.00 58.43  ? 188  PRO A O   1 
ATOM   1446  C  CB  . PRO A  1 188 ? 81.953  -2.875  -30.518 1.00 52.76  ? 188  PRO A CB  1 
ATOM   1447  C  CG  . PRO A  1 188 ? 80.726  -3.531  -29.982 1.00 51.25  ? 188  PRO A CG  1 
ATOM   1448  C  CD  . PRO A  1 188 ? 81.182  -4.869  -29.460 1.00 51.75  ? 188  PRO A CD  1 
ATOM   1449  N  N   . HIS A  1 189 ? 84.884  -3.323  -32.089 1.00 60.62  ? 189  HIS A N   1 
ATOM   1450  C  CA  . HIS A  1 189 ? 86.320  -3.056  -32.081 1.00 60.31  ? 189  HIS A CA  1 
ATOM   1451  C  C   . HIS A  1 189 ? 86.600  -1.603  -31.708 1.00 61.06  ? 189  HIS A C   1 
ATOM   1452  O  O   . HIS A  1 189 ? 85.888  -0.695  -32.136 1.00 59.64  ? 189  HIS A O   1 
ATOM   1453  C  CB  . HIS A  1 189 ? 86.940  -3.383  -33.442 1.00 58.62  ? 189  HIS A CB  1 
ATOM   1454  C  CG  . HIS A  1 189 ? 88.416  -3.137  -33.509 1.00 57.88  ? 189  HIS A CG  1 
ATOM   1455  N  ND1 . HIS A  1 189 ? 89.345  -4.040  -33.038 1.00 57.54  ? 189  HIS A ND1 1 
ATOM   1456  C  CD2 . HIS A  1 189 ? 89.125  -2.087  -33.988 1.00 56.14  ? 189  HIS A CD2 1 
ATOM   1457  C  CE1 . HIS A  1 189 ? 90.560  -3.558  -33.225 1.00 55.75  ? 189  HIS A CE1 1 
ATOM   1458  N  NE2 . HIS A  1 189 ? 90.455  -2.374  -33.799 1.00 54.83  ? 189  HIS A NE2 1 
ATOM   1459  N  N   . ARG A  1 190 ? 87.637  -1.387  -30.907 1.00 63.49  ? 190  ARG A N   1 
ATOM   1460  C  CA  . ARG A  1 190 ? 87.953  -0.045  -30.433 1.00 64.66  ? 190  ARG A CA  1 
ATOM   1461  C  C   . ARG A  1 190 ? 89.235  0.495   -31.048 1.00 65.60  ? 190  ARG A C   1 
ATOM   1462  O  O   . ARG A  1 190 ? 90.305  -0.092  -30.893 1.00 66.00  ? 190  ARG A O   1 
ATOM   1463  C  CB  . ARG A  1 190 ? 88.063  -0.025  -28.903 1.00 64.47  ? 190  ARG A CB  1 
ATOM   1464  C  CG  . ARG A  1 190 ? 88.423  1.341   -28.324 1.00 65.29  ? 190  ARG A CG  1 
ATOM   1465  C  CD  . ARG A  1 190 ? 88.488  1.304   -26.797 1.00 66.86  ? 190  ARG A CD  1 
ATOM   1466  N  NE  . ARG A  1 190 ? 87.252  0.788   -26.209 1.00 68.43  ? 190  ARG A NE  1 
ATOM   1467  C  CZ  . ARG A  1 190 ? 86.192  1.537   -25.914 1.00 68.59  ? 190  ARG A CZ  1 
ATOM   1468  N  NH1 . ARG A  1 190 ? 86.216  2.845   -26.145 1.00 66.76  ? 190  ARG A NH1 1 
ATOM   1469  N  NH2 . ARG A  1 190 ? 85.104  0.983   -25.388 1.00 69.15  ? 190  ARG A NH2 1 
ATOM   1470  N  N   . ASP A  1 191 ? 89.125  1.619   -31.745 1.00 67.30  ? 191  ASP A N   1 
ATOM   1471  C  CA  . ASP A  1 191 ? 90.313  2.325   -32.196 1.00 70.37  ? 191  ASP A CA  1 
ATOM   1472  C  C   . ASP A  1 191 ? 90.472  3.585   -31.356 1.00 67.35  ? 191  ASP A C   1 
ATOM   1473  O  O   . ASP A  1 191 ? 91.290  3.638   -30.435 1.00 69.36  ? 191  ASP A O   1 
ATOM   1474  C  CB  . ASP A  1 191 ? 90.200  2.680   -33.680 1.00 74.75  ? 191  ASP A CB  1 
ATOM   1475  C  CG  . ASP A  1 191 ? 90.518  1.504   -34.589 1.00 79.13  ? 191  ASP A CG  1 
ATOM   1476  O  OD1 . ASP A  1 191 ? 91.474  0.750   -34.291 1.00 80.89  ? 191  ASP A OD1 1 
ATOM   1477  O  OD2 . ASP A  1 191 ? 89.809  1.335   -35.604 1.00 79.91  ? 191  ASP A OD2 1 
ATOM   1478  N  N   . VAL A  1 192 ? 89.653  4.582   -31.650 1.00 60.46  ? 192  VAL A N   1 
ATOM   1479  C  CA  . VAL A  1 192 ? 89.582  5.775   -30.828 1.00 57.54  ? 192  VAL A CA  1 
ATOM   1480  C  C   . VAL A  1 192 ? 88.310  5.628   -30.016 1.00 58.78  ? 192  VAL A C   1 
ATOM   1481  O  O   . VAL A  1 192 ? 88.326  5.571   -28.787 1.00 60.25  ? 192  VAL A O   1 
ATOM   1482  C  CB  . VAL A  1 192 ? 89.511  7.046   -31.678 1.00 54.30  ? 192  VAL A CB  1 
ATOM   1483  C  CG1 . VAL A  1 192 ? 89.396  8.280   -30.773 1.00 53.79  ? 192  VAL A CG1 1 
ATOM   1484  C  CG2 . VAL A  1 192 ? 90.717  7.142   -32.612 1.00 47.23  ? 192  VAL A CG2 1 
ATOM   1485  N  N   . ILE A  1 193 ? 87.203  5.573   -30.742 1.00 57.44  ? 193  ILE A N   1 
ATOM   1486  C  CA  . ILE A  1 193 ? 85.906  5.255   -30.189 1.00 55.15  ? 193  ILE A CA  1 
ATOM   1487  C  C   . ILE A  1 193 ? 85.549  3.912   -30.795 1.00 55.62  ? 193  ILE A C   1 
ATOM   1488  O  O   . ILE A  1 193 ? 86.099  3.538   -31.830 1.00 54.67  ? 193  ILE A O   1 
ATOM   1489  C  CB  . ILE A  1 193 ? 84.858  6.287   -30.614 1.00 54.62  ? 193  ILE A CB  1 
ATOM   1490  C  CG1 . ILE A  1 193 ? 84.761  6.342   -32.137 1.00 54.24  ? 193  ILE A CG1 1 
ATOM   1491  C  CG2 . ILE A  1 193 ? 85.213  7.661   -30.078 1.00 55.39  ? 193  ILE A CG2 1 
ATOM   1492  C  CD1 . ILE A  1 193 ? 83.630  7.209   -32.646 1.00 52.96  ? 193  ILE A CD1 1 
ATOM   1493  N  N   . PRO A  1 194 ? 84.675  3.147   -30.126 1.00 57.10  ? 194  PRO A N   1 
ATOM   1494  C  CA  . PRO A  1 194 ? 84.271  1.858   -30.697 1.00 58.64  ? 194  PRO A CA  1 
ATOM   1495  C  C   . PRO A  1 194 ? 83.684  2.049   -32.095 1.00 61.57  ? 194  PRO A C   1 
ATOM   1496  O  O   . PRO A  1 194 ? 82.957  3.022   -32.327 1.00 59.77  ? 194  PRO A O   1 
ATOM   1497  C  CB  . PRO A  1 194 ? 83.183  1.375   -29.732 1.00 56.11  ? 194  PRO A CB  1 
ATOM   1498  C  CG  . PRO A  1 194 ? 83.470  2.073   -28.457 1.00 56.15  ? 194  PRO A CG  1 
ATOM   1499  C  CD  . PRO A  1 194 ? 84.005  3.419   -28.845 1.00 56.31  ? 194  PRO A CD  1 
ATOM   1500  N  N   . ARG A  1 195 ? 83.972  1.133   -33.015 1.00 64.17  ? 195  ARG A N   1 
ATOM   1501  C  CA  . ARG A  1 195 ? 83.434  1.281   -34.352 1.00 64.21  ? 195  ARG A CA  1 
ATOM   1502  C  C   . ARG A  1 195 ? 82.240  0.361   -34.414 1.00 63.30  ? 195  ARG A C   1 
ATOM   1503  O  O   . ARG A  1 195 ? 82.384  -0.852  -34.538 1.00 64.90  ? 195  ARG A O   1 
ATOM   1504  C  CB  . ARG A  1 195 ? 84.467  0.836   -35.387 1.00 65.75  ? 195  ARG A CB  1 
ATOM   1505  C  CG  . ARG A  1 195 ? 85.895  1.246   -35.072 1.00 67.40  ? 195  ARG A CG  1 
ATOM   1506  C  CD  . ARG A  1 195 ? 86.076  2.741   -35.218 1.00 71.43  ? 195  ARG A CD  1 
ATOM   1507  N  NE  . ARG A  1 195 ? 85.724  3.185   -36.562 1.00 77.56  ? 195  ARG A NE  1 
ATOM   1508  C  CZ  . ARG A  1 195 ? 86.548  3.129   -37.607 1.00 83.06  ? 195  ARG A CZ  1 
ATOM   1509  N  NH1 . ARG A  1 195 ? 87.781  2.649   -37.464 1.00 84.95  ? 195  ARG A NH1 1 
ATOM   1510  N  NH2 . ARG A  1 195 ? 86.143  3.550   -38.798 1.00 83.68  ? 195  ARG A NH2 1 
ATOM   1511  N  N   . TYR A  1 196 ? 81.055  0.958   -34.387 1.00 61.78  ? 196  TYR A N   1 
ATOM   1512  C  CA  . TYR A  1 196 ? 79.826  0.190   -34.298 1.00 60.27  ? 196  TYR A CA  1 
ATOM   1513  C  C   . TYR A  1 196 ? 79.293  -0.066  -35.694 1.00 61.51  ? 196  TYR A C   1 
ATOM   1514  O  O   . TYR A  1 196 ? 79.295  0.830   -36.540 1.00 61.40  ? 196  TYR A O   1 
ATOM   1515  C  CB  . TYR A  1 196 ? 78.765  0.922   -33.475 1.00 57.17  ? 196  TYR A CB  1 
ATOM   1516  C  CG  . TYR A  1 196 ? 79.086  1.110   -32.011 1.00 56.06  ? 196  TYR A CG  1 
ATOM   1517  C  CD1 . TYR A  1 196 ? 79.268  2.380   -31.484 1.00 55.26  ? 196  TYR A CD1 1 
ATOM   1518  C  CD2 . TYR A  1 196 ? 79.182  0.025   -31.150 1.00 56.38  ? 196  TYR A CD2 1 
ATOM   1519  C  CE1 . TYR A  1 196 ? 79.549  2.570   -30.151 1.00 54.52  ? 196  TYR A CE1 1 
ATOM   1520  C  CE2 . TYR A  1 196 ? 79.465  0.206   -29.805 1.00 56.14  ? 196  TYR A CE2 1 
ATOM   1521  C  CZ  . TYR A  1 196 ? 79.647  1.485   -29.314 1.00 56.84  ? 196  TYR A CZ  1 
ATOM   1522  O  OH  . TYR A  1 196 ? 79.929  1.694   -27.981 1.00 59.22  ? 196  TYR A OH  1 
ATOM   1523  N  N   . PHE A  1 197 ? 78.843  -1.296  -35.915 1.00 61.92  ? 197  PHE A N   1 
ATOM   1524  C  CA  . PHE A  1 197 ? 78.306  -1.743  -37.195 1.00 62.77  ? 197  PHE A CA  1 
ATOM   1525  C  C   . PHE A  1 197 ? 79.352  -1.683  -38.299 1.00 61.96  ? 197  PHE A C   1 
ATOM   1526  O  O   . PHE A  1 197 ? 79.011  -1.641  -39.480 1.00 63.25  ? 197  PHE A O   1 
ATOM   1527  C  CB  . PHE A  1 197 ? 77.093  -0.897  -37.589 1.00 66.19  ? 197  PHE A CB  1 
ATOM   1528  C  CG  . PHE A  1 197 ? 76.013  -0.857  -36.546 1.00 68.50  ? 197  PHE A CG  1 
ATOM   1529  C  CD1 . PHE A  1 197 ? 76.050  0.080   -35.527 1.00 69.77  ? 197  PHE A CD1 1 
ATOM   1530  C  CD2 . PHE A  1 197 ? 74.956  -1.752  -36.588 1.00 69.76  ? 197  PHE A CD2 1 
ATOM   1531  C  CE1 . PHE A  1 197 ? 75.054  0.121   -34.566 1.00 71.21  ? 197  PHE A CE1 1 
ATOM   1532  C  CE2 . PHE A  1 197 ? 73.956  -1.717  -35.632 1.00 70.76  ? 197  PHE A CE2 1 
ATOM   1533  C  CZ  . PHE A  1 197 ? 74.005  -0.780  -34.619 1.00 71.37  ? 197  PHE A CZ  1 
ATOM   1534  N  N   . LYS A  1 198 ? 80.623  -1.704  -37.912 1.00 61.29  ? 198  LYS A N   1 
ATOM   1535  C  CA  . LYS A  1 198 ? 81.722  -1.686  -38.872 1.00 59.59  ? 198  LYS A CA  1 
ATOM   1536  C  C   . LYS A  1 198 ? 82.720  -2.813  -38.600 1.00 59.60  ? 198  LYS A C   1 
ATOM   1537  O  O   . LYS A  1 198 ? 82.901  -3.698  -39.433 1.00 59.81  ? 198  LYS A O   1 
ATOM   1538  C  CB  . LYS A  1 198 ? 82.409  -0.315  -38.907 1.00 58.40  ? 198  LYS A CB  1 
ATOM   1539  C  CG  . LYS A  1 198 ? 83.551  -0.193  -39.920 1.00 59.04  ? 198  LYS A CG  1 
ATOM   1540  C  CD  . LYS A  1 198 ? 83.067  -0.212  -41.363 1.00 61.54  ? 198  LYS A CD  1 
ATOM   1541  C  CE  . LYS A  1 198 ? 83.332  1.122   -42.070 1.00 63.02  ? 198  LYS A CE  1 
ATOM   1542  N  NZ  . LYS A  1 198 ? 84.786  1.444   -42.232 1.00 63.27  ? 198  LYS A NZ  1 
ATOM   1543  N  N   . TYR A  1 199 ? 83.376  -2.775  -37.442 1.00 59.23  ? 199  TYR A N   1 
ATOM   1544  C  CA  . TYR A  1 199 ? 84.364  -3.799  -37.107 1.00 60.72  ? 199  TYR A CA  1 
ATOM   1545  C  C   . TYR A  1 199 ? 84.107  -4.496  -35.761 1.00 59.39  ? 199  TYR A C   1 
ATOM   1546  O  O   . TYR A  1 199 ? 83.674  -3.866  -34.791 1.00 58.47  ? 199  TYR A O   1 
ATOM   1547  C  CB  . TYR A  1 199 ? 85.778  -3.210  -37.133 1.00 63.05  ? 199  TYR A CB  1 
ATOM   1548  C  CG  . TYR A  1 199 ? 86.195  -2.613  -38.462 1.00 65.84  ? 199  TYR A CG  1 
ATOM   1549  C  CD1 . TYR A  1 199 ? 86.336  -1.238  -38.615 1.00 66.28  ? 199  TYR A CD1 1 
ATOM   1550  C  CD2 . TYR A  1 199 ? 86.463  -3.423  -39.558 1.00 68.29  ? 199  TYR A CD2 1 
ATOM   1551  C  CE1 . TYR A  1 199 ? 86.726  -0.687  -39.823 1.00 67.20  ? 199  TYR A CE1 1 
ATOM   1552  C  CE2 . TYR A  1 199 ? 86.853  -2.879  -40.773 1.00 69.49  ? 199  TYR A CE2 1 
ATOM   1553  C  CZ  . TYR A  1 199 ? 86.982  -1.511  -40.901 1.00 69.48  ? 199  TYR A CZ  1 
ATOM   1554  O  OH  . TYR A  1 199 ? 87.368  -0.963  -42.109 1.00 70.37  ? 199  TYR A OH  1 
ATOM   1555  N  N   . TRP A  1 200 ? 84.386  -5.798  -35.717 1.00 56.92  ? 200  TRP A N   1 
ATOM   1556  C  CA  . TRP A  1 200 ? 84.195  -6.612  -34.517 1.00 53.07  ? 200  TRP A CA  1 
ATOM   1557  C  C   . TRP A  1 200 ? 85.425  -7.454  -34.220 1.00 50.63  ? 200  TRP A C   1 
ATOM   1558  O  O   . TRP A  1 200 ? 86.180  -7.800  -35.119 1.00 49.56  ? 200  TRP A O   1 
ATOM   1559  C  CB  . TRP A  1 200 ? 83.012  -7.572  -34.687 1.00 53.24  ? 200  TRP A CB  1 
ATOM   1560  C  CG  . TRP A  1 200 ? 81.649  -6.943  -34.587 1.00 55.20  ? 200  TRP A CG  1 
ATOM   1561  C  CD1 . TRP A  1 200 ? 80.899  -6.772  -33.454 1.00 55.59  ? 200  TRP A CD1 1 
ATOM   1562  C  CD2 . TRP A  1 200 ? 80.865  -6.426  -35.667 1.00 55.03  ? 200  TRP A CD2 1 
ATOM   1563  N  NE1 . TRP A  1 200 ? 79.702  -6.170  -33.764 1.00 55.28  ? 200  TRP A NE1 1 
ATOM   1564  C  CE2 . TRP A  1 200 ? 79.658  -5.947  -35.116 1.00 54.87  ? 200  TRP A CE2 1 
ATOM   1565  C  CE3 . TRP A  1 200 ? 81.069  -6.315  -37.045 1.00 53.75  ? 200  TRP A CE3 1 
ATOM   1566  C  CZ2 . TRP A  1 200 ? 78.662  -5.367  -35.898 1.00 53.15  ? 200  TRP A CZ2 1 
ATOM   1567  C  CZ3 . TRP A  1 200 ? 80.076  -5.738  -37.818 1.00 53.21  ? 200  TRP A CZ3 1 
ATOM   1568  C  CH2 . TRP A  1 200 ? 78.890  -5.272  -37.243 1.00 52.64  ? 200  TRP A CH2 1 
ATOM   1569  N  N   . ASP A  1 201 ? 85.617  -7.785  -32.949 1.00 51.43  ? 201  ASP A N   1 
ATOM   1570  C  CA  . ASP A  1 201 ? 86.536  -8.845  -32.571 1.00 51.78  ? 201  ASP A CA  1 
ATOM   1571  C  C   . ASP A  1 201 ? 85.661  -9.991  -32.090 1.00 51.65  ? 201  ASP A C   1 
ATOM   1572  O  O   . ASP A  1 201 ? 84.668  -9.765  -31.397 1.00 48.97  ? 201  ASP A O   1 
ATOM   1573  C  CB  . ASP A  1 201 ? 87.475  -8.384  -31.461 1.00 54.35  ? 201  ASP A CB  1 
ATOM   1574  C  CG  . ASP A  1 201 ? 88.218  -7.123  -31.821 1.00 58.09  ? 201  ASP A CG  1 
ATOM   1575  O  OD1 . ASP A  1 201 ? 88.450  -6.902  -33.027 1.00 59.87  ? 201  ASP A OD1 1 
ATOM   1576  O  OD2 . ASP A  1 201 ? 88.567  -6.351  -30.904 1.00 59.66  ? 201  ASP A OD2 1 
ATOM   1577  N  N   . ILE A  1 202 ? 86.007  -11.216 -32.475 1.00 52.26  ? 202  ILE A N   1 
ATOM   1578  C  CA  . ILE A  1 202 ? 85.173  -12.371 -32.166 1.00 50.06  ? 202  ILE A CA  1 
ATOM   1579  C  C   . ILE A  1 202 ? 85.945  -13.368 -31.310 1.00 51.90  ? 202  ILE A C   1 
ATOM   1580  O  O   . ILE A  1 202 ? 87.054  -13.747 -31.653 1.00 55.32  ? 202  ILE A O   1 
ATOM   1581  C  CB  . ILE A  1 202 ? 84.675  -13.041 -33.462 1.00 47.66  ? 202  ILE A CB  1 
ATOM   1582  C  CG1 . ILE A  1 202 ? 84.041  -11.994 -34.384 1.00 47.14  ? 202  ILE A CG1 1 
ATOM   1583  C  CG2 . ILE A  1 202 ? 83.698  -14.163 -33.156 1.00 46.14  ? 202  ILE A CG2 1 
ATOM   1584  C  CD1 . ILE A  1 202 ? 83.263  -12.574 -35.546 1.00 47.92  ? 202  ILE A CD1 1 
ATOM   1585  N  N   . TYR A  1 203 ? 85.365  -13.787 -30.192 1.00 53.23  ? 203  TYR A N   1 
ATOM   1586  C  CA  . TYR A  1 203 ? 86.067  -14.666 -29.259 1.00 57.12  ? 203  TYR A CA  1 
ATOM   1587  C  C   . TYR A  1 203 ? 85.317  -15.969 -29.052 1.00 59.44  ? 203  TYR A C   1 
ATOM   1588  O  O   . TYR A  1 203 ? 84.117  -16.062 -29.315 1.00 61.53  ? 203  TYR A O   1 
ATOM   1589  C  CB  . TYR A  1 203 ? 86.281  -13.980 -27.901 1.00 58.89  ? 203  TYR A CB  1 
ATOM   1590  C  CG  . TYR A  1 203 ? 86.977  -12.639 -27.986 1.00 61.65  ? 203  TYR A CG  1 
ATOM   1591  C  CD1 . TYR A  1 203 ? 88.351  -12.527 -27.802 1.00 63.99  ? 203  TYR A CD1 1 
ATOM   1592  C  CD2 . TYR A  1 203 ? 86.258  -11.483 -28.257 1.00 62.20  ? 203  TYR A CD2 1 
ATOM   1593  C  CE1 . TYR A  1 203 ? 88.989  -11.294 -27.886 1.00 64.03  ? 203  TYR A CE1 1 
ATOM   1594  C  CE2 . TYR A  1 203 ? 86.884  -10.251 -28.343 1.00 62.76  ? 203  TYR A CE2 1 
ATOM   1595  C  CZ  . TYR A  1 203 ? 88.246  -10.161 -28.158 1.00 62.75  ? 203  TYR A CZ  1 
ATOM   1596  O  OH  . TYR A  1 203 ? 88.854  -8.930  -28.251 1.00 60.96  ? 203  TYR A OH  1 
ATOM   1597  N  N   . LEU A  1 204 ? 86.040  -16.976 -28.583 1.00 59.73  ? 204  LEU A N   1 
ATOM   1598  C  CA  . LEU A  1 204 ? 85.438  -18.248 -28.232 1.00 61.64  ? 204  LEU A CA  1 
ATOM   1599  C  C   . LEU A  1 204 ? 85.615  -18.439 -26.737 1.00 65.22  ? 204  LEU A C   1 
ATOM   1600  O  O   . LEU A  1 204 ? 86.737  -18.559 -26.248 1.00 67.78  ? 204  LEU A O   1 
ATOM   1601  C  CB  . LEU A  1 204 ? 86.100  -19.388 -29.003 1.00 61.26  ? 204  LEU A CB  1 
ATOM   1602  C  CG  . LEU A  1 204 ? 85.271  -20.671 -29.054 1.00 61.63  ? 204  LEU A CG  1 
ATOM   1603  C  CD1 . LEU A  1 204 ? 83.917  -20.387 -29.691 1.00 62.11  ? 204  LEU A CD1 1 
ATOM   1604  C  CD2 . LEU A  1 204 ? 86.003  -21.770 -29.806 1.00 59.84  ? 204  LEU A CD2 1 
ATOM   1605  N  N   . TRP A  1 205 ? 84.505  -18.458 -26.011 1.00 65.52  ? 205  TRP A N   1 
ATOM   1606  C  CA  . TRP A  1 205 ? 84.547  -18.437 -24.556 1.00 67.29  ? 205  TRP A CA  1 
ATOM   1607  C  C   . TRP A  1 205 ? 84.145  -19.792 -23.975 1.00 70.54  ? 205  TRP A C   1 
ATOM   1608  O  O   . TRP A  1 205 ? 83.122  -20.359 -24.359 1.00 72.65  ? 205  TRP A O   1 
ATOM   1609  C  CB  . TRP A  1 205 ? 83.609  -17.338 -24.046 1.00 65.51  ? 205  TRP A CB  1 
ATOM   1610  C  CG  . TRP A  1 205 ? 83.822  -16.922 -22.616 1.00 66.02  ? 205  TRP A CG  1 
ATOM   1611  C  CD1 . TRP A  1 205 ? 84.549  -15.853 -22.168 1.00 64.77  ? 205  TRP A CD1 1 
ATOM   1612  C  CD2 . TRP A  1 205 ? 83.283  -17.556 -21.450 1.00 66.58  ? 205  TRP A CD2 1 
ATOM   1613  N  NE1 . TRP A  1 205 ? 84.501  -15.791 -20.796 1.00 63.31  ? 205  TRP A NE1 1 
ATOM   1614  C  CE2 . TRP A  1 205 ? 83.731  -16.825 -20.331 1.00 64.33  ? 205  TRP A CE2 1 
ATOM   1615  C  CE3 . TRP A  1 205 ? 82.469  -18.676 -21.243 1.00 67.96  ? 205  TRP A CE3 1 
ATOM   1616  C  CZ2 . TRP A  1 205 ? 83.390  -17.178 -19.025 1.00 64.60  ? 205  TRP A CZ2 1 
ATOM   1617  C  CZ3 . TRP A  1 205 ? 82.132  -19.026 -19.941 1.00 65.82  ? 205  TRP A CZ3 1 
ATOM   1618  C  CH2 . TRP A  1 205 ? 82.592  -18.278 -18.852 1.00 64.55  ? 205  TRP A CH2 1 
ATOM   1619  N  N   . LYS A  1 206 ? 84.976  -20.334 -23.089 1.00 70.60  ? 206  LYS A N   1 
ATOM   1620  C  CA  . LYS A  1 206 ? 84.578  -21.496 -22.294 1.00 72.57  ? 206  LYS A CA  1 
ATOM   1621  C  C   . LYS A  1 206 ? 85.239  -21.503 -20.919 1.00 74.27  ? 206  LYS A C   1 
ATOM   1622  O  O   . LYS A  1 206 ? 86.417  -21.172 -20.783 1.00 73.72  ? 206  LYS A O   1 
ATOM   1623  C  CB  . LYS A  1 206 ? 84.880  -22.803 -23.036 1.00 72.39  ? 206  LYS A CB  1 
ATOM   1624  C  CG  . LYS A  1 206 ? 84.356  -24.052 -22.343 1.00 72.02  ? 206  LYS A CG  1 
ATOM   1625  C  CD  . LYS A  1 206 ? 84.711  -25.302 -23.130 1.00 74.54  ? 206  LYS A CD  1 
ATOM   1626  C  CE  . LYS A  1 206 ? 84.187  -26.559 -22.455 1.00 75.96  ? 206  LYS A CE  1 
ATOM   1627  N  N   . ASP A  1 207 ? 84.475  -21.890 -19.903 1.00 76.90  ? 207  ASP A N   1 
ATOM   1628  C  CA  . ASP A  1 207 ? 85.017  -22.095 -18.564 1.00 80.55  ? 207  ASP A CA  1 
ATOM   1629  C  C   . ASP A  1 207 ? 85.913  -20.941 -18.108 1.00 80.34  ? 207  ASP A C   1 
ATOM   1630  O  O   . ASP A  1 207 ? 86.926  -21.158 -17.450 1.00 81.07  ? 207  ASP A O   1 
ATOM   1631  C  CB  . ASP A  1 207 ? 85.775  -23.427 -18.474 1.00 85.04  ? 207  ASP A CB  1 
ATOM   1632  C  CG  . ASP A  1 207 ? 84.893  -24.628 -18.781 1.00 87.04  ? 207  ASP A CG  1 
ATOM   1633  O  OD1 . ASP A  1 207 ? 83.658  -24.518 -18.606 1.00 86.96  ? 207  ASP A OD1 1 
ATOM   1634  O  OD2 . ASP A  1 207 ? 85.440  -25.679 -19.193 1.00 86.61  ? 207  ASP A OD2 1 
ATOM   1635  N  N   . GLY A  1 208 ? 85.549  -19.718 -18.472 1.00 79.42  ? 208  GLY A N   1 
ATOM   1636  C  CA  . GLY A  1 208 ? 86.243  -18.549 -17.965 1.00 78.66  ? 208  GLY A CA  1 
ATOM   1637  C  C   . GLY A  1 208 ? 87.476  -18.140 -18.746 1.00 80.39  ? 208  GLY A C   1 
ATOM   1638  O  O   . GLY A  1 208 ? 88.143  -17.175 -18.379 1.00 80.81  ? 208  GLY A O   1 
ATOM   1639  N  N   . GLU A  1 209 ? 87.783  -18.871 -19.815 1.00 82.08  ? 209  GLU A N   1 
ATOM   1640  C  CA  . GLU A  1 209 ? 88.910  -18.531 -20.688 1.00 81.05  ? 209  GLU A CA  1 
ATOM   1641  C  C   . GLU A  1 209 ? 88.468  -18.406 -22.137 1.00 76.52  ? 209  GLU A C   1 
ATOM   1642  O  O   . GLU A  1 209 ? 87.457  -18.984 -22.535 1.00 75.76  ? 209  GLU A O   1 
ATOM   1643  C  CB  . GLU A  1 209 ? 90.027  -19.563 -20.557 1.00 84.49  ? 209  GLU A CB  1 
ATOM   1644  C  CG  . GLU A  1 209 ? 90.806  -19.420 -19.263 1.00 88.52  ? 209  GLU A CG  1 
ATOM   1645  C  CD  . GLU A  1 209 ? 91.499  -20.698 -18.845 1.00 92.36  ? 209  GLU A CD  1 
ATOM   1646  O  OE1 . GLU A  1 209 ? 92.299  -20.650 -17.886 1.00 92.11  ? 209  GLU A OE1 1 
ATOM   1647  O  OE2 . GLU A  1 209 ? 91.240  -21.750 -19.469 1.00 94.80  ? 209  GLU A OE2 1 
ATOM   1648  N  N   . GLU A  1 210 ? 89.222  -17.646 -22.925 1.00 74.00  ? 210  GLU A N   1 
ATOM   1649  C  CA  . GLU A  1 210 ? 88.828  -17.389 -24.307 1.00 72.35  ? 210  GLU A CA  1 
ATOM   1650  C  C   . GLU A  1 210 ? 90.003  -17.259 -25.269 1.00 68.77  ? 210  GLU A C   1 
ATOM   1651  O  O   . GLU A  1 210 ? 91.078  -16.789 -24.900 1.00 68.53  ? 210  GLU A O   1 
ATOM   1652  C  CB  . GLU A  1 210 ? 87.968  -16.130 -24.383 1.00 73.82  ? 210  GLU A CB  1 
ATOM   1653  C  CG  . GLU A  1 210 ? 88.730  -14.854 -24.102 1.00 75.52  ? 210  GLU A CG  1 
ATOM   1654  C  CD  . GLU A  1 210 ? 87.820  -13.655 -24.019 1.00 77.81  ? 210  GLU A CD  1 
ATOM   1655  O  OE1 . GLU A  1 210 ? 88.335  -12.517 -24.034 1.00 79.56  ? 210  GLU A OE1 1 
ATOM   1656  O  OE2 . GLU A  1 210 ? 86.589  -13.854 -23.934 1.00 77.63  ? 210  GLU A OE2 1 
ATOM   1657  N  N   . GLU A  1 211 ? 89.773  -17.675 -26.511 1.00 66.58  ? 211  GLU A N   1 
ATOM   1658  C  CA  . GLU A  1 211 ? 90.744  -17.511 -27.587 1.00 65.99  ? 211  GLU A CA  1 
ATOM   1659  C  C   . GLU A  1 211 ? 90.128  -16.626 -28.674 1.00 65.62  ? 211  GLU A C   1 
ATOM   1660  O  O   . GLU A  1 211 ? 88.933  -16.725 -28.954 1.00 66.62  ? 211  GLU A O   1 
ATOM   1661  C  CB  . GLU A  1 211 ? 91.147  -18.874 -28.164 1.00 64.53  ? 211  GLU A CB  1 
ATOM   1662  N  N   . LYS A  1 212 ? 90.927  -15.751 -29.278 1.00 63.82  ? 212  LYS A N   1 
ATOM   1663  C  CA  . LYS A  1 212 ? 90.395  -14.842 -30.292 1.00 64.33  ? 212  LYS A CA  1 
ATOM   1664  C  C   . LYS A  1 212 ? 90.278  -15.506 -31.671 1.00 63.93  ? 212  LYS A C   1 
ATOM   1665  O  O   . LYS A  1 212 ? 91.258  -16.001 -32.224 1.00 63.65  ? 212  LYS A O   1 
ATOM   1666  C  CB  . LYS A  1 212 ? 91.239  -13.566 -30.374 1.00 65.66  ? 212  LYS A CB  1 
ATOM   1667  C  CG  . LYS A  1 212 ? 90.621  -12.462 -31.232 1.00 67.25  ? 212  LYS A CG  1 
ATOM   1668  C  CD  . LYS A  1 212 ? 91.538  -11.245 -31.350 1.00 69.53  ? 212  LYS A CD  1 
ATOM   1669  C  CE  . LYS A  1 212 ? 91.528  -10.400 -30.082 1.00 72.44  ? 212  LYS A CE  1 
ATOM   1670  N  NZ  . LYS A  1 212 ? 92.513  -9.278  -30.136 1.00 73.06  ? 212  LYS A NZ  1 
ATOM   1671  N  N   . LEU A  1 213 ? 89.059  -15.541 -32.199 1.00 62.97  ? 213  LEU A N   1 
ATOM   1672  C  CA  . LEU A  1 213 ? 88.789  -16.081 -33.527 1.00 62.36  ? 213  LEU A CA  1 
ATOM   1673  C  C   . LEU A  1 213 ? 89.071  -15.098 -34.657 1.00 66.53  ? 213  LEU A C   1 
ATOM   1674  O  O   . LEU A  1 213 ? 89.535  -15.491 -35.726 1.00 70.31  ? 213  LEU A O   1 
ATOM   1675  C  CB  . LEU A  1 213 ? 87.347  -16.560 -33.617 1.00 60.28  ? 213  LEU A CB  1 
ATOM   1676  C  CG  . LEU A  1 213 ? 87.042  -17.724 -32.685 1.00 60.63  ? 213  LEU A CG  1 
ATOM   1677  C  CD1 . LEU A  1 213 ? 85.547  -17.839 -32.443 1.00 61.29  ? 213  LEU A CD1 1 
ATOM   1678  C  CD2 . LEU A  1 213 ? 87.615  -19.004 -33.263 1.00 61.31  ? 213  LEU A CD2 1 
ATOM   1679  N  N   . PHE A  1 214 ? 88.755  -13.826 -34.440 1.00 65.84  ? 214  PHE A N   1 
ATOM   1680  C  CA  . PHE A  1 214 ? 88.871  -12.841 -35.507 1.00 66.47  ? 214  PHE A CA  1 
ATOM   1681  C  C   . PHE A  1 214 ? 89.259  -11.480 -34.969 1.00 68.40  ? 214  PHE A C   1 
ATOM   1682  O  O   . PHE A  1 214 ? 88.872  -11.110 -33.863 1.00 69.70  ? 214  PHE A O   1 
ATOM   1683  C  CB  . PHE A  1 214 ? 87.545  -12.710 -36.259 1.00 66.10  ? 214  PHE A CB  1 
ATOM   1684  C  CG  . PHE A  1 214 ? 87.169  -13.924 -37.051 1.00 66.74  ? 214  PHE A CG  1 
ATOM   1685  C  CD1 . PHE A  1 214 ? 86.531  -14.993 -36.447 1.00 67.37  ? 214  PHE A CD1 1 
ATOM   1686  C  CD2 . PHE A  1 214 ? 87.436  -13.988 -38.409 1.00 68.98  ? 214  PHE A CD2 1 
ATOM   1687  C  CE1 . PHE A  1 214 ? 86.177  -16.114 -37.177 1.00 69.72  ? 214  PHE A CE1 1 
ATOM   1688  C  CE2 . PHE A  1 214 ? 87.085  -15.105 -39.149 1.00 70.94  ? 214  PHE A CE2 1 
ATOM   1689  C  CZ  . PHE A  1 214 ? 86.454  -16.171 -38.530 1.00 71.03  ? 214  PHE A CZ  1 
ATOM   1690  N  N   . GLU A  1 215 ? 90.002  -10.728 -35.771 1.00 69.63  ? 215  GLU A N   1 
ATOM   1691  C  CA  . GLU A  1 215 ? 90.387  -9.374  -35.408 1.00 72.12  ? 215  GLU A CA  1 
ATOM   1692  C  C   . GLU A  1 215 ? 89.928  -8.372  -36.467 1.00 72.20  ? 215  GLU A C   1 
ATOM   1693  O  O   . GLU A  1 215 ? 90.131  -8.577  -37.668 1.00 73.76  ? 215  GLU A O   1 
ATOM   1694  C  CB  . GLU A  1 215 ? 91.901  -9.285  -35.232 1.00 75.26  ? 215  GLU A CB  1 
ATOM   1695  C  CG  . GLU A  1 215 ? 92.418  -7.867  -35.067 1.00 79.95  ? 215  GLU A CG  1 
ATOM   1696  C  CD  . GLU A  1 215 ? 92.388  -7.401  -33.623 1.00 85.40  ? 215  GLU A CD  1 
ATOM   1697  O  OE1 . GLU A  1 215 ? 92.486  -8.260  -32.723 1.00 88.74  ? 215  GLU A OE1 1 
ATOM   1698  O  OE2 . GLU A  1 215 ? 92.271  -6.180  -33.382 1.00 85.43  ? 215  GLU A OE2 1 
ATOM   1699  N  N   . LYS A  1 216 ? 89.283  -7.303  -36.013 1.00 68.62  ? 216  LYS A N   1 
ATOM   1700  C  CA  . LYS A  1 216 ? 88.882  -6.199  -36.882 1.00 65.21  ? 216  LYS A CA  1 
ATOM   1701  C  C   . LYS A  1 216 ? 88.191  -6.642  -38.167 1.00 64.01  ? 216  LYS A C   1 
ATOM   1702  O  O   . LYS A  1 216 ? 88.592  -6.245  -39.256 1.00 67.14  ? 216  LYS A O   1 
ATOM   1703  C  CB  . LYS A  1 216 ? 90.055  -5.270  -37.194 1.00 64.16  ? 216  LYS A CB  1 
ATOM   1704  C  CG  . LYS A  1 216 ? 89.611  -3.878  -37.624 1.00 63.22  ? 216  LYS A CG  1 
ATOM   1705  C  CD  . LYS A  1 216 ? 90.769  -2.900  -37.639 1.00 64.43  ? 216  LYS A CD  1 
ATOM   1706  C  CE  . LYS A  1 216 ? 90.326  -1.532  -38.134 1.00 65.30  ? 216  LYS A CE  1 
ATOM   1707  N  NZ  . LYS A  1 216 ? 91.423  -0.527  -38.058 1.00 65.61  ? 216  LYS A NZ  1 
ATOM   1708  N  N   . VAL A  1 217 ? 87.143  -7.448  -38.037 1.00 60.33  ? 217  VAL A N   1 
ATOM   1709  C  CA  . VAL A  1 217 ? 86.402  -7.924  -39.198 1.00 56.40  ? 217  VAL A CA  1 
ATOM   1710  C  C   . VAL A  1 217 ? 85.007  -7.323  -39.203 1.00 54.38  ? 217  VAL A C   1 
ATOM   1711  O  O   . VAL A  1 217 ? 84.474  -6.942  -38.164 1.00 53.01  ? 217  VAL A O   1 
ATOM   1712  C  CB  . VAL A  1 217 ? 86.262  -9.457  -39.214 1.00 55.14  ? 217  VAL A CB  1 
ATOM   1713  C  CG1 . VAL A  1 217 ? 87.609  -10.118 -39.414 1.00 53.90  ? 217  VAL A CG1 1 
ATOM   1714  C  CG2 . VAL A  1 217 ? 85.613  -9.931  -37.929 1.00 56.58  ? 217  VAL A CG2 1 
ATOM   1715  N  N   . SER A  1 218 ? 84.426  -7.240  -40.391 1.00 54.57  ? 218  SER A N   1 
ATOM   1716  C  CA  . SER A  1 218 ? 83.142  -6.579  -40.600 1.00 53.58  ? 218  SER A CA  1 
ATOM   1717  C  C   . SER A  1 218 ? 81.910  -7.477  -40.460 1.00 51.48  ? 218  SER A C   1 
ATOM   1718  O  O   . SER A  1 218 ? 80.818  -7.070  -40.825 1.00 53.31  ? 218  SER A O   1 
ATOM   1719  C  CB  . SER A  1 218 ? 83.124  -5.797  -41.915 1.00 56.73  ? 218  SER A CB  1 
ATOM   1720  O  OG  . SER A  1 218 ? 84.131  -4.795  -41.913 1.00 59.24  ? 218  SER A OG  1 
ATOM   1721  N  N   . PHE A  1 219 ? 82.093  -8.716  -40.012 1.00 51.32  ? 219  PHE A N   1 
ATOM   1722  C  CA  . PHE A  1 219 ? 80.951  -9.577  -39.690 1.00 53.82  ? 219  PHE A CA  1 
ATOM   1723  C  C   . PHE A  1 219 ? 80.966  -10.059 -38.236 1.00 57.33  ? 219  PHE A C   1 
ATOM   1724  O  O   . PHE A  1 219 ? 81.993  -9.986  -37.550 1.00 58.12  ? 219  PHE A O   1 
ATOM   1725  C  CB  . PHE A  1 219 ? 80.855  -10.768 -40.652 1.00 54.79  ? 219  PHE A CB  1 
ATOM   1726  C  CG  . PHE A  1 219 ? 82.125  -11.562 -40.772 1.00 57.69  ? 219  PHE A CG  1 
ATOM   1727  C  CD1 . PHE A  1 219 ? 82.386  -12.297 -41.916 1.00 59.73  ? 219  PHE A CD1 1 
ATOM   1728  C  CD2 . PHE A  1 219 ? 83.054  -11.583 -39.742 1.00 58.46  ? 219  PHE A CD2 1 
ATOM   1729  C  CE1 . PHE A  1 219 ? 83.554  -13.029 -42.034 1.00 60.92  ? 219  PHE A CE1 1 
ATOM   1730  C  CE2 . PHE A  1 219 ? 84.222  -12.315 -39.853 1.00 59.94  ? 219  PHE A CE2 1 
ATOM   1731  C  CZ  . PHE A  1 219 ? 84.472  -13.038 -40.999 1.00 61.40  ? 219  PHE A CZ  1 
ATOM   1732  N  N   . TYR A  1 220 ? 79.810  -10.523 -37.768 1.00 56.12  ? 220  TYR A N   1 
ATOM   1733  C  CA  . TYR A  1 220 ? 79.694  -11.091 -36.428 1.00 54.36  ? 220  TYR A CA  1 
ATOM   1734  C  C   . TYR A  1 220 ? 78.801  -12.335 -36.447 1.00 53.77  ? 220  TYR A C   1 
ATOM   1735  O  O   . TYR A  1 220 ? 78.106  -12.591 -37.436 1.00 52.27  ? 220  TYR A O   1 
ATOM   1736  C  CB  . TYR A  1 220 ? 79.159  -10.047 -35.450 1.00 54.58  ? 220  TYR A CB  1 
ATOM   1737  C  CG  . TYR A  1 220 ? 77.765  -9.563  -35.782 1.00 53.74  ? 220  TYR A CG  1 
ATOM   1738  C  CD1 . TYR A  1 220 ? 77.565  -8.565  -36.728 1.00 53.69  ? 220  TYR A CD1 1 
ATOM   1739  C  CD2 . TYR A  1 220 ? 76.650  -10.101 -35.146 1.00 52.70  ? 220  TYR A CD2 1 
ATOM   1740  C  CE1 . TYR A  1 220 ? 76.291  -8.117  -37.036 1.00 53.26  ? 220  TYR A CE1 1 
ATOM   1741  C  CE2 . TYR A  1 220 ? 75.378  -9.661  -35.446 1.00 53.31  ? 220  TYR A CE2 1 
ATOM   1742  C  CZ  . TYR A  1 220 ? 75.202  -8.669  -36.391 1.00 53.36  ? 220  TYR A CZ  1 
ATOM   1743  O  OH  . TYR A  1 220 ? 73.935  -8.225  -36.694 1.00 52.90  ? 220  TYR A OH  1 
ATOM   1744  N  N   . ALA A  1 221 ? 78.807  -13.093 -35.351 1.00 52.62  ? 221  ALA A N   1 
ATOM   1745  C  CA  . ALA A  1 221 ? 78.190  -14.414 -35.331 1.00 49.24  ? 221  ALA A CA  1 
ATOM   1746  C  C   . ALA A  1 221 ? 76.716  -14.347 -34.966 1.00 49.78  ? 221  ALA A C   1 
ATOM   1747  O  O   . ALA A  1 221 ? 76.350  -13.899 -33.888 1.00 48.91  ? 221  ALA A O   1 
ATOM   1748  C  CB  . ALA A  1 221 ? 78.925  -15.315 -34.344 1.00 47.39  ? 221  ALA A CB  1 
ATOM   1749  N  N   . ILE A  1 222 ? 75.868  -14.724 -35.915 1.00 52.74  ? 222  ILE A N   1 
ATOM   1750  C  CA  . ILE A  1 222 ? 74.437  -14.821 -35.666 1.00 53.20  ? 222  ILE A CA  1 
ATOM   1751  C  C   . ILE A  1 222 ? 73.824  -16.208 -35.404 1.00 57.22  ? 222  ILE A C   1 
ATOM   1752  O  O   . ILE A  1 222 ? 72.644  -16.297 -35.066 1.00 59.97  ? 222  ILE A O   1 
ATOM   1753  C  CB  . ILE A  1 222 ? 73.697  -14.183 -36.826 1.00 51.05  ? 222  ILE A CB  1 
ATOM   1754  C  CG1 . ILE A  1 222 ? 73.964  -14.991 -38.093 1.00 46.49  ? 222  ILE A CG1 1 
ATOM   1755  C  CG2 . ILE A  1 222 ? 74.162  -12.741 -36.994 1.00 51.29  ? 222  ILE A CG2 1 
ATOM   1756  C  CD1 . ILE A  1 222 ? 73.204  -14.504 -39.274 1.00 45.04  ? 222  ILE A CD1 1 
ATOM   1757  N  N   . ASP A  1 223 ? 74.589  -17.286 -35.542 1.00 57.79  ? 223  ASP A N   1 
ATOM   1758  C  CA  . ASP A  1 223 ? 74.025  -18.602 -35.231 1.00 56.90  ? 223  ASP A CA  1 
ATOM   1759  C  C   . ASP A  1 223 ? 75.070  -19.710 -35.188 1.00 57.54  ? 223  ASP A C   1 
ATOM   1760  O  O   . ASP A  1 223 ? 76.236  -19.490 -35.512 1.00 57.85  ? 223  ASP A O   1 
ATOM   1761  C  CB  . ASP A  1 223 ? 72.932  -18.958 -36.246 1.00 56.84  ? 223  ASP A CB  1 
ATOM   1762  C  CG  . ASP A  1 223 ? 71.912  -19.937 -35.691 1.00 60.77  ? 223  ASP A CG  1 
ATOM   1763  O  OD1 . ASP A  1 223 ? 71.995  -20.256 -34.489 1.00 64.80  ? 223  ASP A OD1 1 
ATOM   1764  O  OD2 . ASP A  1 223 ? 71.016  -20.375 -36.447 1.00 59.90  ? 223  ASP A OD2 1 
ATOM   1765  N  N   . SER A  1 224 ? 74.638  -20.904 -34.797 1.00 59.53  ? 224  SER A N   1 
ATOM   1766  C  CA  . SER A  1 224 ? 75.506  -22.079 -34.769 1.00 62.78  ? 224  SER A CA  1 
ATOM   1767  C  C   . SER A  1 224 ? 74.701  -23.375 -34.938 1.00 66.70  ? 224  SER A C   1 
ATOM   1768  O  O   . SER A  1 224 ? 73.582  -23.474 -34.439 1.00 67.80  ? 224  SER A O   1 
ATOM   1769  C  CB  . SER A  1 224 ? 76.303  -22.090 -33.460 1.00 62.66  ? 224  SER A CB  1 
ATOM   1770  O  OG  . SER A  1 224 ? 76.840  -23.368 -33.171 1.00 64.82  ? 224  SER A OG  1 
ATOM   1771  N  N   . ASP A  1 225 ? 75.243  -24.349 -35.667 1.00 69.35  ? 225  ASP A N   1 
ATOM   1772  C  CA  . ASP A  1 225 ? 74.763  -25.732 -35.577 1.00 72.65  ? 225  ASP A CA  1 
ATOM   1773  C  C   . ASP A  1 225 ? 75.670  -26.551 -34.658 1.00 74.04  ? 225  ASP A C   1 
ATOM   1774  O  O   . ASP A  1 225 ? 75.503  -27.757 -34.494 1.00 74.75  ? 225  ASP A O   1 
ATOM   1775  C  CB  . ASP A  1 225 ? 74.580  -26.387 -36.954 1.00 76.51  ? 225  ASP A CB  1 
ATOM   1776  C  CG  . ASP A  1 225 ? 75.836  -26.351 -37.801 1.00 78.54  ? 225  ASP A CG  1 
ATOM   1777  O  OD1 . ASP A  1 225 ? 76.943  -26.482 -37.240 1.00 79.14  ? 225  ASP A OD1 1 
ATOM   1778  O  OD2 . ASP A  1 225 ? 75.712  -26.197 -39.036 1.00 78.97  ? 225  ASP A OD2 1 
ATOM   1779  N  N   . GLY A  1 226 ? 76.659  -25.871 -34.096 1.00 76.32  ? 226  GLY A N   1 
ATOM   1780  C  CA  . GLY A  1 226 ? 77.576  -26.447 -33.132 1.00 79.18  ? 226  GLY A CA  1 
ATOM   1781  C  C   . GLY A  1 226 ? 78.793  -27.051 -33.795 1.00 81.73  ? 226  GLY A C   1 
ATOM   1782  O  O   . GLY A  1 226 ? 79.847  -27.176 -33.173 1.00 82.14  ? 226  GLY A O   1 
ATOM   1783  N  N   . GLU A  1 227 ? 78.644  -27.442 -35.057 1.00 83.82  ? 227  GLU A N   1 
ATOM   1784  C  CA  . GLU A  1 227 ? 79.784  -27.727 -35.925 1.00 86.56  ? 227  GLU A CA  1 
ATOM   1785  C  C   . GLU A  1 227 ? 80.339  -26.457 -36.568 1.00 82.95  ? 227  GLU A C   1 
ATOM   1786  O  O   . GLU A  1 227 ? 81.551  -26.271 -36.675 1.00 82.52  ? 227  GLU A O   1 
ATOM   1787  C  CB  . GLU A  1 227 ? 79.412  -28.758 -36.995 1.00 93.02  ? 227  GLU A CB  1 
ATOM   1788  C  CG  . GLU A  1 227 ? 79.203  -30.168 -36.452 1.00 98.55  ? 227  GLU A CG  1 
ATOM   1789  C  CD  . GLU A  1 227 ? 80.454  -30.737 -35.807 1.00 103.17 ? 227  GLU A CD  1 
ATOM   1790  O  OE1 . GLU A  1 227 ? 81.556  -30.538 -36.365 1.00 105.22 ? 227  GLU A OE1 1 
ATOM   1791  O  OE2 . GLU A  1 227 ? 80.336  -31.381 -34.742 1.00 103.90 ? 227  GLU A OE2 1 
ATOM   1792  N  N   . ARG A  1 228 ? 79.422  -25.594 -36.999 1.00 79.20  ? 228  ARG A N   1 
ATOM   1793  C  CA  . ARG A  1 228 ? 79.744  -24.448 -37.839 1.00 73.53  ? 228  ARG A CA  1 
ATOM   1794  C  C   . ARG A  1 228 ? 79.120  -23.181 -37.290 1.00 69.60  ? 228  ARG A C   1 
ATOM   1795  O  O   . ARG A  1 228 ? 77.994  -23.198 -36.805 1.00 71.45  ? 228  ARG A O   1 
ATOM   1796  C  CB  . ARG A  1 228 ? 79.206  -24.680 -39.249 1.00 72.49  ? 228  ARG A CB  1 
ATOM   1797  C  CG  . ARG A  1 228 ? 79.833  -25.845 -39.968 1.00 73.09  ? 228  ARG A CG  1 
ATOM   1798  C  CD  . ARG A  1 228 ? 78.963  -26.309 -41.121 1.00 73.81  ? 228  ARG A CD  1 
ATOM   1799  N  NE  . ARG A  1 228 ? 77.867  -27.155 -40.661 1.00 73.74  ? 228  ARG A NE  1 
ATOM   1800  C  CZ  . ARG A  1 228 ? 78.012  -28.428 -40.307 1.00 72.92  ? 228  ARG A CZ  1 
ATOM   1801  N  NH1 . ARG A  1 228 ? 79.208  -28.997 -40.355 1.00 72.56  ? 228  ARG A NH1 1 
ATOM   1802  N  NH2 . ARG A  1 228 ? 76.965  -29.131 -39.899 1.00 72.25  ? 228  ARG A NH2 1 
ATOM   1803  N  N   . ILE A  1 229 ? 79.848  -22.078 -37.389 1.00 65.46  ? 229  ILE A N   1 
ATOM   1804  C  CA  . ILE A  1 229 ? 79.340  -20.787 -36.954 1.00 63.50  ? 229  ILE A CA  1 
ATOM   1805  C  C   . ILE A  1 229 ? 78.897  -19.967 -38.160 1.00 62.22  ? 229  ILE A C   1 
ATOM   1806  O  O   . ILE A  1 229 ? 79.578  -19.948 -39.184 1.00 63.67  ? 229  ILE A O   1 
ATOM   1807  C  CB  . ILE A  1 229 ? 80.413  -20.014 -36.176 1.00 63.96  ? 229  ILE A CB  1 
ATOM   1808  C  CG1 . ILE A  1 229 ? 80.781  -20.769 -34.895 1.00 63.58  ? 229  ILE A CG1 1 
ATOM   1809  C  CG2 . ILE A  1 229 ? 79.940  -18.597 -35.875 1.00 63.37  ? 229  ILE A CG2 1 
ATOM   1810  C  CD1 . ILE A  1 229 ? 81.928  -20.150 -34.132 1.00 62.17  ? 229  ILE A CD1 1 
ATOM   1811  N  N   . LEU A  1 230 ? 77.751  -19.302 -38.050 1.00 59.38  ? 230  LEU A N   1 
ATOM   1812  C  CA  . LEU A  1 230 ? 77.234  -18.508 -39.159 1.00 57.13  ? 230  LEU A CA  1 
ATOM   1813  C  C   . LEU A  1 230 ? 77.569  -17.036 -38.965 1.00 56.52  ? 230  LEU A C   1 
ATOM   1814  O  O   . LEU A  1 230 ? 77.148  -16.421 -37.990 1.00 57.89  ? 230  LEU A O   1 
ATOM   1815  C  CB  . LEU A  1 230 ? 75.722  -18.695 -39.306 1.00 55.70  ? 230  LEU A CB  1 
ATOM   1816  C  CG  . LEU A  1 230 ? 75.086  -18.029 -40.531 1.00 55.47  ? 230  LEU A CG  1 
ATOM   1817  C  CD1 . LEU A  1 230 ? 75.691  -18.563 -41.823 1.00 54.21  ? 230  LEU A CD1 1 
ATOM   1818  C  CD2 . LEU A  1 230 ? 73.562  -18.192 -40.533 1.00 55.74  ? 230  LEU A CD2 1 
ATOM   1819  N  N   . LEU A  1 231 ? 78.333  -16.476 -39.895 1.00 53.39  ? 231  LEU A N   1 
ATOM   1820  C  CA  . LEU A  1 231 ? 78.732  -15.081 -39.805 1.00 48.79  ? 231  LEU A CA  1 
ATOM   1821  C  C   . LEU A  1 231 ? 77.858  -14.189 -40.688 1.00 49.54  ? 231  LEU A C   1 
ATOM   1822  O  O   . LEU A  1 231 ? 77.499  -14.562 -41.807 1.00 49.96  ? 231  LEU A O   1 
ATOM   1823  C  CB  . LEU A  1 231 ? 80.212  -14.937 -40.155 1.00 45.85  ? 231  LEU A CB  1 
ATOM   1824  C  CG  . LEU A  1 231 ? 81.125  -15.782 -39.259 1.00 43.92  ? 231  LEU A CG  1 
ATOM   1825  C  CD1 . LEU A  1 231 ? 82.593  -15.648 -39.638 1.00 40.61  ? 231  LEU A CD1 1 
ATOM   1826  C  CD2 . LEU A  1 231 ? 80.919  -15.404 -37.804 1.00 45.45  ? 231  LEU A CD2 1 
ATOM   1827  N  N   . TYR A  1 232 ? 77.503  -13.019 -40.165 1.00 50.37  ? 232  TYR A N   1 
ATOM   1828  C  CA  . TYR A  1 232 ? 76.657  -12.062 -40.874 1.00 51.09  ? 232  TYR A CA  1 
ATOM   1829  C  C   . TYR A  1 232 ? 77.395  -10.751 -41.057 1.00 54.48  ? 232  TYR A C   1 
ATOM   1830  O  O   . TYR A  1 232 ? 77.688  -10.056 -40.085 1.00 56.46  ? 232  TYR A O   1 
ATOM   1831  C  CB  . TYR A  1 232 ? 75.385  -11.811 -40.077 1.00 48.52  ? 232  TYR A CB  1 
ATOM   1832  C  CG  . TYR A  1 232 ? 74.450  -10.779 -40.669 1.00 48.60  ? 232  TYR A CG  1 
ATOM   1833  C  CD1 . TYR A  1 232 ? 73.380  -11.164 -41.458 1.00 49.66  ? 232  TYR A CD1 1 
ATOM   1834  C  CD2 . TYR A  1 232 ? 74.620  -9.421  -40.417 1.00 47.80  ? 232  TYR A CD2 1 
ATOM   1835  C  CE1 . TYR A  1 232 ? 72.507  -10.229 -41.991 1.00 49.73  ? 232  TYR A CE1 1 
ATOM   1836  C  CE2 . TYR A  1 232 ? 73.749  -8.477  -40.946 1.00 46.27  ? 232  TYR A CE2 1 
ATOM   1837  C  CZ  . TYR A  1 232 ? 72.693  -8.891  -41.732 1.00 47.51  ? 232  TYR A CZ  1 
ATOM   1838  O  OH  . TYR A  1 232 ? 71.812  -7.978  -42.272 1.00 46.74  ? 232  TYR A OH  1 
ATOM   1839  N  N   . GLY A  1 233 ? 77.714  -10.419 -42.300 1.00 55.97  ? 233  GLY A N   1 
ATOM   1840  C  CA  . GLY A  1 233 ? 78.506  -9.235  -42.562 1.00 57.83  ? 233  GLY A CA  1 
ATOM   1841  C  C   . GLY A  1 233 ? 79.324  -9.416  -43.820 1.00 60.45  ? 233  GLY A C   1 
ATOM   1842  O  O   . GLY A  1 233 ? 78.938  -10.151 -44.735 1.00 62.33  ? 233  GLY A O   1 
ATOM   1843  N  N   . LYS A  1 234 ? 80.438  -8.699  -43.882 1.00 60.72  ? 234  LYS A N   1 
ATOM   1844  C  CA  . LYS A  1 234 ? 81.500  -9.025  -44.822 1.00 62.30  ? 234  LYS A CA  1 
ATOM   1845  C  C   . LYS A  1 234 ? 82.796  -9.282  -44.055 1.00 63.73  ? 234  LYS A C   1 
ATOM   1846  O  O   . LYS A  1 234 ? 82.946  -8.834  -42.921 1.00 63.59  ? 234  LYS A O   1 
ATOM   1847  C  CB  . LYS A  1 234 ? 81.686  -7.907  -45.854 1.00 60.43  ? 234  LYS A CB  1 
ATOM   1848  C  CG  . LYS A  1 234 ? 80.718  -7.984  -47.029 1.00 57.89  ? 234  LYS A CG  1 
ATOM   1849  C  CD  . LYS A  1 234 ? 81.007  -6.901  -48.057 1.00 55.37  ? 234  LYS A CD  1 
ATOM   1850  C  CE  . LYS A  1 234 ? 79.959  -6.886  -49.162 1.00 52.28  ? 234  LYS A CE  1 
ATOM   1851  N  NZ  . LYS A  1 234 ? 80.117  -5.718  -50.071 1.00 50.56  ? 234  LYS A NZ  1 
ATOM   1852  N  N   . PRO A  1 235 ? 83.731  -10.030 -44.659 1.00 65.61  ? 235  PRO A N   1 
ATOM   1853  C  CA  . PRO A  1 235 ? 85.072  -10.111 -44.075 1.00 65.41  ? 235  PRO A CA  1 
ATOM   1854  C  C   . PRO A  1 235 ? 85.611  -8.707  -43.819 1.00 66.80  ? 235  PRO A C   1 
ATOM   1855  O  O   . PRO A  1 235 ? 86.383  -8.495  -42.881 1.00 66.82  ? 235  PRO A O   1 
ATOM   1856  C  CB  . PRO A  1 235 ? 85.867  -10.821 -45.163 1.00 62.22  ? 235  PRO A CB  1 
ATOM   1857  C  CG  . PRO A  1 235 ? 84.855  -11.746 -45.773 1.00 61.98  ? 235  PRO A CG  1 
ATOM   1858  C  CD  . PRO A  1 235 ? 83.562  -10.970 -45.781 1.00 63.00  ? 235  PRO A CD  1 
ATOM   1859  N  N   . GLU A  1 236 ? 85.153  -7.749  -44.621 1.00 67.58  ? 236  GLU A N   1 
ATOM   1860  C  CA  . GLU A  1 236 ? 85.419  -6.343  -44.351 1.00 67.27  ? 236  GLU A CA  1 
ATOM   1861  C  C   . GLU A  1 236 ? 84.738  -5.413  -45.353 1.00 64.36  ? 236  GLU A C   1 
ATOM   1862  O  O   . GLU A  1 236 ? 84.441  -5.805  -46.487 1.00 64.52  ? 236  GLU A O   1 
ATOM   1863  C  CB  . GLU A  1 236 ? 86.924  -6.092  -44.372 1.00 69.57  ? 236  GLU A CB  1 
ATOM   1864  C  CG  . GLU A  1 236 ? 87.306  -4.747  -44.942 1.00 73.35  ? 236  GLU A CG  1 
ATOM   1865  C  CD  . GLU A  1 236 ? 88.525  -4.172  -44.277 1.00 77.53  ? 236  GLU A CD  1 
ATOM   1866  O  OE1 . GLU A  1 236 ? 89.440  -4.959  -43.955 1.00 78.91  ? 236  GLU A OE1 1 
ATOM   1867  O  OE2 . GLU A  1 236 ? 88.561  -2.941  -44.064 1.00 78.88  ? 236  GLU A OE2 1 
ATOM   1868  N  N   . LYS A  1 237 ? 84.558  -4.159  -44.940 1.00 58.30  ? 237  LYS A N   1 
ATOM   1869  C  CA  . LYS A  1 237 ? 83.745  -3.207  -45.685 1.00 53.48  ? 237  LYS A CA  1 
ATOM   1870  C  C   . LYS A  1 237 ? 84.369  -1.829  -45.684 1.00 51.70  ? 237  LYS A C   1 
ATOM   1871  O  O   . LYS A  1 237 ? 84.896  -1.379  -44.668 1.00 50.68  ? 237  LYS A O   1 
ATOM   1872  C  CB  . LYS A  1 237 ? 82.345  -3.101  -45.077 1.00 50.89  ? 237  LYS A CB  1 
ATOM   1873  C  CG  . LYS A  1 237 ? 81.656  -4.428  -44.853 1.00 50.55  ? 237  LYS A CG  1 
ATOM   1874  C  CD  . LYS A  1 237 ? 80.144  -4.313  -44.979 1.00 47.83  ? 237  LYS A CD  1 
ATOM   1875  C  CE  . LYS A  1 237 ? 79.519  -3.525  -43.841 1.00 43.54  ? 237  LYS A CE  1 
ATOM   1876  N  NZ  . LYS A  1 237 ? 78.055  -3.815  -43.736 1.00 41.11  ? 237  LYS A NZ  1 
ATOM   1877  N  N   . LYS A  1 238 ? 84.315  -1.158  -46.827 1.00 50.48  ? 238  LYS A N   1 
ATOM   1878  C  CA  . LYS A  1 238 ? 84.725  0.230   -46.871 1.00 50.45  ? 238  LYS A CA  1 
ATOM   1879  C  C   . LYS A  1 238 ? 83.584  1.060   -46.301 1.00 50.88  ? 238  LYS A C   1 
ATOM   1880  O  O   . LYS A  1 238 ? 83.816  2.075   -45.644 1.00 50.41  ? 238  LYS A O   1 
ATOM   1881  C  CB  . LYS A  1 238 ? 85.072  0.668   -48.298 1.00 51.99  ? 238  LYS A CB  1 
ATOM   1882  C  CG  . LYS A  1 238 ? 85.768  2.025   -48.371 1.00 54.54  ? 238  LYS A CG  1 
ATOM   1883  C  CD  . LYS A  1 238 ? 86.327  2.308   -49.755 1.00 58.94  ? 238  LYS A CD  1 
ATOM   1884  C  CE  . LYS A  1 238 ? 87.510  1.398   -50.069 1.00 64.72  ? 238  LYS A CE  1 
ATOM   1885  N  NZ  . LYS A  1 238 ? 87.942  1.464   -51.503 1.00 66.74  ? 238  LYS A NZ  1 
ATOM   1886  N  N   . TYR A  1 239 ? 82.355  0.598   -46.538 1.00 51.49  ? 239  TYR A N   1 
ATOM   1887  C  CA  . TYR A  1 239 ? 81.145  1.320   -46.146 1.00 51.57  ? 239  TYR A CA  1 
ATOM   1888  C  C   . TYR A  1 239 ? 80.172  0.391   -45.441 1.00 53.79  ? 239  TYR A C   1 
ATOM   1889  O  O   . TYR A  1 239 ? 79.948  -0.735  -45.892 1.00 56.41  ? 239  TYR A O   1 
ATOM   1890  C  CB  . TYR A  1 239 ? 80.434  1.875   -47.374 1.00 52.99  ? 239  TYR A CB  1 
ATOM   1891  C  CG  . TYR A  1 239 ? 81.301  2.684   -48.299 1.00 54.68  ? 239  TYR A CG  1 
ATOM   1892  C  CD1 . TYR A  1 239 ? 81.519  4.032   -48.065 1.00 54.75  ? 239  TYR A CD1 1 
ATOM   1893  C  CD2 . TYR A  1 239 ? 81.886  2.104   -49.419 1.00 55.17  ? 239  TYR A CD2 1 
ATOM   1894  C  CE1 . TYR A  1 239 ? 82.301  4.783   -48.909 1.00 56.73  ? 239  TYR A CE1 1 
ATOM   1895  C  CE2 . TYR A  1 239 ? 82.674  2.846   -50.273 1.00 56.74  ? 239  TYR A CE2 1 
ATOM   1896  C  CZ  . TYR A  1 239 ? 82.877  4.188   -50.014 1.00 58.47  ? 239  TYR A CZ  1 
ATOM   1897  O  OH  . TYR A  1 239 ? 83.659  4.946   -50.855 1.00 59.55  ? 239  TYR A OH  1 
ATOM   1898  N  N   . VAL A  1 240 ? 79.569  0.860   -44.353 1.00 51.27  ? 240  VAL A N   1 
ATOM   1899  C  CA  . VAL A  1 240 ? 78.596  0.033   -43.654 1.00 50.01  ? 240  VAL A CA  1 
ATOM   1900  C  C   . VAL A  1 240 ? 77.375  -0.185  -44.540 1.00 47.33  ? 240  VAL A C   1 
ATOM   1901  O  O   . VAL A  1 240 ? 76.711  -1.210  -44.443 1.00 48.90  ? 240  VAL A O   1 
ATOM   1902  C  CB  . VAL A  1 240 ? 78.204  0.612   -42.273 1.00 49.70  ? 240  VAL A CB  1 
ATOM   1903  C  CG1 . VAL A  1 240 ? 79.442  0.795   -41.423 1.00 50.30  ? 240  VAL A CG1 1 
ATOM   1904  C  CG2 . VAL A  1 240 ? 77.467  1.929   -42.424 1.00 49.64  ? 240  VAL A CG2 1 
ATOM   1905  N  N   . SER A  1 241 ? 77.120  0.764   -45.436 1.00 44.48  ? 241  SER A N   1 
ATOM   1906  C  CA  . SER A  1 241 ? 75.975  0.696   -46.337 1.00 44.59  ? 241  SER A CA  1 
ATOM   1907  C  C   . SER A  1 241 ? 76.065  -0.480  -47.311 1.00 46.69  ? 241  SER A C   1 
ATOM   1908  O  O   . SER A  1 241 ? 75.102  -0.777  -48.024 1.00 47.28  ? 241  SER A O   1 
ATOM   1909  C  CB  . SER A  1 241 ? 75.850  1.992   -47.131 1.00 44.63  ? 241  SER A CB  1 
ATOM   1910  O  OG  . SER A  1 241 ? 75.660  3.099   -46.278 1.00 45.65  ? 241  SER A OG  1 
ATOM   1911  N  N   . GLU A  1 242 ? 77.212  -1.151  -47.345 1.00 45.16  ? 242  GLU A N   1 
ATOM   1912  C  CA  . GLU A  1 242 ? 77.366  -2.291  -48.237 1.00 48.63  ? 242  GLU A CA  1 
ATOM   1913  C  C   . GLU A  1 242 ? 76.397  -3.395  -47.839 1.00 52.91  ? 242  GLU A C   1 
ATOM   1914  O  O   . GLU A  1 242 ? 75.912  -3.427  -46.708 1.00 55.96  ? 242  GLU A O   1 
ATOM   1915  C  CB  . GLU A  1 242 ? 78.800  -2.813  -48.208 1.00 49.41  ? 242  GLU A CB  1 
ATOM   1916  C  CG  . GLU A  1 242 ? 79.827  -1.821  -48.729 1.00 49.27  ? 242  GLU A CG  1 
ATOM   1917  C  CD  . GLU A  1 242 ? 81.243  -2.347  -48.622 1.00 49.33  ? 242  GLU A CD  1 
ATOM   1918  O  OE1 . GLU A  1 242 ? 81.417  -3.586  -48.662 1.00 49.35  ? 242  GLU A OE1 1 
ATOM   1919  O  OE2 . GLU A  1 242 ? 82.177  -1.523  -48.494 1.00 48.46  ? 242  GLU A OE2 1 
ATOM   1920  N  N   . HIS A  1 243 ? 76.083  -4.278  -48.781 1.00 52.83  ? 243  HIS A N   1 
ATOM   1921  C  CA  . HIS A  1 243 ? 75.200  -5.406  -48.501 1.00 53.09  ? 243  HIS A CA  1 
ATOM   1922  C  C   . HIS A  1 243 ? 75.812  -6.359  -47.480 1.00 56.19  ? 243  HIS A C   1 
ATOM   1923  O  O   . HIS A  1 243 ? 76.975  -6.744  -47.596 1.00 60.66  ? 243  HIS A O   1 
ATOM   1924  C  CB  . HIS A  1 243 ? 74.876  -6.178  -49.783 1.00 50.86  ? 243  HIS A CB  1 
ATOM   1925  C  CG  . HIS A  1 243 ? 73.836  -5.526  -50.639 1.00 50.25  ? 243  HIS A CG  1 
ATOM   1926  N  ND1 . HIS A  1 243 ? 72.887  -4.662  -50.133 1.00 50.76  ? 243  HIS A ND1 1 
ATOM   1927  C  CD2 . HIS A  1 243 ? 73.594  -5.611  -51.968 1.00 49.16  ? 243  HIS A CD2 1 
ATOM   1928  C  CE1 . HIS A  1 243 ? 72.106  -4.246  -51.113 1.00 49.75  ? 243  HIS A CE1 1 
ATOM   1929  N  NE2 . HIS A  1 243 ? 72.515  -4.806  -52.238 1.00 49.20  ? 243  HIS A NE2 1 
ATOM   1930  N  N   . ASP A  1 244 ? 75.019  -6.740  -46.484 1.00 52.29  ? 244  ASP A N   1 
ATOM   1931  C  CA  . ASP A  1 244 ? 75.431  -7.761  -45.535 1.00 50.32  ? 244  ASP A CA  1 
ATOM   1932  C  C   . ASP A  1 244 ? 75.183  -9.150  -46.119 1.00 49.17  ? 244  ASP A C   1 
ATOM   1933  O  O   . ASP A  1 244 ? 74.089  -9.443  -46.595 1.00 48.57  ? 244  ASP A O   1 
ATOM   1934  C  CB  . ASP A  1 244 ? 74.672  -7.601  -44.216 1.00 50.30  ? 244  ASP A CB  1 
ATOM   1935  C  CG  . ASP A  1 244 ? 75.073  -6.354  -43.456 1.00 48.42  ? 244  ASP A CG  1 
ATOM   1936  O  OD1 . ASP A  1 244 ? 76.289  -6.135  -43.259 1.00 46.25  ? 244  ASP A OD1 1 
ATOM   1937  O  OD2 . ASP A  1 244 ? 74.164  -5.590  -43.068 1.00 47.95  ? 244  ASP A OD2 1 
ATOM   1938  N  N   . LYS A  1 245 ? 76.204  -10.000 -46.080 1.00 50.77  ? 245  LYS A N   1 
ATOM   1939  C  CA  . LYS A  1 245 ? 76.097  -11.359 -46.598 1.00 54.16  ? 245  LYS A CA  1 
ATOM   1940  C  C   . LYS A  1 245 ? 76.311  -12.365 -45.476 1.00 54.75  ? 245  LYS A C   1 
ATOM   1941  O  O   . LYS A  1 245 ? 76.569  -11.976 -44.345 1.00 56.51  ? 245  LYS A O   1 
ATOM   1942  C  CB  . LYS A  1 245 ? 77.141  -11.573 -47.688 1.00 56.58  ? 245  LYS A CB  1 
ATOM   1943  C  CG  . LYS A  1 245 ? 77.115  -10.523 -48.791 1.00 57.74  ? 245  LYS A CG  1 
ATOM   1944  C  CD  . LYS A  1 245 ? 76.092  -10.864 -49.869 1.00 58.45  ? 245  LYS A CD  1 
ATOM   1945  C  CE  . LYS A  1 245 ? 76.612  -10.502 -51.259 1.00 57.36  ? 245  LYS A CE  1 
ATOM   1946  N  N   . ILE A  1 246 ? 76.218  -13.656 -45.781 1.00 54.86  ? 246  ILE A N   1 
ATOM   1947  C  CA  . ILE A  1 246 ? 76.419  -14.678 -44.749 1.00 56.33  ? 246  ILE A CA  1 
ATOM   1948  C  C   . ILE A  1 246 ? 77.588  -15.625 -45.040 1.00 59.40  ? 246  ILE A C   1 
ATOM   1949  O  O   . ILE A  1 246 ? 77.939  -15.861 -46.201 1.00 62.47  ? 246  ILE A O   1 
ATOM   1950  C  CB  . ILE A  1 246 ? 75.127  -15.481 -44.459 1.00 55.97  ? 246  ILE A CB  1 
ATOM   1951  C  CG1 . ILE A  1 246 ? 74.534  -16.062 -45.740 1.00 53.48  ? 246  ILE A CG1 1 
ATOM   1952  C  CG2 . ILE A  1 246 ? 74.086  -14.597 -43.779 1.00 56.90  ? 246  ILE A CG2 1 
ATOM   1953  C  CD1 . ILE A  1 246 ? 73.187  -16.732 -45.517 1.00 51.30  ? 246  ILE A CD1 1 
ATOM   1954  N  N   . TYR A  1 247 ? 78.195  -16.158 -43.983 1.00 57.90  ? 247  TYR A N   1 
ATOM   1955  C  CA  . TYR A  1 247 ? 79.372  -17.009 -44.131 1.00 58.60  ? 247  TYR A CA  1 
ATOM   1956  C  C   . TYR A  1 247 ? 79.346  -18.195 -43.180 1.00 59.49  ? 247  TYR A C   1 
ATOM   1957  O  O   . TYR A  1 247 ? 78.997  -18.049 -42.004 1.00 60.12  ? 247  TYR A O   1 
ATOM   1958  C  CB  . TYR A  1 247 ? 80.638  -16.190 -43.885 1.00 60.04  ? 247  TYR A CB  1 
ATOM   1959  C  CG  . TYR A  1 247 ? 80.755  -15.000 -44.800 1.00 61.13  ? 247  TYR A CG  1 
ATOM   1960  C  CD1 . TYR A  1 247 ? 81.571  -15.040 -45.923 1.00 61.17  ? 247  TYR A CD1 1 
ATOM   1961  C  CD2 . TYR A  1 247 ? 80.034  -13.842 -44.553 1.00 61.57  ? 247  TYR A CD2 1 
ATOM   1962  C  CE1 . TYR A  1 247 ? 81.673  -13.957 -46.768 1.00 61.96  ? 247  TYR A CE1 1 
ATOM   1963  C  CE2 . TYR A  1 247 ? 80.125  -12.755 -45.393 1.00 63.25  ? 247  TYR A CE2 1 
ATOM   1964  C  CZ  . TYR A  1 247 ? 80.948  -12.818 -46.500 1.00 64.90  ? 247  TYR A CZ  1 
ATOM   1965  O  OH  . TYR A  1 247 ? 81.047  -11.735 -47.342 1.00 67.58  ? 247  TYR A OH  1 
ATOM   1966  N  N   . ILE A  1 248 ? 79.718  -19.368 -43.687 1.00 57.63  ? 248  ILE A N   1 
ATOM   1967  C  CA  . ILE A  1 248 ? 79.861  -20.544 -42.835 1.00 56.54  ? 248  ILE A CA  1 
ATOM   1968  C  C   . ILE A  1 248 ? 81.313  -20.687 -42.401 1.00 60.34  ? 248  ILE A C   1 
ATOM   1969  O  O   . ILE A  1 248 ? 82.210  -20.674 -43.242 1.00 62.73  ? 248  ILE A O   1 
ATOM   1970  C  CB  . ILE A  1 248 ? 79.431  -21.834 -43.550 1.00 53.67  ? 248  ILE A CB  1 
ATOM   1971  C  CG1 . ILE A  1 248 ? 77.957  -21.763 -43.947 1.00 52.80  ? 248  ILE A CG1 1 
ATOM   1972  C  CG2 . ILE A  1 248 ? 79.663  -23.039 -42.652 1.00 52.59  ? 248  ILE A CG2 1 
ATOM   1973  C  CD1 . ILE A  1 248 ? 77.392  -23.089 -44.405 1.00 52.32  ? 248  ILE A CD1 1 
ATOM   1974  N  N   . TYR A  1 249 ? 81.545  -20.810 -41.094 1.00 62.21  ? 249  TYR A N   1 
ATOM   1975  C  CA  . TYR A  1 249 ? 82.903  -20.956 -40.578 1.00 63.92  ? 249  TYR A CA  1 
ATOM   1976  C  C   . TYR A  1 249 ? 83.093  -22.269 -39.830 1.00 66.25  ? 249  TYR A C   1 
ATOM   1977  O  O   . TYR A  1 249 ? 82.576  -22.449 -38.731 1.00 65.39  ? 249  TYR A O   1 
ATOM   1978  C  CB  . TYR A  1 249 ? 83.212  -19.793 -39.634 1.00 64.66  ? 249  TYR A CB  1 
ATOM   1979  C  CG  . TYR A  1 249 ? 84.547  -19.896 -38.936 1.00 67.37  ? 249  TYR A CG  1 
ATOM   1980  C  CD1 . TYR A  1 249 ? 85.690  -19.366 -39.511 1.00 69.88  ? 249  TYR A CD1 1 
ATOM   1981  C  CD2 . TYR A  1 249 ? 84.664  -20.520 -37.702 1.00 67.96  ? 249  TYR A CD2 1 
ATOM   1982  C  CE1 . TYR A  1 249 ? 86.916  -19.457 -38.880 1.00 72.36  ? 249  TYR A CE1 1 
ATOM   1983  C  CE2 . TYR A  1 249 ? 85.886  -20.616 -37.061 1.00 70.34  ? 249  TYR A CE2 1 
ATOM   1984  C  CZ  . TYR A  1 249 ? 87.010  -20.082 -37.654 1.00 73.10  ? 249  TYR A CZ  1 
ATOM   1985  O  OH  . TYR A  1 249 ? 88.234  -20.172 -37.026 1.00 75.25  ? 249  TYR A OH  1 
ATOM   1986  N  N   . ASP A  1 250 ? 83.841  -23.182 -40.441 1.00 70.97  ? 250  ASP A N   1 
ATOM   1987  C  CA  . ASP A  1 250 ? 84.288  -24.427 -39.807 1.00 75.67  ? 250  ASP A CA  1 
ATOM   1988  C  C   . ASP A  1 250 ? 85.719  -24.337 -39.283 1.00 76.53  ? 250  ASP A C   1 
ATOM   1989  O  O   . ASP A  1 250 ? 86.295  -25.333 -38.857 1.00 76.83  ? 250  ASP A O   1 
ATOM   1990  C  CB  . ASP A  1 250 ? 84.117  -25.628 -40.736 1.00 79.45  ? 250  ASP A CB  1 
ATOM   1991  C  CG  . ASP A  1 250 ? 84.785  -25.425 -42.064 1.00 83.80  ? 250  ASP A CG  1 
ATOM   1992  O  OD1 . ASP A  1 250 ? 85.753  -24.635 -42.119 1.00 83.85  ? 250  ASP A OD1 1 
ATOM   1993  O  OD2 . ASP A  1 250 ? 84.340  -26.052 -43.047 1.00 86.49  ? 250  ASP A OD2 1 
ATOM   1994  N  N   . GLY A  1 251 ? 86.293  -23.141 -39.358 1.00 76.99  ? 251  GLY A N   1 
ATOM   1995  C  CA  . GLY A  1 251 ? 87.731  -22.948 -39.268 1.00 75.79  ? 251  GLY A CA  1 
ATOM   1996  C  C   . GLY A  1 251 ? 88.251  -22.515 -40.628 1.00 73.03  ? 251  GLY A C   1 
ATOM   1997  O  O   . GLY A  1 251 ? 89.408  -22.124 -40.785 1.00 72.05  ? 251  GLY A O   1 
ATOM   1998  N  N   . GLU A  1 252 ? 87.366  -22.580 -41.614 1.00 71.11  ? 252  GLU A N   1 
ATOM   1999  C  CA  . GLU A  1 252 ? 87.583  -21.941 -42.902 1.00 70.85  ? 252  GLU A CA  1 
ATOM   2000  C  C   . GLU A  1 252 ? 86.302  -21.196 -43.264 1.00 71.26  ? 252  GLU A C   1 
ATOM   2001  O  O   . GLU A  1 252 ? 85.202  -21.719 -43.059 1.00 72.80  ? 252  GLU A O   1 
ATOM   2002  C  CB  . GLU A  1 252 ? 87.918  -22.979 -43.970 1.00 70.72  ? 252  GLU A CB  1 
ATOM   2003  N  N   . VAL A  1 253 ? 86.441  -19.977 -43.785 1.00 68.23  ? 253  VAL A N   1 
ATOM   2004  C  CA  . VAL A  1 253 ? 85.288  -19.123 -44.066 1.00 64.35  ? 253  VAL A CA  1 
ATOM   2005  C  C   . VAL A  1 253 ? 84.771  -19.325 -45.485 1.00 61.09  ? 253  VAL A C   1 
ATOM   2006  O  O   . VAL A  1 253 ? 85.470  -19.026 -46.446 1.00 58.78  ? 253  VAL A O   1 
ATOM   2007  C  CB  . VAL A  1 253 ? 85.640  -17.626 -43.910 1.00 63.35  ? 253  VAL A CB  1 
ATOM   2008  C  CG1 . VAL A  1 253 ? 84.384  -16.778 -43.997 1.00 64.45  ? 253  VAL A CG1 1 
ATOM   2009  C  CG2 . VAL A  1 253 ? 86.364  -17.370 -42.601 1.00 62.72  ? 253  VAL A CG2 1 
ATOM   2010  N  N   . LYS A  1 254 ? 83.539  -19.807 -45.619 1.00 60.28  ? 254  LYS A N   1 
ATOM   2011  C  CA  . LYS A  1 254 ? 82.949  -19.969 -46.947 1.00 61.20  ? 254  LYS A CA  1 
ATOM   2012  C  C   . LYS A  1 254 ? 81.682  -19.132 -47.123 1.00 63.12  ? 254  LYS A C   1 
ATOM   2013  O  O   . LYS A  1 254 ? 80.671  -19.386 -46.467 1.00 66.42  ? 254  LYS A O   1 
ATOM   2014  C  CB  . LYS A  1 254 ? 82.642  -21.445 -47.222 1.00 60.24  ? 254  LYS A CB  1 
ATOM   2015  N  N   . GLY A  1 255 ? 81.751  -18.110 -47.976 1.00 60.84  ? 255  GLY A N   1 
ATOM   2016  C  CA  . GLY A  1 255 ? 80.566  -17.364 -48.375 1.00 59.30  ? 255  GLY A CA  1 
ATOM   2017  C  C   . GLY A  1 255 ? 79.636  -18.169 -49.263 1.00 58.85  ? 255  GLY A C   1 
ATOM   2018  O  O   . GLY A  1 255 ? 80.049  -18.646 -50.310 1.00 60.58  ? 255  GLY A O   1 
ATOM   2019  N  N   . ILE A  1 256 ? 78.379  -18.326 -48.870 1.00 59.11  ? 256  ILE A N   1 
ATOM   2020  C  CA  . ILE A  1 256 ? 77.432  -19.011 -49.738 1.00 61.22  ? 256  ILE A CA  1 
ATOM   2021  C  C   . ILE A  1 256 ? 76.679  -18.056 -50.659 1.00 64.52  ? 256  ILE A C   1 
ATOM   2022  O  O   . ILE A  1 256 ? 76.040  -18.481 -51.619 1.00 65.58  ? 256  ILE A O   1 
ATOM   2023  C  CB  . ILE A  1 256 ? 76.430  -19.820 -48.919 1.00 61.86  ? 256  ILE A CB  1 
ATOM   2024  C  CG1 . ILE A  1 256 ? 75.533  -18.882 -48.113 1.00 60.87  ? 256  ILE A CG1 1 
ATOM   2025  C  CG2 . ILE A  1 256 ? 77.166  -20.781 -47.999 1.00 62.59  ? 256  ILE A CG2 1 
ATOM   2026  C  CD1 . ILE A  1 256 ? 75.518  -19.191 -46.637 1.00 61.12  ? 256  ILE A CD1 1 
ATOM   2027  N  N   . LEU A  1 257 ? 76.765  -16.762 -50.368 1.00 67.41  ? 257  LEU A N   1 
ATOM   2028  C  CA  . LEU A  1 257 ? 76.046  -15.743 -51.141 1.00 70.52  ? 257  LEU A CA  1 
ATOM   2029  C  C   . LEU A  1 257 ? 76.850  -15.012 -52.236 1.00 72.92  ? 257  LEU A C   1 
ATOM   2030  O  O   . LEU A  1 257 ? 76.349  -14.069 -52.842 1.00 73.76  ? 257  LEU A O   1 
ATOM   2031  C  CB  . LEU A  1 257 ? 75.345  -14.739 -50.211 1.00 70.09  ? 257  LEU A CB  1 
ATOM   2032  N  N   . ASP A  1 258 ? 78.094  -15.414 -52.458 1.00 74.62  ? 258  ASP A N   1 
ATOM   2033  C  CA  . ASP A  1 258 ? 79.024  -14.650 -53.293 1.00 75.67  ? 258  ASP A CA  1 
ATOM   2034  C  C   . ASP A  1 258 ? 78.508  -14.214 -54.674 1.00 74.88  ? 258  ASP A C   1 
ATOM   2035  O  O   . ASP A  1 258 ? 78.971  -13.214 -55.220 1.00 73.56  ? 258  ASP A O   1 
ATOM   2036  C  CB  . ASP A  1 258 ? 80.363  -15.385 -53.416 1.00 76.00  ? 258  ASP A CB  1 
ATOM   2037  N  N   . ASP A  1 259 ? 77.606  -14.989 -55.264 1.00 75.01  ? 259  ASP A N   1 
ATOM   2038  C  CA  . ASP A  1 259 ? 77.142  -14.684 -56.620 1.00 76.26  ? 259  ASP A CA  1 
ATOM   2039  C  C   . ASP A  1 259 ? 75.906  -13.788 -56.713 1.00 76.00  ? 259  ASP A C   1 
ATOM   2040  O  O   . ASP A  1 259 ? 75.463  -13.450 -57.815 1.00 76.20  ? 259  ASP A O   1 
ATOM   2041  C  CB  . ASP A  1 259 ? 76.890  -15.970 -57.410 1.00 79.40  ? 259  ASP A CB  1 
ATOM   2042  C  CG  . ASP A  1 259 ? 78.166  -16.572 -57.966 1.00 83.01  ? 259  ASP A CG  1 
ATOM   2043  O  OD1 . ASP A  1 259 ? 79.089  -15.802 -58.321 1.00 82.25  ? 259  ASP A OD1 1 
ATOM   2044  O  OD2 . ASP A  1 259 ? 78.244  -17.817 -58.048 1.00 84.75  ? 259  ASP A OD2 1 
ATOM   2045  N  N   . ILE A  1 260 ? 75.349  -13.406 -55.568 1.00 73.99  ? 260  ILE A N   1 
ATOM   2046  C  CA  . ILE A  1 260 ? 74.118  -12.620 -55.555 1.00 70.34  ? 260  ILE A CA  1 
ATOM   2047  C  C   . ILE A  1 260 ? 74.369  -11.258 -54.924 1.00 67.15  ? 260  ILE A C   1 
ATOM   2048  O  O   . ILE A  1 260 ? 74.870  -11.186 -53.802 1.00 67.92  ? 260  ILE A O   1 
ATOM   2049  C  CB  . ILE A  1 260 ? 73.014  -13.335 -54.756 1.00 71.17  ? 260  ILE A CB  1 
ATOM   2050  C  CG1 . ILE A  1 260 ? 73.341  -14.818 -54.598 1.00 70.57  ? 260  ILE A CG1 1 
ATOM   2051  C  CG2 . ILE A  1 260 ? 71.666  -13.174 -55.440 1.00 74.40  ? 260  ILE A CG2 1 
ATOM   2052  C  CD1 . ILE A  1 260 ? 72.123  -15.682 -54.334 1.00 70.83  ? 260  ILE A CD1 1 
ATOM   2053  N  N   . ASP A  1 261 ? 74.023  -10.172 -55.614 1.00 62.63  ? 261  ASP A N   1 
ATOM   2054  C  CA  . ASP A  1 261 ? 74.256  -8.887  -54.989 1.00 58.00  ? 261  ASP A CA  1 
ATOM   2055  C  C   . ASP A  1 261 ? 72.903  -8.414  -54.461 1.00 52.80  ? 261  ASP A C   1 
ATOM   2056  O  O   . ASP A  1 261 ? 72.145  -7.727  -55.146 1.00 48.44  ? 261  ASP A O   1 
ATOM   2057  C  CB  . ASP A  1 261 ? 74.758  -7.954  -56.096 1.00 59.63  ? 261  ASP A CB  1 
ATOM   2058  C  CG  . ASP A  1 261 ? 75.302  -6.645  -55.579 1.00 65.34  ? 261  ASP A CG  1 
ATOM   2059  O  OD1 . ASP A  1 261 ? 75.615  -6.552  -54.370 1.00 67.84  ? 261  ASP A OD1 1 
ATOM   2060  O  OD2 . ASP A  1 261 ? 75.438  -5.712  -56.406 1.00 66.04  ? 261  ASP A OD2 1 
ATOM   2061  N  N   . ARG A  1 262 ? 72.703  -8.668  -53.170 1.00 51.92  ? 262  ARG A N   1 
ATOM   2062  C  CA  . ARG A  1 262 ? 71.460  -8.391  -52.447 1.00 52.34  ? 262  ARG A CA  1 
ATOM   2063  C  C   . ARG A  1 262 ? 71.795  -8.420  -50.959 1.00 53.57  ? 262  ARG A C   1 
ATOM   2064  O  O   . ARG A  1 262 ? 72.785  -9.041  -50.576 1.00 56.23  ? 262  ARG A O   1 
ATOM   2065  C  CB  . ARG A  1 262 ? 70.398  -9.447  -52.767 1.00 49.91  ? 262  ARG A CB  1 
ATOM   2066  C  CG  . ARG A  1 262 ? 69.827  -9.367  -54.175 1.00 47.11  ? 262  ARG A CG  1 
ATOM   2067  C  CD  . ARG A  1 262 ? 69.234  -7.997  -54.455 1.00 46.27  ? 262  ARG A CD  1 
ATOM   2068  N  NE  . ARG A  1 262 ? 68.605  -7.928  -55.772 1.00 48.60  ? 262  ARG A NE  1 
ATOM   2069  C  CZ  . ARG A  1 262 ? 69.175  -7.391  -56.852 1.00 46.39  ? 262  ARG A CZ  1 
ATOM   2070  N  NH1 . ARG A  1 262 ? 70.391  -6.861  -56.777 1.00 44.36  ? 262  ARG A NH1 1 
ATOM   2071  N  NH2 . ARG A  1 262 ? 68.527  -7.374  -58.010 1.00 42.94  ? 262  ARG A NH2 1 
ATOM   2072  N  N   . GLU A  1 263 ? 70.977  -7.820  -50.102 1.00 50.32  ? 263  GLU A N   1 
ATOM   2073  C  CA  . GLU A  1 263 ? 71.293  -7.889  -48.671 1.00 48.44  ? 263  GLU A CA  1 
ATOM   2074  C  C   . GLU A  1 263 ? 70.513  -8.970  -47.924 1.00 47.73  ? 263  GLU A C   1 
ATOM   2075  O  O   . GLU A  1 263 ? 69.312  -9.165  -48.145 1.00 45.62  ? 263  GLU A O   1 
ATOM   2076  C  CB  . GLU A  1 263 ? 71.130  -6.533  -47.979 1.00 48.31  ? 263  GLU A CB  1 
ATOM   2077  C  CG  . GLU A  1 263 ? 71.521  -6.553  -46.501 1.00 49.53  ? 263  GLU A CG  1 
ATOM   2078  C  CD  . GLU A  1 263 ? 71.838  -5.176  -45.960 1.00 51.75  ? 263  GLU A CD  1 
ATOM   2079  O  OE1 . GLU A  1 263 ? 70.966  -4.285  -46.055 1.00 52.55  ? 263  GLU A OE1 1 
ATOM   2080  O  OE2 . GLU A  1 263 ? 72.962  -4.987  -45.445 1.00 51.97  ? 263  GLU A OE2 1 
ATOM   2081  N  N   . VAL A  1 264 ? 71.204  -9.688  -47.047 1.00 46.94  ? 264  VAL A N   1 
ATOM   2082  C  CA  . VAL A  1 264 ? 70.514  -10.636 -46.192 1.00 47.97  ? 264  VAL A CA  1 
ATOM   2083  C  C   . VAL A  1 264 ? 69.832  -9.912  -45.039 1.00 50.37  ? 264  VAL A C   1 
ATOM   2084  O  O   . VAL A  1 264 ? 70.457  -9.148  -44.297 1.00 49.51  ? 264  VAL A O   1 
ATOM   2085  C  CB  . VAL A  1 264 ? 71.445  -11.715 -45.649 1.00 47.98  ? 264  VAL A CB  1 
ATOM   2086  C  CG1 . VAL A  1 264 ? 70.645  -12.742 -44.875 1.00 45.56  ? 264  VAL A CG1 1 
ATOM   2087  C  CG2 . VAL A  1 264 ? 72.193  -12.381 -46.790 1.00 49.82  ? 264  VAL A CG2 1 
ATOM   2088  N  N   . ALA A  1 265 ? 68.528  -10.136 -44.937 1.00 52.29  ? 265  ALA A N   1 
ATOM   2089  C  CA  . ALA A  1 265 ? 67.711  -9.611  -43.859 1.00 50.41  ? 265  ALA A CA  1 
ATOM   2090  C  C   . ALA A  1 265 ? 67.870  -10.439 -42.594 1.00 55.02  ? 265  ALA A C   1 
ATOM   2091  O  O   . ALA A  1 265 ? 68.049  -9.898  -41.506 1.00 57.72  ? 265  ALA A O   1 
ATOM   2092  C  CB  . ALA A  1 265 ? 66.261  -9.584  -44.288 1.00 47.67  ? 265  ALA A CB  1 
ATOM   2093  N  N   . GLN A  1 266 ? 67.797  -11.757 -42.749 1.00 57.77  ? 266  GLN A N   1 
ATOM   2094  C  CA  . GLN A  1 266 ? 67.788  -12.671 -41.611 1.00 59.71  ? 266  GLN A CA  1 
ATOM   2095  C  C   . GLN A  1 266 ? 68.379  -14.025 -42.024 1.00 59.91  ? 266  GLN A C   1 
ATOM   2096  O  O   . GLN A  1 266 ? 68.217  -14.454 -43.168 1.00 59.93  ? 266  GLN A O   1 
ATOM   2097  C  CB  . GLN A  1 266 ? 66.346  -12.833 -41.120 1.00 60.16  ? 266  GLN A CB  1 
ATOM   2098  C  CG  . GLN A  1 266 ? 66.186  -13.406 -39.731 1.00 62.46  ? 266  GLN A CG  1 
ATOM   2099  C  CD  . GLN A  1 266 ? 64.735  -13.401 -39.277 1.00 63.41  ? 266  GLN A CD  1 
ATOM   2100  O  OE1 . GLN A  1 266 ? 63.913  -12.655 -39.808 1.00 63.56  ? 266  GLN A OE1 1 
ATOM   2101  N  NE2 . GLN A  1 266 ? 64.412  -14.242 -38.299 1.00 62.65  ? 266  GLN A NE2 1 
ATOM   2102  N  N   . ALA A  1 267 ? 69.059  -14.701 -41.104 1.00 58.67  ? 267  ALA A N   1 
ATOM   2103  C  CA  . ALA A  1 267 ? 69.672  -15.989 -41.428 1.00 57.82  ? 267  ALA A CA  1 
ATOM   2104  C  C   . ALA A  1 267 ? 69.745  -16.939 -40.234 1.00 59.50  ? 267  ALA A C   1 
ATOM   2105  O  O   . ALA A  1 267 ? 69.949  -16.510 -39.097 1.00 59.08  ? 267  ALA A O   1 
ATOM   2106  C  CB  . ALA A  1 267 ? 71.051  -15.780 -42.011 1.00 56.28  ? 267  ALA A CB  1 
ATOM   2107  N  N   . LYS A  1 268 ? 69.584  -18.231 -40.506 1.00 59.82  ? 268  LYS A N   1 
ATOM   2108  C  CA  . LYS A  1 268 ? 69.703  -19.263 -39.479 1.00 59.22  ? 268  LYS A CA  1 
ATOM   2109  C  C   . LYS A  1 268 ? 70.303  -20.540 -40.065 1.00 60.38  ? 268  LYS A C   1 
ATOM   2110  O  O   . LYS A  1 268 ? 70.068  -20.868 -41.226 1.00 60.04  ? 268  LYS A O   1 
ATOM   2111  C  CB  . LYS A  1 268 ? 68.341  -19.561 -38.847 1.00 57.07  ? 268  LYS A CB  1 
ATOM   2112  C  CG  . LYS A  1 268 ? 67.696  -18.367 -38.156 1.00 54.72  ? 268  LYS A CG  1 
ATOM   2113  C  CD  . LYS A  1 268 ? 66.452  -18.783 -37.395 1.00 52.39  ? 268  LYS A CD  1 
ATOM   2114  C  CE  . LYS A  1 268 ? 65.797  -17.600 -36.703 1.00 48.71  ? 268  LYS A CE  1 
ATOM   2115  N  NZ  . LYS A  1 268 ? 64.759  -18.058 -35.737 1.00 47.13  ? 268  LYS A NZ  1 
ATOM   2116  N  N   . ILE A  1 269 ? 71.081  -21.258 -39.261 1.00 62.39  ? 269  ILE A N   1 
ATOM   2117  C  CA  . ILE A  1 269 ? 71.711  -22.492 -39.719 1.00 64.33  ? 269  ILE A CA  1 
ATOM   2118  C  C   . ILE A  1 269 ? 71.292  -23.687 -38.855 1.00 71.02  ? 269  ILE A C   1 
ATOM   2119  O  O   . ILE A  1 269 ? 71.483  -23.695 -37.635 1.00 72.51  ? 269  ILE A O   1 
ATOM   2120  C  CB  . ILE A  1 269 ? 73.251  -22.349 -39.789 1.00 60.70  ? 269  ILE A CB  1 
ATOM   2121  C  CG1 . ILE A  1 269 ? 73.882  -23.556 -40.483 1.00 61.16  ? 269  ILE A CG1 1 
ATOM   2122  C  CG2 . ILE A  1 269 ? 73.854  -22.122 -38.407 1.00 58.63  ? 269  ILE A CG2 1 
ATOM   2123  C  CD1 . ILE A  1 269 ? 75.371  -23.395 -40.745 1.00 59.83  ? 269  ILE A CD1 1 
ATOM   2124  N  N   . ARG A  1 270 ? 70.687  -24.680 -39.499 1.00 74.31  ? 270  ARG A N   1 
ATOM   2125  C  CA  . ARG A  1 270 ? 70.229  -25.883 -38.812 1.00 76.84  ? 270  ARG A CA  1 
ATOM   2126  C  C   . ARG A  1 270 ? 70.757  -27.132 -39.511 1.00 80.16  ? 270  ARG A C   1 
ATOM   2127  O  O   . ARG A  1 270 ? 70.404  -27.399 -40.662 1.00 81.14  ? 270  ARG A O   1 
ATOM   2128  C  CB  . ARG A  1 270 ? 68.701  -25.917 -38.756 1.00 76.94  ? 270  ARG A CB  1 
ATOM   2129  N  N   . ASN A  1 271 ? 71.603  -27.884 -38.809 1.00 81.74  ? 271  ASN A N   1 
ATOM   2130  C  CA  . ASN A  1 271 ? 72.231  -29.077 -39.358 1.00 82.33  ? 271  ASN A CA  1 
ATOM   2131  C  C   . ASN A  1 271 ? 72.773  -28.864 -40.771 1.00 79.99  ? 271  ASN A C   1 
ATOM   2132  O  O   . ASN A  1 271 ? 72.295  -29.500 -41.739 1.00 78.51  ? 271  ASN A O   1 
ATOM   2133  C  CB  . ASN A  1 271 ? 71.255  -30.256 -39.324 1.00 84.13  ? 271  ASN A CB  1 
ATOM   2134  N  N   . GLY A  1 272 ? 73.761  -27.970 -40.878 1.00 78.79  ? 272  GLY A N   1 
ATOM   2135  C  CA  . GLY A  1 272 ? 74.522  -27.779 -42.108 1.00 77.58  ? 272  GLY A CA  1 
ATOM   2136  C  C   . GLY A  1 272 ? 73.800  -27.006 -43.219 1.00 76.25  ? 272  GLY A C   1 
ATOM   2137  O  O   . GLY A  1 272 ? 74.436  -26.556 -44.168 1.00 77.84  ? 272  GLY A O   1 
ATOM   2138  N  N   . LYS A  1 273 ? 72.485  -26.836 -43.086 1.00 73.85  ? 273  LYS A N   1 
ATOM   2139  C  CA  . LYS A  1 273 ? 71.710  -26.087 -44.057 1.00 71.74  ? 273  LYS A CA  1 
ATOM   2140  C  C   . LYS A  1 273 ? 71.442  -24.672 -43.536 1.00 69.83  ? 273  LYS A C   1 
ATOM   2141  O  O   . LYS A  1 273 ? 71.242  -24.470 -42.342 1.00 69.39  ? 273  LYS A O   1 
ATOM   2142  C  CB  . LYS A  1 273 ? 70.390  -26.826 -44.352 1.00 71.75  ? 273  LYS A CB  1 
ATOM   2143  C  CG  . LYS A  1 273 ? 70.545  -28.155 -45.012 1.00 72.68  ? 273  LYS A CG  1 
ATOM   2144  C  CD  . LYS A  1 273 ? 69.284  -28.989 -44.937 1.00 72.31  ? 273  LYS A CD  1 
ATOM   2145  N  N   . VAL A  1 274 ? 71.443  -23.703 -44.448 1.00 68.00  ? 274  VAL A N   1 
ATOM   2146  C  CA  . VAL A  1 274 ? 71.232  -22.323 -44.032 1.00 65.12  ? 274  VAL A CA  1 
ATOM   2147  C  C   . VAL A  1 274 ? 69.954  -21.735 -44.620 1.00 65.55  ? 274  VAL A C   1 
ATOM   2148  O  O   . VAL A  1 274 ? 69.789  -21.669 -45.838 1.00 67.27  ? 274  VAL A O   1 
ATOM   2149  C  CB  . VAL A  1 274 ? 72.417  -21.429 -44.417 1.00 61.26  ? 274  VAL A CB  1 
ATOM   2150  C  CG1 . VAL A  1 274 ? 72.028  -19.970 -44.305 1.00 58.46  ? 274  VAL A CG1 1 
ATOM   2151  C  CG2 . VAL A  1 274 ? 73.610  -21.751 -43.536 1.00 61.90  ? 274  VAL A CG2 1 
ATOM   2152  N  N   . TYR A  1 275 ? 69.046  -21.318 -43.749 1.00 64.14  ? 275  TYR A N   1 
ATOM   2153  C  CA  . TYR A  1 275 ? 67.835  -20.644 -44.175 1.00 63.59  ? 275  TYR A CA  1 
ATOM   2154  C  C   . TYR A  1 275 ? 68.036  -19.146 -44.019 1.00 64.04  ? 275  TYR A C   1 
ATOM   2155  O  O   . TYR A  1 275 ? 68.586  -18.690 -43.019 1.00 67.01  ? 275  TYR A O   1 
ATOM   2156  C  CB  . TYR A  1 275 ? 66.659  -21.097 -43.324 1.00 64.00  ? 275  TYR A CB  1 
ATOM   2157  C  CG  . TYR A  1 275 ? 66.330  -22.564 -43.446 1.00 67.22  ? 275  TYR A CG  1 
ATOM   2158  C  CD1 . TYR A  1 275 ? 67.013  -23.513 -42.701 1.00 69.42  ? 275  TYR A CD1 1 
ATOM   2159  C  CD2 . TYR A  1 275 ? 65.318  -22.999 -44.291 1.00 70.02  ? 275  TYR A CD2 1 
ATOM   2160  C  CE1 . TYR A  1 275 ? 66.702  -24.860 -42.802 1.00 72.10  ? 275  TYR A CE1 1 
ATOM   2161  C  CE2 . TYR A  1 275 ? 64.997  -24.340 -44.399 1.00 71.93  ? 275  TYR A CE2 1 
ATOM   2162  C  CZ  . TYR A  1 275 ? 65.691  -25.266 -43.652 1.00 73.56  ? 275  TYR A CZ  1 
ATOM   2163  O  OH  . TYR A  1 275 ? 65.369  -26.601 -43.757 1.00 75.78  ? 275  TYR A OH  1 
ATOM   2164  N  N   . PHE A  1 276 ? 67.598  -18.377 -45.007 1.00 61.45  ? 276  PHE A N   1 
ATOM   2165  C  CA  . PHE A  1 276 ? 67.821  -16.939 -44.975 1.00 59.40  ? 276  PHE A CA  1 
ATOM   2166  C  C   . PHE A  1 276 ? 66.803  -16.172 -45.815 1.00 58.99  ? 276  PHE A C   1 
ATOM   2167  O  O   . PHE A  1 276 ? 66.096  -16.755 -46.641 1.00 60.67  ? 276  PHE A O   1 
ATOM   2168  C  CB  . PHE A  1 276 ? 69.243  -16.617 -45.438 1.00 57.71  ? 276  PHE A CB  1 
ATOM   2169  C  CG  . PHE A  1 276 ? 69.495  -16.942 -46.881 1.00 58.29  ? 276  PHE A CG  1 
ATOM   2170  C  CD1 . PHE A  1 276 ? 69.829  -18.228 -47.269 1.00 59.46  ? 276  PHE A CD1 1 
ATOM   2171  C  CD2 . PHE A  1 276 ? 69.394  -15.961 -47.852 1.00 57.86  ? 276  PHE A CD2 1 
ATOM   2172  C  CE1 . PHE A  1 276 ? 70.060  -18.525 -48.599 1.00 60.02  ? 276  PHE A CE1 1 
ATOM   2173  C  CE2 . PHE A  1 276 ? 69.623  -16.254 -49.181 1.00 58.44  ? 276  PHE A CE2 1 
ATOM   2174  C  CZ  . PHE A  1 276 ? 69.956  -17.535 -49.555 1.00 59.33  ? 276  PHE A CZ  1 
ATOM   2175  N  N   . THR A  1 277 ? 66.721  -14.866 -45.583 1.00 55.24  ? 277  THR A N   1 
ATOM   2176  C  CA  . THR A  1 277 ? 65.872  -13.995 -46.386 1.00 51.90  ? 277  THR A CA  1 
ATOM   2177  C  C   . THR A  1 277 ? 66.705  -12.901 -47.044 1.00 50.87  ? 277  THR A C   1 
ATOM   2178  O  O   . THR A  1 277 ? 67.748  -12.512 -46.523 1.00 52.45  ? 277  THR A O   1 
ATOM   2179  C  CB  . THR A  1 277 ? 64.746  -13.353 -45.546 1.00 49.72  ? 277  THR A CB  1 
ATOM   2180  O  OG1 . THR A  1 277 ? 65.298  -12.785 -44.353 1.00 47.43  ? 277  THR A OG1 1 
ATOM   2181  C  CG2 . THR A  1 277 ? 63.706  -14.392 -45.166 1.00 48.93  ? 277  THR A CG2 1 
ATOM   2182  N  N   . LEU A  1 278 ? 66.247  -12.418 -48.194 1.00 48.40  ? 278  LEU A N   1 
ATOM   2183  C  CA  . LEU A  1 278 ? 66.953  -11.366 -48.917 1.00 46.90  ? 278  LEU A CA  1 
ATOM   2184  C  C   . LEU A  1 278 ? 66.030  -10.204 -49.228 1.00 49.38  ? 278  LEU A C   1 
ATOM   2185  O  O   . LEU A  1 278 ? 64.825  -10.383 -49.393 1.00 49.86  ? 278  LEU A O   1 
ATOM   2186  C  CB  . LEU A  1 278 ? 67.493  -11.896 -50.236 1.00 45.48  ? 278  LEU A CB  1 
ATOM   2187  C  CG  . LEU A  1 278 ? 68.492  -13.044 -50.209 1.00 46.57  ? 278  LEU A CG  1 
ATOM   2188  C  CD1 . LEU A  1 278 ? 68.662  -13.585 -51.624 1.00 47.88  ? 278  LEU A CD1 1 
ATOM   2189  C  CD2 . LEU A  1 278 ? 69.833  -12.612 -49.614 1.00 44.38  ? 278  LEU A CD2 1 
ATOM   2190  N  N   . PHE A  1 279 ? 66.603  -9.010  -49.329 1.00 51.32  ? 279  PHE A N   1 
ATOM   2191  C  CA  . PHE A  1 279 ? 65.841  -7.861  -49.780 1.00 51.10  ? 279  PHE A CA  1 
ATOM   2192  C  C   . PHE A  1 279 ? 65.879  -7.848  -51.294 1.00 53.35  ? 279  PHE A C   1 
ATOM   2193  O  O   . PHE A  1 279 ? 66.944  -7.685  -51.885 1.00 54.49  ? 279  PHE A O   1 
ATOM   2194  C  CB  . PHE A  1 279 ? 66.492  -6.572  -49.294 1.00 49.22  ? 279  PHE A CB  1 
ATOM   2195  C  CG  . PHE A  1 279 ? 66.403  -6.353  -47.820 1.00 46.99  ? 279  PHE A CG  1 
ATOM   2196  C  CD1 . PHE A  1 279 ? 67.401  -6.807  -46.983 1.00 47.16  ? 279  PHE A CD1 1 
ATOM   2197  C  CD2 . PHE A  1 279 ? 65.336  -5.656  -47.273 1.00 45.52  ? 279  PHE A CD2 1 
ATOM   2198  C  CE1 . PHE A  1 279 ? 67.327  -6.588  -45.625 1.00 46.82  ? 279  PHE A CE1 1 
ATOM   2199  C  CE2 . PHE A  1 279 ? 65.254  -5.433  -45.916 1.00 43.86  ? 279  PHE A CE2 1 
ATOM   2200  C  CZ  . PHE A  1 279 ? 66.246  -5.897  -45.091 1.00 45.03  ? 279  PHE A CZ  1 
ATOM   2201  N  N   . GLU A  1 280 ? 64.720  -8.003  -51.922 1.00 53.87  ? 280  GLU A N   1 
ATOM   2202  C  CA  . GLU A  1 280 ? 64.638  -7.914  -53.372 1.00 53.85  ? 280  GLU A CA  1 
ATOM   2203  C  C   . GLU A  1 280 ? 63.463  -7.070  -53.843 1.00 53.02  ? 280  GLU A C   1 
ATOM   2204  O  O   . GLU A  1 280 ? 62.306  -7.444  -53.644 1.00 50.35  ? 280  GLU A O   1 
ATOM   2205  C  CB  . GLU A  1 280 ? 64.499  -9.308  -53.968 1.00 56.23  ? 280  GLU A CB  1 
ATOM   2206  C  CG  . GLU A  1 280 ? 65.597  -10.277 -53.585 1.00 58.86  ? 280  GLU A CG  1 
ATOM   2207  C  CD  . GLU A  1 280 ? 65.295  -11.682 -54.069 1.00 60.83  ? 280  GLU A CD  1 
ATOM   2208  O  OE1 . GLU A  1 280 ? 64.471  -12.364 -53.425 1.00 58.53  ? 280  GLU A OE1 1 
ATOM   2209  O  OE2 . GLU A  1 280 ? 65.861  -12.097 -55.103 1.00 63.84  ? 280  GLU A OE2 1 
ATOM   2210  N  N   . GLU A  1 281 ? 63.767  -5.947  -54.489 1.00 55.07  ? 281  GLU A N   1 
ATOM   2211  C  CA  . GLU A  1 281 ? 62.779  -5.167  -55.240 1.00 54.85  ? 281  GLU A CA  1 
ATOM   2212  C  C   . GLU A  1 281 ? 61.449  -4.960  -54.512 1.00 53.84  ? 281  GLU A C   1 
ATOM   2213  O  O   . GLU A  1 281 ? 60.379  -5.153  -55.092 1.00 53.85  ? 281  GLU A O   1 
ATOM   2214  C  CB  . GLU A  1 281 ? 62.549  -5.772  -56.631 1.00 52.93  ? 281  GLU A CB  1 
ATOM   2215  C  CG  . GLU A  1 281 ? 63.810  -5.869  -57.478 1.00 52.61  ? 281  GLU A CG  1 
ATOM   2216  C  CD  . GLU A  1 281 ? 64.585  -7.162  -57.253 1.00 52.96  ? 281  GLU A CD  1 
ATOM   2217  O  OE1 . GLU A  1 281 ? 63.954  -8.224  -57.060 1.00 50.89  ? 281  GLU A OE1 1 
ATOM   2218  O  OE2 . GLU A  1 281 ? 65.832  -7.115  -57.274 1.00 54.35  ? 281  GLU A OE2 1 
ATOM   2219  N  N   . GLY A  1 282 ? 61.527  -4.571  -53.243 1.00 53.12  ? 282  GLY A N   1 
ATOM   2220  C  CA  . GLY A  1 282 ? 60.343  -4.279  -52.452 1.00 51.14  ? 282  GLY A CA  1 
ATOM   2221  C  C   . GLY A  1 282 ? 59.763  -5.500  -51.764 1.00 48.89  ? 282  GLY A C   1 
ATOM   2222  O  O   . GLY A  1 282 ? 58.670  -5.447  -51.196 1.00 47.53  ? 282  GLY A O   1 
ATOM   2223  N  N   . SER A  1 283 ? 60.493  -6.609  -51.823 1.00 46.45  ? 283  SER A N   1 
ATOM   2224  C  CA  . SER A  1 283 ? 60.041  -7.849  -51.218 1.00 45.84  ? 283  SER A CA  1 
ATOM   2225  C  C   . SER A  1 283 ? 61.127  -8.374  -50.302 1.00 47.18  ? 283  SER A C   1 
ATOM   2226  O  O   . SER A  1 283 ? 62.291  -8.006  -50.432 1.00 49.27  ? 283  SER A O   1 
ATOM   2227  C  CB  . SER A  1 283 ? 59.749  -8.891  -52.297 1.00 47.58  ? 283  SER A CB  1 
ATOM   2228  O  OG  . SER A  1 283 ? 58.895  -8.371  -53.302 1.00 49.34  ? 283  SER A OG  1 
ATOM   2229  N  N   . VAL A  1 284 ? 60.749  -9.224  -49.360 1.00 46.46  ? 284  VAL A N   1 
ATOM   2230  C  CA  . VAL A  1 284 ? 61.741  -9.933  -48.567 1.00 45.67  ? 284  VAL A CA  1 
ATOM   2231  C  C   . VAL A  1 284 ? 61.459  -11.418 -48.692 1.00 46.24  ? 284  VAL A C   1 
ATOM   2232  O  O   . VAL A  1 284 ? 60.419  -11.904 -48.223 1.00 47.25  ? 284  VAL A O   1 
ATOM   2233  C  CB  . VAL A  1 284 ? 61.723  -9.496  -47.088 1.00 43.03  ? 284  VAL A CB  1 
ATOM   2234  C  CG1 . VAL A  1 284 ? 62.626  -10.397 -46.263 1.00 40.33  ? 284  VAL A CG1 1 
ATOM   2235  C  CG2 . VAL A  1 284 ? 62.155  -8.036  -46.967 1.00 42.75  ? 284  VAL A CG2 1 
ATOM   2236  N  N   . ASN A  1 285 ? 62.385  -12.139 -49.319 1.00 43.71  ? 285  ASN A N   1 
ATOM   2237  C  CA  . ASN A  1 285 ? 62.103  -13.507 -49.713 1.00 44.44  ? 285  ASN A CA  1 
ATOM   2238  C  C   . ASN A  1 285 ? 62.885  -14.552 -48.913 1.00 45.82  ? 285  ASN A C   1 
ATOM   2239  O  O   . ASN A  1 285 ? 63.996  -14.291 -48.450 1.00 44.20  ? 285  ASN A O   1 
ATOM   2240  C  CB  . ASN A  1 285 ? 62.314  -13.667 -51.220 1.00 45.75  ? 285  ASN A CB  1 
ATOM   2241  C  CG  . ASN A  1 285 ? 61.342  -12.820 -52.043 1.00 45.21  ? 285  ASN A CG  1 
ATOM   2242  O  OD1 . ASN A  1 285 ? 60.126  -12.923 -51.894 1.00 43.89  ? 285  ASN A OD1 1 
ATOM   2243  N  ND2 . ASN A  1 285 ? 61.884  -11.971 -52.910 1.00 45.68  ? 285  ASN A ND2 1 
ATOM   2244  N  N   . LEU A  1 286 ? 62.271  -15.720 -48.727 1.00 47.82  ? 286  LEU A N   1 
ATOM   2245  C  CA  . LEU A  1 286 ? 62.883  -16.824 -47.993 1.00 48.96  ? 286  LEU A CA  1 
ATOM   2246  C  C   . LEU A  1 286 ? 63.600  -17.775 -48.956 1.00 51.12  ? 286  LEU A C   1 
ATOM   2247  O  O   . LEU A  1 286 ? 63.056  -18.149 -49.998 1.00 47.88  ? 286  LEU A O   1 
ATOM   2248  C  CB  . LEU A  1 286 ? 61.819  -17.578 -47.182 1.00 49.58  ? 286  LEU A CB  1 
ATOM   2249  C  CG  . LEU A  1 286 ? 62.282  -18.760 -46.319 1.00 49.80  ? 286  LEU A CG  1 
ATOM   2250  C  CD1 . LEU A  1 286 ? 63.339  -18.327 -45.314 1.00 50.18  ? 286  LEU A CD1 1 
ATOM   2251  C  CD2 . LEU A  1 286 ? 61.114  -19.431 -45.605 1.00 47.83  ? 286  LEU A CD2 1 
ATOM   2252  N  N   . TYR A  1 287 ? 64.828  -18.152 -48.610 1.00 55.13  ? 287  TYR A N   1 
ATOM   2253  C  CA  . TYR A  1 287 ? 65.614  -19.070 -49.429 1.00 57.09  ? 287  TYR A CA  1 
ATOM   2254  C  C   . TYR A  1 287 ? 66.270  -20.141 -48.570 1.00 60.69  ? 287  TYR A C   1 
ATOM   2255  O  O   . TYR A  1 287 ? 66.417  -19.976 -47.361 1.00 60.37  ? 287  TYR A O   1 
ATOM   2256  C  CB  . TYR A  1 287 ? 66.699  -18.321 -50.202 1.00 54.90  ? 287  TYR A CB  1 
ATOM   2257  C  CG  . TYR A  1 287 ? 66.182  -17.427 -51.302 1.00 55.89  ? 287  TYR A CG  1 
ATOM   2258  C  CD1 . TYR A  1 287 ? 66.085  -16.053 -51.123 1.00 56.85  ? 287  TYR A CD1 1 
ATOM   2259  C  CD2 . TYR A  1 287 ? 65.798  -17.956 -52.524 1.00 57.47  ? 287  TYR A CD2 1 
ATOM   2260  C  CE1 . TYR A  1 287 ? 65.617  -15.230 -52.130 1.00 57.90  ? 287  TYR A CE1 1 
ATOM   2261  C  CE2 . TYR A  1 287 ? 65.324  -17.138 -53.542 1.00 58.95  ? 287  TYR A CE2 1 
ATOM   2262  C  CZ  . TYR A  1 287 ? 65.236  -15.777 -53.340 1.00 58.78  ? 287  TYR A CZ  1 
ATOM   2263  O  OH  . TYR A  1 287 ? 64.766  -14.967 -54.351 1.00 57.75  ? 287  TYR A OH  1 
ATOM   2264  N  N   . LEU A  1 288 ? 66.672  -21.236 -49.205 1.00 63.66  ? 288  LEU A N   1 
ATOM   2265  C  CA  . LEU A  1 288 ? 67.413  -22.293 -48.527 1.00 64.27  ? 288  LEU A CA  1 
ATOM   2266  C  C   . LEU A  1 288 ? 68.750  -22.538 -49.215 1.00 64.12  ? 288  LEU A C   1 
ATOM   2267  O  O   . LEU A  1 288 ? 68.823  -22.559 -50.444 1.00 62.27  ? 288  LEU A O   1 
ATOM   2268  C  CB  . LEU A  1 288 ? 66.601  -23.587 -48.517 1.00 65.36  ? 288  LEU A CB  1 
ATOM   2269  C  CG  . LEU A  1 288 ? 67.404  -24.877 -48.333 1.00 67.71  ? 288  LEU A CG  1 
ATOM   2270  C  CD1 . LEU A  1 288 ? 68.095  -24.910 -46.976 1.00 68.46  ? 288  LEU A CD1 1 
ATOM   2271  C  CD2 . LEU A  1 288 ? 66.509  -26.092 -48.511 1.00 68.05  ? 288  LEU A CD2 1 
ATOM   2272  N  N   . TRP A  1 289 ? 69.807  -22.702 -48.425 1.00 64.94  ? 289  TRP A N   1 
ATOM   2273  C  CA  . TRP A  1 289 ? 71.070  -23.186 -48.963 1.00 66.04  ? 289  TRP A CA  1 
ATOM   2274  C  C   . TRP A  1 289 ? 71.415  -24.563 -48.398 1.00 68.89  ? 289  TRP A C   1 
ATOM   2275  O  O   . TRP A  1 289 ? 71.730  -24.703 -47.208 1.00 66.91  ? 289  TRP A O   1 
ATOM   2276  C  CB  . TRP A  1 289 ? 72.203  -22.201 -48.686 1.00 65.26  ? 289  TRP A CB  1 
ATOM   2277  C  CG  . TRP A  1 289 ? 73.521  -22.615 -49.288 1.00 67.28  ? 289  TRP A CG  1 
ATOM   2278  C  CD1 . TRP A  1 289 ? 74.011  -22.266 -50.516 1.00 67.17  ? 289  TRP A CD1 1 
ATOM   2279  C  CD2 . TRP A  1 289 ? 74.514  -23.455 -48.687 1.00 68.66  ? 289  TRP A CD2 1 
ATOM   2280  N  NE1 . TRP A  1 289 ? 75.247  -22.833 -50.714 1.00 66.73  ? 289  TRP A NE1 1 
ATOM   2281  C  CE2 . TRP A  1 289 ? 75.579  -23.567 -49.607 1.00 67.97  ? 289  TRP A CE2 1 
ATOM   2282  C  CE3 . TRP A  1 289 ? 74.607  -24.121 -47.461 1.00 69.32  ? 289  TRP A CE3 1 
ATOM   2283  C  CZ2 . TRP A  1 289 ? 76.721  -24.316 -49.337 1.00 68.17  ? 289  TRP A CZ2 1 
ATOM   2284  C  CZ3 . TRP A  1 289 ? 75.741  -24.868 -47.197 1.00 70.01  ? 289  TRP A CZ3 1 
ATOM   2285  C  CH2 . TRP A  1 289 ? 76.782  -24.960 -48.132 1.00 70.01  ? 289  TRP A CH2 1 
ATOM   2286  N  N   . ASP A  1 290 ? 71.308  -25.568 -49.270 1.00 71.11  ? 290  ASP A N   1 
ATOM   2287  C  CA  . ASP A  1 290 ? 71.807  -26.933 -49.050 1.00 70.81  ? 290  ASP A CA  1 
ATOM   2288  C  C   . ASP A  1 290 ? 73.185  -27.203 -49.658 1.00 69.86  ? 290  ASP A C   1 
ATOM   2289  O  O   . ASP A  1 290 ? 73.632  -28.347 -49.715 1.00 70.92  ? 290  ASP A O   1 
ATOM   2290  C  CB  . ASP A  1 290 ? 70.791  -28.011 -49.421 1.00 71.24  ? 290  ASP A CB  1 
ATOM   2291  C  CG  . ASP A  1 290 ? 70.335  -27.910 -50.837 1.00 71.62  ? 290  ASP A CG  1 
ATOM   2292  O  OD1 . ASP A  1 290 ? 71.096  -27.382 -51.677 1.00 72.14  ? 290  ASP A OD1 1 
ATOM   2293  O  OD2 . ASP A  1 290 ? 69.208  -28.370 -51.102 1.00 71.62  ? 290  ASP A OD2 1 
ATOM   2294  N  N   . GLY A  1 291 ? 73.839  -26.149 -50.133 1.00 67.96  ? 291  GLY A N   1 
ATOM   2295  C  CA  . GLY A  1 291 ? 74.999  -26.268 -50.997 1.00 67.63  ? 291  GLY A CA  1 
ATOM   2296  C  C   . GLY A  1 291 ? 74.714  -25.748 -52.387 1.00 66.82  ? 291  GLY A C   1 
ATOM   2297  O  O   . GLY A  1 291 ? 75.614  -25.609 -53.209 1.00 67.26  ? 291  GLY A O   1 
ATOM   2298  N  N   . GLU A  1 292 ? 73.450  -25.438 -52.632 1.00 66.26  ? 292  GLU A N   1 
ATOM   2299  C  CA  . GLU A  1 292 ? 73.063  -24.551 -53.720 1.00 64.93  ? 292  GLU A CA  1 
ATOM   2300  C  C   . GLU A  1 292 ? 71.952  -23.670 -53.153 1.00 68.11  ? 292  GLU A C   1 
ATOM   2301  O  O   . GLU A  1 292 ? 71.410  -23.973 -52.087 1.00 70.62  ? 292  GLU A O   1 
ATOM   2302  C  CB  . GLU A  1 292 ? 72.574  -25.340 -54.935 1.00 60.64  ? 292  GLU A CB  1 
ATOM   2303  N  N   . VAL A  1 293 ? 71.615  -22.582 -53.838 1.00 65.42  ? 293  VAL A N   1 
ATOM   2304  C  CA  . VAL A  1 293 ? 70.526  -21.728 -53.372 1.00 60.76  ? 293  VAL A CA  1 
ATOM   2305  C  C   . VAL A  1 293 ? 69.192  -22.101 -54.022 1.00 61.09  ? 293  VAL A C   1 
ATOM   2306  O  O   . VAL A  1 293 ? 68.993  -21.925 -55.221 1.00 62.12  ? 293  VAL A O   1 
ATOM   2307  C  CB  . VAL A  1 293 ? 70.825  -20.230 -53.608 1.00 56.27  ? 293  VAL A CB  1 
ATOM   2308  C  CG1 . VAL A  1 293 ? 69.606  -19.388 -53.280 1.00 53.48  ? 293  VAL A CG1 1 
ATOM   2309  C  CG2 . VAL A  1 293 ? 72.020  -19.787 -52.775 1.00 55.53  ? 293  VAL A CG2 1 
ATOM   2310  N  N   . ARG A  1 294 ? 68.274  -22.618 -53.216 1.00 62.74  ? 294  ARG A N   1 
ATOM   2311  C  CA  . ARG A  1 294 ? 66.947  -22.962 -53.702 1.00 65.62  ? 294  ARG A CA  1 
ATOM   2312  C  C   . ARG A  1 294 ? 65.918  -22.004 -53.113 1.00 65.13  ? 294  ARG A C   1 
ATOM   2313  O  O   . ARG A  1 294 ? 66.051  -21.574 -51.971 1.00 66.78  ? 294  ARG A O   1 
ATOM   2314  C  CB  . ARG A  1 294 ? 66.607  -24.415 -53.355 1.00 68.79  ? 294  ARG A CB  1 
ATOM   2315  C  CG  . ARG A  1 294 ? 67.707  -25.152 -52.607 1.00 71.06  ? 294  ARG A CG  1 
ATOM   2316  C  CD  . ARG A  1 294 ? 67.963  -26.534 -53.195 1.00 73.56  ? 294  ARG A CD  1 
ATOM   2317  N  NE  . ARG A  1 294 ? 68.835  -26.475 -54.366 1.00 76.70  ? 294  ARG A NE  1 
ATOM   2318  C  CZ  . ARG A  1 294 ? 69.409  -27.534 -54.932 1.00 78.03  ? 294  ARG A CZ  1 
ATOM   2319  N  NH1 . ARG A  1 294 ? 69.209  -28.750 -54.439 1.00 78.44  ? 294  ARG A NH1 1 
ATOM   2320  N  NH2 . ARG A  1 294 ? 70.190  -27.375 -55.992 1.00 78.23  ? 294  ARG A NH2 1 
ATOM   2321  N  N   . GLU A  1 295 ? 64.897  -21.664 -53.893 1.00 63.45  ? 295  GLU A N   1 
ATOM   2322  C  CA  . GLU A  1 295 ? 63.913  -20.684 -53.454 1.00 62.67  ? 295  GLU A CA  1 
ATOM   2323  C  C   . GLU A  1 295 ? 62.751  -21.332 -52.715 1.00 62.28  ? 295  GLU A C   1 
ATOM   2324  O  O   . GLU A  1 295 ? 62.134  -22.274 -53.208 1.00 62.84  ? 295  GLU A O   1 
ATOM   2325  C  CB  . GLU A  1 295 ? 63.416  -19.841 -54.632 1.00 65.51  ? 295  GLU A CB  1 
ATOM   2326  C  CG  . GLU A  1 295 ? 62.050  -20.221 -55.162 1.00 70.64  ? 295  GLU A CG  1 
ATOM   2327  C  CD  . GLU A  1 295 ? 61.501  -19.190 -56.129 1.00 75.66  ? 295  GLU A CD  1 
ATOM   2328  O  OE1 . GLU A  1 295 ? 60.262  -19.112 -56.275 1.00 76.22  ? 295  GLU A OE1 1 
ATOM   2329  O  OE2 . GLU A  1 295 ? 62.309  -18.456 -56.740 1.00 78.80  ? 295  GLU A OE2 1 
ATOM   2330  N  N   . ILE A  1 296 ? 62.465  -20.818 -51.522 1.00 62.38  ? 296  ILE A N   1 
ATOM   2331  C  CA  . ILE A  1 296 ? 61.388  -21.337 -50.688 1.00 59.15  ? 296  ILE A CA  1 
ATOM   2332  C  C   . ILE A  1 296 ? 60.130  -20.481 -50.821 1.00 57.39  ? 296  ILE A C   1 
ATOM   2333  O  O   . ILE A  1 296 ? 59.153  -20.895 -51.437 1.00 57.33  ? 296  ILE A O   1 
ATOM   2334  C  CB  . ILE A  1 296 ? 61.815  -21.383 -49.212 1.00 56.60  ? 296  ILE A CB  1 
ATOM   2335  C  CG1 . ILE A  1 296 ? 63.004  -22.318 -49.040 1.00 54.61  ? 296  ILE A CG1 1 
ATOM   2336  C  CG2 . ILE A  1 296 ? 60.686  -21.880 -48.351 1.00 58.24  ? 296  ILE A CG2 1 
ATOM   2337  C  CD1 . ILE A  1 296 ? 62.652  -23.765 -49.281 1.00 53.84  ? 296  ILE A CD1 1 
ATOM   2338  N  N   . ALA A  1 297 ? 60.159  -19.282 -50.249 1.00 57.56  ? 297  ALA A N   1 
ATOM   2339  C  CA  . ALA A  1 297 ? 59.022  -18.372 -50.355 1.00 58.39  ? 297  ALA A CA  1 
ATOM   2340  C  C   . ALA A  1 297 ? 59.426  -17.051 -50.991 1.00 59.07  ? 297  ALA A C   1 
ATOM   2341  O  O   . ALA A  1 297 ? 60.145  -16.251 -50.389 1.00 60.25  ? 297  ALA A O   1 
ATOM   2342  C  CB  . ALA A  1 297 ? 58.395  -18.141 -48.989 1.00 58.29  ? 297  ALA A CB  1 
ATOM   2343  N  N   . LYS A  1 298 ? 58.928  -16.818 -52.198 1.00 57.81  ? 298  LYS A N   1 
ATOM   2344  C  CA  . LYS A  1 298 ? 59.265  -15.629 -52.961 1.00 56.07  ? 298  LYS A CA  1 
ATOM   2345  C  C   . LYS A  1 298 ? 57.999  -15.098 -53.587 1.00 55.37  ? 298  LYS A C   1 
ATOM   2346  O  O   . LYS A  1 298 ? 57.201  -15.861 -54.120 1.00 58.68  ? 298  LYS A O   1 
ATOM   2347  C  CB  . LYS A  1 298 ? 60.264  -15.959 -54.064 1.00 57.82  ? 298  LYS A CB  1 
ATOM   2348  C  CG  . LYS A  1 298 ? 60.209  -14.973 -55.215 1.00 60.00  ? 298  LYS A CG  1 
ATOM   2349  C  CD  . LYS A  1 298 ? 61.466  -14.984 -56.065 1.00 61.47  ? 298  LYS A CD  1 
ATOM   2350  C  CE  . LYS A  1 298 ? 61.399  -13.870 -57.104 1.00 63.05  ? 298  LYS A CE  1 
ATOM   2351  N  NZ  . LYS A  1 298 ? 62.724  -13.551 -57.714 1.00 64.63  ? 298  LYS A NZ  1 
ATOM   2352  N  N   . GLY A  1 299 ? 57.808  -13.790 -53.534 1.00 52.04  ? 299  GLY A N   1 
ATOM   2353  C  CA  . GLY A  1 299 ? 56.606  -13.207 -54.090 1.00 53.28  ? 299  GLY A CA  1 
ATOM   2354  C  C   . GLY A  1 299 ? 56.481  -11.769 -53.668 1.00 53.90  ? 299  GLY A C   1 
ATOM   2355  O  O   . GLY A  1 299 ? 57.467  -11.165 -53.249 1.00 55.72  ? 299  GLY A O   1 
ATOM   2356  N  N   . LYS A  1 300 ? 55.283  -11.205 -53.763 1.00 53.71  ? 300  LYS A N   1 
ATOM   2357  C  CA  . LYS A  1 300 ? 55.141  -9.847  -53.291 1.00 56.36  ? 300  LYS A CA  1 
ATOM   2358  C  C   . LYS A  1 300 ? 54.683  -9.977  -51.859 1.00 58.52  ? 300  LYS A C   1 
ATOM   2359  O  O   . LYS A  1 300 ? 53.507  -10.219 -51.582 1.00 61.26  ? 300  LYS A O   1 
ATOM   2360  C  CB  . LYS A  1 300 ? 54.067  -9.128  -54.103 1.00 58.47  ? 300  LYS A CB  1 
ATOM   2361  C  CG  . LYS A  1 300 ? 54.431  -8.867  -55.554 1.00 62.05  ? 300  LYS A CG  1 
ATOM   2362  C  CD  . LYS A  1 300 ? 53.180  -8.680  -56.401 1.00 64.71  ? 300  LYS A CD  1 
ATOM   2363  C  CE  . LYS A  1 300 ? 53.350  -7.562  -57.421 1.00 66.04  ? 300  LYS A CE  1 
ATOM   2364  N  N   . HIS A  1 301 ? 55.614  -9.712  -50.952 1.00 56.27  ? 301  HIS A N   1 
ATOM   2365  C  CA  . HIS A  1 301 ? 55.404  -9.960  -49.538 1.00 54.07  ? 301  HIS A CA  1 
ATOM   2366  C  C   . HIS A  1 301 ? 56.708  -9.705  -48.787 1.00 56.79  ? 301  HIS A C   1 
ATOM   2367  O  O   . HIS A  1 301 ? 57.766  -9.549  -49.403 1.00 58.51  ? 301  HIS A O   1 
ATOM   2368  C  CB  . HIS A  1 301 ? 54.882  -11.390 -49.304 1.00 48.28  ? 301  HIS A CB  1 
ATOM   2369  C  CG  . HIS A  1 301 ? 55.843  -12.467 -49.698 1.00 46.99  ? 301  HIS A CG  1 
ATOM   2370  N  ND1 . HIS A  1 301 ? 55.431  -13.725 -50.087 1.00 46.81  ? 301  HIS A ND1 1 
ATOM   2371  C  CD2 . HIS A  1 301 ? 57.196  -12.485 -49.746 1.00 47.20  ? 301  HIS A CD2 1 
ATOM   2372  C  CE1 . HIS A  1 301 ? 56.488  -14.466 -50.365 1.00 46.51  ? 301  HIS A CE1 1 
ATOM   2373  N  NE2 . HIS A  1 301 ? 57.572  -13.738 -50.165 1.00 46.31  ? 301  HIS A NE2 1 
ATOM   2374  N  N   . TRP A  1 302 ? 56.631  -9.655  -47.462 1.00 55.02  ? 302  TRP A N   1 
ATOM   2375  C  CA  . TRP A  1 302 ? 57.830  -9.709  -46.641 1.00 53.55  ? 302  TRP A CA  1 
ATOM   2376  C  C   . TRP A  1 302 ? 57.748  -10.917 -45.735 1.00 55.51  ? 302  TRP A C   1 
ATOM   2377  O  O   . TRP A  1 302 ? 56.706  -11.177 -45.122 1.00 55.68  ? 302  TRP A O   1 
ATOM   2378  C  CB  . TRP A  1 302 ? 57.975  -8.467  -45.770 1.00 50.88  ? 302  TRP A CB  1 
ATOM   2379  C  CG  . TRP A  1 302 ? 58.458  -7.249  -46.480 1.00 48.41  ? 302  TRP A CG  1 
ATOM   2380  C  CD1 . TRP A  1 302 ? 58.188  -6.880  -47.764 1.00 48.03  ? 302  TRP A CD1 1 
ATOM   2381  C  CD2 . TRP A  1 302 ? 59.302  -6.229  -45.938 1.00 45.40  ? 302  TRP A CD2 1 
ATOM   2382  N  NE1 . TRP A  1 302 ? 58.812  -5.687  -48.057 1.00 44.93  ? 302  TRP A NE1 1 
ATOM   2383  C  CE2 . TRP A  1 302 ? 59.504  -5.269  -46.952 1.00 42.91  ? 302  TRP A CE2 1 
ATOM   2384  C  CE3 . TRP A  1 302 ? 59.910  -6.034  -44.692 1.00 42.86  ? 302  TRP A CE3 1 
ATOM   2385  C  CZ2 . TRP A  1 302 ? 60.281  -4.136  -46.760 1.00 40.30  ? 302  TRP A CZ2 1 
ATOM   2386  C  CZ3 . TRP A  1 302 ? 60.683  -4.907  -44.504 1.00 41.23  ? 302  TRP A CZ3 1 
ATOM   2387  C  CH2 . TRP A  1 302 ? 60.861  -3.970  -45.533 1.00 40.41  ? 302  TRP A CH2 1 
ATOM   2388  N  N   . ILE A  1 303 ? 58.856  -11.641 -45.625 1.00 55.45  ? 303  ILE A N   1 
ATOM   2389  C  CA  . ILE A  1 303 ? 58.929  -12.723 -44.663 1.00 53.41  ? 303  ILE A CA  1 
ATOM   2390  C  C   . ILE A  1 303 ? 59.499  -12.076 -43.411 1.00 55.33  ? 303  ILE A C   1 
ATOM   2391  O  O   . ILE A  1 303 ? 60.681  -11.705 -43.365 1.00 57.64  ? 303  ILE A O   1 
ATOM   2392  C  CB  . ILE A  1 303 ? 59.862  -13.852 -45.150 1.00 49.63  ? 303  ILE A CB  1 
ATOM   2393  C  CG1 . ILE A  1 303 ? 59.308  -14.493 -46.426 1.00 46.86  ? 303  ILE A CG1 1 
ATOM   2394  C  CG2 . ILE A  1 303 ? 60.044  -14.899 -44.072 1.00 51.03  ? 303  ILE A CG2 1 
ATOM   2395  C  CD1 . ILE A  1 303 ? 57.866  -14.942 -46.324 1.00 42.62  ? 303  ILE A CD1 1 
ATOM   2396  N  N   . MET A  1 304 ? 58.653  -11.952 -42.392 1.00 52.71  ? 304  MET A N   1 
ATOM   2397  C  CA  . MET A  1 304 ? 59.001  -11.171 -41.219 1.00 50.37  ? 304  MET A CA  1 
ATOM   2398  C  C   . MET A  1 304 ? 59.834  -11.967 -40.225 1.00 52.10  ? 304  MET A C   1 
ATOM   2399  O  O   . MET A  1 304 ? 60.492  -11.388 -39.354 1.00 55.25  ? 304  MET A O   1 
ATOM   2400  C  CB  . MET A  1 304 ? 57.733  -10.645 -40.537 1.00 49.57  ? 304  MET A CB  1 
ATOM   2401  C  CG  . MET A  1 304 ? 56.884  -9.734  -41.416 1.00 48.73  ? 304  MET A CG  1 
ATOM   2402  S  SD  . MET A  1 304 ? 57.792  -8.344  -42.123 1.00 65.99  ? 304  MET A SD  1 
ATOM   2403  C  CE  . MET A  1 304 ? 58.492  -7.594  -40.665 1.00 25.60  ? 304  MET A CE  1 
ATOM   2404  N  N   . GLY A  1 305 ? 59.815  -13.289 -40.368 1.00 50.54  ? 305  GLY A N   1 
ATOM   2405  C  CA  . GLY A  1 305 ? 60.569  -14.155 -39.484 1.00 51.87  ? 305  GLY A CA  1 
ATOM   2406  C  C   . GLY A  1 305 ? 60.352  -15.607 -39.834 1.00 56.03  ? 305  GLY A C   1 
ATOM   2407  O  O   . GLY A  1 305 ? 59.386  -15.953 -40.518 1.00 60.03  ? 305  GLY A O   1 
ATOM   2408  N  N   . PHE A  1 306 ? 61.265  -16.461 -39.388 1.00 55.71  ? 306  PHE A N   1 
ATOM   2409  C  CA  . PHE A  1 306 ? 61.167  -17.884 -39.682 1.00 55.99  ? 306  PHE A CA  1 
ATOM   2410  C  C   . PHE A  1 306 ? 61.976  -18.725 -38.704 1.00 60.54  ? 306  PHE A C   1 
ATOM   2411  O  O   . PHE A  1 306 ? 62.880  -18.223 -38.030 1.00 60.62  ? 306  PHE A O   1 
ATOM   2412  C  CB  . PHE A  1 306 ? 61.651  -18.152 -41.104 1.00 51.30  ? 306  PHE A CB  1 
ATOM   2413  C  CG  . PHE A  1 306 ? 63.037  -17.655 -41.362 1.00 48.66  ? 306  PHE A CG  1 
ATOM   2414  C  CD1 . PHE A  1 306 ? 63.251  -16.360 -41.802 1.00 48.85  ? 306  PHE A CD1 1 
ATOM   2415  C  CD2 . PHE A  1 306 ? 64.127  -18.474 -41.148 1.00 49.66  ? 306  PHE A CD2 1 
ATOM   2416  C  CE1 . PHE A  1 306 ? 64.528  -15.891 -42.034 1.00 50.61  ? 306  PHE A CE1 1 
ATOM   2417  C  CE2 . PHE A  1 306 ? 65.409  -18.016 -41.380 1.00 52.46  ? 306  PHE A CE2 1 
ATOM   2418  C  CZ  . PHE A  1 306 ? 65.611  -16.719 -41.825 1.00 52.69  ? 306  PHE A CZ  1 
ATOM   2419  N  N   . ASP A  1 307 ? 61.652  -20.011 -38.636 1.00 63.31  ? 307  ASP A N   1 
ATOM   2420  C  CA  . ASP A  1 307 ? 62.475  -20.956 -37.899 1.00 65.85  ? 307  ASP A CA  1 
ATOM   2421  C  C   . ASP A  1 307 ? 62.349  -22.343 -38.505 1.00 66.75  ? 307  ASP A C   1 
ATOM   2422  O  O   . ASP A  1 307 ? 61.328  -22.676 -39.106 1.00 67.42  ? 307  ASP A O   1 
ATOM   2423  C  CB  . ASP A  1 307 ? 62.088  -20.988 -36.425 1.00 68.83  ? 307  ASP A CB  1 
ATOM   2424  C  CG  . ASP A  1 307 ? 63.170  -21.590 -35.565 1.00 70.68  ? 307  ASP A CG  1 
ATOM   2425  O  OD1 . ASP A  1 307 ? 64.332  -21.610 -36.025 1.00 71.25  ? 307  ASP A OD1 1 
ATOM   2426  O  OD2 . ASP A  1 307 ? 62.863  -22.031 -34.437 1.00 71.10  ? 307  ASP A OD2 1 
ATOM   2427  N  N   . ALA A  1 308 ? 63.400  -23.143 -38.377 1.00 66.86  ? 308  ALA A N   1 
ATOM   2428  C  CA  . ALA A  1 308 ? 63.345  -24.513 -38.862 1.00 65.82  ? 308  ALA A CA  1 
ATOM   2429  C  C   . ALA A  1 308 ? 64.085  -25.491 -37.962 1.00 66.72  ? 308  ALA A C   1 
ATOM   2430  O  O   . ALA A  1 308 ? 65.224  -25.249 -37.561 1.00 64.11  ? 308  ALA A O   1 
ATOM   2431  C  CB  . ALA A  1 308 ? 63.870  -24.593 -40.283 1.00 64.87  ? 308  ALA A CB  1 
ATOM   2432  N  N   . ASP A  1 309 ? 63.423  -26.590 -37.620 1.00 71.50  ? 309  ASP A N   1 
ATOM   2433  C  CA  . ASP A  1 309 ? 64.124  -27.689 -36.985 1.00 75.81  ? 309  ASP A CA  1 
ATOM   2434  C  C   . ASP A  1 309 ? 63.925  -28.967 -37.778 1.00 74.94  ? 309  ASP A C   1 
ATOM   2435  O  O   . ASP A  1 309 ? 64.814  -29.385 -38.512 1.00 75.08  ? 309  ASP A O   1 
ATOM   2436  C  CB  . ASP A  1 309 ? 63.594  -27.875 -35.562 1.00 80.11  ? 309  ASP A CB  1 
ATOM   2437  C  CG  . ASP A  1 309 ? 64.370  -28.906 -34.777 1.00 82.28  ? 309  ASP A CG  1 
ATOM   2438  O  OD1 . ASP A  1 309 ? 65.618  -28.811 -34.741 1.00 83.06  ? 309  ASP A OD1 1 
ATOM   2439  O  OD2 . ASP A  1 309 ? 63.725  -29.808 -34.201 1.00 82.08  ? 309  ASP A OD2 1 
ATOM   2440  N  N   . GLU A  1 310 ? 62.764  -29.597 -37.612 1.00 76.11  ? 310  GLU A N   1 
ATOM   2441  C  CA  . GLU A  1 310 ? 62.307  -30.626 -38.534 1.00 80.39  ? 310  GLU A CA  1 
ATOM   2442  C  C   . GLU A  1 310 ? 61.355  -30.047 -39.574 1.00 79.49  ? 310  GLU A C   1 
ATOM   2443  O  O   . GLU A  1 310 ? 61.069  -30.675 -40.597 1.00 79.42  ? 310  GLU A O   1 
ATOM   2444  C  CB  . GLU A  1 310 ? 61.625  -31.764 -37.766 1.00 86.02  ? 310  GLU A CB  1 
ATOM   2445  C  CG  . GLU A  1 310 ? 62.563  -32.573 -36.872 1.00 92.29  ? 310  GLU A CG  1 
ATOM   2446  C  CD  . GLU A  1 310 ? 61.823  -33.551 -35.969 1.00 99.37  ? 310  GLU A CD  1 
ATOM   2447  O  OE1 . GLU A  1 310 ? 60.623  -33.809 -36.216 1.00 101.47 ? 310  GLU A OE1 1 
ATOM   2448  O  OE2 . GLU A  1 310 ? 62.442  -34.059 -35.008 1.00 101.93 ? 310  GLU A OE2 1 
ATOM   2449  N  N   . ARG A  1 311 ? 60.906  -28.820 -39.329 1.00 78.10  ? 311  ARG A N   1 
ATOM   2450  C  CA  . ARG A  1 311 ? 59.879  -28.202 -40.159 1.00 76.30  ? 311  ARG A CA  1 
ATOM   2451  C  C   . ARG A  1 311 ? 60.338  -26.794 -40.457 1.00 70.45  ? 311  ARG A C   1 
ATOM   2452  O  O   . ARG A  1 311 ? 61.190  -26.257 -39.755 1.00 69.59  ? 311  ARG A O   1 
ATOM   2453  C  CB  . ARG A  1 311 ? 58.523  -28.140 -39.438 1.00 79.16  ? 311  ARG A CB  1 
ATOM   2454  C  CG  . ARG A  1 311 ? 58.164  -29.337 -38.561 1.00 82.72  ? 311  ARG A CG  1 
ATOM   2455  C  CD  . ARG A  1 311 ? 57.915  -30.616 -39.359 1.00 86.63  ? 311  ARG A CD  1 
ATOM   2456  N  NE  . ARG A  1 311 ? 56.789  -30.520 -40.289 1.00 89.02  ? 311  ARG A NE  1 
ATOM   2457  C  CZ  . ARG A  1 311 ? 55.563  -30.982 -40.042 1.00 90.66  ? 311  ARG A CZ  1 
ATOM   2458  N  NH1 . ARG A  1 311 ? 55.288  -31.573 -38.882 1.00 91.43  ? 311  ARG A NH1 1 
ATOM   2459  N  NH2 . ARG A  1 311 ? 54.608  -30.853 -40.957 1.00 89.88  ? 311  ARG A NH2 1 
ATOM   2460  N  N   . LEU A  1 312 ? 59.780  -26.195 -41.498 1.00 66.30  ? 312  LEU A N   1 
ATOM   2461  C  CA  . LEU A  1 312 ? 60.121  -24.824 -41.831 1.00 63.86  ? 312  LEU A CA  1 
ATOM   2462  C  C   . LEU A  1 312 ? 58.877  -23.968 -41.754 1.00 62.49  ? 312  LEU A C   1 
ATOM   2463  O  O   . LEU A  1 312 ? 57.958  -24.118 -42.549 1.00 62.79  ? 312  LEU A O   1 
ATOM   2464  C  CB  . LEU A  1 312 ? 60.731  -24.729 -43.229 1.00 63.78  ? 312  LEU A CB  1 
ATOM   2465  C  CG  . LEU A  1 312 ? 60.976  -23.296 -43.707 1.00 62.45  ? 312  LEU A CG  1 
ATOM   2466  C  CD1 . LEU A  1 312 ? 61.936  -22.577 -42.776 1.00 61.40  ? 312  LEU A CD1 1 
ATOM   2467  C  CD2 . LEU A  1 312 ? 61.504  -23.282 -45.125 1.00 62.83  ? 312  LEU A CD2 1 
ATOM   2468  N  N   . ILE A  1 313 ? 58.854  -23.064 -40.787 1.00 61.82  ? 313  ILE A N   1 
ATOM   2469  C  CA  . ILE A  1 313 ? 57.727  -22.166 -40.625 1.00 59.13  ? 313  ILE A CA  1 
ATOM   2470  C  C   . ILE A  1 313 ? 58.230  -20.750 -40.766 1.00 57.81  ? 313  ILE A C   1 
ATOM   2471  O  O   . ILE A  1 313 ? 59.405  -20.466 -40.513 1.00 55.57  ? 313  ILE A O   1 
ATOM   2472  C  CB  . ILE A  1 313 ? 57.112  -22.300 -39.240 1.00 59.40  ? 313  ILE A CB  1 
ATOM   2473  C  CG1 . ILE A  1 313 ? 58.138  -21.881 -38.191 1.00 58.55  ? 313  ILE A CG1 1 
ATOM   2474  C  CG2 . ILE A  1 313 ? 56.651  -23.732 -38.999 1.00 61.44  ? 313  ILE A CG2 1 
ATOM   2475  C  CD1 . ILE A  1 313 ? 57.534  -21.265 -36.968 1.00 58.93  ? 313  ILE A CD1 1 
ATOM   2476  N  N   . TYR A  1 314 ? 57.339  -19.857 -41.174 1.00 58.66  ? 314  TYR A N   1 
ATOM   2477  C  CA  . TYR A  1 314 ? 57.686  -18.452 -41.274 1.00 58.08  ? 314  TYR A CA  1 
ATOM   2478  C  C   . TYR A  1 314 ? 56.438  -17.595 -41.175 1.00 59.39  ? 314  TYR A C   1 
ATOM   2479  O  O   . TYR A  1 314 ? 55.324  -18.069 -41.413 1.00 60.70  ? 314  TYR A O   1 
ATOM   2480  C  CB  . TYR A  1 314 ? 58.413  -18.181 -42.590 1.00 55.59  ? 314  TYR A CB  1 
ATOM   2481  C  CG  . TYR A  1 314 ? 57.740  -18.806 -43.789 1.00 54.51  ? 314  TYR A CG  1 
ATOM   2482  C  CD1 . TYR A  1 314 ? 58.009  -20.114 -44.148 1.00 55.68  ? 314  TYR A CD1 1 
ATOM   2483  C  CD2 . TYR A  1 314 ? 56.836  -18.087 -44.559 1.00 55.42  ? 314  TYR A CD2 1 
ATOM   2484  C  CE1 . TYR A  1 314 ? 57.397  -20.698 -45.243 1.00 58.49  ? 314  TYR A CE1 1 
ATOM   2485  C  CE2 . TYR A  1 314 ? 56.219  -18.656 -45.658 1.00 57.33  ? 314  TYR A CE2 1 
ATOM   2486  C  CZ  . TYR A  1 314 ? 56.502  -19.966 -45.998 1.00 58.17  ? 314  TYR A CZ  1 
ATOM   2487  O  OH  . TYR A  1 314 ? 55.895  -20.548 -47.090 1.00 56.37  ? 314  TYR A OH  1 
ATOM   2488  N  N   . LEU A  1 315 ? 56.627  -16.334 -40.815 1.00 58.35  ? 315  LEU A N   1 
ATOM   2489  C  CA  . LEU A  1 315 ? 55.542  -15.372 -40.867 1.00 57.36  ? 315  LEU A CA  1 
ATOM   2490  C  C   . LEU A  1 315 ? 55.613  -14.634 -42.197 1.00 58.04  ? 315  LEU A C   1 
ATOM   2491  O  O   . LEU A  1 315 ? 56.666  -14.108 -42.565 1.00 59.32  ? 315  LEU A O   1 
ATOM   2492  C  CB  . LEU A  1 315 ? 55.654  -14.378 -39.717 1.00 54.22  ? 315  LEU A CB  1 
ATOM   2493  C  CG  . LEU A  1 315 ? 55.711  -14.990 -38.322 1.00 53.80  ? 315  LEU A CG  1 
ATOM   2494  C  CD1 . LEU A  1 315 ? 55.930  -13.908 -37.279 1.00 54.20  ? 315  LEU A CD1 1 
ATOM   2495  C  CD2 . LEU A  1 315 ? 54.434  -15.748 -38.050 1.00 54.31  ? 315  LEU A CD2 1 
ATOM   2496  N  N   . LYS A  1 316 ? 54.500  -14.606 -42.921 1.00 55.21  ? 316  LYS A N   1 
ATOM   2497  C  CA  . LYS A  1 316 ? 54.416  -13.831 -44.148 1.00 52.13  ? 316  LYS A CA  1 
ATOM   2498  C  C   . LYS A  1 316 ? 53.455  -12.657 -43.997 1.00 51.38  ? 316  LYS A C   1 
ATOM   2499  O  O   . LYS A  1 316 ? 52.305  -12.822 -43.582 1.00 51.82  ? 316  LYS A O   1 
ATOM   2500  C  CB  . LYS A  1 316 ? 53.986  -14.702 -45.330 1.00 51.02  ? 316  LYS A CB  1 
ATOM   2501  C  CG  . LYS A  1 316 ? 53.852  -13.903 -46.625 1.00 50.81  ? 316  LYS A CG  1 
ATOM   2502  C  CD  . LYS A  1 316 ? 52.812  -14.483 -47.576 1.00 52.27  ? 316  LYS A CD  1 
ATOM   2503  C  CE  . LYS A  1 316 ? 53.267  -15.792 -48.200 1.00 53.49  ? 316  LYS A CE  1 
ATOM   2504  N  NZ  . LYS A  1 316 ? 52.405  -16.178 -49.347 1.00 53.87  ? 316  LYS A NZ  1 
ATOM   2505  N  N   . GLU A  1 317 ? 53.942  -11.471 -44.345 1.00 50.27  ? 317  GLU A N   1 
ATOM   2506  C  CA  . GLU A  1 317 ? 53.139  -10.256 -44.322 1.00 49.10  ? 317  GLU A CA  1 
ATOM   2507  C  C   . GLU A  1 317 ? 53.044  -9.762  -45.759 1.00 43.92  ? 317  GLU A C   1 
ATOM   2508  O  O   . GLU A  1 317 ? 53.982  -9.923  -46.531 1.00 40.87  ? 317  GLU A O   1 
ATOM   2509  C  CB  . GLU A  1 317 ? 53.800  -9.203  -43.411 1.00 51.24  ? 317  GLU A CB  1 
ATOM   2510  C  CG  . GLU A  1 317 ? 53.089  -7.847  -43.287 1.00 53.35  ? 317  GLU A CG  1 
ATOM   2511  C  CD  . GLU A  1 317 ? 53.742  -6.920  -42.251 1.00 54.56  ? 317  GLU A CD  1 
ATOM   2512  O  OE1 . GLU A  1 317 ? 53.921  -5.720  -42.542 1.00 54.77  ? 317  GLU A OE1 1 
ATOM   2513  O  OE2 . GLU A  1 317 ? 54.076  -7.386  -41.142 1.00 55.22  ? 317  GLU A OE2 1 
ATOM   2514  N  N   . THR A  1 318 ? 51.905  -9.184  -46.121 1.00 43.01  ? 318  THR A N   1 
ATOM   2515  C  CA  . THR A  1 318 ? 51.727  -8.600  -47.442 1.00 44.32  ? 318  THR A CA  1 
ATOM   2516  C  C   . THR A  1 318 ? 51.252  -7.157  -47.295 1.00 47.75  ? 318  THR A C   1 
ATOM   2517  O  O   . THR A  1 318 ? 51.025  -6.687  -46.185 1.00 48.80  ? 318  THR A O   1 
ATOM   2518  C  CB  . THR A  1 318 ? 50.696  -9.385  -48.267 1.00 43.23  ? 318  THR A CB  1 
ATOM   2519  O  OG1 . THR A  1 318 ? 49.380  -9.163  -47.737 1.00 44.97  ? 318  THR A OG1 1 
ATOM   2520  C  CG2 . THR A  1 318 ? 51.018  -10.875 -48.235 1.00 41.20  ? 318  THR A CG2 1 
ATOM   2521  N  N   . ALA A  1 319 ? 51.095  -6.458  -48.413 1.00 48.37  ? 319  ALA A N   1 
ATOM   2522  C  CA  . ALA A  1 319 ? 50.702  -5.054  -48.379 1.00 48.24  ? 319  ALA A CA  1 
ATOM   2523  C  C   . ALA A  1 319 ? 49.296  -4.923  -47.822 1.00 50.02  ? 319  ALA A C   1 
ATOM   2524  O  O   . ALA A  1 319 ? 48.935  -3.920  -47.209 1.00 48.43  ? 319  ALA A O   1 
ATOM   2525  C  CB  . ALA A  1 319 ? 50.770  -4.453  -49.773 1.00 46.60  ? 319  ALA A CB  1 
ATOM   2526  N  N   . THR A  1 320 ? 48.485  -5.931  -48.099 1.00 52.10  ? 320  THR A N   1 
ATOM   2527  C  CA  . THR A  1 320 ? 47.093  -5.903  -47.713 1.00 51.80  ? 320  THR A CA  1 
ATOM   2528  C  C   . THR A  1 320 ? 46.775  -6.582  -46.373 1.00 52.87  ? 320  THR A C   1 
ATOM   2529  O  O   . THR A  1 320 ? 45.674  -6.424  -45.843 1.00 53.49  ? 320  THR A O   1 
ATOM   2530  C  CB  . THR A  1 320 ? 46.241  -6.470  -48.866 1.00 51.15  ? 320  THR A CB  1 
ATOM   2531  O  OG1 . THR A  1 320 ? 45.433  -5.422  -49.407 1.00 51.04  ? 320  THR A OG1 1 
ATOM   2532  C  CG2 . THR A  1 320 ? 45.360  -7.624  -48.413 1.00 52.33  ? 320  THR A CG2 1 
ATOM   2533  N  N   . ARG A  1 321 ? 47.745  -7.300  -45.809 1.00 51.91  ? 321  ARG A N   1 
ATOM   2534  C  CA  A ARG A  1 321 ? 47.505  -8.082  -44.599 0.50 51.49  ? 321  ARG A CA  1 
ATOM   2535  C  CA  B ARG A  1 321 ? 47.510  -8.082  -44.596 0.50 51.49  ? 321  ARG A CA  1 
ATOM   2536  C  C   . ARG A  1 321 ? 48.686  -8.056  -43.627 1.00 51.23  ? 321  ARG A C   1 
ATOM   2537  O  O   . ARG A  1 321 ? 49.842  -8.076  -44.045 1.00 52.97  ? 321  ARG A O   1 
ATOM   2538  C  CB  A ARG A  1 321 ? 47.187  -9.539  -44.970 0.50 51.23  ? 321  ARG A CB  1 
ATOM   2539  C  CB  B ARG A  1 321 ? 47.230  -9.545  -44.952 0.50 51.66  ? 321  ARG A CB  1 
ATOM   2540  C  CG  A ARG A  1 321 ? 45.758  -9.789  -45.438 0.50 49.73  ? 321  ARG A CG  1 
ATOM   2541  C  CG  B ARG A  1 321 ? 45.997  -9.777  -45.793 0.50 50.65  ? 321  ARG A CG  1 
ATOM   2542  C  CD  A ARG A  1 321 ? 44.802  -9.910  -44.261 0.50 47.75  ? 321  ARG A CD  1 
ATOM   2543  C  CD  B ARG A  1 321 ? 44.738  -9.283  -45.106 0.50 49.14  ? 321  ARG A CD  1 
ATOM   2544  N  NE  A ARG A  1 321 ? 44.984  -11.160 -43.527 0.50 45.96  ? 321  ARG A NE  1 
ATOM   2545  N  NE  B ARG A  1 321 ? 43.565  -9.561  -45.926 0.50 49.24  ? 321  ARG A NE  1 
ATOM   2546  C  CZ  A ARG A  1 321 ? 44.107  -12.160 -43.519 0.50 46.06  ? 321  ARG A CZ  1 
ATOM   2547  C  CZ  B ARG A  1 321 ? 42.823  -10.657 -45.809 0.50 50.28  ? 321  ARG A CZ  1 
ATOM   2548  N  NH1 A ARG A  1 321 ? 44.354  -13.261 -42.823 0.50 44.38  ? 321  ARG A NH1 1 
ATOM   2549  N  NH1 B ARG A  1 321 ? 41.775  -10.836 -46.601 0.50 49.76  ? 321  ARG A NH1 1 
ATOM   2550  N  NH2 A ARG A  1 321 ? 42.977  -12.056 -44.202 0.50 49.26  ? 321  ARG A NH2 1 
ATOM   2551  N  NH2 B ARG A  1 321 ? 43.127  -11.572 -44.895 0.50 51.18  ? 321  ARG A NH2 1 
ATOM   2552  N  N   . PRO A  1 322 ? 48.389  -8.031  -42.317 1.00 49.03  ? 322  PRO A N   1 
ATOM   2553  C  CA  . PRO A  1 322 ? 49.395  -8.220  -41.269 1.00 46.31  ? 322  PRO A CA  1 
ATOM   2554  C  C   . PRO A  1 322 ? 49.837  -9.680  -41.252 1.00 47.74  ? 322  PRO A C   1 
ATOM   2555  O  O   . PRO A  1 322 ? 49.102  -10.542 -41.731 1.00 51.48  ? 322  PRO A O   1 
ATOM   2556  C  CB  . PRO A  1 322 ? 48.629  -7.885  -39.989 1.00 44.92  ? 322  PRO A CB  1 
ATOM   2557  C  CG  . PRO A  1 322 ? 47.534  -6.990  -40.431 1.00 45.85  ? 322  PRO A CG  1 
ATOM   2558  C  CD  . PRO A  1 322 ? 47.120  -7.534  -41.764 1.00 49.28  ? 322  PRO A CD  1 
ATOM   2559  N  N   . ALA A  1 323 ? 51.011  -9.957  -40.699 1.00 46.06  ? 323  ALA A N   1 
ATOM   2560  C  CA  . ALA A  1 323 ? 51.627  -11.275 -40.824 1.00 44.50  ? 323  ALA A CA  1 
ATOM   2561  C  C   . ALA A  1 323 ? 50.738  -12.427 -40.371 1.00 48.81  ? 323  ALA A C   1 
ATOM   2562  O  O   . ALA A  1 323 ? 49.997  -12.314 -39.399 1.00 50.69  ? 323  ALA A O   1 
ATOM   2563  C  CB  . ALA A  1 323 ? 52.948  -11.308 -40.083 1.00 40.87  ? 323  ALA A CB  1 
ATOM   2564  N  N   . GLU A  1 324 ? 50.804  -13.527 -41.113 1.00 51.84  ? 324  GLU A N   1 
ATOM   2565  C  CA  . GLU A  1 324 ? 50.191  -14.786 -40.709 1.00 54.88  ? 324  GLU A CA  1 
ATOM   2566  C  C   . GLU A  1 324 ? 51.272  -15.857 -40.747 1.00 57.13  ? 324  GLU A C   1 
ATOM   2567  O  O   . GLU A  1 324 ? 52.331  -15.648 -41.342 1.00 57.79  ? 324  GLU A O   1 
ATOM   2568  C  CB  . GLU A  1 324 ? 49.031  -15.157 -41.634 1.00 54.91  ? 324  GLU A CB  1 
ATOM   2569  C  CG  . GLU A  1 324 ? 47.870  -14.169 -41.611 1.00 55.34  ? 324  GLU A CG  1 
ATOM   2570  C  CD  . GLU A  1 324 ? 47.045  -14.260 -40.340 1.00 56.41  ? 324  GLU A CD  1 
ATOM   2571  O  OE1 . GLU A  1 324 ? 46.139  -13.416 -40.152 1.00 55.96  ? 324  GLU A OE1 1 
ATOM   2572  O  OE2 . GLU A  1 324 ? 47.300  -15.179 -39.533 1.00 56.29  ? 324  GLU A OE2 1 
ATOM   2573  N  N   . LEU A  1 325 ? 51.023  -16.991 -40.102 1.00 57.94  ? 325  LEU A N   1 
ATOM   2574  C  CA  . LEU A  1 325 ? 52.025  -18.050 -40.053 1.00 60.27  ? 325  LEU A CA  1 
ATOM   2575  C  C   . LEU A  1 325 ? 51.869  -19.034 -41.210 1.00 62.21  ? 325  LEU A C   1 
ATOM   2576  O  O   . LEU A  1 325 ? 50.760  -19.464 -41.532 1.00 63.28  ? 325  LEU A O   1 
ATOM   2577  C  CB  . LEU A  1 325 ? 51.967  -18.791 -38.719 1.00 60.86  ? 325  LEU A CB  1 
ATOM   2578  C  CG  . LEU A  1 325 ? 53.112  -19.766 -38.450 1.00 61.80  ? 325  LEU A CG  1 
ATOM   2579  C  CD1 . LEU A  1 325 ? 54.427  -19.026 -38.298 1.00 61.27  ? 325  LEU A CD1 1 
ATOM   2580  C  CD2 . LEU A  1 325 ? 52.827  -20.583 -37.207 1.00 63.04  ? 325  LEU A CD2 1 
ATOM   2581  N  N   . TYR A  1 326 ? 52.988  -19.384 -41.834 1.00 62.61  ? 326  TYR A N   1 
ATOM   2582  C  CA  . TYR A  1 326 ? 52.976  -20.326 -42.944 1.00 63.46  ? 326  TYR A CA  1 
ATOM   2583  C  C   . TYR A  1 326 ? 53.976  -21.449 -42.723 1.00 67.33  ? 326  TYR A C   1 
ATOM   2584  O  O   . TYR A  1 326 ? 54.936  -21.313 -41.961 1.00 67.51  ? 326  TYR A O   1 
ATOM   2585  C  CB  . TYR A  1 326 ? 53.274  -19.621 -44.267 1.00 60.99  ? 326  TYR A CB  1 
ATOM   2586  C  CG  . TYR A  1 326 ? 52.205  -18.649 -44.714 1.00 58.74  ? 326  TYR A CG  1 
ATOM   2587  C  CD1 . TYR A  1 326 ? 52.148  -17.361 -44.200 1.00 56.76  ? 326  TYR A CD1 1 
ATOM   2588  C  CD2 . TYR A  1 326 ? 51.269  -19.013 -45.669 1.00 58.53  ? 326  TYR A CD2 1 
ATOM   2589  C  CE1 . TYR A  1 326 ? 51.182  -16.470 -44.614 1.00 56.92  ? 326  TYR A CE1 1 
ATOM   2590  C  CE2 . TYR A  1 326 ? 50.298  -18.126 -46.091 1.00 58.01  ? 326  TYR A CE2 1 
ATOM   2591  C  CZ  . TYR A  1 326 ? 50.257  -16.858 -45.559 1.00 57.72  ? 326  TYR A CZ  1 
ATOM   2592  O  OH  . TYR A  1 326 ? 49.287  -15.972 -45.976 1.00 57.36  ? 326  TYR A OH  1 
ATOM   2593  N  N   . LEU A  1 327 ? 53.731  -22.559 -43.408 1.00 71.27  ? 327  LEU A N   1 
ATOM   2594  C  CA  . LEU A  1 327 ? 54.551  -23.755 -43.297 1.00 73.32  ? 327  LEU A CA  1 
ATOM   2595  C  C   . LEU A  1 327 ? 54.861  -24.274 -44.693 1.00 75.70  ? 327  LEU A C   1 
ATOM   2596  O  O   . LEU A  1 327 ? 54.035  -24.152 -45.598 1.00 74.87  ? 327  LEU A O   1 
ATOM   2597  C  CB  . LEU A  1 327 ? 53.809  -24.820 -42.493 1.00 72.93  ? 327  LEU A CB  1 
ATOM   2598  C  CG  . LEU A  1 327 ? 54.333  -26.252 -42.561 1.00 73.81  ? 327  LEU A CG  1 
ATOM   2599  C  CD1 . LEU A  1 327 ? 55.809  -26.309 -42.225 1.00 76.40  ? 327  LEU A CD1 1 
ATOM   2600  C  CD2 . LEU A  1 327 ? 53.545  -27.131 -41.614 1.00 72.98  ? 327  LEU A CD2 1 
ATOM   2601  N  N   . TRP A  1 328 ? 56.054  -24.837 -44.870 1.00 79.89  ? 328  TRP A N   1 
ATOM   2602  C  CA  . TRP A  1 328 ? 56.464  -25.382 -46.162 1.00 82.92  ? 328  TRP A CA  1 
ATOM   2603  C  C   . TRP A  1 328 ? 56.765  -26.879 -46.063 1.00 85.36  ? 328  TRP A C   1 
ATOM   2604  O  O   . TRP A  1 328 ? 57.720  -27.292 -45.400 1.00 85.36  ? 328  TRP A O   1 
ATOM   2605  C  CB  . TRP A  1 328 ? 57.684  -24.624 -46.690 1.00 83.64  ? 328  TRP A CB  1 
ATOM   2606  C  CG  . TRP A  1 328 ? 57.968  -24.827 -48.156 1.00 85.09  ? 328  TRP A CG  1 
ATOM   2607  C  CD1 . TRP A  1 328 ? 57.296  -24.272 -49.210 1.00 84.99  ? 328  TRP A CD1 1 
ATOM   2608  C  CD2 . TRP A  1 328 ? 59.017  -25.618 -48.724 1.00 85.76  ? 328  TRP A CD2 1 
ATOM   2609  N  NE1 . TRP A  1 328 ? 57.856  -24.679 -50.397 1.00 84.67  ? 328  TRP A NE1 1 
ATOM   2610  C  CE2 . TRP A  1 328 ? 58.914  -25.506 -50.126 1.00 86.28  ? 328  TRP A CE2 1 
ATOM   2611  C  CE3 . TRP A  1 328 ? 60.030  -26.417 -48.183 1.00 86.57  ? 328  TRP A CE3 1 
ATOM   2612  C  CZ2 . TRP A  1 328 ? 59.787  -26.162 -50.993 1.00 88.61  ? 328  TRP A CZ2 1 
ATOM   2613  C  CZ3 . TRP A  1 328 ? 60.897  -27.068 -49.045 1.00 88.95  ? 328  TRP A CZ3 1 
ATOM   2614  C  CH2 . TRP A  1 328 ? 60.770  -26.936 -50.435 1.00 89.95  ? 328  TRP A CH2 1 
ATOM   2615  N  N   . ASP A  1 329 ? 55.917  -27.678 -46.708 1.00 86.80  ? 329  ASP A N   1 
ATOM   2616  C  CA  . ASP A  1 329 ? 56.084  -29.127 -46.811 1.00 86.44  ? 329  ASP A CA  1 
ATOM   2617  C  C   . ASP A  1 329 ? 56.777  -29.521 -48.117 1.00 86.40  ? 329  ASP A C   1 
ATOM   2618  O  O   . ASP A  1 329 ? 56.931  -30.704 -48.414 1.00 87.84  ? 329  ASP A O   1 
ATOM   2619  C  CB  . ASP A  1 329 ? 54.736  -29.840 -46.683 1.00 86.01  ? 329  ASP A CB  1 
ATOM   2620  N  N   . GLY A  1 330 ? 57.216  -28.519 -48.875 1.00 84.69  ? 330  GLY A N   1 
ATOM   2621  C  CA  . GLY A  1 330 ? 57.564  -28.674 -50.279 1.00 82.23  ? 330  GLY A CA  1 
ATOM   2622  C  C   . GLY A  1 330 ? 56.537  -27.939 -51.122 1.00 79.85  ? 330  GLY A C   1 
ATOM   2623  O  O   . GLY A  1 330 ? 56.722  -27.719 -52.321 1.00 78.89  ? 330  GLY A O   1 
ATOM   2624  N  N   . GLU A  1 331 ? 55.452  -27.546 -50.464 1.00 78.36  ? 331  GLU A N   1 
ATOM   2625  C  CA  . GLU A  1 331 ? 54.522  -26.551 -50.976 1.00 74.77  ? 331  GLU A CA  1 
ATOM   2626  C  C   . GLU A  1 331 ? 54.164  -25.669 -49.781 1.00 73.60  ? 331  GLU A C   1 
ATOM   2627  O  O   . GLU A  1 331 ? 54.385  -26.064 -48.632 1.00 72.92  ? 331  GLU A O   1 
ATOM   2628  C  CB  . GLU A  1 331 ? 53.272  -27.212 -51.556 1.00 72.54  ? 331  GLU A CB  1 
ATOM   2629  N  N   . GLU A  1 332 ? 53.624  -24.481 -50.036 1.00 71.83  ? 332  GLU A N   1 
ATOM   2630  C  CA  . GLU A  1 332 ? 53.297  -23.558 -48.950 1.00 69.80  ? 332  GLU A CA  1 
ATOM   2631  C  C   . GLU A  1 332 ? 51.868  -23.721 -48.442 1.00 72.18  ? 332  GLU A C   1 
ATOM   2632  O  O   . GLU A  1 332 ? 50.912  -23.499 -49.182 1.00 75.13  ? 332  GLU A O   1 
ATOM   2633  C  CB  . GLU A  1 332 ? 53.518  -22.111 -49.391 1.00 65.91  ? 332  GLU A CB  1 
ATOM   2634  C  CG  . GLU A  1 332 ? 53.009  -21.077 -48.401 1.00 64.19  ? 332  GLU A CG  1 
ATOM   2635  C  CD  . GLU A  1 332 ? 53.224  -19.652 -48.876 1.00 63.83  ? 332  GLU A CD  1 
ATOM   2636  O  OE1 . GLU A  1 332 ? 54.335  -19.112 -48.682 1.00 63.67  ? 332  GLU A OE1 1 
ATOM   2637  O  OE2 . GLU A  1 332 ? 52.280  -19.072 -49.452 1.00 63.61  ? 332  GLU A OE2 1 
ATOM   2638  N  N   . ARG A  1 333 ? 51.727  -24.095 -47.175 1.00 71.58  ? 333  ARG A N   1 
ATOM   2639  C  CA  . ARG A  1 333 ? 50.411  -24.183 -46.549 1.00 71.58  ? 333  ARG A CA  1 
ATOM   2640  C  C   . ARG A  1 333 ? 50.260  -23.135 -45.443 1.00 71.79  ? 333  ARG A C   1 
ATOM   2641  O  O   . ARG A  1 333 ? 51.073  -23.069 -44.521 1.00 74.32  ? 333  ARG A O   1 
ATOM   2642  C  CB  . ARG A  1 333 ? 50.168  -25.587 -45.989 1.00 70.67  ? 333  ARG A CB  1 
ATOM   2643  N  N   . GLN A  1 334 ? 49.215  -22.318 -45.534 1.00 68.50  ? 334  GLN A N   1 
ATOM   2644  C  CA  . GLN A  1 334 ? 48.983  -21.264 -44.550 1.00 63.54  ? 334  GLN A CA  1 
ATOM   2645  C  C   . GLN A  1 334 ? 48.418  -21.828 -43.253 1.00 61.06  ? 334  GLN A C   1 
ATOM   2646  O  O   . GLN A  1 334 ? 47.347  -22.422 -43.249 1.00 61.60  ? 334  GLN A O   1 
ATOM   2647  C  CB  . GLN A  1 334 ? 48.009  -20.235 -45.125 1.00 61.67  ? 334  GLN A CB  1 
ATOM   2648  C  CG  . GLN A  1 334 ? 47.535  -19.198 -44.128 1.00 62.41  ? 334  GLN A CG  1 
ATOM   2649  C  CD  . GLN A  1 334 ? 46.648  -18.147 -44.761 1.00 62.71  ? 334  GLN A CD  1 
ATOM   2650  O  OE1 . GLN A  1 334 ? 46.486  -18.108 -45.981 1.00 65.43  ? 334  GLN A OE1 1 
ATOM   2651  N  NE2 . GLN A  1 334 ? 46.068  -17.288 -43.935 1.00 59.93  ? 334  GLN A NE2 1 
ATOM   2652  N  N   . LEU A  1 335 ? 49.129  -21.624 -42.149 1.00 61.19  ? 335  LEU A N   1 
ATOM   2653  C  CA  . LEU A  1 335 ? 48.688  -22.128 -40.841 1.00 60.83  ? 335  LEU A CA  1 
ATOM   2654  C  C   . LEU A  1 335 ? 47.647  -21.277 -40.110 1.00 61.38  ? 335  LEU A C   1 
ATOM   2655  O  O   . LEU A  1 335 ? 46.754  -21.824 -39.464 1.00 64.10  ? 335  LEU A O   1 
ATOM   2656  C  CB  . LEU A  1 335 ? 49.882  -22.385 -39.921 1.00 60.18  ? 335  LEU A CB  1 
ATOM   2657  C  CG  . LEU A  1 335 ? 50.796  -23.524 -40.365 1.00 61.14  ? 335  LEU A CG  1 
ATOM   2658  C  CD1 . LEU A  1 335 ? 52.106  -23.511 -39.594 1.00 60.88  ? 335  LEU A CD1 1 
ATOM   2659  C  CD2 . LEU A  1 335 ? 50.081  -24.847 -40.197 1.00 62.26  ? 335  LEU A CD2 1 
ATOM   2660  N  N   . THR A  1 336 ? 47.759  -19.951 -40.202 1.00 58.81  ? 336  THR A N   1 
ATOM   2661  C  CA  . THR A  1 336 ? 46.941  -19.063 -39.367 1.00 58.18  ? 336  THR A CA  1 
ATOM   2662  C  C   . THR A  1 336 ? 46.137  -18.002 -40.120 1.00 61.42  ? 336  THR A C   1 
ATOM   2663  O  O   . THR A  1 336 ? 46.668  -17.261 -40.946 1.00 66.04  ? 336  THR A O   1 
ATOM   2664  C  CB  . THR A  1 336 ? 47.791  -18.357 -38.290 1.00 55.87  ? 336  THR A CB  1 
ATOM   2665  O  OG1 . THR A  1 336 ? 48.663  -17.398 -38.905 1.00 55.52  ? 336  THR A OG1 1 
ATOM   2666  C  CG2 . THR A  1 336 ? 48.613  -19.372 -37.527 1.00 55.98  ? 336  THR A CG2 1 
ATOM   2667  N  N   . ASP A  1 337 ? 44.840  -17.981 -39.840 1.00 60.00  ? 337  ASP A N   1 
ATOM   2668  C  CA  . ASP A  1 337 ? 43.879  -17.006 -40.371 1.00 60.47  ? 337  ASP A CA  1 
ATOM   2669  C  C   . ASP A  1 337 ? 43.497  -15.774 -39.519 1.00 60.12  ? 337  ASP A C   1 
ATOM   2670  O  O   . ASP A  1 337 ? 42.527  -15.099 -39.853 1.00 60.75  ? 337  ASP A O   1 
ATOM   2671  C  CB  . ASP A  1 337 ? 42.644  -17.670 -40.986 1.00 64.33  ? 337  ASP A CB  1 
ATOM   2672  C  CG  . ASP A  1 337 ? 42.006  -16.808 -42.063 1.00 65.40  ? 337  ASP A CG  1 
ATOM   2673  O  OD1 . ASP A  1 337 ? 42.757  -16.043 -42.713 1.00 62.83  ? 337  ASP A OD1 1 
ATOM   2674  O  OD2 . ASP A  1 337 ? 40.766  -16.887 -42.247 1.00 66.40  ? 337  ASP A OD2 1 
ATOM   2675  N  N   . TYR A  1 338 ? 44.194  -15.511 -38.411 1.00 57.79  ? 338  TYR A N   1 
ATOM   2676  C  CA  . TYR A  1 338 ? 43.664  -14.693 -37.304 1.00 51.19  ? 338  TYR A CA  1 
ATOM   2677  C  C   . TYR A  1 338 ? 42.898  -13.444 -37.742 1.00 51.17  ? 338  TYR A C   1 
ATOM   2678  O  O   . TYR A  1 338 ? 41.875  -13.106 -37.141 1.00 52.08  ? 338  TYR A O   1 
ATOM   2679  C  CB  . TYR A  1 338 ? 44.820  -14.203 -36.415 1.00 46.24  ? 338  TYR A CB  1 
ATOM   2680  C  CG  . TYR A  1 338 ? 45.372  -15.210 -35.438 1.00 47.27  ? 338  TYR A CG  1 
ATOM   2681  C  CD1 . TYR A  1 338 ? 46.451  -16.007 -35.772 1.00 46.17  ? 338  TYR A CD1 1 
ATOM   2682  C  CD2 . TYR A  1 338 ? 44.823  -15.352 -34.169 1.00 50.47  ? 338  TYR A CD2 1 
ATOM   2683  C  CE1 . TYR A  1 338 ? 46.962  -16.929 -34.879 1.00 46.74  ? 338  TYR A CE1 1 
ATOM   2684  C  CE2 . TYR A  1 338 ? 45.328  -16.270 -33.270 1.00 50.53  ? 338  TYR A CE2 1 
ATOM   2685  C  CZ  . TYR A  1 338 ? 46.398  -17.056 -33.632 1.00 50.04  ? 338  TYR A CZ  1 
ATOM   2686  O  OH  . TYR A  1 338 ? 46.908  -17.972 -32.741 1.00 52.91  ? 338  TYR A OH  1 
ATOM   2687  N  N   . ASN A  1 339 ? 43.384  -12.759 -38.771 1.00 51.06  ? 339  ASN A N   1 
ATOM   2688  C  CA  . ASN A  1 339 ? 42.760  -11.519 -39.232 1.00 53.94  ? 339  ASN A CA  1 
ATOM   2689  C  C   . ASN A  1 339 ? 41.715  -11.699 -40.352 1.00 57.56  ? 339  ASN A C   1 
ATOM   2690  O  O   . ASN A  1 339 ? 41.197  -10.715 -40.900 1.00 57.43  ? 339  ASN A O   1 
ATOM   2691  C  CB  . ASN A  1 339 ? 43.835  -10.507 -39.634 1.00 55.28  ? 339  ASN A CB  1 
ATOM   2692  C  CG  . ASN A  1 339 ? 44.771  -10.163 -38.488 1.00 56.59  ? 339  ASN A CG  1 
ATOM   2693  O  OD1 . ASN A  1 339 ? 44.337  -9.997  -37.352 1.00 56.50  ? 339  ASN A OD1 1 
ATOM   2694  N  ND2 . ASN A  1 339 ? 46.061  -10.067 -38.780 1.00 58.07  ? 339  ASN A ND2 1 
ATOM   2695  N  N   . GLY A  1 340 ? 41.426  -12.956 -40.696 1.00 58.52  ? 340  GLY A N   1 
ATOM   2696  C  CA  . GLY A  1 340 ? 40.513  -13.288 -41.780 1.00 58.52  ? 340  GLY A CA  1 
ATOM   2697  C  C   . GLY A  1 340 ? 39.099  -12.750 -41.639 1.00 59.35  ? 340  GLY A C   1 
ATOM   2698  O  O   . GLY A  1 340 ? 38.530  -12.210 -42.597 1.00 53.12  ? 340  GLY A O   1 
ATOM   2699  N  N   . LEU A  1 341 ? 38.524  -12.898 -40.448 1.00 40.07  ? 341  LEU A N   1 
ATOM   2700  C  CA  . LEU A  1 341 ? 37.167  -12.424 -40.205 1.00 43.47  ? 341  LEU A CA  1 
ATOM   2701  C  C   . LEU A  1 341 ? 37.102  -10.899 -40.151 1.00 49.50  ? 341  LEU A C   1 
ATOM   2702  O  O   . LEU A  1 341 ? 36.093  -10.310 -40.537 1.00 51.83  ? 341  LEU A O   1 
ATOM   2703  C  CB  . LEU A  1 341 ? 36.599  -13.026 -38.924 1.00 43.23  ? 341  LEU A CB  1 
ATOM   2704  C  CG  . LEU A  1 341 ? 36.768  -14.539 -38.787 1.00 44.03  ? 341  LEU A CG  1 
ATOM   2705  C  CD1 . LEU A  1 341 ? 36.226  -15.023 -37.448 1.00 43.86  ? 341  LEU A CD1 1 
ATOM   2706  C  CD2 . LEU A  1 341 ? 36.089  -15.252 -39.943 1.00 42.52  ? 341  LEU A CD2 1 
ATOM   2707  N  N   . ILE A  1 342 ? 38.165  -10.255 -39.671 1.00 51.44  ? 342  ILE A N   1 
ATOM   2708  C  CA  . ILE A  1 342 ? 38.197  -8.794  -39.680 1.00 52.86  ? 342  ILE A CA  1 
ATOM   2709  C  C   . ILE A  1 342 ? 38.267  -8.302  -41.124 1.00 53.77  ? 342  ILE A C   1 
ATOM   2710  O  O   . ILE A  1 342 ? 37.608  -7.332  -41.499 1.00 54.81  ? 342  ILE A O   1 
ATOM   2711  C  CB  . ILE A  1 342 ? 39.374  -8.194  -38.843 1.00 42.04  ? 342  ILE A CB  1 
ATOM   2712  C  CG1 . ILE A  1 342 ? 39.149  -8.390  -37.336 1.00 38.03  ? 342  ILE A CG1 1 
ATOM   2713  C  CG2 . ILE A  1 342 ? 39.530  -6.706  -39.141 1.00 40.92  ? 342  ILE A CG2 1 
ATOM   2714  N  N   . PHE A  1 343 ? 39.049  -8.995  -41.942 1.00 53.84  ? 343  PHE A N   1 
ATOM   2715  C  CA  . PHE A  1 343 ? 39.251  -8.566  -43.322 1.00 54.00  ? 343  PHE A CA  1 
ATOM   2716  C  C   . PHE A  1 343 ? 38.158  -9.000  -44.296 1.00 52.32  ? 343  PHE A C   1 
ATOM   2717  O  O   . PHE A  1 343 ? 38.170  -8.600  -45.458 1.00 50.92  ? 343  PHE A O   1 
ATOM   2718  C  CB  . PHE A  1 343 ? 40.637  -8.982  -43.825 1.00 53.27  ? 343  PHE A CB  1 
ATOM   2719  C  CG  . PHE A  1 343 ? 41.739  -8.114  -43.306 1.00 51.53  ? 343  PHE A CG  1 
ATOM   2720  C  CD1 . PHE A  1 343 ? 42.509  -8.519  -42.239 1.00 51.14  ? 343  PHE A CD1 1 
ATOM   2721  C  CD2 . PHE A  1 343 ? 41.976  -6.873  -43.865 1.00 49.87  ? 343  PHE A CD2 1 
ATOM   2722  C  CE1 . PHE A  1 343 ? 43.510  -7.715  -41.756 1.00 50.58  ? 343  PHE A CE1 1 
ATOM   2723  C  CE2 . PHE A  1 343 ? 42.967  -6.068  -43.384 1.00 49.20  ? 343  PHE A CE2 1 
ATOM   2724  C  CZ  . PHE A  1 343 ? 43.737  -6.488  -42.327 1.00 49.86  ? 343  PHE A CZ  1 
ATOM   2725  N  N   . LYS A  1 344 ? 37.223  -9.823  -43.835 1.00 51.64  ? 344  LYS A N   1 
ATOM   2726  C  CA  . LYS A  1 344 ? 36.058  -10.125 -44.653 1.00 52.60  ? 344  LYS A CA  1 
ATOM   2727  C  C   . LYS A  1 344 ? 35.177  -8.887  -44.663 1.00 55.38  ? 344  LYS A C   1 
ATOM   2728  O  O   . LYS A  1 344 ? 34.503  -8.596  -45.649 1.00 55.11  ? 344  LYS A O   1 
ATOM   2729  C  CB  . LYS A  1 344 ? 35.285  -11.332 -44.109 1.00 51.62  ? 344  LYS A CB  1 
ATOM   2730  C  CG  . LYS A  1 344 ? 35.651  -12.665 -44.751 1.00 49.18  ? 344  LYS A CG  1 
ATOM   2731  N  N   . LYS A  1 345 ? 35.187  -8.165  -43.547 1.00 58.23  ? 345  LYS A N   1 
ATOM   2732  C  CA  . LYS A  1 345 ? 34.392  -6.951  -43.399 1.00 60.58  ? 345  LYS A CA  1 
ATOM   2733  C  C   . LYS A  1 345 ? 35.156  -5.638  -43.678 1.00 61.55  ? 345  LYS A C   1 
ATOM   2734  O  O   . LYS A  1 345 ? 34.593  -4.550  -43.532 1.00 63.74  ? 345  LYS A O   1 
ATOM   2735  C  CB  . LYS A  1 345 ? 33.745  -6.917  -42.009 1.00 60.44  ? 345  LYS A CB  1 
ATOM   2736  N  N   . LEU A  1 346 ? 36.426  -5.730  -44.070 1.00 57.92  ? 346  LEU A N   1 
ATOM   2737  C  CA  . LEU A  1 346 ? 37.274  -4.533  -44.157 1.00 52.78  ? 346  LEU A CA  1 
ATOM   2738  C  C   . LEU A  1 346 ? 37.910  -4.293  -45.539 1.00 48.42  ? 346  LEU A C   1 
ATOM   2739  O  O   . LEU A  1 346 ? 38.765  -5.063  -45.977 1.00 47.85  ? 346  LEU A O   1 
ATOM   2740  C  CB  . LEU A  1 346 ? 38.370  -4.615  -43.087 1.00 49.91  ? 346  LEU A CB  1 
ATOM   2741  C  CG  . LEU A  1 346 ? 39.139  -3.339  -42.745 1.00 47.30  ? 346  LEU A CG  1 
ATOM   2742  C  CD1 . LEU A  1 346 ? 38.200  -2.293  -42.171 1.00 47.28  ? 346  LEU A CD1 1 
ATOM   2743  C  CD2 . LEU A  1 346 ? 40.266  -3.638  -41.772 1.00 44.99  ? 346  LEU A CD2 1 
ATOM   2744  N  N   . LYS A  1 347 ? 37.530  -3.207  -46.207 1.00 45.99  ? 347  LYS A N   1 
ATOM   2745  C  CA  . LYS A  1 347 ? 38.046  -2.942  -47.554 1.00 49.72  ? 347  LYS A CA  1 
ATOM   2746  C  C   . LYS A  1 347 ? 39.581  -2.805  -47.582 1.00 56.32  ? 347  LYS A C   1 
ATOM   2747  O  O   . LYS A  1 347 ? 40.160  -2.127  -46.738 1.00 60.50  ? 347  LYS A O   1 
ATOM   2748  C  CB  . LYS A  1 347 ? 37.385  -1.688  -48.138 1.00 49.16  ? 347  LYS A CB  1 
ATOM   2749  C  CG  . LYS A  1 347 ? 37.729  -1.397  -49.601 1.00 49.99  ? 347  LYS A CG  1 
ATOM   2750  N  N   . THR A  1 348 ? 40.237  -3.434  -48.558 1.00 56.12  ? 348  THR A N   1 
ATOM   2751  C  CA  . THR A  1 348 ? 41.698  -3.334  -48.696 1.00 53.51  ? 348  THR A CA  1 
ATOM   2752  C  C   . THR A  1 348 ? 42.066  -2.729  -50.038 1.00 50.44  ? 348  THR A C   1 
ATOM   2753  O  O   . THR A  1 348 ? 41.247  -2.675  -50.946 1.00 52.62  ? 348  THR A O   1 
ATOM   2754  C  CB  . THR A  1 348 ? 42.438  -4.697  -48.564 1.00 58.65  ? 348  THR A CB  1 
ATOM   2755  O  OG1 . THR A  1 348 ? 41.516  -5.778  -48.722 1.00 62.05  ? 348  THR A OG1 1 
ATOM   2756  C  CG2 . THR A  1 348 ? 43.123  -4.820  -47.211 1.00 59.19  ? 348  THR A CG2 1 
ATOM   2757  N  N   . PHE A  1 349 ? 43.293  -2.242  -50.147 1.00 46.92  ? 349  PHE A N   1 
ATOM   2758  C  CA  . PHE A  1 349 ? 43.771  -1.681  -51.398 1.00 46.73  ? 349  PHE A CA  1 
ATOM   2759  C  C   . PHE A  1 349 ? 45.091  -2.323  -51.806 1.00 48.36  ? 349  PHE A C   1 
ATOM   2760  O  O   . PHE A  1 349 ? 46.047  -2.343  -51.035 1.00 50.61  ? 349  PHE A O   1 
ATOM   2761  C  CB  . PHE A  1 349 ? 43.916  -0.165  -51.271 1.00 49.55  ? 349  PHE A CB  1 
ATOM   2762  C  CG  . PHE A  1 349 ? 42.637  0.533   -50.893 1.00 55.17  ? 349  PHE A CG  1 
ATOM   2763  C  CD1 . PHE A  1 349 ? 42.194  0.527   -49.579 1.00 57.69  ? 349  PHE A CD1 1 
ATOM   2764  C  CD2 . PHE A  1 349 ? 41.871  1.186   -51.853 1.00 56.99  ? 349  PHE A CD2 1 
ATOM   2765  C  CE1 . PHE A  1 349 ? 41.011  1.159   -49.228 1.00 59.32  ? 349  PHE A CE1 1 
ATOM   2766  C  CE2 . PHE A  1 349 ? 40.687  1.822   -51.510 1.00 57.48  ? 349  PHE A CE2 1 
ATOM   2767  C  CZ  . PHE A  1 349 ? 40.256  1.809   -50.195 1.00 59.37  ? 349  PHE A CZ  1 
ATOM   2768  N  N   . GLU A  1 350 ? 45.138  -2.873  -53.012 1.00 60.20  ? 350  GLU A N   1 
ATOM   2769  C  CA  . GLU A  1 350 ? 46.383  -3.418  -53.533 1.00 59.75  ? 350  GLU A CA  1 
ATOM   2770  C  C   . GLU A  1 350 ? 47.112  -2.334  -54.314 1.00 57.85  ? 350  GLU A C   1 
ATOM   2771  O  O   . GLU A  1 350 ? 46.520  -1.677  -55.171 1.00 57.30  ? 350  GLU A O   1 
ATOM   2772  C  CB  . GLU A  1 350 ? 46.121  -4.642  -54.413 1.00 61.68  ? 350  GLU A CB  1 
ATOM   2773  C  CG  . GLU A  1 350 ? 45.779  -5.902  -53.625 1.00 65.19  ? 350  GLU A CG  1 
ATOM   2774  C  CD  . GLU A  1 350 ? 47.001  -6.563  -53.000 1.00 67.44  ? 350  GLU A CD  1 
ATOM   2775  O  OE1 . GLU A  1 350 ? 48.129  -6.371  -53.516 1.00 68.67  ? 350  GLU A OE1 1 
ATOM   2776  O  OE2 . GLU A  1 350 ? 46.826  -7.284  -51.995 1.00 65.65  ? 350  GLU A OE2 1 
ATOM   2777  N  N   . PRO A  1 351 ? 48.400  -2.129  -54.000 1.00 54.65  ? 351  PRO A N   1 
ATOM   2778  C  CA  . PRO A  1 351 ? 49.209  -1.125  -54.695 1.00 53.00  ? 351  PRO A CA  1 
ATOM   2779  C  C   . PRO A  1 351 ? 49.557  -1.575  -56.111 1.00 54.86  ? 351  PRO A C   1 
ATOM   2780  O  O   . PRO A  1 351 ? 49.859  -2.751  -56.349 1.00 52.22  ? 351  PRO A O   1 
ATOM   2781  C  CB  . PRO A  1 351 ? 50.472  -1.043  -53.836 1.00 50.15  ? 351  PRO A CB  1 
ATOM   2782  C  CG  . PRO A  1 351 ? 50.573  -2.366  -53.189 1.00 48.48  ? 351  PRO A CG  1 
ATOM   2783  C  CD  . PRO A  1 351 ? 49.165  -2.836  -52.960 1.00 50.68  ? 351  PRO A CD  1 
ATOM   2784  N  N   . ARG A  1 352 ? 49.525  -0.629  -57.041 1.00 58.57  ? 352  ARG A N   1 
ATOM   2785  C  CA  . ARG A  1 352 ? 49.830  -0.902  -58.436 1.00 62.35  ? 352  ARG A CA  1 
ATOM   2786  C  C   . ARG A  1 352 ? 51.271  -0.502  -58.739 1.00 57.62  ? 352  ARG A C   1 
ATOM   2787  O  O   . ARG A  1 352 ? 51.658  0.655   -58.567 1.00 58.21  ? 352  ARG A O   1 
ATOM   2788  C  CB  . ARG A  1 352 ? 48.851  -0.154  -59.346 1.00 70.30  ? 352  ARG A CB  1 
ATOM   2789  C  CG  . ARG A  1 352 ? 49.093  -0.372  -60.825 1.00 78.68  ? 352  ARG A CG  1 
ATOM   2790  C  CD  . ARG A  1 352 ? 47.973  -1.169  -61.485 1.00 85.10  ? 352  ARG A CD  1 
ATOM   2791  N  NE  . ARG A  1 352 ? 48.269  -1.387  -62.898 1.00 90.98  ? 352  ARG A NE  1 
ATOM   2792  C  CZ  . ARG A  1 352 ? 49.282  -2.133  -63.334 1.00 97.41  ? 352  ARG A CZ  1 
ATOM   2793  N  NH1 . ARG A  1 352 ? 50.093  -2.727  -62.462 1.00 99.08  ? 352  ARG A NH1 1 
ATOM   2794  N  NH2 . ARG A  1 352 ? 49.492  -2.287  -64.637 1.00 99.82  ? 352  ARG A NH2 1 
ATOM   2795  N  N   . HIS A  1 353 ? 52.061  -1.471  -59.182 1.00 52.44  ? 353  HIS A N   1 
ATOM   2796  C  CA  . HIS A  1 353 ? 53.479  -1.251  -59.426 1.00 50.85  ? 353  HIS A CA  1 
ATOM   2797  C  C   . HIS A  1 353 ? 53.726  -0.652  -60.810 1.00 51.67  ? 353  HIS A C   1 
ATOM   2798  O  O   . HIS A  1 353 ? 53.013  -0.968  -61.762 1.00 53.23  ? 353  HIS A O   1 
ATOM   2799  C  CB  . HIS A  1 353 ? 54.244  -2.565  -59.257 1.00 48.67  ? 353  HIS A CB  1 
ATOM   2800  C  CG  . HIS A  1 353 ? 55.627  -2.540  -59.827 1.00 46.64  ? 353  HIS A CG  1 
ATOM   2801  N  ND1 . HIS A  1 353 ? 55.879  -2.717  -61.169 1.00 45.92  ? 353  HIS A ND1 1 
ATOM   2802  C  CD2 . HIS A  1 353 ? 56.834  -2.369  -59.237 1.00 46.79  ? 353  HIS A CD2 1 
ATOM   2803  C  CE1 . HIS A  1 353 ? 57.182  -2.653  -61.382 1.00 45.66  ? 353  HIS A CE1 1 
ATOM   2804  N  NE2 . HIS A  1 353 ? 57.784  -2.442  -60.227 1.00 44.22  ? 353  HIS A NE2 1 
ATOM   2805  N  N   . PHE A  1 354 ? 54.712  0.241   -60.902 1.00 49.23  ? 354  PHE A N   1 
ATOM   2806  C  CA  . PHE A  1 354 ? 55.115  0.841   -62.176 1.00 48.00  ? 354  PHE A CA  1 
ATOM   2807  C  C   . PHE A  1 354 ? 56.611  1.163   -62.222 1.00 48.74  ? 354  PHE A C   1 
ATOM   2808  O  O   . PHE A  1 354 ? 57.192  1.575   -61.217 1.00 47.05  ? 354  PHE A O   1 
ATOM   2809  C  CB  . PHE A  1 354 ? 54.296  2.103   -62.477 1.00 46.03  ? 354  PHE A CB  1 
ATOM   2810  C  CG  . PHE A  1 354 ? 54.620  3.277   -61.593 1.00 46.23  ? 354  PHE A CG  1 
ATOM   2811  C  CD1 . PHE A  1 354 ? 55.615  4.177   -61.944 1.00 46.99  ? 354  PHE A CD1 1 
ATOM   2812  C  CD2 . PHE A  1 354 ? 53.909  3.505   -60.421 1.00 44.60  ? 354  PHE A CD2 1 
ATOM   2813  C  CE1 . PHE A  1 354 ? 55.902  5.276   -61.124 1.00 43.38  ? 354  PHE A CE1 1 
ATOM   2814  C  CE2 . PHE A  1 354 ? 54.196  4.596   -59.616 1.00 40.78  ? 354  PHE A CE2 1 
ATOM   2815  C  CZ  . PHE A  1 354 ? 55.191  5.477   -59.972 1.00 39.15  ? 354  PHE A CZ  1 
ATOM   2816  N  N   . ARG A  1 355 ? 57.227  0.980   -63.391 1.00 49.79  ? 355  ARG A N   1 
ATOM   2817  C  CA  . ARG A  1 355 ? 58.636  1.337   -63.585 1.00 49.14  ? 355  ARG A CA  1 
ATOM   2818  C  C   . ARG A  1 355 ? 58.693  2.748   -64.143 1.00 47.79  ? 355  ARG A C   1 
ATOM   2819  O  O   . ARG A  1 355 ? 57.781  3.169   -64.846 1.00 50.56  ? 355  ARG A O   1 
ATOM   2820  C  CB  . ARG A  1 355 ? 59.362  0.365   -64.520 1.00 48.13  ? 355  ARG A CB  1 
ATOM   2821  C  CG  . ARG A  1 355 ? 59.360  -1.085  -64.068 1.00 48.13  ? 355  ARG A CG  1 
ATOM   2822  C  CD  . ARG A  1 355 ? 60.416  -1.367  -63.007 1.00 50.88  ? 355  ARG A CD  1 
ATOM   2823  N  NE  . ARG A  1 355 ? 61.769  -1.316  -63.552 1.00 56.29  ? 355  ARG A NE  1 
ATOM   2824  C  CZ  . ARG A  1 355 ? 62.879  -1.435  -62.824 1.00 60.09  ? 355  ARG A CZ  1 
ATOM   2825  N  NH1 . ARG A  1 355 ? 62.813  -1.609  -61.509 1.00 59.93  ? 355  ARG A NH1 1 
ATOM   2826  N  NH2 . ARG A  1 355 ? 64.065  -1.374  -63.414 1.00 61.10  ? 355  ARG A NH2 1 
ATOM   2827  N  N   . PHE A  1 356 ? 59.719  3.505   -63.771 1.00 45.99  ? 356  PHE A N   1 
ATOM   2828  C  CA  . PHE A  1 356 ? 59.839  4.885   -64.236 1.00 46.98  ? 356  PHE A CA  1 
ATOM   2829  C  C   . PHE A  1 356 ? 61.288  5.316   -64.372 1.00 46.89  ? 356  PHE A C   1 
ATOM   2830  O  O   . PHE A  1 356 ? 62.147  4.891   -63.602 1.00 45.51  ? 356  PHE A O   1 
ATOM   2831  C  CB  . PHE A  1 356 ? 59.090  5.849   -63.308 1.00 49.92  ? 356  PHE A CB  1 
ATOM   2832  C  CG  . PHE A  1 356 ? 59.739  6.027   -61.960 1.00 50.53  ? 356  PHE A CG  1 
ATOM   2833  C  CD1 . PHE A  1 356 ? 59.472  5.146   -60.915 1.00 49.23  ? 356  PHE A CD1 1 
ATOM   2834  C  CD2 . PHE A  1 356 ? 60.609  7.077   -61.736 1.00 49.65  ? 356  PHE A CD2 1 
ATOM   2835  C  CE1 . PHE A  1 356 ? 60.068  5.310   -59.682 1.00 47.34  ? 356  PHE A CE1 1 
ATOM   2836  C  CE2 . PHE A  1 356 ? 61.207  7.241   -60.503 1.00 48.98  ? 356  PHE A CE2 1 
ATOM   2837  C  CZ  . PHE A  1 356 ? 60.934  6.360   -59.477 1.00 47.18  ? 356  PHE A CZ  1 
ATOM   2838  N  N   . LYS A  1 357 ? 61.539  6.187   -65.345 1.00 49.80  ? 357  LYS A N   1 
ATOM   2839  C  CA  . LYS A  1 357 ? 62.891  6.612   -65.701 1.00 50.45  ? 357  LYS A CA  1 
ATOM   2840  C  C   . LYS A  1 357 ? 63.307  7.841   -64.910 1.00 48.57  ? 357  LYS A C   1 
ATOM   2841  O  O   . LYS A  1 357 ? 62.588  8.839   -64.882 1.00 49.06  ? 357  LYS A O   1 
ATOM   2842  C  CB  . LYS A  1 357 ? 62.960  6.908   -67.208 1.00 52.34  ? 357  LYS A CB  1 
ATOM   2843  C  CG  . LYS A  1 357 ? 64.278  7.501   -67.707 1.00 52.33  ? 357  LYS A CG  1 
ATOM   2844  N  N   . SER A  1 358 ? 64.458  7.763   -64.251 1.00 48.70  ? 358  SER A N   1 
ATOM   2845  C  CA  . SER A  1 358 ? 64.992  8.923   -63.541 1.00 52.17  ? 358  SER A CA  1 
ATOM   2846  C  C   . SER A  1 358 ? 66.464  9.109   -63.864 1.00 54.17  ? 358  SER A C   1 
ATOM   2847  O  O   . SER A  1 358 ? 67.298  8.292   -63.473 1.00 53.80  ? 358  SER A O   1 
ATOM   2848  C  CB  . SER A  1 358 ? 64.809  8.755   -62.025 1.00 53.01  ? 358  SER A CB  1 
ATOM   2849  O  OG  . SER A  1 358 ? 65.272  9.888   -61.304 1.00 51.80  ? 358  SER A OG  1 
ATOM   2850  N  N   . ILE A  1 359 ? 66.795  10.205  -64.536 1.00 57.46  ? 359  ILE A N   1 
ATOM   2851  C  CA  . ILE A  1 359 ? 68.174  10.417  -64.950 1.00 58.94  ? 359  ILE A CA  1 
ATOM   2852  C  C   . ILE A  1 359 ? 68.690  9.182   -65.699 1.00 65.82  ? 359  ILE A C   1 
ATOM   2853  O  O   . ILE A  1 359 ? 68.188  8.830   -66.773 1.00 69.33  ? 359  ILE A O   1 
ATOM   2854  C  CB  . ILE A  1 359 ? 69.089  10.735  -63.755 1.00 53.51  ? 359  ILE A CB  1 
ATOM   2855  C  CG1 . ILE A  1 359 ? 68.469  11.841  -62.893 1.00 52.45  ? 359  ILE A CG1 1 
ATOM   2856  C  CG2 . ILE A  1 359 ? 70.481  11.132  -64.236 1.00 49.83  ? 359  ILE A CG2 1 
ATOM   2857  C  CD1 . ILE A  1 359 ? 69.303  12.239  -61.665 1.00 48.58  ? 359  ILE A CD1 1 
ATOM   2858  N  N   . ASP A  1 360 ? 69.699  8.535   -65.126 1.00 66.57  ? 360  ASP A N   1 
ATOM   2859  C  CA  . ASP A  1 360 ? 70.399  7.438   -65.780 1.00 67.83  ? 360  ASP A CA  1 
ATOM   2860  C  C   . ASP A  1 360 ? 69.841  6.052   -65.463 1.00 63.50  ? 360  ASP A C   1 
ATOM   2861  O  O   . ASP A  1 360 ? 70.316  5.056   -66.013 1.00 61.64  ? 360  ASP A O   1 
ATOM   2862  C  CB  . ASP A  1 360 ? 71.887  7.483   -65.406 1.00 73.84  ? 360  ASP A CB  1 
ATOM   2863  C  CG  . ASP A  1 360 ? 72.117  7.595   -63.889 1.00 75.17  ? 360  ASP A CG  1 
ATOM   2864  O  OD1 . ASP A  1 360 ? 71.353  8.315   -63.208 1.00 72.22  ? 360  ASP A OD1 1 
ATOM   2865  O  OD2 . ASP A  1 360 ? 73.075  6.967   -63.380 1.00 77.15  ? 360  ASP A OD2 1 
ATOM   2866  N  N   . LEU A  1 361 ? 68.847  5.973   -64.581 1.00 61.04  ? 361  LEU A N   1 
ATOM   2867  C  CA  . LEU A  1 361 ? 68.379  4.667   -64.127 1.00 57.44  ? 361  LEU A CA  1 
ATOM   2868  C  C   . LEU A  1 361 ? 66.887  4.458   -64.288 1.00 54.62  ? 361  LEU A C   1 
ATOM   2869  O  O   . LEU A  1 361 ? 66.148  5.366   -64.668 1.00 51.76  ? 361  LEU A O   1 
ATOM   2870  C  CB  . LEU A  1 361 ? 68.724  4.468   -62.654 1.00 59.51  ? 361  LEU A CB  1 
ATOM   2871  C  CG  . LEU A  1 361 ? 70.181  4.601   -62.224 1.00 61.94  ? 361  LEU A CG  1 
ATOM   2872  C  CD1 . LEU A  1 361 ? 70.253  4.715   -60.708 1.00 62.92  ? 361  LEU A CD1 1 
ATOM   2873  C  CD2 . LEU A  1 361 ? 70.991  3.421   -62.723 1.00 62.33  ? 361  LEU A CD2 1 
ATOM   2874  N  N   . GLU A  1 362 ? 66.460  3.247   -63.941 1.00 57.86  ? 362  GLU A N   1 
ATOM   2875  C  CA  . GLU A  1 362 ? 65.064  2.835   -64.006 1.00 60.03  ? 362  GLU A CA  1 
ATOM   2876  C  C   . GLU A  1 362 ? 64.650  2.317   -62.626 1.00 57.92  ? 362  GLU A C   1 
ATOM   2877  O  O   . GLU A  1 362 ? 65.307  1.434   -62.068 1.00 59.12  ? 362  GLU A O   1 
ATOM   2878  C  CB  . GLU A  1 362 ? 64.884  1.741   -65.061 1.00 64.10  ? 362  GLU A CB  1 
ATOM   2879  C  CG  . GLU A  1 362 ? 63.560  1.819   -65.815 1.00 70.29  ? 362  GLU A CG  1 
ATOM   2880  C  CD  . GLU A  1 362 ? 63.181  0.512   -66.494 1.00 74.23  ? 362  GLU A CD  1 
ATOM   2881  O  OE1 . GLU A  1 362 ? 63.903  -0.494  -66.310 1.00 75.30  ? 362  GLU A OE1 1 
ATOM   2882  O  OE2 . GLU A  1 362 ? 62.155  0.492   -67.210 1.00 74.44  ? 362  GLU A OE2 1 
ATOM   2883  N  N   . LEU A  1 363 ? 63.568  2.864   -62.074 1.00 53.93  ? 363  LEU A N   1 
ATOM   2884  C  CA  . LEU A  1 363 ? 63.218  2.596   -60.681 1.00 49.66  ? 363  LEU A CA  1 
ATOM   2885  C  C   . LEU A  1 363 ? 61.817  2.030   -60.474 1.00 49.41  ? 363  LEU A C   1 
ATOM   2886  O  O   . LEU A  1 363 ? 60.917  2.232   -61.284 1.00 49.75  ? 363  LEU A O   1 
ATOM   2887  C  CB  . LEU A  1 363 ? 63.375  3.862   -59.835 1.00 46.02  ? 363  LEU A CB  1 
ATOM   2888  C  CG  . LEU A  1 363 ? 64.723  4.583   -59.881 1.00 45.36  ? 363  LEU A CG  1 
ATOM   2889  C  CD1 . LEU A  1 363 ? 64.817  5.444   -61.127 1.00 44.51  ? 363  LEU A CD1 1 
ATOM   2890  C  CD2 . LEU A  1 363 ? 64.934  5.426   -58.623 1.00 43.04  ? 363  LEU A CD2 1 
ATOM   2891  N  N   . ASP A  1 364 ? 61.645  1.323   -59.365 1.00 48.68  ? 364  ASP A N   1 
ATOM   2892  C  CA  . ASP A  1 364 ? 60.341  0.810   -58.978 1.00 47.16  ? 364  ASP A CA  1 
ATOM   2893  C  C   . ASP A  1 364 ? 59.493  1.889   -58.323 1.00 45.96  ? 364  ASP A C   1 
ATOM   2894  O  O   . ASP A  1 364 ? 60.005  2.782   -57.652 1.00 45.28  ? 364  ASP A O   1 
ATOM   2895  C  CB  . ASP A  1 364 ? 60.492  -0.375  -58.029 1.00 46.36  ? 364  ASP A CB  1 
ATOM   2896  C  CG  . ASP A  1 364 ? 60.943  -1.621  -58.737 1.00 46.95  ? 364  ASP A CG  1 
ATOM   2897  O  OD1 . ASP A  1 364 ? 60.429  -1.890  -59.846 1.00 48.85  ? 364  ASP A OD1 1 
ATOM   2898  O  OD2 . ASP A  1 364 ? 61.816  -2.325  -58.191 1.00 46.04  ? 364  ASP A OD2 1 
ATOM   2899  N  N   . GLY A  1 365 ? 58.186  1.796   -58.527 1.00 45.72  ? 365  GLY A N   1 
ATOM   2900  C  CA  . GLY A  1 365 ? 57.253  2.693   -57.887 1.00 46.06  ? 365  GLY A CA  1 
ATOM   2901  C  C   . GLY A  1 365 ? 55.952  1.966   -57.659 1.00 50.38  ? 365  GLY A C   1 
ATOM   2902  O  O   . GLY A  1 365 ? 55.686  0.923   -58.255 1.00 53.83  ? 365  GLY A O   1 
ATOM   2903  N  N   . TRP A  1 366 ? 55.134  2.514   -56.778 1.00 50.90  ? 366  TRP A N   1 
ATOM   2904  C  CA  . TRP A  1 366 ? 53.832  1.936   -56.518 1.00 50.29  ? 366  TRP A CA  1 
ATOM   2905  C  C   . TRP A  1 366 ? 52.869  3.055   -56.220 1.00 50.79  ? 366  TRP A C   1 
ATOM   2906  O  O   . TRP A  1 366 ? 53.270  4.141   -55.785 1.00 51.35  ? 366  TRP A O   1 
ATOM   2907  C  CB  . TRP A  1 366 ? 53.870  1.006   -55.308 1.00 46.91  ? 366  TRP A CB  1 
ATOM   2908  C  CG  . TRP A  1 366 ? 54.650  -0.260  -55.484 1.00 43.93  ? 366  TRP A CG  1 
ATOM   2909  C  CD1 . TRP A  1 366 ? 54.164  -1.485  -55.856 1.00 42.68  ? 366  TRP A CD1 1 
ATOM   2910  C  CD2 . TRP A  1 366 ? 56.053  -0.437  -55.260 1.00 39.56  ? 366  TRP A CD2 1 
ATOM   2911  N  NE1 . TRP A  1 366 ? 55.185  -2.409  -55.889 1.00 41.19  ? 366  TRP A NE1 1 
ATOM   2912  C  CE2 . TRP A  1 366 ? 56.353  -1.790  -55.526 1.00 40.21  ? 366  TRP A CE2 1 
ATOM   2913  C  CE3 . TRP A  1 366 ? 57.083  0.415   -54.867 1.00 36.52  ? 366  TRP A CE3 1 
ATOM   2914  C  CZ2 . TRP A  1 366 ? 57.638  -2.304  -55.408 1.00 40.79  ? 366  TRP A CZ2 1 
ATOM   2915  C  CZ3 . TRP A  1 366 ? 58.353  -0.096  -54.752 1.00 39.35  ? 366  TRP A CZ3 1 
ATOM   2916  C  CH2 . TRP A  1 366 ? 58.622  -1.443  -55.020 1.00 40.78  ? 366  TRP A CH2 1 
ATOM   2917  N  N   . TYR A  1 367 ? 51.593  2.791   -56.451 1.00 47.36  ? 367  TYR A N   1 
ATOM   2918  C  CA  . TYR A  1 367 ? 50.580  3.721   -56.022 1.00 44.35  ? 367  TYR A CA  1 
ATOM   2919  C  C   . TYR A  1 367 ? 49.295  2.986   -55.742 1.00 47.46  ? 367  TYR A C   1 
ATOM   2920  O  O   . TYR A  1 367 ? 49.053  1.901   -56.270 1.00 47.77  ? 367  TYR A O   1 
ATOM   2921  C  CB  . TYR A  1 367 ? 50.371  4.831   -57.049 1.00 43.15  ? 367  TYR A CB  1 
ATOM   2922  C  CG  . TYR A  1 367 ? 49.745  4.403   -58.355 1.00 43.41  ? 367  TYR A CG  1 
ATOM   2923  C  CD1 . TYR A  1 367 ? 50.536  4.063   -59.446 1.00 41.98  ? 367  TYR A CD1 1 
ATOM   2924  C  CD2 . TYR A  1 367 ? 48.361  4.377   -58.511 1.00 41.60  ? 367  TYR A CD2 1 
ATOM   2925  C  CE1 . TYR A  1 367 ? 49.967  3.693   -60.648 1.00 43.19  ? 367  TYR A CE1 1 
ATOM   2926  C  CE2 . TYR A  1 367 ? 47.783  4.011   -59.709 1.00 41.25  ? 367  TYR A CE2 1 
ATOM   2927  C  CZ  . TYR A  1 367 ? 48.590  3.669   -60.778 1.00 44.13  ? 367  TYR A CZ  1 
ATOM   2928  O  OH  . TYR A  1 367 ? 48.024  3.299   -61.981 1.00 45.01  ? 367  TYR A OH  1 
ATOM   2929  N  N   . ILE A  1 368 ? 48.491  3.579   -54.872 1.00 48.32  ? 368  ILE A N   1 
ATOM   2930  C  CA  . ILE A  1 368 ? 47.191  3.043   -54.545 1.00 46.51  ? 368  ILE A CA  1 
ATOM   2931  C  C   . ILE A  1 368 ? 46.146  4.052   -54.984 1.00 46.61  ? 368  ILE A C   1 
ATOM   2932  O  O   . ILE A  1 368 ? 46.291  5.259   -54.762 1.00 46.02  ? 368  ILE A O   1 
ATOM   2933  C  CB  . ILE A  1 368 ? 47.071  2.756   -53.050 1.00 44.67  ? 368  ILE A CB  1 
ATOM   2934  C  CG1 . ILE A  1 368 ? 48.123  1.724   -52.639 1.00 43.41  ? 368  ILE A CG1 1 
ATOM   2935  C  CG2 . ILE A  1 368 ? 45.670  2.272   -52.716 1.00 44.82  ? 368  ILE A CG2 1 
ATOM   2936  C  CD1 . ILE A  1 368 ? 48.119  1.401   -51.161 1.00 44.12  ? 368  ILE A CD1 1 
ATOM   2937  N  N   . LYS A  1 369 ? 45.113  3.545   -55.643 1.00 46.37  ? 369  LYS A N   1 
ATOM   2938  C  CA  . LYS A  1 369 ? 44.057  4.380   -56.177 1.00 47.04  ? 369  LYS A CA  1 
ATOM   2939  C  C   . LYS A  1 369 ? 42.818  4.223   -55.310 1.00 48.76  ? 369  LYS A C   1 
ATOM   2940  O  O   . LYS A  1 369 ? 42.338  3.112   -55.098 1.00 51.19  ? 369  LYS A O   1 
ATOM   2941  C  CB  . LYS A  1 369 ? 43.760  3.964   -57.613 1.00 49.40  ? 369  LYS A CB  1 
ATOM   2942  C  CG  . LYS A  1 369 ? 42.792  4.874   -58.332 1.00 51.58  ? 369  LYS A CG  1 
ATOM   2943  C  CD  . LYS A  1 369 ? 42.636  4.478   -59.788 1.00 50.70  ? 369  LYS A CD  1 
ATOM   2944  C  CE  . LYS A  1 369 ? 41.578  5.336   -60.453 1.00 51.39  ? 369  LYS A CE  1 
ATOM   2945  N  NZ  . LYS A  1 369 ? 41.153  4.770   -61.760 1.00 54.14  ? 369  LYS A NZ  1 
ATOM   2946  N  N   . PRO A  1 370 ? 42.303  5.340   -54.785 1.00 47.71  ? 370  PRO A N   1 
ATOM   2947  C  CA  . PRO A  1 370 ? 41.136  5.309   -53.901 1.00 46.72  ? 370  PRO A CA  1 
ATOM   2948  C  C   . PRO A  1 370 ? 39.890  5.128   -54.753 1.00 50.24  ? 370  PRO A C   1 
ATOM   2949  O  O   . PRO A  1 370 ? 40.036  4.955   -55.961 1.00 54.44  ? 370  PRO A O   1 
ATOM   2950  C  CB  . PRO A  1 370 ? 41.153  6.702   -53.279 1.00 44.03  ? 370  PRO A CB  1 
ATOM   2951  C  CG  . PRO A  1 370 ? 41.742  7.563   -54.342 1.00 44.68  ? 370  PRO A CG  1 
ATOM   2952  C  CD  . PRO A  1 370 ? 42.730  6.716   -55.096 1.00 46.84  ? 370  PRO A CD  1 
ATOM   2953  N  N   . GLU A  1 371 ? 38.697  5.200   -54.175 1.00 48.97  ? 371  GLU A N   1 
ATOM   2954  C  CA  . GLU A  1 371 ? 37.527  5.178   -55.026 1.00 49.39  ? 371  GLU A CA  1 
ATOM   2955  C  C   . GLU A  1 371 ? 37.243  6.639   -55.332 1.00 57.31  ? 371  GLU A C   1 
ATOM   2956  O  O   . GLU A  1 371 ? 36.860  7.415   -54.460 1.00 58.17  ? 371  GLU A O   1 
ATOM   2957  C  CB  . GLU A  1 371 ? 36.337  4.524   -54.312 1.00 42.19  ? 371  GLU A CB  1 
ATOM   2958  N  N   . ILE A  1 372 ? 37.507  7.015   -56.579 1.00 63.11  ? 372  ILE A N   1 
ATOM   2959  C  CA  . ILE A  1 372 ? 37.133  8.316   -57.117 1.00 66.95  ? 372  ILE A CA  1 
ATOM   2960  C  C   . ILE A  1 372 ? 35.693  8.319   -57.622 1.00 75.06  ? 372  ILE A C   1 
ATOM   2961  O  O   . ILE A  1 372 ? 35.166  7.269   -58.009 1.00 75.76  ? 372  ILE A O   1 
ATOM   2962  C  CB  . ILE A  1 372 ? 38.098  8.774   -58.222 1.00 64.81  ? 372  ILE A CB  1 
ATOM   2963  C  CG1 . ILE A  1 372 ? 39.543  8.590   -57.764 1.00 65.06  ? 372  ILE A CG1 1 
ATOM   2964  C  CG2 . ILE A  1 372 ? 37.853  10.226  -58.580 1.00 64.16  ? 372  ILE A CG2 1 
ATOM   2965  C  CD1 . ILE A  1 372 ? 40.563  9.061   -58.773 1.00 65.34  ? 372  ILE A CD1 1 
ATOM   2966  N  N   . LYS A  1 373 ? 35.072  9.498   -57.629 1.00 80.10  ? 373  LYS A N   1 
ATOM   2967  C  CA  . LYS A  1 373 ? 33.757  9.695   -58.243 1.00 82.71  ? 373  LYS A CA  1 
ATOM   2968  C  C   . LYS A  1 373 ? 33.710  9.263   -59.716 1.00 83.74  ? 373  LYS A C   1 
ATOM   2969  O  O   . LYS A  1 373 ? 34.681  8.731   -60.265 1.00 83.10  ? 373  LYS A O   1 
ATOM   2970  C  CB  . LYS A  1 373 ? 33.335  11.163  -58.127 1.00 83.35  ? 373  LYS A CB  1 
ATOM   2971  N  N   . GLU A  1 376 ? 35.707  12.985  -61.221 1.00 83.90  ? 376  GLU A N   1 
ATOM   2972  C  CA  . GLU A  1 376 ? 36.319  13.977  -60.341 1.00 80.86  ? 376  GLU A CA  1 
ATOM   2973  C  C   . GLU A  1 376 ? 37.801  13.657  -60.144 1.00 71.89  ? 376  GLU A C   1 
ATOM   2974  O  O   . GLU A  1 376 ? 38.316  12.703  -60.733 1.00 70.66  ? 376  GLU A O   1 
ATOM   2975  C  CB  . GLU A  1 376 ? 35.584  14.028  -58.998 1.00 84.71  ? 376  GLU A CB  1 
ATOM   2976  C  CG  . GLU A  1 376 ? 35.657  15.380  -58.293 1.00 89.80  ? 376  GLU A CG  1 
ATOM   2977  C  CD  . GLU A  1 376 ? 34.776  15.455  -57.050 1.00 93.74  ? 376  GLU A CD  1 
ATOM   2978  O  OE1 . GLU A  1 376 ? 34.094  14.457  -56.728 1.00 95.64  ? 376  GLU A OE1 1 
ATOM   2979  O  OE2 . GLU A  1 376 ? 34.764  16.518  -56.394 1.00 93.83  ? 376  GLU A OE2 1 
ATOM   2980  N  N   . LYS A  1 377 ? 38.488  14.457  -59.333 1.00 64.27  ? 377  LYS A N   1 
ATOM   2981  C  CA  . LYS A  1 377 ? 39.907  14.231  -59.064 1.00 59.85  ? 377  LYS A CA  1 
ATOM   2982  C  C   . LYS A  1 377 ? 40.177  14.022  -57.570 1.00 58.33  ? 377  LYS A C   1 
ATOM   2983  O  O   . LYS A  1 377 ? 39.402  14.472  -56.727 1.00 62.04  ? 377  LYS A O   1 
ATOM   2984  C  CB  . LYS A  1 377 ? 40.750  15.385  -59.609 1.00 56.63  ? 377  LYS A CB  1 
ATOM   2985  C  CG  . LYS A  1 377 ? 40.698  15.537  -61.123 1.00 56.31  ? 377  LYS A CG  1 
ATOM   2986  C  CD  . LYS A  1 377 ? 42.092  15.653  -61.732 1.00 56.14  ? 377  LYS A CD  1 
ATOM   2987  N  N   . ALA A  1 378 ? 41.270  13.337  -57.242 1.00 52.15  ? 378  ALA A N   1 
ATOM   2988  C  CA  . ALA A  1 378 ? 41.575  13.032  -55.846 1.00 47.71  ? 378  ALA A CA  1 
ATOM   2989  C  C   . ALA A  1 378 ? 42.977  13.463  -55.444 1.00 46.95  ? 378  ALA A C   1 
ATOM   2990  O  O   . ALA A  1 378 ? 43.919  13.339  -56.227 1.00 50.35  ? 378  ALA A O   1 
ATOM   2991  C  CB  . ALA A  1 378 ? 41.383  11.546  -55.570 1.00 46.34  ? 378  ALA A CB  1 
ATOM   2992  N  N   . PRO A  1 379 ? 43.119  13.942  -54.200 1.00 41.92  ? 379  PRO A N   1 
ATOM   2993  C  CA  . PRO A  1 379 ? 44.376  14.428  -53.617 1.00 37.97  ? 379  PRO A CA  1 
ATOM   2994  C  C   . PRO A  1 379 ? 45.408  13.310  -53.561 1.00 35.40  ? 379  PRO A C   1 
ATOM   2995  O  O   . PRO A  1 379 ? 45.045  12.136  -53.657 1.00 31.83  ? 379  PRO A O   1 
ATOM   2996  C  CB  . PRO A  1 379 ? 43.966  14.830  -52.200 1.00 38.06  ? 379  PRO A CB  1 
ATOM   2997  C  CG  . PRO A  1 379 ? 42.788  13.990  -51.903 1.00 39.26  ? 379  PRO A CG  1 
ATOM   2998  C  CD  . PRO A  1 379 ? 42.040  13.895  -53.202 1.00 39.67  ? 379  PRO A CD  1 
ATOM   2999  N  N   . VAL A  1 380 ? 46.679  13.673  -53.415 1.00 37.21  ? 380  VAL A N   1 
ATOM   3000  C  CA  . VAL A  1 380 ? 47.761  12.697  -53.471 1.00 38.78  ? 380  VAL A CA  1 
ATOM   3001  C  C   . VAL A  1 380 ? 48.726  12.841  -52.304 1.00 41.06  ? 380  VAL A C   1 
ATOM   3002  O  O   . VAL A  1 380 ? 49.205  13.935  -52.023 1.00 42.54  ? 380  VAL A O   1 
ATOM   3003  C  CB  . VAL A  1 380 ? 48.571  12.861  -54.765 1.00 38.92  ? 380  VAL A CB  1 
ATOM   3004  C  CG1 . VAL A  1 380 ? 49.624  11.771  -54.869 1.00 40.26  ? 380  VAL A CG1 1 
ATOM   3005  C  CG2 . VAL A  1 380 ? 47.650  12.852  -55.968 1.00 36.49  ? 380  VAL A CG2 1 
ATOM   3006  N  N   . ILE A  1 381 ? 49.011  11.734  -51.627 1.00 41.17  ? 381  ILE A N   1 
ATOM   3007  C  CA  . ILE A  1 381 ? 50.024  11.736  -50.577 1.00 40.97  ? 381  ILE A CA  1 
ATOM   3008  C  C   . ILE A  1 381 ? 51.225  10.928  -51.019 1.00 41.93  ? 381  ILE A C   1 
ATOM   3009  O  O   . ILE A  1 381 ? 51.102  9.746   -51.324 1.00 43.75  ? 381  ILE A O   1 
ATOM   3010  C  CB  . ILE A  1 381 ? 49.520  11.108  -49.267 1.00 40.95  ? 381  ILE A CB  1 
ATOM   3011  C  CG1 . ILE A  1 381 ? 48.261  11.813  -48.765 1.00 42.12  ? 381  ILE A CG1 1 
ATOM   3012  C  CG2 . ILE A  1 381 ? 50.606  11.175  -48.210 1.00 39.89  ? 381  ILE A CG2 1 
ATOM   3013  C  CD1 . ILE A  1 381 ? 47.664  11.172  -47.527 1.00 40.67  ? 381  ILE A CD1 1 
ATOM   3014  N  N   . VAL A  1 382 ? 52.387  11.565  -51.061 1.00 41.49  ? 382  VAL A N   1 
ATOM   3015  C  CA  . VAL A  1 382 ? 53.622  10.853  -51.349 1.00 38.68  ? 382  VAL A CA  1 
ATOM   3016  C  C   . VAL A  1 382 ? 54.275  10.415  -50.048 1.00 41.24  ? 382  VAL A C   1 
ATOM   3017  O  O   . VAL A  1 382 ? 54.516  11.242  -49.160 1.00 38.32  ? 382  VAL A O   1 
ATOM   3018  C  CB  . VAL A  1 382 ? 54.635  11.736  -52.077 1.00 34.90  ? 382  VAL A CB  1 
ATOM   3019  C  CG1 . VAL A  1 382 ? 55.926  10.963  -52.295 1.00 32.96  ? 382  VAL A CG1 1 
ATOM   3020  C  CG2 . VAL A  1 382 ? 54.066  12.246  -53.391 1.00 35.79  ? 382  VAL A CG2 1 
ATOM   3021  N  N   . PHE A  1 383 ? 54.562  9.120   -49.939 1.00 38.44  ? 383  PHE A N   1 
ATOM   3022  C  CA  . PHE A  1 383 ? 55.296  8.587   -48.796 1.00 36.89  ? 383  PHE A CA  1 
ATOM   3023  C  C   . PHE A  1 383 ? 56.764  8.355   -49.141 1.00 39.71  ? 383  PHE A C   1 
ATOM   3024  O  O   . PHE A  1 383 ? 57.082  7.804   -50.201 1.00 38.53  ? 383  PHE A O   1 
ATOM   3025  C  CB  . PHE A  1 383 ? 54.678  7.278   -48.318 1.00 32.40  ? 383  PHE A CB  1 
ATOM   3026  C  CG  . PHE A  1 383 ? 53.406  7.453   -47.560 1.00 31.31  ? 383  PHE A CG  1 
ATOM   3027  C  CD1 . PHE A  1 383 ? 53.357  7.204   -46.200 1.00 28.48  ? 383  PHE A CD1 1 
ATOM   3028  C  CD2 . PHE A  1 383 ? 52.254  7.864   -48.206 1.00 33.28  ? 383  PHE A CD2 1 
ATOM   3029  C  CE1 . PHE A  1 383 ? 52.188  7.361   -45.498 1.00 29.87  ? 383  PHE A CE1 1 
ATOM   3030  C  CE2 . PHE A  1 383 ? 51.076  8.019   -47.510 1.00 35.36  ? 383  PHE A CE2 1 
ATOM   3031  C  CZ  . PHE A  1 383 ? 51.045  7.771   -46.145 1.00 31.28  ? 383  PHE A CZ  1 
ATOM   3032  N  N   . VAL A  1 384 ? 57.656  8.772   -48.248 1.00 34.76  ? 384  VAL A N   1 
ATOM   3033  C  CA  . VAL A  1 384 ? 59.072  8.530   -48.452 1.00 36.72  ? 384  VAL A CA  1 
ATOM   3034  C  C   . VAL A  1 384 ? 59.614  7.674   -47.321 1.00 41.00  ? 384  VAL A C   1 
ATOM   3035  O  O   . VAL A  1 384 ? 59.498  8.040   -46.147 1.00 46.60  ? 384  VAL A O   1 
ATOM   3036  C  CB  . VAL A  1 384 ? 59.867  9.833   -48.520 1.00 35.77  ? 384  VAL A CB  1 
ATOM   3037  C  CG1 . VAL A  1 384 ? 61.325  9.533   -48.785 1.00 34.84  ? 384  VAL A CG1 1 
ATOM   3038  C  CG2 . VAL A  1 384 ? 59.308  10.728  -49.601 1.00 36.67  ? 384  VAL A CG2 1 
ATOM   3039  N  N   . HIS A  1 385 ? 60.210  6.539   -47.674 1.00 38.51  ? 385  HIS A N   1 
ATOM   3040  C  CA  . HIS A  1 385 ? 60.679  5.600   -46.668 1.00 39.54  ? 385  HIS A CA  1 
ATOM   3041  C  C   . HIS A  1 385 ? 61.929  6.077   -45.937 1.00 40.96  ? 385  HIS A C   1 
ATOM   3042  O  O   . HIS A  1 385 ? 62.693  6.910   -46.448 1.00 42.66  ? 385  HIS A O   1 
ATOM   3043  C  CB  . HIS A  1 385 ? 60.873  4.195   -47.256 1.00 42.80  ? 385  HIS A CB  1 
ATOM   3044  C  CG  . HIS A  1 385 ? 62.009  4.076   -48.230 1.00 46.38  ? 385  HIS A CG  1 
ATOM   3045  N  ND1 . HIS A  1 385 ? 63.319  4.333   -47.887 1.00 46.23  ? 385  HIS A ND1 1 
ATOM   3046  C  CD2 . HIS A  1 385 ? 62.032  3.686   -49.527 1.00 50.49  ? 385  HIS A CD2 1 
ATOM   3047  C  CE1 . HIS A  1 385 ? 64.097  4.126   -48.934 1.00 47.81  ? 385  HIS A CE1 1 
ATOM   3048  N  NE2 . HIS A  1 385 ? 63.341  3.732   -49.943 1.00 49.28  ? 385  HIS A NE2 1 
ATOM   3049  N  N   . GLY A  1 386 ? 62.128  5.534   -44.739 1.00 39.53  ? 386  GLY A N   1 
ATOM   3050  C  CA  . GLY A  1 386 ? 63.266  5.891   -43.912 1.00 41.98  ? 386  GLY A CA  1 
ATOM   3051  C  C   . GLY A  1 386 ? 64.494  5.339   -44.593 1.00 46.03  ? 386  GLY A C   1 
ATOM   3052  O  O   . GLY A  1 386 ? 64.386  4.818   -45.706 1.00 48.78  ? 386  GLY A O   1 
ATOM   3053  N  N   . GLY A  1 387 ? 65.665  5.438   -43.977 1.00 45.91  ? 387  GLY A N   1 
ATOM   3054  C  CA  . GLY A  1 387 ? 66.820  5.239   -44.817 1.00 45.42  ? 387  GLY A CA  1 
ATOM   3055  C  C   . GLY A  1 387 ? 68.167  5.805   -44.441 1.00 49.33  ? 387  GLY A C   1 
ATOM   3056  O  O   . GLY A  1 387 ? 68.513  5.942   -43.262 1.00 47.26  ? 387  GLY A O   1 
ATOM   3057  N  N   . PRO A  1 388 ? 68.962  6.101   -45.481 1.00 47.34  ? 388  PRO A N   1 
ATOM   3058  C  CA  . PRO A  1 388 ? 68.438  6.004   -46.857 1.00 43.27  ? 388  PRO A CA  1 
ATOM   3059  C  C   . PRO A  1 388 ? 68.187  4.571   -47.357 1.00 42.35  ? 388  PRO A C   1 
ATOM   3060  O  O   . PRO A  1 388 ? 67.411  4.353   -48.289 1.00 44.54  ? 388  PRO A O   1 
ATOM   3061  C  CB  . PRO A  1 388 ? 69.502  6.713   -47.688 1.00 44.40  ? 388  PRO A CB  1 
ATOM   3062  C  CG  . PRO A  1 388 ? 70.727  6.696   -46.847 1.00 47.24  ? 388  PRO A CG  1 
ATOM   3063  C  CD  . PRO A  1 388 ? 70.281  6.747   -45.431 1.00 47.05  ? 388  PRO A CD  1 
ATOM   3064  N  N   . LYS A  1 389 ? 68.780  3.606   -46.668 1.00 41.69  ? 389  LYS A N   1 
ATOM   3065  C  CA  . LYS A  1 389 ? 68.803  2.206   -47.087 1.00 40.71  ? 389  LYS A CA  1 
ATOM   3066  C  C   . LYS A  1 389 ? 67.584  1.401   -46.609 1.00 45.68  ? 389  LYS A C   1 
ATOM   3067  O  O   . LYS A  1 389 ? 67.638  0.177   -46.524 1.00 51.53  ? 389  LYS A O   1 
ATOM   3068  C  CB  . LYS A  1 389 ? 70.131  1.508   -46.772 1.00 36.56  ? 389  LYS A CB  1 
ATOM   3069  C  CG  . LYS A  1 389 ? 70.373  0.263   -47.635 1.00 33.99  ? 389  LYS A CG  1 
ATOM   3070  C  CD  . LYS A  1 389 ? 71.687  -0.439  -47.318 1.00 33.93  ? 389  LYS A CD  1 
ATOM   3071  C  CE  . LYS A  1 389 ? 71.891  -1.673  -48.198 1.00 38.37  ? 389  LYS A CE  1 
ATOM   3072  N  NZ  . LYS A  1 389 ? 73.077  -2.475  -47.775 1.00 37.22  ? 389  LYS A NZ  1 
ATOM   3073  N  N   . GLY A  1 390 ? 66.569  2.093   -46.106 1.00 45.17  ? 390  GLY A N   1 
ATOM   3074  C  CA  . GLY A  1 390 ? 65.241  1.498   -45.996 1.00 46.29  ? 390  GLY A CA  1 
ATOM   3075  C  C   . GLY A  1 390 ? 64.611  1.132   -47.341 1.00 49.51  ? 390  GLY A C   1 
ATOM   3076  O  O   . GLY A  1 390 ? 65.091  1.550   -48.398 1.00 55.01  ? 390  GLY A O   1 
ATOM   3077  N  N   . MET A  1 391 ? 63.546  0.332   -47.311 1.00 48.73  ? 391  MET A N   1 
ATOM   3078  C  CA  . MET A  1 391 ? 62.881  -0.109  -48.541 1.00 47.00  ? 391  MET A CA  1 
ATOM   3079  C  C   . MET A  1 391 ? 61.354  -0.157  -48.456 1.00 47.27  ? 391  MET A C   1 
ATOM   3080  O  O   . MET A  1 391 ? 60.807  -0.813  -47.568 1.00 46.51  ? 391  MET A O   1 
ATOM   3081  C  CB  . MET A  1 391 ? 63.384  -1.500  -48.930 1.00 46.69  ? 391  MET A CB  1 
ATOM   3082  C  CG  . MET A  1 391 ? 62.930  -1.962  -50.309 1.00 49.92  ? 391  MET A CG  1 
ATOM   3083  S  SD  . MET A  1 391 ? 63.432  -3.656  -50.682 1.00 51.43  ? 391  MET A SD  1 
ATOM   3084  C  CE  . MET A  1 391 ? 62.486  -4.572  -49.489 1.00 26.71  ? 391  MET A CE  1 
ATOM   3085  N  N   . TYR A  1 392 ? 60.673  0.501   -49.399 1.00 48.84  ? 392  TYR A N   1 
ATOM   3086  C  CA  . TYR A  1 392 ? 59.230  0.316   -49.583 1.00 48.70  ? 392  TYR A CA  1 
ATOM   3087  C  C   . TYR A  1 392 ? 58.987  -0.934  -50.402 1.00 50.55  ? 392  TYR A C   1 
ATOM   3088  O  O   . TYR A  1 392 ? 59.936  -1.567  -50.854 1.00 53.54  ? 392  TYR A O   1 
ATOM   3089  C  CB  . TYR A  1 392 ? 58.578  1.525   -50.249 1.00 46.92  ? 392  TYR A CB  1 
ATOM   3090  C  CG  . TYR A  1 392 ? 58.159  2.561   -49.250 1.00 43.81  ? 392  TYR A CG  1 
ATOM   3091  C  CD1 . TYR A  1 392 ? 58.045  3.894   -49.605 1.00 42.32  ? 392  TYR A CD1 1 
ATOM   3092  C  CD2 . TYR A  1 392 ? 57.892  2.201   -47.938 1.00 44.85  ? 392  TYR A CD2 1 
ATOM   3093  C  CE1 . TYR A  1 392 ? 57.674  4.841   -48.681 1.00 45.10  ? 392  TYR A CE1 1 
ATOM   3094  C  CE2 . TYR A  1 392 ? 57.521  3.137   -47.005 1.00 46.68  ? 392  TYR A CE2 1 
ATOM   3095  C  CZ  . TYR A  1 392 ? 57.412  4.457   -47.376 1.00 48.47  ? 392  TYR A CZ  1 
ATOM   3096  O  OH  . TYR A  1 392 ? 57.038  5.386   -46.427 1.00 50.36  ? 392  TYR A OH  1 
ATOM   3097  N  N   . GLY A  1 393 ? 57.730  -1.283  -50.639 1.00 48.90  ? 393  GLY A N   1 
ATOM   3098  C  CA  . GLY A  1 393 ? 57.480  -2.671  -50.958 1.00 49.91  ? 393  GLY A CA  1 
ATOM   3099  C  C   . GLY A  1 393 ? 56.091  -3.237  -50.781 1.00 51.37  ? 393  GLY A C   1 
ATOM   3100  O  O   . GLY A  1 393 ? 55.070  -2.592  -51.030 1.00 51.13  ? 393  GLY A O   1 
ATOM   3101  N  N   . TYR A  1 394 ? 56.096  -4.532  -50.498 1.00 52.44  ? 394  TYR A N   1 
ATOM   3102  C  CA  . TYR A  1 394 ? 54.905  -5.301  -50.170 1.00 53.99  ? 394  TYR A CA  1 
ATOM   3103  C  C   . TYR A  1 394 ? 54.544  -5.520  -48.685 1.00 54.26  ? 394  TYR A C   1 
ATOM   3104  O  O   . TYR A  1 394 ? 53.671  -6.331  -48.396 1.00 57.60  ? 394  TYR A O   1 
ATOM   3105  C  CB  . TYR A  1 394 ? 54.867  -6.582  -50.996 1.00 54.20  ? 394  TYR A CB  1 
ATOM   3106  C  CG  . TYR A  1 394 ? 54.992  -6.248  -52.457 1.00 56.49  ? 394  TYR A CG  1 
ATOM   3107  C  CD1 . TYR A  1 394 ? 56.164  -6.511  -53.153 1.00 57.45  ? 394  TYR A CD1 1 
ATOM   3108  C  CD2 . TYR A  1 394 ? 53.959  -5.605  -53.130 1.00 55.93  ? 394  TYR A CD2 1 
ATOM   3109  C  CE1 . TYR A  1 394 ? 56.290  -6.182  -54.488 1.00 56.12  ? 394  TYR A CE1 1 
ATOM   3110  C  CE2 . TYR A  1 394 ? 54.079  -5.272  -54.461 1.00 55.52  ? 394  TYR A CE2 1 
ATOM   3111  C  CZ  . TYR A  1 394 ? 55.245  -5.564  -55.134 1.00 56.60  ? 394  TYR A CZ  1 
ATOM   3112  O  OH  . TYR A  1 394 ? 55.366  -5.233  -56.462 1.00 60.33  ? 394  TYR A OH  1 
ATOM   3113  N  N   . TYR A  1 395 ? 55.235  -4.882  -47.741 1.00 52.93  ? 395  TYR A N   1 
ATOM   3114  C  CA  . TYR A  1 395 ? 54.802  -5.009  -46.337 1.00 49.97  ? 395  TYR A CA  1 
ATOM   3115  C  C   . TYR A  1 395 ? 53.528  -4.213  -46.008 1.00 49.24  ? 395  TYR A C   1 
ATOM   3116  O  O   . TYR A  1 395 ? 52.944  -3.585  -46.884 1.00 48.89  ? 395  TYR A O   1 
ATOM   3117  C  CB  . TYR A  1 395 ? 55.932  -4.726  -45.338 1.00 48.99  ? 395  TYR A CB  1 
ATOM   3118  C  CG  . TYR A  1 395 ? 56.277  -3.273  -45.101 1.00 49.38  ? 395  TYR A CG  1 
ATOM   3119  C  CD1 . TYR A  1 395 ? 57.480  -2.743  -45.555 1.00 50.06  ? 395  TYR A CD1 1 
ATOM   3120  C  CD2 . TYR A  1 395 ? 55.424  -2.441  -44.393 1.00 48.26  ? 395  TYR A CD2 1 
ATOM   3121  C  CE1 . TYR A  1 395 ? 57.816  -1.419  -45.323 1.00 48.82  ? 395  TYR A CE1 1 
ATOM   3122  C  CE2 . TYR A  1 395 ? 55.748  -1.116  -44.159 1.00 48.12  ? 395  TYR A CE2 1 
ATOM   3123  C  CZ  . TYR A  1 395 ? 56.947  -0.610  -44.625 1.00 47.86  ? 395  TYR A CZ  1 
ATOM   3124  O  OH  . TYR A  1 395 ? 57.276  0.708   -44.394 1.00 45.34  ? 395  TYR A OH  1 
ATOM   3125  N  N   . PHE A  1 396 ? 53.088  -4.248  -44.752 1.00 48.56  ? 396  PHE A N   1 
ATOM   3126  C  CA  . PHE A  1 396 ? 51.788  -3.664  -44.410 1.00 47.89  ? 396  PHE A CA  1 
ATOM   3127  C  C   . PHE A  1 396 ? 51.877  -2.298  -43.727 1.00 47.80  ? 396  PHE A C   1 
ATOM   3128  O  O   . PHE A  1 396 ? 52.215  -2.202  -42.543 1.00 45.03  ? 396  PHE A O   1 
ATOM   3129  C  CB  . PHE A  1 396 ? 50.987  -4.628  -43.526 1.00 47.23  ? 396  PHE A CB  1 
ATOM   3130  C  CG  . PHE A  1 396 ? 49.595  -4.152  -43.212 1.00 49.29  ? 396  PHE A CG  1 
ATOM   3131  C  CD1 . PHE A  1 396 ? 48.527  -4.514  -44.008 1.00 51.35  ? 396  PHE A CD1 1 
ATOM   3132  C  CD2 . PHE A  1 396 ? 49.353  -3.346  -42.122 1.00 47.73  ? 396  PHE A CD2 1 
ATOM   3133  C  CE1 . PHE A  1 396 ? 47.240  -4.078  -43.719 1.00 49.14  ? 396  PHE A CE1 1 
ATOM   3134  C  CE2 . PHE A  1 396 ? 48.068  -2.910  -41.833 1.00 47.63  ? 396  PHE A CE2 1 
ATOM   3135  C  CZ  . PHE A  1 396 ? 47.014  -3.279  -42.635 1.00 47.13  ? 396  PHE A CZ  1 
ATOM   3136  N  N   . LYS A  1 397 ? 51.499  -1.256  -44.463 1.00 43.98  ? 397  LYS A N   1 
ATOM   3137  C  CA  . LYS A  1 397 ? 51.607  0.104   -43.967 1.00 43.02  ? 397  LYS A CA  1 
ATOM   3138  C  C   . LYS A  1 397 ? 50.223  0.659   -43.672 1.00 45.26  ? 397  LYS A C   1 
ATOM   3139  O  O   . LYS A  1 397 ? 49.465  1.005   -44.579 1.00 48.30  ? 397  LYS A O   1 
ATOM   3140  C  CB  . LYS A  1 397 ? 52.312  0.973   -45.005 1.00 44.87  ? 397  LYS A CB  1 
ATOM   3141  C  CG  . LYS A  1 397 ? 52.416  2.445   -44.645 1.00 48.05  ? 397  LYS A CG  1 
ATOM   3142  C  CD  . LYS A  1 397 ? 53.342  2.699   -43.452 1.00 50.27  ? 397  LYS A CD  1 
ATOM   3143  C  CE  . LYS A  1 397 ? 53.650  4.194   -43.319 1.00 53.55  ? 397  LYS A CE  1 
ATOM   3144  N  NZ  . LYS A  1 397 ? 54.382  4.561   -42.074 1.00 52.85  ? 397  LYS A NZ  1 
ATOM   3145  N  N   . TYR A  1 398 ? 49.930  0.793   -42.387 1.00 40.91  ? 398  TYR A N   1 
ATOM   3146  C  CA  . TYR A  1 398 ? 48.612  1.180   -41.915 1.00 41.59  ? 398  TYR A CA  1 
ATOM   3147  C  C   . TYR A  1 398 ? 48.157  2.514   -42.506 1.00 42.71  ? 398  TYR A C   1 
ATOM   3148  O  O   . TYR A  1 398 ? 47.020  2.639   -42.970 1.00 41.52  ? 398  TYR A O   1 
ATOM   3149  C  CB  . TYR A  1 398 ? 48.621  1.246   -40.385 1.00 39.81  ? 398  TYR A CB  1 
ATOM   3150  C  CG  . TYR A  1 398 ? 47.275  1.553   -39.766 1.00 40.27  ? 398  TYR A CG  1 
ATOM   3151  C  CD1 . TYR A  1 398 ? 46.285  0.583   -39.707 1.00 37.99  ? 398  TYR A CD1 1 
ATOM   3152  C  CD2 . TYR A  1 398 ? 47.001  2.805   -39.223 1.00 38.22  ? 398  TYR A CD2 1 
ATOM   3153  C  CE1 . TYR A  1 398 ? 45.063  0.849   -39.137 1.00 38.09  ? 398  TYR A CE1 1 
ATOM   3154  C  CE2 . TYR A  1 398 ? 45.777  3.081   -38.654 1.00 37.02  ? 398  TYR A CE2 1 
ATOM   3155  C  CZ  . TYR A  1 398 ? 44.811  2.096   -38.611 1.00 37.81  ? 398  TYR A CZ  1 
ATOM   3156  O  OH  . TYR A  1 398 ? 43.582  2.347   -38.046 1.00 36.82  ? 398  TYR A OH  1 
ATOM   3157  N  N   . GLU A  1 399 ? 49.045  3.507   -42.486 1.00 41.28  ? 399  GLU A N   1 
ATOM   3158  C  CA  . GLU A  1 399 ? 48.699  4.855   -42.934 1.00 40.11  ? 399  GLU A CA  1 
ATOM   3159  C  C   . GLU A  1 399 ? 48.258  4.890   -44.397 1.00 38.15  ? 399  GLU A C   1 
ATOM   3160  O  O   . GLU A  1 399 ? 47.412  5.705   -44.779 1.00 35.05  ? 399  GLU A O   1 
ATOM   3161  C  CB  . GLU A  1 399 ? 49.866  5.833   -42.726 1.00 38.28  ? 399  GLU A CB  1 
ATOM   3162  C  CG  . GLU A  1 399 ? 50.202  6.156   -41.287 1.00 37.91  ? 399  GLU A CG  1 
ATOM   3163  C  CD  . GLU A  1 399 ? 51.211  5.196   -40.689 1.00 42.26  ? 399  GLU A CD  1 
ATOM   3164  O  OE1 . GLU A  1 399 ? 51.321  4.050   -41.178 1.00 43.52  ? 399  GLU A OE1 1 
ATOM   3165  O  OE2 . GLU A  1 399 ? 51.905  5.592   -39.729 1.00 44.39  ? 399  GLU A OE2 1 
ATOM   3166  N  N   . MET A  1 400 ? 48.838  4.019   -45.218 1.00 39.86  ? 400  MET A N   1 
ATOM   3167  C  CA  . MET A  1 400 ? 48.504  4.004   -46.637 1.00 40.47  ? 400  MET A CA  1 
ATOM   3168  C  C   . MET A  1 400 ? 47.105  3.440   -46.873 1.00 40.01  ? 400  MET A C   1 
ATOM   3169  O  O   . MET A  1 400 ? 46.340  3.984   -47.673 1.00 39.95  ? 400  MET A O   1 
ATOM   3170  C  CB  . MET A  1 400 ? 49.547  3.235   -47.449 1.00 42.84  ? 400  MET A CB  1 
ATOM   3171  C  CG  . MET A  1 400 ? 50.929  3.876   -47.481 1.00 41.24  ? 400  MET A CG  1 
ATOM   3172  S  SD  . MET A  1 400 ? 52.124  2.841   -48.351 1.00 53.32  ? 400  MET A SD  1 
ATOM   3173  C  CE  . MET A  1 400 ? 53.633  3.789   -48.177 1.00 27.10  ? 400  MET A CE  1 
ATOM   3174  N  N   . GLN A  1 401 ? 46.762  2.358   -46.183 1.00 38.23  ? 401  GLN A N   1 
ATOM   3175  C  CA  . GLN A  1 401 ? 45.413  1.824   -46.311 1.00 40.76  ? 401  GLN A CA  1 
ATOM   3176  C  C   . GLN A  1 401 ? 44.419  2.852   -45.771 1.00 42.41  ? 401  GLN A C   1 
ATOM   3177  O  O   . GLN A  1 401 ? 43.394  3.141   -46.386 1.00 46.21  ? 401  GLN A O   1 
ATOM   3178  C  CB  . GLN A  1 401 ? 45.280  0.498   -45.562 1.00 36.32  ? 401  GLN A CB  1 
ATOM   3179  C  CG  . GLN A  1 401 ? 46.240  -0.575  -46.046 1.00 39.12  ? 401  GLN A CG  1 
ATOM   3180  C  CD  . GLN A  1 401 ? 46.015  -0.962  -47.504 1.00 43.03  ? 401  GLN A CD  1 
ATOM   3181  O  OE1 . GLN A  1 401 ? 44.887  -1.240  -47.921 1.00 42.83  ? 401  GLN A OE1 1 
ATOM   3182  N  NE2 . GLN A  1 401 ? 47.091  -0.979  -48.284 1.00 42.90  ? 401  GLN A NE2 1 
ATOM   3183  N  N   . LEU A  1 402 ? 44.745  3.422   -44.619 1.00 42.07  ? 402  LEU A N   1 
ATOM   3184  C  CA  . LEU A  1 402 ? 43.885  4.411   -43.997 1.00 38.63  ? 402  LEU A CA  1 
ATOM   3185  C  C   . LEU A  1 402 ? 43.620  5.595   -44.927 1.00 35.80  ? 402  LEU A C   1 
ATOM   3186  O  O   . LEU A  1 402 ? 42.470  5.938   -45.188 1.00 34.75  ? 402  LEU A O   1 
ATOM   3187  C  CB  . LEU A  1 402 ? 44.480  4.881   -42.669 1.00 35.81  ? 402  LEU A CB  1 
ATOM   3188  C  CG  . LEU A  1 402 ? 43.663  5.932   -41.914 1.00 35.27  ? 402  LEU A CG  1 
ATOM   3189  C  CD1 . LEU A  1 402 ? 42.213  5.487   -41.709 1.00 30.89  ? 402  LEU A CD1 1 
ATOM   3190  C  CD2 . LEU A  1 402 ? 44.341  6.228   -40.584 1.00 40.13  ? 402  LEU A CD2 1 
ATOM   3191  N  N   . MET A  1 403 ? 44.669  6.221   -45.439 1.00 34.64  ? 403  MET A N   1 
ATOM   3192  C  CA  . MET A  1 403 ? 44.441  7.380   -46.294 1.00 39.79  ? 403  MET A CA  1 
ATOM   3193  C  C   . MET A  1 403 ? 43.754  7.015   -47.628 1.00 46.18  ? 403  MET A C   1 
ATOM   3194  O  O   . MET A  1 403 ? 43.061  7.848   -48.211 1.00 49.85  ? 403  MET A O   1 
ATOM   3195  C  CB  . MET A  1 403 ? 45.724  8.194   -46.508 1.00 36.80  ? 403  MET A CB  1 
ATOM   3196  C  CG  . MET A  1 403 ? 46.342  8.719   -45.223 1.00 35.41  ? 403  MET A CG  1 
ATOM   3197  S  SD  . MET A  1 403 ? 45.131  9.420   -44.069 1.00 41.20  ? 403  MET A SD  1 
ATOM   3198  C  CE  . MET A  1 403 ? 44.535  10.821  -45.010 1.00 57.79  ? 403  MET A CE  1 
ATOM   3199  N  N   . ALA A  1 404 ? 43.916  5.775   -48.093 1.00 44.85  ? 404  ALA A N   1 
ATOM   3200  C  CA  . ALA A  1 404 ? 43.234  5.337   -49.316 1.00 43.76  ? 404  ALA A CA  1 
ATOM   3201  C  C   . ALA A  1 404 ? 41.721  5.243   -49.107 1.00 44.62  ? 404  ALA A C   1 
ATOM   3202  O  O   . ALA A  1 404 ? 40.936  5.707   -49.940 1.00 43.24  ? 404  ALA A O   1 
ATOM   3203  C  CB  . ALA A  1 404 ? 43.792  4.006   -49.823 1.00 40.32  ? 404  ALA A CB  1 
ATOM   3204  N  N   . SER A  1 405 ? 41.320  4.629   -48.000 1.00 44.69  ? 405  SER A N   1 
ATOM   3205  C  CA  . SER A  1 405 ? 39.907  4.463   -47.690 1.00 44.35  ? 405  SER A CA  1 
ATOM   3206  C  C   . SER A  1 405 ? 39.247  5.819   -47.519 1.00 43.28  ? 405  SER A C   1 
ATOM   3207  O  O   . SER A  1 405 ? 38.025  5.940   -47.580 1.00 41.67  ? 405  SER A O   1 
ATOM   3208  C  CB  . SER A  1 405 ? 39.739  3.658   -46.406 1.00 46.16  ? 405  SER A CB  1 
ATOM   3209  O  OG  . SER A  1 405 ? 40.108  4.433   -45.282 1.00 47.97  ? 405  SER A OG  1 
ATOM   3210  N  N   . LYS A  1 406 ? 40.071  6.835   -47.283 1.00 44.59  ? 406  LYS A N   1 
ATOM   3211  C  CA  . LYS A  1 406 ? 39.586  8.203   -47.126 1.00 43.88  ? 406  LYS A CA  1 
ATOM   3212  C  C   . LYS A  1 406 ? 39.625  9.046   -48.411 1.00 40.78  ? 406  LYS A C   1 
ATOM   3213  O  O   . LYS A  1 406 ? 39.336  10.239  -48.383 1.00 39.28  ? 406  LYS A O   1 
ATOM   3214  C  CB  . LYS A  1 406 ? 40.284  8.903   -45.960 1.00 44.96  ? 406  LYS A CB  1 
ATOM   3215  C  CG  . LYS A  1 406 ? 39.970  8.262   -44.615 1.00 49.02  ? 406  LYS A CG  1 
ATOM   3216  C  CD  . LYS A  1 406 ? 40.631  9.016   -43.476 1.00 54.07  ? 406  LYS A CD  1 
ATOM   3217  C  CE  . LYS A  1 406 ? 39.826  10.243  -43.094 1.00 57.79  ? 406  LYS A CE  1 
ATOM   3218  N  NZ  . LYS A  1 406 ? 38.451  9.846   -42.690 1.00 61.99  ? 406  LYS A NZ  1 
ATOM   3219  N  N   . GLY A  1 407 ? 39.985  8.430   -49.532 1.00 39.35  ? 407  GLY A N   1 
ATOM   3220  C  CA  . GLY A  1 407 ? 39.924  9.128   -50.805 1.00 39.11  ? 407  GLY A CA  1 
ATOM   3221  C  C   . GLY A  1 407 ? 41.225  9.711   -51.318 1.00 38.82  ? 407  GLY A C   1 
ATOM   3222  O  O   . GLY A  1 407 ? 41.207  10.630  -52.136 1.00 38.81  ? 407  GLY A O   1 
ATOM   3223  N  N   . TYR A  1 408 ? 42.351  9.215   -50.811 1.00 37.48  ? 408  TYR A N   1 
ATOM   3224  C  CA  . TYR A  1 408 ? 43.655  9.708   -51.230 1.00 38.99  ? 408  TYR A CA  1 
ATOM   3225  C  C   . TYR A  1 408 ? 44.380  8.753   -52.166 1.00 43.63  ? 408  TYR A C   1 
ATOM   3226  O  O   . TYR A  1 408 ? 44.420  7.544   -51.933 1.00 47.97  ? 408  TYR A O   1 
ATOM   3227  C  CB  . TYR A  1 408 ? 44.545  9.973   -50.016 1.00 38.60  ? 408  TYR A CB  1 
ATOM   3228  C  CG  . TYR A  1 408 ? 44.085  11.133  -49.176 1.00 38.67  ? 408  TYR A CG  1 
ATOM   3229  C  CD1 . TYR A  1 408 ? 42.970  11.020  -48.358 1.00 37.78  ? 408  TYR A CD1 1 
ATOM   3230  C  CD2 . TYR A  1 408 ? 44.763  12.344  -49.200 1.00 37.49  ? 408  TYR A CD2 1 
ATOM   3231  C  CE1 . TYR A  1 408 ? 42.539  12.079  -47.595 1.00 38.48  ? 408  TYR A CE1 1 
ATOM   3232  C  CE2 . TYR A  1 408 ? 44.341  13.410  -48.431 1.00 37.25  ? 408  TYR A CE2 1 
ATOM   3233  C  CZ  . TYR A  1 408 ? 43.229  13.273  -47.632 1.00 37.84  ? 408  TYR A CZ  1 
ATOM   3234  O  OH  . TYR A  1 408 ? 42.799  14.332  -46.868 1.00 39.33  ? 408  TYR A OH  1 
ATOM   3235  N  N   . TYR A  1 409 ? 44.950  9.308   -53.229 1.00 40.37  ? 409  TYR A N   1 
ATOM   3236  C  CA  . TYR A  1 409 ? 45.980  8.614   -53.972 1.00 42.99  ? 409  TYR A CA  1 
ATOM   3237  C  C   . TYR A  1 409 ? 47.188  8.455   -53.060 1.00 43.99  ? 409  TYR A C   1 
ATOM   3238  O  O   . TYR A  1 409 ? 47.618  9.413   -52.419 1.00 46.38  ? 409  TYR A O   1 
ATOM   3239  C  CB  . TYR A  1 409 ? 46.394  9.424   -55.203 1.00 46.13  ? 409  TYR A CB  1 
ATOM   3240  C  CG  . TYR A  1 409 ? 45.643  9.071   -56.468 1.00 47.72  ? 409  TYR A CG  1 
ATOM   3241  C  CD1 . TYR A  1 409 ? 44.690  9.931   -56.997 1.00 48.21  ? 409  TYR A CD1 1 
ATOM   3242  C  CD2 . TYR A  1 409 ? 45.887  7.875   -57.131 1.00 47.98  ? 409  TYR A CD2 1 
ATOM   3243  C  CE1 . TYR A  1 409 ? 44.004  9.611   -58.148 1.00 50.76  ? 409  TYR A CE1 1 
ATOM   3244  C  CE2 . TYR A  1 409 ? 45.208  7.550   -58.280 1.00 49.81  ? 409  TYR A CE2 1 
ATOM   3245  C  CZ  . TYR A  1 409 ? 44.268  8.420   -58.787 1.00 52.88  ? 409  TYR A CZ  1 
ATOM   3246  O  OH  . TYR A  1 409 ? 43.585  8.096   -59.937 1.00 55.91  ? 409  TYR A OH  1 
ATOM   3247  N  N   . ILE A  1 410 ? 47.732  7.245   -53.000 1.00 42.46  ? 410  ILE A N   1 
ATOM   3248  C  CA  . ILE A  1 410 ? 48.966  6.984   -52.270 1.00 38.74  ? 410  ILE A CA  1 
ATOM   3249  C  C   . ILE A  1 410 ? 50.071  6.655   -53.276 1.00 43.15  ? 410  ILE A C   1 
ATOM   3250  O  O   . ILE A  1 410 ? 49.905  5.759   -54.110 1.00 43.60  ? 410  ILE A O   1 
ATOM   3251  C  CB  . ILE A  1 410 ? 48.819  5.766   -51.333 1.00 34.19  ? 410  ILE A CB  1 
ATOM   3252  C  CG1 . ILE A  1 410 ? 47.636  5.930   -50.375 1.00 35.68  ? 410  ILE A CG1 1 
ATOM   3253  C  CG2 . ILE A  1 410 ? 50.121  5.496   -50.597 1.00 32.35  ? 410  ILE A CG2 1 
ATOM   3254  C  CD1 . ILE A  1 410 ? 47.732  7.111   -49.451 1.00 38.65  ? 410  ILE A CD1 1 
ATOM   3255  N  N   . VAL A  1 411 ? 51.197  7.361   -53.201 1.00 42.10  ? 411  VAL A N   1 
ATOM   3256  C  CA  . VAL A  1 411 ? 52.322  7.052   -54.081 1.00 42.56  ? 411  VAL A CA  1 
ATOM   3257  C  C   . VAL A  1 411 ? 53.645  7.017   -53.324 1.00 44.91  ? 411  VAL A C   1 
ATOM   3258  O  O   . VAL A  1 411 ? 53.914  7.880   -52.481 1.00 47.39  ? 411  VAL A O   1 
ATOM   3259  C  CB  . VAL A  1 411 ? 52.425  8.041   -55.264 1.00 42.83  ? 411  VAL A CB  1 
ATOM   3260  C  CG1 . VAL A  1 411 ? 52.768  9.431   -54.773 1.00 43.93  ? 411  VAL A CG1 1 
ATOM   3261  C  CG2 . VAL A  1 411 ? 53.467  7.562   -56.264 1.00 41.66  ? 411  VAL A CG2 1 
ATOM   3262  N  N   . TYR A  1 412 ? 54.452  5.999   -53.619 1.00 43.26  ? 412  TYR A N   1 
ATOM   3263  C  CA  . TYR A  1 412 ? 55.773  5.836   -53.016 1.00 41.91  ? 412  TYR A CA  1 
ATOM   3264  C  C   . TYR A  1 412 ? 56.734  5.064   -53.935 1.00 48.13  ? 412  TYR A C   1 
ATOM   3265  O  O   . TYR A  1 412 ? 56.304  4.218   -54.723 1.00 51.90  ? 412  TYR A O   1 
ATOM   3266  C  CB  . TYR A  1 412 ? 55.648  5.120   -51.678 1.00 37.00  ? 412  TYR A CB  1 
ATOM   3267  C  CG  . TYR A  1 412 ? 54.910  3.810   -51.764 1.00 35.90  ? 412  TYR A CG  1 
ATOM   3268  C  CD1 . TYR A  1 412 ? 53.524  3.770   -51.774 1.00 34.91  ? 412  TYR A CD1 1 
ATOM   3269  C  CD2 . TYR A  1 412 ? 55.598  2.608   -51.830 1.00 38.98  ? 412  TYR A CD2 1 
ATOM   3270  C  CE1 . TYR A  1 412 ? 52.840  2.564   -51.849 1.00 35.74  ? 412  TYR A CE1 1 
ATOM   3271  C  CE2 . TYR A  1 412 ? 54.924  1.398   -51.905 1.00 39.56  ? 412  TYR A CE2 1 
ATOM   3272  C  CZ  . TYR A  1 412 ? 53.546  1.381   -51.915 1.00 36.90  ? 412  TYR A CZ  1 
ATOM   3273  O  OH  . TYR A  1 412 ? 52.880  0.178   -51.994 1.00 36.19  ? 412  TYR A OH  1 
ATOM   3274  N  N   . VAL A  1 413 ? 58.032  5.338   -53.821 1.00 47.40  ? 413  VAL A N   1 
ATOM   3275  C  CA  . VAL A  1 413 ? 59.024  4.690   -54.677 1.00 46.50  ? 413  VAL A CA  1 
ATOM   3276  C  C   . VAL A  1 413 ? 60.298  4.327   -53.925 1.00 44.89  ? 413  VAL A C   1 
ATOM   3277  O  O   . VAL A  1 413 ? 60.432  4.610   -52.739 1.00 48.24  ? 413  VAL A O   1 
ATOM   3278  C  CB  . VAL A  1 413 ? 59.427  5.603   -55.845 1.00 47.74  ? 413  VAL A CB  1 
ATOM   3279  C  CG1 . VAL A  1 413 ? 58.195  6.110   -56.561 1.00 48.62  ? 413  VAL A CG1 1 
ATOM   3280  C  CG2 . VAL A  1 413 ? 60.262  6.766   -55.339 1.00 47.64  ? 413  VAL A CG2 1 
ATOM   3281  N  N   . ASN A  1 414 ? 61.248  3.734   -54.639 1.00 42.27  ? 414  ASN A N   1 
ATOM   3282  C  CA  . ASN A  1 414 ? 62.546  3.398   -54.068 1.00 45.06  ? 414  ASN A CA  1 
ATOM   3283  C  C   . ASN A  1 414 ? 63.665  4.121   -54.804 1.00 46.98  ? 414  ASN A C   1 
ATOM   3284  O  O   . ASN A  1 414 ? 64.236  3.605   -55.766 1.00 47.24  ? 414  ASN A O   1 
ATOM   3285  C  CB  . ASN A  1 414 ? 62.785  1.891   -54.093 1.00 47.14  ? 414  ASN A CB  1 
ATOM   3286  C  CG  . ASN A  1 414 ? 61.976  1.165   -53.057 1.00 51.40  ? 414  ASN A CG  1 
ATOM   3287  O  OD1 . ASN A  1 414 ? 61.834  1.634   -51.929 1.00 54.51  ? 414  ASN A OD1 1 
ATOM   3288  N  ND2 . ASN A  1 414 ? 61.436  0.011   -53.428 1.00 52.69  ? 414  ASN A ND2 1 
ATOM   3289  N  N   . PRO A  1 415 ? 63.972  5.340   -54.351 1.00 46.95  ? 415  PRO A N   1 
ATOM   3290  C  CA  . PRO A  1 415 ? 65.006  6.143   -54.997 1.00 45.92  ? 415  PRO A CA  1 
ATOM   3291  C  C   . PRO A  1 415 ? 66.344  5.467   -54.779 1.00 45.43  ? 415  PRO A C   1 
ATOM   3292  O  O   . PRO A  1 415 ? 66.450  4.600   -53.911 1.00 44.55  ? 415  PRO A O   1 
ATOM   3293  C  CB  . PRO A  1 415 ? 64.942  7.463   -54.229 1.00 44.31  ? 415  PRO A CB  1 
ATOM   3294  C  CG  . PRO A  1 415 ? 64.476  7.077   -52.883 1.00 43.22  ? 415  PRO A CG  1 
ATOM   3295  C  CD  . PRO A  1 415 ? 63.542  5.916   -53.065 1.00 44.33  ? 415  PRO A CD  1 
ATOM   3296  N  N   . ARG A  1 416 ? 67.344  5.846   -55.563 1.00 45.77  ? 416  ARG A N   1 
ATOM   3297  C  CA  . ARG A  1 416 ? 68.681  5.308   -55.388 1.00 46.86  ? 416  ARG A CA  1 
ATOM   3298  C  C   . ARG A  1 416 ? 69.129  5.470   -53.927 1.00 46.68  ? 416  ARG A C   1 
ATOM   3299  O  O   . ARG A  1 416 ? 68.889  6.505   -53.296 1.00 44.37  ? 416  ARG A O   1 
ATOM   3300  C  CB  . ARG A  1 416 ? 69.647  6.006   -56.336 1.00 45.61  ? 416  ARG A CB  1 
ATOM   3301  C  CG  . ARG A  1 416 ? 69.760  7.487   -56.082 1.00 45.35  ? 416  ARG A CG  1 
ATOM   3302  C  CD  . ARG A  1 416 ? 70.453  8.180   -57.218 1.00 44.23  ? 416  ARG A CD  1 
ATOM   3303  N  NE  . ARG A  1 416 ? 69.585  8.319   -58.381 1.00 44.52  ? 416  ARG A NE  1 
ATOM   3304  C  CZ  . ARG A  1 416 ? 69.984  8.107   -59.632 1.00 44.53  ? 416  ARG A CZ  1 
ATOM   3305  N  NH1 . ARG A  1 416 ? 71.236  7.739   -59.873 1.00 43.82  ? 416  ARG A NH1 1 
ATOM   3306  N  NH2 . ARG A  1 416 ? 69.136  8.258   -60.641 1.00 44.72  ? 416  ARG A NH2 1 
ATOM   3307  N  N   . GLY A  1 417 ? 69.782  4.432   -53.412 1.00 46.63  ? 417  GLY A N   1 
ATOM   3308  C  CA  . GLY A  1 417 ? 70.149  4.324   -52.009 1.00 46.07  ? 417  GLY A CA  1 
ATOM   3309  C  C   . GLY A  1 417 ? 69.308  3.312   -51.245 1.00 48.71  ? 417  GLY A C   1 
ATOM   3310  O  O   . GLY A  1 417 ? 69.743  2.782   -50.219 1.00 50.10  ? 417  GLY A O   1 
ATOM   3311  N  N   . SER A  1 418 ? 68.133  2.990   -51.782 1.00 48.74  ? 418  SER A N   1 
ATOM   3312  C  CA  . SER A  1 418 ? 67.222  2.036   -51.151 1.00 46.70  ? 418  SER A CA  1 
ATOM   3313  C  C   . SER A  1 418 ? 67.809  0.633   -51.124 1.00 47.88  ? 418  SER A C   1 
ATOM   3314  O  O   . SER A  1 418 ? 68.599  0.260   -51.992 1.00 47.25  ? 418  SER A O   1 
ATOM   3315  C  CB  . SER A  1 418 ? 65.879  1.997   -51.889 1.00 46.19  ? 418  SER A CB  1 
ATOM   3316  O  OG  . SER A  1 418 ? 65.216  3.247   -51.858 1.00 45.97  ? 418  SER A OG  1 
ATOM   3317  N  N   . ASN A  1 419 ? 67.412  -0.137  -50.119 1.00 44.99  ? 419  ASN A N   1 
ATOM   3318  C  CA  . ASN A  1 419 ? 67.773  -1.550  -50.008 1.00 46.79  ? 419  ASN A CA  1 
ATOM   3319  C  C   . ASN A  1 419 ? 66.977  -2.402  -50.996 1.00 49.12  ? 419  ASN A C   1 
ATOM   3320  O  O   . ASN A  1 419 ? 65.948  -1.960  -51.513 1.00 47.96  ? 419  ASN A O   1 
ATOM   3321  C  CB  . ASN A  1 419 ? 67.541  -2.043  -48.578 1.00 48.87  ? 419  ASN A CB  1 
ATOM   3322  C  CG  . ASN A  1 419 ? 68.309  -3.305  -48.259 1.00 48.43  ? 419  ASN A CG  1 
ATOM   3323  O  OD1 . ASN A  1 419 ? 69.151  -3.745  -49.037 1.00 52.66  ? 419  ASN A OD1 1 
ATOM   3324  N  ND2 . ASN A  1 419 ? 68.031  -3.888  -47.100 1.00 46.39  ? 419  ASN A ND2 1 
ATOM   3325  N  N   . GLY A  1 420 ? 67.460  -3.610  -51.276 1.00 51.74  ? 420  GLY A N   1 
ATOM   3326  C  CA  . GLY A  1 420 ? 66.724  -4.531  -52.127 1.00 52.04  ? 420  GLY A CA  1 
ATOM   3327  C  C   . GLY A  1 420 ? 67.064  -4.425  -53.597 1.00 51.99  ? 420  GLY A C   1 
ATOM   3328  O  O   . GLY A  1 420 ? 66.255  -4.757  -54.452 1.00 54.15  ? 420  GLY A O   1 
ATOM   3329  N  N   . TYR A  1 421 ? 68.263  -3.933  -53.879 1.00 51.87  ? 421  TYR A N   1 
ATOM   3330  C  CA  . TYR A  1 421 ? 68.781  -3.820  -55.236 1.00 52.39  ? 421  TYR A CA  1 
ATOM   3331  C  C   . TYR A  1 421 ? 70.283  -4.038  -55.188 1.00 52.33  ? 421  TYR A C   1 
ATOM   3332  O  O   . TYR A  1 421 ? 70.808  -4.513  -54.183 1.00 51.94  ? 421  TYR A O   1 
ATOM   3333  C  CB  . TYR A  1 421 ? 68.450  -2.458  -55.848 1.00 52.05  ? 421  TYR A CB  1 
ATOM   3334  C  CG  . TYR A  1 421 ? 66.966  -2.197  -55.936 1.00 55.05  ? 421  TYR A CG  1 
ATOM   3335  C  CD1 . TYR A  1 421 ? 66.319  -1.445  -54.962 1.00 57.74  ? 421  TYR A CD1 1 
ATOM   3336  C  CD2 . TYR A  1 421 ? 66.206  -2.716  -56.979 1.00 54.14  ? 421  TYR A CD2 1 
ATOM   3337  C  CE1 . TYR A  1 421 ? 64.959  -1.206  -55.033 1.00 57.94  ? 421  TYR A CE1 1 
ATOM   3338  C  CE2 . TYR A  1 421 ? 64.847  -2.485  -57.055 1.00 54.97  ? 421  TYR A CE2 1 
ATOM   3339  C  CZ  . TYR A  1 421 ? 64.230  -1.728  -56.080 1.00 57.24  ? 421  TYR A CZ  1 
ATOM   3340  O  OH  . TYR A  1 421 ? 62.879  -1.489  -56.139 1.00 59.02  ? 421  TYR A OH  1 
ATOM   3341  N  N   . SER A  1 422 ? 70.964  -3.734  -56.287 1.00 51.97  ? 422  SER A N   1 
ATOM   3342  C  CA  . SER A  1 422 ? 72.419  -3.811  -56.327 1.00 53.14  ? 422  SER A CA  1 
ATOM   3343  C  C   . SER A  1 422 ? 73.089  -2.957  -55.246 1.00 53.14  ? 422  SER A C   1 
ATOM   3344  O  O   . SER A  1 422 ? 72.687  -1.823  -54.990 1.00 53.29  ? 422  SER A O   1 
ATOM   3345  C  CB  . SER A  1 422 ? 72.933  -3.392  -57.707 1.00 55.61  ? 422  SER A CB  1 
ATOM   3346  O  OG  . SER A  1 422 ? 72.432  -2.122  -58.098 1.00 56.12  ? 422  SER A OG  1 
ATOM   3347  N  N   . GLU A  1 423 ? 74.128  -3.504  -54.627 1.00 53.62  ? 423  GLU A N   1 
ATOM   3348  C  CA  . GLU A  1 423 ? 74.892  -2.757  -53.640 1.00 54.02  ? 423  GLU A CA  1 
ATOM   3349  C  C   . GLU A  1 423 ? 75.250  -1.375  -54.178 1.00 54.87  ? 423  GLU A C   1 
ATOM   3350  O  O   . GLU A  1 423 ? 75.168  -0.389  -53.446 1.00 55.21  ? 423  GLU A O   1 
ATOM   3351  C  CB  . GLU A  1 423 ? 76.161  -3.517  -53.245 1.00 54.07  ? 423  GLU A CB  1 
ATOM   3352  C  CG  . GLU A  1 423 ? 77.073  -2.744  -52.310 1.00 55.21  ? 423  GLU A CG  1 
ATOM   3353  C  CD  . GLU A  1 423 ? 78.277  -3.553  -51.861 1.00 57.06  ? 423  GLU A CD  1 
ATOM   3354  O  OE1 . GLU A  1 423 ? 79.396  -3.266  -52.340 1.00 58.71  ? 423  GLU A OE1 1 
ATOM   3355  O  OE2 . GLU A  1 423 ? 78.103  -4.470  -51.028 1.00 54.94  ? 423  GLU A OE2 1 
ATOM   3356  N  N   . ASP A  1 424 ? 75.632  -1.302  -55.454 1.00 54.16  ? 424  ASP A N   1 
ATOM   3357  C  CA  . ASP A  1 424 ? 75.970  -0.021  -56.076 1.00 53.83  ? 424  ASP A CA  1 
ATOM   3358  C  C   . ASP A  1 424 ? 74.800  0.958   -56.044 1.00 50.18  ? 424  ASP A C   1 
ATOM   3359  O  O   . ASP A  1 424 ? 74.979  2.140   -55.757 1.00 50.79  ? 424  ASP A O   1 
ATOM   3360  C  CB  . ASP A  1 424 ? 76.446  -0.210  -57.518 1.00 59.64  ? 424  ASP A CB  1 
ATOM   3361  C  CG  . ASP A  1 424 ? 77.861  -0.759  -57.605 1.00 64.23  ? 424  ASP A CG  1 
ATOM   3362  O  OD1 . ASP A  1 424 ? 78.669  -0.505  -56.683 1.00 64.82  ? 424  ASP A OD1 1 
ATOM   3363  O  OD2 . ASP A  1 424 ? 78.166  -1.445  -58.607 1.00 65.47  ? 424  ASP A OD2 1 
ATOM   3364  N  N   . PHE A  1 425 ? 73.605  0.460   -56.341 1.00 48.07  ? 425  PHE A N   1 
ATOM   3365  C  CA  . PHE A  1 425 ? 72.392  1.271   -56.288 1.00 49.41  ? 425  PHE A CA  1 
ATOM   3366  C  C   . PHE A  1 425 ? 72.198  1.897   -54.903 1.00 53.02  ? 425  PHE A C   1 
ATOM   3367  O  O   . PHE A  1 425 ? 71.699  3.020   -54.776 1.00 54.24  ? 425  PHE A O   1 
ATOM   3368  C  CB  . PHE A  1 425 ? 71.178  0.415   -56.644 1.00 46.74  ? 425  PHE A CB  1 
ATOM   3369  C  CG  . PHE A  1 425 ? 69.876  1.156   -56.596 1.00 48.14  ? 425  PHE A CG  1 
ATOM   3370  C  CD1 . PHE A  1 425 ? 69.531  2.040   -57.602 1.00 49.26  ? 425  PHE A CD1 1 
ATOM   3371  C  CD2 . PHE A  1 425 ? 68.989  0.957   -55.549 1.00 51.24  ? 425  PHE A CD2 1 
ATOM   3372  C  CE1 . PHE A  1 425 ? 68.325  2.719   -57.565 1.00 51.20  ? 425  PHE A CE1 1 
ATOM   3373  C  CE2 . PHE A  1 425 ? 67.779  1.634   -55.501 1.00 51.19  ? 425  PHE A CE2 1 
ATOM   3374  C  CZ  . PHE A  1 425 ? 67.445  2.515   -56.510 1.00 51.88  ? 425  PHE A CZ  1 
ATOM   3375  N  N   . ALA A  1 426 ? 72.602  1.158   -53.873 1.00 50.89  ? 426  ALA A N   1 
ATOM   3376  C  CA  . ALA A  1 426 ? 72.491  1.621   -52.499 1.00 49.25  ? 426  ALA A CA  1 
ATOM   3377  C  C   . ALA A  1 426 ? 73.542  2.674   -52.158 1.00 49.43  ? 426  ALA A C   1 
ATOM   3378  O  O   . ALA A  1 426 ? 73.256  3.618   -51.420 1.00 52.98  ? 426  ALA A O   1 
ATOM   3379  C  CB  . ALA A  1 426 ? 72.584  0.446   -51.533 1.00 48.47  ? 426  ALA A CB  1 
ATOM   3380  N  N   . LEU A  1 427 ? 74.755  2.508   -52.682 1.00 46.84  ? 427  LEU A N   1 
ATOM   3381  C  CA  . LEU A  1 427 ? 75.867  3.386   -52.322 1.00 44.11  ? 427  LEU A CA  1 
ATOM   3382  C  C   . LEU A  1 427 ? 75.828  4.723   -53.057 1.00 43.55  ? 427  LEU A C   1 
ATOM   3383  O  O   . LEU A  1 427 ? 76.528  5.666   -52.691 1.00 39.40  ? 427  LEU A O   1 
ATOM   3384  C  CB  . LEU A  1 427 ? 77.203  2.690   -52.579 1.00 42.70  ? 427  LEU A CB  1 
ATOM   3385  C  CG  . LEU A  1 427 ? 77.450  1.445   -51.729 1.00 44.73  ? 427  LEU A CG  1 
ATOM   3386  C  CD1 . LEU A  1 427 ? 78.771  0.788   -52.094 1.00 41.47  ? 427  LEU A CD1 1 
ATOM   3387  C  CD2 . LEU A  1 427 ? 77.400  1.790   -50.244 1.00 43.57  ? 427  LEU A CD2 1 
ATOM   3388  N  N   . ARG A  1 428 ? 75.009  4.793   -54.101 1.00 48.44  ? 428  ARG A N   1 
ATOM   3389  C  CA  . ARG A  1 428 ? 74.936  5.980   -54.946 1.00 50.23  ? 428  ARG A CA  1 
ATOM   3390  C  C   . ARG A  1 428 ? 74.459  7.190   -54.164 1.00 50.54  ? 428  ARG A C   1 
ATOM   3391  O  O   . ARG A  1 428 ? 74.634  8.335   -54.600 1.00 48.34  ? 428  ARG A O   1 
ATOM   3392  C  CB  . ARG A  1 428 ? 73.978  5.742   -56.108 1.00 49.62  ? 428  ARG A CB  1 
ATOM   3393  C  CG  . ARG A  1 428 ? 74.579  5.083   -57.308 1.00 49.72  ? 428  ARG A CG  1 
ATOM   3394  C  CD  . ARG A  1 428 ? 73.470  4.759   -58.281 1.00 51.94  ? 428  ARG A CD  1 
ATOM   3395  N  NE  . ARG A  1 428 ? 73.954  4.182   -59.529 1.00 53.16  ? 428  ARG A NE  1 
ATOM   3396  C  CZ  . ARG A  1 428 ? 74.315  4.902   -60.582 1.00 53.93  ? 428  ARG A CZ  1 
ATOM   3397  N  NH1 . ARG A  1 428 ? 74.256  6.224   -60.528 1.00 51.10  ? 428  ARG A NH1 1 
ATOM   3398  N  NH2 . ARG A  1 428 ? 74.735  4.301   -61.687 1.00 58.42  ? 428  ARG A NH2 1 
ATOM   3399  N  N   . VAL A  1 429 ? 73.818  6.919   -53.029 1.00 50.04  ? 429  VAL A N   1 
ATOM   3400  C  CA  . VAL A  1 429 ? 73.240  7.965   -52.202 1.00 48.78  ? 429  VAL A CA  1 
ATOM   3401  C  C   . VAL A  1 429 ? 74.305  8.654   -51.352 1.00 47.62  ? 429  VAL A C   1 
ATOM   3402  O  O   . VAL A  1 429 ? 74.120  9.798   -50.937 1.00 45.68  ? 429  VAL A O   1 
ATOM   3403  C  CB  . VAL A  1 429 ? 72.078  7.422   -51.322 1.00 30.69  ? 429  VAL A CB  1 
ATOM   3404  C  CG1 . VAL A  1 429 ? 72.599  6.596   -50.155 1.00 28.53  ? 429  VAL A CG1 1 
ATOM   3405  C  CG2 . VAL A  1 429 ? 71.195  8.559   -50.818 1.00 29.09  ? 429  VAL A CG2 1 
ATOM   3406  N  N   . LEU A  1 430 ? 75.425  7.970   -51.108 1.00 45.97  ? 430  LEU A N   1 
ATOM   3407  C  CA  . LEU A  1 430 ? 76.438  8.497   -50.187 1.00 47.22  ? 430  LEU A CA  1 
ATOM   3408  C  C   . LEU A  1 430 ? 76.928  9.880   -50.603 1.00 44.51  ? 430  LEU A C   1 
ATOM   3409  O  O   . LEU A  1 430 ? 77.283  10.103  -51.765 1.00 42.37  ? 430  LEU A O   1 
ATOM   3410  C  CB  . LEU A  1 430 ? 77.618  7.533   -50.005 1.00 46.41  ? 430  LEU A CB  1 
ATOM   3411  C  CG  . LEU A  1 430 ? 77.335  6.115   -49.485 1.00 47.37  ? 430  LEU A CG  1 
ATOM   3412  C  CD1 . LEU A  1 430 ? 78.643  5.399   -49.162 1.00 49.41  ? 430  LEU A CD1 1 
ATOM   3413  C  CD2 . LEU A  1 430 ? 76.391  6.092   -48.269 1.00 46.69  ? 430  LEU A CD2 1 
ATOM   3414  N  N   . GLU A  1 431 ? 76.887  10.803  -49.642 1.00 44.90  ? 431  GLU A N   1 
ATOM   3415  C  CA  . GLU A  1 431 ? 77.342  12.185  -49.810 1.00 45.55  ? 431  GLU A CA  1 
ATOM   3416  C  C   . GLU A  1 431 ? 76.488  12.969  -50.799 1.00 48.65  ? 431  GLU A C   1 
ATOM   3417  O  O   . GLU A  1 431 ? 76.670  14.176  -50.985 1.00 44.40  ? 431  GLU A O   1 
ATOM   3418  C  CB  . GLU A  1 431 ? 78.815  12.226  -50.195 1.00 47.37  ? 431  GLU A CB  1 
ATOM   3419  C  CG  . GLU A  1 431 ? 79.717  11.687  -49.108 1.00 49.16  ? 431  GLU A CG  1 
ATOM   3420  C  CD  . GLU A  1 431 ? 81.178  11.746  -49.483 1.00 54.38  ? 431  GLU A CD  1 
ATOM   3421  O  OE1 . GLU A  1 431 ? 81.682  10.742  -50.024 1.00 56.15  ? 431  GLU A OE1 1 
ATOM   3422  O  OE2 . GLU A  1 431 ? 81.819  12.789  -49.237 1.00 51.43  ? 431  GLU A OE2 1 
ATOM   3423  N  N   . ARG A  1 432 ? 75.582  12.243  -51.445 1.00 50.69  ? 432  ARG A N   1 
ATOM   3424  C  CA  . ARG A  1 432 ? 74.625  12.770  -52.416 1.00 56.36  ? 432  ARG A CA  1 
ATOM   3425  C  C   . ARG A  1 432 ? 73.240  13.099  -51.846 1.00 55.69  ? 432  ARG A C   1 
ATOM   3426  O  O   . ARG A  1 432 ? 72.303  13.372  -52.600 1.00 59.47  ? 432  ARG A O   1 
ATOM   3427  C  CB  . ARG A  1 432 ? 74.518  11.845  -53.625 1.00 57.13  ? 432  ARG A CB  1 
ATOM   3428  C  CG  . ARG A  1 432 ? 75.836  11.690  -54.360 1.00 56.98  ? 432  ARG A CG  1 
ATOM   3429  C  CD  . ARG A  1 432 ? 76.432  13.040  -54.714 1.00 55.19  ? 432  ARG A CD  1 
ATOM   3430  N  NE  . ARG A  1 432 ? 75.794  13.625  -55.889 1.00 55.20  ? 432  ARG A NE  1 
ATOM   3431  C  CZ  . ARG A  1 432 ? 76.159  14.778  -56.439 1.00 52.47  ? 432  ARG A CZ  1 
ATOM   3432  N  NH1 . ARG A  1 432 ? 77.162  15.473  -55.914 1.00 49.85  ? 432  ARG A NH1 1 
ATOM   3433  N  NH2 . ARG A  1 432 ? 75.524  15.238  -57.512 1.00 49.70  ? 432  ARG A NH2 1 
ATOM   3434  N  N   . THR A  1 433 ? 73.103  13.025  -50.524 1.00 54.45  ? 433  THR A N   1 
ATOM   3435  C  CA  . THR A  1 433 ? 71.804  13.145  -49.865 1.00 50.90  ? 433  THR A CA  1 
ATOM   3436  C  C   . THR A  1 433 ? 71.021  14.363  -50.334 1.00 49.25  ? 433  THR A C   1 
ATOM   3437  O  O   . THR A  1 433 ? 71.503  15.494  -50.251 1.00 52.37  ? 433  THR A O   1 
ATOM   3438  C  CB  . THR A  1 433 ? 72.016  13.385  -48.356 1.00 48.95  ? 433  THR A CB  1 
ATOM   3439  O  OG1 . THR A  1 433 ? 72.401  12.165  -47.713 1.00 51.39  ? 433  THR A OG1 1 
ATOM   3440  C  CG2 . THR A  1 433 ? 70.755  13.901  -47.726 1.00 45.98  ? 433  THR A CG2 1 
ATOM   3441  N  N   . GLY A  1 434 ? 69.786  14.133  -50.770 1.00 46.35  ? 434  GLY A N   1 
ATOM   3442  C  CA  . GLY A  1 434 ? 68.917  15.217  -51.185 1.00 43.14  ? 434  GLY A CA  1 
ATOM   3443  C  C   . GLY A  1 434 ? 69.078  15.638  -52.634 1.00 43.87  ? 434  GLY A C   1 
ATOM   3444  O  O   . GLY A  1 434 ? 68.355  16.520  -53.109 1.00 45.20  ? 434  GLY A O   1 
ATOM   3445  N  N   . LEU A  1 435 ? 69.998  15.007  -53.358 1.00 43.29  ? 435  LEU A N   1 
ATOM   3446  C  CA  . LEU A  1 435 ? 70.210  15.420  -54.739 1.00 45.75  ? 435  LEU A CA  1 
ATOM   3447  C  C   . LEU A  1 435 ? 69.551  14.494  -55.765 1.00 46.92  ? 435  LEU A C   1 
ATOM   3448  O  O   . LEU A  1 435 ? 68.438  14.768  -56.218 1.00 45.64  ? 435  LEU A O   1 
ATOM   3449  C  CB  . LEU A  1 435 ? 71.709  15.473  -55.016 1.00 43.41  ? 435  LEU A CB  1 
ATOM   3450  C  CG  . LEU A  1 435 ? 72.443  16.341  -54.006 1.00 39.71  ? 435  LEU A CG  1 
ATOM   3451  C  CD1 . LEU A  1 435 ? 73.948  16.166  -54.152 1.00 37.88  ? 435  LEU A CD1 1 
ATOM   3452  C  CD2 . LEU A  1 435 ? 72.008  17.795  -54.177 1.00 36.88  ? 435  LEU A CD2 1 
ATOM   3453  N  N   . GLU A  1 436 ? 70.172  13.353  -56.051 1.00 46.23  ? 436  GLU A N   1 
ATOM   3454  C  CA  . GLU A  1 436 ? 69.632  12.474  -57.080 1.00 44.51  ? 436  GLU A CA  1 
ATOM   3455  C  C   . GLU A  1 436 ? 68.410  11.762  -56.556 1.00 42.95  ? 436  GLU A C   1 
ATOM   3456  O  O   . GLU A  1 436 ? 67.396  11.672  -57.250 1.00 43.02  ? 436  GLU A O   1 
ATOM   3457  C  CB  . GLU A  1 436 ? 70.658  11.449  -57.557 1.00 45.33  ? 436  GLU A CB  1 
ATOM   3458  C  CG  . GLU A  1 436 ? 71.669  11.990  -58.531 1.00 48.81  ? 436  GLU A CG  1 
ATOM   3459  C  CD  . GLU A  1 436 ? 72.793  12.713  -57.836 1.00 53.81  ? 436  GLU A CD  1 
ATOM   3460  O  OE1 . GLU A  1 436 ? 73.326  12.161  -56.848 1.00 55.36  ? 436  GLU A OE1 1 
ATOM   3461  O  OE2 . GLU A  1 436 ? 73.137  13.832  -58.274 1.00 55.52  ? 436  GLU A OE2 1 
ATOM   3462  N  N   . ASP A  1 437 ? 68.513  11.250  -55.333 1.00 40.97  ? 437  ASP A N   1 
ATOM   3463  C  CA  . ASP A  1 437 ? 67.421  10.497  -54.741 1.00 41.90  ? 437  ASP A CA  1 
ATOM   3464  C  C   . ASP A  1 437 ? 66.186  11.375  -54.620 1.00 41.50  ? 437  ASP A C   1 
ATOM   3465  O  O   . ASP A  1 437 ? 65.058  10.898  -54.754 1.00 41.76  ? 437  ASP A O   1 
ATOM   3466  C  CB  . ASP A  1 437 ? 67.823  9.905   -53.389 1.00 44.07  ? 437  ASP A CB  1 
ATOM   3467  C  CG  . ASP A  1 437 ? 68.152  10.965  -52.351 1.00 43.44  ? 437  ASP A CG  1 
ATOM   3468  O  OD1 . ASP A  1 437 ? 68.307  12.154  -52.701 1.00 43.80  ? 437  ASP A OD1 1 
ATOM   3469  O  OD2 . ASP A  1 437 ? 68.270  10.590  -51.172 1.00 43.44  ? 437  ASP A OD2 1 
ATOM   3470  N  N   . PHE A  1 438 ? 66.390  12.665  -54.386 1.00 39.35  ? 438  PHE A N   1 
ATOM   3471  C  CA  . PHE A  1 438 ? 65.255  13.563  -54.409 1.00 37.85  ? 438  PHE A CA  1 
ATOM   3472  C  C   . PHE A  1 438 ? 64.673  13.603  -55.829 1.00 38.96  ? 438  PHE A C   1 
ATOM   3473  O  O   . PHE A  1 438 ? 63.459  13.481  -56.007 1.00 40.80  ? 438  PHE A O   1 
ATOM   3474  C  CB  . PHE A  1 438 ? 65.640  14.951  -53.908 1.00 36.48  ? 438  PHE A CB  1 
ATOM   3475  C  CG  . PHE A  1 438 ? 64.521  15.946  -53.974 1.00 33.87  ? 438  PHE A CG  1 
ATOM   3476  C  CD1 . PHE A  1 438 ? 63.248  15.608  -53.535 1.00 32.13  ? 438  PHE A CD1 1 
ATOM   3477  C  CD2 . PHE A  1 438 ? 64.745  17.224  -54.475 1.00 34.25  ? 438  PHE A CD2 1 
ATOM   3478  C  CE1 . PHE A  1 438 ? 62.217  16.522  -53.598 1.00 34.65  ? 438  PHE A CE1 1 
ATOM   3479  C  CE2 . PHE A  1 438 ? 63.720  18.152  -54.541 1.00 36.22  ? 438  PHE A CE2 1 
ATOM   3480  C  CZ  . PHE A  1 438 ? 62.450  17.802  -54.101 1.00 37.57  ? 438  PHE A CZ  1 
ATOM   3481  N  N   . GLN A  1 439 ? 65.536  13.740  -56.835 1.00 37.52  ? 439  GLN A N   1 
ATOM   3482  C  CA  . GLN A  1 439 ? 65.091  13.731  -58.230 1.00 37.69  ? 439  GLN A CA  1 
ATOM   3483  C  C   . GLN A  1 439 ? 64.322  12.456  -58.577 1.00 34.58  ? 439  GLN A C   1 
ATOM   3484  O  O   . GLN A  1 439 ? 63.296  12.509  -59.270 1.00 28.51  ? 439  GLN A O   1 
ATOM   3485  C  CB  . GLN A  1 439 ? 66.273  13.913  -59.181 1.00 39.52  ? 439  GLN A CB  1 
ATOM   3486  C  CG  . GLN A  1 439 ? 66.907  15.281  -59.084 1.00 43.41  ? 439  GLN A CG  1 
ATOM   3487  C  CD  . GLN A  1 439 ? 65.893  16.387  -59.249 1.00 47.42  ? 439  GLN A CD  1 
ATOM   3488  O  OE1 . GLN A  1 439 ? 65.840  17.318  -58.450 1.00 50.80  ? 439  GLN A OE1 1 
ATOM   3489  N  NE2 . GLN A  1 439 ? 65.073  16.288  -60.288 1.00 48.48  ? 439  GLN A NE2 1 
ATOM   3490  N  N   . ASP A  1 440 ? 64.821  11.319  -58.090 1.00 33.78  ? 440  ASP A N   1 
ATOM   3491  C  CA  . ASP A  1 440 ? 64.149  10.039  -58.267 1.00 36.20  ? 440  ASP A CA  1 
ATOM   3492  C  C   . ASP A  1 440 ? 62.688  10.119  -57.842 1.00 41.37  ? 440  ASP A C   1 
ATOM   3493  O  O   . ASP A  1 440 ? 61.796  9.708   -58.591 1.00 44.50  ? 440  ASP A O   1 
ATOM   3494  C  CB  . ASP A  1 440 ? 64.850  8.953   -57.460 1.00 36.32  ? 440  ASP A CB  1 
ATOM   3495  C  CG  . ASP A  1 440 ? 66.224  8.629   -57.994 1.00 38.70  ? 440  ASP A CG  1 
ATOM   3496  O  OD1 . ASP A  1 440 ? 66.535  9.071   -59.119 1.00 40.56  ? 440  ASP A OD1 1 
ATOM   3497  O  OD2 . ASP A  1 440 ? 66.986  7.926   -57.293 1.00 37.97  ? 440  ASP A OD2 1 
ATOM   3498  N  N   . ILE A  1 441 ? 62.449  10.645  -56.640 1.00 40.46  ? 441  ILE A N   1 
ATOM   3499  C  CA  . ILE A  1 441 ? 61.091  10.804  -56.122 1.00 40.00  ? 441  ILE A CA  1 
ATOM   3500  C  C   . ILE A  1 441 ? 60.246  11.804  -56.940 1.00 41.32  ? 441  ILE A C   1 
ATOM   3501  O  O   . ILE A  1 441 ? 59.050  11.584  -57.135 1.00 41.00  ? 441  ILE A O   1 
ATOM   3502  C  CB  . ILE A  1 441 ? 61.092  11.197  -54.625 1.00 38.38  ? 441  ILE A CB  1 
ATOM   3503  C  CG1 . ILE A  1 441 ? 61.820  10.145  -53.784 1.00 38.18  ? 441  ILE A CG1 1 
ATOM   3504  C  CG2 . ILE A  1 441 ? 59.677  11.361  -54.110 1.00 36.81  ? 441  ILE A CG2 1 
ATOM   3505  C  CD1 . ILE A  1 441 ? 62.268  10.669  -52.431 1.00 35.73  ? 441  ILE A CD1 1 
ATOM   3506  N  N   . LEU A  1 442 ? 60.850  12.893  -57.416 1.00 41.59  ? 442  LEU A N   1 
ATOM   3507  C  CA  . LEU A  1 442 ? 60.125  13.833  -58.282 1.00 41.60  ? 442  LEU A CA  1 
ATOM   3508  C  C   . LEU A  1 442 ? 59.706  13.155  -59.583 1.00 42.24  ? 442  LEU A C   1 
ATOM   3509  O  O   . LEU A  1 442 ? 58.553  13.246  -60.004 1.00 42.95  ? 442  LEU A O   1 
ATOM   3510  C  CB  . LEU A  1 442 ? 60.963  15.077  -58.593 1.00 39.78  ? 442  LEU A CB  1 
ATOM   3511  C  CG  . LEU A  1 442 ? 61.225  16.068  -57.458 1.00 36.53  ? 442  LEU A CG  1 
ATOM   3512  C  CD1 . LEU A  1 442 ? 61.975  17.302  -57.973 1.00 32.64  ? 442  LEU A CD1 1 
ATOM   3513  C  CD2 . LEU A  1 442 ? 59.914  16.460  -56.795 1.00 34.19  ? 442  LEU A CD2 1 
ATOM   3514  N  N   . ASN A  1 443 ? 60.663  12.475  -60.207 1.00 42.83  ? 443  ASN A N   1 
ATOM   3515  C  CA  . ASN A  1 443 ? 60.455  11.789  -61.474 1.00 42.15  ? 443  ASN A CA  1 
ATOM   3516  C  C   . ASN A  1 443 ? 59.466  10.644  -61.353 1.00 45.19  ? 443  ASN A C   1 
ATOM   3517  O  O   . ASN A  1 443 ? 58.676  10.403  -62.270 1.00 48.33  ? 443  ASN A O   1 
ATOM   3518  C  CB  . ASN A  1 443 ? 61.789  11.277  -62.016 1.00 40.82  ? 443  ASN A CB  1 
ATOM   3519  C  CG  . ASN A  1 443 ? 62.667  12.396  -62.534 1.00 40.93  ? 443  ASN A CG  1 
ATOM   3520  O  OD1 . ASN A  1 443 ? 62.167  13.396  -63.053 1.00 40.27  ? 443  ASN A OD1 1 
ATOM   3521  N  ND2 . ASN A  1 443 ? 63.981  12.240  -62.394 1.00 40.36  ? 443  ASN A ND2 1 
ATOM   3522  N  N   . GLY A  1 444 ? 59.519  9.937   -60.226 1.00 43.18  ? 444  GLY A N   1 
ATOM   3523  C  CA  . GLY A  1 444 ? 58.549  8.897   -59.931 1.00 41.04  ? 444  GLY A CA  1 
ATOM   3524  C  C   . GLY A  1 444 ? 57.143  9.459   -59.855 1.00 39.71  ? 444  GLY A C   1 
ATOM   3525  O  O   . GLY A  1 444 ? 56.197  8.841   -60.348 1.00 39.17  ? 444  GLY A O   1 
ATOM   3526  N  N   . ILE A  1 445 ? 57.014  10.639  -59.245 1.00 39.55  ? 445  ILE A N   1 
ATOM   3527  C  CA  . ILE A  1 445 ? 55.722  11.300  -59.074 1.00 41.45  ? 445  ILE A CA  1 
ATOM   3528  C  C   . ILE A  1 445 ? 55.197  11.776  -60.412 1.00 44.96  ? 445  ILE A C   1 
ATOM   3529  O  O   . ILE A  1 445 ? 53.995  11.736  -60.677 1.00 44.88  ? 445  ILE A O   1 
ATOM   3530  C  CB  . ILE A  1 445 ? 55.827  12.536  -58.153 1.00 39.75  ? 445  ILE A CB  1 
ATOM   3531  C  CG1 . ILE A  1 445 ? 56.214  12.130  -56.734 1.00 37.80  ? 445  ILE A CG1 1 
ATOM   3532  C  CG2 . ILE A  1 445 ? 54.507  13.313  -58.126 1.00 37.50  ? 445  ILE A CG2 1 
ATOM   3533  C  CD1 . ILE A  1 445 ? 56.533  13.308  -55.859 1.00 35.99  ? 445  ILE A CD1 1 
ATOM   3534  N  N   . GLU A  1 446 ? 56.111  12.241  -61.252 1.00 47.57  ? 446  GLU A N   1 
ATOM   3535  C  CA  . GLU A  1 446 ? 55.727  12.721  -62.564 1.00 49.87  ? 446  GLU A CA  1 
ATOM   3536  C  C   . GLU A  1 446 ? 55.113  11.583  -63.360 1.00 44.71  ? 446  GLU A C   1 
ATOM   3537  O  O   . GLU A  1 446 ? 54.035  11.721  -63.936 1.00 42.19  ? 446  GLU A O   1 
ATOM   3538  C  CB  . GLU A  1 446 ? 56.937  13.282  -63.304 1.00 57.67  ? 446  GLU A CB  1 
ATOM   3539  C  CG  . GLU A  1 446 ? 56.580  13.986  -64.597 1.00 66.90  ? 446  GLU A CG  1 
ATOM   3540  C  CD  . GLU A  1 446 ? 55.928  15.337  -64.369 1.00 75.85  ? 446  GLU A CD  1 
ATOM   3541  O  OE1 . GLU A  1 446 ? 56.194  16.258  -65.171 1.00 81.21  ? 446  GLU A OE1 1 
ATOM   3542  O  OE2 . GLU A  1 446 ? 55.155  15.485  -63.396 1.00 77.07  ? 446  GLU A OE2 1 
ATOM   3543  N  N   . GLU A  1 447 ? 55.803  10.450  -63.376 1.00 43.79  ? 447  GLU A N   1 
ATOM   3544  C  CA  . GLU A  1 447 ? 55.326  9.308   -64.126 1.00 46.79  ? 447  GLU A CA  1 
ATOM   3545  C  C   . GLU A  1 447 ? 53.970  8.887   -63.587 1.00 50.55  ? 447  GLU A C   1 
ATOM   3546  O  O   . GLU A  1 447 ? 53.079  8.485   -64.354 1.00 54.10  ? 447  GLU A O   1 
ATOM   3547  C  CB  . GLU A  1 447 ? 56.311  8.147   -64.037 1.00 47.11  ? 447  GLU A CB  1 
ATOM   3548  C  CG  . GLU A  1 447 ? 55.796  6.856   -64.666 1.00 48.82  ? 447  GLU A CG  1 
ATOM   3549  C  CD  . GLU A  1 447 ? 55.538  6.979   -66.166 1.00 48.82  ? 447  GLU A CD  1 
ATOM   3550  O  OE1 . GLU A  1 447 ? 55.289  5.931   -66.807 1.00 48.48  ? 447  GLU A OE1 1 
ATOM   3551  O  OE2 . GLU A  1 447 ? 55.588  8.112   -66.698 1.00 46.15  ? 447  GLU A OE2 1 
ATOM   3552  N  N   . PHE A  1 448 ? 53.812  8.988   -62.269 1.00 45.17  ? 448  PHE A N   1 
ATOM   3553  C  CA  . PHE A  1 448 ? 52.566  8.596   -61.643 1.00 41.75  ? 448  PHE A CA  1 
ATOM   3554  C  C   . PHE A  1 448 ? 51.409  9.467   -62.110 1.00 42.50  ? 448  PHE A C   1 
ATOM   3555  O  O   . PHE A  1 448 ? 50.317  8.969   -62.357 1.00 42.98  ? 448  PHE A O   1 
ATOM   3556  C  CB  . PHE A  1 448 ? 52.674  8.661   -60.125 1.00 42.35  ? 448  PHE A CB  1 
ATOM   3557  C  CG  . PHE A  1 448 ? 51.352  8.838   -59.448 1.00 40.30  ? 448  PHE A CG  1 
ATOM   3558  C  CD1 . PHE A  1 448 ? 50.505  7.760   -59.273 1.00 40.14  ? 448  PHE A CD1 1 
ATOM   3559  C  CD2 . PHE A  1 448 ? 50.940  10.092  -59.025 1.00 39.05  ? 448  PHE A CD2 1 
ATOM   3560  C  CE1 . PHE A  1 448 ? 49.278  7.925   -58.671 1.00 42.14  ? 448  PHE A CE1 1 
ATOM   3561  C  CE2 . PHE A  1 448 ? 49.717  10.267  -58.424 1.00 40.77  ? 448  PHE A CE2 1 
ATOM   3562  C  CZ  . PHE A  1 448 ? 48.881  9.183   -58.244 1.00 42.76  ? 448  PHE A CZ  1 
ATOM   3563  N  N   . LEU A  1 449 ? 51.649  10.768  -62.229 1.00 44.29  ? 449  LEU A N   1 
ATOM   3564  C  CA  . LEU A  1 449 ? 50.606  11.703  -62.645 1.00 49.03  ? 449  LEU A CA  1 
ATOM   3565  C  C   . LEU A  1 449 ? 50.169  11.469  -64.099 1.00 52.38  ? 449  LEU A C   1 
ATOM   3566  O  O   . LEU A  1 449 ? 49.002  11.663  -64.459 1.00 52.77  ? 449  LEU A O   1 
ATOM   3567  C  CB  . LEU A  1 449 ? 51.084  13.145  -62.459 1.00 51.12  ? 449  LEU A CB  1 
ATOM   3568  C  CG  . LEU A  1 449 ? 51.432  13.570  -61.029 1.00 52.04  ? 449  LEU A CG  1 
ATOM   3569  C  CD1 . LEU A  1 449 ? 51.913  15.014  -60.987 1.00 51.80  ? 449  LEU A CD1 1 
ATOM   3570  C  CD2 . LEU A  1 449 ? 50.237  13.381  -60.111 1.00 51.85  ? 449  LEU A CD2 1 
ATOM   3571  N  N   . ARG A  1 450 ? 51.113  11.052  -64.935 1.00 51.71  ? 450  ARG A N   1 
ATOM   3572  C  CA  . ARG A  1 450 ? 50.812  10.753  -66.325 1.00 52.33  ? 450  ARG A CA  1 
ATOM   3573  C  C   . ARG A  1 450 ? 49.971  9.476   -66.393 1.00 52.88  ? 450  ARG A C   1 
ATOM   3574  O  O   . ARG A  1 450 ? 49.072  9.350   -67.235 1.00 53.49  ? 450  ARG A O   1 
ATOM   3575  C  CB  . ARG A  1 450 ? 52.118  10.588  -67.105 1.00 51.38  ? 450  ARG A CB  1 
ATOM   3576  C  CG  . ARG A  1 450 ? 51.985  10.505  -68.613 1.00 49.41  ? 450  ARG A CG  1 
ATOM   3577  C  CD  . ARG A  1 450 ? 53.281  9.980   -69.211 1.00 49.68  ? 450  ARG A CD  1 
ATOM   3578  N  NE  . ARG A  1 450 ? 53.560  8.634   -68.728 1.00 50.65  ? 450  ARG A NE  1 
ATOM   3579  C  CZ  . ARG A  1 450 ? 52.993  7.540   -69.225 1.00 51.56  ? 450  ARG A CZ  1 
ATOM   3580  N  NH1 . ARG A  1 450 ? 52.126  7.638   -70.229 1.00 52.08  ? 450  ARG A NH1 1 
ATOM   3581  N  NH2 . ARG A  1 450 ? 53.291  6.351   -68.721 1.00 50.14  ? 450  ARG A NH2 1 
ATOM   3582  N  N   . LEU A  1 451 ? 50.262  8.541   -65.492 1.00 50.09  ? 451  LEU A N   1 
ATOM   3583  C  CA  . LEU A  1 451 ? 49.545  7.271   -65.424 1.00 49.32  ? 451  LEU A CA  1 
ATOM   3584  C  C   . LEU A  1 451 ? 48.123  7.419   -64.873 1.00 48.65  ? 451  LEU A C   1 
ATOM   3585  O  O   . LEU A  1 451 ? 47.258  6.579   -65.113 1.00 47.37  ? 451  LEU A O   1 
ATOM   3586  C  CB  . LEU A  1 451 ? 50.329  6.276   -64.564 1.00 48.64  ? 451  LEU A CB  1 
ATOM   3587  C  CG  . LEU A  1 451 ? 51.634  5.711   -65.133 1.00 47.77  ? 451  LEU A CG  1 
ATOM   3588  C  CD1 . LEU A  1 451 ? 52.364  4.874   -64.086 1.00 46.58  ? 451  LEU A CD1 1 
ATOM   3589  C  CD2 . LEU A  1 451 ? 51.365  4.891   -66.394 1.00 46.80  ? 451  LEU A CD2 1 
ATOM   3590  N  N   . GLU A  1 452 ? 47.888  8.492   -64.129 1.00 49.21  ? 452  GLU A N   1 
ATOM   3591  C  CA  . GLU A  1 452 ? 46.614  8.688   -63.455 1.00 48.19  ? 452  GLU A CA  1 
ATOM   3592  C  C   . GLU A  1 452 ? 46.148  10.135  -63.573 1.00 47.47  ? 452  GLU A C   1 
ATOM   3593  O  O   . GLU A  1 452 ? 46.379  10.941  -62.679 1.00 47.39  ? 452  GLU A O   1 
ATOM   3594  C  CB  . GLU A  1 452 ? 46.743  8.291   -61.985 1.00 49.07  ? 452  GLU A CB  1 
ATOM   3595  C  CG  . GLU A  1 452 ? 46.981  6.810   -61.755 1.00 50.56  ? 452  GLU A CG  1 
ATOM   3596  C  CD  . GLU A  1 452 ? 45.712  6.010   -61.902 1.00 53.51  ? 452  GLU A CD  1 
ATOM   3597  O  OE1 . GLU A  1 452 ? 45.775  4.765   -61.828 1.00 54.57  ? 452  GLU A OE1 1 
ATOM   3598  O  OE2 . GLU A  1 452 ? 44.647  6.638   -62.091 1.00 54.55  ? 452  GLU A OE2 1 
ATOM   3599  N  N   . PRO A  1 453 ? 45.512  10.479  -64.695 1.00 48.62  ? 453  PRO A N   1 
ATOM   3600  C  CA  . PRO A  1 453 ? 44.996  11.841  -64.874 1.00 47.70  ? 453  PRO A CA  1 
ATOM   3601  C  C   . PRO A  1 453 ? 43.961  12.221  -63.819 1.00 45.33  ? 453  PRO A C   1 
ATOM   3602  O  O   . PRO A  1 453 ? 43.619  13.394  -63.702 1.00 45.28  ? 453  PRO A O   1 
ATOM   3603  C  CB  . PRO A  1 453 ? 44.390  11.819  -66.283 1.00 48.08  ? 453  PRO A CB  1 
ATOM   3604  C  CG  . PRO A  1 453 ? 44.255  10.376  -66.635 1.00 49.36  ? 453  PRO A CG  1 
ATOM   3605  C  CD  . PRO A  1 453 ? 45.349  9.663   -65.908 1.00 49.53  ? 453  PRO A CD  1 
ATOM   3606  N  N   . GLN A  1 454 ? 43.450  11.243  -63.080 1.00 46.24  ? 454  GLN A N   1 
ATOM   3607  C  CA  . GLN A  1 454 ? 42.507  11.538  -61.993 1.00 47.59  ? 454  GLN A CA  1 
ATOM   3608  C  C   . GLN A  1 454 ? 43.156  12.009  -60.676 1.00 47.16  ? 454  GLN A C   1 
ATOM   3609  O  O   . GLN A  1 454 ? 42.470  12.544  -59.804 1.00 49.14  ? 454  GLN A O   1 
ATOM   3610  C  CB  . GLN A  1 454 ? 41.593  10.341  -61.721 1.00 46.81  ? 454  GLN A CB  1 
ATOM   3611  C  CG  . GLN A  1 454 ? 40.596  10.041  -62.819 1.00 43.71  ? 454  GLN A CG  1 
ATOM   3612  C  CD  . GLN A  1 454 ? 39.717  8.872   -62.461 1.00 43.25  ? 454  GLN A CD  1 
ATOM   3613  O  OE1 . GLN A  1 454 ? 40.145  7.722   -62.527 1.00 44.86  ? 454  GLN A OE1 1 
ATOM   3614  N  NE2 . GLN A  1 454 ? 38.486  9.158   -62.050 1.00 41.33  ? 454  GLN A NE2 1 
ATOM   3615  N  N   . ALA A  1 455 ? 44.465  11.816  -60.530 1.00 42.70  ? 455  ALA A N   1 
ATOM   3616  C  CA  . ALA A  1 455 ? 45.200  12.453  -59.442 1.00 39.26  ? 455  ALA A CA  1 
ATOM   3617  C  C   . ALA A  1 455 ? 45.197  13.965  -59.665 1.00 43.48  ? 455  ALA A C   1 
ATOM   3618  O  O   . ALA A  1 455 ? 45.472  14.426  -60.770 1.00 47.12  ? 455  ALA A O   1 
ATOM   3619  C  CB  . ALA A  1 455 ? 46.622  11.923  -59.379 1.00 34.57  ? 455  ALA A CB  1 
ATOM   3620  N  N   . ASP A  1 456 ? 44.908  14.744  -58.627 1.00 45.05  ? 456  ASP A N   1 
ATOM   3621  C  CA  . ASP A  1 456 ? 44.835  16.193  -58.800 1.00 45.57  ? 456  ASP A CA  1 
ATOM   3622  C  C   . ASP A  1 456 ? 46.202  16.771  -58.505 1.00 48.59  ? 456  ASP A C   1 
ATOM   3623  O  O   . ASP A  1 456 ? 46.620  16.826  -57.351 1.00 45.72  ? 456  ASP A O   1 
ATOM   3624  C  CB  . ASP A  1 456 ? 43.829  16.791  -57.816 1.00 42.90  ? 456  ASP A CB  1 
ATOM   3625  C  CG  . ASP A  1 456 ? 43.744  18.310  -57.908 1.00 41.94  ? 456  ASP A CG  1 
ATOM   3626  O  OD1 . ASP A  1 456 ? 44.527  18.914  -58.671 1.00 40.80  ? 456  ASP A OD1 1 
ATOM   3627  O  OD2 . ASP A  1 456 ? 42.893  18.904  -57.208 1.00 41.89  ? 456  ASP A OD2 1 
ATOM   3628  N  N   . ARG A  1 457 ? 46.882  17.251  -59.541 1.00 52.82  ? 457  ARG A N   1 
ATOM   3629  C  CA  . ARG A  1 457 ? 48.264  17.668  -59.363 1.00 56.28  ? 457  ARG A CA  1 
ATOM   3630  C  C   . ARG A  1 457 ? 48.312  18.918  -58.498 1.00 53.07  ? 457  ARG A C   1 
ATOM   3631  O  O   . ARG A  1 457 ? 49.355  19.270  -57.952 1.00 51.53  ? 457  ARG A O   1 
ATOM   3632  C  CB  . ARG A  1 457 ? 48.980  17.860  -60.708 1.00 62.26  ? 457  ARG A CB  1 
ATOM   3633  C  CG  . ARG A  1 457 ? 48.551  19.075  -61.511 1.00 68.65  ? 457  ARG A CG  1 
ATOM   3634  C  CD  . ARG A  1 457 ? 48.927  18.928  -62.993 1.00 72.90  ? 457  ARG A CD  1 
ATOM   3635  N  NE  . ARG A  1 457 ? 50.239  18.310  -63.208 1.00 74.53  ? 457  ARG A NE  1 
ATOM   3636  C  CZ  . ARG A  1 457 ? 50.422  17.110  -63.761 1.00 73.21  ? 457  ARG A CZ  1 
ATOM   3637  N  NH1 . ARG A  1 457 ? 49.377  16.393  -64.163 1.00 71.39  ? 457  ARG A NH1 1 
ATOM   3638  N  NH2 . ARG A  1 457 ? 51.650  16.625  -63.914 1.00 70.99  ? 457  ARG A NH2 1 
ATOM   3639  N  N   . GLU A  1 458 ? 47.160  19.563  -58.350 1.00 52.23  ? 458  GLU A N   1 
ATOM   3640  C  CA  . GLU A  1 458 ? 47.050  20.740  -57.494 1.00 55.08  ? 458  GLU A CA  1 
ATOM   3641  C  C   . GLU A  1 458 ? 46.969  20.448  -55.980 1.00 51.50  ? 458  GLU A C   1 
ATOM   3642  O  O   . GLU A  1 458 ? 47.301  21.322  -55.174 1.00 50.74  ? 458  GLU A O   1 
ATOM   3643  C  CB  . GLU A  1 458 ? 45.905  21.657  -57.954 1.00 60.78  ? 458  GLU A CB  1 
ATOM   3644  C  CG  . GLU A  1 458 ? 46.247  22.539  -59.165 1.00 66.18  ? 458  GLU A CG  1 
ATOM   3645  C  CD  . GLU A  1 458 ? 47.527  23.348  -58.962 1.00 71.13  ? 458  GLU A CD  1 
ATOM   3646  O  OE1 . GLU A  1 458 ? 47.507  24.319  -58.166 1.00 70.20  ? 458  GLU A OE1 1 
ATOM   3647  O  OE2 . GLU A  1 458 ? 48.550  23.014  -59.606 1.00 73.25  ? 458  GLU A OE2 1 
ATOM   3648  N  N   . ARG A  1 459 ? 46.501  19.264  -55.579 1.00 46.37  ? 459  ARG A N   1 
ATOM   3649  C  CA  . ARG A  1 459 ? 46.726  18.865  -54.195 1.00 43.40  ? 459  ARG A CA  1 
ATOM   3650  C  C   . ARG A  1 459 ? 47.625  17.632  -54.067 1.00 46.59  ? 459  ARG A C   1 
ATOM   3651  O  O   . ARG A  1 459 ? 47.144  16.493  -54.082 1.00 48.83  ? 459  ARG A O   1 
ATOM   3652  C  CB  . ARG A  1 459 ? 45.377  18.541  -53.546 1.00 41.60  ? 459  ARG A CB  1 
ATOM   3653  C  CG  . ARG A  1 459 ? 44.332  19.645  -53.649 1.00 41.63  ? 459  ARG A CG  1 
ATOM   3654  C  CD  . ARG A  1 459 ? 42.940  19.142  -53.270 1.00 42.20  ? 459  ARG A CD  1 
ATOM   3655  N  NE  . ARG A  1 459 ? 42.288  18.424  -54.363 1.00 47.09  ? 459  ARG A NE  1 
ATOM   3656  C  CZ  . ARG A  1 459 ? 41.236  17.621  -54.211 1.00 52.14  ? 459  ARG A CZ  1 
ATOM   3657  N  NH1 . ARG A  1 459 ? 40.713  17.412  -53.003 1.00 53.85  ? 459  ARG A NH1 1 
ATOM   3658  N  NH2 . ARG A  1 459 ? 40.710  17.014  -55.268 1.00 51.39  ? 459  ARG A NH2 1 
ATOM   3659  N  N   . ILE A  1 460 ? 48.886  17.869  -53.725 1.00 45.39  ? 460  ILE A N   1 
ATOM   3660  C  CA  . ILE A  1 460 ? 49.855  16.796  -53.551 1.00 43.29  ? 460  ILE A CA  1 
ATOM   3661  C  C   . ILE A  1 460 ? 50.643  17.070  -52.282 1.00 43.31  ? 460  ILE A C   1 
ATOM   3662  O  O   . ILE A  1 460 ? 51.349  18.075  -52.183 1.00 43.65  ? 460  ILE A O   1 
ATOM   3663  C  CB  . ILE A  1 460 ? 50.844  16.706  -54.736 1.00 42.05  ? 460  ILE A CB  1 
ATOM   3664  C  CG1 . ILE A  1 460 ? 50.105  16.415  -56.045 1.00 44.40  ? 460  ILE A CG1 1 
ATOM   3665  C  CG2 . ILE A  1 460 ? 51.910  15.643  -54.477 1.00 38.46  ? 460  ILE A CG2 1 
ATOM   3666  C  CD1 . ILE A  1 460 ? 51.016  16.374  -57.281 1.00 44.04  ? 460  ILE A CD1 1 
ATOM   3667  N  N   . GLY A  1 461 ? 50.512  16.178  -51.311 1.00 42.92  ? 461  GLY A N   1 
ATOM   3668  C  CA  . GLY A  1 461 ? 51.278  16.265  -50.087 1.00 43.67  ? 461  GLY A CA  1 
ATOM   3669  C  C   . GLY A  1 461 ? 52.389  15.243  -50.023 1.00 43.51  ? 461  GLY A C   1 
ATOM   3670  O  O   . GLY A  1 461 ? 52.447  14.303  -50.821 1.00 43.07  ? 461  GLY A O   1 
ATOM   3671  N  N   . ILE A  1 462 ? 53.254  15.406  -49.034 1.00 42.10  ? 462  ILE A N   1 
ATOM   3672  C  CA  . ILE A  1 462 ? 54.351  14.484  -48.848 1.00 39.50  ? 462  ILE A CA  1 
ATOM   3673  C  C   . ILE A  1 462 ? 54.585  14.269  -47.361 1.00 40.14  ? 462  ILE A C   1 
ATOM   3674  O  O   . ILE A  1 462 ? 54.405  15.175  -46.550 1.00 40.50  ? 462  ILE A O   1 
ATOM   3675  C  CB  . ILE A  1 462 ? 55.604  14.995  -49.560 1.00 35.77  ? 462  ILE A CB  1 
ATOM   3676  C  CG1 . ILE A  1 462 ? 56.811  14.124  -49.241 1.00 37.81  ? 462  ILE A CG1 1 
ATOM   3677  C  CG2 . ILE A  1 462 ? 55.862  16.439  -49.202 1.00 35.82  ? 462  ILE A CG2 1 
ATOM   3678  C  CD1 . ILE A  1 462 ? 57.923  14.288  -50.267 1.00 41.91  ? 462  ILE A CD1 1 
ATOM   3679  N  N   . THR A  1 463 ? 54.944  13.046  -47.004 1.00 39.85  ? 463  THR A N   1 
ATOM   3680  C  CA  . THR A  1 463 ? 55.167  12.708  -45.615 1.00 37.70  ? 463  THR A CA  1 
ATOM   3681  C  C   . THR A  1 463 ? 56.254  11.658  -45.508 1.00 39.99  ? 463  THR A C   1 
ATOM   3682  O  O   . THR A  1 463 ? 56.478  10.883  -46.441 1.00 41.95  ? 463  THR A O   1 
ATOM   3683  C  CB  . THR A  1 463 ? 53.891  12.159  -44.973 1.00 36.08  ? 463  THR A CB  1 
ATOM   3684  O  OG1 . THR A  1 463 ? 54.146  11.840  -43.600 1.00 40.57  ? 463  THR A OG1 1 
ATOM   3685  C  CG2 . THR A  1 463 ? 53.428  10.915  -45.697 1.00 32.24  ? 463  THR A CG2 1 
ATOM   3686  N  N   . GLY A  1 464 ? 56.939  11.635  -44.373 1.00 34.44  ? 464  GLY A N   1 
ATOM   3687  C  CA  . GLY A  1 464 ? 57.926  10.605  -44.122 1.00 34.64  ? 464  GLY A CA  1 
ATOM   3688  C  C   . GLY A  1 464 ? 58.397  10.625  -42.679 1.00 35.36  ? 464  GLY A C   1 
ATOM   3689  O  O   . GLY A  1 464 ? 58.281  11.641  -41.987 1.00 36.82  ? 464  GLY A O   1 
ATOM   3690  N  N   . ILE A  1 465 ? 58.925  9.493   -42.224 1.00 31.97  ? 465  ILE A N   1 
ATOM   3691  C  CA  . ILE A  1 465 ? 59.543  9.407   -40.917 1.00 30.78  ? 465  ILE A CA  1 
ATOM   3692  C  C   . ILE A  1 465 ? 61.036  9.227   -41.105 1.00 33.56  ? 465  ILE A C   1 
ATOM   3693  O  O   . ILE A  1 465 ? 61.468  8.581   -42.050 1.00 31.61  ? 465  ILE A O   1 
ATOM   3694  C  CB  . ILE A  1 465 ? 59.009  8.199   -40.128 1.00 31.20  ? 465  ILE A CB  1 
ATOM   3695  C  CG1 . ILE A  1 465 ? 57.481  8.230   -40.052 1.00 30.94  ? 465  ILE A CG1 1 
ATOM   3696  C  CG2 . ILE A  1 465 ? 59.622  8.153   -38.723 1.00 29.53  ? 465  ILE A CG2 1 
ATOM   3697  C  CD1 . ILE A  1 465 ? 56.882  6.922   -39.636 1.00 30.36  ? 465  ILE A CD1 1 
ATOM   3698  N  N   . ALA A  1 466 ? 61.828  9.766   -40.184 1.00 38.38  ? 466  ALA A N   1 
ATOM   3699  C  CA  . ALA A  1 466 ? 63.284  9.623   -40.255 1.00 38.96  ? 466  ALA A CA  1 
ATOM   3700  C  C   . ALA A  1 466 ? 63.850  10.260  -41.522 1.00 39.35  ? 466  ALA A C   1 
ATOM   3701  O  O   . ALA A  1 466 ? 63.683  11.459  -41.747 1.00 37.45  ? 466  ALA A O   1 
ATOM   3702  C  CB  . ALA A  1 466 ? 63.691  8.152   -40.158 1.00 36.26  ? 466  ALA A CB  1 
ATOM   3703  N  N   . TYR A  1 467 ? 64.541  9.476   -42.342 1.00 43.20  ? 467  TYR A N   1 
ATOM   3704  C  CA  . TYR A  1 467 ? 65.027  10.015  -43.611 1.00 43.92  ? 467  TYR A CA  1 
ATOM   3705  C  C   . TYR A  1 467 ? 63.851  10.532  -44.443 1.00 42.04  ? 467  TYR A C   1 
ATOM   3706  O  O   . TYR A  1 467 ? 63.982  11.509  -45.184 1.00 40.59  ? 467  TYR A O   1 
ATOM   3707  C  CB  . TYR A  1 467 ? 65.859  8.996   -44.399 1.00 44.40  ? 467  TYR A CB  1 
ATOM   3708  C  CG  . TYR A  1 467 ? 66.613  9.621   -45.564 1.00 46.36  ? 467  TYR A CG  1 
ATOM   3709  C  CD1 . TYR A  1 467 ? 67.723  10.426  -45.342 1.00 50.03  ? 467  TYR A CD1 1 
ATOM   3710  C  CD2 . TYR A  1 467 ? 66.212  9.410   -46.881 1.00 47.52  ? 467  TYR A CD2 1 
ATOM   3711  C  CE1 . TYR A  1 467 ? 68.411  11.003  -46.395 1.00 49.62  ? 467  TYR A CE1 1 
ATOM   3712  C  CE2 . TYR A  1 467 ? 66.893  9.979   -47.940 1.00 45.55  ? 467  TYR A CE2 1 
ATOM   3713  C  CZ  . TYR A  1 467 ? 67.989  10.777  -47.691 1.00 49.24  ? 467  TYR A CZ  1 
ATOM   3714  O  OH  . TYR A  1 467 ? 68.675  11.354  -48.734 1.00 52.90  ? 467  TYR A OH  1 
ATOM   3715  N  N   . GLY A  1 468 ? 62.701  9.879   -44.304 1.00 36.15  ? 468  GLY A N   1 
ATOM   3716  C  CA  . GLY A  1 468 ? 61.488  10.339  -44.954 1.00 36.67  ? 468  GLY A CA  1 
ATOM   3717  C  C   . GLY A  1 468 ? 61.068  11.704  -44.437 1.00 40.13  ? 468  GLY A C   1 
ATOM   3718  O  O   . GLY A  1 468 ? 60.483  12.507  -45.176 1.00 41.26  ? 468  GLY A O   1 
ATOM   3719  N  N   . GLY A  1 469 ? 61.353  11.967  -43.163 1.00 35.20  ? 469  GLY A N   1 
ATOM   3720  C  CA  . GLY A  1 469 ? 61.076  13.270  -42.581 1.00 35.15  ? 469  GLY A CA  1 
ATOM   3721  C  C   . GLY A  1 469 ? 62.047  14.314  -43.103 1.00 35.34  ? 469  GLY A C   1 
ATOM   3722  O  O   . GLY A  1 469 ? 61.672  15.433  -43.472 1.00 31.70  ? 469  GLY A O   1 
ATOM   3723  N  N   . TYR A  1 470 ? 63.315  13.934  -43.138 1.00 34.07  ? 470  TYR A N   1 
ATOM   3724  C  CA  . TYR A  1 470 ? 64.311  14.734  -43.816 1.00 37.98  ? 470  TYR A CA  1 
ATOM   3725  C  C   . TYR A  1 470 ? 63.839  15.105  -45.215 1.00 37.46  ? 470  TYR A C   1 
ATOM   3726  O  O   . TYR A  1 470 ? 63.878  16.275  -45.606 1.00 38.77  ? 470  TYR A O   1 
ATOM   3727  C  CB  . TYR A  1 470 ? 65.611  13.954  -43.947 1.00 37.09  ? 470  TYR A CB  1 
ATOM   3728  C  CG  . TYR A  1 470 ? 66.534  14.571  -44.958 1.00 37.32  ? 470  TYR A CG  1 
ATOM   3729  C  CD1 . TYR A  1 470 ? 67.217  15.751  -44.671 1.00 35.29  ? 470  TYR A CD1 1 
ATOM   3730  C  CD2 . TYR A  1 470 ? 66.709  13.995  -46.206 1.00 38.26  ? 470  TYR A CD2 1 
ATOM   3731  C  CE1 . TYR A  1 470 ? 68.060  16.330  -45.589 1.00 34.28  ? 470  TYR A CE1 1 
ATOM   3732  C  CE2 . TYR A  1 470 ? 67.555  14.572  -47.144 1.00 38.98  ? 470  TYR A CE2 1 
ATOM   3733  C  CZ  . TYR A  1 470 ? 68.225  15.740  -46.823 1.00 36.13  ? 470  TYR A CZ  1 
ATOM   3734  O  OH  . TYR A  1 470 ? 69.058  16.324  -47.739 1.00 35.57  ? 470  TYR A OH  1 
ATOM   3735  N  N   . MET A  1 471 ? 63.399  14.102  -45.970 1.00 34.94  ? 471  MET A N   1 
ATOM   3736  C  CA  . MET A  1 471 ? 63.046  14.321  -47.363 1.00 36.09  ? 471  MET A CA  1 
ATOM   3737  C  C   . MET A  1 471 ? 61.816  15.199  -47.500 1.00 37.80  ? 471  MET A C   1 
ATOM   3738  O  O   . MET A  1 471 ? 61.668  15.922  -48.478 1.00 41.09  ? 471  MET A O   1 
ATOM   3739  C  CB  . MET A  1 471 ? 62.817  13.002  -48.089 1.00 38.43  ? 471  MET A CB  1 
ATOM   3740  C  CG  . MET A  1 471 ? 62.654  13.191  -49.577 1.00 38.39  ? 471  MET A CG  1 
ATOM   3741  S  SD  . MET A  1 471 ? 64.143  13.925  -50.279 1.00 49.78  ? 471  MET A SD  1 
ATOM   3742  C  CE  . MET A  1 471 ? 65.141  12.458  -50.571 1.00 8.51   ? 471  MET A CE  1 
ATOM   3743  N  N   . THR A  1 472 ? 60.928  15.125  -46.520 1.00 38.50  ? 472  THR A N   1 
ATOM   3744  C  CA  . THR A  1 472 ? 59.754  15.977  -46.515 1.00 38.07  ? 472  THR A CA  1 
ATOM   3745  C  C   . THR A  1 472 ? 60.166  17.428  -46.310 1.00 40.04  ? 472  THR A C   1 
ATOM   3746  O  O   . THR A  1 472 ? 59.696  18.309  -47.030 1.00 40.47  ? 472  THR A O   1 
ATOM   3747  C  CB  . THR A  1 472 ? 58.751  15.554  -45.431 1.00 34.57  ? 472  THR A CB  1 
ATOM   3748  O  OG1 . THR A  1 472 ? 58.175  14.286  -45.780 1.00 36.83  ? 472  THR A OG1 1 
ATOM   3749  C  CG2 . THR A  1 472 ? 57.646  16.582  -45.310 1.00 29.29  ? 472  THR A CG2 1 
ATOM   3750  N  N   . ASN A  1 473 ? 61.041  17.673  -45.330 1.00 39.74  ? 473  ASN A N   1 
ATOM   3751  C  CA  . ASN A  1 473 ? 61.570  19.015  -45.093 1.00 41.73  ? 473  ASN A CA  1 
ATOM   3752  C  C   . ASN A  1 473 ? 62.255  19.533  -46.356 1.00 42.56  ? 473  ASN A C   1 
ATOM   3753  O  O   . ASN A  1 473 ? 61.970  20.640  -46.838 1.00 40.76  ? 473  ASN A O   1 
ATOM   3754  C  CB  . ASN A  1 473 ? 62.595  19.022  -43.957 1.00 42.78  ? 473  ASN A CB  1 
ATOM   3755  C  CG  . ASN A  1 473 ? 62.035  18.517  -42.642 1.00 44.94  ? 473  ASN A CG  1 
ATOM   3756  O  OD1 . ASN A  1 473 ? 62.780  18.059  -41.774 1.00 45.43  ? 473  ASN A OD1 1 
ATOM   3757  N  ND2 . ASN A  1 473 ? 60.725  18.597  -42.487 1.00 43.18  ? 473  ASN A ND2 1 
ATOM   3758  N  N   . TRP A  1 474 ? 63.172  18.719  -46.877 1.00 42.93  ? 474  TRP A N   1 
ATOM   3759  C  CA  . TRP A  1 474 ? 63.908  19.053  -48.084 1.00 39.38  ? 474  TRP A CA  1 
ATOM   3760  C  C   . TRP A  1 474 ? 62.919  19.402  -49.170 1.00 38.57  ? 474  TRP A C   1 
ATOM   3761  O  O   . TRP A  1 474 ? 63.039  20.438  -49.816 1.00 38.70  ? 474  TRP A O   1 
ATOM   3762  C  CB  . TRP A  1 474 ? 64.771  17.872  -48.515 1.00 39.50  ? 474  TRP A CB  1 
ATOM   3763  C  CG  . TRP A  1 474 ? 65.756  18.167  -49.614 1.00 42.02  ? 474  TRP A CG  1 
ATOM   3764  C  CD1 . TRP A  1 474 ? 65.753  17.649  -50.878 1.00 43.36  ? 474  TRP A CD1 1 
ATOM   3765  C  CD2 . TRP A  1 474 ? 66.905  19.022  -49.537 1.00 44.36  ? 474  TRP A CD2 1 
ATOM   3766  N  NE1 . TRP A  1 474 ? 66.822  18.133  -51.594 1.00 43.69  ? 474  TRP A NE1 1 
ATOM   3767  C  CE2 . TRP A  1 474 ? 67.545  18.977  -50.794 1.00 42.86  ? 474  TRP A CE2 1 
ATOM   3768  C  CE3 . TRP A  1 474 ? 67.453  19.824  -48.530 1.00 41.08  ? 474  TRP A CE3 1 
ATOM   3769  C  CZ2 . TRP A  1 474 ? 68.701  19.703  -51.069 1.00 43.57  ? 474  TRP A CZ2 1 
ATOM   3770  C  CZ3 . TRP A  1 474 ? 68.605  20.548  -48.807 1.00 39.18  ? 474  TRP A CZ3 1 
ATOM   3771  C  CH2 . TRP A  1 474 ? 69.215  20.479  -50.062 1.00 40.93  ? 474  TRP A CH2 1 
ATOM   3772  N  N   . ALA A  1 475 ? 61.923  18.538  -49.339 1.00 40.01  ? 475  ALA A N   1 
ATOM   3773  C  CA  . ALA A  1 475 ? 60.933  18.685  -50.398 1.00 41.44  ? 475  ALA A CA  1 
ATOM   3774  C  C   . ALA A  1 475 ? 60.253  20.053  -50.388 1.00 44.60  ? 475  ALA A C   1 
ATOM   3775  O  O   . ALA A  1 475 ? 60.150  20.695  -51.433 1.00 48.47  ? 475  ALA A O   1 
ATOM   3776  C  CB  . ALA A  1 475 ? 59.902  17.571  -50.322 1.00 40.24  ? 475  ALA A CB  1 
ATOM   3777  N  N   . LEU A  1 476 ? 59.807  20.501  -49.213 1.00 44.32  ? 476  LEU A N   1 
ATOM   3778  C  CA  . LEU A  1 476 ? 59.123  21.795  -49.087 1.00 42.53  ? 476  LEU A CA  1 
ATOM   3779  C  C   . LEU A  1 476 ? 60.055  22.995  -49.256 1.00 43.31  ? 476  LEU A C   1 
ATOM   3780  O  O   . LEU A  1 476 ? 59.595  24.099  -49.537 1.00 41.47  ? 476  LEU A O   1 
ATOM   3781  C  CB  . LEU A  1 476 ? 58.403  21.910  -47.743 1.00 39.66  ? 476  LEU A CB  1 
ATOM   3782  C  CG  . LEU A  1 476 ? 57.395  20.824  -47.388 1.00 37.66  ? 476  LEU A CG  1 
ATOM   3783  C  CD1 . LEU A  1 476 ? 56.561  21.288  -46.217 1.00 39.23  ? 476  LEU A CD1 1 
ATOM   3784  C  CD2 . LEU A  1 476 ? 56.504  20.508  -48.570 1.00 36.72  ? 476  LEU A CD2 1 
ATOM   3785  N  N   . THR A  1 477 ? 61.346  22.797  -48.998 1.00 44.23  ? 477  THR A N   1 
ATOM   3786  C  CA  . THR A  1 477 ? 62.341  23.844  -49.217 1.00 44.72  ? 477  THR A CA  1 
ATOM   3787  C  C   . THR A  1 477 ? 62.827  23.934  -50.663 1.00 49.92  ? 477  THR A C   1 
ATOM   3788  O  O   . THR A  1 477 ? 63.209  25.010  -51.125 1.00 53.33  ? 477  THR A O   1 
ATOM   3789  C  CB  . THR A  1 477 ? 63.537  23.739  -48.241 1.00 43.81  ? 477  THR A CB  1 
ATOM   3790  O  OG1 . THR A  1 477 ? 64.433  22.702  -48.659 1.00 43.29  ? 477  THR A OG1 1 
ATOM   3791  C  CG2 . THR A  1 477 ? 63.046  23.452  -46.832 1.00 44.50  ? 477  THR A CG2 1 
ATOM   3792  N  N   . GLN A  1 478 ? 62.881  22.789  -51.345 1.00 50.05  ? 478  GLN A N   1 
ATOM   3793  C  CA  . GLN A  1 478 ? 63.386  22.716  -52.721 1.00 46.15  ? 478  GLN A CA  1 
ATOM   3794  C  C   . GLN A  1 478 ? 62.337  22.696  -53.840 1.00 41.87  ? 478  GLN A C   1 
ATOM   3795  O  O   . GLN A  1 478 ? 62.691  22.603  -55.008 1.00 38.91  ? 478  GLN A O   1 
ATOM   3796  C  CB  . GLN A  1 478 ? 64.308  21.502  -52.883 1.00 48.28  ? 478  GLN A CB  1 
ATOM   3797  C  CG  . GLN A  1 478 ? 65.463  21.455  -51.902 1.00 49.47  ? 478  GLN A CG  1 
ATOM   3798  C  CD  . GLN A  1 478 ? 66.381  22.645  -52.043 1.00 54.78  ? 478  GLN A CD  1 
ATOM   3799  O  OE1 . GLN A  1 478 ? 66.809  22.996  -53.149 1.00 58.52  ? 478  GLN A OE1 1 
ATOM   3800  N  NE2 . GLN A  1 478 ? 66.694  23.280  -50.921 1.00 54.13  ? 478  GLN A NE2 1 
ATOM   3801  N  N   . SER A  1 479 ? 61.054  22.716  -53.501 1.00 44.91  ? 479  SER A N   1 
ATOM   3802  C  CA  . SER A  1 479 ? 60.034  22.489  -54.529 1.00 46.87  ? 479  SER A CA  1 
ATOM   3803  C  C   . SER A  1 479 ? 58.698  23.192  -54.271 1.00 50.02  ? 479  SER A C   1 
ATOM   3804  O  O   . SER A  1 479 ? 58.229  23.254  -53.135 1.00 52.97  ? 479  SER A O   1 
ATOM   3805  C  CB  . SER A  1 479 ? 59.823  20.981  -54.717 1.00 45.81  ? 479  SER A CB  1 
ATOM   3806  O  OG  . SER A  1 479 ? 58.739  20.711  -55.584 1.00 46.54  ? 479  SER A OG  1 
ATOM   3807  N  N   . ASP A  1 480 ? 58.079  23.693  -55.336 1.00 49.11  ? 480  ASP A N   1 
ATOM   3808  C  CA  . ASP A  1 480 ? 56.792  24.377  -55.230 1.00 49.01  ? 480  ASP A CA  1 
ATOM   3809  C  C   . ASP A  1 480 ? 55.635  23.412  -55.502 1.00 49.15  ? 480  ASP A C   1 
ATOM   3810  O  O   . ASP A  1 480 ? 54.469  23.808  -55.523 1.00 51.76  ? 480  ASP A O   1 
ATOM   3811  C  CB  . ASP A  1 480 ? 56.735  25.584  -56.175 1.00 48.93  ? 480  ASP A CB  1 
ATOM   3812  N  N   . LEU A  1 481 ? 55.966  22.143  -55.707 1.00 45.86  ? 481  LEU A N   1 
ATOM   3813  C  CA  . LEU A  1 481 ? 54.974  21.146  -56.089 1.00 44.90  ? 481  LEU A CA  1 
ATOM   3814  C  C   . LEU A  1 481 ? 53.964  20.774  -54.991 1.00 47.27  ? 481  LEU A C   1 
ATOM   3815  O  O   . LEU A  1 481 ? 52.817  20.448  -55.294 1.00 47.13  ? 481  LEU A O   1 
ATOM   3816  C  CB  . LEU A  1 481 ? 55.679  19.889  -56.596 1.00 44.55  ? 481  LEU A CB  1 
ATOM   3817  C  CG  . LEU A  1 481 ? 54.776  18.784  -57.139 1.00 45.25  ? 481  LEU A CG  1 
ATOM   3818  C  CD1 . LEU A  1 481 ? 53.979  19.276  -58.338 1.00 44.00  ? 481  LEU A CD1 1 
ATOM   3819  C  CD2 . LEU A  1 481 ? 55.600  17.563  -57.502 1.00 46.27  ? 481  LEU A CD2 1 
ATOM   3820  N  N   . PHE A  1 482 ? 54.379  20.813  -53.726 1.00 48.49  ? 482  PHE A N   1 
ATOM   3821  C  CA  . PHE A  1 482 ? 53.552  20.262  -52.644 1.00 44.66  ? 482  PHE A CA  1 
ATOM   3822  C  C   . PHE A  1 482 ? 52.735  21.299  -51.892 1.00 45.36  ? 482  PHE A C   1 
ATOM   3823  O  O   . PHE A  1 482 ? 53.232  22.374  -51.567 1.00 48.66  ? 482  PHE A O   1 
ATOM   3824  C  CB  . PHE A  1 482 ? 54.415  19.453  -51.675 1.00 39.60  ? 482  PHE A CB  1 
ATOM   3825  C  CG  . PHE A  1 482 ? 55.301  18.475  -52.363 1.00 37.96  ? 482  PHE A CG  1 
ATOM   3826  C  CD1 . PHE A  1 482 ? 56.563  18.848  -52.795 1.00 38.79  ? 482  PHE A CD1 1 
ATOM   3827  C  CD2 . PHE A  1 482 ? 54.861  17.196  -52.626 1.00 39.30  ? 482  PHE A CD2 1 
ATOM   3828  C  CE1 . PHE A  1 482 ? 57.387  17.947  -53.456 1.00 39.14  ? 482  PHE A CE1 1 
ATOM   3829  C  CE2 . PHE A  1 482 ? 55.676  16.291  -53.289 1.00 41.03  ? 482  PHE A CE2 1 
ATOM   3830  C  CZ  . PHE A  1 482 ? 56.944  16.670  -53.704 1.00 40.05  ? 482  PHE A CZ  1 
ATOM   3831  N  N   . LYS A  1 483 ? 51.468  20.983  -51.645 1.00 43.90  ? 483  LYS A N   1 
ATOM   3832  C  CA  . LYS A  1 483 ? 50.609  21.880  -50.883 1.00 44.43  ? 483  LYS A CA  1 
ATOM   3833  C  C   . LYS A  1 483 ? 50.600  21.610  -49.383 1.00 41.31  ? 483  LYS A C   1 
ATOM   3834  O  O   . LYS A  1 483 ? 50.075  22.414  -48.614 1.00 40.96  ? 483  LYS A O   1 
ATOM   3835  C  CB  . LYS A  1 483 ? 49.179  21.818  -51.409 1.00 49.72  ? 483  LYS A CB  1 
ATOM   3836  C  CG  . LYS A  1 483 ? 49.035  22.200  -52.868 1.00 55.20  ? 483  LYS A CG  1 
ATOM   3837  C  CD  . LYS A  1 483 ? 49.409  23.653  -53.120 1.00 56.60  ? 483  LYS A CD  1 
ATOM   3838  C  CE  . LYS A  1 483 ? 49.021  24.062  -54.534 1.00 57.78  ? 483  LYS A CE  1 
ATOM   3839  N  NZ  . LYS A  1 483 ? 49.734  23.236  -55.550 1.00 58.73  ? 483  LYS A NZ  1 
ATOM   3840  N  N   . ALA A  1 484 ? 51.134  20.466  -48.967 1.00 39.51  ? 484  ALA A N   1 
ATOM   3841  C  CA  . ALA A  1 484 ? 51.226  20.168  -47.541 1.00 39.84  ? 484  ALA A CA  1 
ATOM   3842  C  C   . ALA A  1 484 ? 52.257  19.091  -47.271 1.00 40.37  ? 484  ALA A C   1 
ATOM   3843  O  O   . ALA A  1 484 ? 52.566  18.298  -48.163 1.00 42.46  ? 484  ALA A O   1 
ATOM   3844  C  CB  . ALA A  1 484 ? 49.870  19.746  -46.996 1.00 39.58  ? 484  ALA A CB  1 
ATOM   3845  N  N   . GLY A  1 485 ? 52.745  19.021  -46.033 1.00 35.91  ? 485  GLY A N   1 
ATOM   3846  C  CA  . GLY A  1 485 ? 53.626  17.934  -45.648 1.00 32.95  ? 485  GLY A CA  1 
ATOM   3847  C  C   . GLY A  1 485 ? 53.597  17.605  -44.166 1.00 31.92  ? 485  GLY A C   1 
ATOM   3848  O  O   . GLY A  1 485 ? 53.316  18.450  -43.325 1.00 35.17  ? 485  GLY A O   1 
ATOM   3849  N  N   . ILE A  1 486 ? 53.917  16.360  -43.845 1.00 32.07  ? 486  ILE A N   1 
ATOM   3850  C  CA  . ILE A  1 486 ? 54.013  15.921  -42.462 1.00 30.01  ? 486  ILE A CA  1 
ATOM   3851  C  C   . ILE A  1 486 ? 55.358  15.243  -42.256 1.00 34.16  ? 486  ILE A C   1 
ATOM   3852  O  O   . ILE A  1 486 ? 55.628  14.184  -42.833 1.00 34.89  ? 486  ILE A O   1 
ATOM   3853  C  CB  . ILE A  1 486 ? 52.885  14.948  -42.098 1.00 28.00  ? 486  ILE A CB  1 
ATOM   3854  C  CG1 . ILE A  1 486 ? 51.531  15.662  -42.182 1.00 32.15  ? 486  ILE A CG1 1 
ATOM   3855  C  CG2 . ILE A  1 486 ? 53.103  14.397  -40.715 1.00 25.04  ? 486  ILE A CG2 1 
ATOM   3856  C  CD1 . ILE A  1 486 ? 50.337  14.733  -42.049 1.00 32.12  ? 486  ILE A CD1 1 
ATOM   3857  N  N   . SER A  1 487 ? 56.200  15.865  -41.437 1.00 30.97  ? 487  SER A N   1 
ATOM   3858  C  CA  . SER A  1 487 ? 57.552  15.387  -41.231 1.00 32.47  ? 487  SER A CA  1 
ATOM   3859  C  C   . SER A  1 487 ? 57.671  14.785  -39.838 1.00 35.81  ? 487  SER A C   1 
ATOM   3860  O  O   . SER A  1 487 ? 57.162  15.343  -38.871 1.00 37.36  ? 487  SER A O   1 
ATOM   3861  C  CB  . SER A  1 487 ? 58.530  16.536  -41.387 1.00 32.80  ? 487  SER A CB  1 
ATOM   3862  O  OG  . SER A  1 487 ? 59.823  16.138  -40.996 1.00 35.93  ? 487  SER A OG  1 
ATOM   3863  N  N   . GLU A  1 488 ? 58.337  13.642  -39.734 1.00 34.57  ? 488  GLU A N   1 
ATOM   3864  C  CA  . GLU A  1 488 ? 58.373  12.918  -38.473 1.00 33.77  ? 488  GLU A CA  1 
ATOM   3865  C  C   . GLU A  1 488 ? 59.760  12.419  -38.116 1.00 34.53  ? 488  GLU A C   1 
ATOM   3866  O  O   . GLU A  1 488 ? 60.379  11.666  -38.870 1.00 35.50  ? 488  GLU A O   1 
ATOM   3867  C  CB  . GLU A  1 488 ? 57.420  11.729  -38.516 1.00 34.94  ? 488  GLU A CB  1 
ATOM   3868  C  CG  . GLU A  1 488 ? 56.126  12.003  -39.252 1.00 38.88  ? 488  GLU A CG  1 
ATOM   3869  C  CD  . GLU A  1 488 ? 55.027  11.075  -38.804 1.00 41.25  ? 488  GLU A CD  1 
ATOM   3870  O  OE1 . GLU A  1 488 ? 55.040  10.689  -37.613 1.00 38.06  ? 488  GLU A OE1 1 
ATOM   3871  O  OE2 . GLU A  1 488 ? 54.161  10.734  -39.639 1.00 42.91  ? 488  GLU A OE2 1 
ATOM   3872  N  N   . ASN A  1 489 ? 60.238  12.834  -36.951 1.00 34.17  ? 489  ASN A N   1 
ATOM   3873  C  CA  . ASN A  1 489 ? 61.485  12.310  -36.438 1.00 33.66  ? 489  ASN A CA  1 
ATOM   3874  C  C   . ASN A  1 489 ? 62.572  12.405  -37.498 1.00 33.00  ? 489  ASN A C   1 
ATOM   3875  O  O   . ASN A  1 489 ? 63.400  11.505  -37.638 1.00 31.97  ? 489  ASN A O   1 
ATOM   3876  C  CB  . ASN A  1 489 ? 61.275  10.877  -35.957 1.00 37.45  ? 489  ASN A CB  1 
ATOM   3877  C  CG  . ASN A  1 489 ? 60.183  10.780  -34.895 1.00 42.33  ? 489  ASN A CG  1 
ATOM   3878  O  OD1 . ASN A  1 489 ? 58.990  10.919  -35.191 1.00 41.16  ? 489  ASN A OD1 1 
ATOM   3879  N  ND2 . ASN A  1 489 ? 60.591  10.555  -33.648 1.00 43.19  ? 489  ASN A ND2 1 
ATOM   3880  N  N   . GLY A  1 490 ? 62.554  13.514  -38.235 1.00 34.74  ? 490  GLY A N   1 
ATOM   3881  C  CA  . GLY A  1 490 ? 63.437  13.714  -39.370 1.00 38.38  ? 490  GLY A CA  1 
ATOM   3882  C  C   . GLY A  1 490 ? 64.784  14.338  -39.057 1.00 41.32  ? 490  GLY A C   1 
ATOM   3883  O  O   . GLY A  1 490 ? 65.260  14.288  -37.917 1.00 45.08  ? 490  GLY A O   1 
ATOM   3884  N  N   . ILE A  1 491 ? 65.410  14.888  -40.096 1.00 39.13  ? 491  ILE A N   1 
ATOM   3885  C  CA  . ILE A  1 491 ? 66.651  15.641  -39.985 1.00 39.80  ? 491  ILE A CA  1 
ATOM   3886  C  C   . ILE A  1 491 ? 66.460  16.965  -40.708 1.00 41.23  ? 491  ILE A C   1 
ATOM   3887  O  O   . ILE A  1 491 ? 66.175  16.960  -41.902 1.00 43.10  ? 491  ILE A O   1 
ATOM   3888  C  CB  . ILE A  1 491 ? 67.821  14.903  -40.687 1.00 47.88  ? 491  ILE A CB  1 
ATOM   3889  C  CG1 . ILE A  1 491 ? 68.297  13.706  -39.863 1.00 49.23  ? 491  ILE A CG1 1 
ATOM   3890  C  CG2 . ILE A  1 491 ? 68.991  15.851  -40.944 1.00 47.35  ? 491  ILE A CG2 1 
ATOM   3891  C  CD1 . ILE A  1 491 ? 67.430  12.498  -40.011 1.00 50.08  ? 491  ILE A CD1 1 
ATOM   3892  N  N   . SER A  1 492 ? 66.488  18.088  -39.993 1.00 40.83  ? 492  SER A N   1 
ATOM   3893  C  CA  . SER A  1 492 ? 66.674  19.378  -40.653 1.00 42.25  ? 492  SER A CA  1 
ATOM   3894  C  C   . SER A  1 492 ? 68.106  19.923  -40.659 1.00 44.61  ? 492  SER A C   1 
ATOM   3895  O  O   . SER A  1 492 ? 68.399  20.872  -41.381 1.00 46.35  ? 492  SER A O   1 
ATOM   3896  C  CB  . SER A  1 492 ? 65.746  20.417  -40.036 1.00 41.30  ? 492  SER A CB  1 
ATOM   3897  O  OG  . SER A  1 492 ? 66.088  20.624  -38.680 1.00 43.03  ? 492  SER A OG  1 
ATOM   3898  N  N   . TYR A  1 493 ? 68.993  19.356  -39.847 1.00 45.88  ? 493  TYR A N   1 
ATOM   3899  C  CA  . TYR A  1 493 ? 70.391  19.795  -39.857 1.00 46.86  ? 493  TYR A CA  1 
ATOM   3900  C  C   . TYR A  1 493 ? 71.361  18.639  -39.630 1.00 45.01  ? 493  TYR A C   1 
ATOM   3901  O  O   . TYR A  1 493 ? 71.327  17.994  -38.581 1.00 46.21  ? 493  TYR A O   1 
ATOM   3902  C  CB  . TYR A  1 493 ? 70.590  20.870  -38.794 1.00 46.91  ? 493  TYR A CB  1 
ATOM   3903  C  CG  . TYR A  1 493 ? 71.908  21.588  -38.858 1.00 50.64  ? 493  TYR A CG  1 
ATOM   3904  C  CD1 . TYR A  1 493 ? 72.823  21.315  -39.858 1.00 52.11  ? 493  TYR A CD1 1 
ATOM   3905  C  CD2 . TYR A  1 493 ? 72.241  22.542  -37.904 1.00 51.11  ? 493  TYR A CD2 1 
ATOM   3906  C  CE1 . TYR A  1 493 ? 74.040  21.975  -39.913 1.00 52.89  ? 493  TYR A CE1 1 
ATOM   3907  C  CE2 . TYR A  1 493 ? 73.453  23.211  -37.948 1.00 53.10  ? 493  TYR A CE2 1 
ATOM   3908  C  CZ  . TYR A  1 493 ? 74.351  22.923  -38.955 1.00 52.76  ? 493  TYR A CZ  1 
ATOM   3909  O  OH  . TYR A  1 493 ? 75.560  23.584  -39.004 1.00 51.89  ? 493  TYR A OH  1 
ATOM   3910  N  N   . TRP A  1 494 ? 72.297  18.444  -40.547 1.00 42.44  ? 494  TRP A N   1 
ATOM   3911  C  CA  . TRP A  1 494 ? 73.149  17.265  -40.475 1.00 39.69  ? 494  TRP A CA  1 
ATOM   3912  C  C   . TRP A  1 494 ? 74.236  17.357  -39.416 1.00 42.95  ? 494  TRP A C   1 
ATOM   3913  O  O   . TRP A  1 494 ? 74.660  16.331  -38.883 1.00 47.29  ? 494  TRP A O   1 
ATOM   3914  C  CB  . TRP A  1 494 ? 73.787  16.980  -41.832 1.00 37.46  ? 494  TRP A CB  1 
ATOM   3915  C  CG  . TRP A  1 494 ? 72.832  16.405  -42.801 1.00 36.66  ? 494  TRP A CG  1 
ATOM   3916  C  CD1 . TRP A  1 494 ? 72.379  16.981  -43.949 1.00 34.35  ? 494  TRP A CD1 1 
ATOM   3917  C  CD2 . TRP A  1 494 ? 72.182  15.134  -42.702 1.00 34.99  ? 494  TRP A CD2 1 
ATOM   3918  N  NE1 . TRP A  1 494 ? 71.491  16.143  -44.576 1.00 32.56  ? 494  TRP A NE1 1 
ATOM   3919  C  CE2 . TRP A  1 494 ? 71.355  15.001  -43.833 1.00 31.56  ? 494  TRP A CE2 1 
ATOM   3920  C  CE3 . TRP A  1 494 ? 72.223  14.093  -41.767 1.00 34.71  ? 494  TRP A CE3 1 
ATOM   3921  C  CZ2 . TRP A  1 494 ? 70.573  13.875  -44.055 1.00 30.94  ? 494  TRP A CZ2 1 
ATOM   3922  C  CZ3 . TRP A  1 494 ? 71.451  12.975  -41.989 1.00 32.00  ? 494  TRP A CZ3 1 
ATOM   3923  C  CH2 . TRP A  1 494 ? 70.636  12.872  -43.127 1.00 32.58  ? 494  TRP A CH2 1 
ATOM   3924  N  N   . LEU A  1 495 ? 74.699  18.570  -39.117 1.00 38.56  ? 495  LEU A N   1 
ATOM   3925  C  CA  . LEU A  1 495 ? 75.811  18.717  -38.192 1.00 37.87  ? 495  LEU A CA  1 
ATOM   3926  C  C   . LEU A  1 495 ? 75.435  18.223  -36.792 1.00 40.63  ? 495  LEU A C   1 
ATOM   3927  O  O   . LEU A  1 495 ? 76.229  17.540  -36.130 1.00 40.12  ? 495  LEU A O   1 
ATOM   3928  C  CB  . LEU A  1 495 ? 76.311  20.158  -38.134 1.00 35.41  ? 495  LEU A CB  1 
ATOM   3929  C  CG  . LEU A  1 495 ? 77.593  20.271  -37.297 1.00 36.18  ? 495  LEU A CG  1 
ATOM   3930  C  CD1 . LEU A  1 495 ? 78.702  19.403  -37.884 1.00 33.96  ? 495  LEU A CD1 1 
ATOM   3931  C  CD2 . LEU A  1 495 ? 78.066  21.707  -37.160 1.00 37.99  ? 495  LEU A CD2 1 
ATOM   3932  N  N   . THR A  1 496 ? 74.224  18.567  -36.351 1.00 40.68  ? 496  THR A N   1 
ATOM   3933  C  CA  . THR A  1 496 ? 73.747  18.152  -35.043 1.00 37.59  ? 496  THR A CA  1 
ATOM   3934  C  C   . THR A  1 496 ? 73.328  16.698  -35.082 1.00 42.24  ? 496  THR A C   1 
ATOM   3935  O  O   . THR A  1 496 ? 73.373  16.016  -34.056 1.00 47.57  ? 496  THR A O   1 
ATOM   3936  C  CB  . THR A  1 496 ? 72.553  18.982  -34.568 1.00 37.51  ? 496  THR A CB  1 
ATOM   3937  O  OG1 . THR A  1 496 ? 71.383  18.608  -35.307 1.00 39.49  ? 496  THR A OG1 1 
ATOM   3938  C  CG2 . THR A  1 496 ? 72.825  20.458  -34.748 1.00 37.85  ? 496  THR A CG2 1 
ATOM   3939  N  N   . SER A  1 497 ? 72.899  16.217  -36.246 1.00 36.79  ? 497  SER A N   1 
ATOM   3940  C  CA  . SER A  1 497 ? 72.658  14.792  -36.370 1.00 33.21  ? 497  SER A CA  1 
ATOM   3941  C  C   . SER A  1 497 ? 73.965  14.080  -36.056 1.00 36.34  ? 497  SER A C   1 
ATOM   3942  O  O   . SER A  1 497 ? 73.990  13.123  -35.284 1.00 41.98  ? 497  SER A O   1 
ATOM   3943  C  CB  . SER A  1 497 ? 72.198  14.421  -37.766 1.00 31.67  ? 497  SER A CB  1 
ATOM   3944  O  OG  . SER A  1 497 ? 72.475  13.057  -38.012 1.00 31.19  ? 497  SER A OG  1 
ATOM   3945  N  N   . TYR A  1 498 ? 75.056  14.565  -36.642 1.00 34.01  ? 498  TYR A N   1 
ATOM   3946  C  CA  . TYR A  1 498 ? 76.373  14.004  -36.376 1.00 36.29  ? 498  TYR A CA  1 
ATOM   3947  C  C   . TYR A  1 498 ? 76.762  14.084  -34.899 1.00 40.28  ? 498  TYR A C   1 
ATOM   3948  O  O   . TYR A  1 498 ? 77.166  13.090  -34.303 1.00 42.79  ? 498  TYR A O   1 
ATOM   3949  C  CB  . TYR A  1 498 ? 77.428  14.711  -37.227 1.00 36.10  ? 498  TYR A CB  1 
ATOM   3950  C  CG  . TYR A  1 498 ? 78.852  14.566  -36.718 1.00 37.41  ? 498  TYR A CG  1 
ATOM   3951  C  CD1 . TYR A  1 498 ? 79.535  13.357  -36.821 1.00 36.17  ? 498  TYR A CD1 1 
ATOM   3952  C  CD2 . TYR A  1 498 ? 79.517  15.641  -36.152 1.00 38.43  ? 498  TYR A CD2 1 
ATOM   3953  C  CE1 . TYR A  1 498 ? 80.834  13.223  -36.367 1.00 36.53  ? 498  TYR A CE1 1 
ATOM   3954  C  CE2 . TYR A  1 498 ? 80.825  15.516  -35.694 1.00 40.57  ? 498  TYR A CE2 1 
ATOM   3955  C  CZ  . TYR A  1 498 ? 81.480  14.304  -35.806 1.00 37.29  ? 498  TYR A CZ  1 
ATOM   3956  O  OH  . TYR A  1 498 ? 82.778  14.173  -35.352 1.00 32.75  ? 498  TYR A OH  1 
ATOM   3957  N  N   . ALA A  1 499 ? 76.635  15.267  -34.311 1.00 39.85  ? 499  ALA A N   1 
ATOM   3958  C  CA  . ALA A  1 499 ? 77.140  15.505  -32.963 1.00 43.10  ? 499  ALA A CA  1 
ATOM   3959  C  C   . ALA A  1 499 ? 76.257  14.968  -31.826 1.00 41.63  ? 499  ALA A C   1 
ATOM   3960  O  O   . ALA A  1 499 ? 76.760  14.565  -30.778 1.00 39.46  ? 499  ALA A O   1 
ATOM   3961  C  CB  . ALA A  1 499 ? 77.416  16.989  -32.773 1.00 42.77  ? 499  ALA A CB  1 
ATOM   3962  N  N   . PHE A  1 500 ? 74.950  14.958  -32.063 1.00 42.56  ? 500  PHE A N   1 
ATOM   3963  C  CA  . PHE A  1 500 ? 73.917  14.672  -31.064 1.00 40.02  ? 500  PHE A CA  1 
ATOM   3964  C  C   . PHE A  1 500 ? 73.486  13.202  -31.065 1.00 42.22  ? 500  PHE A C   1 
ATOM   3965  O  O   . PHE A  1 500 ? 73.544  12.522  -30.043 1.00 44.75  ? 500  PHE A O   1 
ATOM   3966  C  CB  . PHE A  1 500 ? 72.708  15.583  -31.266 1.00 40.29  ? 500  PHE A CB  1 
ATOM   3967  C  CG  . PHE A  1 500 ? 72.003  15.967  -29.992 1.00 41.29  ? 500  PHE A CG  1 
ATOM   3968  C  CD1 . PHE A  1 500 ? 72.489  15.575  -28.755 1.00 43.74  ? 500  PHE A CD1 1 
ATOM   3969  C  CD2 . PHE A  1 500 ? 70.843  16.724  -30.033 1.00 41.66  ? 500  PHE A CD2 1 
ATOM   3970  C  CE1 . PHE A  1 500 ? 71.828  15.938  -27.580 1.00 42.56  ? 500  PHE A CE1 1 
ATOM   3971  C  CE2 . PHE A  1 500 ? 70.181  17.088  -28.862 1.00 42.64  ? 500  PHE A CE2 1 
ATOM   3972  C  CZ  . PHE A  1 500 ? 70.675  16.694  -27.636 1.00 40.19  ? 500  PHE A CZ  1 
ATOM   3973  N  N   . SER A  1 501 ? 73.002  12.733  -32.210 1.00 41.52  ? 501  SER A N   1 
ATOM   3974  C  CA  . SER A  1 501 ? 72.283  11.461  -32.312 1.00 38.92  ? 501  SER A CA  1 
ATOM   3975  C  C   . SER A  1 501 ? 73.114  10.255  -31.893 1.00 32.11  ? 501  SER A C   1 
ATOM   3976  O  O   . SER A  1 501 ? 74.338  10.319  -31.814 1.00 29.90  ? 501  SER A O   1 
ATOM   3977  C  CB  . SER A  1 501 ? 71.803  11.245  -33.750 1.00 36.94  ? 501  SER A CB  1 
ATOM   3978  O  OG  . SER A  1 501 ? 72.886  10.907  -34.598 1.00 35.11  ? 501  SER A OG  1 
ATOM   3979  N  N   . ASP A  1 502 ? 72.423  9.175   -31.553 1.00 31.49  ? 502  ASP A N   1 
ATOM   3980  C  CA  . ASP A  1 502 ? 73.095  7.956   -31.133 1.00 36.33  ? 502  ASP A CA  1 
ATOM   3981  C  C   . ASP A  1 502 ? 74.164  7.458   -32.128 1.00 36.85  ? 502  ASP A C   1 
ATOM   3982  O  O   . ASP A  1 502 ? 75.300  7.176   -31.735 1.00 32.81  ? 502  ASP A O   1 
ATOM   3983  C  CB  . ASP A  1 502 ? 72.076  6.856   -30.784 1.00 42.22  ? 502  ASP A CB  1 
ATOM   3984  C  CG  . ASP A  1 502 ? 71.159  6.484   -31.952 1.00 46.93  ? 502  ASP A CG  1 
ATOM   3985  O  OD1 . ASP A  1 502 ? 71.144  7.188   -32.986 1.00 46.98  ? 502  ASP A OD1 1 
ATOM   3986  O  OD2 . ASP A  1 502 ? 70.434  5.472   -31.817 1.00 48.79  ? 502  ASP A OD2 1 
ATOM   3987  N  N   . ILE A  1 503 ? 73.808  7.362   -33.410 1.00 36.97  ? 503  ILE A N   1 
ATOM   3988  C  CA  . ILE A  1 503 ? 74.727  6.825   -34.403 1.00 33.97  ? 503  ILE A CA  1 
ATOM   3989  C  C   . ILE A  1 503 ? 75.511  7.891   -35.160 1.00 39.03  ? 503  ILE A C   1 
ATOM   3990  O  O   . ILE A  1 503 ? 76.363  7.566   -35.980 1.00 43.93  ? 503  ILE A O   1 
ATOM   3991  C  CB  . ILE A  1 503 ? 74.008  5.911   -35.408 1.00 33.12  ? 503  ILE A CB  1 
ATOM   3992  C  CG1 . ILE A  1 503 ? 73.039  6.718   -36.276 1.00 32.96  ? 503  ILE A CG1 1 
ATOM   3993  C  CG2 . ILE A  1 503 ? 73.300  4.770   -34.690 1.00 31.52  ? 503  ILE A CG2 1 
ATOM   3994  C  CD1 . ILE A  1 503 ? 72.280  5.881   -37.269 1.00 31.35  ? 503  ILE A CD1 1 
ATOM   3995  N  N   . GLY A  1 504 ? 75.261  9.159   -34.859 1.00 40.55  ? 504  GLY A N   1 
ATOM   3996  C  CA  . GLY A  1 504 ? 75.825  10.241  -35.650 1.00 41.97  ? 504  GLY A CA  1 
ATOM   3997  C  C   . GLY A  1 504 ? 77.313  10.147  -35.969 1.00 42.32  ? 504  GLY A C   1 
ATOM   3998  O  O   . GLY A  1 504 ? 77.702  10.305  -37.129 1.00 42.75  ? 504  GLY A O   1 
ATOM   3999  N  N   . LEU A  1 505 ? 78.140  9.861   -34.962 1.00 42.27  ? 505  LEU A N   1 
ATOM   4000  C  CA  . LEU A  1 505 ? 79.600  9.941   -35.106 1.00 40.40  ? 505  LEU A CA  1 
ATOM   4001  C  C   . LEU A  1 505 ? 80.173  9.146   -36.289 1.00 46.24  ? 505  LEU A C   1 
ATOM   4002  O  O   . LEU A  1 505 ? 81.102  9.608   -36.958 1.00 48.19  ? 505  LEU A O   1 
ATOM   4003  C  CB  . LEU A  1 505 ? 80.312  9.543   -33.806 1.00 38.12  ? 505  LEU A CB  1 
ATOM   4004  C  CG  . LEU A  1 505 ? 80.282  10.512  -32.619 1.00 39.48  ? 505  LEU A CG  1 
ATOM   4005  C  CD1 . LEU A  1 505 ? 81.103  9.978   -31.467 1.00 38.67  ? 505  LEU A CD1 1 
ATOM   4006  C  CD2 . LEU A  1 505 ? 80.783  11.891  -33.001 1.00 39.45  ? 505  LEU A CD2 1 
ATOM   4007  N  N   . TRP A  1 506 ? 79.618  7.966   -36.548 1.00 44.26  ? 506  TRP A N   1 
ATOM   4008  C  CA  . TRP A  1 506 ? 80.015  7.164   -37.707 1.00 44.34  ? 506  TRP A CA  1 
ATOM   4009  C  C   . TRP A  1 506 ? 79.082  7.383   -38.896 1.00 47.68  ? 506  TRP A C   1 
ATOM   4010  O  O   . TRP A  1 506 ? 79.523  7.767   -39.983 1.00 51.38  ? 506  TRP A O   1 
ATOM   4011  C  CB  . TRP A  1 506 ? 80.187  5.680   -37.374 1.00 45.24  ? 506  TRP A CB  1 
ATOM   4012  C  CG  . TRP A  1 506 ? 79.038  5.045   -36.690 1.00 49.25  ? 506  TRP A CG  1 
ATOM   4013  C  CD1 . TRP A  1 506 ? 78.830  4.967   -35.343 1.00 51.70  ? 506  TRP A CD1 1 
ATOM   4014  C  CD2 . TRP A  1 506 ? 77.939  4.362   -37.308 1.00 51.86  ? 506  TRP A CD2 1 
ATOM   4015  N  NE1 . TRP A  1 506 ? 77.663  4.289   -35.084 1.00 53.03  ? 506  TRP A NE1 1 
ATOM   4016  C  CE2 . TRP A  1 506 ? 77.095  3.908   -36.273 1.00 53.13  ? 506  TRP A CE2 1 
ATOM   4017  C  CE3 . TRP A  1 506 ? 77.584  4.096   -38.636 1.00 52.11  ? 506  TRP A CE3 1 
ATOM   4018  C  CZ2 . TRP A  1 506 ? 75.915  3.204   -36.523 1.00 53.29  ? 506  TRP A CZ2 1 
ATOM   4019  C  CZ3 . TRP A  1 506 ? 76.410  3.396   -38.884 1.00 54.99  ? 506  TRP A CZ3 1 
ATOM   4020  C  CH2 . TRP A  1 506 ? 75.592  2.958   -37.832 1.00 54.35  ? 506  TRP A CH2 1 
ATOM   4021  N  N   . PHE A  1 507 ? 77.803  7.083   -38.701 1.00 47.05  ? 507  PHE A N   1 
ATOM   4022  C  CA  . PHE A  1 507 ? 76.821  7.169   -39.775 1.00 47.18  ? 507  PHE A CA  1 
ATOM   4023  C  C   . PHE A  1 507 ? 76.900  8.467   -40.582 1.00 46.66  ? 507  PHE A C   1 
ATOM   4024  O  O   . PHE A  1 507 ? 76.948  8.432   -41.804 1.00 46.36  ? 507  PHE A O   1 
ATOM   4025  C  CB  . PHE A  1 507 ? 75.415  7.001   -39.210 1.00 45.21  ? 507  PHE A CB  1 
ATOM   4026  C  CG  . PHE A  1 507 ? 74.344  6.994   -40.254 1.00 44.44  ? 507  PHE A CG  1 
ATOM   4027  C  CD1 . PHE A  1 507 ? 73.927  5.803   -40.824 1.00 46.23  ? 507  PHE A CD1 1 
ATOM   4028  C  CD2 . PHE A  1 507 ? 73.757  8.178   -40.675 1.00 45.84  ? 507  PHE A CD2 1 
ATOM   4029  C  CE1 . PHE A  1 507 ? 72.935  5.790   -41.790 1.00 47.90  ? 507  PHE A CE1 1 
ATOM   4030  C  CE2 . PHE A  1 507 ? 72.761  8.178   -41.645 1.00 45.62  ? 507  PHE A CE2 1 
ATOM   4031  C  CZ  . PHE A  1 507 ? 72.348  6.985   -42.203 1.00 47.12  ? 507  PHE A CZ  1 
ATOM   4032  N  N   . ASP A  1 508 ? 76.926  9.611   -39.915 1.00 46.24  ? 508  ASP A N   1 
ATOM   4033  C  CA  . ASP A  1 508 ? 76.966  10.865  -40.658 1.00 45.16  ? 508  ASP A CA  1 
ATOM   4034  C  C   . ASP A  1 508 ? 78.219  10.992  -41.526 1.00 45.69  ? 508  ASP A C   1 
ATOM   4035  O  O   . ASP A  1 508 ? 78.190  11.620  -42.585 1.00 45.88  ? 508  ASP A O   1 
ATOM   4036  C  CB  . ASP A  1 508 ? 76.841  12.068  -39.721 1.00 47.34  ? 508  ASP A CB  1 
ATOM   4037  C  CG  . ASP A  1 508 ? 75.399  12.410  -39.402 1.00 49.21  ? 508  ASP A CG  1 
ATOM   4038  O  OD1 . ASP A  1 508 ? 74.755  11.662  -38.634 1.00 47.56  ? 508  ASP A OD1 1 
ATOM   4039  O  OD2 . ASP A  1 508 ? 74.912  13.441  -39.906 1.00 51.99  ? 508  ASP A OD2 1 
ATOM   4040  N  N   . LYS A  1 509 ? 79.320  10.394  -41.096 1.00 41.78  ? 509  LYS A N   1 
ATOM   4041  C  CA  . LYS A  1 509 ? 80.558  10.550  -41.850 1.00 43.83  ? 509  LYS A CA  1 
ATOM   4042  C  C   . LYS A  1 509 ? 80.482  9.881   -43.215 1.00 43.91  ? 509  LYS A C   1 
ATOM   4043  O  O   . LYS A  1 509 ? 81.040  10.376  -44.188 1.00 47.98  ? 509  LYS A O   1 
ATOM   4044  C  CB  . LYS A  1 509 ? 81.750  10.009  -41.065 1.00 41.52  ? 509  LYS A CB  1 
ATOM   4045  C  CG  . LYS A  1 509 ? 82.395  11.030  -40.153 1.00 41.14  ? 509  LYS A CG  1 
ATOM   4046  C  CD  . LYS A  1 509 ? 83.312  10.335  -39.184 1.00 41.52  ? 509  LYS A CD  1 
ATOM   4047  C  CE  . LYS A  1 509 ? 84.212  11.294  -38.463 1.00 42.71  ? 509  LYS A CE  1 
ATOM   4048  N  NZ  . LYS A  1 509 ? 85.134  10.490  -37.637 1.00 44.86  ? 509  LYS A NZ  1 
ATOM   4049  N  N   . GLU A  1 510 ? 79.814  8.738   -43.268 1.00 41.70  ? 510  GLU A N   1 
ATOM   4050  C  CA  . GLU A  1 510 ? 79.638  7.999   -44.511 1.00 42.64  ? 510  GLU A CA  1 
ATOM   4051  C  C   . GLU A  1 510 ? 78.531  8.527   -45.434 1.00 44.36  ? 510  GLU A C   1 
ATOM   4052  O  O   . GLU A  1 510 ? 78.727  8.648   -46.640 1.00 47.89  ? 510  GLU A O   1 
ATOM   4053  C  CB  . GLU A  1 510 ? 79.417  6.531   -44.179 1.00 40.47  ? 510  GLU A CB  1 
ATOM   4054  C  CG  . GLU A  1 510 ? 78.884  5.675   -45.285 1.00 41.17  ? 510  GLU A CG  1 
ATOM   4055  C  CD  . GLU A  1 510 ? 79.104  4.221   -44.959 1.00 44.06  ? 510  GLU A CD  1 
ATOM   4056  O  OE1 . GLU A  1 510 ? 78.261  3.380   -45.332 1.00 46.70  ? 510  GLU A OE1 1 
ATOM   4057  O  OE2 . GLU A  1 510 ? 80.132  3.928   -44.308 1.00 45.83  ? 510  GLU A OE2 1 
ATOM   4058  N  N   . VAL A  1 511 ? 77.369  8.820   -44.861 1.00 42.64  ? 511  VAL A N   1 
ATOM   4059  C  CA  . VAL A  1 511 ? 76.202  9.255   -45.627 1.00 41.46  ? 511  VAL A CA  1 
ATOM   4060  C  C   . VAL A  1 511 ? 76.246  10.737  -46.005 1.00 43.53  ? 511  VAL A C   1 
ATOM   4061  O  O   . VAL A  1 511 ? 75.739  11.140  -47.054 1.00 44.13  ? 511  VAL A O   1 
ATOM   4062  C  CB  . VAL A  1 511 ? 74.903  8.940   -44.857 1.00 38.50  ? 511  VAL A CB  1 
ATOM   4063  C  CG1 . VAL A  1 511 ? 73.676  9.362   -45.653 1.00 37.40  ? 511  VAL A CG1 1 
ATOM   4064  C  CG2 . VAL A  1 511 ? 74.847  7.458   -44.527 1.00 36.75  ? 511  VAL A CG2 1 
ATOM   4065  N  N   . ILE A  1 512 ? 76.841  11.546  -45.136 1.00 46.01  ? 512  ILE A N   1 
ATOM   4066  C  CA  . ILE A  1 512 ? 76.967  12.979  -45.385 1.00 47.24  ? 512  ILE A CA  1 
ATOM   4067  C  C   . ILE A  1 512 ? 78.369  13.357  -45.865 1.00 51.63  ? 512  ILE A C   1 
ATOM   4068  O  O   . ILE A  1 512 ? 78.517  13.880  -46.967 1.00 55.56  ? 512  ILE A O   1 
ATOM   4069  C  CB  . ILE A  1 512 ? 76.547  13.812  -44.173 1.00 46.06  ? 512  ILE A CB  1 
ATOM   4070  C  CG1 . ILE A  1 512 ? 75.249  13.260  -43.586 1.00 44.81  ? 512  ILE A CG1 1 
ATOM   4071  C  CG2 . ILE A  1 512 ? 76.371  15.272  -44.562 1.00 47.29  ? 512  ILE A CG2 1 
ATOM   4072  C  CD1 . ILE A  1 512 ? 74.102  13.223  -44.566 1.00 42.65  ? 512  ILE A CD1 1 
ATOM   4073  N  N   . GLY A  1 513 ? 79.388  13.130  -45.035 1.00 53.47  ? 513  GLY A N   1 
ATOM   4074  C  CA  . GLY A  1 513 ? 80.770  13.350  -45.451 1.00 55.45  ? 513  GLY A CA  1 
ATOM   4075  C  C   . GLY A  1 513 ? 81.783  13.299  -44.317 1.00 56.41  ? 513  GLY A C   1 
ATOM   4076  O  O   . GLY A  1 513 ? 81.402  13.155  -43.157 1.00 59.11  ? 513  GLY A O   1 
ATOM   4077  N  N   . ASP A  1 514 ? 83.072  13.409  -44.635 1.00 56.43  ? 514  ASP A N   1 
ATOM   4078  C  CA  . ASP A  1 514 ? 84.086  13.482  -43.583 1.00 56.69  ? 514  ASP A CA  1 
ATOM   4079  C  C   . ASP A  1 514 ? 84.228  14.906  -43.052 1.00 55.60  ? 514  ASP A C   1 
ATOM   4080  O  O   . ASP A  1 514 ? 83.591  15.840  -43.559 1.00 54.83  ? 514  ASP A O   1 
ATOM   4081  C  CB  . ASP A  1 514 ? 85.446  13.010  -44.092 1.00 59.45  ? 514  ASP A CB  1 
ATOM   4082  C  CG  . ASP A  1 514 ? 85.470  11.536  -44.421 1.00 64.63  ? 514  ASP A CG  1 
ATOM   4083  O  OD1 . ASP A  1 514 ? 84.681  10.778  -43.825 1.00 66.57  ? 514  ASP A OD1 1 
ATOM   4084  O  OD2 . ASP A  1 514 ? 86.288  11.132  -45.274 1.00 67.12  ? 514  ASP A OD2 1 
ATOM   4085  N  N   . ASN A  1 515 ? 85.090  15.062  -42.050 1.00 54.46  ? 515  ASN A N   1 
ATOM   4086  C  CA  . ASN A  1 515 ? 85.420  16.373  -41.494 1.00 55.08  ? 515  ASN A CA  1 
ATOM   4087  C  C   . ASN A  1 515 ? 84.223  17.299  -41.284 1.00 52.05  ? 515  ASN A C   1 
ATOM   4088  O  O   . ASN A  1 515 ? 84.199  18.426  -41.778 1.00 50.38  ? 515  ASN A O   1 
ATOM   4089  C  CB  . ASN A  1 515 ? 86.484  17.043  -42.363 1.00 58.59  ? 515  ASN A CB  1 
ATOM   4090  C  CG  . ASN A  1 515 ? 87.756  16.228  -42.434 1.00 64.08  ? 515  ASN A CG  1 
ATOM   4091  O  OD1 . ASN A  1 515 ? 88.228  15.707  -41.422 1.00 65.04  ? 515  ASN A OD1 1 
ATOM   4092  N  ND2 . ASN A  1 515 ? 88.313  16.098  -43.633 1.00 64.18  ? 515  ASN A ND2 1 
ATOM   4093  N  N   . PRO A  1 516 ? 83.234  16.826  -40.516 1.00 46.91  ? 516  PRO A N   1 
ATOM   4094  C  CA  . PRO A  1 516 ? 81.937  17.495  -40.386 1.00 44.97  ? 516  PRO A CA  1 
ATOM   4095  C  C   . PRO A  1 516 ? 82.076  18.940  -39.930 1.00 44.51  ? 516  PRO A C   1 
ATOM   4096  O  O   . PRO A  1 516 ? 81.274  19.791  -40.311 1.00 46.31  ? 516  PRO A O   1 
ATOM   4097  C  CB  . PRO A  1 516 ? 81.222  16.662  -39.325 1.00 45.27  ? 516  PRO A CB  1 
ATOM   4098  C  CG  . PRO A  1 516 ? 81.866  15.332  -39.402 1.00 46.98  ? 516  PRO A CG  1 
ATOM   4099  C  CD  . PRO A  1 516 ? 83.302  15.602  -39.705 1.00 46.76  ? 516  PRO A CD  1 
ATOM   4100  N  N   . LEU A  1 517 ? 83.093  19.224  -39.133 1.00 42.34  ? 517  LEU A N   1 
ATOM   4101  C  CA  . LEU A  1 517 ? 83.274  20.573  -38.631 1.00 45.07  ? 517  LEU A CA  1 
ATOM   4102  C  C   . LEU A  1 517 ? 83.655  21.504  -39.770 1.00 46.41  ? 517  LEU A C   1 
ATOM   4103  O  O   . LEU A  1 517 ? 83.708  22.719  -39.622 1.00 48.80  ? 517  LEU A O   1 
ATOM   4104  C  CB  . LEU A  1 517 ? 84.320  20.579  -37.517 1.00 45.10  ? 517  LEU A CB  1 
ATOM   4105  C  CG  . LEU A  1 517 ? 83.827  19.859  -36.253 1.00 41.50  ? 517  LEU A CG  1 
ATOM   4106  C  CD1 . LEU A  1 517 ? 84.890  19.818  -35.172 1.00 41.37  ? 517  LEU A CD1 1 
ATOM   4107  C  CD2 . LEU A  1 517 ? 82.575  20.533  -35.738 1.00 36.42  ? 517  LEU A CD2 1 
ATOM   4108  N  N   . GLU A  1 518 ? 83.899  20.901  -40.921 1.00 49.45  ? 518  GLU A N   1 
ATOM   4109  C  CA  . GLU A  1 518 ? 84.511  21.569  -42.056 1.00 51.97  ? 518  GLU A CA  1 
ATOM   4110  C  C   . GLU A  1 518 ? 83.665  21.403  -43.301 1.00 50.87  ? 518  GLU A C   1 
ATOM   4111  O  O   . GLU A  1 518 ? 83.294  22.383  -43.953 1.00 51.22  ? 518  GLU A O   1 
ATOM   4112  C  CB  . GLU A  1 518 ? 85.938  21.090  -42.265 1.00 57.52  ? 518  GLU A CB  1 
ATOM   4113  C  CG  . GLU A  1 518 ? 86.875  21.635  -41.213 1.00 63.61  ? 518  GLU A CG  1 
ATOM   4114  C  CD  . GLU A  1 518 ? 88.049  20.727  -40.960 1.00 71.86  ? 518  GLU A CD  1 
ATOM   4115  O  OE1 . GLU A  1 518 ? 88.025  19.992  -39.947 1.00 74.52  ? 518  GLU A OE1 1 
ATOM   4116  O  OE2 . GLU A  1 518 ? 88.989  20.745  -41.780 1.00 74.44  ? 518  GLU A OE2 1 
ATOM   4117  N  N   . ASN A  1 519 ? 83.430  20.150  -43.665 1.00 49.01  ? 519  ASN A N   1 
ATOM   4118  C  CA  . ASN A  1 519 ? 82.799  19.830  -44.924 1.00 47.75  ? 519  ASN A CA  1 
ATOM   4119  C  C   . ASN A  1 519 ? 81.500  20.608  -45.059 1.00 48.77  ? 519  ASN A C   1 
ATOM   4120  O  O   . ASN A  1 519 ? 80.580  20.453  -44.268 1.00 49.88  ? 519  ASN A O   1 
ATOM   4121  C  CB  . ASN A  1 519 ? 82.509  18.330  -44.905 1.00 47.71  ? 519  ASN A CB  1 
ATOM   4122  C  CG  . ASN A  1 519 ? 81.862  17.836  -46.170 1.00 52.91  ? 519  ASN A CG  1 
ATOM   4123  O  OD1 . ASN A  1 519 ? 81.241  18.597  -46.905 1.00 53.01  ? 519  ASN A OD1 1 
ATOM   4124  N  ND2 . ASN A  1 519 ? 81.998  16.541  -46.431 1.00 53.46  ? 519  ASN A ND2 1 
ATOM   4125  N  N   . GLU A  1 520 ? 81.411  21.390  -46.128 1.00 50.68  ? 520  GLU A N   1 
ATOM   4126  C  CA  . GLU A  1 520 ? 80.321  22.339  -46.311 1.00 55.56  ? 520  GLU A CA  1 
ATOM   4127  C  C   . GLU A  1 520 ? 79.048  21.616  -46.694 1.00 53.92  ? 520  GLU A C   1 
ATOM   4128  O  O   . GLU A  1 520 ? 77.986  22.223  -46.827 1.00 53.97  ? 520  GLU A O   1 
ATOM   4129  C  CB  . GLU A  1 520 ? 80.669  23.344  -47.405 1.00 62.30  ? 520  GLU A CB  1 
ATOM   4130  C  CG  . GLU A  1 520 ? 80.316  24.770  -47.046 1.00 73.83  ? 520  GLU A CG  1 
ATOM   4131  C  CD  . GLU A  1 520 ? 81.399  25.431  -46.212 1.00 82.10  ? 520  GLU A CD  1 
ATOM   4132  O  OE1 . GLU A  1 520 ? 81.335  25.353  -44.962 1.00 83.74  ? 520  GLU A OE1 1 
ATOM   4133  O  OE2 . GLU A  1 520 ? 82.319  26.028  -46.816 1.00 85.74  ? 520  GLU A OE2 1 
ATOM   4134  N  N   . ASN A  1 521 ? 79.177  20.316  -46.908 1.00 51.12  ? 521  ASN A N   1 
ATOM   4135  C  CA  . ASN A  1 521 ? 78.058  19.497  -47.329 1.00 48.78  ? 521  ASN A CA  1 
ATOM   4136  C  C   . ASN A  1 521 ? 76.991  19.429  -46.250 1.00 46.17  ? 521  ASN A C   1 
ATOM   4137  O  O   . ASN A  1 521 ? 75.814  19.210  -46.541 1.00 45.18  ? 521  ASN A O   1 
ATOM   4138  C  CB  . ASN A  1 521 ? 78.538  18.092  -47.678 1.00 50.69  ? 521  ASN A CB  1 
ATOM   4139  C  CG  . ASN A  1 521 ? 77.940  17.586  -48.959 1.00 53.43  ? 521  ASN A CG  1 
ATOM   4140  O  OD1 . ASN A  1 521 ? 77.772  18.342  -49.917 1.00 54.64  ? 521  ASN A OD1 1 
ATOM   4141  N  ND2 . ASN A  1 521 ? 77.598  16.305  -48.986 1.00 53.74  ? 521  ASN A ND2 1 
ATOM   4142  N  N   . TYR A  1 522 ? 77.416  19.620  -45.004 1.00 44.73  ? 522  TYR A N   1 
ATOM   4143  C  CA  . TYR A  1 522 ? 76.507  19.579  -43.871 1.00 43.73  ? 522  TYR A CA  1 
ATOM   4144  C  C   . TYR A  1 522 ? 75.554  20.762  -43.857 1.00 45.13  ? 522  TYR A C   1 
ATOM   4145  O  O   . TYR A  1 522 ? 74.439  20.640  -43.372 1.00 43.63  ? 522  TYR A O   1 
ATOM   4146  C  CB  . TYR A  1 522 ? 77.275  19.475  -42.552 1.00 43.85  ? 522  TYR A CB  1 
ATOM   4147  C  CG  . TYR A  1 522 ? 77.831  18.095  -42.303 1.00 44.81  ? 522  TYR A CG  1 
ATOM   4148  C  CD1 . TYR A  1 522 ? 78.822  17.571  -43.117 1.00 46.68  ? 522  TYR A CD1 1 
ATOM   4149  C  CD2 . TYR A  1 522 ? 77.360  17.313  -41.263 1.00 46.84  ? 522  TYR A CD2 1 
ATOM   4150  C  CE1 . TYR A  1 522 ? 79.334  16.306  -42.901 1.00 45.73  ? 522  TYR A CE1 1 
ATOM   4151  C  CE2 . TYR A  1 522 ? 77.866  16.045  -41.039 1.00 48.08  ? 522  TYR A CE2 1 
ATOM   4152  C  CZ  . TYR A  1 522 ? 78.855  15.546  -41.864 1.00 47.58  ? 522  TYR A CZ  1 
ATOM   4153  O  OH  . TYR A  1 522 ? 79.368  14.284  -41.653 1.00 44.91  ? 522  TYR A OH  1 
ATOM   4154  N  N   . ARG A  1 523 ? 75.992  21.913  -44.353 1.00 47.07  ? 523  ARG A N   1 
ATOM   4155  C  CA  . ARG A  1 523 ? 75.063  23.025  -44.535 1.00 52.56  ? 523  ARG A CA  1 
ATOM   4156  C  C   . ARG A  1 523 ? 74.241  22.926  -45.829 1.00 53.55  ? 523  ARG A C   1 
ATOM   4157  O  O   . ARG A  1 523 ? 73.037  23.139  -45.814 1.00 58.27  ? 523  ARG A O   1 
ATOM   4158  C  CB  . ARG A  1 523 ? 75.771  24.385  -44.413 1.00 59.14  ? 523  ARG A CB  1 
ATOM   4159  C  CG  . ARG A  1 523 ? 76.178  24.732  -42.977 1.00 65.34  ? 523  ARG A CG  1 
ATOM   4160  C  CD  . ARG A  1 523 ? 76.315  26.243  -42.737 1.00 70.45  ? 523  ARG A CD  1 
ATOM   4161  N  NE  . ARG A  1 523 ? 76.267  26.563  -41.306 1.00 71.06  ? 523  ARG A NE  1 
ATOM   4162  C  CZ  . ARG A  1 523 ? 76.133  27.790  -40.803 1.00 70.71  ? 523  ARG A CZ  1 
ATOM   4163  N  NH1 . ARG A  1 523 ? 76.032  28.841  -41.609 1.00 70.02  ? 523  ARG A NH1 1 
ATOM   4164  N  NH2 . ARG A  1 523 ? 76.096  27.968  -39.486 1.00 69.55  ? 523  ARG A NH2 1 
ATOM   4165  N  N   . LYS A  1 524 ? 74.878  22.567  -46.937 1.00 51.14  ? 524  LYS A N   1 
ATOM   4166  C  CA  . LYS A  1 524 ? 74.219  22.641  -48.245 1.00 50.08  ? 524  LYS A CA  1 
ATOM   4167  C  C   . LYS A  1 524 ? 73.057  21.655  -48.407 1.00 50.76  ? 524  LYS A C   1 
ATOM   4168  O  O   . LYS A  1 524 ? 72.082  21.943  -49.109 1.00 47.32  ? 524  LYS A O   1 
ATOM   4169  C  CB  . LYS A  1 524 ? 75.235  22.459  -49.379 1.00 48.59  ? 524  LYS A CB  1 
ATOM   4170  N  N   . LEU A  1 525 ? 73.181  20.489  -47.775 1.00 46.88  ? 525  LEU A N   1 
ATOM   4171  C  CA  . LEU A  1 525 ? 72.156  19.446  -47.821 1.00 44.82  ? 525  LEU A CA  1 
ATOM   4172  C  C   . LEU A  1 525 ? 71.185  19.449  -46.628 1.00 43.60  ? 525  LEU A C   1 
ATOM   4173  O  O   . LEU A  1 525 ? 70.355  18.548  -46.489 1.00 42.78  ? 525  LEU A O   1 
ATOM   4174  C  CB  . LEU A  1 525 ? 72.809  18.074  -47.972 1.00 42.32  ? 525  LEU A CB  1 
ATOM   4175  C  CG  . LEU A  1 525 ? 73.816  18.000  -49.122 1.00 37.43  ? 525  LEU A CG  1 
ATOM   4176  C  CD1 . LEU A  1 525 ? 74.422  16.609  -49.223 1.00 33.66  ? 525  LEU A CD1 1 
ATOM   4177  C  CD2 . LEU A  1 525 ? 73.164  18.420  -50.442 1.00 35.54  ? 525  LEU A CD2 1 
ATOM   4178  N  N   . SER A  1 526 ? 71.318  20.433  -45.745 1.00 42.18  ? 526  SER A N   1 
ATOM   4179  C  CA  . SER A  1 526 ? 70.431  20.532  -44.592 1.00 39.27  ? 526  SER A CA  1 
ATOM   4180  C  C   . SER A  1 526 ? 69.264  21.466  -44.863 1.00 41.07  ? 526  SER A C   1 
ATOM   4181  O  O   . SER A  1 526 ? 69.469  22.630  -45.190 1.00 46.03  ? 526  SER A O   1 
ATOM   4182  C  CB  . SER A  1 526 ? 71.205  21.002  -43.358 1.00 36.10  ? 526  SER A CB  1 
ATOM   4183  O  OG  . SER A  1 526 ? 72.072  19.986  -42.878 1.00 36.22  ? 526  SER A OG  1 
ATOM   4184  N  N   . PRO A  1 527 ? 68.030  20.958  -44.723 1.00 40.59  ? 527  PRO A N   1 
ATOM   4185  C  CA  . PRO A  1 527 ? 66.825  21.753  -44.986 1.00 38.30  ? 527  PRO A CA  1 
ATOM   4186  C  C   . PRO A  1 527 ? 66.756  23.053  -44.175 1.00 37.38  ? 527  PRO A C   1 
ATOM   4187  O  O   . PRO A  1 527 ? 66.240  24.055  -44.675 1.00 37.36  ? 527  PRO A O   1 
ATOM   4188  C  CB  . PRO A  1 527 ? 65.687  20.804  -44.577 1.00 37.11  ? 527  PRO A CB  1 
ATOM   4189  C  CG  . PRO A  1 527 ? 66.252  19.447  -44.739 1.00 35.60  ? 527  PRO A CG  1 
ATOM   4190  C  CD  . PRO A  1 527 ? 67.700  19.570  -44.355 1.00 38.44  ? 527  PRO A CD  1 
ATOM   4191  N  N   . LEU A  1 528 ? 67.283  23.036  -42.953 1.00 36.59  ? 528  LEU A N   1 
ATOM   4192  C  CA  . LEU A  1 528 ? 67.182  24.181  -42.049 1.00 35.86  ? 528  LEU A CA  1 
ATOM   4193  C  C   . LEU A  1 528 ? 67.575  25.488  -42.722 1.00 37.03  ? 528  LEU A C   1 
ATOM   4194  O  O   . LEU A  1 528 ? 66.910  26.506  -42.539 1.00 37.76  ? 528  LEU A O   1 
ATOM   4195  C  CB  . LEU A  1 528 ? 68.034  23.969  -40.787 1.00 30.67  ? 528  LEU A CB  1 
ATOM   4196  C  CG  . LEU A  1 528 ? 67.899  25.060  -39.714 1.00 25.75  ? 528  LEU A CG  1 
ATOM   4197  C  CD1 . LEU A  1 528 ? 66.549  24.979  -39.022 1.00 24.96  ? 528  LEU A CD1 1 
ATOM   4198  C  CD2 . LEU A  1 528 ? 69.020  24.980  -38.694 1.00 23.79  ? 528  LEU A CD2 1 
ATOM   4199  N  N   . PHE A  1 529 ? 68.649  25.460  -43.505 1.00 39.20  ? 529  PHE A N   1 
ATOM   4200  C  CA  . PHE A  1 529 ? 69.181  26.688  -44.095 1.00 42.02  ? 529  PHE A CA  1 
ATOM   4201  C  C   . PHE A  1 529 ? 68.328  27.240  -45.222 1.00 41.45  ? 529  PHE A C   1 
ATOM   4202  O  O   . PHE A  1 529 ? 68.475  28.389  -45.620 1.00 41.73  ? 529  PHE A O   1 
ATOM   4203  C  CB  . PHE A  1 529 ? 70.627  26.485  -44.533 1.00 41.19  ? 529  PHE A CB  1 
ATOM   4204  C  CG  . PHE A  1 529 ? 71.530  26.180  -43.393 1.00 45.85  ? 529  PHE A CG  1 
ATOM   4205  C  CD1 . PHE A  1 529 ? 71.938  24.882  -43.141 1.00 49.55  ? 529  PHE A CD1 1 
ATOM   4206  C  CD2 . PHE A  1 529 ? 71.910  27.190  -42.516 1.00 47.20  ? 529  PHE A CD2 1 
ATOM   4207  C  CE1 . PHE A  1 529 ? 72.747  24.602  -42.056 1.00 51.88  ? 529  PHE A CE1 1 
ATOM   4208  C  CE2 . PHE A  1 529 ? 72.715  26.923  -41.430 1.00 48.06  ? 529  PHE A CE2 1 
ATOM   4209  C  CZ  . PHE A  1 529 ? 73.135  25.630  -41.195 1.00 51.62  ? 529  PHE A CZ  1 
ATOM   4210  N  N   . TYR A  1 530 ? 67.436  26.405  -45.730 1.00 43.03  ? 530  TYR A N   1 
ATOM   4211  C  CA  . TYR A  1 530 ? 66.549  26.780  -46.819 1.00 42.03  ? 530  TYR A CA  1 
ATOM   4212  C  C   . TYR A  1 530 ? 65.160  27.230  -46.348 1.00 43.60  ? 530  TYR A C   1 
ATOM   4213  O  O   . TYR A  1 530 ? 64.274  27.500  -47.170 1.00 47.35  ? 530  TYR A O   1 
ATOM   4214  C  CB  . TYR A  1 530 ? 66.474  25.652  -47.842 1.00 40.56  ? 530  TYR A CB  1 
ATOM   4215  C  CG  . TYR A  1 530 ? 67.824  25.315  -48.449 1.00 41.28  ? 530  TYR A CG  1 
ATOM   4216  C  CD1 . TYR A  1 530 ? 68.756  24.562  -47.745 1.00 39.87  ? 530  TYR A CD1 1 
ATOM   4217  C  CD2 . TYR A  1 530 ? 68.163  25.746  -49.732 1.00 40.67  ? 530  TYR A CD2 1 
ATOM   4218  C  CE1 . TYR A  1 530 ? 69.986  24.249  -48.303 1.00 43.26  ? 530  TYR A CE1 1 
ATOM   4219  C  CE2 . TYR A  1 530 ? 69.390  25.436  -50.299 1.00 40.34  ? 530  TYR A CE2 1 
ATOM   4220  C  CZ  . TYR A  1 530 ? 70.296  24.689  -49.585 1.00 42.77  ? 530  TYR A CZ  1 
ATOM   4221  O  OH  . TYR A  1 530 ? 71.513  24.384  -50.151 1.00 43.73  ? 530  TYR A OH  1 
ATOM   4222  N  N   . ALA A  1 531 ? 64.979  27.321  -45.031 1.00 38.08  ? 531  ALA A N   1 
ATOM   4223  C  CA  . ALA A  1 531 ? 63.660  27.565  -44.442 1.00 38.55  ? 531  ALA A CA  1 
ATOM   4224  C  C   . ALA A  1 531 ? 62.910  28.722  -45.091 1.00 36.58  ? 531  ALA A C   1 
ATOM   4225  O  O   . ALA A  1 531 ? 61.681  28.685  -45.202 1.00 36.42  ? 531  ALA A O   1 
ATOM   4226  C  CB  . ALA A  1 531 ? 63.779  27.798  -42.935 1.00 38.73  ? 531  ALA A CB  1 
ATOM   4227  N  N   . LYS A  1 532 ? 63.647  29.741  -45.524 1.00 37.10  ? 532  LYS A N   1 
ATOM   4228  C  CA  . LYS A  1 532 ? 63.047  30.896  -46.187 1.00 37.79  ? 532  LYS A CA  1 
ATOM   4229  C  C   . LYS A  1 532 ? 62.144  30.468  -47.342 1.00 37.02  ? 532  LYS A C   1 
ATOM   4230  O  O   . LYS A  1 532 ? 61.168  31.146  -47.647 1.00 37.94  ? 532  LYS A O   1 
ATOM   4231  C  CB  . LYS A  1 532 ? 64.131  31.843  -46.714 1.00 35.08  ? 532  LYS A CB  1 
ATOM   4232  N  N   . ASN A  1 533 ? 62.456  29.337  -47.969 1.00 38.55  ? 533  ASN A N   1 
ATOM   4233  C  CA  . ASN A  1 533 ? 61.725  28.904  -49.162 1.00 39.81  ? 533  ASN A CA  1 
ATOM   4234  C  C   . ASN A  1 533 ? 60.327  28.348  -48.921 1.00 42.66  ? 533  ASN A C   1 
ATOM   4235  O  O   . ASN A  1 533 ? 59.460  28.485  -49.780 1.00 48.40  ? 533  ASN A O   1 
ATOM   4236  C  CB  . ASN A  1 533 ? 62.521  27.863  -49.950 1.00 40.03  ? 533  ASN A CB  1 
ATOM   4237  C  CG  . ASN A  1 533 ? 63.840  28.384  -50.440 1.00 40.71  ? 533  ASN A CG  1 
ATOM   4238  O  OD1 . ASN A  1 533 ? 64.098  29.584  -50.408 1.00 42.70  ? 533  ASN A OD1 1 
ATOM   4239  N  ND2 . ASN A  1 533 ? 64.693  27.477  -50.904 1.00 39.77  ? 533  ASN A ND2 1 
ATOM   4240  N  N   . VAL A  1 534 ? 60.109  27.704  -47.778 1.00 39.41  ? 534  VAL A N   1 
ATOM   4241  C  CA  . VAL A  1 534 ? 58.869  26.956  -47.585 1.00 37.83  ? 534  VAL A CA  1 
ATOM   4242  C  C   . VAL A  1 534 ? 57.632  27.847  -47.773 1.00 38.61  ? 534  VAL A C   1 
ATOM   4243  O  O   . VAL A  1 534 ? 57.486  28.861  -47.096 1.00 40.35  ? 534  VAL A O   1 
ATOM   4244  C  CB  . VAL A  1 534 ? 58.860  26.334  -46.185 1.00 34.86  ? 534  VAL A CB  1 
ATOM   4245  C  CG1 . VAL A  1 534 ? 57.484  25.718  -45.847 1.00 31.65  ? 534  VAL A CG1 1 
ATOM   4246  C  CG2 . VAL A  1 534 ? 59.981  25.322  -46.044 1.00 34.63  ? 534  VAL A CG2 1 
ATOM   4247  N  N   . LYS A  1 535 ? 56.773  27.479  -48.726 1.00 39.23  ? 535  LYS A N   1 
ATOM   4248  C  CA  . LYS A  1 535 ? 55.441  28.085  -48.848 1.00 41.19  ? 535  LYS A CA  1 
ATOM   4249  C  C   . LYS A  1 535 ? 54.249  27.236  -48.356 1.00 36.76  ? 535  LYS A C   1 
ATOM   4250  O  O   . LYS A  1 535 ? 53.121  27.728  -48.277 1.00 33.02  ? 535  LYS A O   1 
ATOM   4251  C  CB  . LYS A  1 535 ? 55.228  28.521  -50.297 1.00 43.95  ? 535  LYS A CB  1 
ATOM   4252  C  CG  . LYS A  1 535 ? 56.390  29.339  -50.865 1.00 44.03  ? 535  LYS A CG  1 
ATOM   4253  C  CD  . LYS A  1 535 ? 56.424  29.310  -52.389 1.00 45.78  ? 535  LYS A CD  1 
ATOM   4254  N  N   . ALA A  1 536 ? 54.513  25.971  -48.030 1.00 35.18  ? 536  ALA A N   1 
ATOM   4255  C  CA  . ALA A  1 536 ? 53.471  24.976  -47.712 1.00 36.02  ? 536  ALA A CA  1 
ATOM   4256  C  C   . ALA A  1 536 ? 53.313  24.657  -46.220 1.00 35.57  ? 536  ALA A C   1 
ATOM   4257  O  O   . ALA A  1 536 ? 54.302  24.407  -45.544 1.00 37.63  ? 536  ALA A O   1 
ATOM   4258  C  CB  . ALA A  1 536 ? 53.705  23.705  -48.500 1.00 38.04  ? 536  ALA A CB  1 
ATOM   4259  N  N   . PRO A  1 537 ? 52.072  24.678  -45.700 1.00 38.01  ? 537  PRO A N   1 
ATOM   4260  C  CA  . PRO A  1 537 ? 51.838  24.349  -44.286 1.00 38.72  ? 537  PRO A CA  1 
ATOM   4261  C  C   . PRO A  1 537 ? 52.425  23.006  -43.896 1.00 38.85  ? 537  PRO A C   1 
ATOM   4262  O  O   . PRO A  1 537 ? 52.213  21.999  -44.572 1.00 42.13  ? 537  PRO A O   1 
ATOM   4263  C  CB  . PRO A  1 537 ? 50.306  24.308  -44.173 1.00 36.34  ? 537  PRO A CB  1 
ATOM   4264  C  CG  . PRO A  1 537 ? 49.825  24.190  -45.561 1.00 37.56  ? 537  PRO A CG  1 
ATOM   4265  C  CD  . PRO A  1 537 ? 50.809  24.937  -46.401 1.00 36.78  ? 537  PRO A CD  1 
ATOM   4266  N  N   . LEU A  1 538 ? 53.153  23.006  -42.790 1.00 36.76  ? 538  LEU A N   1 
ATOM   4267  C  CA  . LEU A  1 538 ? 53.898  21.838  -42.368 1.00 37.26  ? 538  LEU A CA  1 
ATOM   4268  C  C   . LEU A  1 538 ? 53.539  21.438  -40.944 1.00 39.66  ? 538  LEU A C   1 
ATOM   4269  O  O   . LEU A  1 538 ? 53.477  22.278  -40.043 1.00 36.47  ? 538  LEU A O   1 
ATOM   4270  C  CB  . LEU A  1 538 ? 55.395  22.123  -42.464 1.00 33.15  ? 538  LEU A CB  1 
ATOM   4271  C  CG  . LEU A  1 538 ? 56.325  21.044  -41.925 1.00 31.90  ? 538  LEU A CG  1 
ATOM   4272  C  CD1 . LEU A  1 538 ? 56.161  19.752  -42.705 1.00 33.16  ? 538  LEU A CD1 1 
ATOM   4273  C  CD2 . LEU A  1 538 ? 57.759  21.523  -41.985 1.00 29.66  ? 538  LEU A CD2 1 
ATOM   4274  N  N   . LEU A  1 539 ? 53.281  20.151  -40.758 1.00 38.65  ? 539  LEU A N   1 
ATOM   4275  C  CA  . LEU A  1 539 ? 53.128  19.598  -39.430 1.00 37.71  ? 539  LEU A CA  1 
ATOM   4276  C  C   . LEU A  1 539 ? 54.378  18.811  -39.104 1.00 36.86  ? 539  LEU A C   1 
ATOM   4277  O  O   . LEU A  1 539 ? 54.741  17.883  -39.820 1.00 38.46  ? 539  LEU A O   1 
ATOM   4278  C  CB  . LEU A  1 539 ? 51.914  18.681  -39.357 1.00 38.23  ? 539  LEU A CB  1 
ATOM   4279  C  CG  . LEU A  1 539 ? 51.916  17.754  -38.139 1.00 40.48  ? 539  LEU A CG  1 
ATOM   4280  C  CD1 . LEU A  1 539 ? 52.089  18.549  -36.859 1.00 42.73  ? 539  LEU A CD1 1 
ATOM   4281  C  CD2 . LEU A  1 539 ? 50.650  16.935  -38.082 1.00 40.75  ? 539  LEU A CD2 1 
ATOM   4282  N  N   . LEU A  1 540 ? 55.042  19.204  -38.027 1.00 36.49  ? 540  LEU A N   1 
ATOM   4283  C  CA  . LEU A  1 540 ? 56.185  18.473  -37.509 1.00 36.54  ? 540  LEU A CA  1 
ATOM   4284  C  C   . LEU A  1 540 ? 55.724  17.585  -36.360 1.00 37.92  ? 540  LEU A C   1 
ATOM   4285  O  O   . LEU A  1 540 ? 54.917  18.007  -35.527 1.00 41.43  ? 540  LEU A O   1 
ATOM   4286  C  CB  . LEU A  1 540 ? 57.247  19.450  -37.021 1.00 35.47  ? 540  LEU A CB  1 
ATOM   4287  C  CG  . LEU A  1 540 ? 58.004  20.185  -38.122 1.00 35.62  ? 540  LEU A CG  1 
ATOM   4288  C  CD1 . LEU A  1 540 ? 58.656  21.452  -37.591 1.00 34.40  ? 540  LEU A CD1 1 
ATOM   4289  C  CD2 . LEU A  1 540 ? 59.040  19.255  -38.722 1.00 37.96  ? 540  LEU A CD2 1 
ATOM   4290  N  N   . ILE A  1 541 ? 56.226  16.355  -36.330 1.00 36.53  ? 541  ILE A N   1 
ATOM   4291  C  CA  . ILE A  1 541 ? 55.881  15.393  -35.289 1.00 37.51  ? 541  ILE A CA  1 
ATOM   4292  C  C   . ILE A  1 541 ? 57.177  14.848  -34.703 1.00 37.89  ? 541  ILE A C   1 
ATOM   4293  O  O   . ILE A  1 541 ? 58.139  14.614  -35.437 1.00 40.26  ? 541  ILE A O   1 
ATOM   4294  C  CB  . ILE A  1 541 ? 55.046  14.206  -35.851 1.00 32.17  ? 541  ILE A CB  1 
ATOM   4295  C  CG1 . ILE A  1 541 ? 53.798  14.697  -36.586 1.00 31.30  ? 541  ILE A CG1 1 
ATOM   4296  C  CG2 . ILE A  1 541 ? 54.636  13.261  -34.739 1.00 31.15  ? 541  ILE A CG2 1 
ATOM   4297  C  CD1 . ILE A  1 541 ? 52.879  13.576  -36.986 1.00 28.97  ? 541  ILE A CD1 1 
ATOM   4298  N  N   . HIS A  1 542 ? 57.212  14.649  -33.389 1.00 35.15  ? 542  HIS A N   1 
ATOM   4299  C  CA  . HIS A  1 542 ? 58.414  14.131  -32.750 1.00 34.38  ? 542  HIS A CA  1 
ATOM   4300  C  C   . HIS A  1 542 ? 58.112  13.431  -31.426 1.00 36.76  ? 542  HIS A C   1 
ATOM   4301  O  O   . HIS A  1 542 ? 57.033  13.601  -30.842 1.00 39.01  ? 542  HIS A O   1 
ATOM   4302  C  CB  . HIS A  1 542 ? 59.433  15.252  -32.540 1.00 35.03  ? 542  HIS A CB  1 
ATOM   4303  C  CG  . HIS A  1 542 ? 60.857  14.811  -32.700 1.00 37.28  ? 542  HIS A CG  1 
ATOM   4304  N  ND1 . HIS A  1 542 ? 61.538  14.908  -33.894 1.00 36.41  ? 542  HIS A ND1 1 
ATOM   4305  C  CD2 . HIS A  1 542 ? 61.724  14.261  -31.819 1.00 38.40  ? 542  HIS A CD2 1 
ATOM   4306  C  CE1 . HIS A  1 542 ? 62.763  14.443  -33.741 1.00 36.76  ? 542  HIS A CE1 1 
ATOM   4307  N  NE2 . HIS A  1 542 ? 62.901  14.042  -32.491 1.00 37.55  ? 542  HIS A NE2 1 
ATOM   4308  N  N   . SER A  1 543 ? 59.060  12.622  -30.967 1.00 33.68  ? 543  SER A N   1 
ATOM   4309  C  CA  . SER A  1 543 ? 58.930  11.974  -29.676 1.00 34.76  ? 543  SER A CA  1 
ATOM   4310  C  C   . SER A  1 543 ? 60.175  12.250  -28.823 1.00 36.16  ? 543  SER A C   1 
ATOM   4311  O  O   . SER A  1 543 ? 61.283  12.375  -29.346 1.00 34.98  ? 543  SER A O   1 
ATOM   4312  C  CB  . SER A  1 543 ? 58.647  10.477  -29.848 1.00 36.06  ? 543  SER A CB  1 
ATOM   4313  O  OG  . SER A  1 543 ? 59.670  9.822   -30.574 1.00 37.82  ? 543  SER A OG  1 
ATOM   4314  N  N   . LEU A  1 544 ? 59.979  12.357  -27.511 1.00 35.59  ? 544  LEU A N   1 
ATOM   4315  C  CA  . LEU A  1 544 ? 61.022  12.828  -26.595 1.00 34.46  ? 544  LEU A CA  1 
ATOM   4316  C  C   . LEU A  1 544 ? 62.121  11.819  -26.308 1.00 34.84  ? 544  LEU A C   1 
ATOM   4317  O  O   . LEU A  1 544 ? 63.177  12.174  -25.804 1.00 40.31  ? 544  LEU A O   1 
ATOM   4318  C  CB  . LEU A  1 544 ? 60.404  13.290  -25.276 1.00 32.93  ? 544  LEU A CB  1 
ATOM   4319  C  CG  . LEU A  1 544 ? 59.670  14.621  -25.353 1.00 34.35  ? 544  LEU A CG  1 
ATOM   4320  C  CD1 . LEU A  1 544 ? 59.152  15.002  -23.989 1.00 37.89  ? 544  LEU A CD1 1 
ATOM   4321  C  CD2 . LEU A  1 544 ? 60.608  15.679  -25.877 1.00 32.74  ? 544  LEU A CD2 1 
ATOM   4322  N  N   . GLU A  1 545 ? 61.841  10.556  -26.577 1.00 34.47  ? 545  GLU A N   1 
ATOM   4323  C  CA  . GLU A  1 545 ? 62.797  9.474   -26.371 1.00 36.76  ? 545  GLU A CA  1 
ATOM   4324  C  C   . GLU A  1 545 ? 63.587  9.035   -27.602 1.00 41.08  ? 545  GLU A C   1 
ATOM   4325  O  O   . GLU A  1 545 ? 64.286  8.019   -27.555 1.00 43.27  ? 545  GLU A O   1 
ATOM   4326  C  CB  . GLU A  1 545 ? 62.143  8.291   -25.673 1.00 40.88  ? 545  GLU A CB  1 
ATOM   4327  C  CG  . GLU A  1 545 ? 61.609  8.646   -24.297 1.00 44.95  ? 545  GLU A CG  1 
ATOM   4328  C  CD  . GLU A  1 545 ? 60.935  7.475   -23.623 1.00 47.51  ? 545  GLU A CD  1 
ATOM   4329  O  OE1 . GLU A  1 545 ? 59.708  7.302   -23.811 1.00 44.98  ? 545  GLU A OE1 1 
ATOM   4330  O  OE2 . GLU A  1 545 ? 61.642  6.726   -22.910 1.00 50.78  ? 545  GLU A OE2 1 
ATOM   4331  N  N   . ASP A  1 546 ? 63.454  9.761   -28.708 1.00 39.88  ? 546  ASP A N   1 
ATOM   4332  C  CA  . ASP A  1 546 ? 64.072  9.332   -29.953 1.00 38.83  ? 546  ASP A CA  1 
ATOM   4333  C  C   . ASP A  1 546 ? 65.503  9.875   -29.973 1.00 37.22  ? 546  ASP A C   1 
ATOM   4334  O  O   . ASP A  1 546 ? 65.735  11.086  -30.019 1.00 37.11  ? 546  ASP A O   1 
ATOM   4335  C  CB  . ASP A  1 546 ? 63.263  9.919   -31.115 1.00 40.37  ? 546  ASP A CB  1 
ATOM   4336  C  CG  . ASP A  1 546 ? 63.916  9.710   -32.482 1.00 41.00  ? 546  ASP A CG  1 
ATOM   4337  O  OD1 . ASP A  1 546 ? 65.077  9.260   -32.561 1.00 39.74  ? 546  ASP A OD1 1 
ATOM   4338  O  OD2 . ASP A  1 546 ? 63.253  10.018  -33.496 1.00 42.40  ? 546  ASP A OD2 1 
ATOM   4339  N  N   . TYR A  1 547 ? 66.462  8.958   -29.888 1.00 36.59  ? 547  TYR A N   1 
ATOM   4340  C  CA  . TYR A  1 547 ? 67.872  9.318   -29.937 1.00 39.88  ? 547  TYR A CA  1 
ATOM   4341  C  C   . TYR A  1 547 ? 68.515  9.108   -31.315 1.00 38.58  ? 547  TYR A C   1 
ATOM   4342  O  O   . TYR A  1 547 ? 69.658  9.517   -31.551 1.00 40.80  ? 547  TYR A O   1 
ATOM   4343  C  CB  . TYR A  1 547 ? 68.612  8.578   -28.818 1.00 43.02  ? 547  TYR A CB  1 
ATOM   4344  C  CG  . TYR A  1 547 ? 67.871  8.696   -27.498 1.00 43.65  ? 547  TYR A CG  1 
ATOM   4345  C  CD1 . TYR A  1 547 ? 67.770  7.623   -26.629 1.00 43.17  ? 547  TYR A CD1 1 
ATOM   4346  C  CD2 . TYR A  1 547 ? 67.245  9.887   -27.141 1.00 43.23  ? 547  TYR A CD2 1 
ATOM   4347  C  CE1 . TYR A  1 547 ? 67.077  7.742   -25.427 1.00 44.45  ? 547  TYR A CE1 1 
ATOM   4348  C  CE2 . TYR A  1 547 ? 66.556  10.013  -25.955 1.00 42.15  ? 547  TYR A CE2 1 
ATOM   4349  C  CZ  . TYR A  1 547 ? 66.474  8.941   -25.097 1.00 42.45  ? 547  TYR A CZ  1 
ATOM   4350  O  OH  . TYR A  1 547 ? 65.778  9.073   -23.914 1.00 39.39  ? 547  TYR A OH  1 
ATOM   4351  N  N   . ARG A  1 548 ? 67.753  8.527   -32.236 1.00 34.62  ? 548  ARG A N   1 
ATOM   4352  C  CA  . ARG A  1 548 ? 68.206  8.369   -33.607 1.00 37.93  ? 548  ARG A CA  1 
ATOM   4353  C  C   . ARG A  1 548 ? 68.199  9.742   -34.270 1.00 38.75  ? 548  ARG A C   1 
ATOM   4354  O  O   . ARG A  1 548 ? 69.184  10.160  -34.876 1.00 39.17  ? 548  ARG A O   1 
ATOM   4355  C  CB  . ARG A  1 548 ? 67.290  7.394   -34.356 1.00 41.21  ? 548  ARG A CB  1 
ATOM   4356  C  CG  . ARG A  1 548 ? 67.667  7.114   -35.818 1.00 40.58  ? 548  ARG A CG  1 
ATOM   4357  C  CD  . ARG A  1 548 ? 69.092  6.580   -35.956 1.00 40.48  ? 548  ARG A CD  1 
ATOM   4358  N  NE  . ARG A  1 548 ? 69.482  5.684   -34.866 1.00 39.39  ? 548  ARG A NE  1 
ATOM   4359  C  CZ  . ARG A  1 548 ? 69.169  4.392   -34.801 1.00 37.71  ? 548  ARG A CZ  1 
ATOM   4360  N  NH1 . ARG A  1 548 ? 69.572  3.663   -33.767 1.00 37.98  ? 548  ARG A NH1 1 
ATOM   4361  N  NH2 . ARG A  1 548 ? 68.446  3.826   -35.761 1.00 35.09  ? 548  ARG A NH2 1 
ATOM   4362  N  N   . CYS A  1 549 ? 67.072  10.435  -34.150 1.00 37.84  ? 549  CYS A N   1 
ATOM   4363  C  CA  . CYS A  1 549 ? 66.942  11.805  -34.628 1.00 37.88  ? 549  CYS A CA  1 
ATOM   4364  C  C   . CYS A  1 549 ? 66.388  12.650  -33.495 1.00 37.60  ? 549  CYS A C   1 
ATOM   4365  O  O   . CYS A  1 549 ? 65.173  12.757  -33.320 1.00 36.46  ? 549  CYS A O   1 
ATOM   4366  C  CB  . CYS A  1 549 ? 66.043  11.890  -35.869 1.00 39.80  ? 549  CYS A CB  1 
ATOM   4367  S  SG  . CYS A  1 549 ? 66.502  10.757  -37.200 1.00 41.50  ? 549  CYS A SG  1 
ATOM   4368  N  N   . PRO A  1 550 ? 67.288  13.251  -32.714 1.00 37.73  ? 550  PRO A N   1 
ATOM   4369  C  CA  . PRO A  1 550 ? 66.959  13.974  -31.488 1.00 36.72  ? 550  PRO A CA  1 
ATOM   4370  C  C   . PRO A  1 550 ? 65.962  15.095  -31.750 1.00 37.84  ? 550  PRO A C   1 
ATOM   4371  O  O   . PRO A  1 550 ? 65.799  15.555  -32.883 1.00 34.64  ? 550  PRO A O   1 
ATOM   4372  C  CB  . PRO A  1 550 ? 68.307  14.549  -31.058 1.00 36.84  ? 550  PRO A CB  1 
ATOM   4373  C  CG  . PRO A  1 550 ? 69.297  13.644  -31.659 1.00 37.62  ? 550  PRO A CG  1 
ATOM   4374  C  CD  . PRO A  1 550 ? 68.731  13.268  -32.983 1.00 38.71  ? 550  PRO A CD  1 
ATOM   4375  N  N   . LEU A  1 551 ? 65.291  15.513  -30.686 1.00 36.82  ? 551  LEU A N   1 
ATOM   4376  C  CA  . LEU A  1 551 ? 64.193  16.457  -30.777 1.00 36.18  ? 551  LEU A CA  1 
ATOM   4377  C  C   . LEU A  1 551 ? 64.553  17.750  -31.515 1.00 36.37  ? 551  LEU A C   1 
ATOM   4378  O  O   . LEU A  1 551 ? 63.684  18.386  -32.113 1.00 36.09  ? 551  LEU A O   1 
ATOM   4379  C  CB  . LEU A  1 551 ? 63.684  16.775  -29.376 1.00 34.74  ? 551  LEU A CB  1 
ATOM   4380  C  CG  . LEU A  1 551 ? 62.669  17.908  -29.300 1.00 33.28  ? 551  LEU A CG  1 
ATOM   4381  C  CD1 . LEU A  1 551 ? 61.320  17.433  -29.818 1.00 32.07  ? 551  LEU A CD1 1 
ATOM   4382  C  CD2 . LEU A  1 551 ? 62.569  18.401  -27.872 1.00 30.94  ? 551  LEU A CD2 1 
ATOM   4383  N  N   . ASP A  1 552 ? 65.826  18.138  -31.473 1.00 35.74  ? 552  ASP A N   1 
ATOM   4384  C  CA  . ASP A  1 552 ? 66.265  19.388  -32.103 1.00 40.93  ? 552  ASP A CA  1 
ATOM   4385  C  C   . ASP A  1 552 ? 65.945  19.447  -33.612 1.00 39.96  ? 552  ASP A C   1 
ATOM   4386  O  O   . ASP A  1 552 ? 65.640  20.514  -34.159 1.00 39.09  ? 552  ASP A O   1 
ATOM   4387  C  CB  . ASP A  1 552 ? 67.764  19.604  -31.868 1.00 42.69  ? 552  ASP A CB  1 
ATOM   4388  C  CG  . ASP A  1 552 ? 68.620  18.531  -32.531 1.00 45.26  ? 552  ASP A CG  1 
ATOM   4389  O  OD1 . ASP A  1 552 ? 69.582  18.880  -33.244 1.00 45.80  ? 552  ASP A OD1 1 
ATOM   4390  O  OD2 . ASP A  1 552 ? 68.330  17.332  -32.343 1.00 46.51  ? 552  ASP A OD2 1 
ATOM   4391  N  N   . GLN A  1 553 ? 66.014  18.296  -34.272 1.00 39.09  ? 553  GLN A N   1 
ATOM   4392  C  CA  . GLN A  1 553 ? 65.803  18.217  -35.713 1.00 37.75  ? 553  GLN A CA  1 
ATOM   4393  C  C   . GLN A  1 553 ? 64.442  18.766  -36.132 1.00 38.07  ? 553  GLN A C   1 
ATOM   4394  O  O   . GLN A  1 553 ? 64.327  19.414  -37.173 1.00 36.64  ? 553  GLN A O   1 
ATOM   4395  C  CB  . GLN A  1 553 ? 65.950  16.771  -36.193 1.00 36.34  ? 553  GLN A CB  1 
ATOM   4396  C  CG  . GLN A  1 553 ? 67.317  16.175  -35.920 1.00 35.03  ? 553  GLN A CG  1 
ATOM   4397  C  CD  . GLN A  1 553 ? 68.395  16.839  -36.746 1.00 35.40  ? 553  GLN A CD  1 
ATOM   4398  O  OE1 . GLN A  1 553 ? 68.119  17.396  -37.812 1.00 36.08  ? 553  GLN A OE1 1 
ATOM   4399  N  NE2 . GLN A  1 553 ? 69.632  16.785  -36.262 1.00 32.89  ? 553  GLN A NE2 1 
ATOM   4400  N  N   . SER A  1 554 ? 63.408  18.457  -35.355 1.00 33.00  ? 554  SER A N   1 
ATOM   4401  C  CA  . SER A  1 554 ? 62.078  18.984  -35.623 1.00 31.82  ? 554  SER A CA  1 
ATOM   4402  C  C   . SER A  1 554 ? 61.918  20.391  -35.079 1.00 34.54  ? 554  SER A C   1 
ATOM   4403  O  O   . SER A  1 554 ? 61.381  21.269  -35.748 1.00 37.06  ? 554  SER A O   1 
ATOM   4404  C  CB  . SER A  1 554 ? 61.007  18.087  -34.997 1.00 31.97  ? 554  SER A CB  1 
ATOM   4405  O  OG  . SER A  1 554 ? 61.137  16.748  -35.429 1.00 31.01  ? 554  SER A OG  1 
ATOM   4406  N  N   . LEU A  1 555 ? 62.398  20.602  -33.861 1.00 32.05  ? 555  LEU A N   1 
ATOM   4407  C  CA  . LEU A  1 555 ? 62.088  21.828  -33.138 1.00 32.54  ? 555  LEU A CA  1 
ATOM   4408  C  C   . LEU A  1 555 ? 62.864  23.020  -33.687 1.00 34.64  ? 555  LEU A C   1 
ATOM   4409  O  O   . LEU A  1 555 ? 62.329  24.127  -33.771 1.00 35.62  ? 555  LEU A O   1 
ATOM   4410  C  CB  . LEU A  1 555 ? 62.344  21.662  -31.638 1.00 31.21  ? 555  LEU A CB  1 
ATOM   4411  C  CG  . LEU A  1 555 ? 61.847  22.784  -30.722 1.00 33.08  ? 555  LEU A CG  1 
ATOM   4412  C  CD1 . LEU A  1 555 ? 60.394  23.169  -31.006 1.00 29.98  ? 555  LEU A CD1 1 
ATOM   4413  C  CD2 . LEU A  1 555 ? 62.020  22.374  -29.268 1.00 34.22  ? 555  LEU A CD2 1 
ATOM   4414  N  N   . MET A  1 556 ? 64.118  22.803  -34.071 1.00 34.69  ? 556  MET A N   1 
ATOM   4415  C  CA  . MET A  1 556 ? 64.893  23.889  -34.654 1.00 35.95  ? 556  MET A CA  1 
ATOM   4416  C  C   . MET A  1 556 ? 64.192  24.374  -35.910 1.00 38.53  ? 556  MET A C   1 
ATOM   4417  O  O   . MET A  1 556 ? 64.046  25.585  -36.136 1.00 36.48  ? 556  MET A O   1 
ATOM   4418  C  CB  . MET A  1 556 ? 66.321  23.450  -34.971 1.00 35.12  ? 556  MET A CB  1 
ATOM   4419  C  CG  . MET A  1 556 ? 67.160  23.232  -33.728 1.00 34.07  ? 556  MET A CG  1 
ATOM   4420  S  SD  . MET A  1 556 ? 68.919  23.071  -34.055 1.00 41.31  ? 556  MET A SD  1 
ATOM   4421  C  CE  . MET A  1 556 ? 68.939  21.575  -35.026 1.00 35.41  ? 556  MET A CE  1 
ATOM   4422  N  N   . PHE A  1 557 ? 63.735  23.416  -36.710 1.00 37.99  ? 557  PHE A N   1 
ATOM   4423  C  CA  . PHE A  1 557 ? 63.052  23.737  -37.947 1.00 39.21  ? 557  PHE A CA  1 
ATOM   4424  C  C   . PHE A  1 557 ? 61.762  24.486  -37.613 1.00 41.11  ? 557  PHE A C   1 
ATOM   4425  O  O   . PHE A  1 557 ? 61.459  25.514  -38.221 1.00 42.80  ? 557  PHE A O   1 
ATOM   4426  C  CB  . PHE A  1 557 ? 62.766  22.457  -38.729 1.00 39.54  ? 557  PHE A CB  1 
ATOM   4427  C  CG  . PHE A  1 557 ? 62.574  22.669  -40.204 1.00 39.16  ? 557  PHE A CG  1 
ATOM   4428  C  CD1 . PHE A  1 557 ? 63.201  23.707  -40.858 1.00 40.03  ? 557  PHE A CD1 1 
ATOM   4429  C  CD2 . PHE A  1 557 ? 61.757  21.824  -40.933 1.00 40.25  ? 557  PHE A CD2 1 
ATOM   4430  C  CE1 . PHE A  1 557 ? 63.020  23.896  -42.215 1.00 40.56  ? 557  PHE A CE1 1 
ATOM   4431  C  CE2 . PHE A  1 557 ? 61.568  22.009  -42.286 1.00 41.31  ? 557  PHE A CE2 1 
ATOM   4432  C  CZ  . PHE A  1 557 ? 62.202  23.045  -42.929 1.00 41.75  ? 557  PHE A CZ  1 
ATOM   4433  N  N   . TYR A  1 558 ? 61.020  23.990  -36.623 1.00 37.53  ? 558  TYR A N   1 
ATOM   4434  C  CA  . TYR A  1 558 ? 59.784  24.651  -36.214 1.00 36.66  ? 558  TYR A CA  1 
ATOM   4435  C  C   . TYR A  1 558 ? 60.012  26.103  -35.770 1.00 38.37  ? 558  TYR A C   1 
ATOM   4436  O  O   . TYR A  1 558 ? 59.284  26.992  -36.206 1.00 42.01  ? 558  TYR A O   1 
ATOM   4437  C  CB  . TYR A  1 558 ? 59.037  23.867  -35.125 1.00 36.07  ? 558  TYR A CB  1 
ATOM   4438  C  CG  . TYR A  1 558 ? 57.837  24.622  -34.583 1.00 37.37  ? 558  TYR A CG  1 
ATOM   4439  C  CD1 . TYR A  1 558 ? 56.625  24.636  -35.269 1.00 37.53  ? 558  TYR A CD1 1 
ATOM   4440  C  CD2 . TYR A  1 558 ? 57.925  25.346  -33.399 1.00 37.26  ? 558  TYR A CD2 1 
ATOM   4441  C  CE1 . TYR A  1 558 ? 55.533  25.343  -34.779 1.00 35.93  ? 558  TYR A CE1 1 
ATOM   4442  C  CE2 . TYR A  1 558 ? 56.846  26.052  -32.906 1.00 34.46  ? 558  TYR A CE2 1 
ATOM   4443  C  CZ  . TYR A  1 558 ? 55.654  26.050  -33.595 1.00 33.53  ? 558  TYR A CZ  1 
ATOM   4444  O  OH  . TYR A  1 558 ? 54.589  26.763  -33.094 1.00 29.95  ? 558  TYR A OH  1 
ATOM   4445  N  N   . HIS A  1 559 ? 61.010  26.352  -34.918 1.00 35.00  ? 559  HIS A N   1 
ATOM   4446  C  CA  . HIS A  1 559 ? 61.260  27.717  -34.438 1.00 33.72  ? 559  HIS A CA  1 
ATOM   4447  C  C   . HIS A  1 559 ? 61.672  28.637  -35.588 1.00 32.09  ? 559  HIS A C   1 
ATOM   4448  O  O   . HIS A  1 559 ? 61.113  29.737  -35.761 1.00 29.02  ? 559  HIS A O   1 
ATOM   4449  C  CB  . HIS A  1 559 ? 62.330  27.754  -33.334 1.00 32.90  ? 559  HIS A CB  1 
ATOM   4450  C  CG  . HIS A  1 559 ? 61.824  27.372  -31.979 1.00 36.24  ? 559  HIS A CG  1 
ATOM   4451  N  ND1 . HIS A  1 559 ? 62.635  26.824  -31.009 1.00 37.42  ? 559  HIS A ND1 1 
ATOM   4452  C  CD2 . HIS A  1 559 ? 60.588  27.458  -31.430 1.00 39.34  ? 559  HIS A CD2 1 
ATOM   4453  C  CE1 . HIS A  1 559 ? 61.921  26.585  -29.924 1.00 38.55  ? 559  HIS A CE1 1 
ATOM   4454  N  NE2 . HIS A  1 559 ? 60.676  26.961  -30.152 1.00 39.24  ? 559  HIS A NE2 1 
ATOM   4455  N  N   . VAL A  1 560 ? 62.659  28.192  -36.363 1.00 30.20  ? 560  VAL A N   1 
ATOM   4456  C  CA  . VAL A  1 560 ? 63.159  28.996  -37.468 1.00 33.30  ? 560  VAL A CA  1 
ATOM   4457  C  C   . VAL A  1 560 ? 62.047  29.347  -38.462 1.00 36.58  ? 560  VAL A C   1 
ATOM   4458  O  O   . VAL A  1 560 ? 61.989  30.468  -38.969 1.00 35.30  ? 560  VAL A O   1 
ATOM   4459  C  CB  . VAL A  1 560 ? 64.301  28.293  -38.189 1.00 34.37  ? 560  VAL A CB  1 
ATOM   4460  C  CG1 . VAL A  1 560 ? 64.733  29.096  -39.394 1.00 36.35  ? 560  VAL A CG1 1 
ATOM   4461  C  CG2 . VAL A  1 560 ? 65.467  28.095  -37.237 1.00 33.70  ? 560  VAL A CG2 1 
ATOM   4462  N  N   . LEU A  1 561 ? 61.156  28.395  -38.721 1.00 36.06  ? 561  LEU A N   1 
ATOM   4463  C  CA  . LEU A  1 561 ? 60.055  28.625  -39.644 1.00 37.53  ? 561  LEU A CA  1 
ATOM   4464  C  C   . LEU A  1 561 ? 59.106  29.689  -39.107 1.00 38.76  ? 561  LEU A C   1 
ATOM   4465  O  O   . LEU A  1 561 ? 58.681  30.572  -39.847 1.00 39.88  ? 561  LEU A O   1 
ATOM   4466  C  CB  . LEU A  1 561 ? 59.305  27.319  -39.944 1.00 39.58  ? 561  LEU A CB  1 
ATOM   4467  C  CG  . LEU A  1 561 ? 60.028  26.302  -40.833 1.00 38.15  ? 561  LEU A CG  1 
ATOM   4468  C  CD1 . LEU A  1 561 ? 59.247  25.006  -40.935 1.00 37.84  ? 561  LEU A CD1 1 
ATOM   4469  C  CD2 . LEU A  1 561 ? 60.279  26.883  -42.210 1.00 38.67  ? 561  LEU A CD2 1 
ATOM   4470  N  N   . LYS A  1 562 ? 58.773  29.609  -37.820 1.00 39.84  ? 562  LYS A N   1 
ATOM   4471  C  CA  . LYS A  1 562 ? 57.924  30.630  -37.203 1.00 39.92  ? 562  LYS A CA  1 
ATOM   4472  C  C   . LYS A  1 562 ? 58.619  31.988  -37.240 1.00 38.40  ? 562  LYS A C   1 
ATOM   4473  O  O   . LYS A  1 562 ? 57.971  33.024  -37.380 1.00 33.36  ? 562  LYS A O   1 
ATOM   4474  C  CB  . LYS A  1 562 ? 57.580  30.283  -35.749 1.00 38.57  ? 562  LYS A CB  1 
ATOM   4475  C  CG  . LYS A  1 562 ? 56.816  28.989  -35.547 1.00 38.62  ? 562  LYS A CG  1 
ATOM   4476  C  CD  . LYS A  1 562 ? 55.428  29.047  -36.157 1.00 38.06  ? 562  LYS A CD  1 
ATOM   4477  C  CE  . LYS A  1 562 ? 54.562  30.118  -35.523 1.00 35.85  ? 562  LYS A CE  1 
ATOM   4478  N  NZ  . LYS A  1 562 ? 53.189  30.062  -36.094 1.00 34.21  ? 562  LYS A NZ  1 
ATOM   4479  N  N   . ASP A  1 563 ? 59.941  31.978  -37.099 1.00 40.64  ? 563  ASP A N   1 
ATOM   4480  C  CA  . ASP A  1 563 ? 60.700  33.217  -37.106 1.00 43.84  ? 563  ASP A CA  1 
ATOM   4481  C  C   . ASP A  1 563 ? 60.540  33.878  -38.472 1.00 44.85  ? 563  ASP A C   1 
ATOM   4482  O  O   . ASP A  1 563 ? 60.563  35.108  -38.595 1.00 48.41  ? 563  ASP A O   1 
ATOM   4483  C  CB  . ASP A  1 563 ? 62.174  32.956  -36.773 1.00 43.86  ? 563  ASP A CB  1 
ATOM   4484  C  CG  . ASP A  1 563 ? 62.863  34.178  -36.181 1.00 45.20  ? 563  ASP A CG  1 
ATOM   4485  O  OD1 . ASP A  1 563 ? 62.157  35.164  -35.882 1.00 45.65  ? 563  ASP A OD1 1 
ATOM   4486  O  OD2 . ASP A  1 563 ? 64.101  34.154  -36.003 1.00 46.50  ? 563  ASP A OD2 1 
ATOM   4487  N  N   . LEU A  1 564 ? 60.347  33.043  -39.488 1.00 38.67  ? 564  LEU A N   1 
ATOM   4488  C  CA  . LEU A  1 564 ? 60.181  33.497  -40.860 1.00 32.70  ? 564  LEU A CA  1 
ATOM   4489  C  C   . LEU A  1 564 ? 58.718  33.679  -41.251 1.00 34.61  ? 564  LEU A C   1 
ATOM   4490  O  O   . LEU A  1 564 ? 58.420  33.946  -42.411 1.00 36.84  ? 564  LEU A O   1 
ATOM   4491  C  CB  . LEU A  1 564 ? 60.847  32.514  -41.808 1.00 28.51  ? 564  LEU A CB  1 
ATOM   4492  C  CG  . LEU A  1 564 ? 62.363  32.466  -41.640 1.00 28.24  ? 564  LEU A CG  1 
ATOM   4493  C  CD1 . LEU A  1 564 ? 62.942  31.255  -42.349 1.00 30.91  ? 564  LEU A CD1 1 
ATOM   4494  C  CD2 . LEU A  1 564 ? 62.987  33.755  -42.151 1.00 21.60  ? 564  LEU A CD2 1 
ATOM   4495  N  N   . GLY A  1 565 ? 57.809  33.494  -40.296 1.00 33.23  ? 565  GLY A N   1 
ATOM   4496  C  CA  . GLY A  1 565 ? 56.396  33.746  -40.526 1.00 33.01  ? 565  GLY A CA  1 
ATOM   4497  C  C   . GLY A  1 565 ? 55.629  32.640  -41.244 1.00 35.71  ? 565  GLY A C   1 
ATOM   4498  O  O   . GLY A  1 565 ? 54.462  32.817  -41.600 1.00 38.44  ? 565  GLY A O   1 
ATOM   4499  N  N   . LYS A  1 566 ? 56.268  31.493  -41.450 1.00 33.71  ? 566  LYS A N   1 
ATOM   4500  C  CA  . LYS A  1 566 ? 55.624  30.361  -42.116 1.00 34.01  ? 566  LYS A CA  1 
ATOM   4501  C  C   . LYS A  1 566 ? 54.476  29.750  -41.301 1.00 37.16  ? 566  LYS A C   1 
ATOM   4502  O  O   . LYS A  1 566 ? 54.411  29.909  -40.086 1.00 36.25  ? 566  LYS A O   1 
ATOM   4503  C  CB  . LYS A  1 566 ? 56.665  29.287  -42.388 1.00 32.23  ? 566  LYS A CB  1 
ATOM   4504  C  CG  . LYS A  1 566 ? 57.910  29.840  -43.017 1.00 32.49  ? 566  LYS A CG  1 
ATOM   4505  C  CD  . LYS A  1 566 ? 57.537  30.717  -44.189 1.00 33.98  ? 566  LYS A CD  1 
ATOM   4506  C  CE  . LYS A  1 566 ? 58.729  30.991  -45.080 1.00 33.34  ? 566  LYS A CE  1 
ATOM   4507  N  NZ  . LYS A  1 566 ? 58.324  31.741  -46.288 1.00 32.68  ? 566  LYS A NZ  1 
ATOM   4508  N  N   . GLU A  1 567 ? 53.572  29.030  -41.959 1.00 40.81  ? 567  GLU A N   1 
ATOM   4509  C  CA  . GLU A  1 567 ? 52.548  28.312  -41.203 1.00 42.45  ? 567  GLU A CA  1 
ATOM   4510  C  C   . GLU A  1 567 ? 53.024  26.895  -40.922 1.00 40.64  ? 567  GLU A C   1 
ATOM   4511  O  O   . GLU A  1 567 ? 53.073  26.051  -41.818 1.00 42.30  ? 567  GLU A O   1 
ATOM   4512  C  CB  . GLU A  1 567 ? 51.228  28.259  -41.970 1.00 40.34  ? 567  GLU A CB  1 
ATOM   4513  C  CG  . GLU A  1 567 ? 50.238  27.253  -41.416 1.00 41.42  ? 567  GLU A CG  1 
ATOM   4514  C  CD  . GLU A  1 567 ? 48.942  27.218  -42.203 1.00 43.93  ? 567  GLU A CD  1 
ATOM   4515  O  OE1 . GLU A  1 567 ? 48.055  26.409  -41.869 1.00 45.41  ? 567  GLU A OE1 1 
ATOM   4516  O  OE2 . GLU A  1 567 ? 48.804  28.002  -43.158 1.00 42.76  ? 567  GLU A OE2 1 
ATOM   4517  N  N   . VAL A  1 568 ? 53.327  26.637  -39.654 1.00 38.01  ? 568  VAL A N   1 
ATOM   4518  C  CA  . VAL A  1 568 ? 53.878  25.362  -39.226 1.00 35.16  ? 568  VAL A CA  1 
ATOM   4519  C  C   . VAL A  1 568 ? 53.336  25.010  -37.840 1.00 35.01  ? 568  VAL A C   1 
ATOM   4520  O  O   . VAL A  1 568 ? 52.813  25.867  -37.122 1.00 34.27  ? 568  VAL A O   1 
ATOM   4521  C  CB  . VAL A  1 568 ? 55.427  25.387  -39.231 1.00 36.52  ? 568  VAL A CB  1 
ATOM   4522  C  CG1 . VAL A  1 568 ? 55.953  26.386  -38.222 1.00 38.72  ? 568  VAL A CG1 1 
ATOM   4523  C  CG2 . VAL A  1 568 ? 56.000  24.003  -38.964 1.00 34.66  ? 568  VAL A CG2 1 
ATOM   4524  N  N   . TYR A  1 569 ? 53.436  23.735  -37.491 1.00 34.52  ? 569  TYR A N   1 
ATOM   4525  C  CA  . TYR A  1 569 ? 52.874  23.225  -36.258 1.00 34.18  ? 569  TYR A CA  1 
ATOM   4526  C  C   . TYR A  1 569 ? 53.725  22.077  -35.764 1.00 35.42  ? 569  TYR A C   1 
ATOM   4527  O  O   . TYR A  1 569 ? 54.222  21.284  -36.551 1.00 36.36  ? 569  TYR A O   1 
ATOM   4528  C  CB  . TYR A  1 569 ? 51.468  22.692  -36.495 1.00 35.62  ? 569  TYR A CB  1 
ATOM   4529  C  CG  . TYR A  1 569 ? 50.525  23.631  -37.194 1.00 40.61  ? 569  TYR A CG  1 
ATOM   4530  C  CD1 . TYR A  1 569 ? 50.381  23.598  -38.577 1.00 40.91  ? 569  TYR A CD1 1 
ATOM   4531  C  CD2 . TYR A  1 569 ? 49.741  24.521  -36.472 1.00 43.37  ? 569  TYR A CD2 1 
ATOM   4532  C  CE1 . TYR A  1 569 ? 49.495  24.441  -39.226 1.00 41.81  ? 569  TYR A CE1 1 
ATOM   4533  C  CE2 . TYR A  1 569 ? 48.848  25.368  -37.113 1.00 45.01  ? 569  TYR A CE2 1 
ATOM   4534  C  CZ  . TYR A  1 569 ? 48.733  25.323  -38.488 1.00 44.65  ? 569  TYR A CZ  1 
ATOM   4535  O  OH  . TYR A  1 569 ? 47.855  26.167  -39.119 1.00 47.00  ? 569  TYR A OH  1 
ATOM   4536  N  N   . ILE A  1 570 ? 53.860  21.954  -34.453 1.00 35.77  ? 570  ILE A N   1 
ATOM   4537  C  CA  . ILE A  1 570 ? 54.635  20.853  -33.916 1.00 35.20  ? 570  ILE A CA  1 
ATOM   4538  C  C   . ILE A  1 570 ? 53.896  20.081  -32.830 1.00 34.51  ? 570  ILE A C   1 
ATOM   4539  O  O   . ILE A  1 570 ? 53.256  20.661  -31.955 1.00 34.63  ? 570  ILE A O   1 
ATOM   4540  C  CB  . ILE A  1 570 ? 55.997  21.326  -33.388 1.00 30.18  ? 570  ILE A CB  1 
ATOM   4541  C  CG1 . ILE A  1 570 ? 56.861  20.116  -33.025 1.00 28.24  ? 570  ILE A CG1 1 
ATOM   4542  C  CG2 . ILE A  1 570 ? 55.803  22.253  -32.206 1.00 26.64  ? 570  ILE A CG2 1 
ATOM   4543  C  CD1 . ILE A  1 570 ? 58.323  20.400  -33.030 1.00 27.11  ? 570  ILE A CD1 1 
ATOM   4544  N  N   . ALA A  1 571 ? 53.992  18.760  -32.912 1.00 32.10  ? 571  ALA A N   1 
ATOM   4545  C  CA  . ALA A  1 571 ? 53.403  17.877  -31.923 1.00 27.73  ? 571  ALA A CA  1 
ATOM   4546  C  C   . ALA A  1 571 ? 54.513  17.040  -31.333 1.00 30.63  ? 571  ALA A C   1 
ATOM   4547  O  O   . ALA A  1 571 ? 55.146  16.265  -32.029 1.00 33.18  ? 571  ALA A O   1 
ATOM   4548  C  CB  . ALA A  1 571 ? 52.351  16.984  -32.563 1.00 23.98  ? 571  ALA A CB  1 
ATOM   4549  N  N   . ILE A  1 572 ? 54.748  17.204  -30.039 1.00 33.24  ? 572  ILE A N   1 
ATOM   4550  C  CA  . ILE A  1 572 ? 55.821  16.499  -29.368 1.00 30.79  ? 572  ILE A CA  1 
ATOM   4551  C  C   . ILE A  1 572 ? 55.235  15.470  -28.411 1.00 33.85  ? 572  ILE A C   1 
ATOM   4552  O  O   . ILE A  1 572 ? 54.598  15.816  -27.422 1.00 33.57  ? 572  ILE A O   1 
ATOM   4553  C  CB  . ILE A  1 572 ? 56.738  17.498  -28.665 1.00 28.06  ? 572  ILE A CB  1 
ATOM   4554  C  CG1 . ILE A  1 572 ? 57.271  18.495  -29.702 1.00 26.07  ? 572  ILE A CG1 1 
ATOM   4555  C  CG2 . ILE A  1 572 ? 57.884  16.781  -27.971 1.00 29.89  ? 572  ILE A CG2 1 
ATOM   4556  C  CD1 . ILE A  1 572 ? 57.747  19.806  -29.134 1.00 24.95  ? 572  ILE A CD1 1 
ATOM   4557  N  N   . PHE A  1 573 ? 55.416  14.199  -28.750 1.00 36.06  ? 573  PHE A N   1 
ATOM   4558  C  CA  . PHE A  1 573 ? 54.857  13.113  -27.960 1.00 38.64  ? 573  PHE A CA  1 
ATOM   4559  C  C   . PHE A  1 573 ? 55.716  12.831  -26.735 1.00 43.05  ? 573  PHE A C   1 
ATOM   4560  O  O   . PHE A  1 573 ? 56.911  12.552  -26.857 1.00 46.13  ? 573  PHE A O   1 
ATOM   4561  C  CB  . PHE A  1 573 ? 54.665  11.861  -28.821 1.00 35.05  ? 573  PHE A CB  1 
ATOM   4562  C  CG  . PHE A  1 573 ? 53.414  11.892  -29.639 1.00 34.32  ? 573  PHE A CG  1 
ATOM   4563  C  CD1 . PHE A  1 573 ? 53.334  12.679  -30.770 1.00 32.95  ? 573  PHE A CD1 1 
ATOM   4564  C  CD2 . PHE A  1 573 ? 52.302  11.154  -29.262 1.00 34.78  ? 573  PHE A CD2 1 
ATOM   4565  C  CE1 . PHE A  1 573 ? 52.173  12.719  -31.522 1.00 33.04  ? 573  PHE A CE1 1 
ATOM   4566  C  CE2 . PHE A  1 573 ? 51.134  11.189  -30.013 1.00 35.59  ? 573  PHE A CE2 1 
ATOM   4567  C  CZ  . PHE A  1 573 ? 51.072  11.973  -31.141 1.00 33.64  ? 573  PHE A CZ  1 
ATOM   4568  N  N   . LYS A  1 574 ? 55.093  12.904  -25.559 1.00 41.12  ? 574  LYS A N   1 
ATOM   4569  C  CA  . LYS A  1 574 ? 55.827  12.904  -24.293 1.00 39.27  ? 574  LYS A CA  1 
ATOM   4570  C  C   . LYS A  1 574 ? 56.659  11.644  -24.061 1.00 41.61  ? 574  LYS A C   1 
ATOM   4571  O  O   . LYS A  1 574 ? 57.707  11.696  -23.436 1.00 43.45  ? 574  LYS A O   1 
ATOM   4572  C  CB  . LYS A  1 574 ? 54.874  13.152  -23.125 1.00 38.26  ? 574  LYS A CB  1 
ATOM   4573  C  CG  . LYS A  1 574 ? 54.041  14.429  -23.283 1.00 40.53  ? 574  LYS A CG  1 
ATOM   4574  C  CD  . LYS A  1 574 ? 53.153  14.694  -22.074 1.00 40.71  ? 574  LYS A CD  1 
ATOM   4575  C  CE  . LYS A  1 574 ? 52.175  15.829  -22.354 1.00 41.39  ? 574  LYS A CE  1 
ATOM   4576  N  NZ  . LYS A  1 574 ? 51.412  16.224  -21.136 1.00 43.47  ? 574  LYS A NZ  1 
ATOM   4577  N  N   . LYS A  1 575 ? 56.209  10.518  -24.596 1.00 42.51  ? 575  LYS A N   1 
ATOM   4578  C  CA  . LYS A  1 575 ? 56.962  9.276   -24.487 1.00 42.24  ? 575  LYS A CA  1 
ATOM   4579  C  C   . LYS A  1 575 ? 57.187  8.682   -25.870 1.00 44.97  ? 575  LYS A C   1 
ATOM   4580  O  O   . LYS A  1 575 ? 56.542  9.079   -26.839 1.00 46.80  ? 575  LYS A O   1 
ATOM   4581  C  CB  . LYS A  1 575 ? 56.228  8.258   -23.609 1.00 40.89  ? 575  LYS A CB  1 
ATOM   4582  C  CG  . LYS A  1 575 ? 55.993  8.718   -22.178 1.00 42.25  ? 575  LYS A CG  1 
ATOM   4583  C  CD  . LYS A  1 575 ? 55.517  7.570   -21.291 1.00 42.92  ? 575  LYS A CD  1 
ATOM   4584  N  N   . GLY A  1 576 ? 58.107  7.728   -25.948 1.00 44.40  ? 576  GLY A N   1 
ATOM   4585  C  CA  . GLY A  1 576 ? 58.348  6.969   -27.160 1.00 44.17  ? 576  GLY A CA  1 
ATOM   4586  C  C   . GLY A  1 576 ? 59.598  7.318   -27.939 1.00 43.16  ? 576  GLY A C   1 
ATOM   4587  O  O   . GLY A  1 576 ? 60.076  8.458   -27.946 1.00 41.85  ? 576  GLY A O   1 
ATOM   4588  N  N   . ALA A  1 577 ? 60.122  6.293   -28.601 1.00 40.15  ? 577  ALA A N   1 
ATOM   4589  C  CA  . ALA A  1 577 ? 61.374  6.371   -29.332 1.00 40.49  ? 577  ALA A CA  1 
ATOM   4590  C  C   . ALA A  1 577 ? 61.167  6.599   -30.829 1.00 42.37  ? 577  ALA A C   1 
ATOM   4591  O  O   . ALA A  1 577 ? 60.059  6.873   -31.281 1.00 41.64  ? 577  ALA A O   1 
ATOM   4592  C  CB  . ALA A  1 577 ? 62.206  5.127   -29.076 1.00 41.35  ? 577  ALA A CB  1 
ATOM   4593  N  N   . HIS A  1 578 ? 62.251  6.482   -31.588 1.00 45.62  ? 578  HIS A N   1 
ATOM   4594  C  CA  . HIS A  1 578 ? 62.250  6.796   -33.008 1.00 44.67  ? 578  HIS A CA  1 
ATOM   4595  C  C   . HIS A  1 578 ? 61.066  6.154   -33.728 1.00 45.85  ? 578  HIS A C   1 
ATOM   4596  O  O   . HIS A  1 578 ? 60.424  6.790   -34.559 1.00 45.40  ? 578  HIS A O   1 
ATOM   4597  C  CB  . HIS A  1 578 ? 63.569  6.336   -33.631 1.00 44.14  ? 578  HIS A CB  1 
ATOM   4598  C  CG  . HIS A  1 578 ? 63.802  6.859   -35.012 1.00 45.84  ? 578  HIS A CG  1 
ATOM   4599  N  ND1 . HIS A  1 578 ? 63.806  8.206   -35.307 1.00 46.93  ? 578  HIS A ND1 1 
ATOM   4600  C  CD2 . HIS A  1 578 ? 64.047  6.217   -36.178 1.00 43.91  ? 578  HIS A CD2 1 
ATOM   4601  C  CE1 . HIS A  1 578 ? 64.042  8.370   -36.596 1.00 47.27  ? 578  HIS A CE1 1 
ATOM   4602  N  NE2 . HIS A  1 578 ? 64.190  7.179   -37.148 1.00 45.89  ? 578  HIS A NE2 1 
ATOM   4603  N  N   . GLY A  1 579 ? 60.762  4.908   -33.385 1.00 43.57  ? 579  GLY A N   1 
ATOM   4604  C  CA  . GLY A  1 579 ? 59.712  4.157   -34.056 1.00 43.31  ? 579  GLY A CA  1 
ATOM   4605  C  C   . GLY A  1 579 ? 58.341  4.205   -33.398 1.00 44.46  ? 579  GLY A C   1 
ATOM   4606  O  O   . GLY A  1 579 ? 57.506  3.325   -33.609 1.00 46.50  ? 579  GLY A O   1 
ATOM   4607  N  N   . HIS A  1 580 ? 58.097  5.238   -32.603 1.00 45.66  ? 580  HIS A N   1 
ATOM   4608  C  CA  . HIS A  1 580 ? 56.890  5.318   -31.778 1.00 44.10  ? 580  HIS A CA  1 
ATOM   4609  C  C   . HIS A  1 580 ? 55.559  5.281   -32.553 1.00 42.95  ? 580  HIS A C   1 
ATOM   4610  O  O   . HIS A  1 580 ? 54.491  5.103   -31.958 1.00 44.80  ? 580  HIS A O   1 
ATOM   4611  C  CB  . HIS A  1 580 ? 56.926  6.602   -30.966 1.00 42.49  ? 580  HIS A CB  1 
ATOM   4612  C  CG  . HIS A  1 580 ? 56.801  7.832   -31.808 1.00 41.08  ? 580  HIS A CG  1 
ATOM   4613  N  ND1 . HIS A  1 580 ? 55.644  8.576   -31.872 1.00 38.21  ? 580  HIS A ND1 1 
ATOM   4614  C  CD2 . HIS A  1 580 ? 57.681  8.429   -32.647 1.00 40.46  ? 580  HIS A CD2 1 
ATOM   4615  C  CE1 . HIS A  1 580 ? 55.824  9.594   -32.695 1.00 38.49  ? 580  HIS A CE1 1 
ATOM   4616  N  NE2 . HIS A  1 580 ? 57.051  9.525   -33.181 1.00 39.02  ? 580  HIS A NE2 1 
ATOM   4617  N  N   . SER A  1 581 ? 55.605  5.467   -33.864 1.00 39.07  ? 581  SER A N   1 
ATOM   4618  C  CA  . SER A  1 581 ? 54.375  5.428   -34.642 1.00 39.29  ? 581  SER A CA  1 
ATOM   4619  C  C   . SER A  1 581 ? 53.768  4.029   -34.616 1.00 38.64  ? 581  SER A C   1 
ATOM   4620  O  O   . SER A  1 581 ? 52.553  3.886   -34.505 1.00 34.56  ? 581  SER A O   1 
ATOM   4621  C  CB  . SER A  1 581 ? 54.608  5.904   -36.076 1.00 37.97  ? 581  SER A CB  1 
ATOM   4622  O  OG  . SER A  1 581 ? 55.632  5.151   -36.701 1.00 41.09  ? 581  SER A OG  1 
ATOM   4623  N  N   . ILE A  1 582 ? 54.590  3.003   -34.836 1.00 46.44  ? 582  ILE A N   1 
ATOM   4624  C  CA  . ILE A  1 582 ? 54.170  1.627   -34.557 1.00 51.74  ? 582  ILE A CA  1 
ATOM   4625  C  C   . ILE A  1 582 ? 54.463  1.045   -33.153 1.00 56.53  ? 582  ILE A C   1 
ATOM   4626  O  O   . ILE A  1 582 ? 53.840  0.061   -32.751 1.00 61.05  ? 582  ILE A O   1 
ATOM   4627  C  CB  . ILE A  1 582 ? 54.775  0.662   -35.600 1.00 53.37  ? 582  ILE A CB  1 
ATOM   4628  C  CG1 . ILE A  1 582 ? 56.297  0.634   -35.463 1.00 53.70  ? 582  ILE A CG1 1 
ATOM   4629  C  CG2 . ILE A  1 582 ? 54.369  1.073   -37.020 1.00 53.11  ? 582  ILE A CG2 1 
ATOM   4630  C  CD1 . ILE A  1 582 ? 56.953  -0.490  -36.214 1.00 54.38  ? 582  ILE A CD1 1 
ATOM   4631  N  N   . ARG A  1 583 ? 55.415  1.622   -32.422 1.00 54.27  ? 583  ARG A N   1 
ATOM   4632  C  CA  . ARG A  1 583 ? 55.803  1.074   -31.113 1.00 53.79  ? 583  ARG A CA  1 
ATOM   4633  C  C   . ARG A  1 583 ? 55.262  1.748   -29.839 1.00 50.94  ? 583  ARG A C   1 
ATOM   4634  O  O   . ARG A  1 583 ? 55.497  1.261   -28.732 1.00 50.77  ? 583  ARG A O   1 
ATOM   4635  C  CB  . ARG A  1 583 ? 57.323  0.951   -31.023 1.00 59.43  ? 583  ARG A CB  1 
ATOM   4636  C  CG  . ARG A  1 583 ? 57.935  0.049   -32.077 1.00 64.66  ? 583  ARG A CG  1 
ATOM   4637  C  CD  . ARG A  1 583 ? 57.464  -1.386  -31.917 1.00 72.77  ? 583  ARG A CD  1 
ATOM   4638  N  NE  . ARG A  1 583 ? 58.390  -2.285  -31.212 1.00 76.20  ? 583  ARG A NE  1 
ATOM   4639  C  CZ  . ARG A  1 583 ? 59.444  -1.918  -30.479 1.00 78.67  ? 583  ARG A CZ  1 
ATOM   4640  N  NH1 . ARG A  1 583 ? 59.759  -0.641  -30.310 1.00 80.06  ? 583  ARG A NH1 1 
ATOM   4641  N  NH2 . ARG A  1 583 ? 60.192  -2.850  -29.900 1.00 78.53  ? 583  ARG A NH2 1 
ATOM   4642  N  N   . GLY A  1 584 ? 54.542  2.854   -29.983 1.00 44.59  ? 584  GLY A N   1 
ATOM   4643  C  CA  . GLY A  1 584 ? 54.115  3.609   -28.821 1.00 39.80  ? 584  GLY A CA  1 
ATOM   4644  C  C   . GLY A  1 584 ? 52.913  2.960   -28.168 1.00 40.01  ? 584  GLY A C   1 
ATOM   4645  O  O   . GLY A  1 584 ? 52.430  1.943   -28.645 1.00 41.00  ? 584  GLY A O   1 
ATOM   4646  N  N   . SER A  1 585 ? 52.424  3.535   -27.074 1.00 40.21  ? 585  SER A N   1 
ATOM   4647  C  CA  . SER A  1 585 ? 51.259  2.968   -26.414 1.00 41.17  ? 585  SER A CA  1 
ATOM   4648  C  C   . SER A  1 585 ? 50.078  3.063   -27.367 1.00 40.16  ? 585  SER A C   1 
ATOM   4649  O  O   . SER A  1 585 ? 50.086  3.892   -28.273 1.00 38.90  ? 585  SER A O   1 
ATOM   4650  C  CB  . SER A  1 585 ? 50.969  3.664   -25.074 1.00 42.58  ? 585  SER A CB  1 
ATOM   4651  O  OG  . SER A  1 585 ? 50.441  4.966   -25.244 1.00 44.38  ? 585  SER A OG  1 
ATOM   4652  N  N   . PRO A  1 586 ? 49.067  2.203   -27.176 1.00 40.34  ? 586  PRO A N   1 
ATOM   4653  C  CA  . PRO A  1 586 ? 47.908  2.223   -28.072 1.00 40.38  ? 586  PRO A CA  1 
ATOM   4654  C  C   . PRO A  1 586 ? 47.272  3.597   -28.131 1.00 43.16  ? 586  PRO A C   1 
ATOM   4655  O  O   . PRO A  1 586 ? 46.983  4.085   -29.215 1.00 44.47  ? 586  PRO A O   1 
ATOM   4656  C  CB  . PRO A  1 586 ? 46.943  1.232   -27.415 1.00 39.49  ? 586  PRO A CB  1 
ATOM   4657  C  CG  . PRO A  1 586 ? 47.827  0.296   -26.666 1.00 40.45  ? 586  PRO A CG  1 
ATOM   4658  C  CD  . PRO A  1 586 ? 48.971  1.132   -26.169 1.00 38.71  ? 586  PRO A CD  1 
ATOM   4659  N  N   . ARG A  1 587 ? 47.070  4.226   -26.980 1.00 42.80  ? 587  ARG A N   1 
ATOM   4660  C  CA  . ARG A  1 587 ? 46.394  5.516   -26.951 1.00 40.18  ? 587  ARG A CA  1 
ATOM   4661  C  C   . ARG A  1 587 ? 47.222  6.568   -27.681 1.00 41.66  ? 587  ARG A C   1 
ATOM   4662  O  O   . ARG A  1 587 ? 46.687  7.399   -28.414 1.00 41.15  ? 587  ARG A O   1 
ATOM   4663  C  CB  . ARG A  1 587 ? 46.128  5.948   -25.513 1.00 37.89  ? 587  ARG A CB  1 
ATOM   4664  C  CG  . ARG A  1 587 ? 45.164  7.109   -25.393 1.00 38.29  ? 587  ARG A CG  1 
ATOM   4665  C  CD  . ARG A  1 587 ? 45.031  7.490   -23.961 1.00 40.96  ? 587  ARG A CD  1 
ATOM   4666  N  NE  . ARG A  1 587 ? 46.345  7.808   -23.420 1.00 45.54  ? 587  ARG A NE  1 
ATOM   4667  C  CZ  . ARG A  1 587 ? 46.696  7.636   -22.153 1.00 47.59  ? 587  ARG A CZ  1 
ATOM   4668  N  NH1 . ARG A  1 587 ? 45.823  7.140   -21.285 1.00 47.44  ? 587  ARG A NH1 1 
ATOM   4669  N  NH2 . ARG A  1 587 ? 47.922  7.956   -21.762 1.00 48.84  ? 587  ARG A NH2 1 
ATOM   4670  N  N   . HIS A  1 588 ? 48.533  6.514   -27.461 1.00 40.75  ? 588  HIS A N   1 
ATOM   4671  C  CA  . HIS A  1 588 ? 49.510  7.351   -28.148 1.00 38.92  ? 588  HIS A CA  1 
ATOM   4672  C  C   . HIS A  1 588 ? 49.392  7.162   -29.668 1.00 35.75  ? 588  HIS A C   1 
ATOM   4673  O  O   . HIS A  1 588 ? 49.105  8.111   -30.407 1.00 32.90  ? 588  HIS A O   1 
ATOM   4674  C  CB  . HIS A  1 588 ? 50.909  6.971   -27.625 1.00 39.97  ? 588  HIS A CB  1 
ATOM   4675  C  CG  . HIS A  1 588 ? 52.057  7.587   -28.369 1.00 44.10  ? 588  HIS A CG  1 
ATOM   4676  N  ND1 . HIS A  1 588 ? 53.271  7.845   -27.767 1.00 45.13  ? 588  HIS A ND1 1 
ATOM   4677  C  CD2 . HIS A  1 588 ? 52.198  7.952   -29.666 1.00 44.71  ? 588  HIS A CD2 1 
ATOM   4678  C  CE1 . HIS A  1 588 ? 54.102  8.364   -28.654 1.00 43.24  ? 588  HIS A CE1 1 
ATOM   4679  N  NE2 . HIS A  1 588 ? 53.476  8.438   -29.814 1.00 43.50  ? 588  HIS A NE2 1 
ATOM   4680  N  N   . ARG A  1 589 ? 49.559  5.925   -30.125 1.00 34.70  ? 589  ARG A N   1 
ATOM   4681  C  CA  . ARG A  1 589 ? 49.486  5.634   -31.553 1.00 37.33  ? 589  ARG A CA  1 
ATOM   4682  C  C   . ARG A  1 589 ? 48.182  6.114   -32.184 1.00 39.53  ? 589  ARG A C   1 
ATOM   4683  O  O   . ARG A  1 589 ? 48.178  6.641   -33.293 1.00 39.97  ? 589  ARG A O   1 
ATOM   4684  C  CB  . ARG A  1 589 ? 49.707  4.142   -31.828 1.00 36.83  ? 589  ARG A CB  1 
ATOM   4685  C  CG  . ARG A  1 589 ? 51.144  3.685   -31.580 1.00 38.31  ? 589  ARG A CG  1 
ATOM   4686  C  CD  . ARG A  1 589 ? 51.319  2.187   -31.838 1.00 39.98  ? 589  ARG A CD  1 
ATOM   4687  N  NE  . ARG A  1 589 ? 51.091  1.842   -33.239 1.00 41.21  ? 589  ARG A NE  1 
ATOM   4688  C  CZ  . ARG A  1 589 ? 50.721  0.639   -33.659 1.00 41.50  ? 589  ARG A CZ  1 
ATOM   4689  N  NH1 . ARG A  1 589 ? 50.532  -0.340  -32.781 1.00 39.02  ? 589  ARG A NH1 1 
ATOM   4690  N  NH2 . ARG A  1 589 ? 50.535  0.413   -34.955 1.00 43.37  ? 589  ARG A NH2 1 
ATOM   4691  N  N   . MET A  1 590 ? 47.075  5.945   -31.482 1.00 37.65  ? 590  MET A N   1 
ATOM   4692  C  CA  . MET A  1 590 ? 45.809  6.381   -32.034 1.00 38.78  ? 590  MET A CA  1 
ATOM   4693  C  C   . MET A  1 590 ? 45.804  7.879   -32.272 1.00 41.48  ? 590  MET A C   1 
ATOM   4694  O  O   . MET A  1 590 ? 45.431  8.334   -33.348 1.00 45.42  ? 590  MET A O   1 
ATOM   4695  C  CB  . MET A  1 590 ? 44.641  6.026   -31.125 1.00 36.93  ? 590  MET A CB  1 
ATOM   4696  C  CG  . MET A  1 590 ? 43.363  6.702   -31.578 1.00 34.60  ? 590  MET A CG  1 
ATOM   4697  S  SD  . MET A  1 590 ? 42.165  6.838   -30.262 1.00 49.33  ? 590  MET A SD  1 
ATOM   4698  C  CE  . MET A  1 590 ? 43.081  7.831   -29.085 1.00 29.12  ? 590  MET A CE  1 
ATOM   4699  N  N   . LYS A  1 591 ? 46.210  8.648   -31.269 1.00 40.15  ? 591  LYS A N   1 
ATOM   4700  C  CA  . LYS A  1 591 ? 46.178  10.098  -31.401 1.00 35.61  ? 591  LYS A CA  1 
ATOM   4701  C  C   . LYS A  1 591 ? 47.078  10.545  -32.546 1.00 34.67  ? 591  LYS A C   1 
ATOM   4702  O  O   . LYS A  1 591 ? 46.753  11.485  -33.270 1.00 35.10  ? 591  LYS A O   1 
ATOM   4703  C  CB  . LYS A  1 591 ? 46.567  10.775  -30.088 1.00 31.76  ? 591  LYS A CB  1 
ATOM   4704  C  CG  . LYS A  1 591 ? 45.545  10.574  -28.998 1.00 29.87  ? 591  LYS A CG  1 
ATOM   4705  C  CD  . LYS A  1 591 ? 45.931  11.301  -27.748 1.00 30.24  ? 591  LYS A CD  1 
ATOM   4706  C  CE  . LYS A  1 591 ? 44.924  11.077  -26.646 1.00 28.83  ? 591  LYS A CE  1 
ATOM   4707  N  NZ  . LYS A  1 591 ? 45.403  11.696  -25.381 1.00 28.21  ? 591  LYS A NZ  1 
ATOM   4708  N  N   . ARG A  1 592 ? 48.194  9.852   -32.733 1.00 33.61  ? 592  ARG A N   1 
ATOM   4709  C  CA  . ARG A  1 592 ? 49.029  10.145  -33.881 1.00 35.17  ? 592  ARG A CA  1 
ATOM   4710  C  C   . ARG A  1 592 ? 48.283  9.892   -35.198 1.00 36.65  ? 592  ARG A C   1 
ATOM   4711  O  O   . ARG A  1 592 ? 48.226  10.768  -36.061 1.00 36.70  ? 592  ARG A O   1 
ATOM   4712  C  CB  . ARG A  1 592 ? 50.339  9.370   -33.850 1.00 32.38  ? 592  ARG A CB  1 
ATOM   4713  C  CG  . ARG A  1 592 ? 51.266  9.859   -34.940 1.00 34.78  ? 592  ARG A CG  1 
ATOM   4714  C  CD  . ARG A  1 592 ? 52.463  8.970   -35.159 1.00 34.37  ? 592  ARG A CD  1 
ATOM   4715  N  NE  . ARG A  1 592 ? 52.890  9.100   -36.543 1.00 36.46  ? 592  ARG A NE  1 
ATOM   4716  C  CZ  . ARG A  1 592 ? 52.438  8.330   -37.527 1.00 37.69  ? 592  ARG A CZ  1 
ATOM   4717  N  NH1 . ARG A  1 592 ? 52.862  8.514   -38.770 1.00 36.95  ? 592  ARG A NH1 1 
ATOM   4718  N  NH2 . ARG A  1 592 ? 51.563  7.370   -37.260 1.00 38.26  ? 592  ARG A NH2 1 
ATOM   4719  N  N   . TYR A  1 593 ? 47.701  8.708   -35.352 1.00 37.59  ? 593  TYR A N   1 
ATOM   4720  C  CA  . TYR A  1 593 ? 46.953  8.403   -36.566 1.00 36.47  ? 593  TYR A CA  1 
ATOM   4721  C  C   . TYR A  1 593 ? 45.892  9.462   -36.827 1.00 39.07  ? 593  TYR A C   1 
ATOM   4722  O  O   . TYR A  1 593 ? 45.795  9.993   -37.939 1.00 39.62  ? 593  TYR A O   1 
ATOM   4723  C  CB  . TYR A  1 593 ? 46.312  7.017   -36.488 1.00 34.70  ? 593  TYR A CB  1 
ATOM   4724  C  CG  . TYR A  1 593 ? 47.308  5.890   -36.583 1.00 34.99  ? 593  TYR A CG  1 
ATOM   4725  C  CD1 . TYR A  1 593 ? 47.265  4.825   -35.698 1.00 36.38  ? 593  TYR A CD1 1 
ATOM   4726  C  CD2 . TYR A  1 593 ? 48.297  5.891   -37.560 1.00 35.01  ? 593  TYR A CD2 1 
ATOM   4727  C  CE1 . TYR A  1 593 ? 48.183  3.794   -35.775 1.00 35.05  ? 593  TYR A CE1 1 
ATOM   4728  C  CE2 . TYR A  1 593 ? 49.220  4.864   -37.644 1.00 34.13  ? 593  TYR A CE2 1 
ATOM   4729  C  CZ  . TYR A  1 593 ? 49.158  3.818   -36.749 1.00 35.10  ? 593  TYR A CZ  1 
ATOM   4730  O  OH  . TYR A  1 593 ? 50.072  2.791   -36.826 1.00 33.01  ? 593  TYR A OH  1 
ATOM   4731  N  N   . LYS A  1 594 ? 45.105  9.769   -35.799 1.00 39.24  ? 594  LYS A N   1 
ATOM   4732  C  CA  . LYS A  1 594 ? 44.041  10.764  -35.925 1.00 41.79  ? 594  LYS A CA  1 
ATOM   4733  C  C   . LYS A  1 594 ? 44.616  12.127  -36.302 1.00 40.04  ? 594  LYS A C   1 
ATOM   4734  O  O   . LYS A  1 594 ? 44.040  12.853  -37.117 1.00 37.91  ? 594  LYS A O   1 
ATOM   4735  C  CB  . LYS A  1 594 ? 43.229  10.863  -34.624 1.00 43.50  ? 594  LYS A CB  1 
ATOM   4736  C  CG  . LYS A  1 594 ? 42.171  11.974  -34.592 1.00 45.77  ? 594  LYS A CG  1 
ATOM   4737  C  CD  . LYS A  1 594 ? 40.892  11.578  -35.323 1.00 49.34  ? 594  LYS A CD  1 
ATOM   4738  C  CE  . LYS A  1 594 ? 39.939  12.765  -35.470 1.00 49.97  ? 594  LYS A CE  1 
ATOM   4739  N  NZ  . LYS A  1 594 ? 38.784  12.487  -36.390 1.00 51.17  ? 594  LYS A NZ  1 
ATOM   4740  N  N   . LEU A  1 595 ? 45.758  12.462  -35.711 1.00 41.36  ? 595  LEU A N   1 
ATOM   4741  C  CA  . LEU A  1 595 ? 46.418  13.727  -35.990 1.00 41.33  ? 595  LEU A CA  1 
ATOM   4742  C  C   . LEU A  1 595 ? 46.903  13.749  -37.429 1.00 40.83  ? 595  LEU A C   1 
ATOM   4743  O  O   . LEU A  1 595 ? 46.612  14.677  -38.174 1.00 40.79  ? 595  LEU A O   1 
ATOM   4744  C  CB  . LEU A  1 595 ? 47.589  13.942  -35.034 1.00 44.82  ? 595  LEU A CB  1 
ATOM   4745  C  CG  . LEU A  1 595 ? 48.246  15.315  -35.121 1.00 46.26  ? 595  LEU A CG  1 
ATOM   4746  C  CD1 . LEU A  1 595 ? 47.257  16.382  -34.693 1.00 45.43  ? 595  LEU A CD1 1 
ATOM   4747  C  CD2 . LEU A  1 595 ? 49.512  15.365  -34.271 1.00 47.86  ? 595  LEU A CD2 1 
ATOM   4748  N  N   . PHE A  1 596 ? 47.651  12.715  -37.799 1.00 38.22  ? 596  PHE A N   1 
ATOM   4749  C  CA  . PHE A  1 596 ? 48.142  12.523  -39.158 1.00 36.97  ? 596  PHE A CA  1 
ATOM   4750  C  C   . PHE A  1 596 ? 46.997  12.670  -40.158 1.00 41.65  ? 596  PHE A C   1 
ATOM   4751  O  O   . PHE A  1 596 ? 47.122  13.342  -41.189 1.00 41.92  ? 596  PHE A O   1 
ATOM   4752  C  CB  . PHE A  1 596 ? 48.748  11.126  -39.250 1.00 35.34  ? 596  PHE A CB  1 
ATOM   4753  C  CG  . PHE A  1 596 ? 49.354  10.809  -40.575 1.00 37.38  ? 596  PHE A CG  1 
ATOM   4754  C  CD1 . PHE A  1 596 ? 50.659  11.171  -40.859 1.00 38.42  ? 596  PHE A CD1 1 
ATOM   4755  C  CD2 . PHE A  1 596 ? 48.626  10.127  -41.539 1.00 36.95  ? 596  PHE A CD2 1 
ATOM   4756  C  CE1 . PHE A  1 596 ? 51.222  10.871  -42.097 1.00 38.74  ? 596  PHE A CE1 1 
ATOM   4757  C  CE2 . PHE A  1 596 ? 49.182  9.825   -42.764 1.00 37.04  ? 596  PHE A CE2 1 
ATOM   4758  C  CZ  . PHE A  1 596 ? 50.479  10.196  -43.045 1.00 36.65  ? 596  PHE A CZ  1 
ATOM   4759  N  N   . MET A  1 597 ? 45.876  12.045  -39.815 1.00 41.65  ? 597  MET A N   1 
ATOM   4760  C  CA  . MET A  1 597 ? 44.670  11.996  -40.633 1.00 42.81  ? 597  MET A CA  1 
ATOM   4761  C  C   . MET A  1 597 ? 44.037  13.372  -40.865 1.00 39.59  ? 597  MET A C   1 
ATOM   4762  O  O   . MET A  1 597 ? 43.828  13.787  -42.005 1.00 40.79  ? 597  MET A O   1 
ATOM   4763  C  CB  . MET A  1 597 ? 43.673  11.091  -39.910 1.00 47.05  ? 597  MET A CB  1 
ATOM   4764  C  CG  . MET A  1 597 ? 42.552  10.497  -40.732 1.00 48.08  ? 597  MET A CG  1 
ATOM   4765  S  SD  . MET A  1 597 ? 41.682  9.304   -39.692 1.00 55.64  ? 597  MET A SD  1 
ATOM   4766  C  CE  . MET A  1 597 ? 40.678  10.397  -38.695 1.00 141.38 ? 597  MET A CE  1 
ATOM   4767  N  N   . GLU A  1 598 ? 43.738  14.078  -39.779 1.00 35.92  ? 598  GLU A N   1 
ATOM   4768  C  CA  . GLU A  1 598 ? 43.026  15.349  -39.872 1.00 39.33  ? 598  GLU A CA  1 
ATOM   4769  C  C   . GLU A  1 598 ? 43.854  16.490  -40.452 1.00 39.20  ? 598  GLU A C   1 
ATOM   4770  O  O   . GLU A  1 598 ? 43.295  17.429  -41.025 1.00 41.87  ? 598  GLU A O   1 
ATOM   4771  C  CB  . GLU A  1 598 ? 42.446  15.761  -38.514 1.00 41.55  ? 598  GLU A CB  1 
ATOM   4772  C  CG  . GLU A  1 598 ? 41.320  14.865  -38.011 1.00 47.50  ? 598  GLU A CG  1 
ATOM   4773  C  CD  . GLU A  1 598 ? 40.048  14.970  -38.842 1.00 50.24  ? 598  GLU A CD  1 
ATOM   4774  O  OE1 . GLU A  1 598 ? 39.799  16.043  -39.434 1.00 49.08  ? 598  GLU A OE1 1 
ATOM   4775  O  OE2 . GLU A  1 598 ? 39.295  13.972  -38.901 1.00 52.93  ? 598  GLU A OE2 1 
ATOM   4776  N  N   . PHE A  1 599 ? 45.174  16.434  -40.295 1.00 37.57  ? 599  PHE A N   1 
ATOM   4777  C  CA  . PHE A  1 599 ? 46.010  17.472  -40.881 1.00 35.75  ? 599  PHE A CA  1 
ATOM   4778  C  C   . PHE A  1 599 ? 45.893  17.393  -42.401 1.00 41.15  ? 599  PHE A C   1 
ATOM   4779  O  O   . PHE A  1 599 ? 45.610  18.393  -43.060 1.00 42.42  ? 599  PHE A O   1 
ATOM   4780  C  CB  . PHE A  1 599 ? 47.470  17.359  -40.434 1.00 31.50  ? 599  PHE A CB  1 
ATOM   4781  C  CG  . PHE A  1 599 ? 48.305  18.557  -40.799 1.00 29.33  ? 599  PHE A CG  1 
ATOM   4782  C  CD1 . PHE A  1 599 ? 48.300  19.696  -40.000 1.00 31.28  ? 599  PHE A CD1 1 
ATOM   4783  C  CD2 . PHE A  1 599 ? 49.080  18.555  -41.944 1.00 28.84  ? 599  PHE A CD2 1 
ATOM   4784  C  CE1 . PHE A  1 599 ? 49.052  20.814  -40.339 1.00 31.27  ? 599  PHE A CE1 1 
ATOM   4785  C  CE2 . PHE A  1 599 ? 49.841  19.664  -42.290 1.00 30.25  ? 599  PHE A CE2 1 
ATOM   4786  C  CZ  . PHE A  1 599 ? 49.826  20.797  -41.487 1.00 32.09  ? 599  PHE A CZ  1 
ATOM   4787  N  N   . PHE A  1 600 ? 46.096  16.203  -42.960 1.00 43.90  ? 600  PHE A N   1 
ATOM   4788  C  CA  . PHE A  1 600 ? 45.946  16.034  -44.401 1.00 41.94  ? 600  PHE A CA  1 
ATOM   4789  C  C   . PHE A  1 600 ? 44.535  16.388  -44.849 1.00 44.21  ? 600  PHE A C   1 
ATOM   4790  O  O   . PHE A  1 600 ? 44.339  17.008  -45.897 1.00 44.16  ? 600  PHE A O   1 
ATOM   4791  C  CB  . PHE A  1 600 ? 46.318  14.616  -44.835 1.00 37.82  ? 600  PHE A CB  1 
ATOM   4792  C  CG  . PHE A  1 600 ? 47.770  14.455  -45.129 1.00 34.19  ? 600  PHE A CG  1 
ATOM   4793  C  CD1 . PHE A  1 600 ? 48.460  13.332  -44.716 1.00 31.42  ? 600  PHE A CD1 1 
ATOM   4794  C  CD2 . PHE A  1 600 ? 48.452  15.447  -45.813 1.00 34.86  ? 600  PHE A CD2 1 
ATOM   4795  C  CE1 . PHE A  1 600 ? 49.802  13.202  -44.983 1.00 32.32  ? 600  PHE A CE1 1 
ATOM   4796  C  CE2 . PHE A  1 600 ? 49.795  15.322  -46.090 1.00 34.89  ? 600  PHE A CE2 1 
ATOM   4797  C  CZ  . PHE A  1 600 ? 50.475  14.201  -45.672 1.00 33.82  ? 600  PHE A CZ  1 
ATOM   4798  N  N   . GLU A  1 601 ? 43.556  15.996  -44.045 1.00 42.31  ? 601  GLU A N   1 
ATOM   4799  C  CA  . GLU A  1 601 ? 42.172  16.316  -44.335 1.00 42.57  ? 601  GLU A CA  1 
ATOM   4800  C  C   . GLU A  1 601 ? 42.002  17.819  -44.475 1.00 41.91  ? 601  GLU A C   1 
ATOM   4801  O  O   . GLU A  1 601 ? 41.368  18.296  -45.415 1.00 45.48  ? 601  GLU A O   1 
ATOM   4802  C  CB  . GLU A  1 601 ? 41.267  15.798  -43.218 1.00 45.01  ? 601  GLU A CB  1 
ATOM   4803  C  CG  . GLU A  1 601 ? 40.959  14.317  -43.307 1.00 48.80  ? 601  GLU A CG  1 
ATOM   4804  C  CD  . GLU A  1 601 ? 40.050  13.995  -44.474 1.00 52.82  ? 601  GLU A CD  1 
ATOM   4805  O  OE1 . GLU A  1 601 ? 40.543  13.448  -45.483 1.00 52.11  ? 601  GLU A OE1 1 
ATOM   4806  O  OE2 . GLU A  1 601 ? 38.841  14.296  -44.383 1.00 56.70  ? 601  GLU A OE2 1 
ATOM   4807  N  N   . ARG A  1 602 ? 42.512  18.562  -43.500 1.00 41.70  ? 602  ARG A N   1 
ATOM   4808  C  CA  . ARG A  1 602 ? 42.344  20.007  -43.510 1.00 37.46  ? 602  ARG A CA  1 
ATOM   4809  C  C   . ARG A  1 602 ? 43.420  20.870  -44.189 1.00 35.47  ? 602  ARG A C   1 
ATOM   4810  O  O   . ARG A  1 602 ? 43.192  22.059  -44.414 1.00 33.44  ? 602  ARG A O   1 
ATOM   4811  C  CB  . ARG A  1 602 ? 42.103  20.478  -42.077 1.00 36.93  ? 602  ARG A CB  1 
ATOM   4812  C  CG  . ARG A  1 602 ? 41.028  19.674  -41.382 1.00 39.09  ? 602  ARG A CG  1 
ATOM   4813  C  CD  . ARG A  1 602 ? 41.190  19.745  -39.877 1.00 46.91  ? 602  ARG A CD  1 
ATOM   4814  N  NE  . ARG A  1 602 ? 40.165  18.984  -39.166 1.00 49.87  ? 602  ARG A NE  1 
ATOM   4815  C  CZ  . ARG A  1 602 ? 38.961  19.455  -38.855 1.00 51.74  ? 602  ARG A CZ  1 
ATOM   4816  N  NH1 . ARG A  1 602 ? 38.610  20.689  -39.195 1.00 47.25  ? 602  ARG A NH1 1 
ATOM   4817  N  NH2 . ARG A  1 602 ? 38.102  18.686  -38.202 1.00 54.27  ? 602  ARG A NH2 1 
ATOM   4818  N  N   . LYS A  1 603 ? 44.609  20.330  -44.442 1.00 37.78  ? 603  LYS A N   1 
ATOM   4819  C  CA  . LYS A  1 603 ? 45.586  21.087  -45.234 1.00 40.34  ? 603  LYS A CA  1 
ATOM   4820  C  C   . LYS A  1 603 ? 45.814  20.709  -46.715 1.00 44.90  ? 603  LYS A C   1 
ATOM   4821  O  O   . LYS A  1 603 ? 46.484  21.442  -47.452 1.00 47.48  ? 603  LYS A O   1 
ATOM   4822  C  CB  . LYS A  1 603 ? 46.905  21.205  -44.465 1.00 40.24  ? 603  LYS A CB  1 
ATOM   4823  C  CG  . LYS A  1 603 ? 46.715  21.767  -43.058 1.00 40.50  ? 603  LYS A CG  1 
ATOM   4824  C  CD  . LYS A  1 603 ? 46.077  23.155  -43.072 1.00 42.51  ? 603  LYS A CD  1 
ATOM   4825  C  CE  . LYS A  1 603 ? 45.875  23.682  -41.644 1.00 42.39  ? 603  LYS A CE  1 
ATOM   4826  N  NZ  . LYS A  1 603 ? 45.570  25.147  -41.561 1.00 40.18  ? 603  LYS A NZ  1 
ATOM   4827  N  N   . LEU A  1 604 ? 45.209  19.616  -47.161 1.00 41.72  ? 604  LEU A N   1 
ATOM   4828  C  CA  . LEU A  1 604 ? 45.555  19.039  -48.456 1.00 38.63  ? 604  LEU A CA  1 
ATOM   4829  C  C   . LEU A  1 604 ? 44.306  18.811  -49.300 1.00 39.64  ? 604  LEU A C   1 
ATOM   4830  O  O   . LEU A  1 604 ? 44.150  19.400  -50.368 1.00 36.22  ? 604  LEU A O   1 
ATOM   4831  C  CB  . LEU A  1 604 ? 46.323  17.731  -48.272 1.00 38.64  ? 604  LEU A CB  1 
ATOM   4832  C  CG  . LEU A  1 604 ? 46.841  17.091  -49.563 1.00 42.30  ? 604  LEU A CG  1 
ATOM   4833  C  CD1 . LEU A  1 604 ? 47.915  17.961  -50.196 1.00 43.45  ? 604  LEU A CD1 1 
ATOM   4834  C  CD2 . LEU A  1 604 ? 47.373  15.680  -49.331 1.00 42.34  ? 604  LEU A CD2 1 
ATOM   4835  N  N   . LYS A  1 605 ? 43.431  17.932  -48.820 1.00 41.74  ? 605  LYS A N   1 
ATOM   4836  C  CA  . LYS A  1 605 ? 42.142  17.707  -49.460 1.00 44.89  ? 605  LYS A CA  1 
ATOM   4837  C  C   . LYS A  1 605 ? 41.390  19.025  -49.669 1.00 49.55  ? 605  LYS A C   1 
ATOM   4838  O  O   . LYS A  1 605 ? 41.187  19.457  -50.807 1.00 53.70  ? 605  LYS A O   1 
ATOM   4839  C  CB  . LYS A  1 605 ? 41.294  16.728  -48.644 1.00 41.72  ? 605  LYS A CB  1 
ATOM   4840  C  CG  . LYS A  1 605 ? 39.908  16.518  -49.223 1.00 38.27  ? 605  LYS A CG  1 
ATOM   4841  C  CD  . LYS A  1 605 ? 39.145  15.434  -48.498 1.00 35.87  ? 605  LYS A CD  1 
ATOM   4842  C  CE  . LYS A  1 605 ? 39.718  14.065  -48.789 1.00 37.21  ? 605  LYS A CE  1 
ATOM   4843  N  NZ  . LYS A  1 605 ? 39.012  13.025  -47.994 1.00 38.04  ? 605  LYS A NZ  1 
ATOM   4844  N  N   . LYS A  1 606 ? 40.967  19.652  -48.574 1.00 48.09  ? 606  LYS A N   1 
ATOM   4845  C  CA  . LYS A  1 606 ? 40.390  20.995  -48.632 1.00 47.81  ? 606  LYS A CA  1 
ATOM   4846  C  C   . LYS A  1 606 ? 41.046  21.870  -47.570 1.00 49.59  ? 606  LYS A C   1 
ATOM   4847  O  O   . LYS A  1 606 ? 40.889  21.608  -46.378 1.00 50.95  ? 606  LYS A O   1 
ATOM   4848  C  CB  . LYS A  1 606 ? 38.877  20.949  -48.397 1.00 44.93  ? 606  LYS A CB  1 
ATOM   4849  N  N   . TYR A  1 607 ? 41.760  22.914  -47.987 1.00 49.20  ? 607  TYR A N   1 
ATOM   4850  C  CA  . TYR A  1 607 ? 42.501  23.746  -47.035 1.00 49.60  ? 607  TYR A CA  1 
ATOM   4851  C  C   . TYR A  1 607 ? 41.620  24.701  -46.245 1.00 51.93  ? 607  TYR A C   1 
ATOM   4852  O  O   . TYR A  1 607 ? 40.722  25.334  -46.797 1.00 54.21  ? 607  TYR A O   1 
ATOM   4853  C  CB  . TYR A  1 607 ? 43.598  24.546  -47.731 1.00 45.46  ? 607  TYR A CB  1 
ATOM   4854  C  CG  . TYR A  1 607 ? 44.306  25.531  -46.819 1.00 47.85  ? 607  TYR A CG  1 
ATOM   4855  C  CD1 . TYR A  1 607 ? 45.434  25.155  -46.099 1.00 49.12  ? 607  TYR A CD1 1 
ATOM   4856  C  CD2 . TYR A  1 607 ? 43.847  26.841  -46.679 1.00 45.29  ? 607  TYR A CD2 1 
ATOM   4857  C  CE1 . TYR A  1 607 ? 46.092  26.058  -45.262 1.00 47.18  ? 607  TYR A CE1 1 
ATOM   4858  C  CE2 . TYR A  1 607 ? 44.494  27.745  -45.853 1.00 44.61  ? 607  TYR A CE2 1 
ATOM   4859  C  CZ  . TYR A  1 607 ? 45.617  27.351  -45.144 1.00 46.22  ? 607  TYR A CZ  1 
ATOM   4860  O  OH  . TYR A  1 607 ? 46.265  28.247  -44.315 1.00 40.17  ? 607  TYR A OH  1 
ATOM   4861  N  N   . GLU A  1 608 ? 41.895  24.805  -44.949 1.00 54.83  ? 608  GLU A N   1 
ATOM   4862  C  CA  . GLU A  1 608 ? 41.233  25.780  -44.089 1.00 54.15  ? 608  GLU A CA  1 
ATOM   4863  C  C   . GLU A  1 608 ? 42.264  26.463  -43.199 1.00 57.93  ? 608  GLU A C   1 
ATOM   4864  O  O   . GLU A  1 608 ? 43.372  25.955  -43.007 1.00 57.61  ? 608  GLU A O   1 
ATOM   4865  C  CB  . GLU A  1 608 ? 40.151  25.113  -43.236 1.00 51.25  ? 608  GLU A CB  1 
ATOM   4866  C  CG  . GLU A  1 608 ? 40.629  23.881  -42.480 1.00 53.15  ? 608  GLU A CG  1 
ATOM   4867  C  CD  . GLU A  1 608 ? 39.556  23.279  -41.586 1.00 54.97  ? 608  GLU A CD  1 
ATOM   4868  O  OE1 . GLU A  1 608 ? 38.403  23.141  -42.044 1.00 55.38  ? 608  GLU A OE1 1 
ATOM   4869  O  OE2 . GLU A  1 608 ? 39.869  22.948  -40.421 1.00 57.40  ? 608  GLU A OE2 1 
ATOM   4870  N  N   . GLU A  1 609 ? 41.908  27.622  -42.660 1.00 59.74  ? 609  GLU A N   1 
ATOM   4871  C  CA  . GLU A  1 609 ? 42.830  28.339  -41.800 1.00 59.43  ? 609  GLU A CA  1 
ATOM   4872  C  C   . GLU A  1 609 ? 42.940  27.688  -40.435 1.00 54.68  ? 609  GLU A C   1 
ATOM   4873  O  O   . GLU A  1 609 ? 41.960  27.175  -39.894 1.00 53.26  ? 609  GLU A O   1 
ATOM   4874  C  CB  . GLU A  1 609 ? 42.435  29.806  -41.672 1.00 62.87  ? 609  GLU A CB  1 
ATOM   4875  C  CG  . GLU A  1 609 ? 43.248  30.701  -42.586 1.00 71.07  ? 609  GLU A CG  1 
ATOM   4876  C  CD  . GLU A  1 609 ? 42.792  32.138  -42.559 1.00 78.62  ? 609  GLU A CD  1 
ATOM   4877  O  OE1 . GLU A  1 609 ? 42.296  32.585  -41.502 1.00 79.92  ? 609  GLU A OE1 1 
ATOM   4878  O  OE2 . GLU A  1 609 ? 42.927  32.816  -43.601 1.00 81.96  ? 609  GLU A OE2 1 
ATOM   4879  N  N   . GLY A  1 610 ? 44.156  27.673  -39.906 1.00 55.05  ? 610  GLY A N   1 
ATOM   4880  C  CA  . GLY A  1 610 ? 44.381  27.262  -38.538 1.00 53.29  ? 610  GLY A CA  1 
ATOM   4881  C  C   . GLY A  1 610 ? 44.279  25.765  -38.351 1.00 54.33  ? 610  GLY A C   1 
ATOM   4882  O  O   . GLY A  1 610 ? 43.707  25.056  -39.180 1.00 55.24  ? 610  GLY A O   1 
ATOM   4883  N  N   . PHE A  1 611 ? 44.849  25.283  -37.253 1.00 55.50  ? 611  PHE A N   1 
ATOM   4884  C  CA  . PHE A  1 611 ? 44.659  23.907  -36.829 1.00 56.50  ? 611  PHE A CA  1 
ATOM   4885  C  C   . PHE A  1 611 ? 44.354  23.922  -35.340 1.00 60.88  ? 611  PHE A C   1 
ATOM   4886  O  O   . PHE A  1 611 ? 45.230  24.237  -34.534 1.00 63.70  ? 611  PHE A O   1 
ATOM   4887  C  CB  . PHE A  1 611 ? 45.943  23.118  -37.081 1.00 53.44  ? 611  PHE A CB  1 
ATOM   4888  C  CG  . PHE A  1 611 ? 45.741  21.634  -37.187 1.00 50.09  ? 611  PHE A CG  1 
ATOM   4889  C  CD1 . PHE A  1 611 ? 45.095  21.091  -38.284 1.00 47.93  ? 611  PHE A CD1 1 
ATOM   4890  C  CD2 . PHE A  1 611 ? 46.228  20.782  -36.208 1.00 47.62  ? 611  PHE A CD2 1 
ATOM   4891  C  CE1 . PHE A  1 611 ? 44.917  19.735  -38.392 1.00 45.75  ? 611  PHE A CE1 1 
ATOM   4892  C  CE2 . PHE A  1 611 ? 46.055  19.422  -36.316 1.00 46.25  ? 611  PHE A CE2 1 
ATOM   4893  C  CZ  . PHE A  1 611 ? 45.399  18.898  -37.409 1.00 46.30  ? 611  PHE A CZ  1 
ATOM   4894  N  N   . ASP A  1 612 ? 43.145  23.536  -34.952 1.00 60.06  ? 612  ASP A N   1 
ATOM   4895  C  CA  . ASP A  1 612 ? 42.817  23.589  -33.541 1.00 56.27  ? 612  ASP A CA  1 
ATOM   4896  C  C   . ASP A  1 612 ? 42.655  22.166  -33.036 1.00 54.27  ? 612  ASP A C   1 
ATOM   4897  O  O   . ASP A  1 612 ? 41.615  21.540  -33.203 1.00 54.04  ? 612  ASP A O   1 
ATOM   4898  C  CB  . ASP A  1 612 ? 41.528  24.396  -33.370 1.00 57.70  ? 612  ASP A CB  1 
ATOM   4899  C  CG  . ASP A  1 612 ? 41.027  24.414  -31.945 1.00 60.19  ? 612  ASP A CG  1 
ATOM   4900  O  OD1 . ASP A  1 612 ? 39.871  24.855  -31.729 1.00 58.22  ? 612  ASP A OD1 1 
ATOM   4901  O  OD2 . ASP A  1 612 ? 41.785  23.987  -31.048 1.00 63.36  ? 612  ASP A OD2 1 
ATOM   4902  N  N   . VAL A  1 613 ? 43.659  21.709  -32.305 1.00 55.13  ? 613  VAL A N   1 
ATOM   4903  C  CA  . VAL A  1 613 ? 43.743  20.309  -31.921 1.00 56.45  ? 613  VAL A CA  1 
ATOM   4904  C  C   . VAL A  1 613 ? 42.777  19.939  -30.797 1.00 58.09  ? 613  VAL A C   1 
ATOM   4905  O  O   . VAL A  1 613 ? 42.316  18.802  -30.720 1.00 58.38  ? 613  VAL A O   1 
ATOM   4906  C  CB  . VAL A  1 613 ? 45.197  19.917  -31.559 1.00 57.65  ? 613  VAL A CB  1 
ATOM   4907  C  CG1 . VAL A  1 613 ? 45.235  18.970  -30.372 1.00 57.59  ? 613  VAL A CG1 1 
ATOM   4908  C  CG2 . VAL A  1 613 ? 45.880  19.301  -32.768 1.00 59.73  ? 613  VAL A CG2 1 
ATOM   4909  N  N   . GLU A  1 614 ? 42.463  20.893  -29.929 1.00 59.87  ? 614  GLU A N   1 
ATOM   4910  C  CA  . GLU A  1 614 ? 41.527  20.621  -28.846 1.00 62.47  ? 614  GLU A CA  1 
ATOM   4911  C  C   . GLU A  1 614 ? 40.179  20.226  -29.440 1.00 62.22  ? 614  GLU A C   1 
ATOM   4912  O  O   . GLU A  1 614 ? 39.601  19.195  -29.083 1.00 60.78  ? 614  GLU A O   1 
ATOM   4913  C  CB  . GLU A  1 614 ? 41.388  21.837  -27.923 1.00 62.74  ? 614  GLU A CB  1 
ATOM   4914  N  N   . LYS A  1 615 ? 39.704  21.049  -30.371 1.00 63.08  ? 615  LYS A N   1 
ATOM   4915  C  CA  . LYS A  1 615 ? 38.428  20.832  -31.040 1.00 63.54  ? 615  LYS A CA  1 
ATOM   4916  C  C   . LYS A  1 615 ? 38.504  19.640  -31.996 1.00 65.18  ? 615  LYS A C   1 
ATOM   4917  O  O   . LYS A  1 615 ? 37.624  18.782  -32.007 1.00 63.46  ? 615  LYS A O   1 
ATOM   4918  C  CB  . LYS A  1 615 ? 38.007  22.110  -31.785 1.00 62.76  ? 615  LYS A CB  1 
ATOM   4919  C  CG  . LYS A  1 615 ? 36.652  22.044  -32.487 1.00 61.77  ? 615  LYS A CG  1 
ATOM   4920  N  N   . ILE A  1 616 ? 39.574  19.585  -32.782 1.00 65.01  ? 616  ILE A N   1 
ATOM   4921  C  CA  . ILE A  1 616 ? 39.716  18.569  -33.818 1.00 65.73  ? 616  ILE A CA  1 
ATOM   4922  C  C   . ILE A  1 616 ? 39.821  17.141  -33.270 1.00 70.93  ? 616  ILE A C   1 
ATOM   4923  O  O   . ILE A  1 616 ? 39.376  16.196  -33.920 1.00 70.89  ? 616  ILE A O   1 
ATOM   4924  C  CB  . ILE A  1 616 ? 40.916  18.872  -34.751 1.00 63.12  ? 616  ILE A CB  1 
ATOM   4925  C  CG1 . ILE A  1 616 ? 40.684  20.178  -35.510 1.00 61.25  ? 616  ILE A CG1 1 
ATOM   4926  C  CG2 . ILE A  1 616 ? 41.112  17.754  -35.749 1.00 63.51  ? 616  ILE A CG2 1 
ATOM   4927  C  CD1 . ILE A  1 616 ? 41.891  20.652  -36.290 1.00 61.07  ? 616  ILE A CD1 1 
ATOM   4928  N  N   . LEU A  1 617 ? 40.401  16.983  -32.083 1.00 74.05  ? 617  LEU A N   1 
ATOM   4929  C  CA  . LEU A  1 617 ? 40.626  15.644  -31.520 1.00 78.29  ? 617  LEU A CA  1 
ATOM   4930  C  C   . LEU A  1 617 ? 39.545  15.121  -30.559 1.00 82.60  ? 617  LEU A C   1 
ATOM   4931  O  O   . LEU A  1 617 ? 39.721  14.063  -29.952 1.00 83.87  ? 617  LEU A O   1 
ATOM   4932  C  CB  . LEU A  1 617 ? 42.031  15.501  -30.922 1.00 78.02  ? 617  LEU A CB  1 
ATOM   4933  C  CG  . LEU A  1 617 ? 43.080  14.987  -31.917 1.00 77.98  ? 617  LEU A CG  1 
ATOM   4934  C  CD1 . LEU A  1 617 ? 43.745  16.132  -32.687 1.00 76.72  ? 617  LEU A CD1 1 
ATOM   4935  C  CD2 . LEU A  1 617 ? 44.125  14.118  -31.218 1.00 78.53  ? 617  LEU A CD2 1 
ATOM   4936  N  N   . LYS A  1 618 ? 38.461  15.888  -30.410 1.00 85.03  ? 618  LYS A N   1 
ATOM   4937  C  CA  . LYS A  1 618 ? 37.243  15.485  -29.680 1.00 86.59  ? 618  LYS A CA  1 
ATOM   4938  C  C   . LYS A  1 618 ? 36.954  16.373  -28.469 1.00 88.19  ? 618  LYS A C   1 
ATOM   4939  O  O   . LYS A  1 618 ? 35.943  17.080  -28.434 1.00 88.92  ? 618  LYS A O   1 
ATOM   4940  C  CB  . LYS A  1 618 ? 37.263  14.005  -29.269 1.00 85.45  ? 618  LYS A CB  1 
ATOM   4941  N  N   . ILE B  1 4   ? 26.050  -34.782 12.810  1.00 93.66  ? 4    ILE B N   1 
ATOM   4942  C  CA  . ILE B  1 4   ? 25.644  -33.391 12.628  1.00 91.74  ? 4    ILE B CA  1 
ATOM   4943  C  C   . ILE B  1 4   ? 24.173  -33.202 12.989  1.00 88.56  ? 4    ILE B C   1 
ATOM   4944  O  O   . ILE B  1 4   ? 23.399  -34.157 13.005  1.00 87.89  ? 4    ILE B O   1 
ATOM   4945  C  CB  . ILE B  1 4   ? 25.859  -32.902 11.165  1.00 68.64  ? 4    ILE B CB  1 
ATOM   4946  C  CG1 . ILE B  1 4   ? 27.158  -33.461 10.578  1.00 67.91  ? 4    ILE B CG1 1 
ATOM   4947  C  CG2 . ILE B  1 4   ? 25.826  -31.373 11.089  1.00 67.96  ? 4    ILE B CG2 1 
ATOM   4948  N  N   . GLU B  1 5   ? 23.802  -31.961 13.286  1.00 86.19  ? 5    GLU B N   1 
ATOM   4949  C  CA  . GLU B  1 5   ? 22.402  -31.592 13.476  1.00 84.76  ? 5    GLU B CA  1 
ATOM   4950  C  C   . GLU B  1 5   ? 22.075  -30.378 12.605  1.00 83.10  ? 5    GLU B C   1 
ATOM   4951  O  O   . GLU B  1 5   ? 22.977  -29.693 12.118  1.00 84.25  ? 5    GLU B O   1 
ATOM   4952  C  CB  . GLU B  1 5   ? 22.103  -31.296 14.948  1.00 84.94  ? 5    GLU B CB  1 
ATOM   4953  N  N   . TRP B  1 6   ? 20.788  -30.118 12.405  1.00 78.88  ? 6    TRP B N   1 
ATOM   4954  C  CA  . TRP B  1 6   ? 20.349  -29.058 11.504  1.00 72.04  ? 6    TRP B CA  1 
ATOM   4955  C  C   . TRP B  1 6   ? 20.286  -27.686 12.172  1.00 68.89  ? 6    TRP B C   1 
ATOM   4956  O  O   . TRP B  1 6   ? 19.645  -27.523 13.209  1.00 68.63  ? 6    TRP B O   1 
ATOM   4957  C  CB  . TRP B  1 6   ? 18.982  -29.406 10.927  1.00 69.47  ? 6    TRP B CB  1 
ATOM   4958  C  CG  . TRP B  1 6   ? 19.002  -30.572 9.998   1.00 68.92  ? 6    TRP B CG  1 
ATOM   4959  C  CD1 . TRP B  1 6   ? 19.069  -31.889 10.337  1.00 67.71  ? 6    TRP B CD1 1 
ATOM   4960  C  CD2 . TRP B  1 6   ? 18.937  -30.527 8.571   1.00 70.88  ? 6    TRP B CD2 1 
ATOM   4961  N  NE1 . TRP B  1 6   ? 19.056  -32.669 9.209   1.00 67.63  ? 6    TRP B NE1 1 
ATOM   4962  C  CE2 . TRP B  1 6   ? 18.976  -31.856 8.110   1.00 69.92  ? 6    TRP B CE2 1 
ATOM   4963  C  CE3 . TRP B  1 6   ? 18.854  -29.489 7.636   1.00 72.07  ? 6    TRP B CE3 1 
ATOM   4964  C  CZ2 . TRP B  1 6   ? 18.933  -32.176 6.758   1.00 71.69  ? 6    TRP B CZ2 1 
ATOM   4965  C  CZ3 . TRP B  1 6   ? 18.813  -29.808 6.294   1.00 72.36  ? 6    TRP B CZ3 1 
ATOM   4966  C  CH2 . TRP B  1 6   ? 18.853  -31.141 5.866   1.00 72.51  ? 6    TRP B CH2 1 
ATOM   4967  N  N   . ASP B  1 7   ? 20.950  -26.706 11.564  1.00 66.58  ? 7    ASP B N   1 
ATOM   4968  C  CA  . ASP B  1 7   ? 20.920  -25.326 12.047  1.00 65.41  ? 7    ASP B CA  1 
ATOM   4969  C  C   . ASP B  1 7   ? 20.906  -24.320 10.891  1.00 61.40  ? 7    ASP B C   1 
ATOM   4970  O  O   . ASP B  1 7   ? 20.750  -24.698 9.732   1.00 60.41  ? 7    ASP B O   1 
ATOM   4971  C  CB  . ASP B  1 7   ? 22.082  -25.043 13.010  1.00 68.94  ? 7    ASP B CB  1 
ATOM   4972  C  CG  . ASP B  1 7   ? 23.443  -25.230 12.366  1.00 74.37  ? 7    ASP B CG  1 
ATOM   4973  O  OD1 . ASP B  1 7   ? 23.545  -25.144 11.121  1.00 76.02  ? 7    ASP B OD1 1 
ATOM   4974  O  OD2 . ASP B  1 7   ? 24.418  -25.455 13.116  1.00 76.18  ? 7    ASP B OD2 1 
ATOM   4975  N  N   . GLU B  1 8   ? 21.049  -23.039 11.220  1.00 58.70  ? 8    GLU B N   1 
ATOM   4976  C  CA  . GLU B  1 8   ? 21.117  -21.985 10.210  1.00 56.43  ? 8    GLU B CA  1 
ATOM   4977  C  C   . GLU B  1 8   ? 22.228  -22.218 9.192   1.00 55.27  ? 8    GLU B C   1 
ATOM   4978  O  O   . GLU B  1 8   ? 22.117  -21.792 8.042   1.00 55.24  ? 8    GLU B O   1 
ATOM   4979  C  CB  . GLU B  1 8   ? 21.349  -20.618 10.860  1.00 54.60  ? 8    GLU B CB  1 
ATOM   4980  C  CG  . GLU B  1 8   ? 20.900  -20.519 12.290  1.00 56.82  ? 8    GLU B CG  1 
ATOM   4981  C  CD  . GLU B  1 8   ? 21.977  -20.916 13.277  1.00 58.64  ? 8    GLU B CD  1 
ATOM   4982  O  OE1 . GLU B  1 8   ? 21.932  -22.059 13.775  1.00 60.15  ? 8    GLU B OE1 1 
ATOM   4983  O  OE2 . GLU B  1 8   ? 22.862  -20.085 13.564  1.00 58.76  ? 8    GLU B OE2 1 
ATOM   4984  N  N   . LYS B  1 9   ? 23.313  -22.857 9.623   1.00 53.89  ? 9    LYS B N   1 
ATOM   4985  C  CA  . LYS B  1 9   ? 24.501  -22.964 8.784   1.00 55.35  ? 9    LYS B CA  1 
ATOM   4986  C  C   . LYS B  1 9   ? 24.620  -24.255 7.995   1.00 56.33  ? 9    LYS B C   1 
ATOM   4987  O  O   . LYS B  1 9   ? 25.574  -24.424 7.241   1.00 57.48  ? 9    LYS B O   1 
ATOM   4988  C  CB  . LYS B  1 9   ? 25.766  -22.816 9.618   1.00 56.20  ? 9    LYS B CB  1 
ATOM   4989  C  CG  . LYS B  1 9   ? 25.583  -22.054 10.892  1.00 57.94  ? 9    LYS B CG  1 
ATOM   4990  C  CD  . LYS B  1 9   ? 26.923  -21.822 11.544  1.00 59.62  ? 9    LYS B CD  1 
ATOM   4991  C  CE  . LYS B  1 9   ? 26.808  -20.815 12.664  1.00 62.59  ? 9    LYS B CE  1 
ATOM   4992  N  NZ  . LYS B  1 9   ? 28.140  -20.256 13.012  1.00 66.43  ? 9    LYS B NZ  1 
ATOM   4993  N  N   . THR B  1 10  ? 23.678  -25.172 8.165   1.00 54.92  ? 10   THR B N   1 
ATOM   4994  C  CA  . THR B  1 10  ? 23.830  -26.482 7.546   1.00 55.57  ? 10   THR B CA  1 
ATOM   4995  C  C   . THR B  1 10  ? 23.875  -26.393 6.024   1.00 56.57  ? 10   THR B C   1 
ATOM   4996  O  O   . THR B  1 10  ? 24.574  -27.170 5.376   1.00 59.06  ? 10   THR B O   1 
ATOM   4997  C  CB  . THR B  1 10  ? 22.734  -27.468 7.987   1.00 54.90  ? 10   THR B CB  1 
ATOM   4998  O  OG1 . THR B  1 10  ? 22.741  -27.579 9.416   1.00 56.74  ? 10   THR B OG1 1 
ATOM   4999  C  CG2 . THR B  1 10  ? 22.983  -28.836 7.382   1.00 51.41  ? 10   THR B CG2 1 
ATOM   5000  N  N   . PHE B  1 11  ? 23.143  -25.435 5.460   1.00 55.12  ? 11   PHE B N   1 
ATOM   5001  C  CA  . PHE B  1 11  ? 23.087  -25.269 4.005   1.00 54.46  ? 11   PHE B CA  1 
ATOM   5002  C  C   . PHE B  1 11  ? 24.470  -24.997 3.405   1.00 51.93  ? 11   PHE B C   1 
ATOM   5003  O  O   . PHE B  1 11  ? 24.672  -25.174 2.205   1.00 50.65  ? 11   PHE B O   1 
ATOM   5004  C  CB  . PHE B  1 11  ? 22.093  -24.163 3.599   1.00 54.01  ? 11   PHE B CB  1 
ATOM   5005  C  CG  . PHE B  1 11  ? 22.613  -22.767 3.810   1.00 53.80  ? 11   PHE B CG  1 
ATOM   5006  C  CD1 . PHE B  1 11  ? 22.631  -22.198 5.073   1.00 54.70  ? 11   PHE B CD1 1 
ATOM   5007  C  CD2 . PHE B  1 11  ? 23.087  -22.026 2.749   1.00 55.39  ? 11   PHE B CD2 1 
ATOM   5008  C  CE1 . PHE B  1 11  ? 23.118  -20.912 5.275   1.00 54.94  ? 11   PHE B CE1 1 
ATOM   5009  C  CE2 . PHE B  1 11  ? 23.574  -20.739 2.944   1.00 56.25  ? 11   PHE B CE2 1 
ATOM   5010  C  CZ  . PHE B  1 11  ? 23.588  -20.183 4.211   1.00 54.59  ? 11   PHE B CZ  1 
ATOM   5011  N  N   . THR B  1 12  ? 25.420  -24.581 4.238   1.00 50.43  ? 12   THR B N   1 
ATOM   5012  C  CA  . THR B  1 12  ? 26.751  -24.258 3.742   1.00 52.67  ? 12   THR B CA  1 
ATOM   5013  C  C   . THR B  1 12  ? 27.634  -25.495 3.627   1.00 56.45  ? 12   THR B C   1 
ATOM   5014  O  O   . THR B  1 12  ? 28.770  -25.408 3.165   1.00 60.01  ? 12   THR B O   1 
ATOM   5015  C  CB  . THR B  1 12  ? 27.469  -23.185 4.602   1.00 61.78  ? 12   THR B CB  1 
ATOM   5016  O  OG1 . THR B  1 12  ? 27.777  -23.715 5.895   1.00 60.99  ? 12   THR B OG1 1 
ATOM   5017  C  CG2 . THR B  1 12  ? 26.606  -21.939 4.751   1.00 62.20  ? 12   THR B CG2 1 
ATOM   5018  N  N   . LYS B  1 13  ? 27.120  -26.648 4.040   1.00 55.86  ? 13   LYS B N   1 
ATOM   5019  C  CA  . LYS B  1 13  ? 27.907  -27.875 3.944   1.00 56.48  ? 13   LYS B CA  1 
ATOM   5020  C  C   . LYS B  1 13  ? 27.602  -28.664 2.668   1.00 58.60  ? 13   LYS B C   1 
ATOM   5021  O  O   . LYS B  1 13  ? 28.218  -29.694 2.396   1.00 61.56  ? 13   LYS B O   1 
ATOM   5022  C  CB  . LYS B  1 13  ? 27.740  -28.736 5.205   1.00 54.13  ? 13   LYS B CB  1 
ATOM   5023  C  CG  . LYS B  1 13  ? 28.321  -28.079 6.458   1.00 52.95  ? 13   LYS B CG  1 
ATOM   5024  C  CD  . LYS B  1 13  ? 28.104  -28.909 7.711   1.00 52.45  ? 13   LYS B CD  1 
ATOM   5025  N  N   . PHE B  1 14  ? 26.670  -28.157 1.871   1.00 56.25  ? 14   PHE B N   1 
ATOM   5026  C  CA  . PHE B  1 14  ? 26.258  -28.842 0.654   1.00 54.84  ? 14   PHE B CA  1 
ATOM   5027  C  C   . PHE B  1 14  ? 27.019  -28.331 -0.560  1.00 52.78  ? 14   PHE B C   1 
ATOM   5028  O  O   . PHE B  1 14  ? 27.363  -27.153 -0.642  1.00 53.47  ? 14   PHE B O   1 
ATOM   5029  C  CB  . PHE B  1 14  ? 24.757  -28.668 0.414   1.00 57.58  ? 14   PHE B CB  1 
ATOM   5030  C  CG  . PHE B  1 14  ? 23.894  -29.123 1.559   1.00 59.11  ? 14   PHE B CG  1 
ATOM   5031  C  CD1 . PHE B  1 14  ? 22.627  -28.589 1.741   1.00 60.51  ? 14   PHE B CD1 1 
ATOM   5032  C  CD2 . PHE B  1 14  ? 24.341  -30.083 2.447   1.00 58.05  ? 14   PHE B CD2 1 
ATOM   5033  C  CE1 . PHE B  1 14  ? 21.824  -29.001 2.791   1.00 59.80  ? 14   PHE B CE1 1 
ATOM   5034  C  CE2 . PHE B  1 14  ? 23.543  -30.497 3.498   1.00 58.16  ? 14   PHE B CE2 1 
ATOM   5035  C  CZ  . PHE B  1 14  ? 22.285  -29.956 3.669   1.00 59.27  ? 14   PHE B CZ  1 
ATOM   5036  N  N   . ALA B  1 15  ? 27.305  -29.236 -1.487  1.00 52.67  ? 15   ALA B N   1 
ATOM   5037  C  CA  . ALA B  1 15  ? 27.859  -28.868 -2.785  1.00 52.27  ? 15   ALA B CA  1 
ATOM   5038  C  C   . ALA B  1 15  ? 26.727  -28.685 -3.786  1.00 52.39  ? 15   ALA B C   1 
ATOM   5039  O  O   . ALA B  1 15  ? 25.950  -29.604 -4.036  1.00 52.92  ? 15   ALA B O   1 
ATOM   5040  C  CB  . ALA B  1 15  ? 28.818  -29.938 -3.274  1.00 51.88  ? 15   ALA B CB  1 
ATOM   5041  N  N   . TYR B  1 16  ? 26.632  -27.493 -4.358  1.00 52.33  ? 16   TYR B N   1 
ATOM   5042  C  CA  . TYR B  1 16  ? 25.581  -27.202 -5.326  1.00 52.79  ? 16   TYR B CA  1 
ATOM   5043  C  C   . TYR B  1 16  ? 26.091  -27.292 -6.772  1.00 51.42  ? 16   TYR B C   1 
ATOM   5044  O  O   . TYR B  1 16  ? 27.068  -26.636 -7.137  1.00 49.96  ? 16   TYR B O   1 
ATOM   5045  C  CB  . TYR B  1 16  ? 24.969  -25.830 -5.024  1.00 51.98  ? 16   TYR B CB  1 
ATOM   5046  C  CG  . TYR B  1 16  ? 24.361  -25.750 -3.632  1.00 51.83  ? 16   TYR B CG  1 
ATOM   5047  C  CD1 . TYR B  1 16  ? 25.120  -25.342 -2.532  1.00 49.29  ? 16   TYR B CD1 1 
ATOM   5048  C  CD2 . TYR B  1 16  ? 23.031  -26.100 -3.415  1.00 51.21  ? 16   TYR B CD2 1 
ATOM   5049  C  CE1 . TYR B  1 16  ? 24.566  -25.279 -1.261  1.00 47.30  ? 16   TYR B CE1 1 
ATOM   5050  C  CE2 . TYR B  1 16  ? 22.468  -26.039 -2.149  1.00 49.74  ? 16   TYR B CE2 1 
ATOM   5051  C  CZ  . TYR B  1 16  ? 23.239  -25.630 -1.078  1.00 47.98  ? 16   TYR B CZ  1 
ATOM   5052  O  OH  . TYR B  1 16  ? 22.673  -25.573 0.175   1.00 46.53  ? 16   TYR B OH  1 
ATOM   5053  N  N   . LEU B  1 17  ? 25.436  -28.118 -7.586  1.00 51.33  ? 17   LEU B N   1 
ATOM   5054  C  CA  . LEU B  1 17  ? 25.839  -28.294 -8.984  1.00 52.86  ? 17   LEU B CA  1 
ATOM   5055  C  C   . LEU B  1 17  ? 24.872  -27.625 -9.957  1.00 53.22  ? 17   LEU B C   1 
ATOM   5056  O  O   . LEU B  1 17  ? 23.654  -27.714 -9.790  1.00 51.40  ? 17   LEU B O   1 
ATOM   5057  C  CB  . LEU B  1 17  ? 25.969  -29.776 -9.324  1.00 53.78  ? 17   LEU B CB  1 
ATOM   5058  C  CG  . LEU B  1 17  ? 26.707  -30.611 -8.280  1.00 54.09  ? 17   LEU B CG  1 
ATOM   5059  C  CD1 . LEU B  1 17  ? 26.960  -32.012 -8.813  1.00 53.35  ? 17   LEU B CD1 1 
ATOM   5060  C  CD2 . LEU B  1 17  ? 28.013  -29.937 -7.883  1.00 54.34  ? 17   LEU B CD2 1 
ATOM   5061  N  N   . SER B  1 18  ? 25.421  -26.974 -10.982 1.00 55.37  ? 18   SER B N   1 
ATOM   5062  C  CA  . SER B  1 18  ? 24.609  -26.209 -11.929 1.00 57.17  ? 18   SER B CA  1 
ATOM   5063  C  C   . SER B  1 18  ? 25.139  -26.212 -13.363 1.00 57.47  ? 18   SER B C   1 
ATOM   5064  O  O   . SER B  1 18  ? 26.302  -26.530 -13.611 1.00 56.27  ? 18   SER B O   1 
ATOM   5065  C  CB  . SER B  1 18  ? 24.468  -24.760 -11.450 1.00 59.05  ? 18   SER B CB  1 
ATOM   5066  O  OG  . SER B  1 18  ? 25.739  -24.162 -11.236 1.00 59.83  ? 18   SER B OG  1 
ATOM   5067  N  N   . ASP B  1 19  ? 24.259  -25.851 -14.295 1.00 60.66  ? 19   ASP B N   1 
ATOM   5068  C  CA  . ASP B  1 19  ? 24.616  -25.601 -15.694 1.00 63.14  ? 19   ASP B CA  1 
ATOM   5069  C  C   . ASP B  1 19  ? 25.422  -26.728 -16.347 1.00 64.64  ? 19   ASP B C   1 
ATOM   5070  O  O   . ASP B  1 19  ? 26.569  -26.524 -16.752 1.00 65.00  ? 19   ASP B O   1 
ATOM   5071  C  CB  . ASP B  1 19  ? 25.367  -24.268 -15.813 1.00 61.67  ? 19   ASP B CB  1 
ATOM   5072  C  CG  . ASP B  1 19  ? 25.516  -23.798 -17.252 1.00 61.13  ? 19   ASP B CG  1 
ATOM   5073  O  OD1 . ASP B  1 19  ? 24.788  -24.308 -18.137 1.00 59.07  ? 19   ASP B OD1 1 
ATOM   5074  O  OD2 . ASP B  1 19  ? 26.361  -22.905 -17.490 1.00 61.54  ? 19   ASP B OD2 1 
ATOM   5075  N  N   . PRO B  1 20  ? 24.814  -27.920 -16.465 1.00 63.25  ? 20   PRO B N   1 
ATOM   5076  C  CA  . PRO B  1 20  ? 25.513  -29.078 -17.026 1.00 63.29  ? 20   PRO B CA  1 
ATOM   5077  C  C   . PRO B  1 20  ? 25.647  -28.962 -18.542 1.00 66.69  ? 20   PRO B C   1 
ATOM   5078  O  O   . PRO B  1 20  ? 24.746  -28.452 -19.213 1.00 68.55  ? 20   PRO B O   1 
ATOM   5079  C  CB  . PRO B  1 20  ? 24.596  -30.239 -16.655 1.00 61.10  ? 20   PRO B CB  1 
ATOM   5080  C  CG  . PRO B  1 20  ? 23.242  -29.643 -16.652 1.00 61.68  ? 20   PRO B CG  1 
ATOM   5081  C  CD  . PRO B  1 20  ? 23.399  -28.215 -16.185 1.00 62.55  ? 20   PRO B CD  1 
ATOM   5082  N  N   . ARG B  1 21  ? 26.766  -29.445 -19.070 1.00 65.51  ? 21   ARG B N   1 
ATOM   5083  C  CA  . ARG B  1 21  ? 27.050  -29.345 -20.490 1.00 64.80  ? 21   ARG B CA  1 
ATOM   5084  C  C   . ARG B  1 21  ? 27.816  -30.579 -20.934 1.00 65.55  ? 21   ARG B C   1 
ATOM   5085  O  O   . ARG B  1 21  ? 28.525  -31.199 -20.137 1.00 64.36  ? 21   ARG B O   1 
ATOM   5086  C  CB  . ARG B  1 21  ? 27.890  -28.101 -20.763 1.00 64.21  ? 21   ARG B CB  1 
ATOM   5087  C  CG  . ARG B  1 21  ? 27.250  -26.799 -20.328 1.00 63.49  ? 21   ARG B CG  1 
ATOM   5088  C  CD  . ARG B  1 21  ? 26.266  -26.301 -21.362 1.00 63.20  ? 21   ARG B CD  1 
ATOM   5089  N  NE  . ARG B  1 21  ? 25.727  -24.997 -20.997 1.00 63.88  ? 21   ARG B NE  1 
ATOM   5090  C  CZ  . ARG B  1 21  ? 25.041  -24.219 -21.826 1.00 64.48  ? 21   ARG B CZ  1 
ATOM   5091  N  NH1 . ARG B  1 21  ? 24.817  -24.619 -23.069 1.00 67.52  ? 21   ARG B NH1 1 
ATOM   5092  N  NH2 . ARG B  1 21  ? 24.582  -23.044 -21.417 1.00 62.14  ? 21   ARG B NH2 1 
ATOM   5093  N  N   . THR B  1 22  ? 27.672  -30.940 -22.205 1.00 66.31  ? 22   THR B N   1 
ATOM   5094  C  CA  . THR B  1 22  ? 28.373  -32.102 -22.719 1.00 68.05  ? 22   THR B CA  1 
ATOM   5095  C  C   . THR B  1 22  ? 28.719  -32.020 -24.205 1.00 70.19  ? 22   THR B C   1 
ATOM   5096  O  O   . THR B  1 22  ? 27.942  -31.511 -25.016 1.00 70.67  ? 22   THR B O   1 
ATOM   5097  C  CB  . THR B  1 22  ? 27.554  -33.371 -22.464 1.00 70.66  ? 22   THR B CB  1 
ATOM   5098  O  OG1 . THR B  1 22  ? 28.238  -34.501 -23.014 1.00 75.52  ? 22   THR B OG1 1 
ATOM   5099  C  CG2 . THR B  1 22  ? 26.183  -33.250 -23.105 1.00 69.34  ? 22   THR B CG2 1 
ATOM   5100  N  N   . ARG B  1 23  ? 29.895  -32.532 -24.549 1.00 72.13  ? 23   ARG B N   1 
ATOM   5101  C  CA  . ARG B  1 23  ? 30.245  -32.823 -25.935 1.00 74.35  ? 23   ARG B CA  1 
ATOM   5102  C  C   . ARG B  1 23  ? 31.070  -34.100 -25.953 1.00 74.01  ? 23   ARG B C   1 
ATOM   5103  O  O   . ARG B  1 23  ? 31.970  -34.283 -25.128 1.00 72.01  ? 23   ARG B O   1 
ATOM   5104  C  CB  . ARG B  1 23  ? 31.031  -31.679 -26.583 1.00 75.45  ? 23   ARG B CB  1 
ATOM   5105  C  CG  . ARG B  1 23  ? 30.268  -30.906 -27.659 1.00 76.33  ? 23   ARG B CG  1 
ATOM   5106  C  CD  . ARG B  1 23  ? 29.408  -29.806 -27.049 1.00 76.23  ? 23   ARG B CD  1 
ATOM   5107  N  NE  . ARG B  1 23  ? 28.985  -28.814 -28.036 1.00 75.12  ? 23   ARG B NE  1 
ATOM   5108  N  N   . LYS B  1 24  ? 30.754  -34.985 -26.892 1.00 75.37  ? 24   LYS B N   1 
ATOM   5109  C  CA  . LYS B  1 24  ? 31.453  -36.261 -27.011 1.00 74.43  ? 24   LYS B CA  1 
ATOM   5110  C  C   . LYS B  1 24  ? 31.520  -37.003 -25.674 1.00 72.98  ? 24   LYS B C   1 
ATOM   5111  O  O   . LYS B  1 24  ? 30.498  -37.224 -25.023 1.00 72.41  ? 24   LYS B O   1 
ATOM   5112  C  CB  . LYS B  1 24  ? 32.858  -36.052 -27.586 1.00 73.32  ? 24   LYS B CB  1 
ATOM   5113  N  N   . ASN B  1 25  ? 32.727  -37.376 -25.267 1.00 72.97  ? 25   ASN B N   1 
ATOM   5114  C  CA  . ASN B  1 25  ? 32.925  -38.134 -24.035 1.00 74.26  ? 25   ASN B CA  1 
ATOM   5115  C  C   . ASN B  1 25  ? 33.145  -37.249 -22.796 1.00 75.08  ? 25   ASN B C   1 
ATOM   5116  O  O   . ASN B  1 25  ? 33.466  -37.749 -21.712 1.00 75.13  ? 25   ASN B O   1 
ATOM   5117  C  CB  . ASN B  1 25  ? 34.058  -39.153 -24.196 1.00 73.53  ? 25   ASN B CB  1 
ATOM   5118  N  N   . LEU B  1 26  ? 33.005  -35.936 -22.971 1.00 73.29  ? 26   LEU B N   1 
ATOM   5119  C  CA  . LEU B  1 26  ? 33.198  -34.982 -21.878 1.00 70.72  ? 26   LEU B CA  1 
ATOM   5120  C  C   . LEU B  1 26  ? 31.897  -34.466 -21.264 1.00 67.28  ? 26   LEU B C   1 
ATOM   5121  O  O   . LEU B  1 26  ? 30.896  -34.279 -21.955 1.00 67.25  ? 26   LEU B O   1 
ATOM   5122  C  CB  . LEU B  1 26  ? 34.017  -33.787 -22.359 1.00 70.74  ? 26   LEU B CB  1 
ATOM   5123  C  CG  . LEU B  1 26  ? 35.428  -34.108 -22.840 1.00 70.46  ? 26   LEU B CG  1 
ATOM   5124  C  CD1 . LEU B  1 26  ? 36.101  -32.849 -23.356 1.00 68.84  ? 26   LEU B CD1 1 
ATOM   5125  C  CD2 . LEU B  1 26  ? 36.233  -34.751 -21.715 1.00 71.07  ? 26   LEU B CD2 1 
ATOM   5126  N  N   . VAL B  1 27  ? 31.930  -34.231 -19.957 1.00 63.62  ? 27   VAL B N   1 
ATOM   5127  C  CA  . VAL B  1 27  ? 30.851  -33.534 -19.267 1.00 61.72  ? 27   VAL B CA  1 
ATOM   5128  C  C   . VAL B  1 27  ? 31.422  -32.386 -18.439 1.00 60.24  ? 27   VAL B C   1 
ATOM   5129  O  O   . VAL B  1 27  ? 32.462  -32.527 -17.788 1.00 60.08  ? 27   VAL B O   1 
ATOM   5130  C  CB  . VAL B  1 27  ? 30.044  -34.481 -18.354 1.00 61.55  ? 27   VAL B CB  1 
ATOM   5131  C  CG1 . VAL B  1 27  ? 29.156  -33.691 -17.414 1.00 60.66  ? 27   VAL B CG1 1 
ATOM   5132  C  CG2 . VAL B  1 27  ? 29.214  -35.435 -19.188 1.00 63.69  ? 27   VAL B CG2 1 
ATOM   5133  N  N   . ALA B  1 28  ? 30.751  -31.242 -18.474 1.00 58.93  ? 28   ALA B N   1 
ATOM   5134  C  CA  . ALA B  1 28  ? 31.192  -30.096 -17.691 1.00 58.02  ? 28   ALA B CA  1 
ATOM   5135  C  C   . ALA B  1 28  ? 30.040  -29.501 -16.889 1.00 56.50  ? 28   ALA B C   1 
ATOM   5136  O  O   . ALA B  1 28  ? 28.897  -29.469 -17.346 1.00 56.40  ? 28   ALA B O   1 
ATOM   5137  C  CB  . ALA B  1 28  ? 31.816  -29.047 -18.593 1.00 57.72  ? 28   ALA B CB  1 
ATOM   5138  N  N   . TYR B  1 29  ? 30.342  -29.034 -15.687 1.00 56.22  ? 29   TYR B N   1 
ATOM   5139  C  CA  . TYR B  1 29  ? 29.327  -28.419 -14.851 1.00 56.92  ? 29   TYR B CA  1 
ATOM   5140  C  C   . TYR B  1 29  ? 29.978  -27.479 -13.852 1.00 60.16  ? 29   TYR B C   1 
ATOM   5141  O  O   . TYR B  1 29  ? 31.196  -27.309 -13.854 1.00 63.34  ? 29   TYR B O   1 
ATOM   5142  C  CB  . TYR B  1 29  ? 28.492  -29.487 -14.146 1.00 56.29  ? 29   TYR B CB  1 
ATOM   5143  C  CG  . TYR B  1 29  ? 29.302  -30.462 -13.325 1.00 57.32  ? 29   TYR B CG  1 
ATOM   5144  C  CD1 . TYR B  1 29  ? 29.982  -31.507 -13.926 1.00 57.60  ? 29   TYR B CD1 1 
ATOM   5145  C  CD2 . TYR B  1 29  ? 29.379  -30.339 -11.947 1.00 58.31  ? 29   TYR B CD2 1 
ATOM   5146  C  CE1 . TYR B  1 29  ? 30.721  -32.399 -13.176 1.00 58.32  ? 29   TYR B CE1 1 
ATOM   5147  C  CE2 . TYR B  1 29  ? 30.111  -31.224 -11.194 1.00 58.00  ? 29   TYR B CE2 1 
ATOM   5148  C  CZ  . TYR B  1 29  ? 30.782  -32.251 -11.810 1.00 58.31  ? 29   TYR B CZ  1 
ATOM   5149  O  OH  . TYR B  1 29  ? 31.514  -33.133 -11.047 1.00 58.44  ? 29   TYR B OH  1 
ATOM   5150  N  N   . VAL B  1 30  ? 29.161  -26.861 -13.006 1.00 60.17  ? 30   VAL B N   1 
ATOM   5151  C  CA  . VAL B  1 30  ? 29.652  -25.872 -12.057 1.00 57.64  ? 30   VAL B CA  1 
ATOM   5152  C  C   . VAL B  1 30  ? 29.429  -26.352 -10.630 1.00 58.76  ? 30   VAL B C   1 
ATOM   5153  O  O   . VAL B  1 30  ? 28.288  -26.559 -10.212 1.00 60.77  ? 30   VAL B O   1 
ATOM   5154  C  CB  . VAL B  1 30  ? 28.921  -24.529 -12.227 1.00 55.02  ? 30   VAL B CB  1 
ATOM   5155  C  CG1 . VAL B  1 30  ? 29.619  -23.441 -11.430 1.00 53.09  ? 30   VAL B CG1 1 
ATOM   5156  C  CG2 . VAL B  1 30  ? 28.825  -24.155 -13.702 1.00 55.13  ? 30   VAL B CG2 1 
ATOM   5157  N  N   . LEU B  1 31  ? 30.521  -26.536 -9.891  1.00 56.29  ? 31   LEU B N   1 
ATOM   5158  C  CA  . LEU B  1 31  ? 30.458  -26.875 -8.473  1.00 52.64  ? 31   LEU B CA  1 
ATOM   5159  C  C   . LEU B  1 31  ? 30.507  -25.598 -7.640  1.00 51.58  ? 31   LEU B C   1 
ATOM   5160  O  O   . LEU B  1 31  ? 31.477  -24.851 -7.707  1.00 51.71  ? 31   LEU B O   1 
ATOM   5161  C  CB  . LEU B  1 31  ? 31.624  -27.788 -8.095  1.00 51.74  ? 31   LEU B CB  1 
ATOM   5162  C  CG  . LEU B  1 31  ? 31.963  -27.914 -6.607  1.00 52.46  ? 31   LEU B CG  1 
ATOM   5163  C  CD1 . LEU B  1 31  ? 30.767  -28.453 -5.831  1.00 54.12  ? 31   LEU B CD1 1 
ATOM   5164  C  CD2 . LEU B  1 31  ? 33.198  -28.787 -6.384  1.00 50.81  ? 31   LEU B CD2 1 
ATOM   5165  N  N   . THR B  1 32  ? 29.462  -25.345 -6.858  1.00 51.90  ? 32   THR B N   1 
ATOM   5166  C  CA  . THR B  1 32  ? 29.379  -24.116 -6.065  1.00 52.18  ? 32   THR B CA  1 
ATOM   5167  C  C   . THR B  1 32  ? 29.278  -24.385 -4.560  1.00 53.38  ? 32   THR B C   1 
ATOM   5168  O  O   . THR B  1 32  ? 28.492  -25.220 -4.118  1.00 57.80  ? 32   THR B O   1 
ATOM   5169  C  CB  . THR B  1 32  ? 28.188  -23.240 -6.514  1.00 52.01  ? 32   THR B CB  1 
ATOM   5170  O  OG1 . THR B  1 32  ? 28.382  -22.835 -7.873  1.00 56.25  ? 32   THR B OG1 1 
ATOM   5171  C  CG2 . THR B  1 32  ? 28.069  -22.006 -5.651  1.00 48.59  ? 32   THR B CG2 1 
ATOM   5172  N  N   . LYS B  1 33  ? 30.081  -23.675 -3.776  1.00 49.17  ? 33   LYS B N   1 
ATOM   5173  C  CA  . LYS B  1 33  ? 30.020  -23.789 -2.325  1.00 47.74  ? 33   LYS B CA  1 
ATOM   5174  C  C   . LYS B  1 33  ? 29.656  -22.436 -1.740  1.00 46.38  ? 33   LYS B C   1 
ATOM   5175  O  O   . LYS B  1 33  ? 30.009  -21.407 -2.297  1.00 48.75  ? 33   LYS B O   1 
ATOM   5176  C  CB  . LYS B  1 33  ? 31.361  -24.266 -1.750  1.00 47.01  ? 33   LYS B CB  1 
ATOM   5177  C  CG  . LYS B  1 33  ? 31.778  -25.668 -2.176  1.00 46.96  ? 33   LYS B CG  1 
ATOM   5178  C  CD  . LYS B  1 33  ? 30.696  -26.702 -1.863  1.00 48.29  ? 33   LYS B CD  1 
ATOM   5179  C  CE  . LYS B  1 33  ? 30.490  -26.865 -0.364  1.00 47.94  ? 33   LYS B CE  1 
ATOM   5180  N  NZ  . LYS B  1 33  ? 31.768  -27.144 0.339   1.00 46.53  ? 33   LYS B NZ  1 
ATOM   5181  N  N   . ALA B  1 34  ? 28.934  -22.430 -0.629  1.00 44.73  ? 34   ALA B N   1 
ATOM   5182  C  CA  . ALA B  1 34  ? 28.664  -21.182 0.063   1.00 41.32  ? 34   ALA B CA  1 
ATOM   5183  C  C   . ALA B  1 34  ? 29.656  -21.048 1.206   1.00 40.97  ? 34   ALA B C   1 
ATOM   5184  O  O   . ALA B  1 34  ? 29.636  -21.830 2.148   1.00 40.24  ? 34   ALA B O   1 
ATOM   5185  C  CB  . ALA B  1 34  ? 27.237  -21.147 0.575   1.00 38.69  ? 34   ALA B CB  1 
ATOM   5186  N  N   . ASN B  1 35  ? 30.539  -20.064 1.102   1.00 42.75  ? 35   ASN B N   1 
ATOM   5187  C  CA  . ASN B  1 35  ? 31.570  -19.847 2.101   1.00 46.73  ? 35   ASN B CA  1 
ATOM   5188  C  C   . ASN B  1 35  ? 31.093  -18.821 3.112   1.00 51.85  ? 35   ASN B C   1 
ATOM   5189  O  O   . ASN B  1 35  ? 30.931  -17.644 2.783   1.00 56.12  ? 35   ASN B O   1 
ATOM   5190  C  CB  . ASN B  1 35  ? 32.846  -19.362 1.422   1.00 49.04  ? 35   ASN B CB  1 
ATOM   5191  C  CG  . ASN B  1 35  ? 33.990  -19.160 2.392   1.00 53.65  ? 35   ASN B CG  1 
ATOM   5192  O  OD1 . ASN B  1 35  ? 33.802  -18.683 3.513   1.00 54.89  ? 35   ASN B OD1 1 
ATOM   5193  N  ND2 . ASN B  1 35  ? 35.195  -19.507 1.954   1.00 54.93  ? 35   ASN B ND2 1 
ATOM   5194  N  N   . LEU B  1 36  ? 30.875  -19.261 4.344   1.00 50.68  ? 36   LEU B N   1 
ATOM   5195  C  CA  . LEU B  1 36  ? 30.330  -18.380 5.363   1.00 52.30  ? 36   LEU B CA  1 
ATOM   5196  C  C   . LEU B  1 36  ? 31.397  -17.424 5.897   1.00 55.12  ? 36   LEU B C   1 
ATOM   5197  O  O   . LEU B  1 36  ? 31.092  -16.301 6.296   1.00 55.49  ? 36   LEU B O   1 
ATOM   5198  C  CB  . LEU B  1 36  ? 29.722  -19.207 6.494   1.00 53.52  ? 36   LEU B CB  1 
ATOM   5199  C  CG  . LEU B  1 36  ? 28.740  -18.551 7.462   1.00 54.40  ? 36   LEU B CG  1 
ATOM   5200  C  CD1 . LEU B  1 36  ? 27.731  -17.678 6.728   1.00 54.71  ? 36   LEU B CD1 1 
ATOM   5201  C  CD2 . LEU B  1 36  ? 28.031  -19.629 8.272   1.00 55.56  ? 36   LEU B CD2 1 
ATOM   5202  N  N   . GLU B  1 37  ? 32.650  -17.867 5.879   1.00 57.96  ? 37   GLU B N   1 
ATOM   5203  C  CA  . GLU B  1 37  ? 33.749  -17.090 6.444   1.00 60.02  ? 37   GLU B CA  1 
ATOM   5204  C  C   . GLU B  1 37  ? 34.059  -15.860 5.609   1.00 58.63  ? 37   GLU B C   1 
ATOM   5205  O  O   . GLU B  1 37  ? 34.232  -14.763 6.144   1.00 58.00  ? 37   GLU B O   1 
ATOM   5206  C  CB  . GLU B  1 37  ? 35.001  -17.955 6.586   1.00 64.38  ? 37   GLU B CB  1 
ATOM   5207  C  CG  . GLU B  1 37  ? 34.998  -18.843 7.822   1.00 69.67  ? 37   GLU B CG  1 
ATOM   5208  C  CD  . GLU B  1 37  ? 33.817  -19.799 7.862   1.00 73.50  ? 37   GLU B CD  1 
ATOM   5209  O  OE1 . GLU B  1 37  ? 33.452  -20.340 6.793   1.00 75.47  ? 37   GLU B OE1 1 
ATOM   5210  O  OE2 . GLU B  1 37  ? 33.259  -20.010 8.964   1.00 73.34  ? 37   GLU B OE2 1 
ATOM   5211  N  N   . SER B  1 38  ? 34.128  -16.056 4.297   1.00 57.27  ? 38   SER B N   1 
ATOM   5212  C  CA  . SER B  1 38  ? 34.392  -14.970 3.365   1.00 53.38  ? 38   SER B CA  1 
ATOM   5213  C  C   . SER B  1 38  ? 33.099  -14.294 2.939   1.00 50.70  ? 38   SER B C   1 
ATOM   5214  O  O   . SER B  1 38  ? 33.121  -13.227 2.326   1.00 48.17  ? 38   SER B O   1 
ATOM   5215  C  CB  . SER B  1 38  ? 35.096  -15.515 2.130   1.00 52.60  ? 38   SER B CB  1 
ATOM   5216  O  OG  . SER B  1 38  ? 34.273  -16.459 1.471   1.00 53.13  ? 38   SER B OG  1 
ATOM   5217  N  N   . ASN B  1 39  ? 31.975  -14.922 3.276   1.00 50.58  ? 39   ASN B N   1 
ATOM   5218  C  CA  . ASN B  1 39  ? 30.656  -14.474 2.835   1.00 49.28  ? 39   ASN B CA  1 
ATOM   5219  C  C   . ASN B  1 39  ? 30.576  -14.319 1.317   1.00 49.67  ? 39   ASN B C   1 
ATOM   5220  O  O   . ASN B  1 39  ? 29.948  -13.393 0.802   1.00 48.97  ? 39   ASN B O   1 
ATOM   5221  C  CB  . ASN B  1 39  ? 30.259  -13.176 3.538   1.00 47.85  ? 39   ASN B CB  1 
ATOM   5222  C  CG  . ASN B  1 39  ? 28.774  -12.889 3.446   1.00 50.50  ? 39   ASN B CG  1 
ATOM   5223  O  OD1 . ASN B  1 39  ? 27.978  -13.748 3.057   1.00 52.32  ? 39   ASN B OD1 1 
ATOM   5224  N  ND2 . ASN B  1 39  ? 28.389  -11.675 3.815   1.00 51.44  ? 39   ASN B ND2 1 
ATOM   5225  N  N   . LYS B  1 40  ? 31.220  -15.235 0.605   1.00 51.03  ? 40   LYS B N   1 
ATOM   5226  C  CA  . LYS B  1 40  ? 31.161  -15.244 -0.853  1.00 52.90  ? 40   LYS B CA  1 
ATOM   5227  C  C   . LYS B  1 40  ? 30.754  -16.626 -1.362  1.00 52.78  ? 40   LYS B C   1 
ATOM   5228  O  O   . LYS B  1 40  ? 30.874  -17.624 -0.641  1.00 52.72  ? 40   LYS B O   1 
ATOM   5229  C  CB  . LYS B  1 40  ? 32.505  -14.816 -1.456  1.00 50.79  ? 40   LYS B CB  1 
ATOM   5230  C  CG  . LYS B  1 40  ? 32.990  -13.458 -0.966  1.00 51.07  ? 40   LYS B CG  1 
ATOM   5231  C  CD  . LYS B  1 40  ? 34.278  -13.016 -1.650  1.00 50.18  ? 40   LYS B CD  1 
ATOM   5232  N  N   . TYR B  1 41  ? 30.243  -16.679 -2.588  1.00 49.80  ? 41   TYR B N   1 
ATOM   5233  C  CA  . TYR B  1 41  ? 29.982  -17.957 -3.228  1.00 49.41  ? 41   TYR B CA  1 
ATOM   5234  C  C   . TYR B  1 41  ? 31.189  -18.319 -4.064  1.00 52.82  ? 41   TYR B C   1 
ATOM   5235  O  O   . TYR B  1 41  ? 31.702  -17.488 -4.819  1.00 52.41  ? 41   TYR B O   1 
ATOM   5236  C  CB  . TYR B  1 41  ? 28.762  -17.887 -4.132  1.00 47.12  ? 41   TYR B CB  1 
ATOM   5237  C  CG  . TYR B  1 41  ? 27.449  -17.917 -3.410  1.00 48.58  ? 41   TYR B CG  1 
ATOM   5238  C  CD1 . TYR B  1 41  ? 26.651  -16.786 -3.342  1.00 50.28  ? 41   TYR B CD1 1 
ATOM   5239  C  CD2 . TYR B  1 41  ? 26.997  -19.079 -2.802  1.00 51.20  ? 41   TYR B CD2 1 
ATOM   5240  C  CE1 . TYR B  1 41  ? 25.434  -16.806 -2.686  1.00 52.32  ? 41   TYR B CE1 1 
ATOM   5241  C  CE2 . TYR B  1 41  ? 25.780  -19.113 -2.140  1.00 53.83  ? 41   TYR B CE2 1 
ATOM   5242  C  CZ  . TYR B  1 41  ? 25.002  -17.970 -2.085  1.00 54.68  ? 41   TYR B CZ  1 
ATOM   5243  O  OH  . TYR B  1 41  ? 23.789  -17.987 -1.431  1.00 55.50  ? 41   TYR B OH  1 
ATOM   5244  N  N   . GLU B  1 42  ? 31.638  -19.563 -3.929  1.00 53.82  ? 42   GLU B N   1 
ATOM   5245  C  CA  . GLU B  1 42  ? 32.789  -20.047 -4.671  1.00 52.05  ? 42   GLU B CA  1 
ATOM   5246  C  C   . GLU B  1 42  ? 32.341  -20.930 -5.827  1.00 51.90  ? 42   GLU B C   1 
ATOM   5247  O  O   . GLU B  1 42  ? 31.554  -21.850 -5.637  1.00 54.53  ? 42   GLU B O   1 
ATOM   5248  C  CB  . GLU B  1 42  ? 33.719  -20.808 -3.736  1.00 51.02  ? 42   GLU B CB  1 
ATOM   5249  C  CG  . GLU B  1 42  ? 34.196  -19.967 -2.571  1.00 52.11  ? 42   GLU B CG  1 
ATOM   5250  C  CD  . GLU B  1 42  ? 35.105  -20.734 -1.637  1.00 56.86  ? 42   GLU B CD  1 
ATOM   5251  O  OE1 . GLU B  1 42  ? 35.150  -21.976 -1.753  1.00 58.91  ? 42   GLU B OE1 1 
ATOM   5252  O  OE2 . GLU B  1 42  ? 35.774  -20.100 -0.790  1.00 57.84  ? 42   GLU B OE2 1 
ATOM   5253  N  N   . ASN B  1 43  ? 32.834  -20.638 -7.026  1.00 49.93  ? 43   ASN B N   1 
ATOM   5254  C  CA  . ASN B  1 43  ? 32.462  -21.401 -8.220  1.00 47.43  ? 43   ASN B CA  1 
ATOM   5255  C  C   . ASN B  1 43  ? 33.642  -22.105 -8.863  1.00 43.76  ? 43   ASN B C   1 
ATOM   5256  O  O   . ASN B  1 43  ? 34.672  -21.498 -9.134  1.00 40.45  ? 43   ASN B O   1 
ATOM   5257  C  CB  . ASN B  1 43  ? 31.793  -20.502 -9.256  1.00 48.62  ? 43   ASN B CB  1 
ATOM   5258  C  CG  . ASN B  1 43  ? 30.482  -19.943 -8.770  1.00 51.24  ? 43   ASN B CG  1 
ATOM   5259  O  OD1 . ASN B  1 43  ? 29.625  -20.678 -8.283  1.00 52.71  ? 43   ASN B OD1 1 
ATOM   5260  N  ND2 . ASN B  1 43  ? 30.320  -18.632 -8.888  1.00 51.30  ? 43   ASN B ND2 1 
ATOM   5261  N  N   . THR B  1 44  ? 33.476  -23.393 -9.116  1.00 45.68  ? 44   THR B N   1 
ATOM   5262  C  CA  . THR B  1 44  ? 34.533  -24.194 -9.700  1.00 49.26  ? 44   THR B CA  1 
ATOM   5263  C  C   . THR B  1 44  ? 33.963  -25.038 -10.831 1.00 52.65  ? 44   THR B C   1 
ATOM   5264  O  O   . THR B  1 44  ? 33.015  -25.801 -10.631 1.00 54.74  ? 44   THR B O   1 
ATOM   5265  C  CB  . THR B  1 44  ? 35.195  -25.099 -8.635  1.00 50.95  ? 44   THR B CB  1 
ATOM   5266  O  OG1 . THR B  1 44  ? 35.634  -24.299 -7.528  1.00 50.85  ? 44   THR B OG1 1 
ATOM   5267  C  CG2 . THR B  1 44  ? 36.387  -25.841 -9.223  1.00 51.30  ? 44   THR B CG2 1 
ATOM   5268  N  N   . ILE B  1 45  ? 34.522  -24.881 -12.026 1.00 51.62  ? 45   ILE B N   1 
ATOM   5269  C  CA  . ILE B  1 45  ? 34.102  -25.701 -13.149 1.00 51.43  ? 45   ILE B CA  1 
ATOM   5270  C  C   . ILE B  1 45  ? 34.762  -27.067 -13.046 1.00 53.85  ? 45   ILE B C   1 
ATOM   5271  O  O   . ILE B  1 45  ? 35.984  -27.170 -12.890 1.00 55.52  ? 45   ILE B O   1 
ATOM   5272  C  CB  . ILE B  1 45  ? 34.453  -25.055 -14.504 1.00 48.68  ? 45   ILE B CB  1 
ATOM   5273  C  CG1 . ILE B  1 45  ? 33.742  -23.708 -14.644 1.00 46.21  ? 45   ILE B CG1 1 
ATOM   5274  C  CG2 . ILE B  1 45  ? 34.104  -26.008 -15.663 1.00 46.15  ? 45   ILE B CG2 1 
ATOM   5275  C  CD1 . ILE B  1 45  ? 33.890  -23.073 -16.007 1.00 46.52  ? 45   ILE B CD1 1 
ATOM   5276  N  N   . VAL B  1 46  ? 33.946  -28.112 -13.114 1.00 53.76  ? 46   VAL B N   1 
ATOM   5277  C  CA  . VAL B  1 46  ? 34.451  -29.477 -13.128 1.00 55.87  ? 46   VAL B CA  1 
ATOM   5278  C  C   . VAL B  1 46  ? 34.206  -30.124 -14.486 1.00 59.50  ? 46   VAL B C   1 
ATOM   5279  O  O   . VAL B  1 46  ? 33.102  -30.066 -15.028 1.00 60.78  ? 46   VAL B O   1 
ATOM   5280  C  CB  . VAL B  1 46  ? 33.800  -30.337 -12.032 1.00 54.34  ? 46   VAL B CB  1 
ATOM   5281  C  CG1 . VAL B  1 46  ? 34.304  -31.772 -12.116 1.00 51.20  ? 46   VAL B CG1 1 
ATOM   5282  C  CG2 . VAL B  1 46  ? 34.082  -29.737 -10.659 1.00 54.57  ? 46   VAL B CG2 1 
ATOM   5283  N  N   . ILE B  1 47  ? 35.249  -30.736 -15.033 1.00 61.33  ? 47   ILE B N   1 
ATOM   5284  C  CA  . ILE B  1 47  ? 35.160  -31.430 -16.312 1.00 62.72  ? 47   ILE B CA  1 
ATOM   5285  C  C   . ILE B  1 47  ? 35.513  -32.901 -16.108 1.00 66.73  ? 47   ILE B C   1 
ATOM   5286  O  O   . ILE B  1 47  ? 36.634  -33.231 -15.710 1.00 67.29  ? 47   ILE B O   1 
ATOM   5287  C  CB  . ILE B  1 47  ? 36.103  -30.795 -17.360 1.00 58.67  ? 47   ILE B CB  1 
ATOM   5288  C  CG1 . ILE B  1 47  ? 35.748  -29.320 -17.560 1.00 60.52  ? 47   ILE B CG1 1 
ATOM   5289  C  CG2 . ILE B  1 47  ? 36.011  -31.532 -18.672 1.00 54.63  ? 47   ILE B CG2 1 
ATOM   5290  C  CD1 . ILE B  1 47  ? 36.786  -28.526 -18.328 1.00 61.56  ? 47   ILE B CD1 1 
ATOM   5291  N  N   . GLU B  1 48  ? 34.547  -33.781 -16.359 1.00 69.90  ? 48   GLU B N   1 
ATOM   5292  C  CA  . GLU B  1 48  ? 34.764  -35.215 -16.188 1.00 74.48  ? 48   GLU B CA  1 
ATOM   5293  C  C   . GLU B  1 48  ? 34.828  -35.951 -17.519 1.00 80.57  ? 48   GLU B C   1 
ATOM   5294  O  O   . GLU B  1 48  ? 34.059  -35.672 -18.440 1.00 81.30  ? 48   GLU B O   1 
ATOM   5295  C  CB  . GLU B  1 48  ? 33.677  -35.837 -15.308 1.00 73.79  ? 48   GLU B CB  1 
ATOM   5296  C  CG  . GLU B  1 48  ? 33.546  -35.191 -13.938 1.00 73.77  ? 48   GLU B CG  1 
ATOM   5297  C  CD  . GLU B  1 48  ? 32.833  -36.071 -12.930 1.00 72.33  ? 48   GLU B CD  1 
ATOM   5298  O  OE1 . GLU B  1 48  ? 32.657  -37.277 -13.203 1.00 72.77  ? 48   GLU B OE1 1 
ATOM   5299  O  OE2 . GLU B  1 48  ? 32.453  -35.554 -11.859 1.00 70.47  ? 48   GLU B OE2 1 
ATOM   5300  N  N   . ASN B  1 49  ? 35.760  -36.892 -17.610 1.00 85.28  ? 49   ASN B N   1 
ATOM   5301  C  CA  . ASN B  1 49  ? 35.851  -37.773 -18.762 1.00 89.60  ? 49   ASN B CA  1 
ATOM   5302  C  C   . ASN B  1 49  ? 35.052  -39.032 -18.482 1.00 91.00  ? 49   ASN B C   1 
ATOM   5303  O  O   . ASN B  1 49  ? 35.369  -39.776 -17.558 1.00 92.32  ? 49   ASN B O   1 
ATOM   5304  C  CB  . ASN B  1 49  ? 37.306  -38.140 -19.037 1.00 92.51  ? 49   ASN B CB  1 
ATOM   5305  C  CG  . ASN B  1 49  ? 37.451  -39.066 -20.219 1.00 95.17  ? 49   ASN B CG  1 
ATOM   5306  O  OD1 . ASN B  1 49  ? 36.808  -38.876 -21.251 1.00 96.72  ? 49   ASN B OD1 1 
ATOM   5307  N  ND2 . ASN B  1 49  ? 38.281  -40.088 -20.071 1.00 95.86  ? 49   ASN B ND2 1 
ATOM   5308  N  N   . LEU B  1 50  ? 34.015  -39.273 -19.272 1.00 91.15  ? 50   LEU B N   1 
ATOM   5309  C  CA  . LEU B  1 50  ? 33.091  -40.360 -18.966 1.00 91.43  ? 50   LEU B CA  1 
ATOM   5310  C  C   . LEU B  1 50  ? 33.706  -41.759 -19.011 1.00 93.99  ? 50   LEU B C   1 
ATOM   5311  O  O   . LEU B  1 50  ? 34.476  -42.106 -19.913 1.00 93.30  ? 50   LEU B O   1 
ATOM   5312  C  CB  . LEU B  1 50  ? 31.841  -40.276 -19.838 1.00 89.63  ? 50   LEU B CB  1 
ATOM   5313  C  CG  . LEU B  1 50  ? 31.061  -38.980 -19.615 1.00 89.48  ? 50   LEU B CG  1 
ATOM   5314  C  CD1 . LEU B  1 50  ? 29.898  -38.853 -20.586 1.00 90.36  ? 50   LEU B CD1 1 
ATOM   5315  C  CD2 . LEU B  1 50  ? 30.580  -38.903 -18.176 1.00 89.44  ? 50   LEU B CD2 1 
ATOM   5316  N  N   . GLU B  1 51  ? 33.341  -42.542 -18.001 1.00 96.83  ? 51   GLU B N   1 
ATOM   5317  C  CA  . GLU B  1 51  ? 33.761  -43.928 -17.831 1.00 99.76  ? 51   GLU B CA  1 
ATOM   5318  C  C   . GLU B  1 51  ? 35.126  -44.199 -17.184 1.00 101.63 ? 51   GLU B C   1 
ATOM   5319  O  O   . GLU B  1 51  ? 35.401  -45.341 -16.810 1.00 102.31 ? 51   GLU B O   1 
ATOM   5320  N  N   . ASP B  1 52  ? 35.997  -43.196 -17.071 1.00 101.44 ? 52   ASP B N   1 
ATOM   5321  C  CA  . ASP B  1 52  ? 37.091  -43.290 -16.095 1.00 99.97  ? 52   ASP B CA  1 
ATOM   5322  C  C   . ASP B  1 52  ? 36.838  -42.511 -14.797 1.00 98.30  ? 52   ASP B C   1 
ATOM   5323  O  O   . ASP B  1 52  ? 37.621  -42.593 -13.851 1.00 99.53  ? 52   ASP B O   1 
ATOM   5324  C  CB  . ASP B  1 52  ? 38.453  -42.946 -16.707 1.00 100.30 ? 52   ASP B CB  1 
ATOM   5325  C  CG  . ASP B  1 52  ? 38.571  -41.495 -17.105 1.00 101.88 ? 52   ASP B CG  1 
ATOM   5326  O  OD1 . ASP B  1 52  ? 39.332  -41.214 -18.051 1.00 103.37 ? 52   ASP B OD1 1 
ATOM   5327  O  OD2 . ASP B  1 52  ? 37.922  -40.636 -16.475 1.00 102.13 ? 52   ASP B OD2 1 
ATOM   5328  N  N   . GLY B  1 53  ? 35.728  -41.782 -14.753 1.00 94.86  ? 53   GLY B N   1 
ATOM   5329  C  CA  . GLY B  1 53  ? 35.401  -40.948 -13.612 1.00 90.69  ? 53   GLY B CA  1 
ATOM   5330  C  C   . GLY B  1 53  ? 36.472  -39.937 -13.233 1.00 87.69  ? 53   GLY B C   1 
ATOM   5331  O  O   . GLY B  1 53  ? 36.514  -39.482 -12.090 1.00 89.14  ? 53   GLY B O   1 
ATOM   5332  N  N   . SER B  1 54  ? 37.332  -39.571 -14.182 1.00 82.86  ? 54   SER B N   1 
ATOM   5333  C  CA  . SER B  1 54  ? 38.382  -38.584 -13.920 1.00 77.48  ? 54   SER B CA  1 
ATOM   5334  C  C   . SER B  1 54  ? 37.862  -37.144 -14.034 1.00 74.21  ? 54   SER B C   1 
ATOM   5335  O  O   . SER B  1 54  ? 36.963  -36.859 -14.834 1.00 74.60  ? 54   SER B O   1 
ATOM   5336  C  CB  . SER B  1 54  ? 39.581  -38.795 -14.849 1.00 75.12  ? 54   SER B CB  1 
ATOM   5337  O  OG  . SER B  1 54  ? 39.432  -38.055 -16.047 1.00 74.26  ? 54   SER B OG  1 
ATOM   5338  N  N   . ARG B  1 55  ? 38.429  -36.249 -13.225 1.00 68.46  ? 55   ARG B N   1 
ATOM   5339  C  CA  . ARG B  1 55  ? 38.032  -34.842 -13.204 1.00 64.46  ? 55   ARG B CA  1 
ATOM   5340  C  C   . ARG B  1 55  ? 39.210  -33.897 -13.420 1.00 62.12  ? 55   ARG B C   1 
ATOM   5341  O  O   . ARG B  1 55  ? 40.302  -34.135 -12.911 1.00 63.44  ? 55   ARG B O   1 
ATOM   5342  C  CB  . ARG B  1 55  ? 37.399  -34.491 -11.854 1.00 63.92  ? 55   ARG B CB  1 
ATOM   5343  C  CG  . ARG B  1 55  ? 36.066  -35.144 -11.582 1.00 62.19  ? 55   ARG B CG  1 
ATOM   5344  C  CD  . ARG B  1 55  ? 35.537  -34.803 -10.197 1.00 58.70  ? 55   ARG B CD  1 
ATOM   5345  N  NE  . ARG B  1 55  ? 34.262  -35.475 -9.972  1.00 57.49  ? 55   ARG B NE  1 
ATOM   5346  C  CZ  . ARG B  1 55  ? 33.749  -35.755 -8.777  1.00 57.99  ? 55   ARG B CZ  1 
ATOM   5347  N  NH1 . ARG B  1 55  ? 34.399  -35.421 -7.665  1.00 56.19  ? 55   ARG B NH1 1 
ATOM   5348  N  NH2 . ARG B  1 55  ? 32.580  -36.377 -8.698  1.00 58.87  ? 55   ARG B NH2 1 
ATOM   5349  N  N   . LYS B  1 56  ? 38.979  -32.816 -14.157 1.00 59.48  ? 56   LYS B N   1 
ATOM   5350  C  CA  . LYS B  1 56  ? 39.903  -31.677 -14.164 1.00 59.30  ? 56   LYS B CA  1 
ATOM   5351  C  C   . LYS B  1 56  ? 39.144  -30.397 -13.774 1.00 56.37  ? 56   LYS B C   1 
ATOM   5352  O  O   . LYS B  1 56  ? 37.914  -30.392 -13.759 1.00 56.47  ? 56   LYS B O   1 
ATOM   5353  C  CB  . LYS B  1 56  ? 40.661  -31.542 -15.498 1.00 62.08  ? 56   LYS B CB  1 
ATOM   5354  C  CG  . LYS B  1 56  ? 39.844  -31.812 -16.762 1.00 64.57  ? 56   LYS B CG  1 
ATOM   5355  C  CD  . LYS B  1 56  ? 40.748  -31.916 -17.999 1.00 63.80  ? 56   LYS B CD  1 
ATOM   5356  N  N   . PHE B  1 57  ? 39.856  -29.331 -13.416 1.00 54.16  ? 57   PHE B N   1 
ATOM   5357  C  CA  . PHE B  1 57  ? 39.182  -28.143 -12.878 1.00 52.68  ? 57   PHE B CA  1 
ATOM   5358  C  C   . PHE B  1 57  ? 39.529  -26.817 -13.557 1.00 49.86  ? 57   PHE B C   1 
ATOM   5359  O  O   . PHE B  1 57  ? 40.645  -26.618 -14.031 1.00 49.36  ? 57   PHE B O   1 
ATOM   5360  C  CB  . PHE B  1 57  ? 39.454  -28.020 -11.376 1.00 52.71  ? 57   PHE B CB  1 
ATOM   5361  C  CG  . PHE B  1 57  ? 39.269  -29.302 -10.628 1.00 53.65  ? 57   PHE B CG  1 
ATOM   5362  C  CD1 . PHE B  1 57  ? 40.326  -30.177 -10.470 1.00 54.30  ? 57   PHE B CD1 1 
ATOM   5363  C  CD2 . PHE B  1 57  ? 38.034  -29.644 -10.098 1.00 52.86  ? 57   PHE B CD2 1 
ATOM   5364  C  CE1 . PHE B  1 57  ? 40.155  -31.365 -9.793  1.00 55.11  ? 57   PHE B CE1 1 
ATOM   5365  C  CE2 . PHE B  1 57  ? 37.860  -30.832 -9.418  1.00 53.30  ? 57   PHE B CE2 1 
ATOM   5366  C  CZ  . PHE B  1 57  ? 38.918  -31.693 -9.266  1.00 54.29  ? 57   PHE B CZ  1 
ATOM   5367  N  N   . ILE B  1 58  ? 38.553  -25.917 -13.613 1.00 48.13  ? 58   ILE B N   1 
ATOM   5368  C  CA  . ILE B  1 58  ? 38.841  -24.511 -13.878 1.00 49.09  ? 58   ILE B CA  1 
ATOM   5369  C  C   . ILE B  1 58  ? 38.327  -23.677 -12.696 1.00 54.74  ? 58   ILE B C   1 
ATOM   5370  O  O   . ILE B  1 58  ? 37.120  -23.561 -12.469 1.00 60.32  ? 58   ILE B O   1 
ATOM   5371  C  CB  . ILE B  1 58  ? 38.253  -24.028 -15.216 1.00 43.16  ? 58   ILE B CB  1 
ATOM   5372  C  CG1 . ILE B  1 58  ? 38.776  -24.895 -16.362 1.00 40.85  ? 58   ILE B CG1 1 
ATOM   5373  C  CG2 . ILE B  1 58  ? 38.632  -22.585 -15.457 1.00 40.91  ? 58   ILE B CG2 1 
ATOM   5374  C  CD1 . ILE B  1 58  ? 38.015  -24.733 -17.652 1.00 38.51  ? 58   ILE B CD1 1 
ATOM   5375  N  N   . GLU B  1 59  ? 39.255  -23.094 -11.949 1.00 51.60  ? 59   GLU B N   1 
ATOM   5376  C  CA  . GLU B  1 59  ? 38.928  -22.484 -10.670 1.00 51.26  ? 59   GLU B CA  1 
ATOM   5377  C  C   . GLU B  1 59  ? 38.375  -21.061 -10.786 1.00 52.64  ? 59   GLU B C   1 
ATOM   5378  O  O   . GLU B  1 59  ? 38.821  -20.268 -11.610 1.00 53.15  ? 59   GLU B O   1 
ATOM   5379  C  CB  . GLU B  1 59  ? 40.158  -22.498 -9.766  1.00 49.69  ? 59   GLU B CB  1 
ATOM   5380  C  CG  . GLU B  1 59  ? 39.924  -21.883 -8.411  1.00 49.43  ? 59   GLU B CG  1 
ATOM   5381  C  CD  . GLU B  1 59  ? 38.966  -22.691 -7.570  1.00 52.47  ? 59   GLU B CD  1 
ATOM   5382  O  OE1 . GLU B  1 59  ? 39.407  -23.197 -6.517  1.00 54.64  ? 59   GLU B OE1 1 
ATOM   5383  O  OE2 . GLU B  1 59  ? 37.777  -22.817 -7.949  1.00 51.78  ? 59   GLU B OE2 1 
ATOM   5384  N  N   . ASP B  1 60  ? 37.393  -20.754 -9.946  1.00 54.00  ? 60   ASP B N   1 
ATOM   5385  C  CA  . ASP B  1 60  ? 36.829  -19.411 -9.851  1.00 56.57  ? 60   ASP B CA  1 
ATOM   5386  C  C   . ASP B  1 60  ? 36.165  -18.921 -11.118 1.00 53.77  ? 60   ASP B C   1 
ATOM   5387  O  O   . ASP B  1 60  ? 36.326  -17.759 -11.491 1.00 52.64  ? 60   ASP B O   1 
ATOM   5388  C  CB  . ASP B  1 60  ? 37.897  -18.408 -9.448  1.00 63.09  ? 60   ASP B CB  1 
ATOM   5389  C  CG  . ASP B  1 60  ? 37.612  -17.786 -8.118  1.00 71.23  ? 60   ASP B CG  1 
ATOM   5390  O  OD1 . ASP B  1 60  ? 37.191  -18.529 -7.204  1.00 73.53  ? 60   ASP B OD1 1 
ATOM   5391  O  OD2 . ASP B  1 60  ? 37.788  -16.557 -7.995  1.00 75.53  ? 60   ASP B OD2 1 
ATOM   5392  N  N   . ALA B  1 61  ? 35.400  -19.800 -11.758 1.00 50.87  ? 61   ALA B N   1 
ATOM   5393  C  CA  . ALA B  1 61  ? 34.797  -19.498 -13.044 1.00 48.89  ? 61   ALA B CA  1 
ATOM   5394  C  C   . ALA B  1 61  ? 33.422  -20.129 -13.150 1.00 50.04  ? 61   ALA B C   1 
ATOM   5395  O  O   . ALA B  1 61  ? 33.065  -20.989 -12.349 1.00 51.58  ? 61   ALA B O   1 
ATOM   5396  C  CB  . ALA B  1 61  ? 35.688  -19.996 -14.158 1.00 50.00  ? 61   ALA B CB  1 
ATOM   5397  N  N   . SER B  1 62  ? 32.647  -19.690 -14.136 1.00 50.89  ? 62   SER B N   1 
ATOM   5398  C  CA  . SER B  1 62  ? 31.361  -20.317 -14.431 1.00 52.06  ? 62   SER B CA  1 
ATOM   5399  C  C   . SER B  1 62  ? 30.977  -20.179 -15.906 1.00 52.71  ? 62   SER B C   1 
ATOM   5400  O  O   . SER B  1 62  ? 31.780  -19.751 -16.736 1.00 50.28  ? 62   SER B O   1 
ATOM   5401  C  CB  . SER B  1 62  ? 30.252  -19.779 -13.516 1.00 52.42  ? 62   SER B CB  1 
ATOM   5402  O  OG  . SER B  1 62  ? 30.234  -18.362 -13.481 1.00 53.30  ? 62   SER B OG  1 
ATOM   5403  N  N   . MET B  1 63  ? 29.746  -20.561 -16.225 1.00 55.81  ? 63   MET B N   1 
ATOM   5404  C  CA  . MET B  1 63  ? 29.265  -20.536 -17.604 1.00 55.17  ? 63   MET B CA  1 
ATOM   5405  C  C   . MET B  1 63  ? 30.167  -21.320 -18.556 1.00 53.20  ? 63   MET B C   1 
ATOM   5406  O  O   . MET B  1 63  ? 30.575  -20.802 -19.595 1.00 52.54  ? 63   MET B O   1 
ATOM   5407  C  CB  . MET B  1 63  ? 29.112  -19.096 -18.100 1.00 56.27  ? 63   MET B CB  1 
ATOM   5408  C  CG  . MET B  1 63  ? 28.054  -18.293 -17.368 1.00 57.79  ? 63   MET B CG  1 
ATOM   5409  S  SD  . MET B  1 63  ? 27.726  -16.721 -18.177 1.00 73.57  ? 63   MET B SD  1 
ATOM   5410  C  CE  . MET B  1 63  ? 26.930  -17.279 -19.679 1.00 59.43  ? 63   MET B CE  1 
ATOM   5411  N  N   . PRO B  1 64  ? 30.471  -22.580 -18.210 1.00 54.01  ? 64   PRO B N   1 
ATOM   5412  C  CA  . PRO B  1 64  ? 31.303  -23.410 -19.084 1.00 52.90  ? 64   PRO B CA  1 
ATOM   5413  C  C   . PRO B  1 64  ? 30.622  -23.717 -20.407 1.00 50.23  ? 64   PRO B C   1 
ATOM   5414  O  O   . PRO B  1 64  ? 29.467  -24.146 -20.457 1.00 46.90  ? 64   PRO B O   1 
ATOM   5415  C  CB  . PRO B  1 64  ? 31.471  -24.699 -18.282 1.00 55.84  ? 64   PRO B CB  1 
ATOM   5416  C  CG  . PRO B  1 64  ? 30.255  -24.757 -17.420 1.00 58.00  ? 64   PRO B CG  1 
ATOM   5417  C  CD  . PRO B  1 64  ? 30.000  -23.329 -17.032 1.00 57.25  ? 64   PRO B CD  1 
ATOM   5418  N  N   . ARG B  1 65  ? 31.367  -23.510 -21.481 1.00 51.56  ? 65   ARG B N   1 
ATOM   5419  C  CA  . ARG B  1 65  ? 30.867  -23.780 -22.811 1.00 51.96  ? 65   ARG B CA  1 
ATOM   5420  C  C   . ARG B  1 65  ? 31.893  -24.601 -23.578 1.00 51.95  ? 65   ARG B C   1 
ATOM   5421  O  O   . ARG B  1 65  ? 33.031  -24.164 -23.792 1.00 49.30  ? 65   ARG B O   1 
ATOM   5422  C  CB  . ARG B  1 65  ? 30.569  -22.469 -23.529 1.00 52.13  ? 65   ARG B CB  1 
ATOM   5423  C  CG  . ARG B  1 65  ? 29.554  -21.609 -22.812 1.00 54.58  ? 65   ARG B CG  1 
ATOM   5424  C  CD  . ARG B  1 65  ? 28.229  -22.340 -22.655 1.00 60.51  ? 65   ARG B CD  1 
ATOM   5425  N  NE  . ARG B  1 65  ? 27.172  -21.434 -22.215 1.00 65.08  ? 65   ARG B NE  1 
ATOM   5426  C  CZ  . ARG B  1 65  ? 26.863  -21.205 -20.942 1.00 66.72  ? 65   ARG B CZ  1 
ATOM   5427  N  NH1 . ARG B  1 65  ? 27.523  -21.825 -19.975 1.00 66.41  ? 65   ARG B NH1 1 
ATOM   5428  N  NH2 . ARG B  1 65  ? 25.889  -20.360 -20.634 1.00 67.84  ? 65   ARG B NH2 1 
ATOM   5429  N  N   . ILE B  1 66  ? 31.495  -25.805 -23.970 1.00 54.19  ? 66   ILE B N   1 
ATOM   5430  C  CA  . ILE B  1 66  ? 32.377  -26.665 -24.736 1.00 54.95  ? 66   ILE B CA  1 
ATOM   5431  C  C   . ILE B  1 66  ? 32.165  -26.412 -26.210 1.00 57.57  ? 66   ILE B C   1 
ATOM   5432  O  O   . ILE B  1 66  ? 31.043  -26.515 -26.712 1.00 58.99  ? 66   ILE B O   1 
ATOM   5433  C  CB  . ILE B  1 66  ? 32.140  -28.144 -24.433 1.00 53.07  ? 66   ILE B CB  1 
ATOM   5434  C  CG1 . ILE B  1 66  ? 32.257  -28.392 -22.926 1.00 51.00  ? 66   ILE B CG1 1 
ATOM   5435  C  CG2 . ILE B  1 66  ? 33.136  -28.996 -25.209 1.00 53.37  ? 66   ILE B CG2 1 
ATOM   5436  C  CD1 . ILE B  1 66  ? 32.030  -29.823 -22.511 1.00 51.85  ? 66   ILE B CD1 1 
ATOM   5437  N  N   . SER B  1 67  ? 33.246  -26.060 -26.897 1.00 58.29  ? 67   SER B N   1 
ATOM   5438  C  CA  . SER B  1 67  ? 33.172  -25.812 -28.325 1.00 58.29  ? 67   SER B CA  1 
ATOM   5439  C  C   . SER B  1 67  ? 32.611  -27.052 -29.016 1.00 58.87  ? 67   SER B C   1 
ATOM   5440  O  O   . SER B  1 67  ? 32.753  -28.170 -28.510 1.00 56.04  ? 67   SER B O   1 
ATOM   5441  C  CB  . SER B  1 67  ? 34.539  -25.410 -28.897 1.00 57.19  ? 67   SER B CB  1 
ATOM   5442  O  OG  . SER B  1 67  ? 35.495  -26.452 -28.795 1.00 56.05  ? 67   SER B OG  1 
ATOM   5443  N  N   . PRO B  1 68  ? 31.929  -26.846 -30.150 1.00 60.99  ? 68   PRO B N   1 
ATOM   5444  C  CA  . PRO B  1 68  ? 31.319  -27.933 -30.916 1.00 59.73  ? 68   PRO B CA  1 
ATOM   5445  C  C   . PRO B  1 68  ? 32.294  -29.066 -31.214 1.00 58.78  ? 68   PRO B C   1 
ATOM   5446  O  O   . PRO B  1 68  ? 31.904  -30.233 -31.150 1.00 60.50  ? 68   PRO B O   1 
ATOM   5447  C  CB  . PRO B  1 68  ? 30.892  -27.237 -32.207 1.00 59.70  ? 68   PRO B CB  1 
ATOM   5448  C  CG  . PRO B  1 68  ? 30.576  -25.852 -31.781 1.00 59.46  ? 68   PRO B CG  1 
ATOM   5449  C  CD  . PRO B  1 68  ? 31.591  -25.526 -30.713 1.00 61.52  ? 68   PRO B CD  1 
ATOM   5450  N  N   . ASP B  1 69  ? 33.544  -28.737 -31.518 1.00 56.89  ? 69   ASP B N   1 
ATOM   5451  C  CA  . ASP B  1 69  ? 34.489  -29.767 -31.919 1.00 59.28  ? 69   ASP B CA  1 
ATOM   5452  C  C   . ASP B  1 69  ? 35.103  -30.468 -30.718 1.00 61.13  ? 69   ASP B C   1 
ATOM   5453  O  O   . ASP B  1 69  ? 35.879  -31.406 -30.876 1.00 62.87  ? 69   ASP B O   1 
ATOM   5454  C  CB  . ASP B  1 69  ? 35.574  -29.204 -32.845 1.00 61.61  ? 69   ASP B CB  1 
ATOM   5455  C  CG  . ASP B  1 69  ? 36.468  -28.191 -32.161 1.00 64.26  ? 69   ASP B CG  1 
ATOM   5456  O  OD1 . ASP B  1 69  ? 36.630  -28.264 -30.923 1.00 65.80  ? 69   ASP B OD1 1 
ATOM   5457  O  OD2 . ASP B  1 69  ? 37.019  -27.325 -32.875 1.00 64.16  ? 69   ASP B OD2 1 
ATOM   5458  N  N   . GLY B  1 70  ? 34.748  -30.012 -29.520 1.00 62.03  ? 70   GLY B N   1 
ATOM   5459  C  CA  . GLY B  1 70  ? 35.230  -30.619 -28.291 1.00 62.59  ? 70   GLY B CA  1 
ATOM   5460  C  C   . GLY B  1 70  ? 36.709  -30.380 -28.029 1.00 65.06  ? 70   GLY B C   1 
ATOM   5461  O  O   . GLY B  1 70  ? 37.287  -30.987 -27.121 1.00 66.27  ? 70   GLY B O   1 
ATOM   5462  N  N   . LYS B  1 71  ? 37.329  -29.516 -28.831 1.00 64.18  ? 71   LYS B N   1 
ATOM   5463  C  CA  . LYS B  1 71  ? 38.739  -29.187 -28.654 1.00 63.54  ? 71   LYS B CA  1 
ATOM   5464  C  C   . LYS B  1 71  ? 38.978  -28.194 -27.510 1.00 64.02  ? 71   LYS B C   1 
ATOM   5465  O  O   . LYS B  1 71  ? 39.867  -28.391 -26.679 1.00 66.00  ? 71   LYS B O   1 
ATOM   5466  C  CB  . LYS B  1 71  ? 39.333  -28.663 -29.962 1.00 62.70  ? 71   LYS B CB  1 
ATOM   5467  N  N   . LYS B  1 72  ? 38.169  -27.140 -27.458 1.00 62.44  ? 72   LYS B N   1 
ATOM   5468  C  CA  . LYS B  1 72  ? 38.372  -26.077 -26.477 1.00 59.11  ? 72   LYS B CA  1 
ATOM   5469  C  C   . LYS B  1 72  ? 37.112  -25.759 -25.654 1.00 59.74  ? 72   LYS B C   1 
ATOM   5470  O  O   . LYS B  1 72  ? 36.002  -26.157 -26.007 1.00 61.80  ? 72   LYS B O   1 
ATOM   5471  C  CB  . LYS B  1 72  ? 38.910  -24.822 -27.179 1.00 56.06  ? 72   LYS B CB  1 
ATOM   5472  C  CG  . LYS B  1 72  ? 38.365  -24.634 -28.584 1.00 54.97  ? 72   LYS B CG  1 
ATOM   5473  C  CD  . LYS B  1 72  ? 39.114  -23.568 -29.373 1.00 53.98  ? 72   LYS B CD  1 
ATOM   5474  C  CE  . LYS B  1 72  ? 38.491  -23.408 -30.759 1.00 55.59  ? 72   LYS B CE  1 
ATOM   5475  N  NZ  . LYS B  1 72  ? 39.113  -22.351 -31.609 1.00 56.97  ? 72   LYS B NZ  1 
ATOM   5476  N  N   . ILE B  1 73  ? 37.300  -25.056 -24.542 1.00 57.93  ? 73   ILE B N   1 
ATOM   5477  C  CA  . ILE B  1 73  ? 36.195  -24.681 -23.669 1.00 55.32  ? 73   ILE B CA  1 
ATOM   5478  C  C   . ILE B  1 73  ? 36.252  -23.199 -23.317 1.00 51.12  ? 73   ILE B C   1 
ATOM   5479  O  O   . ILE B  1 73  ? 37.296  -22.691 -22.922 1.00 50.72  ? 73   ILE B O   1 
ATOM   5480  C  CB  . ILE B  1 73  ? 36.224  -25.491 -22.366 1.00 58.27  ? 73   ILE B CB  1 
ATOM   5481  C  CG1 . ILE B  1 73  ? 35.014  -25.155 -21.500 1.00 60.94  ? 73   ILE B CG1 1 
ATOM   5482  C  CG2 . ILE B  1 73  ? 37.500  -25.212 -21.584 1.00 57.54  ? 73   ILE B CG2 1 
ATOM   5483  C  CD1 . ILE B  1 73  ? 34.913  -26.010 -20.253 1.00 61.71  ? 73   ILE B CD1 1 
ATOM   5484  N  N   . ALA B  1 74  ? 35.122  -22.513 -23.454 1.00 50.52  ? 74   ALA B N   1 
ATOM   5485  C  CA  . ALA B  1 74  ? 35.013  -21.096 -23.095 1.00 49.50  ? 74   ALA B CA  1 
ATOM   5486  C  C   . ALA B  1 74  ? 34.328  -20.926 -21.728 1.00 51.83  ? 74   ALA B C   1 
ATOM   5487  O  O   . ALA B  1 74  ? 33.473  -21.737 -21.354 1.00 53.02  ? 74   ALA B O   1 
ATOM   5488  C  CB  . ALA B  1 74  ? 34.243  -20.335 -24.177 1.00 46.51  ? 74   ALA B CB  1 
ATOM   5489  N  N   . PHE B  1 75  ? 34.729  -19.907 -20.969 1.00 51.74  ? 75   PHE B N   1 
ATOM   5490  C  CA  . PHE B  1 75  ? 34.109  -19.640 -19.667 1.00 51.60  ? 75   PHE B CA  1 
ATOM   5491  C  C   . PHE B  1 75  ? 34.278  -18.192 -19.212 1.00 51.41  ? 75   PHE B C   1 
ATOM   5492  O  O   . PHE B  1 75  ? 34.934  -17.395 -19.876 1.00 52.50  ? 75   PHE B O   1 
ATOM   5493  C  CB  . PHE B  1 75  ? 34.673  -20.581 -18.601 1.00 53.04  ? 75   PHE B CB  1 
ATOM   5494  C  CG  . PHE B  1 75  ? 36.164  -20.489 -18.439 1.00 54.51  ? 75   PHE B CG  1 
ATOM   5495  C  CD1 . PHE B  1 75  ? 37.013  -21.136 -19.324 1.00 56.76  ? 75   PHE B CD1 1 
ATOM   5496  C  CD2 . PHE B  1 75  ? 36.716  -19.762 -17.398 1.00 54.71  ? 75   PHE B CD2 1 
ATOM   5497  C  CE1 . PHE B  1 75  ? 38.388  -21.056 -19.175 1.00 58.02  ? 75   PHE B CE1 1 
ATOM   5498  C  CE2 . PHE B  1 75  ? 38.092  -19.674 -17.238 1.00 55.28  ? 75   PHE B CE2 1 
ATOM   5499  C  CZ  . PHE B  1 75  ? 38.931  -20.322 -18.126 1.00 57.35  ? 75   PHE B CZ  1 
ATOM   5500  N  N   . MET B  1 76  ? 33.704  -17.863 -18.059 1.00 52.03  ? 76   MET B N   1 
ATOM   5501  C  CA  . MET B  1 76  ? 33.738  -16.491 -17.551 1.00 53.38  ? 76   MET B CA  1 
ATOM   5502  C  C   . MET B  1 76  ? 34.253  -16.421 -16.127 1.00 53.48  ? 76   MET B C   1 
ATOM   5503  O  O   . MET B  1 76  ? 33.815  -17.179 -15.267 1.00 53.80  ? 76   MET B O   1 
ATOM   5504  C  CB  . MET B  1 76  ? 32.343  -15.868 -17.582 1.00 55.71  ? 76   MET B CB  1 
ATOM   5505  C  CG  . MET B  1 76  ? 31.622  -15.981 -18.912 1.00 57.88  ? 76   MET B CG  1 
ATOM   5506  S  SD  . MET B  1 76  ? 31.208  -14.369 -19.611 1.00 83.88  ? 76   MET B SD  1 
ATOM   5507  C  CE  . MET B  1 76  ? 31.174  -13.367 -18.134 1.00 78.10  ? 76   MET B CE  1 
ATOM   5508  N  N   . ARG B  1 77  ? 35.183  -15.508 -15.879 1.00 56.89  ? 77   ARG B N   1 
ATOM   5509  C  CA  . ARG B  1 77  ? 35.569  -15.179 -14.516 1.00 62.19  ? 77   ARG B CA  1 
ATOM   5510  C  C   . ARG B  1 77  ? 34.990  -13.819 -14.170 1.00 70.37  ? 77   ARG B C   1 
ATOM   5511  O  O   . ARG B  1 77  ? 35.200  -12.839 -14.885 1.00 69.65  ? 77   ARG B O   1 
ATOM   5512  C  CB  . ARG B  1 77  ? 37.087  -15.191 -14.338 1.00 60.37  ? 77   ARG B CB  1 
ATOM   5513  C  CG  . ARG B  1 77  ? 37.667  -16.586 -14.202 1.00 59.24  ? 77   ARG B CG  1 
ATOM   5514  C  CD  . ARG B  1 77  ? 39.093  -16.541 -13.682 1.00 57.62  ? 77   ARG B CD  1 
ATOM   5515  N  NE  . ARG B  1 77  ? 39.619  -17.881 -13.430 1.00 58.79  ? 77   ARG B NE  1 
ATOM   5516  C  CZ  . ARG B  1 77  ? 40.423  -18.540 -14.262 1.00 60.39  ? 77   ARG B CZ  1 
ATOM   5517  N  NH1 . ARG B  1 77  ? 40.806  -17.981 -15.403 1.00 62.44  ? 77   ARG B NH1 1 
ATOM   5518  N  NH2 . ARG B  1 77  ? 40.855  -19.756 -13.954 1.00 59.11  ? 77   ARG B NH2 1 
ATOM   5519  N  N   . PHE B  1 78  ? 34.224  -13.773 -13.088 1.00 79.14  ? 78   PHE B N   1 
ATOM   5520  C  CA  . PHE B  1 78  ? 33.553  -12.543 -12.688 1.00 85.95  ? 78   PHE B CA  1 
ATOM   5521  C  C   . PHE B  1 78  ? 34.362  -11.753 -11.656 1.00 91.04  ? 78   PHE B C   1 
ATOM   5522  O  O   . PHE B  1 78  ? 33.896  -10.741 -11.129 1.00 91.68  ? 78   PHE B O   1 
ATOM   5523  C  CB  . PHE B  1 78  ? 32.115  -12.825 -12.237 1.00 85.85  ? 78   PHE B CB  1 
ATOM   5524  C  CG  . PHE B  1 78  ? 31.209  -13.289 -13.354 1.00 85.92  ? 78   PHE B CG  1 
ATOM   5525  C  CD1 . PHE B  1 78  ? 31.101  -14.635 -13.672 1.00 87.09  ? 78   PHE B CD1 1 
ATOM   5526  C  CD2 . PHE B  1 78  ? 30.466  -12.374 -14.090 1.00 85.72  ? 78   PHE B CD2 1 
ATOM   5527  C  CE1 . PHE B  1 78  ? 30.263  -15.057 -14.703 1.00 87.60  ? 78   PHE B CE1 1 
ATOM   5528  C  CE2 . PHE B  1 78  ? 29.629  -12.789 -15.120 1.00 85.41  ? 78   PHE B CE2 1 
ATOM   5529  C  CZ  . PHE B  1 78  ? 29.526  -14.129 -15.424 1.00 86.55  ? 78   PHE B CZ  1 
ATOM   5530  N  N   . ASN B  1 79  ? 35.567  -12.249 -11.374 1.00 95.53  ? 79   ASN B N   1 
ATOM   5531  C  CA  . ASN B  1 79  ? 36.527  -11.603 -10.474 1.00 99.40  ? 79   ASN B CA  1 
ATOM   5532  C  C   . ASN B  1 79  ? 36.688  -10.092 -10.678 1.00 100.77 ? 79   ASN B C   1 
ATOM   5533  O  O   . ASN B  1 79  ? 35.709  -9.345  -10.751 1.00 101.03 ? 79   ASN B O   1 
ATOM   5534  C  CB  . ASN B  1 79  ? 37.897  -12.279 -10.608 1.00 100.03 ? 79   ASN B CB  1 
ATOM   5535  N  N   . LYS B  1 83  ? 33.803  -4.655  -10.669 1.00 94.96  ? 83   LYS B N   1 
ATOM   5536  C  CA  . LYS B  1 83  ? 32.800  -5.465  -11.366 1.00 95.69  ? 83   LYS B CA  1 
ATOM   5537  C  C   . LYS B  1 83  ? 33.138  -5.648  -12.839 1.00 94.88  ? 83   LYS B C   1 
ATOM   5538  O  O   . LYS B  1 83  ? 32.543  -5.003  -13.702 1.00 95.60  ? 83   LYS B O   1 
ATOM   5539  C  CB  . LYS B  1 83  ? 31.400  -4.854  -11.234 1.00 95.65  ? 83   LYS B CB  1 
ATOM   5540  N  N   . THR B  1 84  ? 34.082  -6.543  -13.114 1.00 92.13  ? 84   THR B N   1 
ATOM   5541  C  CA  . THR B  1 84  ? 34.549  -6.800  -14.470 1.00 88.26  ? 84   THR B CA  1 
ATOM   5542  C  C   . THR B  1 84  ? 34.543  -8.291  -14.778 1.00 83.82  ? 84   THR B C   1 
ATOM   5543  O  O   . THR B  1 84  ? 35.252  -9.065  -14.133 1.00 85.47  ? 84   THR B O   1 
ATOM   5544  C  CB  . THR B  1 84  ? 35.984  -6.278  -14.663 1.00 89.77  ? 84   THR B CB  1 
ATOM   5545  O  OG1 . THR B  1 84  ? 36.655  -7.078  -15.648 1.00 92.55  ? 84   THR B OG1 1 
ATOM   5546  C  CG2 . THR B  1 84  ? 36.760  -6.345  -13.345 1.00 87.91  ? 84   THR B CG2 1 
ATOM   5547  N  N   . ALA B  1 85  ? 33.758  -8.696  -15.771 1.00 77.26  ? 85   ALA B N   1 
ATOM   5548  C  CA  . ALA B  1 85  ? 33.720  -10.100 -16.170 1.00 71.34  ? 85   ALA B CA  1 
ATOM   5549  C  C   . ALA B  1 85  ? 34.508  -10.337 -17.457 1.00 65.91  ? 85   ALA B C   1 
ATOM   5550  O  O   . ALA B  1 85  ? 34.338  -9.623  -18.440 1.00 67.05  ? 85   ALA B O   1 
ATOM   5551  C  CB  . ALA B  1 85  ? 32.290  -10.562 -16.332 1.00 71.65  ? 85   ALA B CB  1 
ATOM   5552  N  N   . GLN B  1 86  ? 35.367  -11.348 -17.454 1.00 59.77  ? 86   GLN B N   1 
ATOM   5553  C  CA  . GLN B  1 86  ? 36.188  -11.635 -18.622 1.00 55.35  ? 86   GLN B CA  1 
ATOM   5554  C  C   . GLN B  1 86  ? 35.859  -12.982 -19.244 1.00 50.06  ? 86   GLN B C   1 
ATOM   5555  O  O   . GLN B  1 86  ? 35.699  -13.974 -18.550 1.00 51.50  ? 86   GLN B O   1 
ATOM   5556  C  CB  . GLN B  1 86  ? 37.672  -11.574 -18.254 1.00 58.11  ? 86   GLN B CB  1 
ATOM   5557  C  CG  . GLN B  1 86  ? 38.052  -12.451 -17.070 1.00 60.80  ? 86   GLN B CG  1 
ATOM   5558  C  CD  . GLN B  1 86  ? 39.189  -11.864 -16.246 1.00 61.03  ? 86   GLN B CD  1 
ATOM   5559  O  OE1 . GLN B  1 86  ? 39.707  -12.508 -15.328 1.00 59.17  ? 86   GLN B OE1 1 
ATOM   5560  N  NE2 . GLN B  1 86  ? 39.579  -10.630 -16.567 1.00 60.45  ? 86   GLN B NE2 1 
ATOM   5561  N  N   . ILE B  1 87  ? 35.758  -13.016 -20.564 1.00 45.97  ? 87   ILE B N   1 
ATOM   5562  C  CA  . ILE B  1 87  ? 35.607  -14.289 -21.251 1.00 44.62  ? 87   ILE B CA  1 
ATOM   5563  C  C   . ILE B  1 87  ? 36.981  -14.916 -21.492 1.00 45.07  ? 87   ILE B C   1 
ATOM   5564  O  O   . ILE B  1 87  ? 37.907  -14.261 -21.980 1.00 44.72  ? 87   ILE B O   1 
ATOM   5565  C  CB  . ILE B  1 87  ? 34.836  -14.143 -22.586 1.00 40.55  ? 87   ILE B CB  1 
ATOM   5566  C  CG1 . ILE B  1 87  ? 33.508  -13.432 -22.336 1.00 40.45  ? 87   ILE B CG1 1 
ATOM   5567  C  CG2 . ILE B  1 87  ? 34.596  -15.508 -23.211 1.00 37.31  ? 87   ILE B CG2 1 
ATOM   5568  C  CD1 . ILE B  1 87  ? 32.741  -13.094 -23.578 1.00 41.43  ? 87   ILE B CD1 1 
ATOM   5569  N  N   . TRP B  1 88  ? 37.100  -16.195 -21.158 1.00 44.62  ? 88   TRP B N   1 
ATOM   5570  C  CA  . TRP B  1 88  ? 38.319  -16.944 -21.413 1.00 46.28  ? 88   TRP B CA  1 
ATOM   5571  C  C   . TRP B  1 88  ? 38.036  -18.056 -22.407 1.00 50.01  ? 88   TRP B C   1 
ATOM   5572  O  O   . TRP B  1 88  ? 36.884  -18.450 -22.616 1.00 49.77  ? 88   TRP B O   1 
ATOM   5573  C  CB  . TRP B  1 88  ? 38.854  -17.576 -20.134 1.00 45.37  ? 88   TRP B CB  1 
ATOM   5574  C  CG  . TRP B  1 88  ? 39.424  -16.608 -19.161 1.00 43.40  ? 88   TRP B CG  1 
ATOM   5575  C  CD1 . TRP B  1 88  ? 38.730  -15.771 -18.343 1.00 43.75  ? 88   TRP B CD1 1 
ATOM   5576  C  CD2 . TRP B  1 88  ? 40.809  -16.392 -18.875 1.00 40.21  ? 88   TRP B CD2 1 
ATOM   5577  N  NE1 . TRP B  1 88  ? 39.593  -15.035 -17.574 1.00 41.42  ? 88   TRP B NE1 1 
ATOM   5578  C  CE2 . TRP B  1 88  ? 40.876  -15.395 -17.882 1.00 39.05  ? 88   TRP B CE2 1 
ATOM   5579  C  CE3 . TRP B  1 88  ? 41.998  -16.936 -19.367 1.00 41.03  ? 88   TRP B CE3 1 
ATOM   5580  C  CZ2 . TRP B  1 88  ? 42.081  -14.931 -17.370 1.00 37.99  ? 88   TRP B CZ2 1 
ATOM   5581  C  CZ3 . TRP B  1 88  ? 43.200  -16.470 -18.856 1.00 41.65  ? 88   TRP B CZ3 1 
ATOM   5582  C  CH2 . TRP B  1 88  ? 43.229  -15.477 -17.866 1.00 40.34  ? 88   TRP B CH2 1 
ATOM   5583  N  N   . VAL B  1 89  ? 39.094  -18.523 -23.057 1.00 51.71  ? 89   VAL B N   1 
ATOM   5584  C  CA  . VAL B  1 89  ? 39.042  -19.764 -23.816 1.00 52.18  ? 89   VAL B CA  1 
ATOM   5585  C  C   . VAL B  1 89  ? 40.241  -20.612 -23.423 1.00 53.83  ? 89   VAL B C   1 
ATOM   5586  O  O   . VAL B  1 89  ? 41.384  -20.160 -23.501 1.00 56.26  ? 89   VAL B O   1 
ATOM   5587  C  CB  . VAL B  1 89  ? 39.090  -19.523 -25.330 1.00 50.21  ? 89   VAL B CB  1 
ATOM   5588  C  CG1 . VAL B  1 89  ? 39.263  -20.833 -26.052 1.00 50.15  ? 89   VAL B CG1 1 
ATOM   5589  C  CG2 . VAL B  1 89  ? 37.829  -18.829 -25.797 1.00 51.29  ? 89   VAL B CG2 1 
ATOM   5590  N  N   . ALA B  1 90  ? 39.983  -21.837 -22.987 1.00 52.68  ? 90   ALA B N   1 
ATOM   5591  C  CA  . ALA B  1 90  ? 41.066  -22.756 -22.674 1.00 53.08  ? 90   ALA B CA  1 
ATOM   5592  C  C   . ALA B  1 90  ? 40.964  -23.988 -23.560 1.00 54.75  ? 90   ALA B C   1 
ATOM   5593  O  O   . ALA B  1 90  ? 39.872  -24.368 -23.979 1.00 53.63  ? 90   ALA B O   1 
ATOM   5594  C  CB  . ALA B  1 90  ? 41.025  -23.147 -21.215 1.00 51.83  ? 90   ALA B CB  1 
ATOM   5595  N  N   . ASP B  1 91  ? 42.103  -24.605 -23.854 1.00 56.59  ? 91   ASP B N   1 
ATOM   5596  C  CA  . ASP B  1 91  ? 42.104  -25.854 -24.597 1.00 57.44  ? 91   ASP B CA  1 
ATOM   5597  C  C   . ASP B  1 91  ? 41.833  -26.998 -23.632 1.00 55.76  ? 91   ASP B C   1 
ATOM   5598  O  O   . ASP B  1 91  ? 42.419  -27.057 -22.550 1.00 54.75  ? 91   ASP B O   1 
ATOM   5599  C  CB  . ASP B  1 91  ? 43.439  -26.060 -25.309 1.00 59.23  ? 91   ASP B CB  1 
ATOM   5600  C  CG  . ASP B  1 91  ? 44.344  -27.027 -24.577 1.00 63.03  ? 91   ASP B CG  1 
ATOM   5601  O  OD1 . ASP B  1 91  ? 44.539  -28.152 -25.084 1.00 64.37  ? 91   ASP B OD1 1 
ATOM   5602  O  OD2 . ASP B  1 91  ? 44.850  -26.665 -23.492 1.00 63.98  ? 91   ASP B OD2 1 
ATOM   5603  N  N   . LEU B  1 92  ? 40.937  -27.899 -24.028 1.00 55.64  ? 92   LEU B N   1 
ATOM   5604  C  CA  . LEU B  1 92  ? 40.502  -29.002 -23.170 1.00 56.52  ? 92   LEU B CA  1 
ATOM   5605  C  C   . LEU B  1 92  ? 41.581  -30.025 -22.800 1.00 60.20  ? 92   LEU B C   1 
ATOM   5606  O  O   . LEU B  1 92  ? 41.513  -30.628 -21.732 1.00 61.31  ? 92   LEU B O   1 
ATOM   5607  C  CB  . LEU B  1 92  ? 39.300  -29.715 -23.788 1.00 55.14  ? 92   LEU B CB  1 
ATOM   5608  C  CG  . LEU B  1 92  ? 37.959  -29.052 -23.488 1.00 55.88  ? 92   LEU B CG  1 
ATOM   5609  C  CD1 . LEU B  1 92  ? 36.859  -29.541 -24.421 1.00 55.54  ? 92   LEU B CD1 1 
ATOM   5610  C  CD2 . LEU B  1 92  ? 37.583  -29.290 -22.032 1.00 57.12  ? 92   LEU B CD2 1 
ATOM   5611  N  N   . LYS B  1 93  ? 42.569  -30.238 -23.665 1.00 61.72  ? 93   LYS B N   1 
ATOM   5612  C  CA  . LYS B  1 93  ? 43.594  -31.232 -23.354 1.00 61.27  ? 93   LYS B CA  1 
ATOM   5613  C  C   . LYS B  1 93  ? 44.469  -30.840 -22.158 1.00 62.66  ? 93   LYS B C   1 
ATOM   5614  O  O   . LYS B  1 93  ? 44.572  -31.597 -21.192 1.00 63.38  ? 93   LYS B O   1 
ATOM   5615  C  CB  . LYS B  1 93  ? 44.457  -31.543 -24.578 1.00 59.76  ? 93   LYS B CB  1 
ATOM   5616  N  N   . THR B  1 94  ? 45.110  -29.674 -22.221 1.00 62.81  ? 94   THR B N   1 
ATOM   5617  C  CA  . THR B  1 94  ? 45.946  -29.214 -21.104 1.00 62.65  ? 94   THR B CA  1 
ATOM   5618  C  C   . THR B  1 94  ? 45.273  -28.227 -20.148 1.00 61.01  ? 94   THR B C   1 
ATOM   5619  O  O   . THR B  1 94  ? 45.847  -27.867 -19.119 1.00 61.15  ? 94   THR B O   1 
ATOM   5620  C  CB  . THR B  1 94  ? 47.247  -28.555 -21.613 1.00 61.20  ? 94   THR B CB  1 
ATOM   5621  O  OG1 . THR B  1 94  ? 46.987  -27.197 -21.997 1.00 56.68  ? 94   THR B OG1 1 
ATOM   5622  C  CG2 . THR B  1 94  ? 47.804  -29.329 -22.802 1.00 62.92  ? 94   THR B CG2 1 
ATOM   5623  N  N   . LEU B  1 95  ? 44.059  -27.803 -20.485 1.00 59.75  ? 95   LEU B N   1 
ATOM   5624  C  CA  . LEU B  1 95  ? 43.363  -26.740 -19.746 1.00 58.56  ? 95   LEU B CA  1 
ATOM   5625  C  C   . LEU B  1 95  ? 44.142  -25.413 -19.633 1.00 57.10  ? 95   LEU B C   1 
ATOM   5626  O  O   . LEU B  1 95  ? 43.908  -24.640 -18.707 1.00 57.74  ? 95   LEU B O   1 
ATOM   5627  C  CB  . LEU B  1 95  ? 42.910  -27.215 -18.353 1.00 55.97  ? 95   LEU B CB  1 
ATOM   5628  C  CG  . LEU B  1 95  ? 41.699  -28.155 -18.270 1.00 54.52  ? 95   LEU B CG  1 
ATOM   5629  C  CD1 . LEU B  1 95  ? 41.346  -28.478 -16.820 1.00 54.09  ? 95   LEU B CD1 1 
ATOM   5630  C  CD2 . LEU B  1 95  ? 40.497  -27.565 -18.987 1.00 52.85  ? 95   LEU B CD2 1 
ATOM   5631  N  N   . SER B  1 96  ? 45.041  -25.137 -20.576 1.00 54.57  ? 96   SER B N   1 
ATOM   5632  C  CA  . SER B  1 96  ? 45.738  -23.850 -20.603 1.00 51.66  ? 96   SER B CA  1 
ATOM   5633  C  C   . SER B  1 96  ? 44.842  -22.820 -21.291 1.00 52.83  ? 96   SER B C   1 
ATOM   5634  O  O   . SER B  1 96  ? 44.129  -23.157 -22.237 1.00 54.28  ? 96   SER B O   1 
ATOM   5635  C  CB  . SER B  1 96  ? 47.090  -23.962 -21.315 1.00 49.88  ? 96   SER B CB  1 
ATOM   5636  O  OG  . SER B  1 96  ? 46.934  -24.068 -22.721 1.00 48.37  ? 96   SER B OG  1 
ATOM   5637  N  N   . ALA B  1 97  ? 44.876  -21.571 -20.827 1.00 52.08  ? 97   ALA B N   1 
ATOM   5638  C  CA  . ALA B  1 97  ? 43.844  -20.598 -21.215 1.00 50.51  ? 97   ALA B CA  1 
ATOM   5639  C  C   . ALA B  1 97  ? 44.350  -19.210 -21.622 1.00 48.96  ? 97   ALA B C   1 
ATOM   5640  O  O   . ALA B  1 97  ? 45.427  -18.784 -21.214 1.00 50.29  ? 97   ALA B O   1 
ATOM   5641  C  CB  . ALA B  1 97  ? 42.800  -20.470 -20.103 1.00 47.52  ? 97   ALA B CB  1 
ATOM   5642  N  N   . LYS B  1 98  ? 43.555  -18.510 -22.426 1.00 47.19  ? 98   LYS B N   1 
ATOM   5643  C  CA  . LYS B  1 98  ? 43.815  -17.104 -22.738 1.00 46.79  ? 98   LYS B CA  1 
ATOM   5644  C  C   . LYS B  1 98  ? 42.552  -16.251 -22.598 1.00 45.76  ? 98   LYS B C   1 
ATOM   5645  O  O   . LYS B  1 98  ? 41.439  -16.716 -22.862 1.00 45.64  ? 98   LYS B O   1 
ATOM   5646  C  CB  . LYS B  1 98  ? 44.407  -16.949 -24.141 1.00 45.99  ? 98   LYS B CB  1 
ATOM   5647  C  CG  . LYS B  1 98  ? 43.563  -17.551 -25.243 1.00 44.83  ? 98   LYS B CG  1 
ATOM   5648  C  CD  . LYS B  1 98  ? 44.004  -17.047 -26.603 1.00 42.81  ? 98   LYS B CD  1 
ATOM   5649  C  CE  . LYS B  1 98  ? 42.914  -17.242 -27.634 1.00 41.90  ? 98   LYS B CE  1 
ATOM   5650  N  NZ  . LYS B  1 98  ? 43.217  -16.487 -28.875 1.00 42.70  ? 98   LYS B NZ  1 
ATOM   5651  N  N   . LYS B  1 99  ? 42.725  -15.005 -22.168 1.00 45.67  ? 99   LYS B N   1 
ATOM   5652  C  CA  . LYS B  1 99  ? 41.593  -14.107 -21.989 1.00 46.32  ? 99   LYS B CA  1 
ATOM   5653  C  C   . LYS B  1 99  ? 41.231  -13.545 -23.348 1.00 51.04  ? 99   LYS B C   1 
ATOM   5654  O  O   . LYS B  1 99  ? 42.052  -12.901 -23.999 1.00 52.03  ? 99   LYS B O   1 
ATOM   5655  C  CB  . LYS B  1 99  ? 41.966  -12.976 -21.027 1.00 44.71  ? 99   LYS B CB  1 
ATOM   5656  C  CG  . LYS B  1 99  ? 40.884  -11.928 -20.840 1.00 46.26  ? 99   LYS B CG  1 
ATOM   5657  N  N   . VAL B  1 100 ? 40.019  -13.835 -23.802 1.00 53.15  ? 100  VAL B N   1 
ATOM   5658  C  CA  . VAL B  1 100 ? 39.565  -13.348 -25.103 1.00 52.40  ? 100  VAL B CA  1 
ATOM   5659  C  C   . VAL B  1 100 ? 38.997  -11.928 -25.105 1.00 53.83  ? 100  VAL B C   1 
ATOM   5660  O  O   . VAL B  1 100 ? 39.296  -11.128 -25.991 1.00 55.21  ? 100  VAL B O   1 
ATOM   5661  C  CB  . VAL B  1 100 ? 38.568  -14.327 -25.750 1.00 49.86  ? 100  VAL B CB  1 
ATOM   5662  C  CG1 . VAL B  1 100 ? 37.847  -13.661 -26.898 1.00 50.10  ? 100  VAL B CG1 1 
ATOM   5663  C  CG2 . VAL B  1 100 ? 39.299  -15.567 -26.235 1.00 49.55  ? 100  VAL B CG2 1 
ATOM   5664  N  N   . LEU B  1 101 ? 38.159  -11.634 -24.119 1.00 54.49  ? 101  LEU B N   1 
ATOM   5665  C  CA  . LEU B  1 101 ? 37.472  -10.352 -24.062 1.00 55.14  ? 101  LEU B CA  1 
ATOM   5666  C  C   . LEU B  1 101 ? 37.125  -9.955  -22.631 1.00 55.68  ? 101  LEU B C   1 
ATOM   5667  O  O   . LEU B  1 101 ? 36.745  -10.804 -21.825 1.00 54.60  ? 101  LEU B O   1 
ATOM   5668  C  CB  . LEU B  1 101 ? 36.197  -10.410 -24.903 1.00 55.01  ? 101  LEU B CB  1 
ATOM   5669  C  CG  . LEU B  1 101 ? 35.500  -9.070  -25.129 1.00 54.31  ? 101  LEU B CG  1 
ATOM   5670  C  CD1 . LEU B  1 101 ? 36.433  -8.130  -25.880 1.00 53.10  ? 101  LEU B CD1 1 
ATOM   5671  C  CD2 . LEU B  1 101 ? 34.193  -9.256  -25.882 1.00 52.88  ? 101  LEU B CD2 1 
ATOM   5672  N  N   . GLU B  1 102 ? 37.216  -8.664  -22.328 1.00 57.81  ? 102  GLU B N   1 
ATOM   5673  C  CA  . GLU B  1 102 ? 36.781  -8.153  -21.029 1.00 61.84  ? 102  GLU B CA  1 
ATOM   5674  C  C   . GLU B  1 102 ? 35.351  -7.648  -21.164 1.00 65.23  ? 102  GLU B C   1 
ATOM   5675  O  O   . GLU B  1 102 ? 35.094  -6.668  -21.859 1.00 65.23  ? 102  GLU B O   1 
ATOM   5676  C  CB  . GLU B  1 102 ? 37.704  -7.037  -20.530 1.00 60.11  ? 102  GLU B CB  1 
ATOM   5677  N  N   . ALA B  1 103 ? 34.416  -8.312  -20.497 1.00 67.95  ? 103  ALA B N   1 
ATOM   5678  C  CA  . ALA B  1 103 ? 33.009  -8.040  -20.749 1.00 72.50  ? 103  ALA B CA  1 
ATOM   5679  C  C   . ALA B  1 103 ? 32.178  -7.653  -19.521 1.00 75.90  ? 103  ALA B C   1 
ATOM   5680  O  O   . ALA B  1 103 ? 31.938  -8.471  -18.632 1.00 77.30  ? 103  ALA B O   1 
ATOM   5681  C  CB  . ALA B  1 103 ? 32.384  -9.239  -21.437 1.00 74.33  ? 103  ALA B CB  1 
ATOM   5682  N  N   . LYS B  1 104 ? 31.712  -6.408  -19.498 1.00 76.29  ? 104  LYS B N   1 
ATOM   5683  C  CA  . LYS B  1 104 ? 30.683  -6.003  -18.550 1.00 75.65  ? 104  LYS B CA  1 
ATOM   5684  C  C   . LYS B  1 104 ? 29.324  -6.115  -19.236 1.00 76.44  ? 104  LYS B C   1 
ATOM   5685  O  O   . LYS B  1 104 ? 29.197  -5.861  -20.437 1.00 77.31  ? 104  LYS B O   1 
ATOM   5686  C  CB  . LYS B  1 104 ? 30.915  -4.577  -18.042 1.00 72.92  ? 104  LYS B CB  1 
ATOM   5687  N  N   . ASN B  1 105 ? 28.318  -6.516  -18.469 1.00 74.58  ? 105  ASN B N   1 
ATOM   5688  C  CA  . ASN B  1 105 ? 26.954  -6.634  -18.974 1.00 71.54  ? 105  ASN B CA  1 
ATOM   5689  C  C   . ASN B  1 105 ? 26.759  -7.716  -20.029 1.00 69.61  ? 105  ASN B C   1 
ATOM   5690  O  O   . ASN B  1 105 ? 25.987  -7.543  -20.971 1.00 72.00  ? 105  ASN B O   1 
ATOM   5691  C  CB  . ASN B  1 105 ? 26.473  -5.286  -19.506 1.00 70.30  ? 105  ASN B CB  1 
ATOM   5692  C  CG  . ASN B  1 105 ? 26.616  -4.181  -18.486 1.00 69.60  ? 105  ASN B CG  1 
ATOM   5693  O  OD1 . ASN B  1 105 ? 26.555  -4.423  -17.280 1.00 69.96  ? 105  ASN B OD1 1 
ATOM   5694  N  ND2 . ASN B  1 105 ? 26.811  -2.960  -18.962 1.00 68.42  ? 105  ASN B ND2 1 
ATOM   5695  N  N   . ILE B  1 106 ? 27.452  -8.835  -19.861 1.00 65.13  ? 106  ILE B N   1 
ATOM   5696  C  CA  . ILE B  1 106 ? 27.246  -9.993  -20.718 1.00 61.40  ? 106  ILE B CA  1 
ATOM   5697  C  C   . ILE B  1 106 ? 26.503  -11.059 -19.941 1.00 58.05  ? 106  ILE B C   1 
ATOM   5698  O  O   . ILE B  1 106 ? 27.043  -11.621 -18.988 1.00 58.02  ? 106  ILE B O   1 
ATOM   5699  C  CB  . ILE B  1 106 ? 28.575  -10.592 -21.187 1.00 61.89  ? 106  ILE B CB  1 
ATOM   5700  C  CG1 . ILE B  1 106 ? 29.277  -9.638  -22.142 1.00 63.21  ? 106  ILE B CG1 1 
ATOM   5701  C  CG2 . ILE B  1 106 ? 28.334  -11.898 -21.906 1.00 61.37  ? 106  ILE B CG2 1 
ATOM   5702  C  CD1 . ILE B  1 106 ? 28.636  -9.594  -23.490 1.00 64.62  ? 106  ILE B CD1 1 
ATOM   5703  N  N   . ARG B  1 107 ? 25.258  -11.315 -20.326 1.00 55.47  ? 107  ARG B N   1 
ATOM   5704  C  CA  . ARG B  1 107 ? 24.461  -12.344 -19.670 1.00 52.60  ? 107  ARG B CA  1 
ATOM   5705  C  C   . ARG B  1 107 ? 24.529  -13.723 -20.326 1.00 53.39  ? 107  ARG B C   1 
ATOM   5706  O  O   . ARG B  1 107 ? 24.062  -14.709 -19.749 1.00 52.53  ? 107  ARG B O   1 
ATOM   5707  C  CB  . ARG B  1 107 ? 23.009  -11.898 -19.625 1.00 51.97  ? 107  ARG B CB  1 
ATOM   5708  C  CG  . ARG B  1 107 ? 22.784  -10.591 -18.904 1.00 54.24  ? 107  ARG B CG  1 
ATOM   5709  C  CD  . ARG B  1 107 ? 21.321  -10.208 -19.012 1.00 58.16  ? 107  ARG B CD  1 
ATOM   5710  N  NE  . ARG B  1 107 ? 20.997  -9.004  -18.259 1.00 59.67  ? 107  ARG B NE  1 
ATOM   5711  C  CZ  . ARG B  1 107 ? 20.237  -8.021  -18.729 1.00 62.14  ? 107  ARG B CZ  1 
ATOM   5712  N  NH1 . ARG B  1 107 ? 19.733  -8.100  -19.957 1.00 61.32  ? 107  ARG B NH1 1 
ATOM   5713  N  NH2 . ARG B  1 107 ? 19.988  -6.956  -17.976 1.00 64.06  ? 107  ARG B NH2 1 
ATOM   5714  N  N   . SER B  1 108 ? 25.098  -13.795 -21.528 1.00 55.02  ? 108  SER B N   1 
ATOM   5715  C  CA  . SER B  1 108 ? 25.098  -15.044 -22.294 1.00 54.92  ? 108  SER B CA  1 
ATOM   5716  C  C   . SER B  1 108 ? 26.284  -15.199 -23.261 1.00 55.75  ? 108  SER B C   1 
ATOM   5717  O  O   . SER B  1 108 ? 26.733  -14.218 -23.857 1.00 56.85  ? 108  SER B O   1 
ATOM   5718  C  CB  . SER B  1 108 ? 23.762  -15.189 -23.038 1.00 53.87  ? 108  SER B CB  1 
ATOM   5719  O  OG  . SER B  1 108 ? 23.954  -15.593 -24.382 1.00 56.58  ? 108  SER B OG  1 
ATOM   5720  N  N   . ILE B  1 109 ? 26.782  -16.429 -23.407 1.00 54.90  ? 109  ILE B N   1 
ATOM   5721  C  CA  . ILE B  1 109 ? 27.712  -16.778 -24.491 1.00 54.32  ? 109  ILE B CA  1 
ATOM   5722  C  C   . ILE B  1 109 ? 27.427  -18.170 -25.066 1.00 58.08  ? 109  ILE B C   1 
ATOM   5723  O  O   . ILE B  1 109 ? 27.278  -19.140 -24.320 1.00 60.33  ? 109  ILE B O   1 
ATOM   5724  C  CB  . ILE B  1 109 ? 29.200  -16.731 -24.064 1.00 50.77  ? 109  ILE B CB  1 
ATOM   5725  C  CG1 . ILE B  1 109 ? 29.471  -17.733 -22.943 1.00 49.74  ? 109  ILE B CG1 1 
ATOM   5726  C  CG2 . ILE B  1 109 ? 29.629  -15.317 -23.689 1.00 49.18  ? 109  ILE B CG2 1 
ATOM   5727  C  CD1 . ILE B  1 109 ? 30.922  -17.821 -22.553 1.00 48.66  ? 109  ILE B CD1 1 
ATOM   5728  N  N   . GLU B  1 110 ? 27.381  -18.260 -26.394 1.00 58.20  ? 110  GLU B N   1 
ATOM   5729  C  CA  . GLU B  1 110 ? 27.096  -19.510 -27.095 1.00 57.94  ? 110  GLU B CA  1 
ATOM   5730  C  C   . GLU B  1 110 ? 28.055  -19.687 -28.273 1.00 56.65  ? 110  GLU B C   1 
ATOM   5731  O  O   . GLU B  1 110 ? 28.308  -18.740 -29.016 1.00 56.34  ? 110  GLU B O   1 
ATOM   5732  C  CB  . GLU B  1 110 ? 25.646  -19.517 -27.596 1.00 60.71  ? 110  GLU B CB  1 
ATOM   5733  C  CG  . GLU B  1 110 ? 25.297  -20.712 -28.493 1.00 63.92  ? 110  GLU B CG  1 
ATOM   5734  C  CD  . GLU B  1 110 ? 24.009  -20.523 -29.301 1.00 62.68  ? 110  GLU B CD  1 
ATOM   5735  O  OE1 . GLU B  1 110 ? 23.427  -19.419 -29.281 1.00 61.29  ? 110  GLU B OE1 1 
ATOM   5736  O  OE2 . GLU B  1 110 ? 23.580  -21.490 -29.966 1.00 62.73  ? 110  GLU B OE2 1 
ATOM   5737  N  N   . TRP B  1 111 ? 28.589  -20.897 -28.438 1.00 55.05  ? 111  TRP B N   1 
ATOM   5738  C  CA  . TRP B  1 111 ? 29.472  -21.208 -29.563 1.00 53.02  ? 111  TRP B CA  1 
ATOM   5739  C  C   . TRP B  1 111 ? 28.727  -21.276 -30.897 1.00 53.12  ? 111  TRP B C   1 
ATOM   5740  O  O   . TRP B  1 111 ? 27.649  -21.859 -30.996 1.00 52.56  ? 111  TRP B O   1 
ATOM   5741  C  CB  . TRP B  1 111 ? 30.174  -22.556 -29.355 1.00 52.35  ? 111  TRP B CB  1 
ATOM   5742  C  CG  . TRP B  1 111 ? 31.356  -22.566 -28.428 1.00 53.16  ? 111  TRP B CG  1 
ATOM   5743  C  CD1 . TRP B  1 111 ? 31.411  -23.118 -27.180 1.00 53.57  ? 111  TRP B CD1 1 
ATOM   5744  C  CD2 . TRP B  1 111 ? 32.663  -22.035 -28.687 1.00 51.80  ? 111  TRP B CD2 1 
ATOM   5745  N  NE1 . TRP B  1 111 ? 32.664  -22.951 -26.642 1.00 52.05  ? 111  TRP B NE1 1 
ATOM   5746  C  CE2 . TRP B  1 111 ? 33.451  -22.290 -27.547 1.00 49.98  ? 111  TRP B CE2 1 
ATOM   5747  C  CE3 . TRP B  1 111 ? 33.241  -21.363 -29.767 1.00 51.41  ? 111  TRP B CE3 1 
ATOM   5748  C  CZ2 . TRP B  1 111 ? 34.779  -21.901 -27.456 1.00 48.29  ? 111  TRP B CZ2 1 
ATOM   5749  C  CZ3 . TRP B  1 111 ? 34.562  -20.976 -29.673 1.00 50.06  ? 111  TRP B CZ3 1 
ATOM   5750  C  CH2 . TRP B  1 111 ? 35.317  -21.248 -28.526 1.00 48.49  ? 111  TRP B CH2 1 
ATOM   5751  N  N   . ASN B  1 112 ? 29.324  -20.688 -31.925 1.00 52.80  ? 112  ASN B N   1 
ATOM   5752  C  CA  . ASN B  1 112 ? 28.909  -20.931 -33.297 1.00 53.92  ? 112  ASN B CA  1 
ATOM   5753  C  C   . ASN B  1 112 ? 29.359  -22.329 -33.719 1.00 55.37  ? 112  ASN B C   1 
ATOM   5754  O  O   . ASN B  1 112 ? 30.208  -22.932 -33.068 1.00 56.41  ? 112  ASN B O   1 
ATOM   5755  C  CB  . ASN B  1 112 ? 29.500  -19.874 -34.229 1.00 55.82  ? 112  ASN B CB  1 
ATOM   5756  C  CG  . ASN B  1 112 ? 29.177  -20.135 -35.687 1.00 57.92  ? 112  ASN B CG  1 
ATOM   5757  O  OD1 . ASN B  1 112 ? 29.892  -20.872 -36.372 1.00 57.54  ? 112  ASN B OD1 1 
ATOM   5758  N  ND2 . ASN B  1 112 ? 28.096  -19.531 -36.171 1.00 57.99  ? 112  ASN B ND2 1 
ATOM   5759  N  N   . GLN B  1 113 ? 28.767  -22.866 -34.780 1.00 56.12  ? 113  GLN B N   1 
ATOM   5760  C  CA  . GLN B  1 113 ? 29.171  -24.177 -35.299 1.00 55.58  ? 113  GLN B CA  1 
ATOM   5761  C  C   . GLN B  1 113 ? 30.680  -24.291 -35.570 1.00 55.59  ? 113  GLN B C   1 
ATOM   5762  O  O   . GLN B  1 113 ? 31.276  -25.345 -35.339 1.00 56.21  ? 113  GLN B O   1 
ATOM   5763  C  CB  . GLN B  1 113 ? 28.377  -24.533 -36.563 1.00 52.78  ? 113  GLN B CB  1 
ATOM   5764  N  N   . ASP B  1 114 ? 31.299  -23.212 -36.046 1.00 52.63  ? 114  ASP B N   1 
ATOM   5765  C  CA  . ASP B  1 114 ? 32.718  -23.253 -36.413 1.00 51.78  ? 114  ASP B CA  1 
ATOM   5766  C  C   . ASP B  1 114 ? 33.680  -23.454 -35.236 1.00 50.21  ? 114  ASP B C   1 
ATOM   5767  O  O   . ASP B  1 114 ? 34.884  -23.633 -35.436 1.00 47.74  ? 114  ASP B O   1 
ATOM   5768  C  CB  . ASP B  1 114 ? 33.122  -22.019 -37.228 1.00 53.62  ? 114  ASP B CB  1 
ATOM   5769  C  CG  . ASP B  1 114 ? 32.770  -20.716 -36.538 1.00 58.96  ? 114  ASP B CG  1 
ATOM   5770  O  OD1 . ASP B  1 114 ? 32.618  -20.699 -35.297 1.00 61.00  ? 114  ASP B OD1 1 
ATOM   5771  O  OD2 . ASP B  1 114 ? 32.653  -19.697 -37.247 1.00 61.45  ? 114  ASP B OD2 1 
ATOM   5772  N  N   . SER B  1 115 ? 33.156  -23.405 -34.015 1.00 49.43  ? 115  SER B N   1 
ATOM   5773  C  CA  . SER B  1 115 ? 33.988  -23.538 -32.826 1.00 48.95  ? 115  SER B CA  1 
ATOM   5774  C  C   . SER B  1 115 ? 35.032  -22.434 -32.812 1.00 45.51  ? 115  SER B C   1 
ATOM   5775  O  O   . SER B  1 115 ? 36.077  -22.552 -32.173 1.00 42.18  ? 115  SER B O   1 
ATOM   5776  C  CB  . SER B  1 115 ? 34.672  -24.907 -32.791 1.00 52.76  ? 115  SER B CB  1 
ATOM   5777  O  OG  . SER B  1 115 ? 33.726  -25.952 -32.630 1.00 54.99  ? 115  SER B OG  1 
ATOM   5778  N  N   . ARG B  1 116 ? 34.720  -21.353 -33.517 1.00 46.59  ? 116  ARG B N   1 
ATOM   5779  C  CA  . ARG B  1 116 ? 35.593  -20.189 -33.596 1.00 48.44  ? 116  ARG B CA  1 
ATOM   5780  C  C   . ARG B  1 116 ? 34.894  -18.950 -33.038 1.00 49.49  ? 116  ARG B C   1 
ATOM   5781  O  O   . ARG B  1 116 ? 35.383  -18.333 -32.094 1.00 53.05  ? 116  ARG B O   1 
ATOM   5782  C  CB  . ARG B  1 116 ? 36.122  -19.938 -35.012 1.00 47.55  ? 116  ARG B CB  1 
ATOM   5783  C  CG  . ARG B  1 116 ? 37.091  -18.770 -35.040 1.00 47.71  ? 116  ARG B CG  1 
ATOM   5784  C  CD  . ARG B  1 116 ? 37.747  -18.517 -36.390 1.00 47.71  ? 116  ARG B CD  1 
ATOM   5785  N  NE  . ARG B  1 116 ? 38.459  -17.240 -36.358 1.00 50.04  ? 116  ARG B NE  1 
ATOM   5786  C  CZ  . ARG B  1 116 ? 39.260  -16.779 -37.316 1.00 53.27  ? 116  ARG B CZ  1 
ATOM   5787  N  NH1 . ARG B  1 116 ? 39.477  -17.486 -38.416 1.00 55.16  ? 116  ARG B NH1 1 
ATOM   5788  N  NH2 . ARG B  1 116 ? 39.851  -15.600 -37.169 1.00 53.45  ? 116  ARG B NH2 1 
ATOM   5789  N  N   . ARG B  1 117 ? 33.782  -18.557 -33.650 1.00 46.29  ? 117  ARG B N   1 
ATOM   5790  C  CA  . ARG B  1 117 ? 33.024  -17.410 -33.160 1.00 46.45  ? 117  ARG B CA  1 
ATOM   5791  C  C   . ARG B  1 117 ? 32.166  -17.699 -31.927 1.00 50.14  ? 117  ARG B C   1 
ATOM   5792  O  O   . ARG B  1 117 ? 31.781  -18.839 -31.663 1.00 54.38  ? 117  ARG B O   1 
ATOM   5793  C  CB  . ARG B  1 117 ? 32.160  -16.830 -34.270 1.00 46.24  ? 117  ARG B CB  1 
ATOM   5794  C  CG  . ARG B  1 117 ? 32.974  -16.227 -35.395 1.00 46.64  ? 117  ARG B CG  1 
ATOM   5795  C  CD  . ARG B  1 117 ? 32.119  -15.993 -36.616 1.00 48.05  ? 117  ARG B CD  1 
ATOM   5796  N  NE  . ARG B  1 117 ? 31.689  -17.248 -37.223 1.00 50.52  ? 117  ARG B NE  1 
ATOM   5797  C  CZ  . ARG B  1 117 ? 30.679  -17.348 -38.081 1.00 53.86  ? 117  ARG B CZ  1 
ATOM   5798  N  NH1 . ARG B  1 117 ? 29.990  -16.264 -38.419 1.00 54.29  ? 117  ARG B NH1 1 
ATOM   5799  N  NH2 . ARG B  1 117 ? 30.348  -18.530 -38.592 1.00 53.92  ? 117  ARG B NH2 1 
ATOM   5800  N  N   . LEU B  1 118 ? 31.895  -16.644 -31.167 1.00 48.64  ? 118  LEU B N   1 
ATOM   5801  C  CA  . LEU B  1 118 ? 30.979  -16.712 -30.043 1.00 47.76  ? 118  LEU B CA  1 
ATOM   5802  C  C   . LEU B  1 118 ? 29.911  -15.650 -30.213 1.00 48.79  ? 118  LEU B C   1 
ATOM   5803  O  O   . LEU B  1 118 ? 30.182  -14.551 -30.708 1.00 49.47  ? 118  LEU B O   1 
ATOM   5804  C  CB  . LEU B  1 118 ? 31.712  -16.471 -28.725 1.00 46.22  ? 118  LEU B CB  1 
ATOM   5805  C  CG  . LEU B  1 118 ? 32.520  -17.622 -28.133 1.00 45.80  ? 118  LEU B CG  1 
ATOM   5806  C  CD1 . LEU B  1 118 ? 33.213  -17.172 -26.853 1.00 44.30  ? 118  LEU B CD1 1 
ATOM   5807  C  CD2 . LEU B  1 118 ? 31.621  -18.820 -27.869 1.00 45.91  ? 118  LEU B CD2 1 
ATOM   5808  N  N   . LEU B  1 119 ? 28.695  -15.985 -29.801 1.00 47.72  ? 119  LEU B N   1 
ATOM   5809  C  CA  . LEU B  1 119 ? 27.609  -15.026 -29.771 1.00 43.40  ? 119  LEU B CA  1 
ATOM   5810  C  C   . LEU B  1 119 ? 27.395  -14.579 -28.337 1.00 46.03  ? 119  LEU B C   1 
ATOM   5811  O  O   . LEU B  1 119 ? 27.065  -15.382 -27.470 1.00 48.61  ? 119  LEU B O   1 
ATOM   5812  C  CB  . LEU B  1 119 ? 26.334  -15.656 -30.298 1.00 40.33  ? 119  LEU B CB  1 
ATOM   5813  C  CG  . LEU B  1 119 ? 25.136  -14.766 -30.006 1.00 40.26  ? 119  LEU B CG  1 
ATOM   5814  C  CD1 . LEU B  1 119 ? 25.387  -13.390 -30.595 1.00 40.33  ? 119  LEU B CD1 1 
ATOM   5815  C  CD2 . LEU B  1 119 ? 23.839  -15.371 -30.538 1.00 40.43  ? 119  LEU B CD2 1 
ATOM   5816  N  N   . ALA B  1 120 ? 27.593  -13.293 -28.085 1.00 46.84  ? 120  ALA B N   1 
ATOM   5817  C  CA  . ALA B  1 120 ? 27.433  -12.760 -26.744 1.00 46.33  ? 120  ALA B CA  1 
ATOM   5818  C  C   . ALA B  1 120 ? 26.218  -11.849 -26.677 1.00 47.20  ? 120  ALA B C   1 
ATOM   5819  O  O   . ALA B  1 120 ? 26.139  -10.861 -27.401 1.00 49.24  ? 120  ALA B O   1 
ATOM   5820  C  CB  . ALA B  1 120 ? 28.684  -12.011 -26.324 1.00 45.54  ? 120  ALA B CB  1 
ATOM   5821  N  N   . VAL B  1 121 ? 25.271  -12.191 -25.809 1.00 44.08  ? 121  VAL B N   1 
ATOM   5822  C  CA  . VAL B  1 121 ? 24.118  -11.338 -25.571 1.00 43.17  ? 121  VAL B CA  1 
ATOM   5823  C  C   . VAL B  1 121 ? 24.293  -10.603 -24.241 1.00 47.95  ? 121  VAL B C   1 
ATOM   5824  O  O   . VAL B  1 121 ? 24.751  -11.181 -23.256 1.00 48.77  ? 121  VAL B O   1 
ATOM   5825  C  CB  . VAL B  1 121 ? 22.820  -12.156 -25.535 1.00 41.33  ? 121  VAL B CB  1 
ATOM   5826  C  CG1 . VAL B  1 121 ? 21.616  -11.236 -25.389 1.00 40.49  ? 121  VAL B CG1 1 
ATOM   5827  C  CG2 . VAL B  1 121 ? 22.699  -13.023 -26.786 1.00 38.83  ? 121  VAL B CG2 1 
ATOM   5828  N  N   . GLY B  1 122 ? 23.900  -9.334  -24.214 1.00 49.15  ? 122  GLY B N   1 
ATOM   5829  C  CA  . GLY B  1 122 ? 24.129  -8.476  -23.066 1.00 46.96  ? 122  GLY B CA  1 
ATOM   5830  C  C   . GLY B  1 122 ? 23.252  -7.240  -23.122 1.00 45.55  ? 122  GLY B C   1 
ATOM   5831  O  O   . GLY B  1 122 ? 22.288  -7.193  -23.886 1.00 46.71  ? 122  GLY B O   1 
ATOM   5832  N  N   . PHE B  1 123 ? 23.555  -6.244  -22.299 1.00 43.08  ? 123  PHE B N   1 
ATOM   5833  C  CA  . PHE B  1 123 ? 22.743  -5.033  -22.297 1.00 45.86  ? 123  PHE B CA  1 
ATOM   5834  C  C   . PHE B  1 123 ? 23.587  -3.770  -22.228 1.00 46.14  ? 123  PHE B C   1 
ATOM   5835  O  O   . PHE B  1 123 ? 24.760  -3.819  -21.866 1.00 45.98  ? 123  PHE B O   1 
ATOM   5836  C  CB  . PHE B  1 123 ? 21.769  -5.055  -21.123 1.00 47.45  ? 123  PHE B CB  1 
ATOM   5837  C  CG  . PHE B  1 123 ? 22.443  -5.164  -19.793 1.00 50.11  ? 123  PHE B CG  1 
ATOM   5838  C  CD1 . PHE B  1 123 ? 22.819  -6.402  -19.296 1.00 52.80  ? 123  PHE B CD1 1 
ATOM   5839  C  CD2 . PHE B  1 123 ? 22.716  -4.032  -19.043 1.00 51.38  ? 123  PHE B CD2 1 
ATOM   5840  C  CE1 . PHE B  1 123 ? 23.449  -6.513  -18.069 1.00 54.44  ? 123  PHE B CE1 1 
ATOM   5841  C  CE2 . PHE B  1 123 ? 23.347  -4.133  -17.813 1.00 53.28  ? 123  PHE B CE2 1 
ATOM   5842  C  CZ  . PHE B  1 123 ? 23.714  -5.376  -17.326 1.00 54.59  ? 123  PHE B CZ  1 
ATOM   5843  N  N   . LYS B  1 124 ? 22.985  -2.640  -22.586 1.00 46.36  ? 124  LYS B N   1 
ATOM   5844  C  CA  . LYS B  1 124 ? 23.617  -1.342  -22.353 1.00 48.33  ? 124  LYS B CA  1 
ATOM   5845  C  C   . LYS B  1 124 ? 22.622  -0.313  -21.788 1.00 49.15  ? 124  LYS B C   1 
ATOM   5846  O  O   . LYS B  1 124 ? 21.465  -0.228  -22.219 1.00 49.11  ? 124  LYS B O   1 
ATOM   5847  C  CB  . LYS B  1 124 ? 24.329  -0.826  -23.612 1.00 47.28  ? 124  LYS B CB  1 
ATOM   5848  C  CG  . LYS B  1 124 ? 23.563  0.222   -24.395 1.00 47.60  ? 124  LYS B CG  1 
ATOM   5849  N  N   . ARG B  1 125 ? 23.069  0.442   -20.791 1.00 46.70  ? 125  ARG B N   1 
ATOM   5850  C  CA  . ARG B  1 125 ? 22.216  1.450   -20.189 1.00 43.76  ? 125  ARG B CA  1 
ATOM   5851  C  C   . ARG B  1 125 ? 22.888  2.820   -20.195 1.00 42.69  ? 125  ARG B C   1 
ATOM   5852  O  O   . ARG B  1 125 ? 24.041  2.949   -20.594 1.00 44.37  ? 125  ARG B O   1 
ATOM   5853  C  CB  . ARG B  1 125 ? 21.858  1.040   -18.764 1.00 41.11  ? 125  ARG B CB  1 
ATOM   5854  C  CG  . ARG B  1 125 ? 21.324  -0.369  -18.641 1.00 40.16  ? 125  ARG B CG  1 
ATOM   5855  C  CD  . ARG B  1 125 ? 21.119  -0.738  -17.181 1.00 41.84  ? 125  ARG B CD  1 
ATOM   5856  N  NE  . ARG B  1 125 ? 20.488  -2.046  -17.019 1.00 45.25  ? 125  ARG B NE  1 
ATOM   5857  C  CZ  . ARG B  1 125 ? 20.499  -2.743  -15.887 1.00 45.48  ? 125  ARG B CZ  1 
ATOM   5858  N  NH1 . ARG B  1 125 ? 21.114  -2.257  -14.821 1.00 46.89  ? 125  ARG B NH1 1 
ATOM   5859  N  NH2 . ARG B  1 125 ? 19.904  -3.924  -15.819 1.00 44.19  ? 125  ARG B NH2 1 
ATOM   5860  N  N   . ARG B  1 126 ? 22.166  3.829   -19.718 1.00 41.37  ? 126  ARG B N   1 
ATOM   5861  C  CA  . ARG B  1 126 ? 22.636  5.209   -19.743 1.00 40.77  ? 126  ARG B CA  1 
ATOM   5862  C  C   . ARG B  1 126 ? 23.778  5.430   -18.749 1.00 45.88  ? 126  ARG B C   1 
ATOM   5863  O  O   . ARG B  1 126 ? 24.744  6.130   -19.041 1.00 47.64  ? 126  ARG B O   1 
ATOM   5864  C  CB  . ARG B  1 126 ? 21.463  6.153   -19.480 1.00 40.51  ? 126  ARG B CB  1 
ATOM   5865  C  CG  . ARG B  1 126 ? 20.339  6.029   -20.519 1.00 41.88  ? 126  ARG B CG  1 
ATOM   5866  C  CD  . ARG B  1 126 ? 19.169  6.974   -20.233 1.00 42.42  ? 126  ARG B CD  1 
ATOM   5867  N  NE  . ARG B  1 126 ? 18.388  7.272   -21.435 1.00 43.71  ? 126  ARG B NE  1 
ATOM   5868  C  CZ  . ARG B  1 126 ? 17.177  6.778   -21.699 1.00 44.33  ? 126  ARG B CZ  1 
ATOM   5869  N  NH1 . ARG B  1 126 ? 16.552  7.112   -22.820 1.00 41.25  ? 126  ARG B NH1 1 
ATOM   5870  N  NH2 . ARG B  1 126 ? 16.580  5.956   -20.844 1.00 47.69  ? 126  ARG B NH2 1 
ATOM   5871  N  N   . GLU B  1 127 ? 23.662  4.816   -17.577 1.00 49.15  ? 127  GLU B N   1 
ATOM   5872  C  CA  . GLU B  1 127 ? 24.763  4.743   -16.620 1.00 51.23  ? 127  GLU B CA  1 
ATOM   5873  C  C   . GLU B  1 127 ? 25.226  6.065   -16.008 1.00 46.97  ? 127  GLU B C   1 
ATOM   5874  O  O   . GLU B  1 127 ? 26.370  6.160   -15.568 1.00 46.76  ? 127  GLU B O   1 
ATOM   5875  C  CB  . GLU B  1 127 ? 25.976  4.052   -17.260 1.00 58.80  ? 127  GLU B CB  1 
ATOM   5876  C  CG  . GLU B  1 127 ? 25.708  2.654   -17.806 1.00 69.56  ? 127  GLU B CG  1 
ATOM   5877  C  CD  . GLU B  1 127 ? 25.643  1.586   -16.725 1.00 78.57  ? 127  GLU B CD  1 
ATOM   5878  O  OE1 . GLU B  1 127 ? 25.241  1.905   -15.585 1.00 82.53  ? 127  GLU B OE1 1 
ATOM   5879  O  OE2 . GLU B  1 127 ? 25.998  0.422   -17.016 1.00 80.79  ? 127  GLU B OE2 1 
ATOM   5880  N  N   . ASP B  1 128 ? 24.360  7.071   -15.944 1.00 42.56  ? 128  ASP B N   1 
ATOM   5881  C  CA  . ASP B  1 128 ? 24.731  8.280   -15.212 1.00 39.94  ? 128  ASP B CA  1 
ATOM   5882  C  C   . ASP B  1 128 ? 24.982  7.952   -13.744 1.00 41.09  ? 128  ASP B C   1 
ATOM   5883  O  O   . ASP B  1 128 ? 24.282  7.138   -13.150 1.00 42.63  ? 128  ASP B O   1 
ATOM   5884  C  CB  . ASP B  1 128 ? 23.664  9.360   -15.321 1.00 39.61  ? 128  ASP B CB  1 
ATOM   5885  C  CG  . ASP B  1 128 ? 24.030  10.617  -14.547 1.00 39.39  ? 128  ASP B CG  1 
ATOM   5886  O  OD1 . ASP B  1 128 ? 24.583  11.547  -15.167 1.00 39.60  ? 128  ASP B OD1 1 
ATOM   5887  O  OD2 . ASP B  1 128 ? 23.761  10.677  -13.326 1.00 38.10  ? 128  ASP B OD2 1 
ATOM   5888  N  N   . GLU B  1 129 ? 25.980  8.594   -13.159 1.00 42.75  ? 129  GLU B N   1 
ATOM   5889  C  CA  . GLU B  1 129 ? 26.393  8.272   -11.797 1.00 48.86  ? 129  GLU B CA  1 
ATOM   5890  C  C   . GLU B  1 129 ? 25.323  8.621   -10.750 1.00 48.08  ? 129  GLU B C   1 
ATOM   5891  O  O   . GLU B  1 129 ? 25.065  7.859   -9.825  1.00 47.95  ? 129  GLU B O   1 
ATOM   5892  C  CB  . GLU B  1 129 ? 27.695  9.005   -11.482 1.00 55.27  ? 129  GLU B CB  1 
ATOM   5893  C  CG  . GLU B  1 129 ? 28.598  8.304   -10.477 1.00 62.66  ? 129  GLU B CG  1 
ATOM   5894  C  CD  . GLU B  1 129 ? 29.852  9.107   -10.176 1.00 67.66  ? 129  GLU B CD  1 
ATOM   5895  O  OE1 . GLU B  1 129 ? 30.484  8.843   -9.128  1.00 69.65  ? 129  GLU B OE1 1 
ATOM   5896  O  OE2 . GLU B  1 129 ? 30.204  9.998   -10.988 1.00 67.18  ? 129  GLU B OE2 1 
ATOM   5897  N  N   . ASP B  1 130 ? 24.747  9.808   -10.889 1.00 45.55  ? 130  ASP B N   1 
ATOM   5898  C  CA  . ASP B  1 130 ? 23.762  10.354  -9.959  1.00 41.59  ? 130  ASP B CA  1 
ATOM   5899  C  C   . ASP B  1 130 ? 22.293  9.933   -10.123 1.00 43.21  ? 130  ASP B C   1 
ATOM   5900  O  O   . ASP B  1 130 ? 21.551  9.830   -9.136  1.00 40.95  ? 130  ASP B O   1 
ATOM   5901  C  CB  . ASP B  1 130 ? 23.904  11.868  -9.933  1.00 39.45  ? 130  ASP B CB  1 
ATOM   5902  C  CG  . ASP B  1 130 ? 25.323  12.294  -9.636  1.00 38.20  ? 130  ASP B CG  1 
ATOM   5903  O  OD1 . ASP B  1 130 ? 25.872  11.853  -8.610  1.00 40.34  ? 130  ASP B OD1 1 
ATOM   5904  O  OD2 . ASP B  1 130 ? 25.908  13.032  -10.445 1.00 37.14  ? 130  ASP B OD2 1 
ATOM   5905  N  N   . PHE B  1 131 ? 21.856  9.730   -11.363 1.00 44.95  ? 131  PHE B N   1 
ATOM   5906  C  CA  . PHE B  1 131 ? 20.448  9.414   -11.585 1.00 42.37  ? 131  PHE B CA  1 
ATOM   5907  C  C   . PHE B  1 131 ? 20.166  8.409   -12.696 1.00 40.72  ? 131  PHE B C   1 
ATOM   5908  O  O   . PHE B  1 131 ? 20.964  8.208   -13.611 1.00 43.43  ? 131  PHE B O   1 
ATOM   5909  C  CB  . PHE B  1 131 ? 19.617  10.691  -11.782 1.00 41.19  ? 131  PHE B CB  1 
ATOM   5910  C  CG  . PHE B  1 131 ? 19.751  11.315  -13.145 1.00 41.33  ? 131  PHE B CG  1 
ATOM   5911  C  CD1 . PHE B  1 131 ? 20.716  12.283  -13.390 1.00 40.29  ? 131  PHE B CD1 1 
ATOM   5912  C  CD2 . PHE B  1 131 ? 18.888  10.957  -14.175 1.00 40.09  ? 131  PHE B CD2 1 
ATOM   5913  C  CE1 . PHE B  1 131 ? 20.828  12.871  -14.642 1.00 38.25  ? 131  PHE B CE1 1 
ATOM   5914  C  CE2 . PHE B  1 131 ? 18.993  11.535  -15.422 1.00 37.31  ? 131  PHE B CE2 1 
ATOM   5915  C  CZ  . PHE B  1 131 ? 19.965  12.494  -15.657 1.00 38.30  ? 131  PHE B CZ  1 
ATOM   5916  N  N   . ILE B  1 132 ? 19.012  7.773   -12.572 1.00 36.84  ? 132  ILE B N   1 
ATOM   5917  C  CA  . ILE B  1 132 ? 18.502  6.831   -13.543 1.00 36.97  ? 132  ILE B CA  1 
ATOM   5918  C  C   . ILE B  1 132 ? 17.442  7.563   -14.337 1.00 41.48  ? 132  ILE B C   1 
ATOM   5919  O  O   . ILE B  1 132 ? 16.721  8.385   -13.778 1.00 46.32  ? 132  ILE B O   1 
ATOM   5920  C  CB  . ILE B  1 132 ? 17.841  5.670   -12.810 1.00 34.59  ? 132  ILE B CB  1 
ATOM   5921  C  CG1 . ILE B  1 132 ? 18.912  4.783   -12.180 1.00 37.64  ? 132  ILE B CG1 1 
ATOM   5922  C  CG2 . ILE B  1 132 ? 16.939  4.881   -13.734 1.00 30.93  ? 132  ILE B CG2 1 
ATOM   5923  C  CD1 . ILE B  1 132 ? 18.407  4.003   -10.983 1.00 40.14  ? 132  ILE B CD1 1 
ATOM   5924  N  N   . PHE B  1 133 ? 17.342  7.283   -15.632 1.00 40.22  ? 133  PHE B N   1 
ATOM   5925  C  CA  . PHE B  1 133 ? 16.305  7.908   -16.447 1.00 40.85  ? 133  PHE B CA  1 
ATOM   5926  C  C   . PHE B  1 133 ? 15.562  6.860   -17.257 1.00 42.53  ? 133  PHE B C   1 
ATOM   5927  O  O   . PHE B  1 133 ? 16.183  6.054   -17.950 1.00 43.95  ? 133  PHE B O   1 
ATOM   5928  C  CB  . PHE B  1 133 ? 16.914  8.958   -17.375 1.00 39.99  ? 133  PHE B CB  1 
ATOM   5929  C  CG  . PHE B  1 133 ? 15.914  9.926   -17.934 1.00 40.55  ? 133  PHE B CG  1 
ATOM   5930  C  CD1 . PHE B  1 133 ? 15.473  11.001  -17.180 1.00 42.38  ? 133  PHE B CD1 1 
ATOM   5931  C  CD2 . PHE B  1 133 ? 15.419  9.767   -19.216 1.00 39.99  ? 133  PHE B CD2 1 
ATOM   5932  C  CE1 . PHE B  1 133 ? 14.556  11.895  -17.696 1.00 41.63  ? 133  PHE B CE1 1 
ATOM   5933  C  CE2 . PHE B  1 133 ? 14.503  10.655  -19.738 1.00 38.74  ? 133  PHE B CE2 1 
ATOM   5934  C  CZ  . PHE B  1 133 ? 14.071  11.716  -18.982 1.00 40.57  ? 133  PHE B CZ  1 
ATOM   5935  N  N   . GLU B  1 134 ? 14.236  6.868   -17.178 1.00 42.72  ? 134  GLU B N   1 
ATOM   5936  C  CA  . GLU B  1 134 ? 13.442  5.857   -17.875 1.00 45.09  ? 134  GLU B CA  1 
ATOM   5937  C  C   . GLU B  1 134 ? 12.368  6.464   -18.781 1.00 46.26  ? 134  GLU B C   1 
ATOM   5938  O  O   . GLU B  1 134 ? 11.518  7.220   -18.307 1.00 48.83  ? 134  GLU B O   1 
ATOM   5939  C  CB  . GLU B  1 134 ? 12.799  4.905   -16.863 1.00 45.48  ? 134  GLU B CB  1 
ATOM   5940  C  CG  . GLU B  1 134 ? 12.159  3.691   -17.496 1.00 49.28  ? 134  GLU B CG  1 
ATOM   5941  C  CD  . GLU B  1 134 ? 13.042  3.058   -18.559 1.00 51.85  ? 134  GLU B CD  1 
ATOM   5942  O  OE1 . GLU B  1 134 ? 12.922  3.438   -19.745 1.00 50.80  ? 134  GLU B OE1 1 
ATOM   5943  O  OE2 . GLU B  1 134 ? 13.858  2.180   -18.208 1.00 54.36  ? 134  GLU B OE2 1 
ATOM   5944  N  N   . ASP B  1 135 ? 12.445  6.195   -20.086 1.00 43.56  ? 135  ASP B N   1 
ATOM   5945  C  CA  . ASP B  1 135 ? 11.346  6.537   -20.998 1.00 43.68  ? 135  ASP B CA  1 
ATOM   5946  C  C   . ASP B  1 135 ? 10.373  5.399   -21.387 1.00 44.94  ? 135  ASP B C   1 
ATOM   5947  O  O   . ASP B  1 135 ? 9.394   5.639   -22.101 1.00 44.61  ? 135  ASP B O   1 
ATOM   5948  C  CB  . ASP B  1 135 ? 11.853  7.279   -22.243 1.00 44.77  ? 135  ASP B CB  1 
ATOM   5949  C  CG  . ASP B  1 135 ? 13.078  6.633   -22.861 1.00 49.15  ? 135  ASP B CG  1 
ATOM   5950  O  OD1 . ASP B  1 135 ? 13.801  7.334   -23.604 1.00 49.70  ? 135  ASP B OD1 1 
ATOM   5951  O  OD2 . ASP B  1 135 ? 13.325  5.436   -22.610 1.00 51.19  ? 135  ASP B OD2 1 
ATOM   5952  N  N   . ASP B  1 136 ? 10.632  4.182   -20.912 1.00 44.70  ? 136  ASP B N   1 
ATOM   5953  C  CA  . ASP B  1 136 ? 9.869   2.992   -21.310 1.00 45.72  ? 136  ASP B CA  1 
ATOM   5954  C  C   . ASP B  1 136 ? 9.372   2.290   -20.052 1.00 45.50  ? 136  ASP B C   1 
ATOM   5955  O  O   . ASP B  1 136 ? 9.461   2.845   -18.968 1.00 48.81  ? 136  ASP B O   1 
ATOM   5956  C  CB  . ASP B  1 136 ? 10.739  2.046   -22.146 1.00 48.92  ? 136  ASP B CB  1 
ATOM   5957  C  CG  . ASP B  1 136 ? 9.929   1.187   -23.119 1.00 51.33  ? 136  ASP B CG  1 
ATOM   5958  O  OD1 . ASP B  1 136 ? 8.711   1.017   -22.911 1.00 53.54  ? 136  ASP B OD1 1 
ATOM   5959  O  OD2 . ASP B  1 136 ? 10.519  0.677   -24.097 1.00 48.67  ? 136  ASP B OD2 1 
ATOM   5960  N  N   . VAL B  1 137 ? 8.804   1.098   -20.190 1.00 43.64  ? 137  VAL B N   1 
ATOM   5961  C  CA  . VAL B  1 137 ? 8.387   0.324   -19.018 1.00 43.72  ? 137  VAL B CA  1 
ATOM   5962  C  C   . VAL B  1 137 ? 8.933   -1.097  -19.076 1.00 43.92  ? 137  VAL B C   1 
ATOM   5963  O  O   . VAL B  1 137 ? 9.203   -1.611  -20.158 1.00 45.97  ? 137  VAL B O   1 
ATOM   5964  C  CB  . VAL B  1 137 ? 6.847   0.237   -18.904 1.00 42.95  ? 137  VAL B CB  1 
ATOM   5965  C  CG1 . VAL B  1 137 ? 6.240   1.616   -18.828 1.00 42.45  ? 137  VAL B CG1 1 
ATOM   5966  C  CG2 . VAL B  1 137 ? 6.272   -0.528  -20.086 1.00 42.88  ? 137  VAL B CG2 1 
ATOM   5967  N  N   . PRO B  1 138 ? 9.105   -1.736  -17.910 1.00 43.05  ? 138  PRO B N   1 
ATOM   5968  C  CA  . PRO B  1 138 ? 8.923   -1.122  -16.594 1.00 45.17  ? 138  PRO B CA  1 
ATOM   5969  C  C   . PRO B  1 138 ? 10.199  -0.381  -16.225 1.00 44.69  ? 138  PRO B C   1 
ATOM   5970  O  O   . PRO B  1 138 ? 11.140  -0.395  -17.014 1.00 45.31  ? 138  PRO B O   1 
ATOM   5971  C  CB  . PRO B  1 138 ? 8.724   -2.331  -15.681 1.00 44.05  ? 138  PRO B CB  1 
ATOM   5972  C  CG  . PRO B  1 138 ? 9.547   -3.394  -16.314 1.00 43.36  ? 138  PRO B CG  1 
ATOM   5973  C  CD  . PRO B  1 138 ? 9.491   -3.153  -17.802 1.00 42.90  ? 138  PRO B CD  1 
ATOM   5974  N  N   . ALA B  1 139 ? 10.240  0.262   -15.066 1.00 43.28  ? 139  ALA B N   1 
ATOM   5975  C  CA  . ALA B  1 139 ? 11.427  1.023   -14.689 1.00 41.01  ? 139  ALA B CA  1 
ATOM   5976  C  C   . ALA B  1 139 ? 12.512  0.114   -14.122 1.00 43.32  ? 139  ALA B C   1 
ATOM   5977  O  O   . ALA B  1 139 ? 13.682  0.480   -14.087 1.00 47.11  ? 139  ALA B O   1 
ATOM   5978  C  CB  . ALA B  1 139 ? 11.074  2.116   -13.707 1.00 36.77  ? 139  ALA B CB  1 
ATOM   5979  N  N   . TRP B  1 140 ? 12.124  -1.081  -13.698 1.00 42.00  ? 140  TRP B N   1 
ATOM   5980  C  CA  . TRP B  1 140 ? 13.068  -2.012  -13.098 1.00 41.99  ? 140  TRP B CA  1 
ATOM   5981  C  C   . TRP B  1 140 ? 12.582  -3.448  -13.255 1.00 39.69  ? 140  TRP B C   1 
ATOM   5982  O  O   . TRP B  1 140 ? 11.422  -3.690  -13.581 1.00 39.72  ? 140  TRP B O   1 
ATOM   5983  C  CB  . TRP B  1 140 ? 13.282  -1.669  -11.621 1.00 45.96  ? 140  TRP B CB  1 
ATOM   5984  C  CG  . TRP B  1 140 ? 12.024  -1.712  -10.800 1.00 50.95  ? 140  TRP B CG  1 
ATOM   5985  C  CD1 . TRP B  1 140 ? 10.846  -2.312  -11.139 1.00 53.29  ? 140  TRP B CD1 1 
ATOM   5986  C  CD2 . TRP B  1 140 ? 11.815  -1.124  -9.507  1.00 53.59  ? 140  TRP B CD2 1 
ATOM   5987  N  NE1 . TRP B  1 140 ? 9.922   -2.142  -10.139 1.00 53.69  ? 140  TRP B NE1 1 
ATOM   5988  C  CE2 . TRP B  1 140 ? 10.489  -1.416  -9.126  1.00 53.61  ? 140  TRP B CE2 1 
ATOM   5989  C  CE3 . TRP B  1 140 ? 12.619  -0.382  -8.635  1.00 56.13  ? 140  TRP B CE3 1 
ATOM   5990  C  CZ2 . TRP B  1 140 ? 9.948   -0.991  -7.907  1.00 54.27  ? 140  TRP B CZ2 1 
ATOM   5991  C  CZ3 . TRP B  1 140 ? 12.076  0.040   -7.418  1.00 56.40  ? 140  TRP B CZ3 1 
ATOM   5992  C  CH2 . TRP B  1 140 ? 10.755  -0.267  -7.070  1.00 54.41  ? 140  TRP B CH2 1 
ATOM   5993  N  N   . PHE B  1 141 ? 13.483  -4.400  -13.058 1.00 37.03  ? 141  PHE B N   1 
ATOM   5994  C  CA  . PHE B  1 141 ? 13.107  -5.802  -13.100 1.00 38.34  ? 141  PHE B CA  1 
ATOM   5995  C  C   . PHE B  1 141 ? 13.902  -6.577  -12.059 1.00 40.68  ? 141  PHE B C   1 
ATOM   5996  O  O   . PHE B  1 141 ? 15.113  -6.384  -11.932 1.00 38.41  ? 141  PHE B O   1 
ATOM   5997  C  CB  . PHE B  1 141 ? 13.351  -6.374  -14.492 1.00 38.77  ? 141  PHE B CB  1 
ATOM   5998  C  CG  . PHE B  1 141 ? 12.543  -7.603  -14.793 1.00 41.46  ? 141  PHE B CG  1 
ATOM   5999  C  CD1 . PHE B  1 141 ? 11.304  -7.502  -15.399 1.00 42.87  ? 141  PHE B CD1 1 
ATOM   6000  C  CD2 . PHE B  1 141 ? 13.028  -8.859  -14.485 1.00 42.75  ? 141  PHE B CD2 1 
ATOM   6001  C  CE1 . PHE B  1 141 ? 10.566  -8.627  -15.691 1.00 43.87  ? 141  PHE B CE1 1 
ATOM   6002  C  CE2 . PHE B  1 141 ? 12.288  -9.991  -14.773 1.00 43.19  ? 141  PHE B CE2 1 
ATOM   6003  C  CZ  . PHE B  1 141 ? 11.057  -9.872  -15.377 1.00 43.43  ? 141  PHE B CZ  1 
ATOM   6004  N  N   . ASP B  1 142 ? 13.221  -7.464  -11.335 1.00 45.22  ? 142  ASP B N   1 
ATOM   6005  C  CA  . ASP B  1 142 ? 13.834  -8.183  -10.226 1.00 47.33  ? 142  ASP B CA  1 
ATOM   6006  C  C   . ASP B  1 142 ? 15.111  -8.897  -10.615 1.00 50.21  ? 142  ASP B C   1 
ATOM   6007  O  O   . ASP B  1 142 ? 15.137  -9.675  -11.568 1.00 52.73  ? 142  ASP B O   1 
ATOM   6008  C  CB  . ASP B  1 142 ? 12.883  -9.214  -9.630  1.00 48.34  ? 142  ASP B CB  1 
ATOM   6009  C  CG  . ASP B  1 142 ? 13.461  -9.870  -8.393  1.00 48.76  ? 142  ASP B CG  1 
ATOM   6010  O  OD1 . ASP B  1 142 ? 13.234  -9.333  -7.287  1.00 52.85  ? 142  ASP B OD1 1 
ATOM   6011  O  OD2 . ASP B  1 142 ? 14.157  -10.900 -8.520  1.00 44.60  ? 142  ASP B OD2 1 
ATOM   6012  N  N   . ASN B  1 143 ? 16.151  -8.652  -9.829  1.00 50.73  ? 143  ASN B N   1 
ATOM   6013  C  CA  . ASN B  1 143 ? 17.456  -9.254  -10.040 1.00 52.29  ? 143  ASN B CA  1 
ATOM   6014  C  C   . ASN B  1 143 ? 18.249  -8.602  -11.176 1.00 53.15  ? 143  ASN B C   1 
ATOM   6015  O  O   . ASN B  1 143 ? 19.450  -8.832  -11.298 1.00 55.56  ? 143  ASN B O   1 
ATOM   6016  C  CB  . ASN B  1 143 ? 17.321  -10.764 -10.266 1.00 53.02  ? 143  ASN B CB  1 
ATOM   6017  C  CG  . ASN B  1 143 ? 18.583  -11.522 -9.909  1.00 53.74  ? 143  ASN B CG  1 
ATOM   6018  O  OD1 . ASN B  1 143 ? 19.446  -11.009 -9.197  1.00 53.64  ? 143  ASN B OD1 1 
ATOM   6019  N  ND2 . ASN B  1 143 ? 18.695  -12.755 -10.397 1.00 53.97  ? 143  ASN B ND2 1 
ATOM   6020  N  N   . MET B  1 144 ? 17.594  -7.795  -12.009 1.00 51.89  ? 144  MET B N   1 
ATOM   6021  C  CA  . MET B  1 144 ? 18.327  -7.025  -13.021 1.00 50.48  ? 144  MET B CA  1 
ATOM   6022  C  C   . MET B  1 144 ? 18.650  -5.556  -12.652 1.00 48.34  ? 144  MET B C   1 
ATOM   6023  O  O   . MET B  1 144 ? 19.365  -4.871  -13.388 1.00 48.02  ? 144  MET B O   1 
ATOM   6024  C  CB  . MET B  1 144 ? 17.600  -7.085  -14.370 1.00 49.49  ? 144  MET B CB  1 
ATOM   6025  C  CG  . MET B  1 144 ? 17.339  -8.496  -14.883 1.00 51.40  ? 144  MET B CG  1 
ATOM   6026  S  SD  . MET B  1 144 ? 16.541  -8.537  -16.513 1.00 70.58  ? 144  MET B SD  1 
ATOM   6027  C  CE  . MET B  1 144 ? 16.393  -10.305 -16.736 1.00 135.66 ? 144  MET B CE  1 
ATOM   6028  N  N   . GLY B  1 145 ? 18.153  -5.081  -11.513 1.00 45.65  ? 145  GLY B N   1 
ATOM   6029  C  CA  . GLY B  1 145 ? 18.292  -3.676  -11.152 1.00 44.31  ? 145  GLY B CA  1 
ATOM   6030  C  C   . GLY B  1 145 ? 17.322  -2.752  -11.881 1.00 44.03  ? 145  GLY B C   1 
ATOM   6031  O  O   . GLY B  1 145 ? 16.339  -3.204  -12.466 1.00 42.70  ? 145  GLY B O   1 
ATOM   6032  N  N   . PHE B  1 146 ? 17.584  -1.448  -11.824 1.00 44.60  ? 146  PHE B N   1 
ATOM   6033  C  CA  . PHE B  1 146 ? 16.811  -0.477  -12.589 1.00 46.43  ? 146  PHE B CA  1 
ATOM   6034  C  C   . PHE B  1 146 ? 17.200  -0.609  -14.054 1.00 46.44  ? 146  PHE B C   1 
ATOM   6035  O  O   . PHE B  1 146 ? 18.362  -0.821  -14.363 1.00 47.14  ? 146  PHE B O   1 
ATOM   6036  C  CB  . PHE B  1 146 ? 17.121  0.944   -12.119 1.00 48.78  ? 146  PHE B CB  1 
ATOM   6037  C  CG  . PHE B  1 146 ? 16.404  1.347   -10.860 1.00 50.52  ? 146  PHE B CG  1 
ATOM   6038  C  CD1 . PHE B  1 146 ? 16.965  1.112   -9.613  1.00 50.17  ? 146  PHE B CD1 1 
ATOM   6039  C  CD2 . PHE B  1 146 ? 15.174  1.983   -10.922 1.00 50.30  ? 146  PHE B CD2 1 
ATOM   6040  C  CE1 . PHE B  1 146 ? 16.302  1.493   -8.451  1.00 49.20  ? 146  PHE B CE1 1 
ATOM   6041  C  CE2 . PHE B  1 146 ? 14.510  2.367   -9.763  1.00 49.35  ? 146  PHE B CE2 1 
ATOM   6042  C  CZ  . PHE B  1 146 ? 15.074  2.120   -8.529  1.00 48.04  ? 146  PHE B CZ  1 
ATOM   6043  N  N   . PHE B  1 147 ? 16.245  -0.479  -14.965 1.00 47.28  ? 147  PHE B N   1 
ATOM   6044  C  CA  . PHE B  1 147 ? 16.559  -0.654  -16.385 1.00 48.16  ? 147  PHE B CA  1 
ATOM   6045  C  C   . PHE B  1 147 ? 17.406  0.492   -16.939 1.00 48.66  ? 147  PHE B C   1 
ATOM   6046  O  O   . PHE B  1 147 ? 18.344  0.264   -17.696 1.00 51.24  ? 147  PHE B O   1 
ATOM   6047  C  CB  . PHE B  1 147 ? 15.292  -0.883  -17.227 1.00 46.14  ? 147  PHE B CB  1 
ATOM   6048  C  CG  . PHE B  1 147 ? 14.903  -2.332  -17.356 1.00 45.02  ? 147  PHE B CG  1 
ATOM   6049  C  CD1 . PHE B  1 147 ? 13.618  -2.744  -17.068 1.00 46.50  ? 147  PHE B CD1 1 
ATOM   6050  C  CD2 . PHE B  1 147 ? 15.826  -3.280  -17.773 1.00 45.32  ? 147  PHE B CD2 1 
ATOM   6051  C  CE1 . PHE B  1 147 ? 13.262  -4.082  -17.186 1.00 47.32  ? 147  PHE B CE1 1 
ATOM   6052  C  CE2 . PHE B  1 147 ? 15.478  -4.615  -17.895 1.00 44.73  ? 147  PHE B CE2 1 
ATOM   6053  C  CZ  . PHE B  1 147 ? 14.198  -5.017  -17.601 1.00 45.79  ? 147  PHE B CZ  1 
ATOM   6054  N  N   . ASP B  1 148 ? 17.077  1.720   -16.564 1.00 46.64  ? 148  ASP B N   1 
ATOM   6055  C  CA  . ASP B  1 148 ? 17.908  2.857   -16.923 1.00 47.30  ? 148  ASP B CA  1 
ATOM   6056  C  C   . ASP B  1 148 ? 18.087  2.950   -18.437 1.00 46.13  ? 148  ASP B C   1 
ATOM   6057  O  O   . ASP B  1 148 ? 19.176  3.257   -18.928 1.00 43.23  ? 148  ASP B O   1 
ATOM   6058  C  CB  . ASP B  1 148 ? 19.267  2.746   -16.224 1.00 50.68  ? 148  ASP B CB  1 
ATOM   6059  C  CG  . ASP B  1 148 ? 20.077  4.028   -16.298 1.00 54.08  ? 148  ASP B CG  1 
ATOM   6060  O  OD1 . ASP B  1 148 ? 19.484  5.128   -16.189 1.00 52.73  ? 148  ASP B OD1 1 
ATOM   6061  O  OD2 . ASP B  1 148 ? 21.315  3.928   -16.452 1.00 56.62  ? 148  ASP B OD2 1 
ATOM   6062  N  N   . GLY B  1 149 ? 17.008  2.677   -19.168 1.00 49.00  ? 149  GLY B N   1 
ATOM   6063  C  CA  . GLY B  1 149 ? 16.983  2.823   -20.615 1.00 50.78  ? 149  GLY B CA  1 
ATOM   6064  C  C   . GLY B  1 149 ? 17.636  1.670   -21.348 1.00 53.49  ? 149  GLY B C   1 
ATOM   6065  O  O   . GLY B  1 149 ? 18.084  1.815   -22.483 1.00 53.70  ? 149  GLY B O   1 
ATOM   6066  N  N   . GLU B  1 150 ? 17.669  0.517   -20.693 1.00 55.59  ? 150  GLU B N   1 
ATOM   6067  C  CA  . GLU B  1 150 ? 18.412  -0.641  -21.172 1.00 55.54  ? 150  GLU B CA  1 
ATOM   6068  C  C   . GLU B  1 150 ? 18.040  -1.030  -22.592 1.00 56.96  ? 150  GLU B C   1 
ATOM   6069  O  O   . GLU B  1 150 ? 16.880  -0.939  -22.986 1.00 59.76  ? 150  GLU B O   1 
ATOM   6070  C  CB  . GLU B  1 150 ? 18.179  -1.828  -20.235 1.00 54.42  ? 150  GLU B CB  1 
ATOM   6071  C  CG  . GLU B  1 150 ? 18.729  -3.149  -20.738 1.00 53.81  ? 150  GLU B CG  1 
ATOM   6072  C  CD  . GLU B  1 150 ? 18.636  -4.251  -19.694 1.00 53.18  ? 150  GLU B CD  1 
ATOM   6073  O  OE1 . GLU B  1 150 ? 18.977  -3.996  -18.516 1.00 49.63  ? 150  GLU B OE1 1 
ATOM   6074  O  OE2 . GLU B  1 150 ? 18.219  -5.373  -20.055 1.00 53.99  ? 150  GLU B OE2 1 
ATOM   6075  N  N   . LYS B  1 151 ? 19.047  -1.438  -23.357 1.00 56.44  ? 151  LYS B N   1 
ATOM   6076  C  CA  . LYS B  1 151 ? 18.848  -2.026  -24.676 1.00 57.99  ? 151  LYS B CA  1 
ATOM   6077  C  C   . LYS B  1 151 ? 19.618  -3.337  -24.709 1.00 57.18  ? 151  LYS B C   1 
ATOM   6078  O  O   . LYS B  1 151 ? 20.674  -3.447  -24.081 1.00 59.79  ? 151  LYS B O   1 
ATOM   6079  C  CB  . LYS B  1 151 ? 19.370  -1.092  -25.769 1.00 58.56  ? 151  LYS B CB  1 
ATOM   6080  C  CG  . LYS B  1 151 ? 18.667  0.251   -25.823 1.00 59.41  ? 151  LYS B CG  1 
ATOM   6081  C  CD  . LYS B  1 151 ? 17.187  0.084   -26.127 1.00 62.10  ? 151  LYS B CD  1 
ATOM   6082  C  CE  . LYS B  1 151 ? 16.894  0.363   -27.589 1.00 65.37  ? 151  LYS B CE  1 
ATOM   6083  N  NZ  . LYS B  1 151 ? 17.322  1.741   -27.963 1.00 66.41  ? 151  LYS B NZ  1 
ATOM   6084  N  N   . THR B  1 152 ? 19.095  -4.335  -25.417 1.00 51.42  ? 152  THR B N   1 
ATOM   6085  C  CA  . THR B  1 152 ? 19.817  -5.594  -25.560 1.00 49.58  ? 152  THR B CA  1 
ATOM   6086  C  C   . THR B  1 152 ? 20.938  -5.401  -26.579 1.00 50.09  ? 152  THR B C   1 
ATOM   6087  O  O   . THR B  1 152 ? 20.730  -4.789  -27.624 1.00 49.35  ? 152  THR B O   1 
ATOM   6088  C  CB  . THR B  1 152 ? 18.891  -6.751  -26.022 1.00 45.75  ? 152  THR B CB  1 
ATOM   6089  O  OG1 . THR B  1 152 ? 17.680  -6.753  -25.254 1.00 46.53  ? 152  THR B OG1 1 
ATOM   6090  C  CG2 . THR B  1 152 ? 19.585  -8.101  -25.865 1.00 44.16  ? 152  THR B CG2 1 
ATOM   6091  N  N   . THR B  1 153 ? 22.131  -5.901  -26.269 1.00 50.33  ? 153  THR B N   1 
ATOM   6092  C  CA  . THR B  1 153 ? 23.243  -5.841  -27.212 1.00 51.67  ? 153  THR B CA  1 
ATOM   6093  C  C   . THR B  1 153 ? 23.630  -7.231  -27.668 1.00 50.92  ? 153  THR B C   1 
ATOM   6094  O  O   . THR B  1 153 ? 23.540  -8.192  -26.903 1.00 50.99  ? 153  THR B O   1 
ATOM   6095  C  CB  . THR B  1 153 ? 24.493  -5.207  -26.596 1.00 55.02  ? 153  THR B CB  1 
ATOM   6096  O  OG1 . THR B  1 153 ? 24.763  -5.835  -25.339 1.00 58.08  ? 153  THR B OG1 1 
ATOM   6097  C  CG2 . THR B  1 153 ? 24.299  -3.717  -26.386 1.00 55.32  ? 153  THR B CG2 1 
ATOM   6098  N  N   . PHE B  1 154 ? 24.073  -7.325  -28.918 1.00 50.22  ? 154  PHE B N   1 
ATOM   6099  C  CA  . PHE B  1 154 ? 24.544  -8.580  -29.482 1.00 47.04  ? 154  PHE B CA  1 
ATOM   6100  C  C   . PHE B  1 154 ? 25.955  -8.427  -30.024 1.00 47.45  ? 154  PHE B C   1 
ATOM   6101  O  O   . PHE B  1 154 ? 26.239  -7.502  -30.775 1.00 48.30  ? 154  PHE B O   1 
ATOM   6102  C  CB  . PHE B  1 154 ? 23.620  -9.033  -30.600 1.00 44.87  ? 154  PHE B CB  1 
ATOM   6103  C  CG  . PHE B  1 154 ? 22.277  -9.487  -30.125 1.00 46.03  ? 154  PHE B CG  1 
ATOM   6104  C  CD1 . PHE B  1 154 ? 21.201  -8.616  -30.125 1.00 48.22  ? 154  PHE B CD1 1 
ATOM   6105  C  CD2 . PHE B  1 154 ? 22.080  -10.785 -29.683 1.00 44.87  ? 154  PHE B CD2 1 
ATOM   6106  C  CE1 . PHE B  1 154 ? 19.945  -9.033  -29.695 1.00 46.74  ? 154  PHE B CE1 1 
ATOM   6107  C  CE2 . PHE B  1 154 ? 20.829  -11.202 -29.252 1.00 44.82  ? 154  PHE B CE2 1 
ATOM   6108  C  CZ  . PHE B  1 154 ? 19.764  -10.323 -29.260 1.00 45.59  ? 154  PHE B CZ  1 
ATOM   6109  N  N   . TRP B  1 155 ? 26.840  -9.336  -29.635 1.00 49.15  ? 155  TRP B N   1 
ATOM   6110  C  CA  A TRP B  1 155 ? 28.218  -9.307  -30.104 0.50 50.66  ? 155  TRP B CA  1 
ATOM   6111  C  CA  B TRP B  1 155 ? 28.221  -9.304  -30.088 0.50 50.66  ? 155  TRP B CA  1 
ATOM   6112  C  C   . TRP B  1 155 ? 28.592  -10.637 -30.723 1.00 51.51  ? 155  TRP B C   1 
ATOM   6113  O  O   . TRP B  1 155 ? 28.223  -11.692 -30.219 1.00 53.49  ? 155  TRP B O   1 
ATOM   6114  C  CB  A TRP B  1 155 ? 29.194  -9.028  -28.960 0.50 52.09  ? 155  TRP B CB  1 
ATOM   6115  C  CB  B TRP B  1 155 ? 29.169  -9.035  -28.914 0.50 52.10  ? 155  TRP B CB  1 
ATOM   6116  C  CG  A TRP B  1 155 ? 29.117  -7.664  -28.370 0.50 53.44  ? 155  TRP B CG  1 
ATOM   6117  C  CG  B TRP B  1 155 ? 28.995  -7.709  -28.230 0.50 53.09  ? 155  TRP B CG  1 
ATOM   6118  C  CD1 A TRP B  1 155 ? 29.693  -6.526  -28.853 0.50 53.13  ? 155  TRP B CD1 1 
ATOM   6119  C  CD1 B TRP B  1 155 ? 28.128  -6.711  -28.569 0.50 53.58  ? 155  TRP B CD1 1 
ATOM   6120  C  CD2 A TRP B  1 155 ? 28.451  -7.296  -27.161 0.50 53.30  ? 155  TRP B CD2 1 
ATOM   6121  C  CD2 B TRP B  1 155 ? 29.715  -7.241  -27.084 0.50 53.26  ? 155  TRP B CD2 1 
ATOM   6122  N  NE1 A TRP B  1 155 ? 29.412  -5.467  -28.026 0.50 52.83  ? 155  TRP B NE1 1 
ATOM   6123  N  NE1 B TRP B  1 155 ? 28.264  -5.652  -27.705 0.50 53.05  ? 155  TRP B NE1 1 
ATOM   6124  C  CE2 A TRP B  1 155 ? 28.650  -5.914  -26.979 0.50 53.22  ? 155  TRP B CE2 1 
ATOM   6125  C  CE2 B TRP B  1 155 ? 29.233  -5.952  -26.784 0.50 53.16  ? 155  TRP B CE2 1 
ATOM   6126  C  CE3 A TRP B  1 155 ? 27.696  -8.000  -26.220 0.50 54.78  ? 155  TRP B CE3 1 
ATOM   6127  C  CE3 B TRP B  1 155 ? 30.723  -7.787  -26.282 0.50 55.35  ? 155  TRP B CE3 1 
ATOM   6128  C  CZ2 A TRP B  1 155 ? 28.123  -5.222  -25.894 0.50 54.86  ? 155  TRP B CZ2 1 
ATOM   6129  C  CZ2 B TRP B  1 155 ? 29.723  -5.201  -25.716 0.50 53.95  ? 155  TRP B CZ2 1 
ATOM   6130  C  CZ3 A TRP B  1 155 ? 27.173  -7.312  -25.141 0.50 56.28  ? 155  TRP B CZ3 1 
ATOM   6131  C  CZ3 B TRP B  1 155 ? 31.209  -7.039  -25.220 0.50 55.16  ? 155  TRP B CZ3 1 
ATOM   6132  C  CH2 A TRP B  1 155 ? 27.393  -5.937  -24.984 0.50 56.14  ? 155  TRP B CH2 1 
ATOM   6133  C  CH2 B TRP B  1 155 ? 30.709  -5.761  -24.948 0.50 54.25  ? 155  TRP B CH2 1 
ATOM   6134  N  N   . VAL B  1 156 ? 29.330  -10.580 -31.822 1.00 51.26  ? 156  VAL B N   1 
ATOM   6135  C  CA  . VAL B  1 156 ? 29.888  -11.779 -32.416 1.00 48.84  ? 156  VAL B CA  1 
ATOM   6136  C  C   . VAL B  1 156 ? 31.386  -11.714 -32.176 1.00 47.90  ? 156  VAL B C   1 
ATOM   6137  O  O   . VAL B  1 156 ? 32.051  -10.778 -32.617 1.00 45.92  ? 156  VAL B O   1 
ATOM   6138  C  CB  . VAL B  1 156 ? 29.593  -11.860 -33.912 1.00 47.35  ? 156  VAL B CB  1 
ATOM   6139  C  CG1 . VAL B  1 156 ? 30.042  -13.213 -34.462 1.00 47.58  ? 156  VAL B CG1 1 
ATOM   6140  C  CG2 . VAL B  1 156 ? 28.113  -11.650 -34.149 1.00 46.42  ? 156  VAL B CG2 1 
ATOM   6141  N  N   . ILE B  1 157 ? 31.912  -12.696 -31.452 1.00 48.37  ? 157  ILE B N   1 
ATOM   6142  C  CA  . ILE B  1 157 ? 33.289  -12.643 -30.984 1.00 46.96  ? 157  ILE B CA  1 
ATOM   6143  C  C   . ILE B  1 157 ? 34.163  -13.683 -31.673 1.00 50.40  ? 157  ILE B C   1 
ATOM   6144  O  O   . ILE B  1 157 ? 33.807  -14.857 -31.720 1.00 53.14  ? 157  ILE B O   1 
ATOM   6145  C  CB  . ILE B  1 157 ? 33.352  -12.868 -29.456 1.00 41.83  ? 157  ILE B CB  1 
ATOM   6146  C  CG1 . ILE B  1 157 ? 32.493  -11.825 -28.733 1.00 39.13  ? 157  ILE B CG1 1 
ATOM   6147  C  CG2 . ILE B  1 157 ? 34.796  -12.829 -28.958 1.00 39.28  ? 157  ILE B CG2 1 
ATOM   6148  C  CD1 . ILE B  1 157 ? 32.409  -12.035 -27.231 1.00 37.25  ? 157  ILE B CD1 1 
ATOM   6149  N  N   . ASP B  1 158 ? 35.302  -13.254 -32.210 1.00 49.21  ? 158  ASP B N   1 
ATOM   6150  C  CA  . ASP B  1 158 ? 36.291  -14.189 -32.733 1.00 48.00  ? 158  ASP B CA  1 
ATOM   6151  C  C   . ASP B  1 158 ? 37.256  -14.565 -31.615 1.00 51.52  ? 158  ASP B C   1 
ATOM   6152  O  O   . ASP B  1 158 ? 37.966  -13.710 -31.091 1.00 52.55  ? 158  ASP B O   1 
ATOM   6153  C  CB  . ASP B  1 158 ? 37.063  -13.563 -33.895 1.00 45.23  ? 158  ASP B CB  1 
ATOM   6154  C  CG  . ASP B  1 158 ? 38.267  -14.391 -34.301 1.00 47.28  ? 158  ASP B CG  1 
ATOM   6155  O  OD1 . ASP B  1 158 ? 38.296  -15.594 -33.971 1.00 45.61  ? 158  ASP B OD1 1 
ATOM   6156  O  OD2 . ASP B  1 158 ? 39.187  -13.842 -34.946 1.00 50.73  ? 158  ASP B OD2 1 
ATOM   6157  N  N   . THR B  1 159 ? 37.293  -15.841 -31.247 1.00 52.77  ? 159  THR B N   1 
ATOM   6158  C  CA  . THR B  1 159 ? 38.144  -16.264 -30.134 1.00 52.25  ? 159  THR B CA  1 
ATOM   6159  C  C   . THR B  1 159 ? 39.624  -16.340 -30.518 1.00 51.44  ? 159  THR B C   1 
ATOM   6160  O  O   . THR B  1 159 ? 40.489  -16.448 -29.652 1.00 52.25  ? 159  THR B O   1 
ATOM   6161  C  CB  . THR B  1 159 ? 37.685  -17.611 -29.518 1.00 50.10  ? 159  THR B CB  1 
ATOM   6162  O  OG1 . THR B  1 159 ? 37.926  -18.686 -30.438 1.00 50.15  ? 159  THR B OG1 1 
ATOM   6163  C  CG2 . THR B  1 159 ? 36.207  -17.560 -29.170 1.00 50.11  ? 159  THR B CG2 1 
ATOM   6164  N  N   . GLU B  1 160 ? 39.911  -16.286 -31.815 1.00 50.59  ? 160  GLU B N   1 
ATOM   6165  C  CA  . GLU B  1 160 ? 41.290  -16.314 -32.297 1.00 52.07  ? 160  GLU B CA  1 
ATOM   6166  C  C   . GLU B  1 160 ? 41.900  -14.919 -32.311 1.00 54.35  ? 160  GLU B C   1 
ATOM   6167  O  O   . GLU B  1 160 ? 42.882  -14.652 -31.621 1.00 57.38  ? 160  GLU B O   1 
ATOM   6168  C  CB  . GLU B  1 160 ? 41.371  -16.961 -33.675 1.00 52.74  ? 160  GLU B CB  1 
ATOM   6169  C  CG  . GLU B  1 160 ? 40.916  -18.405 -33.661 1.00 54.82  ? 160  GLU B CG  1 
ATOM   6170  C  CD  . GLU B  1 160 ? 41.169  -19.117 -34.969 1.00 56.68  ? 160  GLU B CD  1 
ATOM   6171  O  OE1 . GLU B  1 160 ? 42.038  -18.659 -35.745 1.00 57.97  ? 160  GLU B OE1 1 
ATOM   6172  O  OE2 . GLU B  1 160 ? 40.496  -20.139 -35.216 1.00 56.97  ? 160  GLU B OE2 1 
ATOM   6173  N  N   . GLY B  1 161 ? 41.334  -14.038 -33.125 1.00 52.35  ? 161  GLY B N   1 
ATOM   6174  C  CA  . GLY B  1 161 ? 41.705  -12.637 -33.091 1.00 50.79  ? 161  GLY B CA  1 
ATOM   6175  C  C   . GLY B  1 161 ? 41.253  -11.930 -31.818 1.00 49.93  ? 161  GLY B C   1 
ATOM   6176  O  O   . GLY B  1 161 ? 41.793  -10.879 -31.468 1.00 48.24  ? 161  GLY B O   1 
ATOM   6177  N  N   . GLU B  1 162 ? 40.282  -12.503 -31.109 1.00 49.36  ? 162  GLU B N   1 
ATOM   6178  C  CA  . GLU B  1 162 ? 39.753  -11.869 -29.896 1.00 49.53  ? 162  GLU B CA  1 
ATOM   6179  C  C   . GLU B  1 162 ? 39.224  -10.464 -30.182 1.00 46.54  ? 162  GLU B C   1 
ATOM   6180  O  O   . GLU B  1 162 ? 39.653  -9.497  -29.559 1.00 46.54  ? 162  GLU B O   1 
ATOM   6181  C  CB  . GLU B  1 162 ? 40.825  -11.801 -28.798 1.00 50.79  ? 162  GLU B CB  1 
ATOM   6182  C  CG  . GLU B  1 162 ? 41.475  -13.139 -28.468 1.00 51.67  ? 162  GLU B CG  1 
ATOM   6183  C  CD  . GLU B  1 162 ? 42.751  -12.978 -27.668 1.00 50.35  ? 162  GLU B CD  1 
ATOM   6184  O  OE1 . GLU B  1 162 ? 43.015  -11.849 -27.206 1.00 47.95  ? 162  GLU B OE1 1 
ATOM   6185  O  OE2 . GLU B  1 162 ? 43.490  -13.973 -27.515 1.00 50.61  ? 162  GLU B OE2 1 
ATOM   6186  N  N   . GLU B  1 163 ? 38.324  -10.351 -31.152 1.00 45.13  ? 163  GLU B N   1 
ATOM   6187  C  CA  . GLU B  1 163 ? 37.728  -9.064  -31.491 1.00 46.03  ? 163  GLU B CA  1 
ATOM   6188  C  C   . GLU B  1 163 ? 36.237  -9.208  -31.729 1.00 48.25  ? 163  GLU B C   1 
ATOM   6189  O  O   . GLU B  1 163 ? 35.751  -10.297 -32.009 1.00 50.05  ? 163  GLU B O   1 
ATOM   6190  C  CB  . GLU B  1 163 ? 38.391  -8.463  -32.731 1.00 45.32  ? 163  GLU B CB  1 
ATOM   6191  C  CG  . GLU B  1 163 ? 39.702  -7.754  -32.449 1.00 46.86  ? 163  GLU B CG  1 
ATOM   6192  C  CD  . GLU B  1 163 ? 39.512  -6.436  -31.728 1.00 49.82  ? 163  GLU B CD  1 
ATOM   6193  O  OE1 . GLU B  1 163 ? 38.447  -5.808  -31.903 1.00 50.85  ? 163  GLU B OE1 1 
ATOM   6194  O  OE2 . GLU B  1 163 ? 40.432  -6.028  -30.987 1.00 51.33  ? 163  GLU B OE2 1 
ATOM   6195  N  N   . VAL B  1 164 ? 35.509  -8.104  -31.626 1.00 48.05  ? 164  VAL B N   1 
ATOM   6196  C  CA  . VAL B  1 164 ? 34.086  -8.140  -31.893 1.00 46.50  ? 164  VAL B CA  1 
ATOM   6197  C  C   . VAL B  1 164 ? 33.946  -7.781  -33.351 1.00 50.64  ? 164  VAL B C   1 
ATOM   6198  O  O   . VAL B  1 164 ? 34.198  -6.644  -33.753 1.00 52.69  ? 164  VAL B O   1 
ATOM   6199  C  CB  . VAL B  1 164 ? 33.326  -7.104  -31.039 1.00 42.91  ? 164  VAL B CB  1 
ATOM   6200  C  CG1 . VAL B  1 164 ? 31.911  -6.901  -31.565 1.00 42.43  ? 164  VAL B CG1 1 
ATOM   6201  C  CG2 . VAL B  1 164 ? 33.313  -7.523  -29.578 1.00 40.34  ? 164  VAL B CG2 1 
ATOM   6202  N  N   . ILE B  1 165 ? 33.582  -8.782  -34.140 1.00 52.24  ? 165  ILE B N   1 
ATOM   6203  C  CA  . ILE B  1 165 ? 33.431  -8.639  -35.580 1.00 53.59  ? 165  ILE B CA  1 
ATOM   6204  C  C   . ILE B  1 165 ? 32.077  -8.080  -36.005 1.00 57.24  ? 165  ILE B C   1 
ATOM   6205  O  O   . ILE B  1 165 ? 31.967  -7.391  -37.017 1.00 59.17  ? 165  ILE B O   1 
ATOM   6206  C  CB  . ILE B  1 165 ? 33.766  -9.950  -36.295 1.00 54.00  ? 165  ILE B CB  1 
ATOM   6207  C  CG1 . ILE B  1 165 ? 32.890  -11.080 -35.768 1.00 58.56  ? 165  ILE B CG1 1 
ATOM   6208  C  CG2 . ILE B  1 165 ? 35.219  -10.306 -36.057 1.00 50.35  ? 165  ILE B CG2 1 
ATOM   6209  C  CD1 . ILE B  1 165 ? 33.340  -12.444 -36.220 1.00 60.84  ? 165  ILE B CD1 1 
ATOM   6210  N  N   . GLU B  1 166 ? 31.044  -8.404  -35.237 1.00 59.47  ? 166  GLU B N   1 
ATOM   6211  C  CA  . GLU B  1 166 ? 29.688  -7.950  -35.528 1.00 59.64  ? 166  GLU B CA  1 
ATOM   6212  C  C   . GLU B  1 166 ? 29.011  -7.546  -34.234 1.00 56.52  ? 166  GLU B C   1 
ATOM   6213  O  O   . GLU B  1 166 ? 29.126  -8.241  -33.227 1.00 54.67  ? 166  GLU B O   1 
ATOM   6214  C  CB  . GLU B  1 166 ? 28.870  -9.064  -36.191 1.00 62.85  ? 166  GLU B CB  1 
ATOM   6215  C  CG  . GLU B  1 166 ? 29.167  -9.295  -37.664 1.00 67.76  ? 166  GLU B CG  1 
ATOM   6216  C  CD  . GLU B  1 166 ? 28.497  -8.270  -38.549 1.00 72.50  ? 166  GLU B CD  1 
ATOM   6217  O  OE1 . GLU B  1 166 ? 28.823  -8.216  -39.754 1.00 73.71  ? 166  GLU B OE1 1 
ATOM   6218  O  OE2 . GLU B  1 166 ? 27.639  -7.520  -38.037 1.00 74.25  ? 166  GLU B OE2 1 
ATOM   6219  N  N   . GLN B  1 167 ? 28.310  -6.421  -34.260 1.00 56.88  ? 167  GLN B N   1 
ATOM   6220  C  CA  . GLN B  1 167 ? 27.486  -6.024  -33.132 1.00 57.18  ? 167  GLN B CA  1 
ATOM   6221  C  C   . GLN B  1 167 ? 26.267  -5.238  -33.588 1.00 56.06  ? 167  GLN B C   1 
ATOM   6222  O  O   . GLN B  1 167 ? 26.320  -4.491  -34.561 1.00 56.59  ? 167  GLN B O   1 
ATOM   6223  C  CB  . GLN B  1 167 ? 28.296  -5.193  -32.144 1.00 60.96  ? 167  GLN B CB  1 
ATOM   6224  C  CG  . GLN B  1 167 ? 28.857  -3.911  -32.732 1.00 65.99  ? 167  GLN B CG  1 
ATOM   6225  C  CD  . GLN B  1 167 ? 29.648  -3.110  -31.715 1.00 71.04  ? 167  GLN B CD  1 
ATOM   6226  O  OE1 . GLN B  1 167 ? 29.424  -3.221  -30.506 1.00 72.78  ? 167  GLN B OE1 1 
ATOM   6227  N  NE2 . GLN B  1 167 ? 30.586  -2.300  -32.198 1.00 71.24  ? 167  GLN B NE2 1 
ATOM   6228  N  N   . PHE B  1 168 ? 25.167  -5.408  -32.869 1.00 54.83  ? 168  PHE B N   1 
ATOM   6229  C  CA  . PHE B  1 168 ? 23.981  -4.602  -33.093 1.00 53.98  ? 168  PHE B CA  1 
ATOM   6230  C  C   . PHE B  1 168 ? 23.149  -4.610  -31.821 1.00 54.74  ? 168  PHE B C   1 
ATOM   6231  O  O   . PHE B  1 168 ? 23.472  -5.325  -30.868 1.00 54.27  ? 168  PHE B O   1 
ATOM   6232  C  CB  . PHE B  1 168 ? 23.176  -5.186  -34.250 1.00 54.63  ? 168  PHE B CB  1 
ATOM   6233  C  CG  . PHE B  1 168 ? 22.750  -6.614  -34.031 1.00 55.55  ? 168  PHE B CG  1 
ATOM   6234  C  CD1 . PHE B  1 168 ? 23.614  -7.660  -34.303 1.00 56.80  ? 168  PHE B CD1 1 
ATOM   6235  C  CD2 . PHE B  1 168 ? 21.483  -6.909  -33.554 1.00 55.64  ? 168  PHE B CD2 1 
ATOM   6236  C  CE1 . PHE B  1 168 ? 23.219  -8.975  -34.102 1.00 57.38  ? 168  PHE B CE1 1 
ATOM   6237  C  CE2 . PHE B  1 168 ? 21.085  -8.220  -33.353 1.00 56.30  ? 168  PHE B CE2 1 
ATOM   6238  C  CZ  . PHE B  1 168 ? 21.953  -9.253  -33.624 1.00 56.28  ? 168  PHE B CZ  1 
ATOM   6239  N  N   . GLU B  1 169 ? 22.057  -3.855  -31.814 1.00 55.25  ? 169  GLU B N   1 
ATOM   6240  C  CA  . GLU B  1 169 ? 21.214  -3.811  -30.629 1.00 58.02  ? 169  GLU B CA  1 
ATOM   6241  C  C   . GLU B  1 169 ? 19.728  -3.939  -30.938 1.00 59.41  ? 169  GLU B C   1 
ATOM   6242  O  O   . GLU B  1 169 ? 19.279  -3.660  -32.044 1.00 62.16  ? 169  GLU B O   1 
ATOM   6243  C  CB  . GLU B  1 169 ? 21.497  -2.557  -29.790 1.00 61.21  ? 169  GLU B CB  1 
ATOM   6244  C  CG  . GLU B  1 169 ? 20.848  -1.269  -30.282 1.00 63.97  ? 169  GLU B CG  1 
ATOM   6245  C  CD  . GLU B  1 169 ? 21.195  -0.069  -29.399 1.00 64.53  ? 169  GLU B CD  1 
ATOM   6246  O  OE1 . GLU B  1 169 ? 20.370  0.867   -29.316 1.00 65.73  ? 169  GLU B OE1 1 
ATOM   6247  O  OE2 . GLU B  1 169 ? 22.293  -0.062  -28.793 1.00 62.58  ? 169  GLU B OE2 1 
ATOM   6248  N  N   . LYS B  1 170 ? 18.972  -4.383  -29.943 1.00 58.94  ? 170  LYS B N   1 
ATOM   6249  C  CA  . LYS B  1 170 ? 17.530  -4.520  -30.066 1.00 57.28  ? 170  LYS B CA  1 
ATOM   6250  C  C   . LYS B  1 170 ? 16.870  -3.979  -28.810 1.00 55.32  ? 170  LYS B C   1 
ATOM   6251  O  O   . LYS B  1 170 ? 17.554  -3.589  -27.861 1.00 56.17  ? 170  LYS B O   1 
ATOM   6252  C  CB  . LYS B  1 170 ? 17.156  -5.989  -30.247 1.00 58.21  ? 170  LYS B CB  1 
ATOM   6253  C  CG  . LYS B  1 170 ? 17.579  -6.578  -31.579 1.00 58.98  ? 170  LYS B CG  1 
ATOM   6254  C  CD  . LYS B  1 170 ? 16.943  -5.832  -32.726 1.00 58.55  ? 170  LYS B CD  1 
ATOM   6255  C  CE  . LYS B  1 170 ? 17.173  -6.557  -34.035 1.00 59.51  ? 170  LYS B CE  1 
ATOM   6256  N  NZ  . LYS B  1 170 ? 16.436  -5.891  -35.145 1.00 60.10  ? 170  LYS B NZ  1 
ATOM   6257  N  N   . PRO B  1 171 ? 15.534  -3.977  -28.782 1.00 52.55  ? 171  PRO B N   1 
ATOM   6258  C  CA  . PRO B  1 171 ? 14.850  -3.476  -27.592 1.00 49.88  ? 171  PRO B CA  1 
ATOM   6259  C  C   . PRO B  1 171 ? 15.125  -4.342  -26.372 1.00 48.75  ? 171  PRO B C   1 
ATOM   6260  O  O   . PRO B  1 171 ? 15.642  -5.453  -26.466 1.00 46.92  ? 171  PRO B O   1 
ATOM   6261  C  CB  . PRO B  1 171 ? 13.373  -3.551  -27.978 1.00 49.98  ? 171  PRO B CB  1 
ATOM   6262  C  CG  . PRO B  1 171 ? 13.379  -3.484  -29.460 1.00 51.63  ? 171  PRO B CG  1 
ATOM   6263  C  CD  . PRO B  1 171 ? 14.593  -4.240  -29.883 1.00 52.39  ? 171  PRO B CD  1 
ATOM   6264  N  N   . ARG B  1 172 ? 14.807  -3.774  -25.220 1.00 49.75  ? 172  ARG B N   1 
ATOM   6265  C  CA  . ARG B  1 172 ? 14.956  -4.403  -23.919 1.00 50.43  ? 172  ARG B CA  1 
ATOM   6266  C  C   . ARG B  1 172 ? 14.290  -5.780  -23.852 1.00 52.37  ? 172  ARG B C   1 
ATOM   6267  O  O   . ARG B  1 172 ? 13.171  -5.964  -24.321 1.00 52.98  ? 172  ARG B O   1 
ATOM   6268  C  CB  . ARG B  1 172 ? 14.310  -3.467  -22.905 1.00 49.96  ? 172  ARG B CB  1 
ATOM   6269  C  CG  . ARG B  1 172 ? 14.410  -3.861  -21.468 1.00 49.15  ? 172  ARG B CG  1 
ATOM   6270  C  CD  . ARG B  1 172 ? 13.666  -2.831  -20.643 1.00 47.09  ? 172  ARG B CD  1 
ATOM   6271  N  NE  . ARG B  1 172 ? 14.085  -1.474  -20.980 1.00 44.82  ? 172  ARG B NE  1 
ATOM   6272  C  CZ  . ARG B  1 172 ? 13.616  -0.385  -20.384 1.00 43.04  ? 172  ARG B CZ  1 
ATOM   6273  N  NH1 . ARG B  1 172 ? 12.713  -0.505  -19.427 1.00 43.50  ? 172  ARG B NH1 1 
ATOM   6274  N  NH2 . ARG B  1 172 ? 14.048  0.820   -20.735 1.00 42.42  ? 172  ARG B NH2 1 
ATOM   6275  N  N   . PHE B  1 173 ? 14.975  -6.735  -23.236 1.00 54.28  ? 173  PHE B N   1 
ATOM   6276  C  CA  . PHE B  1 173 ? 14.499  -8.117  -23.146 1.00 58.05  ? 173  PHE B CA  1 
ATOM   6277  C  C   . PHE B  1 173 ? 14.440  -8.871  -24.466 1.00 58.31  ? 173  PHE B C   1 
ATOM   6278  O  O   . PHE B  1 173 ? 13.646  -9.799  -24.620 1.00 59.09  ? 173  PHE B O   1 
ATOM   6279  C  CB  . PHE B  1 173 ? 13.125  -8.181  -22.480 1.00 62.57  ? 173  PHE B CB  1 
ATOM   6280  C  CG  . PHE B  1 173 ? 13.184  -8.462  -21.011 1.00 67.49  ? 173  PHE B CG  1 
ATOM   6281  C  CD1 . PHE B  1 173 ? 12.103  -9.017  -20.354 1.00 70.59  ? 173  PHE B CD1 1 
ATOM   6282  C  CD2 . PHE B  1 173 ? 14.324  -8.169  -20.285 1.00 69.73  ? 173  PHE B CD2 1 
ATOM   6283  C  CE1 . PHE B  1 173 ? 12.158  -9.276  -18.994 1.00 72.78  ? 173  PHE B CE1 1 
ATOM   6284  C  CE2 . PHE B  1 173 ? 14.387  -8.423  -18.926 1.00 71.90  ? 173  PHE B CE2 1 
ATOM   6285  C  CZ  . PHE B  1 173 ? 13.303  -8.978  -18.279 1.00 73.04  ? 173  PHE B CZ  1 
ATOM   6286  N  N   . SER B  1 174 ? 15.271  -8.473  -25.419 1.00 57.52  ? 174  SER B N   1 
ATOM   6287  C  CA  . SER B  1 174 ? 15.457  -9.265  -26.625 1.00 56.80  ? 174  SER B CA  1 
ATOM   6288  C  C   . SER B  1 174 ? 16.414  -10.413 -26.344 1.00 54.44  ? 174  SER B C   1 
ATOM   6289  O  O   . SER B  1 174 ? 17.220  -10.349 -25.421 1.00 54.60  ? 174  SER B O   1 
ATOM   6290  C  CB  . SER B  1 174 ? 15.972  -8.400  -27.773 1.00 61.20  ? 174  SER B CB  1 
ATOM   6291  O  OG  . SER B  1 174 ? 15.026  -7.401  -28.118 1.00 63.93  ? 174  SER B OG  1 
ATOM   6292  N  N   . SER B  1 175 ? 16.309  -11.478 -27.125 1.00 54.24  ? 175  SER B N   1 
ATOM   6293  C  CA  . SER B  1 175 ? 17.227  -12.600 -26.997 1.00 53.18  ? 175  SER B CA  1 
ATOM   6294  C  C   . SER B  1 175 ? 17.658  -13.080 -28.371 1.00 51.40  ? 175  SER B C   1 
ATOM   6295  O  O   . SER B  1 175 ? 17.035  -12.738 -29.375 1.00 50.39  ? 175  SER B O   1 
ATOM   6296  C  CB  . SER B  1 175 ? 16.592  -13.743 -26.197 1.00 54.28  ? 175  SER B CB  1 
ATOM   6297  O  OG  . SER B  1 175 ? 15.285  -14.044 -26.657 1.00 55.06  ? 175  SER B OG  1 
ATOM   6298  N  N   . GLY B  1 176 ? 18.722  -13.874 -28.414 1.00 51.75  ? 176  GLY B N   1 
ATOM   6299  C  CA  . GLY B  1 176 ? 19.222  -14.391 -29.674 1.00 51.50  ? 176  GLY B CA  1 
ATOM   6300  C  C   . GLY B  1 176 ? 19.957  -15.709 -29.535 1.00 50.77  ? 176  GLY B C   1 
ATOM   6301  O  O   . GLY B  1 176 ? 20.484  -16.028 -28.469 1.00 48.07  ? 176  GLY B O   1 
ATOM   6302  N  N   . ILE B  1 177 ? 20.000  -16.469 -30.628 1.00 51.17  ? 177  ILE B N   1 
ATOM   6303  C  CA  . ILE B  1 177 ? 20.648  -17.774 -30.645 1.00 49.74  ? 177  ILE B CA  1 
ATOM   6304  C  C   . ILE B  1 177 ? 21.235  -18.070 -32.012 1.00 51.09  ? 177  ILE B C   1 
ATOM   6305  O  O   . ILE B  1 177 ? 20.739  -17.588 -33.033 1.00 51.70  ? 177  ILE B O   1 
ATOM   6306  C  CB  . ILE B  1 177 ? 19.662  -18.902 -30.321 1.00 49.65  ? 177  ILE B CB  1 
ATOM   6307  C  CG1 . ILE B  1 177 ? 18.557  -18.962 -31.384 1.00 48.55  ? 177  ILE B CG1 1 
ATOM   6308  C  CG2 . ILE B  1 177 ? 19.091  -18.742 -28.914 1.00 49.24  ? 177  ILE B CG2 1 
ATOM   6309  C  CD1 . ILE B  1 177 ? 17.675  -20.180 -31.276 1.00 46.63  ? 177  ILE B CD1 1 
ATOM   6310  N  N   . TRP B  1 178 ? 22.287  -18.881 -32.028 1.00 52.15  ? 178  TRP B N   1 
ATOM   6311  C  CA  . TRP B  1 178 ? 22.912  -19.277 -33.279 1.00 53.48  ? 178  TRP B CA  1 
ATOM   6312  C  C   . TRP B  1 178 ? 21.974  -20.178 -34.040 1.00 57.63  ? 178  TRP B C   1 
ATOM   6313  O  O   . TRP B  1 178 ? 21.500  -21.187 -33.511 1.00 60.54  ? 178  TRP B O   1 
ATOM   6314  C  CB  . TRP B  1 178 ? 24.195  -20.065 -33.028 1.00 52.02  ? 178  TRP B CB  1 
ATOM   6315  C  CG  . TRP B  1 178 ? 25.405  -19.233 -32.800 1.00 51.64  ? 178  TRP B CG  1 
ATOM   6316  C  CD1 . TRP B  1 178 ? 26.217  -19.255 -31.707 1.00 52.09  ? 178  TRP B CD1 1 
ATOM   6317  C  CD2 . TRP B  1 178 ? 25.957  -18.261 -33.692 1.00 51.74  ? 178  TRP B CD2 1 
ATOM   6318  N  NE1 . TRP B  1 178 ? 27.242  -18.353 -31.859 1.00 52.87  ? 178  TRP B NE1 1 
ATOM   6319  C  CE2 . TRP B  1 178 ? 27.104  -17.728 -33.070 1.00 52.66  ? 178  TRP B CE2 1 
ATOM   6320  C  CE3 . TRP B  1 178 ? 25.592  -17.786 -34.955 1.00 50.91  ? 178  TRP B CE3 1 
ATOM   6321  C  CZ2 . TRP B  1 178 ? 27.890  -16.747 -33.668 1.00 52.47  ? 178  TRP B CZ2 1 
ATOM   6322  C  CZ3 . TRP B  1 178 ? 26.373  -16.811 -35.548 1.00 50.44  ? 178  TRP B CZ3 1 
ATOM   6323  C  CH2 . TRP B  1 178 ? 27.508  -16.301 -34.904 1.00 51.82  ? 178  TRP B CH2 1 
ATOM   6324  N  N   . HIS B  1 179 ? 21.682  -19.803 -35.276 1.00 57.73  ? 179  HIS B N   1 
ATOM   6325  C  CA  . HIS B  1 179 ? 21.114  -20.745 -36.215 1.00 56.33  ? 179  HIS B CA  1 
ATOM   6326  C  C   . HIS B  1 179 ? 22.049  -20.820 -37.415 1.00 56.66  ? 179  HIS B C   1 
ATOM   6327  O  O   . HIS B  1 179 ? 22.073  -19.910 -38.245 1.00 57.22  ? 179  HIS B O   1 
ATOM   6328  C  CB  . HIS B  1 179 ? 19.746  -20.238 -36.635 1.00 55.91  ? 179  HIS B CB  1 
ATOM   6329  C  CG  . HIS B  1 179 ? 19.039  -21.135 -37.591 1.00 57.30  ? 179  HIS B CG  1 
ATOM   6330  N  ND1 . HIS B  1 179 ? 18.787  -22.460 -37.316 1.00 58.02  ? 179  HIS B ND1 1 
ATOM   6331  C  CD2 . HIS B  1 179 ? 18.527  -20.898 -38.821 1.00 58.46  ? 179  HIS B CD2 1 
ATOM   6332  C  CE1 . HIS B  1 179 ? 18.150  -23.003 -38.338 1.00 59.98  ? 179  HIS B CE1 1 
ATOM   6333  N  NE2 . HIS B  1 179 ? 17.980  -22.076 -39.265 1.00 59.89  ? 179  HIS B NE2 1 
ATOM   6334  N  N   . GLY B  1 180 ? 22.768  -21.929 -37.550 1.00 55.96  ? 180  GLY B N   1 
ATOM   6335  C  CA  . GLY B  1 180 ? 23.773  -22.024 -38.589 1.00 56.59  ? 180  GLY B CA  1 
ATOM   6336  C  C   . GLY B  1 180 ? 24.708  -20.830 -38.507 1.00 59.91  ? 180  GLY B C   1 
ATOM   6337  O  O   . GLY B  1 180 ? 25.282  -20.542 -37.460 1.00 61.57  ? 180  GLY B O   1 
ATOM   6338  N  N   . ASP B  1 181 ? 24.867  -20.133 -39.625 1.00 60.88  ? 181  ASP B N   1 
ATOM   6339  C  CA  . ASP B  1 181 ? 25.653  -18.905 -39.651 1.00 60.06  ? 181  ASP B CA  1 
ATOM   6340  C  C   . ASP B  1 181 ? 24.778  -17.682 -39.433 1.00 55.02  ? 181  ASP B C   1 
ATOM   6341  O  O   . ASP B  1 181 ? 25.245  -16.551 -39.532 1.00 53.09  ? 181  ASP B O   1 
ATOM   6342  C  CB  . ASP B  1 181 ? 26.444  -18.774 -40.953 1.00 63.52  ? 181  ASP B CB  1 
ATOM   6343  C  CG  . ASP B  1 181 ? 27.748  -19.532 -40.911 1.00 67.73  ? 181  ASP B CG  1 
ATOM   6344  O  OD1 . ASP B  1 181 ? 28.070  -20.092 -39.838 1.00 68.68  ? 181  ASP B OD1 1 
ATOM   6345  O  OD2 . ASP B  1 181 ? 28.456  -19.557 -41.939 1.00 69.85  ? 181  ASP B OD2 1 
ATOM   6346  N  N   . SER B  1 182 ? 23.500  -17.912 -39.163 1.00 53.84  ? 182  SER B N   1 
ATOM   6347  C  CA  . SER B  1 182 ? 22.578  -16.816 -38.908 1.00 55.89  ? 182  SER B CA  1 
ATOM   6348  C  C   . SER B  1 182 ? 22.318  -16.621 -37.411 1.00 55.38  ? 182  SER B C   1 
ATOM   6349  O  O   . SER B  1 182 ? 22.845  -17.358 -36.575 1.00 55.71  ? 182  SER B O   1 
ATOM   6350  C  CB  . SER B  1 182 ? 21.265  -17.058 -39.651 1.00 59.14  ? 182  SER B CB  1 
ATOM   6351  O  OG  . SER B  1 182 ? 21.450  -16.916 -41.050 1.00 62.66  ? 182  SER B OG  1 
ATOM   6352  N  N   . ILE B  1 183 ? 21.513  -15.618 -37.075 1.00 52.99  ? 183  ILE B N   1 
ATOM   6353  C  CA  . ILE B  1 183 ? 21.093  -15.421 -35.690 1.00 51.24  ? 183  ILE B CA  1 
ATOM   6354  C  C   . ILE B  1 183 ? 19.580  -15.283 -35.603 1.00 51.19  ? 183  ILE B C   1 
ATOM   6355  O  O   . ILE B  1 183 ? 18.986  -14.457 -36.295 1.00 49.88  ? 183  ILE B O   1 
ATOM   6356  C  CB  . ILE B  1 183 ? 21.728  -14.171 -35.037 1.00 47.14  ? 183  ILE B CB  1 
ATOM   6357  C  CG1 . ILE B  1 183 ? 23.244  -14.323 -34.919 1.00 42.09  ? 183  ILE B CG1 1 
ATOM   6358  C  CG2 . ILE B  1 183 ? 21.136  -13.949 -33.657 1.00 46.72  ? 183  ILE B CG2 1 
ATOM   6359  C  CD1 . ILE B  1 183 ? 23.915  -13.165 -34.231 1.00 36.24  ? 183  ILE B CD1 1 
ATOM   6360  N  N   . VAL B  1 184 ? 18.959  -16.089 -34.749 1.00 51.67  ? 184  VAL B N   1 
ATOM   6361  C  CA  . VAL B  1 184 ? 17.528  -15.967 -34.523 1.00 52.99  ? 184  VAL B CA  1 
ATOM   6362  C  C   . VAL B  1 184 ? 17.292  -14.981 -33.386 1.00 55.88  ? 184  VAL B C   1 
ATOM   6363  O  O   . VAL B  1 184 ? 17.708  -15.223 -32.257 1.00 55.71  ? 184  VAL B O   1 
ATOM   6364  C  CB  . VAL B  1 184 ? 16.905  -17.315 -34.157 1.00 51.59  ? 184  VAL B CB  1 
ATOM   6365  C  CG1 . VAL B  1 184 ? 15.392  -17.207 -34.156 1.00 50.78  ? 184  VAL B CG1 1 
ATOM   6366  C  CG2 . VAL B  1 184 ? 17.360  -18.377 -35.134 1.00 53.26  ? 184  VAL B CG2 1 
ATOM   6367  N  N   . VAL B  1 185 ? 16.625  -13.870 -33.687 1.00 58.65  ? 185  VAL B N   1 
ATOM   6368  C  CA  . VAL B  1 185 ? 16.403  -12.824 -32.688 1.00 59.88  ? 185  VAL B CA  1 
ATOM   6369  C  C   . VAL B  1 185 ? 14.938  -12.651 -32.300 1.00 61.98  ? 185  VAL B C   1 
ATOM   6370  O  O   . VAL B  1 185 ? 14.107  -12.237 -33.110 1.00 60.99  ? 185  VAL B O   1 
ATOM   6371  C  CB  . VAL B  1 185 ? 16.947  -11.459 -33.134 1.00 56.52  ? 185  VAL B CB  1 
ATOM   6372  C  CG1 . VAL B  1 185 ? 16.616  -10.409 -32.086 1.00 54.86  ? 185  VAL B CG1 1 
ATOM   6373  C  CG2 . VAL B  1 185 ? 18.442  -11.541 -33.364 1.00 55.96  ? 185  VAL B CG2 1 
ATOM   6374  N  N   . SER B  1 186 ? 14.646  -12.952 -31.040 1.00 63.04  ? 186  SER B N   1 
ATOM   6375  C  CA  . SER B  1 186 ? 13.299  -12.850 -30.507 1.00 62.52  ? 186  SER B CA  1 
ATOM   6376  C  C   . SER B  1 186 ? 13.143  -11.539 -29.752 1.00 59.69  ? 186  SER B C   1 
ATOM   6377  O  O   . SER B  1 186 ? 13.831  -11.298 -28.766 1.00 58.88  ? 186  SER B O   1 
ATOM   6378  C  CB  . SER B  1 186 ? 13.020  -14.029 -29.574 1.00 64.19  ? 186  SER B CB  1 
ATOM   6379  O  OG  . SER B  1 186 ? 13.404  -15.257 -30.172 1.00 64.67  ? 186  SER B OG  1 
ATOM   6380  N  N   . VAL B  1 187 ? 12.217  -10.701 -30.203 1.00 58.76  ? 187  VAL B N   1 
ATOM   6381  C  CA  . VAL B  1 187 ? 12.036  -9.387  -29.606 1.00 56.22  ? 187  VAL B CA  1 
ATOM   6382  C  C   . VAL B  1 187 ? 10.615  -9.245  -29.091 1.00 60.30  ? 187  VAL B C   1 
ATOM   6383  O  O   . VAL B  1 187 ? 9.666   -9.693  -29.737 1.00 63.61  ? 187  VAL B O   1 
ATOM   6384  C  CB  . VAL B  1 187 ? 12.240  -8.289  -30.656 1.00 50.29  ? 187  VAL B CB  1 
ATOM   6385  C  CG1 . VAL B  1 187 ? 12.055  -6.919  -30.038 1.00 48.21  ? 187  VAL B CG1 1 
ATOM   6386  C  CG2 . VAL B  1 187 ? 13.607  -8.421  -31.293 1.00 49.35  ? 187  VAL B CG2 1 
ATOM   6387  N  N   . PRO B  1 188 ? 10.457  -8.598  -27.931 1.00 58.51  ? 188  PRO B N   1 
ATOM   6388  C  CA  . PRO B  1 188 ? 9.110   -8.369  -27.417 1.00 59.06  ? 188  PRO B CA  1 
ATOM   6389  C  C   . PRO B  1 188 ? 8.348   -7.518  -28.409 1.00 61.01  ? 188  PRO B C   1 
ATOM   6390  O  O   . PRO B  1 188 ? 8.914   -6.561  -28.946 1.00 62.19  ? 188  PRO B O   1 
ATOM   6391  C  CB  . PRO B  1 188 ? 9.365   -7.586  -26.131 1.00 58.27  ? 188  PRO B CB  1 
ATOM   6392  C  CG  . PRO B  1 188 ? 10.713  -8.031  -25.698 1.00 58.09  ? 188  PRO B CG  1 
ATOM   6393  C  CD  . PRO B  1 188 ? 11.489  -8.180  -26.970 1.00 58.09  ? 188  PRO B CD  1 
ATOM   6394  N  N   . HIS B  1 189 ? 7.096   -7.877  -28.669 1.00 60.25  ? 189  HIS B N   1 
ATOM   6395  C  CA  . HIS B  1 189 ? 6.279   -7.105  -29.590 1.00 59.50  ? 189  HIS B CA  1 
ATOM   6396  C  C   . HIS B  1 189 ? 5.700   -5.898  -28.886 1.00 56.57  ? 189  HIS B C   1 
ATOM   6397  O  O   . HIS B  1 189 ? 5.221   -6.007  -27.768 1.00 57.43  ? 189  HIS B O   1 
ATOM   6398  C  CB  . HIS B  1 189 ? 5.139   -7.943  -30.157 1.00 61.53  ? 189  HIS B CB  1 
ATOM   6399  C  CG  . HIS B  1 189 ? 4.184   -7.148  -30.987 1.00 62.78  ? 189  HIS B CG  1 
ATOM   6400  N  ND1 . HIS B  1 189 ? 4.342   -6.984  -32.345 1.00 63.14  ? 189  HIS B ND1 1 
ATOM   6401  C  CD2 . HIS B  1 189 ? 3.088   -6.431  -30.645 1.00 64.04  ? 189  HIS B CD2 1 
ATOM   6402  C  CE1 . HIS B  1 189 ? 3.369   -6.220  -32.809 1.00 64.62  ? 189  HIS B CE1 1 
ATOM   6403  N  NE2 . HIS B  1 189 ? 2.594   -5.871  -31.797 1.00 64.74  ? 189  HIS B NE2 1 
ATOM   6404  N  N   . ARG B  1 190 ? 5.726   -4.748  -29.546 1.00 56.41  ? 190  ARG B N   1 
ATOM   6405  C  CA  . ARG B  1 190 ? 5.221   -3.526  -28.934 1.00 59.49  ? 190  ARG B CA  1 
ATOM   6406  C  C   . ARG B  1 190 ? 3.863   -3.088  -29.481 1.00 66.41  ? 190  ARG B C   1 
ATOM   6407  O  O   . ARG B  1 190 ? 3.706   -2.924  -30.689 1.00 69.67  ? 190  ARG B O   1 
ATOM   6408  C  CB  . ARG B  1 190 ? 6.227   -2.386  -29.112 1.00 57.71  ? 190  ARG B CB  1 
ATOM   6409  C  CG  . ARG B  1 190 ? 5.716   -1.050  -28.602 1.00 59.88  ? 190  ARG B CG  1 
ATOM   6410  C  CD  . ARG B  1 190 ? 6.658   0.105   -28.911 1.00 62.18  ? 190  ARG B CD  1 
ATOM   6411  N  NE  . ARG B  1 190 ? 7.972   -0.089  -28.310 1.00 65.95  ? 190  ARG B NE  1 
ATOM   6412  C  CZ  . ARG B  1 190 ? 8.244   0.124   -27.026 1.00 69.27  ? 190  ARG B CZ  1 
ATOM   6413  N  NH1 . ARG B  1 190 ? 7.289   0.534   -26.193 1.00 70.28  ? 190  ARG B NH1 1 
ATOM   6414  N  NH2 . ARG B  1 190 ? 9.474   -0.080  -26.573 1.00 69.90  ? 190  ARG B NH2 1 
ATOM   6415  N  N   . ASP B  1 191 ? 2.886   -2.888  -28.595 1.00 69.78  ? 191  ASP B N   1 
ATOM   6416  C  CA  . ASP B  1 191 ? 1.660   -2.196  -28.985 1.00 74.26  ? 191  ASP B CA  1 
ATOM   6417  C  C   . ASP B  1 191 ? 1.693   -0.782  -28.421 1.00 74.76  ? 191  ASP B C   1 
ATOM   6418  O  O   . ASP B  1 191 ? 2.037   0.181   -29.110 1.00 75.00  ? 191  ASP B O   1 
ATOM   6419  C  CB  . ASP B  1 191 ? 0.437   -2.894  -28.379 1.00 78.42  ? 191  ASP B CB  1 
ATOM   6420  C  CG  . ASP B  1 191 ? -0.096  -4.015  -29.243 1.00 83.44  ? 191  ASP B CG  1 
ATOM   6421  O  OD1 . ASP B  1 191 ? 0.076   -3.953  -30.480 1.00 86.57  ? 191  ASP B OD1 1 
ATOM   6422  O  OD2 . ASP B  1 191 ? -0.706  -4.951  -28.678 1.00 83.73  ? 191  ASP B OD2 1 
ATOM   6423  N  N   . VAL B  1 192 ? 1.403   -0.693  -27.129 1.00 73.69  ? 192  VAL B N   1 
ATOM   6424  C  CA  . VAL B  1 192 ? 1.390   0.560   -26.393 1.00 72.68  ? 192  VAL B CA  1 
ATOM   6425  C  C   . VAL B  1 192 ? 2.630   0.516   -25.528 1.00 71.37  ? 192  VAL B C   1 
ATOM   6426  O  O   . VAL B  1 192 ? 3.521   1.362   -25.629 1.00 72.60  ? 192  VAL B O   1 
ATOM   6427  C  CB  . VAL B  1 192 ? 0.142   0.685   -25.502 1.00 73.17  ? 192  VAL B CB  1 
ATOM   6428  C  CG1 . VAL B  1 192 ? 0.210   1.960   -24.666 1.00 72.66  ? 192  VAL B CG1 1 
ATOM   6429  C  CG2 . VAL B  1 192 ? -1.117  0.664   -26.347 1.00 71.63  ? 192  VAL B CG2 1 
ATOM   6430  N  N   . ILE B  1 193 ? 2.654   -0.476  -24.650 1.00 67.99  ? 193  ILE B N   1 
ATOM   6431  C  CA  . ILE B  1 193 ? 3.861   -0.847  -23.945 1.00 65.85  ? 193  ILE B CA  1 
ATOM   6432  C  C   . ILE B  1 193 ? 4.212   -2.238  -24.456 1.00 65.25  ? 193  ILE B C   1 
ATOM   6433  O  O   . ILE B  1 193 ? 3.336   -2.950  -24.934 1.00 65.43  ? 193  ILE B O   1 
ATOM   6434  C  CB  . ILE B  1 193 ? 3.620   -0.895  -22.439 1.00 64.61  ? 193  ILE B CB  1 
ATOM   6435  C  CG1 . ILE B  1 193 ? 2.658   -2.033  -22.098 1.00 63.55  ? 193  ILE B CG1 1 
ATOM   6436  C  CG2 . ILE B  1 193 ? 3.074   0.440   -21.948 1.00 64.57  ? 193  ILE B CG2 1 
ATOM   6437  C  CD1 . ILE B  1 193 ? 2.467   -2.244  -20.622 1.00 62.18  ? 193  ILE B CD1 1 
ATOM   6438  N  N   . PRO B  1 194 ? 5.498   -2.617  -24.397 1.00 64.63  ? 194  PRO B N   1 
ATOM   6439  C  CA  . PRO B  1 194 ? 5.908   -3.947  -24.864 1.00 63.73  ? 194  PRO B CA  1 
ATOM   6440  C  C   . PRO B  1 194 ? 5.057   -5.045  -24.235 1.00 63.59  ? 194  PRO B C   1 
ATOM   6441  O  O   . PRO B  1 194 ? 4.692   -4.930  -23.065 1.00 65.35  ? 194  PRO B O   1 
ATOM   6442  C  CB  . PRO B  1 194 ? 7.347   -4.056  -24.353 1.00 61.89  ? 194  PRO B CB  1 
ATOM   6443  C  CG  . PRO B  1 194 ? 7.827   -2.657  -24.327 1.00 61.64  ? 194  PRO B CG  1 
ATOM   6444  C  CD  . PRO B  1 194 ? 6.644   -1.827  -23.915 1.00 63.01  ? 194  PRO B CD  1 
ATOM   6445  N  N   . ARG B  1 195 ? 4.751   -6.103  -24.977 1.00 61.01  ? 195  ARG B N   1 
ATOM   6446  C  CA  . ARG B  1 195 ? 4.006   -7.188  -24.371 1.00 61.11  ? 195  ARG B CA  1 
ATOM   6447  C  C   . ARG B  1 195 ? 5.014   -8.269  -24.037 1.00 62.70  ? 195  ARG B C   1 
ATOM   6448  O  O   . ARG B  1 195 ? 5.448   -9.020  -24.900 1.00 64.75  ? 195  ARG B O   1 
ATOM   6449  C  CB  . ARG B  1 195 ? 2.976   -7.736  -25.361 1.00 61.87  ? 195  ARG B CB  1 
ATOM   6450  C  CG  . ARG B  1 195 ? 2.290   -6.683  -26.226 1.00 62.60  ? 195  ARG B CG  1 
ATOM   6451  C  CD  . ARG B  1 195 ? 1.372   -5.780  -25.410 1.00 63.63  ? 195  ARG B CD  1 
ATOM   6452  N  NE  . ARG B  1 195 ? 0.336   -6.530  -24.702 1.00 66.62  ? 195  ARG B NE  1 
ATOM   6453  C  CZ  . ARG B  1 195 ? -0.843  -6.862  -25.227 1.00 69.43  ? 195  ARG B CZ  1 
ATOM   6454  N  NH1 . ARG B  1 195 ? -1.149  -6.516  -26.475 1.00 69.29  ? 195  ARG B NH1 1 
ATOM   6455  N  NH2 . ARG B  1 195 ? -1.722  -7.548  -24.504 1.00 69.46  ? 195  ARG B NH2 1 
ATOM   6456  N  N   . TYR B  1 196 ? 5.321   -8.401  -22.755 1.00 63.56  ? 196  TYR B N   1 
ATOM   6457  C  CA  . TYR B  1 196 ? 6.381   -9.295  -22.332 1.00 64.76  ? 196  TYR B CA  1 
ATOM   6458  C  C   . TYR B  1 196 ? 5.749   -10.619 -21.953 1.00 67.98  ? 196  TYR B C   1 
ATOM   6459  O  O   . TYR B  1 196 ? 4.723   -10.645 -21.272 1.00 68.35  ? 196  TYR B O   1 
ATOM   6460  C  CB  . TYR B  1 196 ? 7.138   -8.724  -21.128 1.00 65.37  ? 196  TYR B CB  1 
ATOM   6461  C  CG  . TYR B  1 196 ? 7.920   -7.438  -21.354 1.00 65.05  ? 196  TYR B CG  1 
ATOM   6462  C  CD1 . TYR B  1 196 ? 7.461   -6.227  -20.846 1.00 62.99  ? 196  TYR B CD1 1 
ATOM   6463  C  CD2 . TYR B  1 196 ? 9.136   -7.440  -22.036 1.00 66.00  ? 196  TYR B CD2 1 
ATOM   6464  C  CE1 . TYR B  1 196 ? 8.179   -5.049  -21.025 1.00 61.77  ? 196  TYR B CE1 1 
ATOM   6465  C  CE2 . TYR B  1 196 ? 9.862   -6.263  -22.223 1.00 64.14  ? 196  TYR B CE2 1 
ATOM   6466  C  CZ  . TYR B  1 196 ? 9.376   -5.073  -21.714 1.00 61.38  ? 196  TYR B CZ  1 
ATOM   6467  O  OH  . TYR B  1 196 ? 10.082  -3.904  -21.893 1.00 57.74  ? 196  TYR B OH  1 
ATOM   6468  N  N   . PHE B  1 197 ? 6.362   -11.711 -22.399 1.00 70.93  ? 197  PHE B N   1 
ATOM   6469  C  CA  . PHE B  1 197 ? 5.889   -13.061 -22.093 1.00 72.47  ? 197  PHE B CA  1 
ATOM   6470  C  C   . PHE B  1 197 ? 4.591   -13.390 -22.816 1.00 71.45  ? 197  PHE B C   1 
ATOM   6471  O  O   . PHE B  1 197 ? 4.099   -14.517 -22.746 1.00 71.45  ? 197  PHE B O   1 
ATOM   6472  C  CB  . PHE B  1 197 ? 5.727   -13.259 -20.585 1.00 75.99  ? 197  PHE B CB  1 
ATOM   6473  C  CG  . PHE B  1 197 ? 7.002   -13.076 -19.817 1.00 79.95  ? 197  PHE B CG  1 
ATOM   6474  C  CD1 . PHE B  1 197 ? 7.316   -11.845 -19.255 1.00 81.23  ? 197  PHE B CD1 1 
ATOM   6475  C  CD2 . PHE B  1 197 ? 7.893   -14.130 -19.668 1.00 81.50  ? 197  PHE B CD2 1 
ATOM   6476  C  CE1 . PHE B  1 197 ? 8.494   -11.667 -18.551 1.00 82.51  ? 197  PHE B CE1 1 
ATOM   6477  C  CE2 . PHE B  1 197 ? 9.072   -13.965 -18.966 1.00 82.89  ? 197  PHE B CE2 1 
ATOM   6478  C  CZ  . PHE B  1 197 ? 9.375   -12.729 -18.405 1.00 83.66  ? 197  PHE B CZ  1 
ATOM   6479  N  N   . LYS B  1 198 ? 4.047   -12.396 -23.510 1.00 70.81  ? 198  LYS B N   1 
ATOM   6480  C  CA  . LYS B  1 198 ? 2.813   -12.562 -24.265 1.00 70.71  ? 198  LYS B CA  1 
ATOM   6481  C  C   . LYS B  1 198 ? 3.087   -12.687 -25.762 1.00 69.68  ? 198  LYS B C   1 
ATOM   6482  O  O   . LYS B  1 198 ? 2.776   -13.711 -26.365 1.00 70.72  ? 198  LYS B O   1 
ATOM   6483  C  CB  . LYS B  1 198 ? 1.843   -11.415 -23.983 1.00 71.59  ? 198  LYS B CB  1 
ATOM   6484  C  CG  . LYS B  1 198 ? 0.485   -11.576 -24.649 1.00 73.08  ? 198  LYS B CG  1 
ATOM   6485  C  CD  . LYS B  1 198 ? -0.266  -12.785 -24.116 1.00 75.04  ? 198  LYS B CD  1 
ATOM   6486  C  CE  . LYS B  1 198 ? -1.515  -12.368 -23.349 1.00 75.99  ? 198  LYS B CE  1 
ATOM   6487  N  NZ  . LYS B  1 198 ? -2.574  -11.796 -24.226 1.00 75.84  ? 198  LYS B NZ  1 
ATOM   6488  N  N   . TYR B  1 199 ? 3.644   -11.637 -26.364 1.00 67.17  ? 199  TYR B N   1 
ATOM   6489  C  CA  . TYR B  1 199 ? 3.923   -11.637 -27.799 1.00 64.53  ? 199  TYR B CA  1 
ATOM   6490  C  C   . TYR B  1 199 ? 5.371   -11.312 -28.146 1.00 63.09  ? 199  TYR B C   1 
ATOM   6491  O  O   . TYR B  1 199 ? 6.045   -10.562 -27.449 1.00 63.42  ? 199  TYR B O   1 
ATOM   6492  C  CB  . TYR B  1 199 ? 3.006   -10.659 -28.532 1.00 64.97  ? 199  TYR B CB  1 
ATOM   6493  C  CG  . TYR B  1 199 ? 1.541   -11.002 -28.451 1.00 67.22  ? 199  TYR B CG  1 
ATOM   6494  C  CD1 . TYR B  1 199 ? 0.673   -10.230 -27.694 1.00 68.53  ? 199  TYR B CD1 1 
ATOM   6495  C  CD2 . TYR B  1 199 ? 1.023   -12.093 -29.132 1.00 69.59  ? 199  TYR B CD2 1 
ATOM   6496  C  CE1 . TYR B  1 199 ? -0.669  -10.530 -27.614 1.00 70.23  ? 199  TYR B CE1 1 
ATOM   6497  C  CE2 . TYR B  1 199 ? -0.321  -12.404 -29.059 1.00 72.23  ? 199  TYR B CE2 1 
ATOM   6498  C  CZ  . TYR B  1 199 ? -1.165  -11.617 -28.296 1.00 73.85  ? 199  TYR B CZ  1 
ATOM   6499  O  OH  . TYR B  1 199 ? -2.509  -11.913 -28.212 1.00 77.19  ? 199  TYR B OH  1 
ATOM   6500  N  N   . TRP B  1 200 ? 5.832   -11.878 -29.252 1.00 62.32  ? 200  TRP B N   1 
ATOM   6501  C  CA  . TRP B  1 200 ? 7.166   -11.616 -29.768 1.00 60.06  ? 200  TRP B CA  1 
ATOM   6502  C  C   . TRP B  1 200 ? 7.115   -11.399 -31.273 1.00 57.41  ? 200  TRP B C   1 
ATOM   6503  O  O   . TRP B  1 200 ? 6.189   -11.846 -31.945 1.00 57.53  ? 200  TRP B O   1 
ATOM   6504  C  CB  . TRP B  1 200 ? 8.098   -12.799 -29.487 1.00 59.87  ? 200  TRP B CB  1 
ATOM   6505  C  CG  . TRP B  1 200 ? 8.527   -12.947 -28.063 1.00 61.28  ? 200  TRP B CG  1 
ATOM   6506  C  CD1 . TRP B  1 200 ? 9.616   -12.379 -27.473 1.00 61.58  ? 200  TRP B CD1 1 
ATOM   6507  C  CD2 . TRP B  1 200 ? 7.891   -13.737 -27.052 1.00 63.19  ? 200  TRP B CD2 1 
ATOM   6508  N  NE1 . TRP B  1 200 ? 9.694   -12.756 -26.156 1.00 61.94  ? 200  TRP B NE1 1 
ATOM   6509  C  CE2 . TRP B  1 200 ? 8.645   -13.591 -25.872 1.00 61.95  ? 200  TRP B CE2 1 
ATOM   6510  C  CE3 . TRP B  1 200 ? 6.752   -14.549 -27.028 1.00 65.70  ? 200  TRP B CE3 1 
ATOM   6511  C  CZ2 . TRP B  1 200 ? 8.300   -14.226 -24.682 1.00 61.93  ? 200  TRP B CZ2 1 
ATOM   6512  C  CZ3 . TRP B  1 200 ? 6.410   -15.181 -25.844 1.00 65.56  ? 200  TRP B CZ3 1 
ATOM   6513  C  CH2 . TRP B  1 200 ? 7.183   -15.015 -24.688 1.00 64.41  ? 200  TRP B CH2 1 
ATOM   6514  N  N   . ASP B  1 201 ? 8.111   -10.700 -31.795 1.00 55.54  ? 201  ASP B N   1 
ATOM   6515  C  CA  . ASP B  1 201 ? 8.403   -10.755 -33.211 1.00 54.90  ? 201  ASP B CA  1 
ATOM   6516  C  C   . ASP B  1 201 ? 9.729   -11.496 -33.289 1.00 56.29  ? 201  ASP B C   1 
ATOM   6517  O  O   . ASP B  1 201 ? 10.593  -11.311 -32.433 1.00 56.12  ? 201  ASP B O   1 
ATOM   6518  C  CB  . ASP B  1 201 ? 8.527   -9.353  -33.805 1.00 52.93  ? 201  ASP B CB  1 
ATOM   6519  C  CG  . ASP B  1 201 ? 7.328   -8.476  -33.490 1.00 52.23  ? 201  ASP B CG  1 
ATOM   6520  O  OD1 . ASP B  1 201 ? 6.202   -9.007  -33.400 1.00 49.90  ? 201  ASP B OD1 1 
ATOM   6521  O  OD2 . ASP B  1 201 ? 7.514   -7.251  -33.326 1.00 54.59  ? 201  ASP B OD2 1 
ATOM   6522  N  N   . ILE B  1 202 ? 9.882   -12.357 -34.287 1.00 56.65  ? 202  ILE B N   1 
ATOM   6523  C  CA  . ILE B  1 202 ? 11.111  -13.129 -34.427 1.00 56.07  ? 202  ILE B CA  1 
ATOM   6524  C  C   . ILE B  1 202 ? 11.784  -12.856 -35.767 1.00 56.78  ? 202  ILE B C   1 
ATOM   6525  O  O   . ILE B  1 202 ? 11.152  -12.939 -36.815 1.00 57.88  ? 202  ILE B O   1 
ATOM   6526  C  CB  . ILE B  1 202 ? 10.847  -14.630 -34.267 1.00 53.98  ? 202  ILE B CB  1 
ATOM   6527  C  CG1 . ILE B  1 202 ? 10.007  -14.878 -33.016 1.00 55.79  ? 202  ILE B CG1 1 
ATOM   6528  C  CG2 . ILE B  1 202 ? 12.153  -15.396 -34.189 1.00 51.62  ? 202  ILE B CG2 1 
ATOM   6529  C  CD1 . ILE B  1 202 ? 9.896   -16.346 -32.633 1.00 58.28  ? 202  ILE B CD1 1 
ATOM   6530  N  N   . TYR B  1 203 ? 13.071  -12.524 -35.718 1.00 56.30  ? 203  TYR B N   1 
ATOM   6531  C  CA  . TYR B  1 203 ? 13.829  -12.180 -36.916 1.00 56.26  ? 203  TYR B CA  1 
ATOM   6532  C  C   . TYR B  1 203 ? 14.994  -13.134 -37.141 1.00 56.87  ? 203  TYR B C   1 
ATOM   6533  O  O   . TYR B  1 203 ? 15.548  -13.700 -36.201 1.00 54.51  ? 203  TYR B O   1 
ATOM   6534  C  CB  . TYR B  1 203 ? 14.388  -10.760 -36.817 1.00 56.26  ? 203  TYR B CB  1 
ATOM   6535  C  CG  . TYR B  1 203 ? 13.364  -9.674  -36.586 1.00 57.52  ? 203  TYR B CG  1 
ATOM   6536  C  CD1 . TYR B  1 203 ? 12.810  -8.982  -37.656 1.00 57.76  ? 203  TYR B CD1 1 
ATOM   6537  C  CD2 . TYR B  1 203 ? 12.974  -9.314  -35.295 1.00 56.92  ? 203  TYR B CD2 1 
ATOM   6538  C  CE1 . TYR B  1 203 ? 11.879  -7.969  -37.451 1.00 57.97  ? 203  TYR B CE1 1 
ATOM   6539  C  CE2 . TYR B  1 203 ? 12.045  -8.303  -35.080 1.00 56.25  ? 203  TYR B CE2 1 
ATOM   6540  C  CZ  . TYR B  1 203 ? 11.502  -7.634  -36.162 1.00 57.37  ? 203  TYR B CZ  1 
ATOM   6541  O  OH  . TYR B  1 203 ? 10.581  -6.629  -35.966 1.00 56.77  ? 203  TYR B OH  1 
ATOM   6542  N  N   . LEU B  1 204 ? 15.363  -13.300 -38.404 1.00 60.02  ? 204  LEU B N   1 
ATOM   6543  C  CA  . LEU B  1 204 ? 16.570  -14.020 -38.768 1.00 61.77  ? 204  LEU B CA  1 
ATOM   6544  C  C   . LEU B  1 204 ? 17.608  -12.984 -39.197 1.00 62.05  ? 204  LEU B C   1 
ATOM   6545  O  O   . LEU B  1 204 ? 17.350  -12.178 -40.087 1.00 62.67  ? 204  LEU B O   1 
ATOM   6546  C  CB  . LEU B  1 204 ? 16.271  -14.986 -39.910 1.00 63.04  ? 204  LEU B CB  1 
ATOM   6547  C  CG  . LEU B  1 204 ? 17.416  -15.907 -40.321 1.00 64.04  ? 204  LEU B CG  1 
ATOM   6548  C  CD1 . LEU B  1 204 ? 17.773  -16.839 -39.177 1.00 63.71  ? 204  LEU B CD1 1 
ATOM   6549  C  CD2 . LEU B  1 204 ? 17.032  -16.691 -41.561 1.00 64.35  ? 204  LEU B CD2 1 
ATOM   6550  N  N   . TRP B  1 205 ? 18.777  -13.004 -38.565 1.00 61.77  ? 205  TRP B N   1 
ATOM   6551  C  CA  . TRP B  1 205 ? 19.761  -11.936 -38.731 1.00 62.92  ? 205  TRP B CA  1 
ATOM   6552  C  C   . TRP B  1 205 ? 21.064  -12.464 -39.330 1.00 65.92  ? 205  TRP B C   1 
ATOM   6553  O  O   . TRP B  1 205 ? 21.622  -13.444 -38.837 1.00 68.50  ? 205  TRP B O   1 
ATOM   6554  C  CB  . TRP B  1 205 ? 20.031  -11.283 -37.366 1.00 61.22  ? 205  TRP B CB  1 
ATOM   6555  C  CG  . TRP B  1 205 ? 20.713  -9.927  -37.399 1.00 59.56  ? 205  TRP B CG  1 
ATOM   6556  C  CD1 . TRP B  1 205 ? 20.117  -8.700  -37.261 1.00 58.50  ? 205  TRP B CD1 1 
ATOM   6557  C  CD2 . TRP B  1 205 ? 22.116  -9.673  -37.543 1.00 57.24  ? 205  TRP B CD2 1 
ATOM   6558  N  NE1 . TRP B  1 205 ? 21.061  -7.704  -37.326 1.00 57.50  ? 205  TRP B NE1 1 
ATOM   6559  C  CE2 . TRP B  1 205 ? 22.296  -8.274  -37.499 1.00 56.59  ? 205  TRP B CE2 1 
ATOM   6560  C  CE3 . TRP B  1 205 ? 23.235  -10.491 -37.715 1.00 57.93  ? 205  TRP B CE3 1 
ATOM   6561  C  CZ2 . TRP B  1 205 ? 23.549  -7.679  -37.620 1.00 56.40  ? 205  TRP B CZ2 1 
ATOM   6562  C  CZ3 . TRP B  1 205 ? 24.483  -9.897  -37.836 1.00 58.88  ? 205  TRP B CZ3 1 
ATOM   6563  C  CH2 . TRP B  1 205 ? 24.628  -8.506  -37.786 1.00 57.88  ? 205  TRP B CH2 1 
ATOM   6564  N  N   . LYS B  1 206 ? 21.528  -11.838 -40.410 1.00 65.55  ? 206  LYS B N   1 
ATOM   6565  C  CA  . LYS B  1 206 ? 22.846  -12.146 -40.965 1.00 66.93  ? 206  LYS B CA  1 
ATOM   6566  C  C   . LYS B  1 206 ? 23.548  -10.915 -41.541 1.00 67.40  ? 206  LYS B C   1 
ATOM   6567  O  O   . LYS B  1 206 ? 22.941  -10.125 -42.260 1.00 66.92  ? 206  LYS B O   1 
ATOM   6568  C  CB  . LYS B  1 206 ? 22.732  -13.229 -42.038 1.00 68.95  ? 206  LYS B CB  1 
ATOM   6569  C  CG  . LYS B  1 206 ? 24.031  -13.515 -42.775 1.00 71.14  ? 206  LYS B CG  1 
ATOM   6570  C  CD  . LYS B  1 206 ? 24.568  -14.901 -42.442 1.00 73.49  ? 206  LYS B CD  1 
ATOM   6571  C  CE  . LYS B  1 206 ? 25.651  -15.327 -43.427 1.00 74.92  ? 206  LYS B CE  1 
ATOM   6572  N  NZ  . LYS B  1 206 ? 25.985  -16.774 -43.293 1.00 75.85  ? 206  LYS B NZ  1 
ATOM   6573  N  N   . ASP B  1 207 ? 24.828  -10.759 -41.217 1.00 69.45  ? 207  ASP B N   1 
ATOM   6574  C  CA  . ASP B  1 207 ? 25.681  -9.766  -41.870 1.00 72.36  ? 207  ASP B CA  1 
ATOM   6575  C  C   . ASP B  1 207 ? 25.030  -8.398  -42.020 1.00 69.94  ? 207  ASP B C   1 
ATOM   6576  O  O   . ASP B  1 207 ? 25.090  -7.791  -43.088 1.00 70.59  ? 207  ASP B O   1 
ATOM   6577  C  CB  . ASP B  1 207 ? 26.147  -10.267 -43.237 1.00 77.62  ? 207  ASP B CB  1 
ATOM   6578  C  CG  . ASP B  1 207 ? 27.001  -11.511 -43.137 1.00 81.93  ? 207  ASP B CG  1 
ATOM   6579  O  OD1 . ASP B  1 207 ? 27.847  -11.572 -42.220 1.00 82.45  ? 207  ASP B OD1 1 
ATOM   6580  O  OD2 . ASP B  1 207 ? 26.823  -12.428 -43.969 1.00 83.65  ? 207  ASP B OD2 1 
ATOM   6581  N  N   . GLY B  1 208 ? 24.396  -7.919  -40.960 1.00 67.20  ? 208  GLY B N   1 
ATOM   6582  C  CA  . GLY B  1 208 ? 23.817  -6.591  -40.979 1.00 68.69  ? 208  GLY B CA  1 
ATOM   6583  C  C   . GLY B  1 208 ? 22.405  -6.496  -41.529 1.00 71.92  ? 208  GLY B C   1 
ATOM   6584  O  O   . GLY B  1 208 ? 21.824  -5.412  -41.551 1.00 72.93  ? 208  GLY B O   1 
ATOM   6585  N  N   . GLU B  1 209 ? 21.846  -7.617  -41.973 1.00 73.98  ? 209  GLU B N   1 
ATOM   6586  C  CA  . GLU B  1 209 ? 20.476  -7.632  -42.484 1.00 77.17  ? 209  GLU B CA  1 
ATOM   6587  C  C   . GLU B  1 209 ? 19.599  -8.645  -41.749 1.00 76.34  ? 209  GLU B C   1 
ATOM   6588  O  O   . GLU B  1 209 ? 20.103  -9.572  -41.118 1.00 77.99  ? 209  GLU B O   1 
ATOM   6589  C  CB  . GLU B  1 209 ? 20.467  -7.924  -43.983 1.00 81.78  ? 209  GLU B CB  1 
ATOM   6590  C  CG  . GLU B  1 209 ? 21.082  -6.828  -44.831 1.00 85.41  ? 209  GLU B CG  1 
ATOM   6591  C  CD  . GLU B  1 209 ? 21.293  -7.273  -46.263 1.00 90.78  ? 209  GLU B CD  1 
ATOM   6592  O  OE1 . GLU B  1 209 ? 21.245  -6.414  -47.169 1.00 92.56  ? 209  GLU B OE1 1 
ATOM   6593  O  OE2 . GLU B  1 209 ? 21.513  -8.486  -46.479 1.00 92.73  ? 209  GLU B OE2 1 
ATOM   6594  N  N   . GLU B  1 210 ? 18.284  -8.465  -41.830 1.00 72.88  ? 210  GLU B N   1 
ATOM   6595  C  CA  . GLU B  1 210 ? 17.360  -9.364  -41.146 1.00 69.67  ? 210  GLU B CA  1 
ATOM   6596  C  C   . GLU B  1 210 ? 16.074  -9.617  -41.936 1.00 69.10  ? 210  GLU B C   1 
ATOM   6597  O  O   . GLU B  1 210 ? 15.550  -8.725  -42.600 1.00 67.57  ? 210  GLU B O   1 
ATOM   6598  C  CB  . GLU B  1 210 ? 17.014  -8.818  -39.758 1.00 67.94  ? 210  GLU B CB  1 
ATOM   6599  C  CG  . GLU B  1 210 ? 15.961  -7.716  -39.773 1.00 67.78  ? 210  GLU B CG  1 
ATOM   6600  C  CD  . GLU B  1 210 ? 15.837  -6.971  -38.451 1.00 66.24  ? 210  GLU B CD  1 
ATOM   6601  O  OE1 . GLU B  1 210 ? 15.115  -5.953  -38.419 1.00 66.23  ? 210  GLU B OE1 1 
ATOM   6602  O  OE2 . GLU B  1 210 ? 16.454  -7.393  -37.451 1.00 64.98  ? 210  GLU B OE2 1 
ATOM   6603  N  N   . GLU B  1 211 ? 15.574  -10.846 -41.858 1.00 70.26  ? 211  GLU B N   1 
ATOM   6604  C  CA  . GLU B  1 211 ? 14.258  -11.182 -42.389 1.00 70.75  ? 211  GLU B CA  1 
ATOM   6605  C  C   . GLU B  1 211 ? 13.342  -11.548 -41.223 1.00 74.98  ? 211  GLU B C   1 
ATOM   6606  O  O   . GLU B  1 211 ? 13.757  -12.263 -40.311 1.00 77.84  ? 211  GLU B O   1 
ATOM   6607  C  CB  . GLU B  1 211 ? 14.354  -12.347 -43.377 1.00 68.40  ? 211  GLU B CB  1 
ATOM   6608  N  N   . LYS B  1 212 ? 12.105  -11.052 -41.249 1.00 74.22  ? 212  LYS B N   1 
ATOM   6609  C  CA  . LYS B  1 212 ? 11.139  -11.325 -40.183 1.00 70.12  ? 212  LYS B CA  1 
ATOM   6610  C  C   . LYS B  1 212 ? 10.515  -12.703 -40.387 1.00 68.85  ? 212  LYS B C   1 
ATOM   6611  O  O   . LYS B  1 212 ? 9.872   -12.955 -41.408 1.00 69.84  ? 212  LYS B O   1 
ATOM   6612  C  CB  . LYS B  1 212 ? 10.042  -10.256 -40.209 1.00 67.70  ? 212  LYS B CB  1 
ATOM   6613  C  CG  . LYS B  1 212 ? 9.154   -10.171 -38.973 1.00 65.92  ? 212  LYS B CG  1 
ATOM   6614  C  CD  . LYS B  1 212 ? 8.088   -9.094  -39.172 1.00 65.18  ? 212  LYS B CD  1 
ATOM   6615  C  CE  . LYS B  1 212 ? 7.842   -8.284  -37.910 1.00 65.28  ? 212  LYS B CE  1 
ATOM   6616  N  N   . LEU B  1 213 ? 10.721  -13.597 -39.423 1.00 65.77  ? 213  LEU B N   1 
ATOM   6617  C  CA  . LEU B  1 213 ? 10.129  -14.931 -39.464 1.00 63.98  ? 213  LEU B CA  1 
ATOM   6618  C  C   . LEU B  1 213 ? 8.689   -14.976 -38.965 1.00 64.89  ? 213  LEU B C   1 
ATOM   6619  O  O   . LEU B  1 213 ? 7.850   -15.693 -39.514 1.00 66.58  ? 213  LEU B O   1 
ATOM   6620  C  CB  . LEU B  1 213 ? 10.985  -15.930 -38.691 1.00 62.66  ? 213  LEU B CB  1 
ATOM   6621  C  CG  . LEU B  1 213 ? 12.415  -16.028 -39.206 1.00 62.22  ? 213  LEU B CG  1 
ATOM   6622  C  CD1 . LEU B  1 213 ? 13.118  -17.237 -38.611 1.00 62.15  ? 213  LEU B CD1 1 
ATOM   6623  C  CD2 . LEU B  1 213 ? 12.403  -16.101 -40.720 1.00 63.12  ? 213  LEU B CD2 1 
ATOM   6624  N  N   . PHE B  1 214 ? 8.422   -14.231 -37.898 1.00 64.14  ? 214  PHE B N   1 
ATOM   6625  C  CA  . PHE B  1 214 ? 7.117   -14.250 -37.249 1.00 62.33  ? 214  PHE B CA  1 
ATOM   6626  C  C   . PHE B  1 214 ? 6.768   -12.881 -36.690 1.00 62.57  ? 214  PHE B C   1 
ATOM   6627  O  O   . PHE B  1 214 ? 7.628   -12.172 -36.170 1.00 59.19  ? 214  PHE B O   1 
ATOM   6628  C  CB  . PHE B  1 214 ? 7.099   -15.251 -36.091 1.00 59.13  ? 214  PHE B CB  1 
ATOM   6629  C  CG  . PHE B  1 214 ? 7.168   -16.690 -36.511 1.00 57.45  ? 214  PHE B CG  1 
ATOM   6630  C  CD1 . PHE B  1 214 ? 8.383   -17.352 -36.565 1.00 57.28  ? 214  PHE B CD1 1 
ATOM   6631  C  CD2 . PHE B  1 214 ? 6.016   -17.392 -36.816 1.00 55.45  ? 214  PHE B CD2 1 
ATOM   6632  C  CE1 . PHE B  1 214 ? 8.449   -18.681 -36.931 1.00 56.53  ? 214  PHE B CE1 1 
ATOM   6633  C  CE2 . PHE B  1 214 ? 6.077   -18.720 -37.184 1.00 54.71  ? 214  PHE B CE2 1 
ATOM   6634  C  CZ  . PHE B  1 214 ? 7.292   -19.364 -37.239 1.00 55.94  ? 214  PHE B CZ  1 
ATOM   6635  N  N   . GLU B  1 215 ? 5.494   -12.523 -36.778 1.00 65.12  ? 215  GLU B N   1 
ATOM   6636  C  CA  . GLU B  1 215 ? 5.011   -11.306 -36.154 1.00 65.57  ? 215  GLU B CA  1 
ATOM   6637  C  C   . GLU B  1 215 ? 3.965   -11.622 -35.098 1.00 64.66  ? 215  GLU B C   1 
ATOM   6638  O  O   . GLU B  1 215 ? 3.089   -12.452 -35.312 1.00 64.53  ? 215  GLU B O   1 
ATOM   6639  C  CB  . GLU B  1 215 ? 4.415   -10.364 -37.188 1.00 66.79  ? 215  GLU B CB  1 
ATOM   6640  C  CG  . GLU B  1 215 ? 3.349   -9.468  -36.605 1.00 69.36  ? 215  GLU B CG  1 
ATOM   6641  C  CD  . GLU B  1 215 ? 3.536   -8.029  -37.001 1.00 73.33  ? 215  GLU B CD  1 
ATOM   6642  O  OE1 . GLU B  1 215 ? 3.927   -7.781  -38.162 1.00 76.92  ? 215  GLU B OE1 1 
ATOM   6643  O  OE2 . GLU B  1 215 ? 3.300   -7.145  -36.152 1.00 73.29  ? 215  GLU B OE2 1 
ATOM   6644  N  N   . LYS B  1 216 ? 4.074   -10.959 -33.954 1.00 64.42  ? 216  LYS B N   1 
ATOM   6645  C  CA  . LYS B  1 216 ? 3.085   -11.061 -32.886 1.00 63.89  ? 216  LYS B CA  1 
ATOM   6646  C  C   . LYS B  1 216 ? 2.725   -12.492 -32.491 1.00 62.00  ? 216  LYS B C   1 
ATOM   6647  O  O   . LYS B  1 216 ? 1.557   -12.869 -32.497 1.00 61.60  ? 216  LYS B O   1 
ATOM   6648  C  CB  . LYS B  1 216 ? 1.825   -10.256 -33.216 1.00 66.70  ? 216  LYS B CB  1 
ATOM   6649  C  CG  . LYS B  1 216 ? 1.067   -9.821  -31.967 1.00 70.63  ? 216  LYS B CG  1 
ATOM   6650  C  CD  . LYS B  1 216 ? 0.142   -8.644  -32.219 1.00 73.04  ? 216  LYS B CD  1 
ATOM   6651  C  CE  . LYS B  1 216 ? -0.488  -8.183  -30.915 1.00 74.28  ? 216  LYS B CE  1 
ATOM   6652  N  NZ  . LYS B  1 216 ? -1.471  -7.087  -31.115 1.00 75.66  ? 216  LYS B NZ  1 
ATOM   6653  N  N   . VAL B  1 217 ? 3.728   -13.287 -32.142 1.00 61.56  ? 217  VAL B N   1 
ATOM   6654  C  CA  . VAL B  1 217 ? 3.480   -14.667 -31.752 1.00 62.06  ? 217  VAL B CA  1 
ATOM   6655  C  C   . VAL B  1 217 ? 3.808   -14.906 -30.287 1.00 62.70  ? 217  VAL B C   1 
ATOM   6656  O  O   . VAL B  1 217 ? 4.626   -14.210 -29.691 1.00 64.10  ? 217  VAL B O   1 
ATOM   6657  C  CB  . VAL B  1 217 ? 4.300   -15.644 -32.588 1.00 62.01  ? 217  VAL B CB  1 
ATOM   6658  C  CG1 . VAL B  1 217 ? 3.952   -15.495 -34.061 1.00 60.95  ? 217  VAL B CG1 1 
ATOM   6659  C  CG2 . VAL B  1 217 ? 5.782   -15.414 -32.343 1.00 61.50  ? 217  VAL B CG2 1 
ATOM   6660  N  N   . SER B  1 218 ? 3.164   -15.917 -29.724 1.00 60.68  ? 218  SER B N   1 
ATOM   6661  C  CA  . SER B  1 218 ? 3.273   -16.239 -28.306 1.00 58.42  ? 218  SER B CA  1 
ATOM   6662  C  C   . SER B  1 218 ? 4.405   -17.208 -27.979 1.00 58.96  ? 218  SER B C   1 
ATOM   6663  O  O   . SER B  1 218 ? 4.443   -17.759 -26.885 1.00 60.11  ? 218  SER B O   1 
ATOM   6664  C  CB  . SER B  1 218 ? 1.941   -16.717 -27.738 1.00 58.12  ? 218  SER B CB  1 
ATOM   6665  O  OG  . SER B  1 218 ? 1.007   -15.653 -27.738 1.00 58.38  ? 218  SER B OG  1 
ATOM   6666  N  N   . PHE B  1 219 ? 5.257   -17.503 -28.957 1.00 58.38  ? 219  PHE B N   1 
ATOM   6667  C  CA  . PHE B  1 219 ? 6.505   -18.211 -28.663 1.00 57.27  ? 219  PHE B CA  1 
ATOM   6668  C  C   . PHE B  1 219 ? 7.758   -17.454 -29.117 1.00 56.49  ? 219  PHE B C   1 
ATOM   6669  O  O   . PHE B  1 219 ? 7.678   -16.492 -29.885 1.00 54.30  ? 219  PHE B O   1 
ATOM   6670  C  CB  . PHE B  1 219 ? 6.485   -19.633 -29.230 1.00 56.86  ? 219  PHE B CB  1 
ATOM   6671  C  CG  . PHE B  1 219 ? 6.144   -19.705 -30.687 1.00 57.13  ? 219  PHE B CG  1 
ATOM   6672  C  CD1 . PHE B  1 219 ? 5.579   -20.852 -31.217 1.00 57.85  ? 219  PHE B CD1 1 
ATOM   6673  C  CD2 . PHE B  1 219 ? 6.396   -18.638 -31.529 1.00 56.96  ? 219  PHE B CD2 1 
ATOM   6674  C  CE1 . PHE B  1 219 ? 5.263   -20.933 -32.557 1.00 57.02  ? 219  PHE B CE1 1 
ATOM   6675  C  CE2 . PHE B  1 219 ? 6.087   -18.712 -32.871 1.00 57.95  ? 219  PHE B CE2 1 
ATOM   6676  C  CZ  . PHE B  1 219 ? 5.518   -19.864 -33.386 1.00 58.00  ? 219  PHE B CZ  1 
ATOM   6677  N  N   . TYR B  1 220 ? 8.905   -17.871 -28.590 1.00 57.96  ? 220  TYR B N   1 
ATOM   6678  C  CA  . TYR B  1 220 ? 10.201  -17.328 -28.991 1.00 59.63  ? 220  TYR B CA  1 
ATOM   6679  C  C   . TYR B  1 220 ? 11.202  -18.470 -29.194 1.00 60.85  ? 220  TYR B C   1 
ATOM   6680  O  O   . TYR B  1 220 ? 10.916  -19.617 -28.845 1.00 63.55  ? 220  TYR B O   1 
ATOM   6681  C  CB  . TYR B  1 220 ? 10.708  -16.300 -27.974 1.00 59.74  ? 220  TYR B CB  1 
ATOM   6682  C  CG  . TYR B  1 220 ? 10.853  -16.834 -26.573 1.00 59.24  ? 220  TYR B CG  1 
ATOM   6683  C  CD1 . TYR B  1 220 ? 9.749   -16.977 -25.755 1.00 59.65  ? 220  TYR B CD1 1 
ATOM   6684  C  CD2 . TYR B  1 220 ? 12.097  -17.188 -26.066 1.00 59.46  ? 220  TYR B CD2 1 
ATOM   6685  C  CE1 . TYR B  1 220 ? 9.870   -17.464 -24.473 1.00 60.34  ? 220  TYR B CE1 1 
ATOM   6686  C  CE2 . TYR B  1 220 ? 12.231  -17.676 -24.784 1.00 59.56  ? 220  TYR B CE2 1 
ATOM   6687  C  CZ  . TYR B  1 220 ? 11.111  -17.813 -23.990 1.00 60.44  ? 220  TYR B CZ  1 
ATOM   6688  O  OH  . TYR B  1 220 ? 11.222  -18.298 -22.704 1.00 60.56  ? 220  TYR B OH  1 
ATOM   6689  N  N   . ALA B  1 221 ? 12.360  -18.177 -29.775 1.00 59.83  ? 221  ALA B N   1 
ATOM   6690  C  CA  . ALA B  1 221 ? 13.258  -19.250 -30.200 1.00 61.86  ? 221  ALA B CA  1 
ATOM   6691  C  C   . ALA B  1 221 ? 14.292  -19.594 -29.140 1.00 65.24  ? 221  ALA B C   1 
ATOM   6692  O  O   . ALA B  1 221 ? 15.178  -18.796 -28.852 1.00 68.21  ? 221  ALA B O   1 
ATOM   6693  C  CB  . ALA B  1 221 ? 13.949  -18.866 -31.502 1.00 60.29  ? 221  ALA B CB  1 
ATOM   6694  N  N   . ILE B  1 222 ? 14.163  -20.775 -28.540 1.00 64.34  ? 222  ILE B N   1 
ATOM   6695  C  CA  . ILE B  1 222 ? 15.119  -21.197 -27.523 1.00 61.43  ? 222  ILE B CA  1 
ATOM   6696  C  C   . ILE B  1 222 ? 16.301  -22.070 -27.951 1.00 60.03  ? 222  ILE B C   1 
ATOM   6697  O  O   . ILE B  1 222 ? 17.249  -22.213 -27.188 1.00 60.12  ? 222  ILE B O   1 
ATOM   6698  C  CB  . ILE B  1 222 ? 14.383  -21.976 -26.428 1.00 60.39  ? 222  ILE B CB  1 
ATOM   6699  C  CG1 . ILE B  1 222 ? 13.615  -23.144 -27.056 1.00 60.13  ? 222  ILE B CG1 1 
ATOM   6700  C  CG2 . ILE B  1 222 ? 13.444  -21.051 -25.666 1.00 59.04  ? 222  ILE B CG2 1 
ATOM   6701  C  CD1 . ILE B  1 222 ? 12.937  -24.055 -26.048 1.00 61.14  ? 222  ILE B CD1 1 
ATOM   6702  N  N   . ASP B  1 223 ? 16.265  -22.650 -29.147 1.00 60.42  ? 223  ASP B N   1 
ATOM   6703  C  CA  . ASP B  1 223 ? 17.354  -23.551 -29.567 1.00 61.54  ? 223  ASP B CA  1 
ATOM   6704  C  C   . ASP B  1 223 ? 17.439  -23.821 -31.072 1.00 59.69  ? 223  ASP B C   1 
ATOM   6705  O  O   . ASP B  1 223 ? 16.494  -23.559 -31.815 1.00 57.55  ? 223  ASP B O   1 
ATOM   6706  C  CB  . ASP B  1 223 ? 17.352  -24.860 -28.765 1.00 64.00  ? 223  ASP B CB  1 
ATOM   6707  C  CG  . ASP B  1 223 ? 18.728  -25.516 -28.709 1.00 66.04  ? 223  ASP B CG  1 
ATOM   6708  O  OD1 . ASP B  1 223 ? 19.708  -24.890 -29.168 1.00 67.25  ? 223  ASP B OD1 1 
ATOM   6709  O  OD2 . ASP B  1 223 ? 18.831  -26.650 -28.188 1.00 66.57  ? 223  ASP B OD2 1 
ATOM   6710  N  N   . SER B  1 224 ? 18.582  -24.333 -31.517 1.00 60.97  ? 224  SER B N   1 
ATOM   6711  C  CA  . SER B  1 224 ? 18.734  -24.749 -32.905 1.00 64.25  ? 224  SER B CA  1 
ATOM   6712  C  C   . SER B  1 224 ? 19.723  -25.906 -33.065 1.00 69.10  ? 224  SER B C   1 
ATOM   6713  O  O   . SER B  1 224 ? 20.720  -25.984 -32.345 1.00 69.94  ? 224  SER B O   1 
ATOM   6714  C  CB  . SER B  1 224 ? 19.169  -23.556 -33.758 1.00 63.15  ? 224  SER B CB  1 
ATOM   6715  O  OG  . SER B  1 224 ? 19.512  -23.955 -35.070 1.00 62.76  ? 224  SER B OG  1 
ATOM   6716  N  N   . ASP B  1 225 ? 19.412  -26.828 -33.975 1.00 72.38  ? 225  ASP B N   1 
ATOM   6717  C  CA  . ASP B  1 225 ? 20.382  -27.800 -34.484 1.00 75.44  ? 225  ASP B CA  1 
ATOM   6718  C  C   . ASP B  1 225 ? 20.946  -27.340 -35.826 1.00 78.09  ? 225  ASP B C   1 
ATOM   6719  O  O   . ASP B  1 225 ? 21.716  -28.052 -36.470 1.00 80.56  ? 225  ASP B O   1 
ATOM   6720  C  CB  . ASP B  1 225 ? 19.772  -29.195 -34.602 1.00 76.88  ? 225  ASP B CB  1 
ATOM   6721  C  CG  . ASP B  1 225 ? 18.563  -29.224 -35.503 1.00 76.69  ? 225  ASP B CG  1 
ATOM   6722  O  OD1 . ASP B  1 225 ? 18.466  -28.362 -36.405 1.00 75.76  ? 225  ASP B OD1 1 
ATOM   6723  O  OD2 . ASP B  1 225 ? 17.710  -30.114 -35.307 1.00 76.51  ? 225  ASP B OD2 1 
ATOM   6724  N  N   . GLY B  1 226 ? 20.504  -26.160 -36.251 1.00 77.56  ? 226  GLY B N   1 
ATOM   6725  C  CA  . GLY B  1 226 ? 20.967  -25.504 -37.463 1.00 77.04  ? 226  GLY B CA  1 
ATOM   6726  C  C   . GLY B  1 226 ? 20.161  -25.838 -38.702 1.00 78.24  ? 226  GLY B C   1 
ATOM   6727  O  O   . GLY B  1 226 ? 20.132  -25.060 -39.654 1.00 77.65  ? 226  GLY B O   1 
ATOM   6728  N  N   . GLU B  1 227 ? 19.511  -26.998 -38.699 1.00 80.14  ? 227  GLU B N   1 
ATOM   6729  C  CA  . GLU B  1 227 ? 18.455  -27.297 -39.663 1.00 80.32  ? 227  GLU B CA  1 
ATOM   6730  C  C   . GLU B  1 227 ? 17.104  -26.727 -39.225 1.00 75.90  ? 227  GLU B C   1 
ATOM   6731  O  O   . GLU B  1 227 ? 16.363  -26.160 -40.029 1.00 74.05  ? 227  GLU B O   1 
ATOM   6732  C  CB  . GLU B  1 227 ? 18.358  -28.805 -39.915 1.00 85.20  ? 227  GLU B CB  1 
ATOM   6733  C  CG  . GLU B  1 227 ? 19.518  -29.371 -40.722 1.00 90.09  ? 227  GLU B CG  1 
ATOM   6734  C  CD  . GLU B  1 227 ? 19.625  -28.743 -42.100 1.00 95.60  ? 227  GLU B CD  1 
ATOM   6735  O  OE1 . GLU B  1 227 ? 18.585  -28.609 -42.781 1.00 96.97  ? 227  GLU B OE1 1 
ATOM   6736  O  OE2 . GLU B  1 227 ? 20.747  -28.374 -42.503 1.00 98.40  ? 227  GLU B OE2 1 
ATOM   6737  N  N   . ARG B  1 228 ? 16.804  -26.875 -37.936 1.00 73.84  ? 228  ARG B N   1 
ATOM   6738  C  CA  . ARG B  1 228 ? 15.505  -26.502 -37.379 1.00 73.65  ? 228  ARG B CA  1 
ATOM   6739  C  C   . ARG B  1 228 ? 15.627  -25.541 -36.194 1.00 72.26  ? 228  ARG B C   1 
ATOM   6740  O  O   . ARG B  1 228 ? 16.657  -25.487 -35.524 1.00 72.90  ? 228  ARG B O   1 
ATOM   6741  C  CB  . ARG B  1 228 ? 14.749  -27.751 -36.925 1.00 75.62  ? 228  ARG B CB  1 
ATOM   6742  C  CG  . ARG B  1 228 ? 14.415  -28.733 -38.027 1.00 77.72  ? 228  ARG B CG  1 
ATOM   6743  C  CD  . ARG B  1 228 ? 14.336  -30.153 -37.478 1.00 79.32  ? 228  ARG B CD  1 
ATOM   6744  N  NE  . ARG B  1 228 ? 15.655  -30.670 -37.115 1.00 80.47  ? 228  ARG B NE  1 
ATOM   6745  C  CZ  . ARG B  1 228 ? 16.479  -31.280 -37.965 1.00 82.00  ? 228  ARG B CZ  1 
ATOM   6746  N  NH1 . ARG B  1 228 ? 16.121  -31.452 -39.230 1.00 84.19  ? 228  ARG B NH1 1 
ATOM   6747  N  NH2 . ARG B  1 228 ? 17.662  -31.718 -37.555 1.00 81.68  ? 228  ARG B NH2 1 
ATOM   6748  N  N   . ILE B  1 229 ? 14.557  -24.797 -35.933 1.00 69.15  ? 229  ILE B N   1 
ATOM   6749  C  CA  . ILE B  1 229 ? 14.516  -23.857 -34.820 1.00 65.84  ? 229  ILE B CA  1 
ATOM   6750  C  C   . ILE B  1 229 ? 13.450  -24.284 -33.818 1.00 66.18  ? 229  ILE B C   1 
ATOM   6751  O  O   . ILE B  1 229 ? 12.295  -24.509 -34.182 1.00 68.17  ? 229  ILE B O   1 
ATOM   6752  C  CB  . ILE B  1 229 ? 14.210  -22.436 -35.308 1.00 65.03  ? 229  ILE B CB  1 
ATOM   6753  C  CG1 . ILE B  1 229 ? 15.319  -21.950 -36.240 1.00 66.15  ? 229  ILE B CG1 1 
ATOM   6754  C  CG2 . ILE B  1 229 ? 14.054  -21.486 -34.135 1.00 64.81  ? 229  ILE B CG2 1 
ATOM   6755  C  CD1 . ILE B  1 229 ? 15.059  -20.580 -36.823 1.00 67.31  ? 229  ILE B CD1 1 
ATOM   6756  N  N   . LEU B  1 230 ? 13.838  -24.405 -32.555 1.00 63.25  ? 230  LEU B N   1 
ATOM   6757  C  CA  . LEU B  1 230 ? 12.913  -24.862 -31.530 1.00 61.40  ? 230  LEU B CA  1 
ATOM   6758  C  C   . LEU B  1 230 ? 12.181  -23.678 -30.893 1.00 60.87  ? 230  LEU B C   1 
ATOM   6759  O  O   . LEU B  1 230 ? 12.811  -22.780 -30.346 1.00 61.81  ? 230  LEU B O   1 
ATOM   6760  C  CB  . LEU B  1 230 ? 13.658  -25.690 -30.479 1.00 59.80  ? 230  LEU B CB  1 
ATOM   6761  C  CG  . LEU B  1 230 ? 12.835  -26.297 -29.340 1.00 61.14  ? 230  LEU B CG  1 
ATOM   6762  C  CD1 . LEU B  1 230 ? 11.752  -27.228 -29.866 1.00 62.16  ? 230  LEU B CD1 1 
ATOM   6763  C  CD2 . LEU B  1 230 ? 13.741  -27.031 -28.368 1.00 61.06  ? 230  LEU B CD2 1 
ATOM   6764  N  N   . LEU B  1 231 ? 10.854  -23.677 -30.973 1.00 59.63  ? 231  LEU B N   1 
ATOM   6765  C  CA  . LEU B  1 231 ? 10.065  -22.564 -30.459 1.00 60.94  ? 231  LEU B CA  1 
ATOM   6766  C  C   . LEU B  1 231 ? 9.414   -22.917 -29.129 1.00 60.58  ? 231  LEU B C   1 
ATOM   6767  O  O   . LEU B  1 231 ? 8.925   -24.027 -28.957 1.00 61.80  ? 231  LEU B O   1 
ATOM   6768  C  CB  . LEU B  1 231 ? 9.012   -22.143 -31.484 1.00 62.54  ? 231  LEU B CB  1 
ATOM   6769  C  CG  . LEU B  1 231 ? 9.597   -21.632 -32.804 1.00 63.68  ? 231  LEU B CG  1 
ATOM   6770  C  CD1 . LEU B  1 231 ? 8.500   -21.260 -33.780 1.00 63.70  ? 231  LEU B CD1 1 
ATOM   6771  C  CD2 . LEU B  1 231 ? 10.508  -20.442 -32.551 1.00 63.37  ? 231  LEU B CD2 1 
ATOM   6772  N  N   . TYR B  1 232 ? 9.422   -21.976 -28.187 1.00 58.03  ? 232  TYR B N   1 
ATOM   6773  C  CA  . TYR B  1 232 ? 8.892   -22.232 -26.849 1.00 58.33  ? 232  TYR B CA  1 
ATOM   6774  C  C   . TYR B  1 232 ? 7.757   -21.277 -26.527 1.00 58.37  ? 232  TYR B C   1 
ATOM   6775  O  O   . TYR B  1 232 ? 7.952   -20.065 -26.437 1.00 57.14  ? 232  TYR B O   1 
ATOM   6776  C  CB  . TYR B  1 232 ? 9.993   -22.105 -25.803 1.00 57.91  ? 232  TYR B CB  1 
ATOM   6777  C  CG  . TYR B  1 232 ? 9.540   -22.305 -24.374 1.00 59.48  ? 232  TYR B CG  1 
ATOM   6778  C  CD1 . TYR B  1 232 ? 9.543   -23.570 -23.796 1.00 60.74  ? 232  TYR B CD1 1 
ATOM   6779  C  CD2 . TYR B  1 232 ? 9.134   -21.225 -23.590 1.00 59.90  ? 232  TYR B CD2 1 
ATOM   6780  C  CE1 . TYR B  1 232 ? 9.142   -23.761 -22.476 1.00 61.85  ? 232  TYR B CE1 1 
ATOM   6781  C  CE2 . TYR B  1 232 ? 8.732   -21.402 -22.273 1.00 60.22  ? 232  TYR B CE2 1 
ATOM   6782  C  CZ  . TYR B  1 232 ? 8.738   -22.675 -21.720 1.00 61.50  ? 232  TYR B CZ  1 
ATOM   6783  O  OH  . TYR B  1 232 ? 8.338   -22.868 -20.416 1.00 60.27  ? 232  TYR B OH  1 
ATOM   6784  N  N   . GLY B  1 233 ? 6.558   -21.826 -26.387 1.00 58.12  ? 233  GLY B N   1 
ATOM   6785  C  CA  . GLY B  1 233 ? 5.389   -20.995 -26.228 1.00 59.06  ? 233  GLY B CA  1 
ATOM   6786  C  C   . GLY B  1 233 ? 4.196   -21.678 -26.848 1.00 62.93  ? 233  GLY B C   1 
ATOM   6787  O  O   . GLY B  1 233 ? 4.134   -22.905 -26.943 1.00 64.30  ? 233  GLY B O   1 
ATOM   6788  N  N   . LYS B  1 234 ? 3.222   -20.857 -27.216 1.00 64.99  ? 234  LYS B N   1 
ATOM   6789  C  CA  . LYS B  1 234 ? 2.171   -21.242 -28.143 1.00 64.65  ? 234  LYS B CA  1 
ATOM   6790  C  C   . LYS B  1 234 ? 2.201   -20.266 -29.314 1.00 61.74  ? 234  LYS B C   1 
ATOM   6791  O  O   . LYS B  1 234 ? 2.761   -19.186 -29.192 1.00 61.02  ? 234  LYS B O   1 
ATOM   6792  C  CB  . LYS B  1 234 ? 0.810   -21.174 -27.458 1.00 66.42  ? 234  LYS B CB  1 
ATOM   6793  C  CG  . LYS B  1 234 ? 0.515   -22.307 -26.502 1.00 68.21  ? 234  LYS B CG  1 
ATOM   6794  C  CD  . LYS B  1 234 ? -0.983  -22.371 -26.261 1.00 71.48  ? 234  LYS B CD  1 
ATOM   6795  C  CE  . LYS B  1 234 ? -1.341  -23.252 -25.084 1.00 74.03  ? 234  LYS B CE  1 
ATOM   6796  N  NZ  . LYS B  1 234 ? -2.787  -23.119 -24.748 1.00 75.52  ? 234  LYS B NZ  1 
ATOM   6797  N  N   . PRO B  1 235 ? 1.612   -20.643 -30.460 1.00 62.17  ? 235  PRO B N   1 
ATOM   6798  C  CA  . PRO B  1 235 ? 1.485   -19.692 -31.573 1.00 62.57  ? 235  PRO B CA  1 
ATOM   6799  C  C   . PRO B  1 235 ? 0.678   -18.450 -31.186 1.00 66.18  ? 235  PRO B C   1 
ATOM   6800  O  O   . PRO B  1 235 ? 0.957   -17.357 -31.679 1.00 65.71  ? 235  PRO B O   1 
ATOM   6801  C  CB  . PRO B  1 235 ? 0.740   -20.500 -32.630 1.00 60.61  ? 235  PRO B CB  1 
ATOM   6802  C  CG  . PRO B  1 235 ? 1.123   -21.903 -32.348 1.00 59.60  ? 235  PRO B CG  1 
ATOM   6803  C  CD  . PRO B  1 235 ? 1.217   -22.005 -30.857 1.00 59.92  ? 235  PRO B CD  1 
ATOM   6804  N  N   . GLU B  1 236 ? -0.327  -18.625 -30.334 1.00 70.70  ? 236  GLU B N   1 
ATOM   6805  C  CA  . GLU B  1 236 ? -1.025  -17.496 -29.723 1.00 73.19  ? 236  GLU B CA  1 
ATOM   6806  C  C   . GLU B  1 236 ? -1.559  -17.856 -28.342 1.00 72.16  ? 236  GLU B C   1 
ATOM   6807  O  O   . GLU B  1 236 ? -2.034  -18.968 -28.127 1.00 73.63  ? 236  GLU B O   1 
ATOM   6808  C  CB  . GLU B  1 236 ? -2.170  -17.011 -30.607 1.00 76.95  ? 236  GLU B CB  1 
ATOM   6809  C  CG  . GLU B  1 236 ? -2.921  -15.835 -30.013 1.00 81.53  ? 236  GLU B CG  1 
ATOM   6810  C  CD  . GLU B  1 236 ? -3.212  -14.753 -31.033 1.00 85.31  ? 236  GLU B CD  1 
ATOM   6811  O  OE1 . GLU B  1 236 ? -3.956  -15.030 -31.999 1.00 87.67  ? 236  GLU B OE1 1 
ATOM   6812  O  OE2 . GLU B  1 236 ? -2.692  -13.627 -30.868 1.00 84.30  ? 236  GLU B OE2 1 
ATOM   6813  N  N   . LYS B  1 237 ? -1.505  -16.903 -27.419 1.00 68.88  ? 237  LYS B N   1 
ATOM   6814  C  CA  . LYS B  1 237 ? -1.972  -17.130 -26.058 1.00 67.59  ? 237  LYS B CA  1 
ATOM   6815  C  C   . LYS B  1 237 ? -3.028  -16.110 -25.655 1.00 67.10  ? 237  LYS B C   1 
ATOM   6816  O  O   . LYS B  1 237 ? -2.809  -14.905 -25.789 1.00 68.14  ? 237  LYS B O   1 
ATOM   6817  C  CB  . LYS B  1 237 ? -0.807  -17.024 -25.078 1.00 66.84  ? 237  LYS B CB  1 
ATOM   6818  C  CG  . LYS B  1 237 ? -0.030  -18.300 -24.832 1.00 67.05  ? 237  LYS B CG  1 
ATOM   6819  C  CD  . LYS B  1 237 ? 0.846   -18.095 -23.611 1.00 67.93  ? 237  LYS B CD  1 
ATOM   6820  C  CE  . LYS B  1 237 ? 1.722   -19.286 -23.314 1.00 68.21  ? 237  LYS B CE  1 
ATOM   6821  N  NZ  . LYS B  1 237 ? 2.514   -19.019 -22.086 1.00 66.26  ? 237  LYS B NZ  1 
ATOM   6822  N  N   . LYS B  1 238 ? -4.163  -16.586 -25.151 1.00 65.53  ? 238  LYS B N   1 
ATOM   6823  C  CA  . LYS B  1 238 ? -5.155  -15.683 -24.575 1.00 66.63  ? 238  LYS B CA  1 
ATOM   6824  C  C   . LYS B  1 238 ? -4.670  -15.259 -23.197 1.00 70.86  ? 238  LYS B C   1 
ATOM   6825  O  O   . LYS B  1 238 ? -4.843  -14.111 -22.785 1.00 71.20  ? 238  LYS B O   1 
ATOM   6826  C  CB  . LYS B  1 238 ? -6.523  -16.357 -24.461 1.00 63.52  ? 238  LYS B CB  1 
ATOM   6827  N  N   . TYR B  1 239 ? -4.052  -16.204 -22.498 1.00 72.49  ? 239  TYR B N   1 
ATOM   6828  C  CA  . TYR B  1 239 ? -3.537  -15.972 -21.161 1.00 74.33  ? 239  TYR B CA  1 
ATOM   6829  C  C   . TYR B  1 239 ? -2.092  -16.454 -21.070 1.00 70.51  ? 239  TYR B C   1 
ATOM   6830  O  O   . TYR B  1 239 ? -1.802  -17.610 -21.379 1.00 67.68  ? 239  TYR B O   1 
ATOM   6831  C  CB  . TYR B  1 239 ? -4.388  -16.732 -20.142 1.00 80.89  ? 239  TYR B CB  1 
ATOM   6832  C  CG  . TYR B  1 239 ? -5.878  -16.489 -20.258 1.00 85.77  ? 239  TYR B CG  1 
ATOM   6833  C  CD1 . TYR B  1 239 ? -6.384  -15.207 -20.442 1.00 87.16  ? 239  TYR B CD1 1 
ATOM   6834  C  CD2 . TYR B  1 239 ? -6.782  -17.546 -20.184 1.00 87.60  ? 239  TYR B CD2 1 
ATOM   6835  C  CE1 . TYR B  1 239 ? -7.747  -14.984 -20.545 1.00 88.63  ? 239  TYR B CE1 1 
ATOM   6836  C  CE2 . TYR B  1 239 ? -8.146  -17.331 -20.287 1.00 88.39  ? 239  TYR B CE2 1 
ATOM   6837  C  CZ  . TYR B  1 239 ? -8.621  -16.049 -20.468 1.00 88.69  ? 239  TYR B CZ  1 
ATOM   6838  O  OH  . TYR B  1 239 ? -9.973  -15.827 -20.574 1.00 88.07  ? 239  TYR B OH  1 
ATOM   6839  N  N   . VAL B  1 240 ? -1.187  -15.580 -20.637 1.00 70.07  ? 240  VAL B N   1 
ATOM   6840  C  CA  . VAL B  1 240 ? 0.209   -15.973 -20.471 1.00 69.79  ? 240  VAL B CA  1 
ATOM   6841  C  C   . VAL B  1 240 ? 0.305   -17.146 -19.502 1.00 70.31  ? 240  VAL B C   1 
ATOM   6842  O  O   . VAL B  1 240 ? 1.303   -17.872 -19.484 1.00 70.59  ? 240  VAL B O   1 
ATOM   6843  C  CB  . VAL B  1 240 ? 1.074   -14.821 -19.944 1.00 68.83  ? 240  VAL B CB  1 
ATOM   6844  C  CG1 . VAL B  1 240 ? 0.765   -13.541 -20.703 1.00 68.95  ? 240  VAL B CG1 1 
ATOM   6845  C  CG2 . VAL B  1 240 ? 0.847   -14.632 -18.459 1.00 68.57  ? 240  VAL B CG2 1 
ATOM   6846  N  N   . SER B  1 241 ? -0.744  -17.328 -18.703 1.00 68.91  ? 241  SER B N   1 
ATOM   6847  C  CA  . SER B  1 241 ? -0.785  -18.402 -17.720 1.00 67.39  ? 241  SER B CA  1 
ATOM   6848  C  C   . SER B  1 241 ? -0.923  -19.773 -18.366 1.00 67.61  ? 241  SER B C   1 
ATOM   6849  O  O   . SER B  1 241 ? -0.753  -20.789 -17.694 1.00 68.75  ? 241  SER B O   1 
ATOM   6850  C  CB  . SER B  1 241 ? -1.931  -18.193 -16.731 1.00 67.04  ? 241  SER B CB  1 
ATOM   6851  O  OG  . SER B  1 241 ? -1.705  -17.070 -15.900 1.00 67.08  ? 241  SER B OG  1 
ATOM   6852  N  N   . GLU B  1 242 ? -1.240  -19.804 -19.660 1.00 66.31  ? 242  GLU B N   1 
ATOM   6853  C  CA  . GLU B  1 242 ? -1.405  -21.074 -20.366 1.00 66.72  ? 242  GLU B CA  1 
ATOM   6854  C  C   . GLU B  1 242 ? -0.103  -21.875 -20.382 1.00 64.68  ? 242  GLU B C   1 
ATOM   6855  O  O   . GLU B  1 242 ? 0.991   -21.313 -20.366 1.00 63.99  ? 242  GLU B O   1 
ATOM   6856  C  CB  . GLU B  1 242 ? -1.909  -20.858 -21.802 1.00 68.47  ? 242  GLU B CB  1 
ATOM   6857  C  CG  . GLU B  1 242 ? -3.328  -20.295 -21.929 1.00 67.98  ? 242  GLU B CG  1 
ATOM   6858  C  CD  . GLU B  1 242 ? -3.658  -19.866 -23.356 1.00 68.72  ? 242  GLU B CD  1 
ATOM   6859  O  OE1 . GLU B  1 242 ? -3.076  -20.441 -24.306 1.00 69.68  ? 242  GLU B OE1 1 
ATOM   6860  O  OE2 . GLU B  1 242 ? -4.488  -18.946 -23.528 1.00 67.31  ? 242  GLU B OE2 1 
ATOM   6861  N  N   . HIS B  1 243 ? -0.233  -23.195 -20.411 1.00 65.31  ? 243  HIS B N   1 
ATOM   6862  C  CA  . HIS B  1 243 ? 0.922   -24.078 -20.477 1.00 66.14  ? 243  HIS B CA  1 
ATOM   6863  C  C   . HIS B  1 243 ? 1.788   -23.749 -21.686 1.00 67.42  ? 243  HIS B C   1 
ATOM   6864  O  O   . HIS B  1 243 ? 1.286   -23.591 -22.798 1.00 68.52  ? 243  HIS B O   1 
ATOM   6865  C  CB  . HIS B  1 243 ? 0.469   -25.539 -20.539 1.00 66.19  ? 243  HIS B CB  1 
ATOM   6866  C  CG  . HIS B  1 243 ? 0.153   -26.132 -19.201 1.00 66.91  ? 243  HIS B CG  1 
ATOM   6867  N  ND1 . HIS B  1 243 ? 0.287   -25.426 -18.024 1.00 67.71  ? 243  HIS B ND1 1 
ATOM   6868  C  CD2 . HIS B  1 243 ? -0.279  -27.366 -18.850 1.00 67.31  ? 243  HIS B CD2 1 
ATOM   6869  C  CE1 . HIS B  1 243 ? -0.051  -26.198 -17.008 1.00 67.59  ? 243  HIS B CE1 1 
ATOM   6870  N  NE2 . HIS B  1 243 ? -0.397  -27.381 -17.481 1.00 67.88  ? 243  HIS B NE2 1 
ATOM   6871  N  N   . ASP B  1 244 ? 3.092   -23.632 -21.467 1.00 66.07  ? 244  ASP B N   1 
ATOM   6872  C  CA  . ASP B  1 244 ? 4.002   -23.397 -22.576 1.00 64.48  ? 244  ASP B CA  1 
ATOM   6873  C  C   . ASP B  1 244 ? 4.334   -24.718 -23.254 1.00 63.43  ? 244  ASP B C   1 
ATOM   6874  O  O   . ASP B  1 244 ? 4.521   -25.738 -22.587 1.00 63.25  ? 244  ASP B O   1 
ATOM   6875  C  CB  . ASP B  1 244 ? 5.272   -22.684 -22.106 1.00 63.34  ? 244  ASP B CB  1 
ATOM   6876  C  CG  . ASP B  1 244 ? 5.079   -21.184 -21.964 1.00 63.31  ? 244  ASP B CG  1 
ATOM   6877  O  OD1 . ASP B  1 244 ? 4.591   -20.548 -22.925 1.00 60.37  ? 244  ASP B OD1 1 
ATOM   6878  O  OD2 . ASP B  1 244 ? 5.412   -20.642 -20.887 1.00 65.99  ? 244  ASP B OD2 1 
ATOM   6879  N  N   . LYS B  1 245 ? 4.387   -24.696 -24.581 1.00 61.72  ? 245  LYS B N   1 
ATOM   6880  C  CA  . LYS B  1 245 ? 4.747   -25.880 -25.338 1.00 61.21  ? 245  LYS B CA  1 
ATOM   6881  C  C   . LYS B  1 245 ? 6.005   -25.628 -26.166 1.00 62.28  ? 245  LYS B C   1 
ATOM   6882  O  O   . LYS B  1 245 ? 6.576   -24.540 -26.128 1.00 62.28  ? 245  LYS B O   1 
ATOM   6883  C  CB  . LYS B  1 245 ? 3.577   -26.305 -26.224 1.00 62.47  ? 245  LYS B CB  1 
ATOM   6884  C  CG  . LYS B  1 245 ? 2.321   -26.693 -25.441 1.00 62.11  ? 245  LYS B CG  1 
ATOM   6885  N  N   . ILE B  1 246 ? 6.438   -26.643 -26.906 1.00 64.29  ? 246  ILE B N   1 
ATOM   6886  C  CA  . ILE B  1 246 ? 7.602   -26.527 -27.780 1.00 63.12  ? 246  ILE B CA  1 
ATOM   6887  C  C   . ILE B  1 246 ? 7.235   -26.934 -29.202 1.00 64.66  ? 246  ILE B C   1 
ATOM   6888  O  O   . ILE B  1 246 ? 6.449   -27.851 -29.403 1.00 67.05  ? 246  ILE B O   1 
ATOM   6889  C  CB  . ILE B  1 246 ? 8.790   -27.383 -27.275 1.00 62.02  ? 246  ILE B CB  1 
ATOM   6890  C  CG1 . ILE B  1 246 ? 8.375   -28.847 -27.111 1.00 63.79  ? 246  ILE B CG1 1 
ATOM   6891  C  CG2 . ILE B  1 246 ? 9.315   -26.838 -25.961 1.00 59.77  ? 246  ILE B CG2 1 
ATOM   6892  C  CD1 . ILE B  1 246 ? 9.406   -29.704 -26.385 1.00 63.35  ? 246  ILE B CD1 1 
ATOM   6893  N  N   . TYR B  1 247 ? 7.802   -26.246 -30.185 1.00 66.22  ? 247  TYR B N   1 
ATOM   6894  C  CA  . TYR B  1 247 ? 7.519   -26.534 -31.587 1.00 67.96  ? 247  TYR B CA  1 
ATOM   6895  C  C   . TYR B  1 247 ? 8.800   -26.650 -32.398 1.00 70.06  ? 247  TYR B C   1 
ATOM   6896  O  O   . TYR B  1 247 ? 9.815   -26.059 -32.041 1.00 70.84  ? 247  TYR B O   1 
ATOM   6897  C  CB  . TYR B  1 247 ? 6.645   -25.437 -32.182 1.00 67.04  ? 247  TYR B CB  1 
ATOM   6898  C  CG  . TYR B  1 247 ? 5.393   -25.192 -31.390 1.00 67.62  ? 247  TYR B CG  1 
ATOM   6899  C  CD1 . TYR B  1 247 ? 4.177   -25.717 -31.796 1.00 67.97  ? 247  TYR B CD1 1 
ATOM   6900  C  CD2 . TYR B  1 247 ? 5.428   -24.444 -30.225 1.00 69.07  ? 247  TYR B CD2 1 
ATOM   6901  C  CE1 . TYR B  1 247 ? 3.029   -25.499 -31.068 1.00 68.49  ? 247  TYR B CE1 1 
ATOM   6902  C  CE2 . TYR B  1 247 ? 4.287   -24.218 -29.492 1.00 70.29  ? 247  TYR B CE2 1 
ATOM   6903  C  CZ  . TYR B  1 247 ? 3.090   -24.747 -29.918 1.00 70.16  ? 247  TYR B CZ  1 
ATOM   6904  O  OH  . TYR B  1 247 ? 1.951   -24.524 -29.185 1.00 70.95  ? 247  TYR B OH  1 
ATOM   6905  N  N   . ILE B  1 248 ? 8.748   -27.415 -33.487 1.00 70.73  ? 248  ILE B N   1 
ATOM   6906  C  CA  . ILE B  1 248 ? 9.870   -27.511 -34.419 1.00 71.59  ? 248  ILE B CA  1 
ATOM   6907  C  C   . ILE B  1 248 ? 9.571   -26.686 -35.662 1.00 72.70  ? 248  ILE B C   1 
ATOM   6908  O  O   . ILE B  1 248 ? 8.555   -26.907 -36.313 1.00 76.11  ? 248  ILE B O   1 
ATOM   6909  C  CB  . ILE B  1 248 ? 10.100  -28.957 -34.878 1.00 72.88  ? 248  ILE B CB  1 
ATOM   6910  C  CG1 . ILE B  1 248 ? 10.455  -29.860 -33.697 1.00 73.46  ? 248  ILE B CG1 1 
ATOM   6911  C  CG2 . ILE B  1 248 ? 11.202  -29.008 -35.926 1.00 73.02  ? 248  ILE B CG2 1 
ATOM   6912  C  CD1 . ILE B  1 248 ? 11.923  -29.854 -33.357 1.00 73.40  ? 248  ILE B CD1 1 
ATOM   6913  N  N   . TYR B  1 249 ? 10.440  -25.736 -35.993 1.00 70.80  ? 249  TYR B N   1 
ATOM   6914  C  CA  . TYR B  1 249 ? 10.237  -24.944 -37.200 1.00 72.47  ? 249  TYR B CA  1 
ATOM   6915  C  C   . TYR B  1 249 ? 11.316  -25.188 -38.250 1.00 74.71  ? 249  TYR B C   1 
ATOM   6916  O  O   . TYR B  1 249 ? 12.451  -24.747 -38.101 1.00 75.32  ? 249  TYR B O   1 
ATOM   6917  C  CB  . TYR B  1 249 ? 10.191  -23.462 -36.830 1.00 72.58  ? 249  TYR B CB  1 
ATOM   6918  C  CG  . TYR B  1 249 ? 10.019  -22.502 -37.987 1.00 73.97  ? 249  TYR B CG  1 
ATOM   6919  C  CD1 . TYR B  1 249 ? 8.755   -22.131 -38.422 1.00 75.51  ? 249  TYR B CD1 1 
ATOM   6920  C  CD2 . TYR B  1 249 ? 11.120  -21.940 -38.621 1.00 74.54  ? 249  TYR B CD2 1 
ATOM   6921  C  CE1 . TYR B  1 249 ? 8.590   -21.244 -39.466 1.00 77.09  ? 249  TYR B CE1 1 
ATOM   6922  C  CE2 . TYR B  1 249 ? 10.964  -21.050 -39.666 1.00 76.80  ? 249  TYR B CE2 1 
ATOM   6923  C  CZ  . TYR B  1 249 ? 9.694   -20.706 -40.084 1.00 78.57  ? 249  TYR B CZ  1 
ATOM   6924  O  OH  . TYR B  1 249 ? 9.522   -19.821 -41.124 1.00 80.32  ? 249  TYR B OH  1 
ATOM   6925  N  N   . ASP B  1 250 ? 10.946  -25.893 -39.315 1.00 76.72  ? 250  ASP B N   1 
ATOM   6926  C  CA  . ASP B  1 250 ? 11.783  -26.016 -40.511 1.00 78.93  ? 250  ASP B CA  1 
ATOM   6927  C  C   . ASP B  1 250 ? 11.385  -25.026 -41.601 1.00 80.05  ? 250  ASP B C   1 
ATOM   6928  O  O   . ASP B  1 250 ? 11.896  -25.083 -42.715 1.00 81.95  ? 250  ASP B O   1 
ATOM   6929  C  CB  . ASP B  1 250 ? 11.893  -27.456 -41.033 1.00 80.24  ? 250  ASP B CB  1 
ATOM   6930  C  CG  . ASP B  1 250 ? 10.559  -28.145 -41.144 1.00 81.72  ? 250  ASP B CG  1 
ATOM   6931  O  OD1 . ASP B  1 250 ? 9.567   -27.480 -41.518 1.00 82.23  ? 250  ASP B OD1 1 
ATOM   6932  O  OD2 . ASP B  1 250 ? 10.510  -29.361 -40.861 1.00 82.11  ? 250  ASP B OD2 1 
ATOM   6933  N  N   . GLY B  1 251 ? 10.467  -24.125 -41.265 1.00 79.90  ? 251  GLY B N   1 
ATOM   6934  C  CA  . GLY B  1 251 ? 9.763   -23.312 -42.243 1.00 80.09  ? 251  GLY B CA  1 
ATOM   6935  C  C   . GLY B  1 251 ? 8.308   -23.729 -42.288 1.00 80.49  ? 251  GLY B C   1 
ATOM   6936  O  O   . GLY B  1 251 ? 7.471   -23.093 -42.933 1.00 80.69  ? 251  GLY B O   1 
ATOM   6937  N  N   . GLU B  1 252 ? 8.018   -24.819 -41.590 1.00 80.69  ? 252  GLU B N   1 
ATOM   6938  C  CA  . GLU B  1 252 ? 6.656   -25.187 -41.241 1.00 79.44  ? 252  GLU B CA  1 
ATOM   6939  C  C   . GLU B  1 252 ? 6.641   -25.464 -39.739 1.00 77.88  ? 252  GLU B C   1 
ATOM   6940  O  O   . GLU B  1 252 ? 7.444   -26.256 -39.243 1.00 77.90  ? 252  GLU B O   1 
ATOM   6941  C  CB  . GLU B  1 252 ? 6.210   -26.421 -42.027 1.00 78.99  ? 252  GLU B CB  1 
ATOM   6942  N  N   . VAL B  1 253 ? 5.751   -24.797 -39.012 1.00 76.30  ? 253  VAL B N   1 
ATOM   6943  C  CA  . VAL B  1 253 ? 5.678   -24.964 -37.561 1.00 73.73  ? 253  VAL B CA  1 
ATOM   6944  C  C   . VAL B  1 253 ? 4.902   -26.223 -37.197 1.00 72.66  ? 253  VAL B C   1 
ATOM   6945  O  O   . VAL B  1 253 ? 3.727   -26.350 -37.530 1.00 72.79  ? 253  VAL B O   1 
ATOM   6946  C  CB  . VAL B  1 253 ? 4.997   -23.749 -36.890 1.00 72.29  ? 253  VAL B CB  1 
ATOM   6947  C  CG1 . VAL B  1 253 ? 4.745   -24.020 -35.416 1.00 71.96  ? 253  VAL B CG1 1 
ATOM   6948  C  CG2 . VAL B  1 253 ? 5.839   -22.497 -37.066 1.00 71.87  ? 253  VAL B CG2 1 
ATOM   6949  N  N   . LYS B  1 254 ? 5.550   -27.151 -36.501 1.00 72.66  ? 254  LYS B N   1 
ATOM   6950  C  CA  . LYS B  1 254 ? 4.875   -28.381 -36.096 1.00 74.06  ? 254  LYS B CA  1 
ATOM   6951  C  C   . LYS B  1 254 ? 5.007   -28.634 -34.601 1.00 75.02  ? 254  LYS B C   1 
ATOM   6952  O  O   . LYS B  1 254 ? 6.099   -28.895 -34.104 1.00 75.22  ? 254  LYS B O   1 
ATOM   6953  C  CB  . LYS B  1 254 ? 5.433   -29.575 -36.875 1.00 73.83  ? 254  LYS B CB  1 
ATOM   6954  N  N   . GLY B  1 255 ? 3.888   -28.555 -33.888 1.00 76.54  ? 255  GLY B N   1 
ATOM   6955  C  CA  . GLY B  1 255 ? 3.873   -28.860 -32.468 1.00 78.80  ? 255  GLY B CA  1 
ATOM   6956  C  C   . GLY B  1 255 ? 4.114   -30.335 -32.238 1.00 82.09  ? 255  GLY B C   1 
ATOM   6957  O  O   . GLY B  1 255 ? 3.415   -31.171 -32.806 1.00 84.78  ? 255  GLY B O   1 
ATOM   6958  N  N   . ILE B  1 256 ? 5.119   -30.673 -31.442 1.00 82.30  ? 256  ILE B N   1 
ATOM   6959  C  CA  . ILE B  1 256 ? 5.343   -32.075 -31.131 1.00 84.50  ? 256  ILE B CA  1 
ATOM   6960  C  C   . ILE B  1 256 ? 4.603   -32.493 -29.865 1.00 86.70  ? 256  ILE B C   1 
ATOM   6961  O  O   . ILE B  1 256 ? 4.480   -33.679 -29.577 1.00 88.61  ? 256  ILE B O   1 
ATOM   6962  C  CB  . ILE B  1 256 ? 6.844   -32.373 -30.976 1.00 84.68  ? 256  ILE B CB  1 
ATOM   6963  C  CG1 . ILE B  1 256 ? 7.338   -31.945 -29.594 1.00 84.36  ? 256  ILE B CG1 1 
ATOM   6964  C  CG2 . ILE B  1 256 ? 7.643   -31.675 -32.074 1.00 84.53  ? 256  ILE B CG2 1 
ATOM   6965  C  CD1 . ILE B  1 256 ? 8.845   -31.897 -29.477 1.00 84.37  ? 256  ILE B CD1 1 
ATOM   6966  N  N   . LEU B  1 257 ? 4.129   -31.505 -29.109 1.00 87.04  ? 257  LEU B N   1 
ATOM   6967  C  CA  . LEU B  1 257 ? 3.450   -31.745 -27.830 1.00 87.61  ? 257  LEU B CA  1 
ATOM   6968  C  C   . LEU B  1 257 ? 1.916   -31.724 -27.816 1.00 88.58  ? 257  LEU B C   1 
ATOM   6969  O  O   . LEU B  1 257 ? 1.313   -31.844 -26.749 1.00 87.97  ? 257  LEU B O   1 
ATOM   6970  C  CB  . LEU B  1 257 ? 4.018   -30.848 -26.723 1.00 87.23  ? 257  LEU B CB  1 
ATOM   6971  C  CG  . LEU B  1 257 ? 5.364   -31.322 -26.169 1.00 86.62  ? 257  LEU B CG  1 
ATOM   6972  C  CD1 . LEU B  1 257 ? 5.464   -31.072 -24.671 1.00 85.89  ? 257  LEU B CD1 1 
ATOM   6973  C  CD2 . LEU B  1 257 ? 5.577   -32.795 -26.482 1.00 86.47  ? 257  LEU B CD2 1 
ATOM   6974  N  N   . ASP B  1 258 ? 1.293   -31.553 -28.980 1.00 89.99  ? 258  ASP B N   1 
ATOM   6975  C  CA  . ASP B  1 258 ? -0.146  -31.276 -29.056 1.00 90.64  ? 258  ASP B CA  1 
ATOM   6976  C  C   . ASP B  1 258 ? -1.039  -32.248 -28.283 1.00 90.44  ? 258  ASP B C   1 
ATOM   6977  O  O   . ASP B  1 258 ? -2.127  -31.873 -27.836 1.00 90.56  ? 258  ASP B O   1 
ATOM   6978  C  CB  . ASP B  1 258 ? -0.613  -31.256 -30.511 1.00 92.39  ? 258  ASP B CB  1 
ATOM   6979  C  CG  . ASP B  1 258 ? 0.202   -30.331 -31.372 1.00 94.00  ? 258  ASP B CG  1 
ATOM   6980  O  OD1 . ASP B  1 258 ? 0.088   -29.098 -31.199 1.00 94.12  ? 258  ASP B OD1 1 
ATOM   6981  O  OD2 . ASP B  1 258 ? 0.947   -30.842 -32.232 1.00 94.72  ? 258  ASP B OD2 1 
ATOM   6982  N  N   . ASP B  1 259 ? -0.596  -33.492 -28.134 1.00 89.14  ? 259  ASP B N   1 
ATOM   6983  C  CA  . ASP B  1 259 ? -1.424  -34.514 -27.499 1.00 88.20  ? 259  ASP B CA  1 
ATOM   6984  C  C   . ASP B  1 259 ? -1.311  -34.531 -25.966 1.00 85.30  ? 259  ASP B C   1 
ATOM   6985  O  O   . ASP B  1 259 ? -1.979  -35.325 -25.302 1.00 85.10  ? 259  ASP B O   1 
ATOM   6986  C  CB  . ASP B  1 259 ? -1.106  -35.896 -28.085 1.00 88.81  ? 259  ASP B CB  1 
ATOM   6987  N  N   . ILE B  1 260 ? -0.482  -33.647 -25.411 1.00 81.94  ? 260  ILE B N   1 
ATOM   6988  C  CA  . ILE B  1 260 ? -0.215  -33.628 -23.970 1.00 79.15  ? 260  ILE B CA  1 
ATOM   6989  C  C   . ILE B  1 260 ? -0.575  -32.292 -23.314 1.00 79.80  ? 260  ILE B C   1 
ATOM   6990  O  O   . ILE B  1 260 ? -0.138  -31.242 -23.779 1.00 80.38  ? 260  ILE B O   1 
ATOM   6991  C  CB  . ILE B  1 260 ? 1.280   -33.868 -23.691 1.00 75.35  ? 260  ILE B CB  1 
ATOM   6992  C  CG1 . ILE B  1 260 ? 1.767   -35.138 -24.381 1.00 75.05  ? 260  ILE B CG1 1 
ATOM   6993  C  CG2 . ILE B  1 260 ? 1.536   -33.938 -22.199 1.00 74.75  ? 260  ILE B CG2 1 
ATOM   6994  C  CD1 . ILE B  1 260 ? 3.256   -35.362 -24.244 1.00 75.37  ? 260  ILE B CD1 1 
ATOM   6995  N  N   . ASP B  1 261 ? -1.338  -32.307 -22.222 1.00 80.26  ? 261  ASP B N   1 
ATOM   6996  C  CA  . ASP B  1 261 ? -1.555  -31.046 -21.521 1.00 81.14  ? 261  ASP B CA  1 
ATOM   6997  C  C   . ASP B  1 261 ? -0.655  -31.039 -20.287 1.00 80.01  ? 261  ASP B C   1 
ATOM   6998  O  O   . ASP B  1 261 ? -0.992  -31.595 -19.243 1.00 78.71  ? 261  ASP B O   1 
ATOM   6999  C  CB  . ASP B  1 261 ? -3.031  -30.981 -21.094 1.00 82.46  ? 261  ASP B CB  1 
ATOM   7000  C  CG  . ASP B  1 261 ? -3.425  -29.645 -20.483 1.00 83.72  ? 261  ASP B CG  1 
ATOM   7001  O  OD1 . ASP B  1 261 ? -2.557  -28.757 -20.358 1.00 87.44  ? 261  ASP B OD1 1 
ATOM   7002  O  OD2 . ASP B  1 261 ? -4.613  -29.490 -20.116 1.00 80.37  ? 261  ASP B OD2 1 
ATOM   7003  N  N   . ARG B  1 262 ? 0.463   -30.328 -20.415 1.00 79.04  ? 262  ARG B N   1 
ATOM   7004  C  CA  . ARG B  1 262 ? 1.426   -30.081 -19.344 1.00 78.01  ? 262  ARG B CA  1 
ATOM   7005  C  C   . ARG B  1 262 ? 2.286   -28.908 -19.803 1.00 78.86  ? 262  ARG B C   1 
ATOM   7006  O  O   . ARG B  1 262 ? 2.364   -28.648 -21.008 1.00 79.49  ? 262  ARG B O   1 
ATOM   7007  C  CB  . ARG B  1 262 ? 2.300   -31.309 -19.090 1.00 76.06  ? 262  ARG B CB  1 
ATOM   7008  C  CG  . ARG B  1 262 ? 1.581   -32.469 -18.418 1.00 75.20  ? 262  ARG B CG  1 
ATOM   7009  C  CD  . ARG B  1 262 ? 1.069   -32.097 -17.034 1.00 74.41  ? 262  ARG B CD  1 
ATOM   7010  N  NE  . ARG B  1 262 ? 0.361   -33.206 -16.399 1.00 74.46  ? 262  ARG B NE  1 
ATOM   7011  C  CZ  . ARG B  1 262 ? -0.964  -33.328 -16.362 1.00 73.91  ? 262  ARG B CZ  1 
ATOM   7012  N  NH1 . ARG B  1 262 ? -1.735  -32.400 -16.913 1.00 73.56  ? 262  ARG B NH1 1 
ATOM   7013  N  NH2 . ARG B  1 262 ? -1.521  -34.374 -15.767 1.00 73.67  ? 262  ARG B NH2 1 
ATOM   7014  N  N   . GLU B  1 263 ? 2.971   -28.230 -18.884 1.00 76.50  ? 263  GLU B N   1 
ATOM   7015  C  CA  . GLU B  1 263 ? 3.903   -27.189 -19.313 1.00 72.69  ? 263  GLU B CA  1 
ATOM   7016  C  C   . GLU B  1 263 ? 5.317   -27.740 -19.468 1.00 67.34  ? 263  GLU B C   1 
ATOM   7017  O  O   . GLU B  1 263 ? 5.761   -28.578 -18.683 1.00 63.90  ? 263  GLU B O   1 
ATOM   7018  C  CB  . GLU B  1 263 ? 3.897   -25.981 -18.372 1.00 73.78  ? 263  GLU B CB  1 
ATOM   7019  C  CG  . GLU B  1 263 ? 4.651   -24.772 -18.934 1.00 74.44  ? 263  GLU B CG  1 
ATOM   7020  C  CD  . GLU B  1 263 ? 4.284   -23.477 -18.239 1.00 76.34  ? 263  GLU B CD  1 
ATOM   7021  O  OE1 . GLU B  1 263 ? 3.939   -23.531 -17.043 1.00 78.52  ? 263  GLU B OE1 1 
ATOM   7022  O  OE2 . GLU B  1 263 ? 4.328   -22.409 -18.886 1.00 76.57  ? 263  GLU B OE2 1 
ATOM   7023  N  N   . VAL B  1 264 ? 6.007   -27.272 -20.503 1.00 66.07  ? 264  VAL B N   1 
ATOM   7024  C  CA  . VAL B  1 264 ? 7.397   -27.635 -20.735 1.00 64.30  ? 264  VAL B CA  1 
ATOM   7025  C  C   . VAL B  1 264 ? 8.296   -26.762 -19.871 1.00 63.87  ? 264  VAL B C   1 
ATOM   7026  O  O   . VAL B  1 264 ? 8.238   -25.535 -19.948 1.00 63.91  ? 264  VAL B O   1 
ATOM   7027  C  CB  . VAL B  1 264 ? 7.798   -27.426 -22.203 1.00 61.26  ? 264  VAL B CB  1 
ATOM   7028  C  CG1 . VAL B  1 264 ? 9.178   -28.005 -22.451 1.00 59.93  ? 264  VAL B CG1 1 
ATOM   7029  C  CG2 . VAL B  1 264 ? 6.768   -28.050 -23.134 1.00 60.44  ? 264  VAL B CG2 1 
ATOM   7030  N  N   . ALA B  1 265 ? 9.107   -27.398 -19.033 1.00 64.31  ? 265  ALA B N   1 
ATOM   7031  C  CA  . ALA B  1 265 ? 10.024  -26.673 -18.164 1.00 66.29  ? 265  ALA B CA  1 
ATOM   7032  C  C   . ALA B  1 265 ? 11.243  -26.134 -18.909 1.00 68.07  ? 265  ALA B C   1 
ATOM   7033  O  O   . ALA B  1 265 ? 11.564  -24.952 -18.811 1.00 67.32  ? 265  ALA B O   1 
ATOM   7034  C  CB  . ALA B  1 265 ? 10.466  -27.565 -17.008 1.00 66.39  ? 265  ALA B CB  1 
ATOM   7035  N  N   . GLN B  1 266 ? 11.909  -27.013 -19.651 1.00 69.63  ? 266  GLN B N   1 
ATOM   7036  C  CA  . GLN B  1 266 ? 13.147  -26.677 -20.342 1.00 70.65  ? 266  GLN B CA  1 
ATOM   7037  C  C   . GLN B  1 266 ? 13.269  -27.591 -21.554 1.00 73.77  ? 266  GLN B C   1 
ATOM   7038  O  O   . GLN B  1 266 ? 12.840  -28.745 -21.499 1.00 74.47  ? 266  GLN B O   1 
ATOM   7039  C  CB  . GLN B  1 266 ? 14.320  -26.890 -19.385 1.00 69.89  ? 266  GLN B CB  1 
ATOM   7040  C  CG  . GLN B  1 266 ? 15.684  -26.518 -19.910 1.00 69.99  ? 266  GLN B CG  1 
ATOM   7041  C  CD  . GLN B  1 266 ? 16.768  -26.761 -18.873 1.00 71.59  ? 266  GLN B CD  1 
ATOM   7042  O  OE1 . GLN B  1 266 ? 17.960  -26.621 -19.153 1.00 73.30  ? 266  GLN B OE1 1 
ATOM   7043  N  NE2 . GLN B  1 266 ? 16.357  -27.134 -17.666 1.00 71.27  ? 266  GLN B NE2 1 
ATOM   7044  N  N   . ALA B  1 267 ? 13.853  -27.093 -22.642 1.00 74.23  ? 267  ALA B N   1 
ATOM   7045  C  CA  . ALA B  1 267 ? 13.948  -27.893 -23.863 1.00 73.40  ? 267  ALA B CA  1 
ATOM   7046  C  C   . ALA B  1 267 ? 15.192  -27.609 -24.712 1.00 73.91  ? 267  ALA B C   1 
ATOM   7047  O  O   . ALA B  1 267 ? 15.585  -26.454 -24.884 1.00 75.07  ? 267  ALA B O   1 
ATOM   7048  C  CB  . ALA B  1 267 ? 12.690  -27.712 -24.696 1.00 72.57  ? 267  ALA B CB  1 
ATOM   7049  N  N   . LYS B  1 268 ? 15.782  -28.667 -25.269 1.00 72.62  ? 268  LYS B N   1 
ATOM   7050  C  CA  . LYS B  1 268 ? 16.929  -28.548 -26.171 1.00 69.98  ? 268  LYS B CA  1 
ATOM   7051  C  C   . LYS B  1 268 ? 16.729  -29.425 -27.405 1.00 69.43  ? 268  LYS B C   1 
ATOM   7052  O  O   . LYS B  1 268 ? 15.930  -30.358 -27.386 1.00 70.06  ? 268  LYS B O   1 
ATOM   7053  C  CB  . LYS B  1 268 ? 18.223  -28.954 -25.460 1.00 67.58  ? 268  LYS B CB  1 
ATOM   7054  C  CG  . LYS B  1 268 ? 18.510  -28.184 -24.189 1.00 65.56  ? 268  LYS B CG  1 
ATOM   7055  C  CD  . LYS B  1 268 ? 19.922  -28.444 -23.701 1.00 64.46  ? 268  LYS B CD  1 
ATOM   7056  C  CE  . LYS B  1 268 ? 20.241  -27.606 -22.477 1.00 64.68  ? 268  LYS B CE  1 
ATOM   7057  N  NZ  . LYS B  1 268 ? 21.702  -27.589 -22.186 1.00 65.95  ? 268  LYS B NZ  1 
ATOM   7058  N  N   . ILE B  1 269 ? 17.458  -29.132 -28.474 1.00 68.92  ? 269  ILE B N   1 
ATOM   7059  C  CA  . ILE B  1 269 ? 17.354  -29.928 -29.692 1.00 71.43  ? 269  ILE B CA  1 
ATOM   7060  C  C   . ILE B  1 269 ? 18.719  -30.249 -30.286 1.00 75.00  ? 269  ILE B C   1 
ATOM   7061  O  O   . ILE B  1 269 ? 19.512  -29.356 -30.581 1.00 75.55  ? 269  ILE B O   1 
ATOM   7062  C  CB  . ILE B  1 269 ? 16.465  -29.238 -30.755 1.00 71.14  ? 269  ILE B CB  1 
ATOM   7063  C  CG1 . ILE B  1 269 ? 16.410  -30.070 -32.041 1.00 70.64  ? 269  ILE B CG1 1 
ATOM   7064  C  CG2 . ILE B  1 269 ? 16.962  -27.831 -31.055 1.00 70.11  ? 269  ILE B CG2 1 
ATOM   7065  C  CD1 . ILE B  1 269 ? 15.582  -29.433 -33.144 1.00 69.48  ? 269  ILE B CD1 1 
ATOM   7066  N  N   . ARG B  1 270 ? 18.993  -31.535 -30.461 1.00 78.17  ? 270  ARG B N   1 
ATOM   7067  C  CA  . ARG B  1 270 ? 20.264  -31.957 -31.032 1.00 81.32  ? 270  ARG B CA  1 
ATOM   7068  C  C   . ARG B  1 270 ? 20.040  -33.016 -32.108 1.00 82.41  ? 270  ARG B C   1 
ATOM   7069  O  O   . ARG B  1 270 ? 19.484  -34.086 -31.845 1.00 82.20  ? 270  ARG B O   1 
ATOM   7070  C  CB  . ARG B  1 270 ? 21.195  -32.470 -29.930 1.00 84.39  ? 270  ARG B CB  1 
ATOM   7071  C  CG  . ARG B  1 270 ? 20.881  -31.900 -28.531 1.00 87.65  ? 270  ARG B CG  1 
ATOM   7072  C  CD  . ARG B  1 270 ? 21.996  -31.003 -27.965 1.00 89.36  ? 270  ARG B CD  1 
ATOM   7073  N  NE  . ARG B  1 270 ? 21.735  -29.568 -28.091 1.00 90.85  ? 270  ARG B NE  1 
ATOM   7074  C  CZ  . ARG B  1 270 ? 22.552  -28.612 -27.654 1.00 92.28  ? 270  ARG B CZ  1 
ATOM   7075  N  NH1 . ARG B  1 270 ? 23.687  -28.933 -27.057 1.00 93.17  ? 270  ARG B NH1 1 
ATOM   7076  N  NH2 . ARG B  1 270 ? 22.234  -27.334 -27.815 1.00 91.82  ? 270  ARG B NH2 1 
ATOM   7077  N  N   . ASN B  1 271 ? 20.454  -32.692 -33.329 1.00 82.98  ? 271  ASN B N   1 
ATOM   7078  C  CA  . ASN B  1 271 ? 20.296  -33.588 -34.468 1.00 83.36  ? 271  ASN B CA  1 
ATOM   7079  C  C   . ASN B  1 271 ? 18.894  -34.191 -34.571 1.00 83.20  ? 271  ASN B C   1 
ATOM   7080  O  O   . ASN B  1 271 ? 18.715  -35.399 -34.426 1.00 84.48  ? 271  ASN B O   1 
ATOM   7081  C  CB  . ASN B  1 271 ? 21.351  -34.698 -34.418 1.00 83.30  ? 271  ASN B CB  1 
ATOM   7082  N  N   . GLY B  1 272 ? 17.906  -33.330 -34.793 1.00 81.19  ? 272  GLY B N   1 
ATOM   7083  C  CA  . GLY B  1 272 ? 16.548  -33.740 -35.115 1.00 78.86  ? 272  GLY B CA  1 
ATOM   7084  C  C   . GLY B  1 272 ? 15.713  -34.209 -33.937 1.00 76.40  ? 272  GLY B C   1 
ATOM   7085  O  O   . GLY B  1 272 ? 14.484  -34.256 -34.019 1.00 75.98  ? 272  GLY B O   1 
ATOM   7086  N  N   . LYS B  1 273 ? 16.370  -34.507 -32.823 1.00 73.91  ? 273  LYS B N   1 
ATOM   7087  C  CA  . LYS B  1 273 ? 15.675  -35.006 -31.644 1.00 72.71  ? 273  LYS B CA  1 
ATOM   7088  C  C   . LYS B  1 273 ? 15.599  -33.911 -30.586 1.00 71.76  ? 273  LYS B C   1 
ATOM   7089  O  O   . LYS B  1 273 ? 16.493  -33.075 -30.483 1.00 72.70  ? 273  LYS B O   1 
ATOM   7090  C  CB  . LYS B  1 273 ? 16.375  -36.249 -31.089 1.00 72.60  ? 273  LYS B CB  1 
ATOM   7091  N  N   . VAL B  1 274 ? 14.523  -33.900 -29.812 1.00 69.37  ? 274  VAL B N   1 
ATOM   7092  C  CA  . VAL B  1 274 ? 14.349  -32.872 -28.798 1.00 67.97  ? 274  VAL B CA  1 
ATOM   7093  C  C   . VAL B  1 274 ? 14.248  -33.451 -27.394 1.00 68.49  ? 274  VAL B C   1 
ATOM   7094  O  O   . VAL B  1 274 ? 13.413  -34.306 -27.117 1.00 67.88  ? 274  VAL B O   1 
ATOM   7095  C  CB  . VAL B  1 274 ? 13.115  -32.007 -29.078 1.00 66.57  ? 274  VAL B CB  1 
ATOM   7096  C  CG1 . VAL B  1 274 ? 12.832  -31.101 -27.889 1.00 65.58  ? 274  VAL B CG1 1 
ATOM   7097  C  CG2 . VAL B  1 274 ? 13.319  -31.197 -30.349 1.00 65.36  ? 274  VAL B CG2 1 
ATOM   7098  N  N   . TYR B  1 275 ? 15.119  -32.976 -26.514 1.00 69.75  ? 275  TYR B N   1 
ATOM   7099  C  CA  . TYR B  1 275 ? 15.090  -33.361 -25.114 1.00 71.14  ? 275  TYR B CA  1 
ATOM   7100  C  C   . TYR B  1 275 ? 14.361  -32.295 -24.308 1.00 70.07  ? 275  TYR B C   1 
ATOM   7101  O  O   . TYR B  1 275 ? 14.663  -31.113 -24.425 1.00 69.38  ? 275  TYR B O   1 
ATOM   7102  C  CB  . TYR B  1 275 ? 16.512  -33.521 -24.596 1.00 72.25  ? 275  TYR B CB  1 
ATOM   7103  C  CG  . TYR B  1 275 ? 17.251  -34.705 -25.171 1.00 73.82  ? 275  TYR B CG  1 
ATOM   7104  C  CD1 . TYR B  1 275 ? 17.996  -34.585 -26.335 1.00 74.18  ? 275  TYR B CD1 1 
ATOM   7105  C  CD2 . TYR B  1 275 ? 17.212  -35.941 -24.539 1.00 75.65  ? 275  TYR B CD2 1 
ATOM   7106  C  CE1 . TYR B  1 275 ? 18.683  -35.669 -26.858 1.00 75.90  ? 275  TYR B CE1 1 
ATOM   7107  C  CE2 . TYR B  1 275 ? 17.893  -37.030 -25.052 1.00 77.14  ? 275  TYR B CE2 1 
ATOM   7108  C  CZ  . TYR B  1 275 ? 18.628  -36.891 -26.210 1.00 77.63  ? 275  TYR B CZ  1 
ATOM   7109  O  OH  . TYR B  1 275 ? 19.305  -37.978 -26.718 1.00 78.79  ? 275  TYR B OH  1 
ATOM   7110  N  N   . PHE B  1 276 ? 13.395  -32.706 -23.497 1.00 71.33  ? 276  PHE B N   1 
ATOM   7111  C  CA  . PHE B  1 276 ? 12.604  -31.734 -22.746 1.00 74.22  ? 276  PHE B CA  1 
ATOM   7112  C  C   . PHE B  1 276 ? 12.172  -32.208 -21.347 1.00 73.84  ? 276  PHE B C   1 
ATOM   7113  O  O   . PHE B  1 276 ? 12.253  -33.394 -21.025 1.00 74.03  ? 276  PHE B O   1 
ATOM   7114  C  CB  . PHE B  1 276 ? 11.400  -31.276 -23.577 1.00 76.01  ? 276  PHE B CB  1 
ATOM   7115  C  CG  . PHE B  1 276 ? 10.382  -32.348 -23.813 1.00 77.89  ? 276  PHE B CG  1 
ATOM   7116  C  CD1 . PHE B  1 276 ? 10.569  -33.299 -24.807 1.00 78.22  ? 276  PHE B CD1 1 
ATOM   7117  C  CD2 . PHE B  1 276 ? 9.232   -32.403 -23.045 1.00 79.65  ? 276  PHE B CD2 1 
ATOM   7118  C  CE1 . PHE B  1 276 ? 9.628   -34.287 -25.024 1.00 78.81  ? 276  PHE B CE1 1 
ATOM   7119  C  CE2 . PHE B  1 276 ? 8.284   -33.392 -23.258 1.00 80.69  ? 276  PHE B CE2 1 
ATOM   7120  C  CZ  . PHE B  1 276 ? 8.484   -34.334 -24.251 1.00 79.57  ? 276  PHE B CZ  1 
ATOM   7121  N  N   . THR B  1 277 ? 11.740  -31.265 -20.513 1.00 71.21  ? 277  THR B N   1 
ATOM   7122  C  CA  . THR B  1 277 ? 11.205  -31.593 -19.198 1.00 69.70  ? 277  THR B CA  1 
ATOM   7123  C  C   . THR B  1 277 ? 9.774   -31.101 -19.059 1.00 69.95  ? 277  THR B C   1 
ATOM   7124  O  O   . THR B  1 277 ? 9.353   -30.178 -19.757 1.00 71.33  ? 277  THR B O   1 
ATOM   7125  C  CB  . THR B  1 277 ? 12.022  -30.952 -18.083 1.00 69.44  ? 277  THR B CB  1 
ATOM   7126  O  OG1 . THR B  1 277 ? 12.149  -29.550 -18.342 1.00 70.84  ? 277  THR B OG1 1 
ATOM   7127  C  CG2 . THR B  1 277 ? 13.400  -31.583 -17.997 1.00 69.06  ? 277  THR B CG2 1 
ATOM   7128  N  N   . LEU B  1 278 ? 9.033   -31.709 -18.138 1.00 67.21  ? 278  LEU B N   1 
ATOM   7129  C  CA  . LEU B  1 278 ? 7.636   -31.358 -17.931 1.00 64.55  ? 278  LEU B CA  1 
ATOM   7130  C  C   . LEU B  1 278 ? 7.304   -31.214 -16.453 1.00 64.74  ? 278  LEU B C   1 
ATOM   7131  O  O   . LEU B  1 278 ? 7.906   -31.869 -15.605 1.00 64.70  ? 278  LEU B O   1 
ATOM   7132  C  CB  . LEU B  1 278 ? 6.735   -32.429 -18.540 1.00 63.66  ? 278  LEU B CB  1 
ATOM   7133  C  CG  . LEU B  1 278 ? 6.671   -32.536 -20.061 1.00 62.83  ? 278  LEU B CG  1 
ATOM   7134  C  CD1 . LEU B  1 278 ? 5.995   -33.832 -20.453 1.00 63.23  ? 278  LEU B CD1 1 
ATOM   7135  C  CD2 . LEU B  1 278 ? 5.930   -31.348 -20.646 1.00 62.68  ? 278  LEU B CD2 1 
ATOM   7136  N  N   . PHE B  1 279 ? 6.319   -30.380 -16.148 1.00 65.25  ? 279  PHE B N   1 
ATOM   7137  C  CA  . PHE B  1 279 ? 5.854   -30.268 -14.778 1.00 65.72  ? 279  PHE B CA  1 
ATOM   7138  C  C   . PHE B  1 279 ? 4.703   -31.246 -14.614 1.00 66.72  ? 279  PHE B C   1 
ATOM   7139  O  O   . PHE B  1 279 ? 3.616   -31.031 -15.153 1.00 65.47  ? 279  PHE B O   1 
ATOM   7140  C  CB  . PHE B  1 279 ? 5.328   -28.857 -14.498 1.00 66.43  ? 279  PHE B CB  1 
ATOM   7141  C  CG  . PHE B  1 279 ? 6.373   -27.775 -14.577 1.00 66.52  ? 279  PHE B CG  1 
ATOM   7142  C  CD1 . PHE B  1 279 ? 6.400   -26.894 -15.651 1.00 64.19  ? 279  PHE B CD1 1 
ATOM   7143  C  CD2 . PHE B  1 279 ? 7.309   -27.616 -13.564 1.00 66.81  ? 279  PHE B CD2 1 
ATOM   7144  C  CE1 . PHE B  1 279 ? 7.352   -25.884 -15.717 1.00 62.08  ? 279  PHE B CE1 1 
ATOM   7145  C  CE2 . PHE B  1 279 ? 8.264   -26.606 -13.630 1.00 64.21  ? 279  PHE B CE2 1 
ATOM   7146  C  CZ  . PHE B  1 279 ? 8.284   -25.743 -14.709 1.00 61.35  ? 279  PHE B CZ  1 
ATOM   7147  N  N   . GLU B  1 280 ? 4.937   -32.312 -13.854 1.00 68.43  ? 280  GLU B N   1 
ATOM   7148  C  CA  . GLU B  1 280 ? 3.904   -33.308 -13.613 1.00 68.97  ? 280  GLU B CA  1 
ATOM   7149  C  C   . GLU B  1 280 ? 3.731   -33.646 -12.137 1.00 67.76  ? 280  GLU B C   1 
ATOM   7150  O  O   . GLU B  1 280 ? 4.584   -34.295 -11.536 1.00 66.90  ? 280  GLU B O   1 
ATOM   7151  C  CB  . GLU B  1 280 ? 4.237   -34.590 -14.373 1.00 71.80  ? 280  GLU B CB  1 
ATOM   7152  C  CG  . GLU B  1 280 ? 4.294   -34.432 -15.880 1.00 74.84  ? 280  GLU B CG  1 
ATOM   7153  C  CD  . GLU B  1 280 ? 4.760   -35.698 -16.569 1.00 77.89  ? 280  GLU B CD  1 
ATOM   7154  O  OE1 . GLU B  1 280 ? 5.858   -36.188 -16.234 1.00 77.55  ? 280  GLU B OE1 1 
ATOM   7155  O  OE2 . GLU B  1 280 ? 4.026   -36.209 -17.439 1.00 80.62  ? 280  GLU B OE2 1 
ATOM   7156  N  N   . GLU B  1 281 ? 2.590   -33.256 -11.581 1.00 66.98  ? 281  GLU B N   1 
ATOM   7157  C  CA  . GLU B  1 281 ? 2.163   -33.716 -10.266 1.00 67.73  ? 281  GLU B CA  1 
ATOM   7158  C  C   . GLU B  1 281 ? 3.257   -33.676 -9.195  1.00 69.10  ? 281  GLU B C   1 
ATOM   7159  O  O   . GLU B  1 281 ? 3.388   -34.609 -8.399  1.00 69.74  ? 281  GLU B O   1 
ATOM   7160  C  CB  . GLU B  1 281 ? 1.572   -35.127 -10.373 1.00 68.72  ? 281  GLU B CB  1 
ATOM   7161  C  CG  . GLU B  1 281 ? 0.342   -35.226 -11.277 1.00 68.53  ? 281  GLU B CG  1 
ATOM   7162  C  CD  . GLU B  1 281 ? 0.678   -35.616 -12.708 1.00 68.62  ? 281  GLU B CD  1 
ATOM   7163  O  OE1 . GLU B  1 281 ? 1.689   -36.321 -12.920 1.00 66.94  ? 281  GLU B OE1 1 
ATOM   7164  O  OE2 . GLU B  1 281 ? -0.077  -35.219 -13.621 1.00 69.74  ? 281  GLU B OE2 1 
ATOM   7165  N  N   . GLY B  1 282 ? 4.034   -32.597 -9.171  1.00 69.80  ? 282  GLY B N   1 
ATOM   7166  C  CA  . GLY B  1 282 ? 5.065   -32.417 -8.160  1.00 66.94  ? 282  GLY B CA  1 
ATOM   7167  C  C   . GLY B  1 282 ? 6.445   -32.862 -8.610  1.00 63.60  ? 282  GLY B C   1 
ATOM   7168  O  O   . GLY B  1 282 ? 7.413   -32.793 -7.858  1.00 61.36  ? 282  GLY B O   1 
ATOM   7169  N  N   . SER B  1 283 ? 6.533   -33.328 -9.849  1.00 63.63  ? 283  SER B N   1 
ATOM   7170  C  CA  . SER B  1 283 ? 7.803   -33.760 -10.404 1.00 63.80  ? 283  SER B CA  1 
ATOM   7171  C  C   . SER B  1 283 ? 8.143   -32.911 -11.612 1.00 65.28  ? 283  SER B C   1 
ATOM   7172  O  O   . SER B  1 283 ? 7.267   -32.287 -12.209 1.00 66.12  ? 283  SER B O   1 
ATOM   7173  C  CB  . SER B  1 283 ? 7.746   -35.231 -10.816 1.00 63.70  ? 283  SER B CB  1 
ATOM   7174  O  OG  . SER B  1 283 ? 7.417   -36.054 -9.716  1.00 66.98  ? 283  SER B OG  1 
ATOM   7175  N  N   . VAL B  1 284 ? 9.429   -32.864 -11.941 1.00 64.86  ? 284  VAL B N   1 
ATOM   7176  C  CA  . VAL B  1 284 ? 9.876   -32.352 -13.225 1.00 65.85  ? 284  VAL B CA  1 
ATOM   7177  C  C   . VAL B  1 284 ? 10.566  -33.509 -13.943 1.00 66.96  ? 284  VAL B C   1 
ATOM   7178  O  O   . VAL B  1 284 ? 11.605  -34.005 -13.493 1.00 67.00  ? 284  VAL B O   1 
ATOM   7179  C  CB  . VAL B  1 284 ? 10.825  -31.154 -13.061 1.00 65.88  ? 284  VAL B CB  1 
ATOM   7180  C  CG1 . VAL B  1 284 ? 11.233  -30.605 -14.419 1.00 64.15  ? 284  VAL B CG1 1 
ATOM   7181  C  CG2 . VAL B  1 284 ? 10.156  -30.073 -12.230 1.00 66.34  ? 284  VAL B CG2 1 
ATOM   7182  N  N   . ASN B  1 285 ? 9.976   -33.952 -15.047 1.00 67.32  ? 285  ASN B N   1 
ATOM   7183  C  CA  . ASN B  1 285 ? 10.391  -35.203 -15.666 1.00 69.43  ? 285  ASN B CA  1 
ATOM   7184  C  C   . ASN B  1 285 ? 11.022  -35.019 -17.038 1.00 69.59  ? 285  ASN B C   1 
ATOM   7185  O  O   . ASN B  1 285 ? 10.575  -34.185 -17.826 1.00 71.43  ? 285  ASN B O   1 
ATOM   7186  C  CB  . ASN B  1 285 ? 9.201   -36.166 -15.744 1.00 71.18  ? 285  ASN B CB  1 
ATOM   7187  C  CG  . ASN B  1 285 ? 8.705   -36.592 -14.369 1.00 69.63  ? 285  ASN B CG  1 
ATOM   7188  O  OD1 . ASN B  1 285 ? 9.483   -37.053 -13.533 1.00 70.07  ? 285  ASN B OD1 1 
ATOM   7189  N  ND2 . ASN B  1 285 ? 7.408   -36.427 -14.127 1.00 67.11  ? 285  ASN B ND2 1 
ATOM   7190  N  N   . LEU B  1 286 ? 12.059  -35.808 -17.314 1.00 66.86  ? 286  LEU B N   1 
ATOM   7191  C  CA  . LEU B  1 286 ? 12.794  -35.716 -18.573 1.00 65.40  ? 286  LEU B CA  1 
ATOM   7192  C  C   . LEU B  1 286 ? 12.258  -36.680 -19.633 1.00 65.97  ? 286  LEU B C   1 
ATOM   7193  O  O   . LEU B  1 286 ? 12.034  -37.863 -19.368 1.00 64.41  ? 286  LEU B O   1 
ATOM   7194  C  CB  . LEU B  1 286 ? 14.289  -35.966 -18.340 1.00 63.84  ? 286  LEU B CB  1 
ATOM   7195  C  CG  . LEU B  1 286 ? 15.239  -35.789 -19.532 1.00 59.44  ? 286  LEU B CG  1 
ATOM   7196  C  CD1 . LEU B  1 286 ? 15.138  -34.381 -20.092 1.00 57.38  ? 286  LEU B CD1 1 
ATOM   7197  C  CD2 . LEU B  1 286 ? 16.681  -36.118 -19.149 1.00 56.54  ? 286  LEU B CD2 1 
ATOM   7198  N  N   . TYR B  1 287 ? 12.065  -36.156 -20.840 1.00 67.30  ? 287  TYR B N   1 
ATOM   7199  C  CA  . TYR B  1 287 ? 11.510  -36.921 -21.947 1.00 66.98  ? 287  TYR B CA  1 
ATOM   7200  C  C   . TYR B  1 287 ? 12.321  -36.664 -23.196 1.00 67.66  ? 287  TYR B C   1 
ATOM   7201  O  O   . TYR B  1 287 ? 13.063  -35.691 -23.268 1.00 66.12  ? 287  TYR B O   1 
ATOM   7202  C  CB  . TYR B  1 287 ? 10.061  -36.512 -22.206 1.00 66.76  ? 287  TYR B CB  1 
ATOM   7203  C  CG  . TYR B  1 287 ? 9.103   -36.880 -21.098 1.00 67.43  ? 287  TYR B CG  1 
ATOM   7204  C  CD1 . TYR B  1 287 ? 8.754   -35.959 -20.120 1.00 68.09  ? 287  TYR B CD1 1 
ATOM   7205  C  CD2 . TYR B  1 287 ? 8.544   -38.148 -21.033 1.00 67.42  ? 287  TYR B CD2 1 
ATOM   7206  C  CE1 . TYR B  1 287 ? 7.873   -36.293 -19.103 1.00 69.20  ? 287  TYR B CE1 1 
ATOM   7207  C  CE2 . TYR B  1 287 ? 7.666   -38.492 -20.027 1.00 68.77  ? 287  TYR B CE2 1 
ATOM   7208  C  CZ  . TYR B  1 287 ? 7.332   -37.563 -19.064 1.00 70.15  ? 287  TYR B CZ  1 
ATOM   7209  O  OH  . TYR B  1 287 ? 6.457   -37.910 -18.061 1.00 71.05  ? 287  TYR B OH  1 
ATOM   7210  N  N   . LEU B  1 288 ? 12.169  -37.537 -24.184 1.00 72.24  ? 288  LEU B N   1 
ATOM   7211  C  CA  . LEU B  1 288 ? 12.887  -37.410 -25.448 1.00 76.10  ? 288  LEU B CA  1 
ATOM   7212  C  C   . LEU B  1 288 ? 11.917  -37.537 -26.612 1.00 79.80  ? 288  LEU B C   1 
ATOM   7213  O  O   . LEU B  1 288 ? 11.012  -38.364 -26.570 1.00 82.05  ? 288  LEU B O   1 
ATOM   7214  C  CB  . LEU B  1 288 ? 13.957  -38.497 -25.553 1.00 77.30  ? 288  LEU B CB  1 
ATOM   7215  C  CG  . LEU B  1 288 ? 14.204  -39.053 -26.955 1.00 79.26  ? 288  LEU B CG  1 
ATOM   7216  C  CD1 . LEU B  1 288 ? 14.812  -37.991 -27.854 1.00 80.00  ? 288  LEU B CD1 1 
ATOM   7217  C  CD2 . LEU B  1 288 ? 15.106  -40.270 -26.886 1.00 80.00  ? 288  LEU B CD2 1 
ATOM   7218  N  N   . TRP B  1 289 ? 12.086  -36.709 -27.641 1.00 81.23  ? 289  TRP B N   1 
ATOM   7219  C  CA  . TRP B  1 289 ? 11.282  -36.843 -28.854 1.00 82.72  ? 289  TRP B CA  1 
ATOM   7220  C  C   . TRP B  1 289 ? 12.137  -37.212 -30.064 1.00 83.91  ? 289  TRP B C   1 
ATOM   7221  O  O   . TRP B  1 289 ? 12.919  -36.401 -30.549 1.00 84.21  ? 289  TRP B O   1 
ATOM   7222  C  CB  . TRP B  1 289 ? 10.511  -35.546 -29.120 1.00 82.74  ? 289  TRP B CB  1 
ATOM   7223  C  CG  . TRP B  1 289 ? 9.534   -35.603 -30.270 1.00 84.06  ? 289  TRP B CG  1 
ATOM   7224  C  CD1 . TRP B  1 289 ? 8.207   -35.919 -30.205 1.00 84.98  ? 289  TRP B CD1 1 
ATOM   7225  C  CD2 . TRP B  1 289 ? 9.805   -35.306 -31.648 1.00 84.58  ? 289  TRP B CD2 1 
ATOM   7226  N  NE1 . TRP B  1 289 ? 7.639   -35.847 -31.454 1.00 84.84  ? 289  TRP B NE1 1 
ATOM   7227  C  CE2 . TRP B  1 289 ? 8.598   -35.472 -32.358 1.00 85.07  ? 289  TRP B CE2 1 
ATOM   7228  C  CE3 . TRP B  1 289 ? 10.954  -34.920 -32.351 1.00 84.26  ? 289  TRP B CE3 1 
ATOM   7229  C  CZ2 . TRP B  1 289 ? 8.507   -35.267 -33.740 1.00 85.37  ? 289  TRP B CZ2 1 
ATOM   7230  C  CZ3 . TRP B  1 289 ? 10.862  -34.717 -33.725 1.00 83.79  ? 289  TRP B CZ3 1 
ATOM   7231  C  CH2 . TRP B  1 289 ? 9.648   -34.891 -34.402 1.00 84.39  ? 289  TRP B CH2 1 
ATOM   7232  N  N   . ASP B  1 290 ? 11.994  -38.455 -30.520 1.00 86.54  ? 290  ASP B N   1 
ATOM   7233  C  CA  . ASP B  1 290 ? 12.552  -38.942 -31.793 1.00 87.95  ? 290  ASP B CA  1 
ATOM   7234  C  C   . ASP B  1 290 ? 11.545  -38.914 -32.954 1.00 85.62  ? 290  ASP B C   1 
ATOM   7235  O  O   . ASP B  1 290 ? 11.810  -39.442 -34.035 1.00 85.09  ? 290  ASP B O   1 
ATOM   7236  C  CB  . ASP B  1 290 ? 13.238  -40.304 -31.651 1.00 90.42  ? 290  ASP B CB  1 
ATOM   7237  C  CG  . ASP B  1 290 ? 12.384  -41.307 -30.930 1.00 94.15  ? 290  ASP B CG  1 
ATOM   7238  O  OD1 . ASP B  1 290 ? 11.164  -41.355 -31.202 1.00 94.43  ? 290  ASP B OD1 1 
ATOM   7239  O  OD2 . ASP B  1 290 ? 12.935  -42.042 -30.085 1.00 96.29  ? 290  ASP B OD2 1 
ATOM   7240  N  N   . GLY B  1 291 ? 10.389  -38.302 -32.705 1.00 83.32  ? 291  GLY B N   1 
ATOM   7241  C  CA  . GLY B  1 291 ? 9.201   -38.429 -33.534 1.00 81.18  ? 291  GLY B CA  1 
ATOM   7242  C  C   . GLY B  1 291 ? 8.085   -39.160 -32.812 1.00 81.11  ? 291  GLY B C   1 
ATOM   7243  O  O   . GLY B  1 291 ? 6.927   -39.112 -33.226 1.00 82.60  ? 291  GLY B O   1 
ATOM   7244  N  N   . GLU B  1 292 ? 8.430   -39.799 -31.701 1.00 79.87  ? 292  GLU B N   1 
ATOM   7245  C  CA  . GLU B  1 292 ? 7.442   -40.246 -30.726 1.00 77.84  ? 292  GLU B CA  1 
ATOM   7246  C  C   . GLU B  1 292 ? 7.973   -39.855 -29.352 1.00 77.70  ? 292  GLU B C   1 
ATOM   7247  O  O   . GLU B  1 292 ? 9.186   -39.850 -29.132 1.00 76.77  ? 292  GLU B O   1 
ATOM   7248  C  CB  . GLU B  1 292 ? 7.214   -41.758 -30.808 1.00 76.15  ? 292  GLU B CB  1 
ATOM   7249  N  N   . VAL B  1 293 ? 7.080   -39.506 -28.433 1.00 76.78  ? 293  VAL B N   1 
ATOM   7250  C  CA  . VAL B  1 293 ? 7.511   -39.077 -27.107 1.00 73.73  ? 293  VAL B CA  1 
ATOM   7251  C  C   . VAL B  1 293 ? 7.840   -40.265 -26.207 1.00 73.56  ? 293  VAL B C   1 
ATOM   7252  O  O   . VAL B  1 293 ? 7.006   -41.134 -25.970 1.00 72.99  ? 293  VAL B O   1 
ATOM   7253  C  CB  . VAL B  1 293 ? 6.469   -38.169 -26.432 1.00 70.36  ? 293  VAL B CB  1 
ATOM   7254  C  CG1 . VAL B  1 293 ? 6.960   -37.726 -25.070 1.00 67.26  ? 293  VAL B CG1 1 
ATOM   7255  C  CG2 . VAL B  1 293 ? 6.187   -36.963 -27.304 1.00 69.87  ? 293  VAL B CG2 1 
ATOM   7256  N  N   . ARG B  1 294 ? 9.072   -40.297 -25.715 1.00 74.88  ? 294  ARG B N   1 
ATOM   7257  C  CA  . ARG B  1 294 ? 9.524   -41.377 -24.854 1.00 77.23  ? 294  ARG B CA  1 
ATOM   7258  C  C   . ARG B  1 294 ? 10.022  -40.807 -23.537 1.00 77.69  ? 294  ARG B C   1 
ATOM   7259  O  O   . ARG B  1 294 ? 10.587  -39.713 -23.492 1.00 76.54  ? 294  ARG B O   1 
ATOM   7260  C  CB  . ARG B  1 294 ? 10.625  -42.191 -25.536 1.00 80.19  ? 294  ARG B CB  1 
ATOM   7261  C  CG  . ARG B  1 294 ? 10.684  -41.975 -27.036 1.00 83.09  ? 294  ARG B CG  1 
ATOM   7262  C  CD  . ARG B  1 294 ? 11.207  -43.189 -27.776 1.00 85.90  ? 294  ARG B CD  1 
ATOM   7263  N  NE  . ARG B  1 294 ? 10.554  -43.312 -29.077 1.00 89.24  ? 294  ARG B NE  1 
ATOM   7264  C  CZ  . ARG B  1 294 ? 10.139  -44.460 -29.604 1.00 90.35  ? 294  ARG B CZ  1 
ATOM   7265  N  NH1 . ARG B  1 294 ? 10.320  -45.598 -28.946 1.00 90.78  ? 294  ARG B NH1 1 
ATOM   7266  N  NH2 . ARG B  1 294 ? 9.546   -44.472 -30.792 1.00 89.53  ? 294  ARG B NH2 1 
ATOM   7267  N  N   . GLU B  1 295 ? 9.792   -41.560 -22.469 1.00 79.32  ? 295  GLU B N   1 
ATOM   7268  C  CA  . GLU B  1 295 ? 10.161  -41.150 -21.124 1.00 80.01  ? 295  GLU B CA  1 
ATOM   7269  C  C   . GLU B  1 295 ? 11.607  -41.531 -20.831 1.00 77.87  ? 295  GLU B C   1 
ATOM   7270  O  O   . GLU B  1 295 ? 11.996  -42.685 -21.003 1.00 78.88  ? 295  GLU B O   1 
ATOM   7271  C  CB  . GLU B  1 295 ? 9.209   -41.801 -20.115 1.00 82.76  ? 295  GLU B CB  1 
ATOM   7272  C  CG  . GLU B  1 295 ? 9.868   -42.335 -18.854 1.00 85.78  ? 295  GLU B CG  1 
ATOM   7273  C  CD  . GLU B  1 295 ? 8.886   -43.068 -17.953 1.00 89.40  ? 295  GLU B CD  1 
ATOM   7274  O  OE1 . GLU B  1 295 ? 9.332   -43.664 -16.951 1.00 91.21  ? 295  GLU B OE1 1 
ATOM   7275  O  OE2 . GLU B  1 295 ? 7.669   -43.048 -18.245 1.00 89.69  ? 295  GLU B OE2 1 
ATOM   7276  N  N   . ILE B  1 296 ? 12.405  -40.559 -20.403 1.00 73.16  ? 296  ILE B N   1 
ATOM   7277  C  CA  . ILE B  1 296 ? 13.791  -40.829 -20.049 1.00 68.60  ? 296  ILE B CA  1 
ATOM   7278  C  C   . ILE B  1 296 ? 13.919  -40.986 -18.541 1.00 69.41  ? 296  ILE B C   1 
ATOM   7279  O  O   . ILE B  1 296 ? 14.225  -42.071 -18.052 1.00 70.78  ? 296  ILE B O   1 
ATOM   7280  C  CB  . ILE B  1 296 ? 14.735  -39.722 -20.535 1.00 64.21  ? 296  ILE B CB  1 
ATOM   7281  C  CG1 . ILE B  1 296 ? 14.593  -39.516 -22.046 1.00 60.54  ? 296  ILE B CG1 1 
ATOM   7282  C  CG2 . ILE B  1 296 ? 16.169  -40.067 -20.179 1.00 63.65  ? 296  ILE B CG2 1 
ATOM   7283  C  CD1 . ILE B  1 296 ? 15.237  -40.592 -22.870 1.00 59.23  ? 296  ILE B CD1 1 
ATOM   7284  N  N   . ALA B  1 297 ? 13.675  -39.905 -17.804 1.00 69.60  ? 297  ALA B N   1 
ATOM   7285  C  CA  . ALA B  1 297 ? 13.700  -39.966 -16.344 1.00 69.84  ? 297  ALA B CA  1 
ATOM   7286  C  C   . ALA B  1 297 ? 12.386  -39.479 -15.728 1.00 70.93  ? 297  ALA B C   1 
ATOM   7287  O  O   . ALA B  1 297 ? 12.029  -38.299 -15.828 1.00 69.10  ? 297  ALA B O   1 
ATOM   7288  C  CB  . ALA B  1 297 ? 14.877  -39.181 -15.796 1.00 68.56  ? 297  ALA B CB  1 
ATOM   7289  N  N   . LYS B  1 298 ? 11.684  -40.410 -15.086 1.00 72.46  ? 298  LYS B N   1 
ATOM   7290  C  CA  . LYS B  1 298 ? 10.392  -40.150 -14.465 1.00 72.40  ? 298  LYS B CA  1 
ATOM   7291  C  C   . LYS B  1 298 ? 10.414  -40.717 -13.053 1.00 74.51  ? 298  LYS B C   1 
ATOM   7292  O  O   . LYS B  1 298 ? 10.885  -41.832 -12.834 1.00 74.36  ? 298  LYS B O   1 
ATOM   7293  C  CB  . LYS B  1 298 ? 9.280   -40.822 -15.270 1.00 71.90  ? 298  LYS B CB  1 
ATOM   7294  C  CG  . LYS B  1 298 ? 7.889   -40.262 -15.036 1.00 71.42  ? 298  LYS B CG  1 
ATOM   7295  C  CD  . LYS B  1 298 ? 6.823   -41.154 -15.667 1.00 72.33  ? 298  LYS B CD  1 
ATOM   7296  C  CE  . LYS B  1 298 ? 5.498   -40.415 -15.822 1.00 72.46  ? 298  LYS B CE  1 
ATOM   7297  N  N   . GLY B  1 299 ? 9.912   -39.949 -12.095 1.00 77.24  ? 299  GLY B N   1 
ATOM   7298  C  CA  . GLY B  1 299 ? 9.909   -40.371 -10.704 1.00 78.63  ? 299  GLY B CA  1 
ATOM   7299  C  C   . GLY B  1 299 ? 9.533   -39.221 -9.796  1.00 78.10  ? 299  GLY B C   1 
ATOM   7300  O  O   . GLY B  1 299 ? 9.020   -38.207 -10.275 1.00 76.81  ? 299  GLY B O   1 
ATOM   7301  N  N   . LYS B  1 300 ? 9.776   -39.358 -8.494  1.00 79.32  ? 300  LYS B N   1 
ATOM   7302  C  CA  . LYS B  1 300 ? 9.544   -38.223 -7.627  1.00 80.27  ? 300  LYS B CA  1 
ATOM   7303  C  C   . LYS B  1 300 ? 10.869  -37.499 -7.484  1.00 82.12  ? 300  LYS B C   1 
ATOM   7304  O  O   . LYS B  1 300 ? 11.743  -37.896 -6.704  1.00 83.11  ? 300  LYS B O   1 
ATOM   7305  C  CB  . LYS B  1 300 ? 9.073   -38.714 -6.264  1.00 80.80  ? 300  LYS B CB  1 
ATOM   7306  C  CG  . LYS B  1 300 ? 8.147   -39.922 -6.327  1.00 83.31  ? 300  LYS B CG  1 
ATOM   7307  C  CD  . LYS B  1 300 ? 7.090   -39.833 -5.246  1.00 84.75  ? 300  LYS B CD  1 
ATOM   7308  C  CE  . LYS B  1 300 ? 6.550   -41.191 -4.858  1.00 86.73  ? 300  LYS B CE  1 
ATOM   7309  N  NZ  . LYS B  1 300 ? 6.145   -41.179 -3.422  1.00 87.84  ? 300  LYS B NZ  1 
ATOM   7310  N  N   . HIS B  1 301 ? 10.954  -36.365 -8.167  1.00 81.09  ? 301  HIS B N   1 
ATOM   7311  C  CA  . HIS B  1 301 ? 12.211  -35.651 -8.325  1.00 79.45  ? 301  HIS B CA  1 
ATOM   7312  C  C   . HIS B  1 301 ? 12.038  -34.478 -9.286  1.00 77.58  ? 301  HIS B C   1 
ATOM   7313  O  O   . HIS B  1 301 ? 11.024  -34.376 -9.982  1.00 77.02  ? 301  HIS B O   1 
ATOM   7314  C  CB  . HIS B  1 301 ? 13.349  -36.595 -8.773  1.00 79.25  ? 301  HIS B CB  1 
ATOM   7315  C  CG  . HIS B  1 301 ? 13.170  -37.198 -10.137 1.00 81.43  ? 301  HIS B CG  1 
ATOM   7316  N  ND1 . HIS B  1 301 ? 12.361  -36.647 -11.109 1.00 82.87  ? 301  HIS B ND1 1 
ATOM   7317  C  CD2 . HIS B  1 301 ? 13.724  -38.303 -10.697 1.00 81.62  ? 301  HIS B CD2 1 
ATOM   7318  C  CE1 . HIS B  1 301 ? 12.417  -37.388 -12.202 1.00 81.73  ? 301  HIS B CE1 1 
ATOM   7319  N  NE2 . HIS B  1 301 ? 13.238  -38.399 -11.979 1.00 81.13  ? 301  HIS B NE2 1 
ATOM   7320  N  N   . TRP B  1 302 ? 13.026  -33.591 -9.316  1.00 74.82  ? 302  TRP B N   1 
ATOM   7321  C  CA  . TRP B  1 302 ? 13.076  -32.549 -10.332 1.00 71.01  ? 302  TRP B CA  1 
ATOM   7322  C  C   . TRP B  1 302 ? 14.346  -32.681 -11.150 1.00 68.38  ? 302  TRP B C   1 
ATOM   7323  O  O   . TRP B  1 302 ? 15.431  -32.879 -10.598 1.00 66.79  ? 302  TRP B O   1 
ATOM   7324  C  CB  . TRP B  1 302 ? 13.051  -31.163 -9.703  1.00 69.36  ? 302  TRP B CB  1 
ATOM   7325  C  CG  . TRP B  1 302 ? 11.727  -30.729 -9.211  1.00 67.88  ? 302  TRP B CG  1 
ATOM   7326  C  CD1 . TRP B  1 302 ? 10.767  -31.505 -8.642  1.00 68.34  ? 302  TRP B CD1 1 
ATOM   7327  C  CD2 . TRP B  1 302 ? 11.208  -29.399 -9.241  1.00 66.16  ? 302  TRP B CD2 1 
ATOM   7328  N  NE1 . TRP B  1 302 ? 9.675   -30.738 -8.311  1.00 67.64  ? 302  TRP B NE1 1 
ATOM   7329  C  CE2 . TRP B  1 302 ? 9.924   -29.439 -8.670  1.00 66.95  ? 302  TRP B CE2 1 
ATOM   7330  C  CE3 . TRP B  1 302 ? 11.706  -28.176 -9.696  1.00 65.04  ? 302  TRP B CE3 1 
ATOM   7331  C  CZ2 . TRP B  1 302 ? 9.131   -28.303 -8.541  1.00 66.54  ? 302  TRP B CZ2 1 
ATOM   7332  C  CZ3 . TRP B  1 302 ? 10.918  -27.050 -9.567  1.00 64.46  ? 302  TRP B CZ3 1 
ATOM   7333  C  CH2 . TRP B  1 302 ? 9.647   -27.120 -8.995  1.00 64.88  ? 302  TRP B CH2 1 
ATOM   7334  N  N   . ILE B  1 303 ? 14.210  -32.566 -12.466 1.00 67.43  ? 303  ILE B N   1 
ATOM   7335  C  CA  . ILE B  1 303 ? 15.374  -32.510 -13.331 1.00 65.96  ? 303  ILE B CA  1 
ATOM   7336  C  C   . ILE B  1 303 ? 15.679  -31.033 -13.527 1.00 65.24  ? 303  ILE B C   1 
ATOM   7337  O  O   . ILE B  1 303 ? 14.920  -30.318 -14.186 1.00 65.16  ? 303  ILE B O   1 
ATOM   7338  C  CB  . ILE B  1 303 ? 15.087  -33.182 -14.683 1.00 63.76  ? 303  ILE B CB  1 
ATOM   7339  C  CG1 . ILE B  1 303 ? 14.745  -34.655 -14.468 1.00 63.22  ? 303  ILE B CG1 1 
ATOM   7340  C  CG2 . ILE B  1 303 ? 16.270  -33.051 -15.611 1.00 63.18  ? 303  ILE B CG2 1 
ATOM   7341  C  CD1 . ILE B  1 303 ? 15.778  -35.397 -13.661 1.00 62.22  ? 303  ILE B CD1 1 
ATOM   7342  N  N   . MET B  1 304 ? 16.788  -30.580 -12.952 1.00 64.64  ? 304  MET B N   1 
ATOM   7343  C  CA  . MET B  1 304 ? 17.087  -29.151 -12.876 1.00 65.03  ? 304  MET B CA  1 
ATOM   7344  C  C   . MET B  1 304 ? 17.819  -28.624 -14.107 1.00 65.20  ? 304  MET B C   1 
ATOM   7345  O  O   . MET B  1 304 ? 17.910  -27.418 -14.320 1.00 65.88  ? 304  MET B O   1 
ATOM   7346  C  CB  . MET B  1 304 ? 17.874  -28.839 -11.607 1.00 64.86  ? 304  MET B CB  1 
ATOM   7347  C  CG  . MET B  1 304 ? 17.154  -29.223 -10.312 1.00 64.63  ? 304  MET B CG  1 
ATOM   7348  S  SD  . MET B  1 304 ? 15.697  -28.221 -9.956  1.00 68.36  ? 304  MET B SD  1 
ATOM   7349  C  CE  . MET B  1 304 ? 16.411  -26.581 -9.901  1.00 90.90  ? 304  MET B CE  1 
ATOM   7350  N  N   . GLY B  1 305 ? 18.328  -29.540 -14.922 1.00 65.57  ? 305  GLY B N   1 
ATOM   7351  C  CA  . GLY B  1 305 ? 18.993  -29.189 -16.163 1.00 63.73  ? 305  GLY B CA  1 
ATOM   7352  C  C   . GLY B  1 305 ? 19.573  -30.432 -16.802 1.00 60.84  ? 305  GLY B C   1 
ATOM   7353  O  O   . GLY B  1 305 ? 19.746  -31.451 -16.135 1.00 59.22  ? 305  GLY B O   1 
ATOM   7354  N  N   . PHE B  1 306 ? 19.874  -30.342 -18.094 1.00 60.14  ? 306  PHE B N   1 
ATOM   7355  C  CA  . PHE B  1 306 ? 20.352  -31.482 -18.869 1.00 58.84  ? 306  PHE B CA  1 
ATOM   7356  C  C   . PHE B  1 306 ? 21.086  -30.988 -20.112 1.00 61.87  ? 306  PHE B C   1 
ATOM   7357  O  O   . PHE B  1 306 ? 20.935  -29.832 -20.504 1.00 62.32  ? 306  PHE B O   1 
ATOM   7358  C  CB  . PHE B  1 306 ? 19.169  -32.358 -19.284 1.00 55.16  ? 306  PHE B CB  1 
ATOM   7359  C  CG  . PHE B  1 306 ? 18.105  -31.608 -20.043 1.00 55.09  ? 306  PHE B CG  1 
ATOM   7360  C  CD1 . PHE B  1 306 ? 17.035  -31.029 -19.378 1.00 55.04  ? 306  PHE B CD1 1 
ATOM   7361  C  CD2 . PHE B  1 306 ? 18.188  -31.465 -21.423 1.00 56.47  ? 306  PHE B CD2 1 
ATOM   7362  C  CE1 . PHE B  1 306 ? 16.060  -30.333 -20.078 1.00 56.84  ? 306  PHE B CE1 1 
ATOM   7363  C  CE2 . PHE B  1 306 ? 17.220  -30.770 -22.131 1.00 57.03  ? 306  PHE B CE2 1 
ATOM   7364  C  CZ  . PHE B  1 306 ? 16.153  -30.204 -21.459 1.00 58.11  ? 306  PHE B CZ  1 
ATOM   7365  N  N   . ASP B  1 307 ? 21.893  -31.856 -20.715 1.00 64.10  ? 307  ASP B N   1 
ATOM   7366  C  CA  . ASP B  1 307 ? 22.486  -31.594 -22.026 1.00 64.83  ? 307  ASP B CA  1 
ATOM   7367  C  C   . ASP B  1 307 ? 22.731  -32.939 -22.695 1.00 68.38  ? 307  ASP B C   1 
ATOM   7368  O  O   . ASP B  1 307 ? 22.944  -33.953 -22.018 1.00 65.85  ? 307  ASP B O   1 
ATOM   7369  C  CB  . ASP B  1 307 ? 23.795  -30.797 -21.903 1.00 63.59  ? 307  ASP B CB  1 
ATOM   7370  C  CG  . ASP B  1 307 ? 24.254  -30.193 -23.231 1.00 63.05  ? 307  ASP B CG  1 
ATOM   7371  O  OD1 . ASP B  1 307 ? 23.437  -30.098 -24.169 1.00 64.58  ? 307  ASP B OD1 1 
ATOM   7372  O  OD2 . ASP B  1 307 ? 25.436  -29.800 -23.332 1.00 61.75  ? 307  ASP B OD2 1 
ATOM   7373  N  N   . ALA B  1 308 ? 22.678  -32.954 -24.022 1.00 72.79  ? 308  ALA B N   1 
ATOM   7374  C  CA  . ALA B  1 308 ? 22.974  -34.165 -24.771 1.00 75.80  ? 308  ALA B CA  1 
ATOM   7375  C  C   . ALA B  1 308 ? 23.740  -33.821 -26.035 1.00 80.64  ? 308  ALA B C   1 
ATOM   7376  O  O   . ALA B  1 308 ? 23.370  -32.887 -26.739 1.00 81.09  ? 308  ALA B O   1 
ATOM   7377  C  CB  . ALA B  1 308 ? 21.692  -34.890 -25.120 1.00 74.86  ? 308  ALA B CB  1 
ATOM   7378  N  N   . ASP B  1 309 ? 24.836  -34.526 -26.303 1.00 84.73  ? 309  ASP B N   1 
ATOM   7379  C  CA  . ASP B  1 309 ? 25.410  -34.494 -27.646 1.00 86.41  ? 309  ASP B CA  1 
ATOM   7380  C  C   . ASP B  1 309 ? 25.555  -35.899 -28.225 1.00 87.05  ? 309  ASP B C   1 
ATOM   7381  O  O   . ASP B  1 309 ? 24.749  -36.324 -29.053 1.00 86.45  ? 309  ASP B O   1 
ATOM   7382  C  CB  . ASP B  1 309 ? 26.765  -33.794 -27.630 1.00 86.49  ? 309  ASP B CB  1 
ATOM   7383  C  CG  . ASP B  1 309 ? 27.331  -33.604 -29.014 1.00 88.50  ? 309  ASP B CG  1 
ATOM   7384  O  OD1 . ASP B  1 309 ? 26.551  -33.272 -29.934 1.00 88.77  ? 309  ASP B OD1 1 
ATOM   7385  O  OD2 . ASP B  1 309 ? 28.554  -33.796 -29.180 1.00 89.76  ? 309  ASP B OD2 1 
ATOM   7386  N  N   . GLU B  1 310 ? 26.584  -36.618 -27.783 1.00 87.56  ? 310  GLU B N   1 
ATOM   7387  C  CA  . GLU B  1 310 ? 26.664  -38.054 -28.015 1.00 88.21  ? 310  GLU B CA  1 
ATOM   7388  C  C   . GLU B  1 310 ? 26.117  -38.808 -26.811 1.00 87.53  ? 310  GLU B C   1 
ATOM   7389  O  O   . GLU B  1 310 ? 25.865  -40.009 -26.873 1.00 87.46  ? 310  GLU B O   1 
ATOM   7390  C  CB  . GLU B  1 310 ? 28.106  -38.476 -28.313 1.00 89.02  ? 310  GLU B CB  1 
ATOM   7391  C  CG  . GLU B  1 310 ? 28.593  -38.051 -29.695 1.00 91.41  ? 310  GLU B CG  1 
ATOM   7392  C  CD  . GLU B  1 310 ? 30.028  -38.465 -29.973 1.00 94.37  ? 310  GLU B CD  1 
ATOM   7393  O  OE1 . GLU B  1 310 ? 30.600  -39.237 -29.174 1.00 96.08  ? 310  GLU B OE1 1 
ATOM   7394  O  OE2 . GLU B  1 310 ? 30.588  -38.013 -30.995 1.00 94.50  ? 310  GLU B OE2 1 
ATOM   7395  N  N   . ARG B  1 311 ? 25.901  -38.073 -25.727 1.00 87.17  ? 311  ARG B N   1 
ATOM   7396  C  CA  . ARG B  1 311 ? 25.505  -38.655 -24.455 1.00 86.68  ? 311  ARG B CA  1 
ATOM   7397  C  C   . ARG B  1 311 ? 24.453  -37.748 -23.863 1.00 85.65  ? 311  ARG B C   1 
ATOM   7398  O  O   . ARG B  1 311 ? 24.323  -36.598 -24.277 1.00 86.40  ? 311  ARG B O   1 
ATOM   7399  C  CB  . ARG B  1 311 ? 26.694  -38.720 -23.495 1.00 86.82  ? 311  ARG B CB  1 
ATOM   7400  C  CG  . ARG B  1 311 ? 27.968  -39.265 -24.100 1.00 88.52  ? 311  ARG B CG  1 
ATOM   7401  C  CD  . ARG B  1 311 ? 27.822  -40.731 -24.470 1.00 92.47  ? 311  ARG B CD  1 
ATOM   7402  N  NE  . ARG B  1 311 ? 27.852  -41.613 -23.305 1.00 94.53  ? 311  ARG B NE  1 
ATOM   7403  C  CZ  . ARG B  1 311 ? 28.970  -42.083 -22.757 1.00 94.55  ? 311  ARG B CZ  1 
ATOM   7404  N  NH1 . ARG B  1 311 ? 30.151  -41.744 -23.262 1.00 94.32  ? 311  ARG B NH1 1 
ATOM   7405  N  NH2 . ARG B  1 311 ? 28.910  -42.885 -21.702 1.00 93.97  ? 311  ARG B NH2 1 
ATOM   7406  N  N   . LEU B  1 312 ? 23.706  -38.253 -22.892 1.00 83.15  ? 312  LEU B N   1 
ATOM   7407  C  CA  . LEU B  1 312 ? 22.686  -37.443 -22.253 1.00 82.53  ? 312  LEU B CA  1 
ATOM   7408  C  C   . LEU B  1 312 ? 22.961  -37.364 -20.764 1.00 84.15  ? 312  LEU B C   1 
ATOM   7409  O  O   . LEU B  1 312 ? 22.940  -38.380 -20.070 1.00 87.02  ? 312  LEU B O   1 
ATOM   7410  C  CB  . LEU B  1 312 ? 21.305  -38.042 -22.500 1.00 82.45  ? 312  LEU B CB  1 
ATOM   7411  C  CG  . LEU B  1 312 ? 20.129  -37.327 -21.837 1.00 82.84  ? 312  LEU B CG  1 
ATOM   7412  C  CD1 . LEU B  1 312 ? 20.020  -35.901 -22.340 1.00 81.77  ? 312  LEU B CD1 1 
ATOM   7413  C  CD2 . LEU B  1 312 ? 18.834  -38.086 -22.088 1.00 83.91  ? 312  LEU B CD2 1 
ATOM   7414  N  N   . ILE B  1 313 ? 23.225  -36.160 -20.270 1.00 80.78  ? 313  ILE B N   1 
ATOM   7415  C  CA  . ILE B  1 313 ? 23.477  -35.985 -18.847 1.00 78.66  ? 313  ILE B CA  1 
ATOM   7416  C  C   . ILE B  1 313 ? 22.560  -34.931 -18.233 1.00 75.11  ? 313  ILE B C   1 
ATOM   7417  O  O   . ILE B  1 313 ? 22.207  -33.946 -18.881 1.00 76.73  ? 313  ILE B O   1 
ATOM   7418  C  CB  . ILE B  1 313 ? 24.950  -35.648 -18.575 1.00 80.17  ? 313  ILE B CB  1 
ATOM   7419  C  CG1 . ILE B  1 313 ? 25.366  -34.390 -19.339 1.00 80.81  ? 313  ILE B CG1 1 
ATOM   7420  C  CG2 . ILE B  1 313 ? 25.833  -36.817 -18.964 1.00 80.63  ? 313  ILE B CG2 1 
ATOM   7421  C  CD1 . ILE B  1 313 ? 25.514  -33.168 -18.460 1.00 80.38  ? 313  ILE B CD1 1 
ATOM   7422  N  N   . TYR B  1 314 ? 22.164  -35.146 -16.986 1.00 68.99  ? 314  TYR B N   1 
ATOM   7423  C  CA  . TYR B  1 314 ? 21.222  -34.242 -16.350 1.00 65.90  ? 314  TYR B CA  1 
ATOM   7424  C  C   . TYR B  1 314 ? 21.386  -34.190 -14.838 1.00 67.08  ? 314  TYR B C   1 
ATOM   7425  O  O   . TYR B  1 314 ? 21.832  -35.150 -14.206 1.00 69.86  ? 314  TYR B O   1 
ATOM   7426  C  CB  . TYR B  1 314 ? 19.793  -34.653 -16.696 1.00 63.90  ? 314  TYR B CB  1 
ATOM   7427  C  CG  . TYR B  1 314 ? 19.492  -36.101 -16.396 1.00 64.90  ? 314  TYR B CG  1 
ATOM   7428  C  CD1 . TYR B  1 314 ? 19.633  -37.077 -17.375 1.00 65.42  ? 314  TYR B CD1 1 
ATOM   7429  C  CD2 . TYR B  1 314 ? 19.073  -36.496 -15.134 1.00 66.28  ? 314  TYR B CD2 1 
ATOM   7430  C  CE1 . TYR B  1 314 ? 19.361  -38.400 -17.109 1.00 65.30  ? 314  TYR B CE1 1 
ATOM   7431  C  CE2 . TYR B  1 314 ? 18.797  -37.825 -14.858 1.00 67.57  ? 314  TYR B CE2 1 
ATOM   7432  C  CZ  . TYR B  1 314 ? 18.944  -38.770 -15.852 1.00 66.36  ? 314  TYR B CZ  1 
ATOM   7433  O  OH  . TYR B  1 314 ? 18.673  -40.089 -15.587 1.00 67.25  ? 314  TYR B OH  1 
ATOM   7434  N  N   . LEU B  1 315 ? 21.008  -33.061 -14.255 1.00 63.67  ? 315  LEU B N   1 
ATOM   7435  C  CA  . LEU B  1 315 ? 21.029  -32.941 -12.812 1.00 62.73  ? 315  LEU B CA  1 
ATOM   7436  C  C   . LEU B  1 315 ? 19.682  -33.353 -12.228 1.00 62.15  ? 315  LEU B C   1 
ATOM   7437  O  O   . LEU B  1 315 ? 18.628  -32.858 -12.635 1.00 60.42  ? 315  LEU B O   1 
ATOM   7438  C  CB  . LEU B  1 315 ? 21.415  -31.522 -12.391 1.00 60.81  ? 315  LEU B CB  1 
ATOM   7439  C  CG  . LEU B  1 315 ? 22.838  -31.120 -12.783 1.00 58.54  ? 315  LEU B CG  1 
ATOM   7440  C  CD1 . LEU B  1 315 ? 23.037  -29.629 -12.610 1.00 56.88  ? 315  LEU B CD1 1 
ATOM   7441  C  CD2 . LEU B  1 315 ? 23.867  -31.899 -11.978 1.00 58.87  ? 315  LEU B CD2 1 
ATOM   7442  N  N   . LYS B  1 316 ? 19.727  -34.284 -11.284 1.00 63.00  ? 316  LYS B N   1 
ATOM   7443  C  CA  . LYS B  1 316 ? 18.524  -34.742 -10.618 1.00 65.17  ? 316  LYS B CA  1 
ATOM   7444  C  C   . LYS B  1 316 ? 18.554  -34.384 -9.135  1.00 69.07  ? 316  LYS B C   1 
ATOM   7445  O  O   . LYS B  1 316 ? 19.496  -34.726 -8.417  1.00 71.26  ? 316  LYS B O   1 
ATOM   7446  C  CB  . LYS B  1 316 ? 18.358  -36.247 -10.783 1.00 63.77  ? 316  LYS B CB  1 
ATOM   7447  C  CG  . LYS B  1 316 ? 17.024  -36.736 -10.287 1.00 64.51  ? 316  LYS B CG  1 
ATOM   7448  C  CD  . LYS B  1 316 ? 17.153  -38.032 -9.527  1.00 65.40  ? 316  LYS B CD  1 
ATOM   7449  C  CE  . LYS B  1 316 ? 17.416  -39.197 -10.451 1.00 65.18  ? 316  LYS B CE  1 
ATOM   7450  N  NZ  . LYS B  1 316 ? 17.462  -40.452 -9.661  1.00 65.86  ? 316  LYS B NZ  1 
ATOM   7451  N  N   . GLU B  1 317 ? 17.515  -33.692 -8.688  1.00 68.92  ? 317  GLU B N   1 
ATOM   7452  C  CA  . GLU B  1 317 ? 17.395  -33.281 -7.299  1.00 68.26  ? 317  GLU B CA  1 
ATOM   7453  C  C   . GLU B  1 317 ? 16.144  -33.933 -6.700  1.00 70.51  ? 317  GLU B C   1 
ATOM   7454  O  O   . GLU B  1 317 ? 15.157  -34.148 -7.407  1.00 72.27  ? 317  GLU B O   1 
ATOM   7455  C  CB  . GLU B  1 317 ? 17.308  -31.755 -7.236  1.00 66.15  ? 317  GLU B CB  1 
ATOM   7456  C  CG  . GLU B  1 317 ? 16.888  -31.177 -5.898  1.00 67.69  ? 317  GLU B CG  1 
ATOM   7457  C  CD  . GLU B  1 317 ? 16.650  -29.676 -5.969  1.00 69.55  ? 317  GLU B CD  1 
ATOM   7458  O  OE1 . GLU B  1 317 ? 15.875  -29.151 -5.142  1.00 68.22  ? 317  GLU B OE1 1 
ATOM   7459  O  OE2 . GLU B  1 317 ? 17.242  -29.019 -6.853  1.00 71.30  ? 317  GLU B OE2 1 
ATOM   7460  N  N   . THR B  1 318 ? 16.187  -34.266 -5.411  1.00 68.29  ? 318  THR B N   1 
ATOM   7461  C  CA  . THR B  1 318 ? 15.034  -34.870 -4.742  1.00 67.20  ? 318  THR B CA  1 
ATOM   7462  C  C   . THR B  1 318 ? 14.590  -34.060 -3.528  1.00 69.69  ? 318  THR B C   1 
ATOM   7463  O  O   . THR B  1 318 ? 15.133  -32.992 -3.249  1.00 71.28  ? 318  THR B O   1 
ATOM   7464  C  CB  . THR B  1 318 ? 15.314  -36.314 -4.286  1.00 65.06  ? 318  THR B CB  1 
ATOM   7465  O  OG1 . THR B  1 318 ? 16.233  -36.307 -3.187  1.00 62.44  ? 318  THR B OG1 1 
ATOM   7466  C  CG2 . THR B  1 318 ? 15.884  -37.139 -5.428  1.00 66.08  ? 318  THR B CG2 1 
ATOM   7467  N  N   . ALA B  1 319 ? 13.592  -34.565 -2.811  1.00 69.84  ? 319  ALA B N   1 
ATOM   7468  C  CA  . ALA B  1 319 ? 13.108  -33.877 -1.624  1.00 70.95  ? 319  ALA B CA  1 
ATOM   7469  C  C   . ALA B  1 319 ? 14.141  -33.959 -0.517  1.00 73.20  ? 319  ALA B C   1 
ATOM   7470  O  O   . ALA B  1 319 ? 14.268  -33.041 0.289   1.00 74.24  ? 319  ALA B O   1 
ATOM   7471  C  CB  . ALA B  1 319 ? 11.790  -34.466 -1.158  1.00 71.28  ? 319  ALA B CB  1 
ATOM   7472  N  N   . THR B  1 320 ? 14.843  -35.086 -0.452  1.00 75.20  ? 320  THR B N   1 
ATOM   7473  C  CA  . THR B  1 320 ? 15.880  -35.276 0.559   1.00 77.06  ? 320  THR B CA  1 
ATOM   7474  C  C   . THR B  1 320 ? 17.324  -35.021 0.113   1.00 79.55  ? 320  THR B C   1 
ATOM   7475  O  O   . THR B  1 320 ? 18.241  -35.098 0.931   1.00 80.41  ? 320  THR B O   1 
ATOM   7476  C  CB  . THR B  1 320 ? 15.793  -36.679 1.175   1.00 76.19  ? 320  THR B CB  1 
ATOM   7477  O  OG1 . THR B  1 320 ? 15.944  -37.661 0.145   1.00 75.81  ? 320  THR B OG1 1 
ATOM   7478  C  CG2 . THR B  1 320 ? 14.449  -36.864 1.847   1.00 77.14  ? 320  THR B CG2 1 
ATOM   7479  N  N   . ARG B  1 321 ? 17.539  -34.730 -1.166  1.00 81.48  ? 321  ARG B N   1 
ATOM   7480  C  CA  . ARG B  1 321 ? 18.903  -34.507 -1.651  1.00 82.25  ? 321  ARG B CA  1 
ATOM   7481  C  C   . ARG B  1 321 ? 19.037  -33.362 -2.648  1.00 79.76  ? 321  ARG B C   1 
ATOM   7482  O  O   . ARG B  1 321 ? 18.179  -33.175 -3.511  1.00 80.71  ? 321  ARG B O   1 
ATOM   7483  C  CB  . ARG B  1 321 ? 19.469  -35.787 -2.271  1.00 85.05  ? 321  ARG B CB  1 
ATOM   7484  C  CG  . ARG B  1 321 ? 19.732  -36.899 -1.274  1.00 89.31  ? 321  ARG B CG  1 
ATOM   7485  C  CD  . ARG B  1 321 ? 20.948  -36.602 -0.418  1.00 93.48  ? 321  ARG B CD  1 
ATOM   7486  N  NE  . ARG B  1 321 ? 22.167  -36.526 -1.217  1.00 98.49  ? 321  ARG B NE  1 
ATOM   7487  C  CZ  . ARG B  1 321 ? 22.870  -37.586 -1.609  1.00 102.18 ? 321  ARG B CZ  1 
ATOM   7488  N  NH1 . ARG B  1 321 ? 23.968  -37.424 -2.334  1.00 102.40 ? 321  ARG B NH1 1 
ATOM   7489  N  NH2 . ARG B  1 321 ? 22.474  -38.810 -1.278  1.00 103.66 ? 321  ARG B NH2 1 
ATOM   7490  N  N   . PRO B  1 322 ? 20.135  -32.605 -2.538  1.00 76.50  ? 322  PRO B N   1 
ATOM   7491  C  CA  . PRO B  1 322 ? 20.507  -31.598 -3.530  1.00 75.29  ? 322  PRO B CA  1 
ATOM   7492  C  C   . PRO B  1 322 ? 20.971  -32.269 -4.808  1.00 74.31  ? 322  PRO B C   1 
ATOM   7493  O  O   . PRO B  1 322 ? 21.544  -33.358 -4.764  1.00 74.85  ? 322  PRO B O   1 
ATOM   7494  C  CB  . PRO B  1 322 ? 21.686  -30.875 -2.871  1.00 75.45  ? 322  PRO B CB  1 
ATOM   7495  C  CG  . PRO B  1 322 ? 21.544  -31.140 -1.432  1.00 76.06  ? 322  PRO B CG  1 
ATOM   7496  C  CD  . PRO B  1 322 ? 20.970  -32.517 -1.333  1.00 76.90  ? 322  PRO B CD  1 
ATOM   7497  N  N   . ALA B  1 323 ? 20.767  -31.584 -5.926  1.00 73.12  ? 323  ALA B N   1 
ATOM   7498  C  CA  . ALA B  1 323 ? 21.006  -32.149 -7.247  1.00 71.72  ? 323  ALA B CA  1 
ATOM   7499  C  C   . ALA B  1 323 ? 22.386  -32.783 -7.393  1.00 68.39  ? 323  ALA B C   1 
ATOM   7500  O  O   . ALA B  1 323 ? 23.389  -32.241 -6.933  1.00 67.33  ? 323  ALA B O   1 
ATOM   7501  C  CB  . ALA B  1 323 ? 20.811  -31.075 -8.311  1.00 72.19  ? 323  ALA B CB  1 
ATOM   7502  N  N   . GLU B  1 324 ? 22.407  -33.948 -8.033  1.00 67.30  ? 324  GLU B N   1 
ATOM   7503  C  CA  . GLU B  1 324 ? 23.634  -34.643 -8.388  1.00 66.21  ? 324  GLU B CA  1 
ATOM   7504  C  C   . GLU B  1 324 ? 23.546  -34.933 -9.875  1.00 65.93  ? 324  GLU B C   1 
ATOM   7505  O  O   . GLU B  1 324 ? 22.469  -34.847 -10.464 1.00 64.38  ? 324  GLU B O   1 
ATOM   7506  C  CB  . GLU B  1 324 ? 23.771  -35.954 -7.611  1.00 66.12  ? 324  GLU B CB  1 
ATOM   7507  C  CG  . GLU B  1 324 ? 23.860  -35.800 -6.097  1.00 65.68  ? 324  GLU B CG  1 
ATOM   7508  C  CD  . GLU B  1 324 ? 25.257  -35.440 -5.624  1.00 66.64  ? 324  GLU B CD  1 
ATOM   7509  O  OE1 . GLU B  1 324 ? 25.427  -35.173 -4.414  1.00 67.70  ? 324  GLU B OE1 1 
ATOM   7510  O  OE2 . GLU B  1 324 ? 26.186  -35.429 -6.459  1.00 65.66  ? 324  GLU B OE2 1 
ATOM   7511  N  N   . LEU B  1 325 ? 24.674  -35.272 -10.485 1.00 67.03  ? 325  LEU B N   1 
ATOM   7512  C  CA  . LEU B  1 325 ? 24.713  -35.474 -11.925 1.00 69.64  ? 325  LEU B CA  1 
ATOM   7513  C  C   . LEU B  1 325 ? 24.426  -36.922 -12.295 1.00 71.19  ? 325  LEU B C   1 
ATOM   7514  O  O   . LEU B  1 325 ? 24.935  -37.849 -11.665 1.00 71.73  ? 325  LEU B O   1 
ATOM   7515  C  CB  . LEU B  1 325 ? 26.072  -35.052 -12.488 1.00 70.16  ? 325  LEU B CB  1 
ATOM   7516  C  CG  . LEU B  1 325 ? 26.223  -35.026 -14.011 1.00 69.58  ? 325  LEU B CG  1 
ATOM   7517  C  CD1 . LEU B  1 325 ? 25.169  -34.132 -14.651 1.00 69.60  ? 325  LEU B CD1 1 
ATOM   7518  C  CD2 . LEU B  1 325 ? 27.614  -34.555 -14.378 1.00 68.91  ? 325  LEU B CD2 1 
ATOM   7519  N  N   . TYR B  1 326 ? 23.610  -37.111 -13.325 1.00 71.43  ? 326  TYR B N   1 
ATOM   7520  C  CA  . TYR B  1 326 ? 23.312  -38.448 -13.811 1.00 72.59  ? 326  TYR B CA  1 
ATOM   7521  C  C   . TYR B  1 326 ? 23.578  -38.572 -15.311 1.00 72.97  ? 326  TYR B C   1 
ATOM   7522  O  O   . TYR B  1 326 ? 23.550  -37.587 -16.048 1.00 69.76  ? 326  TYR B O   1 
ATOM   7523  C  CB  . TYR B  1 326 ? 21.866  -38.831 -13.474 1.00 72.42  ? 326  TYR B CB  1 
ATOM   7524  C  CG  . TYR B  1 326 ? 21.582  -38.886 -11.987 1.00 73.52  ? 326  TYR B CG  1 
ATOM   7525  C  CD1 . TYR B  1 326 ? 21.429  -37.722 -11.247 1.00 73.76  ? 326  TYR B CD1 1 
ATOM   7526  C  CD2 . TYR B  1 326 ? 21.466  -40.103 -11.322 1.00 74.03  ? 326  TYR B CD2 1 
ATOM   7527  C  CE1 . TYR B  1 326 ? 21.170  -37.766 -9.881  1.00 73.08  ? 326  TYR B CE1 1 
ATOM   7528  C  CE2 . TYR B  1 326 ? 21.205  -40.157 -9.957  1.00 72.37  ? 326  TYR B CE2 1 
ATOM   7529  C  CZ  . TYR B  1 326 ? 21.059  -38.985 -9.244  1.00 71.62  ? 326  TYR B CZ  1 
ATOM   7530  O  OH  . TYR B  1 326 ? 20.803  -39.023 -7.893  1.00 69.81  ? 326  TYR B OH  1 
ATOM   7531  N  N   . LEU B  1 327 ? 23.844  -39.798 -15.745 1.00 77.24  ? 327  LEU B N   1 
ATOM   7532  C  CA  . LEU B  1 327 ? 24.054  -40.108 -17.150 1.00 82.49  ? 327  LEU B CA  1 
ATOM   7533  C  C   . LEU B  1 327 ? 23.061  -41.180 -17.592 1.00 88.71  ? 327  LEU B C   1 
ATOM   7534  O  O   . LEU B  1 327 ? 22.848  -42.157 -16.875 1.00 89.66  ? 327  LEU B O   1 
ATOM   7535  C  CB  . LEU B  1 327 ? 25.476  -40.616 -17.358 1.00 82.24  ? 327  LEU B CB  1 
ATOM   7536  C  CG  . LEU B  1 327 ? 25.744  -41.274 -18.709 1.00 82.77  ? 327  LEU B CG  1 
ATOM   7537  C  CD1 . LEU B  1 327 ? 25.593  -40.261 -19.830 1.00 83.22  ? 327  LEU B CD1 1 
ATOM   7538  C  CD2 . LEU B  1 327 ? 27.124  -41.901 -18.730 1.00 83.05  ? 327  LEU B CD2 1 
ATOM   7539  N  N   . TRP B  1 328 ? 22.453  -41.003 -18.763 1.00 93.91  ? 328  TRP B N   1 
ATOM   7540  C  CA  . TRP B  1 328 ? 21.509  -41.996 -19.276 1.00 99.65  ? 328  TRP B CA  1 
ATOM   7541  C  C   . TRP B  1 328 ? 22.013  -42.693 -20.542 1.00 101.79 ? 328  TRP B C   1 
ATOM   7542  O  O   . TRP B  1 328 ? 22.080  -42.089 -21.612 1.00 101.41 ? 328  TRP B O   1 
ATOM   7543  C  CB  . TRP B  1 328 ? 20.144  -41.352 -19.537 1.00 102.71 ? 328  TRP B CB  1 
ATOM   7544  C  CG  . TRP B  1 328 ? 19.035  -42.340 -19.766 1.00 106.19 ? 328  TRP B CG  1 
ATOM   7545  C  CD1 . TRP B  1 328 ? 18.317  -43.003 -18.813 1.00 107.24 ? 328  TRP B CD1 1 
ATOM   7546  C  CD2 . TRP B  1 328 ? 18.511  -42.768 -21.031 1.00 108.12 ? 328  TRP B CD2 1 
ATOM   7547  N  NE1 . TRP B  1 328 ? 17.383  -43.820 -19.405 1.00 108.16 ? 328  TRP B NE1 1 
ATOM   7548  C  CE2 . TRP B  1 328 ? 17.481  -43.693 -20.766 1.00 108.61 ? 328  TRP B CE2 1 
ATOM   7549  C  CE3 . TRP B  1 328 ? 18.814  -42.459 -22.361 1.00 109.48 ? 328  TRP B CE3 1 
ATOM   7550  C  CZ2 . TRP B  1 328 ? 16.754  -44.312 -21.782 1.00 109.78 ? 328  TRP B CZ2 1 
ATOM   7551  C  CZ3 . TRP B  1 328 ? 18.090  -43.076 -23.368 1.00 110.44 ? 328  TRP B CZ3 1 
ATOM   7552  C  CH2 . TRP B  1 328 ? 17.073  -43.992 -23.073 1.00 110.48 ? 328  TRP B CH2 1 
ATOM   7553  N  N   . ASP B  1 329 ? 22.371  -43.967 -20.395 1.00 104.77 ? 329  ASP B N   1 
ATOM   7554  C  CA  . ASP B  1 329 ? 22.775  -44.834 -21.508 1.00 107.08 ? 329  ASP B CA  1 
ATOM   7555  C  C   . ASP B  1 329 ? 21.643  -45.722 -22.046 1.00 108.14 ? 329  ASP B C   1 
ATOM   7556  O  O   . ASP B  1 329 ? 21.873  -46.578 -22.899 1.00 109.79 ? 329  ASP B O   1 
ATOM   7557  C  CB  . ASP B  1 329 ? 24.005  -45.675 -21.143 1.00 107.37 ? 329  ASP B CB  1 
ATOM   7558  C  CG  . ASP B  1 329 ? 23.792  -46.515 -19.902 1.00 107.65 ? 329  ASP B CG  1 
ATOM   7559  O  OD1 . ASP B  1 329 ? 22.647  -46.952 -19.665 1.00 106.77 ? 329  ASP B OD1 1 
ATOM   7560  O  OD2 . ASP B  1 329 ? 24.773  -46.739 -19.162 1.00 108.25 ? 329  ASP B OD2 1 
ATOM   7561  N  N   . GLY B  1 330 ? 20.431  -45.517 -21.536 1.00 106.32 ? 330  GLY B N   1 
ATOM   7562  C  CA  . GLY B  1 330 ? 19.327  -46.445 -21.726 1.00 104.30 ? 330  GLY B CA  1 
ATOM   7563  C  C   . GLY B  1 330 ? 19.002  -47.125 -20.409 1.00 102.13 ? 330  GLY B C   1 
ATOM   7564  O  O   . GLY B  1 330 ? 17.959  -47.762 -20.250 1.00 103.11 ? 330  GLY B O   1 
ATOM   7565  N  N   . GLU B  1 331 ? 19.920  -46.971 -19.462 1.00 98.66  ? 331  GLU B N   1 
ATOM   7566  C  CA  . GLU B  1 331 ? 19.665  -47.239 -18.055 1.00 95.46  ? 331  GLU B CA  1 
ATOM   7567  C  C   . GLU B  1 331 ? 20.338  -46.106 -17.287 1.00 91.39  ? 331  GLU B C   1 
ATOM   7568  O  O   . GLU B  1 331 ? 21.511  -45.803 -17.524 1.00 90.72  ? 331  GLU B O   1 
ATOM   7569  C  CB  . GLU B  1 331 ? 20.238  -48.595 -17.641 1.00 96.29  ? 331  GLU B CB  1 
ATOM   7570  N  N   . GLU B  1 332 ? 19.603  -45.458 -16.392 1.00 87.54  ? 332  GLU B N   1 
ATOM   7571  C  CA  . GLU B  1 332 ? 20.153  -44.314 -15.670 1.00 82.87  ? 332  GLU B CA  1 
ATOM   7572  C  C   . GLU B  1 332 ? 21.307  -44.705 -14.746 1.00 83.54  ? 332  GLU B C   1 
ATOM   7573  O  O   . GLU B  1 332 ? 21.166  -45.594 -13.908 1.00 85.31  ? 332  GLU B O   1 
ATOM   7574  C  CB  . GLU B  1 332 ? 19.057  -43.623 -14.859 1.00 77.95  ? 332  GLU B CB  1 
ATOM   7575  C  CG  . GLU B  1 332 ? 19.585  -42.558 -13.919 1.00 75.77  ? 332  GLU B CG  1 
ATOM   7576  C  CD  . GLU B  1 332 ? 18.555  -42.110 -12.900 1.00 74.23  ? 332  GLU B CD  1 
ATOM   7577  O  OE1 . GLU B  1 332 ? 17.532  -41.518 -13.303 1.00 74.58  ? 332  GLU B OE1 1 
ATOM   7578  O  OE2 . GLU B  1 332 ? 18.769  -42.356 -11.695 1.00 72.30  ? 332  GLU B OE2 1 
ATOM   7579  N  N   . ARG B  1 333 ? 22.446  -44.035 -14.898 1.00 82.43  ? 333  ARG B N   1 
ATOM   7580  C  CA  . ARG B  1 333 ? 23.589  -44.259 -14.015 1.00 82.45  ? 333  ARG B CA  1 
ATOM   7581  C  C   . ARG B  1 333 ? 23.956  -42.977 -13.273 1.00 81.94  ? 333  ARG B C   1 
ATOM   7582  O  O   . ARG B  1 333 ? 24.151  -41.928 -13.887 1.00 81.72  ? 333  ARG B O   1 
ATOM   7583  C  CB  . ARG B  1 333 ? 24.793  -44.777 -14.804 1.00 82.36  ? 333  ARG B CB  1 
ATOM   7584  N  N   . GLN B  1 334 ? 24.045  -43.055 -11.950 1.00 80.44  ? 334  GLN B N   1 
ATOM   7585  C  CA  . GLN B  1 334 ? 24.390  -41.880 -11.165 1.00 76.19  ? 334  GLN B CA  1 
ATOM   7586  C  C   . GLN B  1 334 ? 25.883  -41.606 -11.282 1.00 76.32  ? 334  GLN B C   1 
ATOM   7587  O  O   . GLN B  1 334 ? 26.708  -42.456 -10.946 1.00 75.19  ? 334  GLN B O   1 
ATOM   7588  C  CB  . GLN B  1 334 ? 24.002  -42.083 -9.704  1.00 73.04  ? 334  GLN B CB  1 
ATOM   7589  C  CG  . GLN B  1 334 ? 24.216  -40.861 -8.849  1.00 72.57  ? 334  GLN B CG  1 
ATOM   7590  C  CD  . GLN B  1 334 ? 23.978  -41.130 -7.382  1.00 71.85  ? 334  GLN B CD  1 
ATOM   7591  O  OE1 . GLN B  1 334 ? 23.355  -42.124 -7.018  1.00 71.85  ? 334  GLN B OE1 1 
ATOM   7592  N  NE2 . GLN B  1 334 ? 24.485  -40.249 -6.529  1.00 71.50  ? 334  GLN B NE2 1 
ATOM   7593  N  N   . LEU B  1 335 ? 26.217  -40.414 -11.771 1.00 77.99  ? 335  LEU B N   1 
ATOM   7594  C  CA  . LEU B  1 335 ? 27.605  -40.023 -12.017 1.00 78.65  ? 335  LEU B CA  1 
ATOM   7595  C  C   . LEU B  1 335 ? 28.380  -39.540 -10.792 1.00 77.21  ? 335  LEU B C   1 
ATOM   7596  O  O   . LEU B  1 335 ? 29.544  -39.897 -10.600 1.00 76.68  ? 335  LEU B O   1 
ATOM   7597  C  CB  . LEU B  1 335 ? 27.665  -38.945 -13.099 1.00 79.96  ? 335  LEU B CB  1 
ATOM   7598  C  CG  . LEU B  1 335 ? 27.335  -39.407 -14.514 1.00 82.43  ? 335  LEU B CG  1 
ATOM   7599  C  CD1 . LEU B  1 335 ? 27.603  -38.282 -15.495 1.00 83.69  ? 335  LEU B CD1 1 
ATOM   7600  C  CD2 . LEU B  1 335 ? 28.157  -40.633 -14.866 1.00 82.82  ? 335  LEU B CD2 1 
ATOM   7601  N  N   . THR B  1 336 ? 27.739  -38.718 -9.971  1.00 75.73  ? 336  THR B N   1 
ATOM   7602  C  CA  . THR B  1 336 ? 28.439  -38.072 -8.872  1.00 74.99  ? 336  THR B CA  1 
ATOM   7603  C  C   . THR B  1 336 ? 27.658  -38.181 -7.586  1.00 74.63  ? 336  THR B C   1 
ATOM   7604  O  O   . THR B  1 336 ? 26.449  -37.952 -7.566  1.00 75.36  ? 336  THR B O   1 
ATOM   7605  C  CB  . THR B  1 336 ? 28.644  -36.575 -9.144  1.00 74.15  ? 336  THR B CB  1 
ATOM   7606  O  OG1 . THR B  1 336 ? 27.396  -35.886 -8.994  1.00 72.81  ? 336  THR B OG1 1 
ATOM   7607  C  CG2 . THR B  1 336 ? 29.177  -36.355 -10.546 1.00 74.97  ? 336  THR B CG2 1 
ATOM   7608  N  N   . ASP B  1 337 ? 28.336  -38.560 -6.511  1.00 73.85  ? 337  ASP B N   1 
ATOM   7609  C  CA  . ASP B  1 337 ? 27.751  -38.354 -5.208  1.00 74.05  ? 337  ASP B CA  1 
ATOM   7610  C  C   . ASP B  1 337 ? 28.646  -37.340 -4.496  1.00 73.25  ? 337  ASP B C   1 
ATOM   7611  O  O   . ASP B  1 337 ? 29.692  -37.705 -3.958  1.00 74.99  ? 337  ASP B O   1 
ATOM   7612  C  CB  . ASP B  1 337 ? 27.783  -39.703 -4.487  1.00 74.26  ? 337  ASP B CB  1 
ATOM   7613  C  CG  . ASP B  1 337 ? 26.869  -39.757 -3.290  1.00 75.92  ? 337  ASP B CG  1 
ATOM   7614  O  OD1 . ASP B  1 337 ? 25.865  -39.015 -3.267  1.00 77.88  ? 337  ASP B OD1 1 
ATOM   7615  O  OD2 . ASP B  1 337 ? 27.152  -40.558 -2.375  1.00 75.01  ? 337  ASP B OD2 1 
ATOM   7616  N  N   . TYR B  1 338 ? 28.216  -36.081 -4.432  1.00 70.39  ? 338  TYR B N   1 
ATOM   7617  C  CA  . TYR B  1 338 ? 28.997  -35.059 -3.729  1.00 68.76  ? 338  TYR B CA  1 
ATOM   7618  C  C   . TYR B  1 338 ? 28.722  -35.023 -2.243  1.00 72.47  ? 338  TYR B C   1 
ATOM   7619  O  O   . TYR B  1 338 ? 29.633  -34.915 -1.419  1.00 74.07  ? 338  TYR B O   1 
ATOM   7620  C  CB  . TYR B  1 338 ? 28.808  -33.665 -4.342  1.00 62.51  ? 338  TYR B CB  1 
ATOM   7621  C  CG  . TYR B  1 338 ? 29.770  -33.372 -5.466  1.00 56.30  ? 338  TYR B CG  1 
ATOM   7622  C  CD1 . TYR B  1 338 ? 29.368  -33.461 -6.788  1.00 54.89  ? 338  TYR B CD1 1 
ATOM   7623  C  CD2 . TYR B  1 338 ? 31.084  -33.027 -5.203  1.00 56.03  ? 338  TYR B CD2 1 
ATOM   7624  C  CE1 . TYR B  1 338 ? 30.241  -33.207 -7.822  1.00 55.44  ? 338  TYR B CE1 1 
ATOM   7625  C  CE2 . TYR B  1 338 ? 31.974  -32.769 -6.232  1.00 57.55  ? 338  TYR B CE2 1 
ATOM   7626  C  CZ  . TYR B  1 338 ? 31.547  -32.861 -7.542  1.00 56.78  ? 338  TYR B CZ  1 
ATOM   7627  O  OH  . TYR B  1 338 ? 32.425  -32.604 -8.575  1.00 55.14  ? 338  TYR B OH  1 
ATOM   7628  N  N   . ASN B  1 339 ? 27.437  -35.099 -1.923  1.00 73.39  ? 339  ASN B N   1 
ATOM   7629  C  CA  . ASN B  1 339 ? 26.959  -34.912 -0.567  1.00 74.00  ? 339  ASN B CA  1 
ATOM   7630  C  C   . ASN B  1 339 ? 26.746  -36.230 0.167   1.00 77.79  ? 339  ASN B C   1 
ATOM   7631  O  O   . ASN B  1 339 ? 26.287  -36.250 1.311   1.00 78.49  ? 339  ASN B O   1 
ATOM   7632  C  CB  . ASN B  1 339 ? 25.689  -34.063 -0.579  1.00 71.05  ? 339  ASN B CB  1 
ATOM   7633  C  CG  . ASN B  1 339 ? 25.916  -32.690 -1.193  1.00 66.98  ? 339  ASN B CG  1 
ATOM   7634  O  OD1 . ASN B  1 339 ? 27.013  -32.141 -1.116  1.00 64.65  ? 339  ASN B OD1 1 
ATOM   7635  N  ND2 . ASN B  1 339 ? 24.879  -32.133 -1.807  1.00 66.29  ? 339  ASN B ND2 1 
ATOM   7636  N  N   . GLY B  1 340 ? 27.074  -37.328 -0.506  1.00 79.91  ? 340  GLY B N   1 
ATOM   7637  C  CA  . GLY B  1 340 ? 26.882  -38.653 0.053   1.00 82.77  ? 340  GLY B CA  1 
ATOM   7638  C  C   . GLY B  1 340 ? 27.500  -38.813 1.426   1.00 85.68  ? 340  GLY B C   1 
ATOM   7639  O  O   . GLY B  1 340 ? 26.885  -39.373 2.330   1.00 86.11  ? 340  GLY B O   1 
ATOM   7640  N  N   . LEU B  1 341 ? 28.718  -38.312 1.587   1.00 53.91  ? 341  LEU B N   1 
ATOM   7641  C  CA  . LEU B  1 341 ? 29.404  -38.399 2.868   1.00 57.34  ? 341  LEU B CA  1 
ATOM   7642  C  C   . LEU B  1 341 ? 28.694  -37.589 3.945   1.00 63.43  ? 341  LEU B C   1 
ATOM   7643  O  O   . LEU B  1 341 ? 28.619  -38.017 5.097   1.00 65.92  ? 341  LEU B O   1 
ATOM   7644  C  CB  . LEU B  1 341 ? 30.853  -37.933 2.737   1.00 55.35  ? 341  LEU B CB  1 
ATOM   7645  C  CG  . LEU B  1 341 ? 31.745  -38.882 1.945   1.00 54.43  ? 341  LEU B CG  1 
ATOM   7646  C  CD1 . LEU B  1 341 ? 33.202  -38.433 2.013   1.00 54.71  ? 341  LEU B CD1 1 
ATOM   7647  C  CD2 . LEU B  1 341 ? 31.581  -40.301 2.475   1.00 52.49  ? 341  LEU B CD2 1 
ATOM   7648  N  N   . ILE B  1 342 ? 28.177  -36.420 3.576   1.00 65.91  ? 342  ILE B N   1 
ATOM   7649  C  CA  . ILE B  1 342 ? 27.522  -35.549 4.551   1.00 68.00  ? 342  ILE B CA  1 
ATOM   7650  C  C   . ILE B  1 342 ? 26.182  -36.127 5.009   1.00 69.88  ? 342  ILE B C   1 
ATOM   7651  O  O   . ILE B  1 342 ? 25.920  -36.237 6.210   1.00 70.53  ? 342  ILE B O   1 
ATOM   7652  C  CB  . ILE B  1 342 ? 27.348  -34.102 4.020   1.00 59.38  ? 342  ILE B CB  1 
ATOM   7653  C  CG1 . ILE B  1 342 ? 28.673  -33.338 4.105   1.00 59.74  ? 342  ILE B CG1 1 
ATOM   7654  C  CG2 . ILE B  1 342 ? 26.264  -33.360 4.800   1.00 57.25  ? 342  ILE B CG2 1 
ATOM   7655  N  N   . PHE B  1 343 ? 25.349  -36.517 4.048   1.00 70.09  ? 343  PHE B N   1 
ATOM   7656  C  CA  . PHE B  1 343 ? 24.013  -37.019 4.347   1.00 72.47  ? 343  PHE B CA  1 
ATOM   7657  C  C   . PHE B  1 343 ? 24.028  -38.416 4.966   1.00 77.32  ? 343  PHE B C   1 
ATOM   7658  O  O   . PHE B  1 343 ? 22.983  -38.951 5.348   1.00 79.62  ? 343  PHE B O   1 
ATOM   7659  C  CB  . PHE B  1 343 ? 23.123  -36.964 3.106   1.00 72.27  ? 343  PHE B CB  1 
ATOM   7660  C  CG  . PHE B  1 343 ? 22.623  -35.581 2.781   1.00 71.12  ? 343  PHE B CG  1 
ATOM   7661  C  CD1 . PHE B  1 343 ? 23.120  -34.883 1.689   1.00 69.95  ? 343  PHE B CD1 1 
ATOM   7662  C  CD2 . PHE B  1 343 ? 21.660  -34.978 3.577   1.00 69.27  ? 343  PHE B CD2 1 
ATOM   7663  C  CE1 . PHE B  1 343 ? 22.659  -33.614 1.395   1.00 68.95  ? 343  PHE B CE1 1 
ATOM   7664  C  CE2 . PHE B  1 343 ? 21.195  -33.711 3.288   1.00 68.34  ? 343  PHE B CE2 1 
ATOM   7665  C  CZ  . PHE B  1 343 ? 21.695  -33.027 2.196   1.00 68.79  ? 343  PHE B CZ  1 
ATOM   7666  N  N   . LYS B  1 344 ? 25.215  -39.010 5.038   1.00 78.74  ? 344  LYS B N   1 
ATOM   7667  C  CA  . LYS B  1 344 ? 25.414  -40.249 5.779   1.00 78.90  ? 344  LYS B CA  1 
ATOM   7668  C  C   . LYS B  1 344 ? 25.241  -39.970 7.277   1.00 78.56  ? 344  LYS B C   1 
ATOM   7669  O  O   . LYS B  1 344 ? 24.687  -40.789 8.011   1.00 79.20  ? 344  LYS B O   1 
ATOM   7670  C  CB  . LYS B  1 344 ? 26.806  -40.816 5.490   1.00 79.13  ? 344  LYS B CB  1 
ATOM   7671  C  CG  . LYS B  1 344 ? 26.899  -42.341 5.482   1.00 78.87  ? 344  LYS B CG  1 
ATOM   7672  C  CD  . LYS B  1 344 ? 28.253  -42.822 4.959   1.00 77.81  ? 344  LYS B CD  1 
ATOM   7673  N  N   . LYS B  1 345 ? 25.722  -38.811 7.725   1.00 77.51  ? 345  LYS B N   1 
ATOM   7674  C  CA  . LYS B  1 345 ? 25.610  -38.418 9.130   1.00 77.11  ? 345  LYS B CA  1 
ATOM   7675  C  C   . LYS B  1 345 ? 24.400  -37.517 9.414   1.00 76.21  ? 345  LYS B C   1 
ATOM   7676  O  O   . LYS B  1 345 ? 24.176  -37.118 10.554  1.00 75.24  ? 345  LYS B O   1 
ATOM   7677  C  CB  . LYS B  1 345 ? 26.892  -37.718 9.604   1.00 76.47  ? 345  LYS B CB  1 
ATOM   7678  C  CG  . LYS B  1 345 ? 28.185  -38.467 9.310   1.00 75.95  ? 345  LYS B CG  1 
ATOM   7679  N  N   . LEU B  1 346 ? 23.625  -37.190 8.385   1.00 76.58  ? 346  LEU B N   1 
ATOM   7680  C  CA  . LEU B  1 346 ? 22.545  -36.215 8.546   1.00 77.03  ? 346  LEU B CA  1 
ATOM   7681  C  C   . LEU B  1 346 ? 21.158  -36.788 8.250   1.00 75.22  ? 346  LEU B C   1 
ATOM   7682  O  O   . LEU B  1 346 ? 20.873  -37.203 7.127   1.00 73.42  ? 346  LEU B O   1 
ATOM   7683  C  CB  . LEU B  1 346 ? 22.807  -34.980 7.677   1.00 78.48  ? 346  LEU B CB  1 
ATOM   7684  C  CG  . LEU B  1 346 ? 22.017  -33.709 7.998   1.00 78.99  ? 346  LEU B CG  1 
ATOM   7685  C  CD1 . LEU B  1 346 ? 22.331  -33.210 9.399   1.00 78.70  ? 346  LEU B CD1 1 
ATOM   7686  C  CD2 . LEU B  1 346 ? 22.324  -32.633 6.975   1.00 79.46  ? 346  LEU B CD2 1 
ATOM   7687  N  N   . LYS B  1 347 ? 20.299  -36.795 9.268   1.00 74.84  ? 347  LYS B N   1 
ATOM   7688  C  CA  . LYS B  1 347 ? 18.949  -37.336 9.136   1.00 73.88  ? 347  LYS B CA  1 
ATOM   7689  C  C   . LYS B  1 347 ? 18.087  -36.496 8.196   1.00 73.14  ? 347  LYS B C   1 
ATOM   7690  O  O   . LYS B  1 347 ? 18.046  -35.272 8.303   1.00 72.86  ? 347  LYS B O   1 
ATOM   7691  C  CB  . LYS B  1 347 ? 18.270  -37.468 10.507  1.00 73.87  ? 347  LYS B CB  1 
ATOM   7692  C  CG  . LYS B  1 347 ? 16.861  -38.050 10.429  1.00 74.80  ? 347  LYS B CG  1 
ATOM   7693  C  CD  . LYS B  1 347 ? 16.299  -38.399 11.800  1.00 75.96  ? 347  LYS B CD  1 
ATOM   7694  C  CE  . LYS B  1 347 ? 14.934  -39.072 11.675  1.00 76.44  ? 347  LYS B CE  1 
ATOM   7695  N  NZ  . LYS B  1 347 ? 14.297  -39.341 12.996  1.00 76.05  ? 347  LYS B NZ  1 
ATOM   7696  N  N   . THR B  1 348 ? 17.402  -37.172 7.278   1.00 73.16  ? 348  THR B N   1 
ATOM   7697  C  CA  . THR B  1 348 ? 16.521  -36.521 6.317   1.00 73.09  ? 348  THR B CA  1 
ATOM   7698  C  C   . THR B  1 348 ? 15.113  -37.085 6.459   1.00 72.48  ? 348  THR B C   1 
ATOM   7699  O  O   . THR B  1 348 ? 14.919  -38.162 7.027   1.00 72.65  ? 348  THR B O   1 
ATOM   7700  C  CB  . THR B  1 348 ? 17.003  -36.729 4.870   1.00 74.61  ? 348  THR B CB  1 
ATOM   7701  O  OG1 . THR B  1 348 ? 16.999  -38.128 4.560   1.00 74.74  ? 348  THR B OG1 1 
ATOM   7702  C  CG2 . THR B  1 348 ? 18.411  -36.188 4.694   1.00 76.07  ? 348  THR B CG2 1 
ATOM   7703  N  N   . PHE B  1 349 ? 14.130  -36.349 5.951   1.00 70.66  ? 349  PHE B N   1 
ATOM   7704  C  CA  . PHE B  1 349 ? 12.736  -36.748 6.085   1.00 67.80  ? 349  PHE B CA  1 
ATOM   7705  C  C   . PHE B  1 349 ? 12.040  -36.814 4.733   1.00 64.13  ? 349  PHE B C   1 
ATOM   7706  O  O   . PHE B  1 349 ? 11.850  -35.790 4.081   1.00 67.51  ? 349  PHE B O   1 
ATOM   7707  C  CB  . PHE B  1 349 ? 11.999  -35.755 6.986   1.00 69.06  ? 349  PHE B CB  1 
ATOM   7708  C  CG  . PHE B  1 349 ? 12.667  -35.527 8.311   1.00 70.63  ? 349  PHE B CG  1 
ATOM   7709  C  CD1 . PHE B  1 349 ? 13.580  -34.498 8.473   1.00 72.15  ? 349  PHE B CD1 1 
ATOM   7710  C  CD2 . PHE B  1 349 ? 12.384  -36.342 9.394   1.00 70.83  ? 349  PHE B CD2 1 
ATOM   7711  C  CE1 . PHE B  1 349 ? 14.198  -34.285 9.695   1.00 72.27  ? 349  PHE B CE1 1 
ATOM   7712  C  CE2 . PHE B  1 349 ? 12.997  -36.135 10.615  1.00 71.10  ? 349  PHE B CE2 1 
ATOM   7713  C  CZ  . PHE B  1 349 ? 13.905  -35.106 10.767  1.00 71.44  ? 349  PHE B CZ  1 
ATOM   7714  N  N   . GLU B  1 350 ? 11.638  -38.013 4.325   1.00 93.96  ? 350  GLU B N   1 
ATOM   7715  C  CA  . GLU B  1 350 ? 10.914  -38.178 3.072   1.00 89.02  ? 350  GLU B CA  1 
ATOM   7716  C  C   . GLU B  1 350 ? 9.454   -37.780 3.231   1.00 85.66  ? 350  GLU B C   1 
ATOM   7717  O  O   . GLU B  1 350 ? 8.789   -38.217 4.163   1.00 86.44  ? 350  GLU B O   1 
ATOM   7718  C  CB  . GLU B  1 350 ? 11.018  -39.621 2.585   1.00 89.54  ? 350  GLU B CB  1 
ATOM   7719  C  CG  . GLU B  1 350 ? 12.214  -39.883 1.683   1.00 90.41  ? 350  GLU B CG  1 
ATOM   7720  C  CD  . GLU B  1 350 ? 12.007  -39.351 0.278   1.00 91.26  ? 350  GLU B CD  1 
ATOM   7721  O  OE1 . GLU B  1 350 ? 10.837  -39.113 -0.098  1.00 89.68  ? 350  GLU B OE1 1 
ATOM   7722  O  OE2 . GLU B  1 350 ? 13.012  -39.172 -0.448  1.00 92.80  ? 350  GLU B OE2 1 
ATOM   7723  N  N   . PRO B  1 351 ? 8.951   -36.937 2.320   1.00 82.45  ? 351  PRO B N   1 
ATOM   7724  C  CA  . PRO B  1 351 ? 7.552   -36.501 2.380   1.00 81.07  ? 351  PRO B CA  1 
ATOM   7725  C  C   . PRO B  1 351 ? 6.560   -37.619 2.057   1.00 80.05  ? 351  PRO B C   1 
ATOM   7726  O  O   . PRO B  1 351 ? 6.813   -38.437 1.172   1.00 79.05  ? 351  PRO B O   1 
ATOM   7727  C  CB  . PRO B  1 351 ? 7.482   -35.398 1.317   1.00 79.96  ? 351  PRO B CB  1 
ATOM   7728  C  CG  . PRO B  1 351 ? 8.604   -35.681 0.396   1.00 80.05  ? 351  PRO B CG  1 
ATOM   7729  C  CD  . PRO B  1 351 ? 9.693   -36.276 1.234   1.00 80.95  ? 351  PRO B CD  1 
ATOM   7730  N  N   . ARG B  1 352 ? 5.444   -37.646 2.783   1.00 80.55  ? 352  ARG B N   1 
ATOM   7731  C  CA  . ARG B  1 352 ? 4.368   -38.600 2.524   1.00 80.24  ? 352  ARG B CA  1 
ATOM   7732  C  C   . ARG B  1 352 ? 3.268   -37.961 1.672   1.00 79.48  ? 352  ARG B C   1 
ATOM   7733  O  O   . ARG B  1 352 ? 2.621   -36.998 2.097   1.00 77.46  ? 352  ARG B O   1 
ATOM   7734  C  CB  . ARG B  1 352 ? 3.783   -39.125 3.838   1.00 78.17  ? 352  ARG B CB  1 
ATOM   7735  N  N   . HIS B  1 353 ? 3.069   -38.498 0.470   1.00 78.35  ? 353  HIS B N   1 
ATOM   7736  C  CA  . HIS B  1 353 ? 2.059   -37.986 -0.452  1.00 77.65  ? 353  HIS B CA  1 
ATOM   7737  C  C   . HIS B  1 353 ? 0.653   -38.425 -0.063  1.00 78.17  ? 353  HIS B C   1 
ATOM   7738  O  O   . HIS B  1 353 ? 0.452   -39.551 0.382   1.00 80.14  ? 353  HIS B O   1 
ATOM   7739  C  CB  . HIS B  1 353 ? 2.357   -38.446 -1.880  1.00 77.57  ? 353  HIS B CB  1 
ATOM   7740  C  CG  . HIS B  1 353 ? 1.285   -38.089 -2.863  1.00 77.85  ? 353  HIS B CG  1 
ATOM   7741  N  ND1 . HIS B  1 353 ? 0.603   -39.035 -3.599  1.00 78.31  ? 353  HIS B ND1 1 
ATOM   7742  C  CD2 . HIS B  1 353 ? 0.773   -36.889 -3.226  1.00 77.16  ? 353  HIS B CD2 1 
ATOM   7743  C  CE1 . HIS B  1 353 ? -0.279  -38.432 -4.377  1.00 78.34  ? 353  HIS B CE1 1 
ATOM   7744  N  NE2 . HIS B  1 353 ? -0.195  -37.130 -4.170  1.00 77.73  ? 353  HIS B NE2 1 
ATOM   7745  N  N   . PHE B  1 354 ? -0.318  -37.532 -0.239  1.00 76.82  ? 354  PHE B N   1 
ATOM   7746  C  CA  . PHE B  1 354 ? -1.716  -37.843 0.060   1.00 76.69  ? 354  PHE B CA  1 
ATOM   7747  C  C   . PHE B  1 354 ? -2.690  -37.063 -0.824  1.00 76.96  ? 354  PHE B C   1 
ATOM   7748  O  O   . PHE B  1 354 ? -2.401  -35.942 -1.237  1.00 77.60  ? 354  PHE B O   1 
ATOM   7749  C  CB  . PHE B  1 354 ? -2.024  -37.618 1.547   1.00 76.45  ? 354  PHE B CB  1 
ATOM   7750  C  CG  . PHE B  1 354 ? -2.093  -36.169 1.956   1.00 77.01  ? 354  PHE B CG  1 
ATOM   7751  C  CD1 . PHE B  1 354 ? -3.299  -35.482 1.927   1.00 77.22  ? 354  PHE B CD1 1 
ATOM   7752  C  CD2 . PHE B  1 354 ? -0.961  -35.503 2.404   1.00 77.60  ? 354  PHE B CD2 1 
ATOM   7753  C  CE1 . PHE B  1 354 ? -3.370  -34.152 2.318   1.00 77.48  ? 354  PHE B CE1 1 
ATOM   7754  C  CE2 . PHE B  1 354 ? -1.025  -34.175 2.796   1.00 76.97  ? 354  PHE B CE2 1 
ATOM   7755  C  CZ  . PHE B  1 354 ? -2.230  -33.499 2.754   1.00 77.06  ? 354  PHE B CZ  1 
ATOM   7756  N  N   . ARG B  1 355 ? -3.845  -37.660 -1.105  1.00 75.79  ? 355  ARG B N   1 
ATOM   7757  C  CA  . ARG B  1 355 ? -4.853  -37.017 -1.936  1.00 75.16  ? 355  ARG B CA  1 
ATOM   7758  C  C   . ARG B  1 355 ? -5.979  -36.519 -1.051  1.00 78.80  ? 355  ARG B C   1 
ATOM   7759  O  O   . ARG B  1 355 ? -6.257  -37.104 -0.006  1.00 79.86  ? 355  ARG B O   1 
ATOM   7760  C  CB  . ARG B  1 355 ? -5.396  -37.993 -2.976  1.00 75.03  ? 355  ARG B CB  1 
ATOM   7761  C  CG  . ARG B  1 355 ? -4.355  -38.485 -3.961  1.00 76.32  ? 355  ARG B CG  1 
ATOM   7762  C  CD  . ARG B  1 355 ? -4.061  -37.437 -5.020  1.00 77.81  ? 355  ARG B CD  1 
ATOM   7763  N  NE  . ARG B  1 355 ? -5.118  -37.366 -6.025  1.00 79.25  ? 355  ARG B NE  1 
ATOM   7764  C  CZ  . ARG B  1 355 ? -5.140  -36.492 -7.026  1.00 80.23  ? 355  ARG B CZ  1 
ATOM   7765  N  NH1 . ARG B  1 355 ? -4.165  -35.603 -7.156  1.00 80.34  ? 355  ARG B NH1 1 
ATOM   7766  N  NH2 . ARG B  1 355 ? -6.140  -36.503 -7.897  1.00 80.58  ? 355  ARG B NH2 1 
ATOM   7767  N  N   . PHE B  1 356 ? -6.600  -35.413 -1.447  1.00 82.56  ? 356  PHE B N   1 
ATOM   7768  C  CA  . PHE B  1 356 ? -7.725  -34.870 -0.694  1.00 86.89  ? 356  PHE B CA  1 
ATOM   7769  C  C   . PHE B  1 356 ? -8.728  -34.198 -1.625  1.00 86.89  ? 356  PHE B C   1 
ATOM   7770  O  O   . PHE B  1 356 ? -8.377  -33.780 -2.729  1.00 86.75  ? 356  PHE B O   1 
ATOM   7771  C  CB  . PHE B  1 356 ? -7.245  -33.904 0.399   1.00 90.95  ? 356  PHE B CB  1 
ATOM   7772  C  CG  . PHE B  1 356 ? -6.657  -32.617 -0.126  1.00 93.15  ? 356  PHE B CG  1 
ATOM   7773  C  CD1 . PHE B  1 356 ? -5.356  -32.569 -0.600  1.00 93.48  ? 356  PHE B CD1 1 
ATOM   7774  C  CD2 . PHE B  1 356 ? -7.403  -31.451 -0.122  1.00 93.77  ? 356  PHE B CD2 1 
ATOM   7775  C  CE1 . PHE B  1 356 ? -4.820  -31.383 -1.077  1.00 93.52  ? 356  PHE B CE1 1 
ATOM   7776  C  CE2 . PHE B  1 356 ? -6.872  -30.265 -0.597  1.00 93.64  ? 356  PHE B CE2 1 
ATOM   7777  C  CZ  . PHE B  1 356 ? -5.579  -30.231 -1.074  1.00 93.13  ? 356  PHE B CZ  1 
ATOM   7778  N  N   . LYS B  1 357 ? -9.980  -34.112 -1.191  1.00 87.32  ? 357  LYS B N   1 
ATOM   7779  C  CA  . LYS B  1 357 ? -11.011 -33.506 -2.024  1.00 88.55  ? 357  LYS B CA  1 
ATOM   7780  C  C   . LYS B  1 357 ? -11.272 -32.069 -1.602  1.00 89.21  ? 357  LYS B C   1 
ATOM   7781  O  O   . LYS B  1 357 ? -11.512 -31.794 -0.427  1.00 89.44  ? 357  LYS B O   1 
ATOM   7782  C  CB  . LYS B  1 357 ? -12.309 -34.317 -1.973  1.00 88.84  ? 357  LYS B CB  1 
ATOM   7783  N  N   . SER B  1 358 ? -11.211 -31.154 -2.561  1.00 89.97  ? 358  SER B N   1 
ATOM   7784  C  CA  . SER B  1 358 ? -11.530 -29.762 -2.288  1.00 91.46  ? 358  SER B CA  1 
ATOM   7785  C  C   . SER B  1 358 ? -12.579 -29.296 -3.284  1.00 93.19  ? 358  SER B C   1 
ATOM   7786  O  O   . SER B  1 358 ? -12.306 -29.175 -4.482  1.00 92.52  ? 358  SER B O   1 
ATOM   7787  C  CB  . SER B  1 358 ? -10.272 -28.898 -2.402  1.00 91.65  ? 358  SER B CB  1 
ATOM   7788  O  OG  . SER B  1 358 ? -10.481 -27.602 -1.869  1.00 91.73  ? 358  SER B OG  1 
ATOM   7789  N  N   . ILE B  1 359 ? -13.779 -29.026 -2.777  1.00 94.61  ? 359  ILE B N   1 
ATOM   7790  C  CA  . ILE B  1 359 ? -14.898 -28.640 -3.628  1.00 95.61  ? 359  ILE B CA  1 
ATOM   7791  C  C   . ILE B  1 359 ? -15.078 -29.641 -4.781  1.00 98.69  ? 359  ILE B C   1 
ATOM   7792  O  O   . ILE B  1 359 ? -15.391 -30.813 -4.550  1.00 100.90 ? 359  ILE B O   1 
ATOM   7793  C  CB  . ILE B  1 359 ? -14.772 -27.191 -4.124  1.00 93.82  ? 359  ILE B CB  1 
ATOM   7794  C  CG1 . ILE B  1 359 ? -14.392 -26.277 -2.958  1.00 91.92  ? 359  ILE B CG1 1 
ATOM   7795  C  CG2 . ILE B  1 359 ? -16.076 -26.728 -4.742  1.00 94.20  ? 359  ILE B CG2 1 
ATOM   7796  C  CD1 . ILE B  1 359 ? -14.665 -24.813 -3.218  1.00 91.22  ? 359  ILE B CD1 1 
ATOM   7797  N  N   . ASP B  1 360 ? -14.906 -29.179 -6.015  1.00 98.31  ? 360  ASP B N   1 
ATOM   7798  C  CA  . ASP B  1 360 ? -15.149 -30.017 -7.189  1.00 97.68  ? 360  ASP B CA  1 
ATOM   7799  C  C   . ASP B  1 360 ? -13.929 -30.797 -7.699  1.00 94.72  ? 360  ASP B C   1 
ATOM   7800  O  O   . ASP B  1 360 ? -14.019 -31.496 -8.708  1.00 93.23  ? 360  ASP B O   1 
ATOM   7801  C  CB  . ASP B  1 360 ? -15.748 -29.178 -8.325  1.00 99.31  ? 360  ASP B CB  1 
ATOM   7802  C  CG  . ASP B  1 360 ? -14.900 -27.953 -8.670  1.00 99.66  ? 360  ASP B CG  1 
ATOM   7803  O  OD1 . ASP B  1 360 ? -14.376 -27.293 -7.744  1.00 97.47  ? 360  ASP B OD1 1 
ATOM   7804  O  OD2 . ASP B  1 360 ? -14.768 -27.646 -9.876  1.00 100.21 ? 360  ASP B OD2 1 
ATOM   7805  N  N   . LEU B  1 361 ? -12.798 -30.683 -7.007  1.00 93.09  ? 361  LEU B N   1 
ATOM   7806  C  CA  . LEU B  1 361 ? -11.552 -31.273 -7.496  1.00 91.24  ? 361  LEU B CA  1 
ATOM   7807  C  C   . LEU B  1 361 ? -10.873 -32.208 -6.501  1.00 90.43  ? 361  LEU B C   1 
ATOM   7808  O  O   . LEU B  1 361 ? -11.174 -32.190 -5.308  1.00 91.37  ? 361  LEU B O   1 
ATOM   7809  C  CB  . LEU B  1 361 ? -10.566 -30.177 -7.896  1.00 89.58  ? 361  LEU B CB  1 
ATOM   7810  C  CG  . LEU B  1 361 ? -10.991 -29.221 -9.006  1.00 88.61  ? 361  LEU B CG  1 
ATOM   7811  C  CD1 . LEU B  1 361 ? -9.921  -28.166 -9.201  1.00 89.36  ? 361  LEU B CD1 1 
ATOM   7812  C  CD2 . LEU B  1 361 ? -11.248 -29.976 -10.297 1.00 87.40  ? 361  LEU B CD2 1 
ATOM   7813  N  N   . GLU B  1 362 ? -9.950  -33.020 -7.012  1.00 88.52  ? 362  GLU B N   1 
ATOM   7814  C  CA  . GLU B  1 362 ? -9.104  -33.871 -6.179  1.00 87.81  ? 362  GLU B CA  1 
ATOM   7815  C  C   . GLU B  1 362 ? -7.643  -33.432 -6.324  1.00 82.15  ? 362  GLU B C   1 
ATOM   7816  O  O   . GLU B  1 362 ? -7.115  -33.376 -7.436  1.00 81.53  ? 362  GLU B O   1 
ATOM   7817  C  CB  . GLU B  1 362 ? -9.278  -35.337 -6.582  1.00 92.14  ? 362  GLU B CB  1 
ATOM   7818  C  CG  . GLU B  1 362 ? -8.502  -36.333 -5.733  1.00 95.27  ? 362  GLU B CG  1 
ATOM   7819  C  CD  . GLU B  1 362 ? -8.806  -37.772 -6.109  1.00 97.32  ? 362  GLU B CD  1 
ATOM   7820  O  OE1 . GLU B  1 362 ? -7.857  -38.582 -6.211  1.00 97.66  ? 362  GLU B OE1 1 
ATOM   7821  O  OE2 . GLU B  1 362 ? -9.999  -38.092 -6.300  1.00 98.11  ? 362  GLU B OE2 1 
ATOM   7822  N  N   . LEU B  1 363 ? -6.990  -33.134 -5.202  1.00 76.95  ? 363  LEU B N   1 
ATOM   7823  C  CA  . LEU B  1 363 ? -5.703  -32.430 -5.217  1.00 72.68  ? 363  LEU B CA  1 
ATOM   7824  C  C   . LEU B  1 363 ? -4.558  -33.213 -4.571  1.00 73.24  ? 363  LEU B C   1 
ATOM   7825  O  O   . LEU B  1 363 ? -4.784  -34.161 -3.817  1.00 75.56  ? 363  LEU B O   1 
ATOM   7826  C  CB  . LEU B  1 363 ? -5.840  -31.077 -4.513  1.00 68.29  ? 363  LEU B CB  1 
ATOM   7827  C  CG  . LEU B  1 363 ? -6.350  -29.875 -5.312  1.00 66.66  ? 363  LEU B CG  1 
ATOM   7828  C  CD1 . LEU B  1 363 ? -7.322  -30.300 -6.391  1.00 68.02  ? 363  LEU B CD1 1 
ATOM   7829  C  CD2 . LEU B  1 363 ? -6.979  -28.824 -4.395  1.00 64.75  ? 363  LEU B CD2 1 
ATOM   7830  N  N   . ASP B  1 364 ? -3.328  -32.821 -4.896  1.00 70.56  ? 364  ASP B N   1 
ATOM   7831  C  CA  . ASP B  1 364 ? -2.135  -33.400 -4.279  1.00 70.65  ? 364  ASP B CA  1 
ATOM   7832  C  C   . ASP B  1 364 ? -1.695  -32.663 -3.017  1.00 72.40  ? 364  ASP B C   1 
ATOM   7833  O  O   . ASP B  1 364 ? -1.751  -31.435 -2.947  1.00 74.51  ? 364  ASP B O   1 
ATOM   7834  C  CB  . ASP B  1 364 ? -0.971  -33.424 -5.268  1.00 69.90  ? 364  ASP B CB  1 
ATOM   7835  C  CG  . ASP B  1 364 ? -1.028  -34.605 -6.207  1.00 68.09  ? 364  ASP B CG  1 
ATOM   7836  O  OD1 . ASP B  1 364 ? -1.455  -35.695 -5.773  1.00 64.22  ? 364  ASP B OD1 1 
ATOM   7837  O  OD2 . ASP B  1 364 ? -0.638  -34.437 -7.380  1.00 70.25  ? 364  ASP B OD2 1 
ATOM   7838  N  N   . GLY B  1 365 ? -1.223  -33.422 -2.034  1.00 72.12  ? 365  GLY B N   1 
ATOM   7839  C  CA  . GLY B  1 365 ? -0.688  -32.846 -0.816  1.00 70.64  ? 365  GLY B CA  1 
ATOM   7840  C  C   . GLY B  1 365 ? 0.426   -33.711 -0.262  1.00 70.76  ? 365  GLY B C   1 
ATOM   7841  O  O   . GLY B  1 365 ? 0.564   -34.877 -0.622  1.00 71.50  ? 365  GLY B O   1 
ATOM   7842  N  N   . TRP B  1 366 ? 1.231   -33.133 0.617   1.00 70.21  ? 366  TRP B N   1 
ATOM   7843  C  CA  . TRP B  1 366 ? 2.375   -33.836 1.176   1.00 66.85  ? 366  TRP B CA  1 
ATOM   7844  C  C   . TRP B  1 366 ? 2.554   -33.422 2.616   1.00 66.03  ? 366  TRP B C   1 
ATOM   7845  O  O   . TRP B  1 366 ? 2.148   -32.329 3.012   1.00 63.69  ? 366  TRP B O   1 
ATOM   7846  C  CB  . TRP B  1 366 ? 3.653   -33.504 0.403   1.00 62.51  ? 366  TRP B CB  1 
ATOM   7847  C  CG  . TRP B  1 366 ? 3.687   -34.041 -0.989  1.00 61.97  ? 366  TRP B CG  1 
ATOM   7848  C  CD1 . TRP B  1 366 ? 4.252   -35.214 -1.402  1.00 61.65  ? 366  TRP B CD1 1 
ATOM   7849  C  CD2 . TRP B  1 366 ? 3.148   -33.420 -2.162  1.00 61.85  ? 366  TRP B CD2 1 
ATOM   7850  N  NE1 . TRP B  1 366 ? 4.089   -35.364 -2.758  1.00 61.25  ? 366  TRP B NE1 1 
ATOM   7851  C  CE2 . TRP B  1 366 ? 3.415   -34.277 -3.248  1.00 61.40  ? 366  TRP B CE2 1 
ATOM   7852  C  CE3 . TRP B  1 366 ? 2.462   -32.225 -2.399  1.00 61.72  ? 366  TRP B CE3 1 
ATOM   7853  C  CZ2 . TRP B  1 366 ? 3.019   -33.978 -4.548  1.00 61.88  ? 366  TRP B CZ2 1 
ATOM   7854  C  CZ3 . TRP B  1 366 ? 2.072   -31.930 -3.690  1.00 62.34  ? 366  TRP B CZ3 1 
ATOM   7855  C  CH2 . TRP B  1 366 ? 2.351   -32.802 -4.749  1.00 62.22  ? 366  TRP B CH2 1 
ATOM   7856  N  N   . TYR B  1 367 ? 3.164   -34.299 3.400   1.00 67.50  ? 367  TYR B N   1 
ATOM   7857  C  CA  . TYR B  1 367 ? 3.535   -33.934 4.756   1.00 67.56  ? 367  TYR B CA  1 
ATOM   7858  C  C   . TYR B  1 367 ? 4.755   -34.699 5.248   1.00 61.45  ? 367  TYR B C   1 
ATOM   7859  O  O   . TYR B  1 367 ? 5.101   -35.762 4.730   1.00 55.76  ? 367  TYR B O   1 
ATOM   7860  C  CB  . TYR B  1 367 ? 2.354   -34.075 5.724   1.00 73.54  ? 367  TYR B CB  1 
ATOM   7861  C  CG  . TYR B  1 367 ? 1.929   -35.497 6.026   1.00 80.77  ? 367  TYR B CG  1 
ATOM   7862  C  CD1 . TYR B  1 367 ? 0.852   -36.077 5.366   1.00 84.45  ? 367  TYR B CD1 1 
ATOM   7863  C  CD2 . TYR B  1 367 ? 2.592   -36.251 6.988   1.00 83.41  ? 367  TYR B CD2 1 
ATOM   7864  C  CE1 . TYR B  1 367 ? 0.456   -37.371 5.649   1.00 86.96  ? 367  TYR B CE1 1 
ATOM   7865  C  CE2 . TYR B  1 367 ? 2.204   -37.544 7.276   1.00 85.91  ? 367  TYR B CE2 1 
ATOM   7866  C  CZ  . TYR B  1 367 ? 1.136   -38.099 6.604   1.00 87.86  ? 367  TYR B CZ  1 
ATOM   7867  O  OH  . TYR B  1 367 ? 0.749   -39.387 6.888   1.00 89.76  ? 367  TYR B OH  1 
ATOM   7868  N  N   . ILE B  1 368 ? 5.417   -34.123 6.240   1.00 61.98  ? 368  ILE B N   1 
ATOM   7869  C  CA  . ILE B  1 368 ? 6.588   -34.731 6.839   1.00 64.00  ? 368  ILE B CA  1 
ATOM   7870  C  C   . ILE B  1 368 ? 6.336   -34.922 8.320   1.00 69.44  ? 368  ILE B C   1 
ATOM   7871  O  O   . ILE B  1 368 ? 5.801   -34.033 8.988   1.00 72.73  ? 368  ILE B O   1 
ATOM   7872  C  CB  . ILE B  1 368 ? 7.818   -33.841 6.658   1.00 62.19  ? 368  ILE B CB  1 
ATOM   7873  C  CG1 . ILE B  1 368 ? 8.177   -33.725 5.171   1.00 60.08  ? 368  ILE B CG1 1 
ATOM   7874  C  CG2 . ILE B  1 368 ? 8.981   -34.377 7.477   1.00 62.27  ? 368  ILE B CG2 1 
ATOM   7875  C  CD1 . ILE B  1 368 ? 9.530   -33.093 4.918   1.00 59.05  ? 368  ILE B CD1 1 
ATOM   7876  N  N   . LYS B  1 369 ? 6.706   -36.088 8.834   1.00 70.31  ? 369  LYS B N   1 
ATOM   7877  C  CA  . LYS B  1 369 ? 6.493   -36.377 10.240  1.00 69.82  ? 369  LYS B CA  1 
ATOM   7878  C  C   . LYS B  1 369 ? 7.804   -36.245 11.002  1.00 67.94  ? 369  LYS B C   1 
ATOM   7879  O  O   . LYS B  1 369 ? 8.802   -36.870 10.642  1.00 65.85  ? 369  LYS B O   1 
ATOM   7880  C  CB  . LYS B  1 369 ? 5.917   -37.781 10.412  1.00 72.73  ? 369  LYS B CB  1 
ATOM   7881  C  CG  . LYS B  1 369 ? 4.955   -37.924 11.586  1.00 75.49  ? 369  LYS B CG  1 
ATOM   7882  C  CD  . LYS B  1 369 ? 4.747   -39.385 11.968  1.00 77.73  ? 369  LYS B CD  1 
ATOM   7883  C  CE  . LYS B  1 369 ? 3.855   -39.520 13.195  1.00 79.36  ? 369  LYS B CE  1 
ATOM   7884  N  NZ  . LYS B  1 369 ? 3.823   -40.923 13.701  1.00 81.00  ? 369  LYS B NZ  1 
ATOM   7885  N  N   . PRO B  1 370 ? 7.813   -35.413 12.053  1.00 70.26  ? 370  PRO B N   1 
ATOM   7886  C  CA  . PRO B  1 370 ? 8.984   -35.308 12.932  1.00 73.08  ? 370  PRO B CA  1 
ATOM   7887  C  C   . PRO B  1 370 ? 9.133   -36.574 13.773  1.00 77.31  ? 370  PRO B C   1 
ATOM   7888  O  O   . PRO B  1 370 ? 8.283   -37.458 13.677  1.00 77.54  ? 370  PRO B O   1 
ATOM   7889  C  CB  . PRO B  1 370 ? 8.630   -34.122 13.838  1.00 70.80  ? 370  PRO B CB  1 
ATOM   7890  C  CG  . PRO B  1 370 ? 7.136   -34.055 13.819  1.00 69.26  ? 370  PRO B CG  1 
ATOM   7891  C  CD  . PRO B  1 370 ? 6.737   -34.483 12.438  1.00 69.78  ? 370  PRO B CD  1 
ATOM   7892  N  N   . GLU B  1 371 ? 10.163  -36.660 14.606  1.00 81.49  ? 371  GLU B N   1 
ATOM   7893  C  CA  . GLU B  1 371 ? 10.232  -37.768 15.541  1.00 86.36  ? 371  GLU B CA  1 
ATOM   7894  C  C   . GLU B  1 371 ? 9.530   -37.253 16.793  1.00 95.06  ? 371  GLU B C   1 
ATOM   7895  O  O   . GLU B  1 371 ? 10.028  -36.355 17.470  1.00 97.30  ? 371  GLU B O   1 
ATOM   7896  C  CB  . GLU B  1 371 ? 11.689  -38.152 15.824  1.00 82.59  ? 371  GLU B CB  1 
ATOM   7897  N  N   . ILE B  1 372 ? 8.366   -37.827 17.089  1.00 101.19 ? 372  ILE B N   1 
ATOM   7898  C  CA  . ILE B  1 372 ? 7.472   -37.292 18.116  1.00 107.30 ? 372  ILE B CA  1 
ATOM   7899  C  C   . ILE B  1 372 ? 7.484   -38.165 19.365  1.00 114.00 ? 372  ILE B C   1 
ATOM   7900  O  O   . ILE B  1 372 ? 7.611   -39.388 19.269  1.00 115.32 ? 372  ILE B O   1 
ATOM   7901  C  CB  . ILE B  1 372 ? 6.022   -37.176 17.599  1.00 107.11 ? 372  ILE B CB  1 
ATOM   7902  N  N   . LYS B  1 373 ? 7.318   -37.549 20.532  1.00 118.57 ? 373  LYS B N   1 
ATOM   7903  C  CA  . LYS B  1 373 ? 7.458   -38.286 21.783  1.00 123.51 ? 373  LYS B CA  1 
ATOM   7904  C  C   . LYS B  1 373 ? 6.284   -39.243 21.960  1.00 127.35 ? 373  LYS B C   1 
ATOM   7905  O  O   . LYS B  1 373 ? 5.397   -39.313 21.104  1.00 129.31 ? 373  LYS B O   1 
ATOM   7906  C  CB  . LYS B  1 373 ? 7.552   -37.329 22.974  1.00 123.49 ? 373  LYS B CB  1 
ATOM   7907  N  N   . GLU B  1 374 ? 6.276   -39.979 23.069  1.00 128.23 ? 374  GLU B N   1 
ATOM   7908  C  CA  . GLU B  1 374 ? 5.277   -41.025 23.261  1.00 127.31 ? 374  GLU B CA  1 
ATOM   7909  C  C   . GLU B  1 374 ? 3.927   -40.426 23.624  1.00 123.89 ? 374  GLU B C   1 
ATOM   7910  O  O   . GLU B  1 374 ? 3.791   -39.740 24.637  1.00 123.02 ? 374  GLU B O   1 
ATOM   7911  C  CB  . GLU B  1 374 ? 5.724   -42.008 24.347  1.00 128.36 ? 374  GLU B CB  1 
ATOM   7912  N  N   . GLY B  1 375 ? 2.926   -40.714 22.798  1.00 120.93 ? 375  GLY B N   1 
ATOM   7913  C  CA  . GLY B  1 375 ? 1.603   -40.154 22.982  1.00 118.18 ? 375  GLY B CA  1 
ATOM   7914  C  C   . GLY B  1 375 ? 1.617   -38.644 23.139  1.00 115.10 ? 375  GLY B C   1 
ATOM   7915  O  O   . GLY B  1 375 ? 0.784   -38.087 23.857  1.00 116.05 ? 375  GLY B O   1 
ATOM   7916  N  N   . GLU B  1 376 ? 2.565   -37.975 22.485  1.00 109.95 ? 376  GLU B N   1 
ATOM   7917  C  CA  . GLU B  1 376 ? 2.616   -36.514 22.526  1.00 102.70 ? 376  GLU B CA  1 
ATOM   7918  C  C   . GLU B  1 376 ? 2.105   -35.898 21.221  1.00 96.08  ? 376  GLU B C   1 
ATOM   7919  O  O   . GLU B  1 376 ? 1.782   -36.612 20.270  1.00 93.94  ? 376  GLU B O   1 
ATOM   7920  C  CB  . GLU B  1 376 ? 4.035   -36.026 22.833  1.00 101.28 ? 376  GLU B CB  1 
ATOM   7921  N  N   . LYS B  1 377 ? 2.054   -34.570 21.178  1.00 91.99  ? 377  LYS B N   1 
ATOM   7922  C  CA  . LYS B  1 377 ? 1.545   -33.844 20.016  1.00 88.36  ? 377  LYS B CA  1 
ATOM   7923  C  C   . LYS B  1 377 ? 2.626   -32.923 19.462  1.00 83.47  ? 377  LYS B C   1 
ATOM   7924  O  O   . LYS B  1 377 ? 3.452   -32.412 20.216  1.00 82.32  ? 377  LYS B O   1 
ATOM   7925  C  CB  . LYS B  1 377 ? 0.317   -33.013 20.402  1.00 89.25  ? 377  LYS B CB  1 
ATOM   7926  C  CG  . LYS B  1 377 ? -0.980  -33.802 20.567  1.00 91.30  ? 377  LYS B CG  1 
ATOM   7927  C  CD  . LYS B  1 377 ? -1.748  -33.897 19.249  1.00 92.62  ? 377  LYS B CD  1 
ATOM   7928  C  CE  . LYS B  1 377 ? -3.246  -34.108 19.481  1.00 93.49  ? 377  LYS B CE  1 
ATOM   7929  N  NZ  . LYS B  1 377 ? -4.077  -33.749 18.287  1.00 93.12  ? 377  LYS B NZ  1 
ATOM   7930  N  N   . ALA B  1 378 ? 2.624   -32.704 18.150  1.00 79.96  ? 378  ALA B N   1 
ATOM   7931  C  CA  . ALA B  1 378 ? 3.613   -31.818 17.539  1.00 76.80  ? 378  ALA B CA  1 
ATOM   7932  C  C   . ALA B  1 378 ? 2.965   -30.650 16.794  1.00 75.03  ? 378  ALA B C   1 
ATOM   7933  O  O   . ALA B  1 378 ? 1.907   -30.806 16.186  1.00 76.34  ? 378  ALA B O   1 
ATOM   7934  C  CB  . ALA B  1 378 ? 4.526   -32.603 16.612  1.00 75.73  ? 378  ALA B CB  1 
ATOM   7935  N  N   . PRO B  1 379 ? 3.607   -29.473 16.836  1.00 70.88  ? 379  PRO B N   1 
ATOM   7936  C  CA  . PRO B  1 379 ? 3.091   -28.289 16.144  1.00 68.26  ? 379  PRO B CA  1 
ATOM   7937  C  C   . PRO B  1 379 ? 3.136   -28.506 14.644  1.00 63.60  ? 379  PRO B C   1 
ATOM   7938  O  O   . PRO B  1 379 ? 3.808   -29.428 14.196  1.00 60.90  ? 379  PRO B O   1 
ATOM   7939  C  CB  . PRO B  1 379 ? 4.065   -27.187 16.560  1.00 69.43  ? 379  PRO B CB  1 
ATOM   7940  C  CG  . PRO B  1 379 ? 5.308   -27.907 16.933  1.00 69.72  ? 379  PRO B CG  1 
ATOM   7941  C  CD  . PRO B  1 379 ? 4.863   -29.190 17.549  1.00 69.24  ? 379  PRO B CD  1 
ATOM   7942  N  N   . VAL B  1 380 ? 2.416   -27.688 13.884  1.00 62.92  ? 380  VAL B N   1 
ATOM   7943  C  CA  . VAL B  1 380 ? 2.339   -27.873 12.439  1.00 63.35  ? 380  VAL B CA  1 
ATOM   7944  C  C   . VAL B  1 380 ? 2.676   -26.600 11.667  1.00 63.20  ? 380  VAL B C   1 
ATOM   7945  O  O   . VAL B  1 380 ? 2.218   -25.515 12.021  1.00 64.38  ? 380  VAL B O   1 
ATOM   7946  C  CB  . VAL B  1 380 ? 0.935   -28.349 12.015  1.00 63.94  ? 380  VAL B CB  1 
ATOM   7947  C  CG1 . VAL B  1 380 ? 0.867   -28.523 10.507  1.00 63.89  ? 380  VAL B CG1 1 
ATOM   7948  C  CG2 . VAL B  1 380 ? 0.576   -29.647 12.725  1.00 64.24  ? 380  VAL B CG2 1 
ATOM   7949  N  N   . ILE B  1 381 ? 3.473   -26.739 10.611  1.00 61.52  ? 381  ILE B N   1 
ATOM   7950  C  CA  . ILE B  1 381 ? 3.779   -25.607 9.743   1.00 59.64  ? 381  ILE B CA  1 
ATOM   7951  C  C   . ILE B  1 381 ? 3.260   -25.836 8.334   1.00 59.35  ? 381  ILE B C   1 
ATOM   7952  O  O   . ILE B  1 381 ? 3.596   -26.832 7.695   1.00 60.15  ? 381  ILE B O   1 
ATOM   7953  C  CB  . ILE B  1 381 ? 5.291   -25.334 9.647   1.00 58.10  ? 381  ILE B CB  1 
ATOM   7954  C  CG1 . ILE B  1 381 ? 5.878   -25.050 11.029  1.00 58.54  ? 381  ILE B CG1 1 
ATOM   7955  C  CG2 . ILE B  1 381 ? 5.557   -24.162 8.707   1.00 55.76  ? 381  ILE B CG2 1 
ATOM   7956  C  CD1 . ILE B  1 381 ? 7.371   -24.821 11.012  1.00 58.08  ? 381  ILE B CD1 1 
ATOM   7957  N  N   . VAL B  1 382 ? 2.449   -24.902 7.849   1.00 57.86  ? 382  VAL B N   1 
ATOM   7958  C  CA  . VAL B  1 382 ? 1.946   -24.973 6.486   1.00 57.25  ? 382  VAL B CA  1 
ATOM   7959  C  C   . VAL B  1 382 ? 2.733   -24.088 5.539   1.00 58.66  ? 382  VAL B C   1 
ATOM   7960  O  O   . VAL B  1 382 ? 2.807   -22.875 5.719   1.00 59.05  ? 382  VAL B O   1 
ATOM   7961  C  CB  . VAL B  1 382 ? 0.480   -24.556 6.389   1.00 56.18  ? 382  VAL B CB  1 
ATOM   7962  C  CG1 . VAL B  1 382 ? 0.060   -24.499 4.932   1.00 53.93  ? 382  VAL B CG1 1 
ATOM   7963  C  CG2 . VAL B  1 382 ? -0.387  -25.526 7.154   1.00 57.76  ? 382  VAL B CG2 1 
ATOM   7964  N  N   . PHE B  1 383 ? 3.305   -24.712 4.519   1.00 59.97  ? 383  PHE B N   1 
ATOM   7965  C  CA  . PHE B  1 383 ? 4.005   -23.995 3.470   1.00 60.05  ? 383  PHE B CA  1 
ATOM   7966  C  C   . PHE B  1 383 ? 3.112   -23.768 2.265   1.00 59.56  ? 383  PHE B C   1 
ATOM   7967  O  O   . PHE B  1 383 ? 2.352   -24.649 1.868   1.00 60.61  ? 383  PHE B O   1 
ATOM   7968  C  CB  . PHE B  1 383 ? 5.247   -24.769 3.054   1.00 61.96  ? 383  PHE B CB  1 
ATOM   7969  C  CG  . PHE B  1 383 ? 6.333   -24.735 4.075   1.00 63.95  ? 383  PHE B CG  1 
ATOM   7970  C  CD1 . PHE B  1 383 ? 7.424   -23.904 3.911   1.00 63.79  ? 383  PHE B CD1 1 
ATOM   7971  C  CD2 . PHE B  1 383 ? 6.246   -25.508 5.217   1.00 65.50  ? 383  PHE B CD2 1 
ATOM   7972  C  CE1 . PHE B  1 383 ? 8.421   -23.857 4.854   1.00 65.09  ? 383  PHE B CE1 1 
ATOM   7973  C  CE2 . PHE B  1 383 ? 7.238   -25.467 6.165   1.00 66.56  ? 383  PHE B CE2 1 
ATOM   7974  C  CZ  . PHE B  1 383 ? 8.331   -24.638 5.985   1.00 66.20  ? 383  PHE B CZ  1 
ATOM   7975  N  N   . VAL B  1 384 ? 3.212   -22.577 1.686   1.00 57.95  ? 384  VAL B N   1 
ATOM   7976  C  CA  . VAL B  1 384 ? 2.474   -22.242 0.477   1.00 56.31  ? 384  VAL B CA  1 
ATOM   7977  C  C   . VAL B  1 384 ? 3.433   -21.758 -0.597  1.00 55.64  ? 384  VAL B C   1 
ATOM   7978  O  O   . VAL B  1 384 ? 4.114   -20.747 -0.419  1.00 52.74  ? 384  VAL B O   1 
ATOM   7979  C  CB  . VAL B  1 384 ? 1.454   -21.133 0.734   1.00 55.58  ? 384  VAL B CB  1 
ATOM   7980  C  CG1 . VAL B  1 384 ? 0.768   -20.744 -0.559  1.00 54.53  ? 384  VAL B CG1 1 
ATOM   7981  C  CG2 . VAL B  1 384 ? 0.443   -21.572 1.782   1.00 56.34  ? 384  VAL B CG2 1 
ATOM   7982  N  N   . HIS B  1 385 ? 3.467   -22.469 -1.722  1.00 58.40  ? 385  HIS B N   1 
ATOM   7983  C  CA  . HIS B  1 385 ? 4.421   -22.165 -2.788  1.00 57.08  ? 385  HIS B CA  1 
ATOM   7984  C  C   . HIS B  1 385 ? 4.149   -20.812 -3.450  1.00 51.89  ? 385  HIS B C   1 
ATOM   7985  O  O   . HIS B  1 385 ? 3.056   -20.251 -3.317  1.00 46.58  ? 385  HIS B O   1 
ATOM   7986  C  CB  . HIS B  1 385 ? 4.500   -23.304 -3.829  1.00 59.50  ? 385  HIS B CB  1 
ATOM   7987  C  CG  . HIS B  1 385 ? 3.251   -23.505 -4.639  1.00 63.20  ? 385  HIS B CG  1 
ATOM   7988  N  ND1 . HIS B  1 385 ? 2.432   -22.467 -5.031  1.00 64.83  ? 385  HIS B ND1 1 
ATOM   7989  C  CD2 . HIS B  1 385 ? 2.700   -24.630 -5.157  1.00 63.92  ? 385  HIS B CD2 1 
ATOM   7990  C  CE1 . HIS B  1 385 ? 1.423   -22.943 -5.739  1.00 64.45  ? 385  HIS B CE1 1 
ATOM   7991  N  NE2 . HIS B  1 385 ? 1.563   -24.253 -5.831  1.00 63.72  ? 385  HIS B NE2 1 
ATOM   7992  N  N   . GLY B  1 386 ? 5.166   -20.271 -4.119  1.00 51.78  ? 386  GLY B N   1 
ATOM   7993  C  CA  . GLY B  1 386 ? 4.999   -19.050 -4.885  1.00 53.01  ? 386  GLY B CA  1 
ATOM   7994  C  C   . GLY B  1 386 ? 4.067   -19.353 -6.041  1.00 57.19  ? 386  GLY B C   1 
ATOM   7995  O  O   . GLY B  1 386 ? 3.668   -20.504 -6.223  1.00 58.96  ? 386  GLY B O   1 
ATOM   7996  N  N   . GLY B  1 387 ? 3.727   -18.355 -6.845  1.00 57.96  ? 387  GLY B N   1 
ATOM   7997  C  CA  . GLY B  1 387 ? 2.664   -18.571 -7.800  1.00 60.57  ? 387  GLY B CA  1 
ATOM   7998  C  C   . GLY B  1 387 ? 2.106   -17.392 -8.567  1.00 61.69  ? 387  GLY B C   1 
ATOM   7999  O  O   . GLY B  1 387 ? 2.796   -16.410 -8.829  1.00 61.46  ? 387  GLY B O   1 
ATOM   8000  N  N   . PRO B  1 388 ? 0.836   -17.516 -8.969  1.00 62.57  ? 388  PRO B N   1 
ATOM   8001  C  CA  . PRO B  1 388 ? 0.067   -18.698 -8.561  1.00 61.19  ? 388  PRO B CA  1 
ATOM   8002  C  C   . PRO B  1 388 ? 0.577   -19.978 -9.208  1.00 59.43  ? 388  PRO B C   1 
ATOM   8003  O  O   . PRO B  1 388 ? 0.331   -21.057 -8.687  1.00 61.03  ? 388  PRO B O   1 
ATOM   8004  C  CB  . PRO B  1 388 ? -1.347  -18.385 -9.056  1.00 61.75  ? 388  PRO B CB  1 
ATOM   8005  C  CG  . PRO B  1 388 ? -1.386  -16.897 -9.177  1.00 62.78  ? 388  PRO B CG  1 
ATOM   8006  C  CD  . PRO B  1 388 ? -0.011  -16.508 -9.623  1.00 63.23  ? 388  PRO B CD  1 
ATOM   8007  N  N   . LYS B  1 389 ? 1.334   -19.859 -10.289 1.00 58.62  ? 389  LYS B N   1 
ATOM   8008  C  CA  . LYS B  1 389 ? 1.658   -21.032 -11.094 1.00 59.90  ? 389  LYS B CA  1 
ATOM   8009  C  C   . LYS B  1 389 ? 2.908   -21.794 -10.642 1.00 64.19  ? 389  LYS B C   1 
ATOM   8010  O  O   . LYS B  1 389 ? 3.385   -22.682 -11.346 1.00 65.59  ? 389  LYS B O   1 
ATOM   8011  C  CB  . LYS B  1 389 ? 1.692   -20.730 -12.594 1.00 55.15  ? 389  LYS B CB  1 
ATOM   8012  C  CG  . LYS B  1 389 ? 1.465   -21.995 -13.424 1.00 55.56  ? 389  LYS B CG  1 
ATOM   8013  C  CD  . LYS B  1 389 ? 1.154   -21.729 -14.891 1.00 55.17  ? 389  LYS B CD  1 
ATOM   8014  C  CE  . LYS B  1 389 ? 1.126   -23.037 -15.675 1.00 54.37  ? 389  LYS B CE  1 
ATOM   8015  N  NZ  . LYS B  1 389 ? 1.032   -22.806 -17.144 1.00 54.07  ? 389  LYS B NZ  1 
ATOM   8016  N  N   . GLY B  1 390 ? 3.473   -21.410 -9.501  1.00 63.82  ? 390  GLY B N   1 
ATOM   8017  C  CA  . GLY B  1 390 ? 4.511   -22.213 -8.874  1.00 61.33  ? 390  GLY B CA  1 
ATOM   8018  C  C   . GLY B  1 390 ? 3.985   -23.578 -8.454  1.00 60.56  ? 390  GLY B C   1 
ATOM   8019  O  O   . GLY B  1 390 ? 2.775   -23.771 -8.334  1.00 60.79  ? 390  GLY B O   1 
ATOM   8020  N  N   . MET B  1 391 ? 4.892   -24.522 -8.214  1.00 59.11  ? 391  MET B N   1 
ATOM   8021  C  CA  . MET B  1 391 ? 4.513   -25.898 -7.889  1.00 58.61  ? 391  MET B CA  1 
ATOM   8022  C  C   . MET B  1 391 ? 5.295   -26.459 -6.705  1.00 59.83  ? 391  MET B C   1 
ATOM   8023  O  O   . MET B  1 391 ? 6.509   -26.295 -6.630  1.00 61.88  ? 391  MET B O   1 
ATOM   8024  C  CB  . MET B  1 391 ? 4.749   -26.787 -9.114  1.00 57.15  ? 391  MET B CB  1 
ATOM   8025  C  CG  . MET B  1 391 ? 4.447   -28.259 -8.911  1.00 55.72  ? 391  MET B CG  1 
ATOM   8026  S  SD  . MET B  1 391 ? 4.428   -29.163 -10.462 1.00 69.00  ? 391  MET B SD  1 
ATOM   8027  C  CE  . MET B  1 391 ? 6.174   -29.412 -10.756 1.00 44.65  ? 391  MET B CE  1 
ATOM   8028  N  N   . TYR B  1 392 ? 4.616   -27.126 -5.778  1.00 59.87  ? 392  TYR B N   1 
ATOM   8029  C  CA  . TYR B  1 392 ? 5.344   -27.884 -4.764  1.00 61.42  ? 392  TYR B CA  1 
ATOM   8030  C  C   . TYR B  1 392 ? 5.524   -29.306 -5.251  1.00 63.67  ? 392  TYR B C   1 
ATOM   8031  O  O   . TYR B  1 392 ? 4.980   -29.682 -6.283  1.00 65.24  ? 392  TYR B O   1 
ATOM   8032  C  CB  . TYR B  1 392 ? 4.623   -27.872 -3.419  1.00 60.94  ? 392  TYR B CB  1 
ATOM   8033  C  CG  . TYR B  1 392 ? 5.103   -26.770 -2.517  1.00 59.79  ? 392  TYR B CG  1 
ATOM   8034  C  CD1 . TYR B  1 392 ? 4.238   -26.140 -1.636  1.00 59.81  ? 392  TYR B CD1 1 
ATOM   8035  C  CD2 . TYR B  1 392 ? 6.424   -26.356 -2.551  1.00 58.23  ? 392  TYR B CD2 1 
ATOM   8036  C  CE1 . TYR B  1 392 ? 4.675   -25.128 -0.816  1.00 58.62  ? 392  TYR B CE1 1 
ATOM   8037  C  CE2 . TYR B  1 392 ? 6.870   -25.349 -1.733  1.00 57.80  ? 392  TYR B CE2 1 
ATOM   8038  C  CZ  . TYR B  1 392 ? 5.992   -24.737 -0.869  1.00 58.81  ? 392  TYR B CZ  1 
ATOM   8039  O  OH  . TYR B  1 392 ? 6.438   -23.729 -0.054  1.00 60.57  ? 392  TYR B OH  1 
ATOM   8040  N  N   . GLY B  1 393 ? 6.236   -30.121 -4.487  1.00 65.47  ? 393  GLY B N   1 
ATOM   8041  C  CA  . GLY B  1 393 ? 6.712   -31.364 -5.052  1.00 67.17  ? 393  GLY B CA  1 
ATOM   8042  C  C   . GLY B  1 393 ? 7.942   -31.967 -4.411  1.00 69.54  ? 393  GLY B C   1 
ATOM   8043  O  O   . GLY B  1 393 ? 8.203   -31.805 -3.218  1.00 71.85  ? 393  GLY B O   1 
ATOM   8044  N  N   . TYR B  1 394 ? 8.667   -32.724 -5.222  1.00 69.18  ? 394  TYR B N   1 
ATOM   8045  C  CA  . TYR B  1 394 ? 9.809   -33.499 -4.768  1.00 71.16  ? 394  TYR B CA  1 
ATOM   8046  C  C   . TYR B  1 394 ? 11.166  -32.796 -4.838  1.00 73.70  ? 394  TYR B C   1 
ATOM   8047  O  O   . TYR B  1 394 ? 12.195  -33.438 -4.639  1.00 76.81  ? 394  TYR B O   1 
ATOM   8048  C  CB  . TYR B  1 394 ? 9.829   -34.859 -5.458  1.00 71.51  ? 394  TYR B CB  1 
ATOM   8049  C  CG  . TYR B  1 394 ? 8.520   -35.575 -5.259  1.00 73.83  ? 394  TYR B CG  1 
ATOM   8050  C  CD1 . TYR B  1 394 ? 7.575   -35.628 -6.275  1.00 74.97  ? 394  TYR B CD1 1 
ATOM   8051  C  CD2 . TYR B  1 394 ? 8.205   -36.155 -4.036  1.00 73.63  ? 394  TYR B CD2 1 
ATOM   8052  C  CE1 . TYR B  1 394 ? 6.368   -36.266 -6.087  1.00 75.40  ? 394  TYR B CE1 1 
ATOM   8053  C  CE2 . TYR B  1 394 ? 7.001   -36.794 -3.841  1.00 73.84  ? 394  TYR B CE2 1 
ATOM   8054  C  CZ  . TYR B  1 394 ? 6.086   -36.845 -4.868  1.00 74.71  ? 394  TYR B CZ  1 
ATOM   8055  O  OH  . TYR B  1 394 ? 4.884   -37.483 -4.679  1.00 75.90  ? 394  TYR B OH  1 
ATOM   8056  N  N   . TYR B  1 395 ? 11.194  -31.504 -5.159  1.00 70.21  ? 395  TYR B N   1 
ATOM   8057  C  CA  . TYR B  1 395 ? 12.476  -30.804 -5.109  1.00 66.16  ? 395  TYR B CA  1 
ATOM   8058  C  C   . TYR B  1 395 ? 12.906  -30.557 -3.659  1.00 66.20  ? 395  TYR B C   1 
ATOM   8059  O  O   . TYR B  1 395 ? 12.154  -30.835 -2.722  1.00 68.47  ? 395  TYR B O   1 
ATOM   8060  C  CB  . TYR B  1 395 ? 12.441  -29.495 -5.911  1.00 61.29  ? 395  TYR B CB  1 
ATOM   8061  C  CG  . TYR B  1 395 ? 11.775  -28.307 -5.232  1.00 56.13  ? 395  TYR B CG  1 
ATOM   8062  C  CD1 . TYR B  1 395 ? 10.551  -27.824 -5.677  1.00 53.55  ? 395  TYR B CD1 1 
ATOM   8063  C  CD2 . TYR B  1 395 ? 12.386  -27.650 -4.172  1.00 52.95  ? 395  TYR B CD2 1 
ATOM   8064  C  CE1 . TYR B  1 395 ? 9.948   -26.736 -5.077  1.00 50.43  ? 395  TYR B CE1 1 
ATOM   8065  C  CE2 . TYR B  1 395 ? 11.788  -26.566 -3.563  1.00 50.41  ? 395  TYR B CE2 1 
ATOM   8066  C  CZ  . TYR B  1 395 ? 10.572  -26.112 -4.022  1.00 49.80  ? 395  TYR B CZ  1 
ATOM   8067  O  OH  . TYR B  1 395 ? 9.976   -25.031 -3.418  1.00 49.80  ? 395  TYR B OH  1 
ATOM   8068  N  N   . PHE B  1 396 ? 14.097  -29.998 -3.479  1.00 62.11  ? 396  PHE B N   1 
ATOM   8069  C  CA  . PHE B  1 396 ? 14.693  -29.920 -2.153  1.00 61.05  ? 396  PHE B CA  1 
ATOM   8070  C  C   . PHE B  1 396 ? 14.443  -28.556 -1.518  1.00 59.22  ? 396  PHE B C   1 
ATOM   8071  O  O   . PHE B  1 396 ? 15.003  -27.548 -1.954  1.00 58.80  ? 396  PHE B O   1 
ATOM   8072  C  CB  . PHE B  1 396 ? 16.195  -30.198 -2.264  1.00 62.80  ? 396  PHE B CB  1 
ATOM   8073  C  CG  . PHE B  1 396 ? 16.907  -30.262 -0.947  1.00 64.22  ? 396  PHE B CG  1 
ATOM   8074  C  CD1 . PHE B  1 396 ? 17.054  -31.469 -0.284  1.00 65.63  ? 396  PHE B CD1 1 
ATOM   8075  C  CD2 . PHE B  1 396 ? 17.444  -29.118 -0.376  1.00 63.65  ? 396  PHE B CD2 1 
ATOM   8076  C  CE1 . PHE B  1 396 ? 17.715  -31.535 0.934   1.00 66.38  ? 396  PHE B CE1 1 
ATOM   8077  C  CE2 . PHE B  1 396 ? 18.106  -29.176 0.840   1.00 64.45  ? 396  PHE B CE2 1 
ATOM   8078  C  CZ  . PHE B  1 396 ? 18.241  -30.387 1.496   1.00 65.56  ? 396  PHE B CZ  1 
ATOM   8079  N  N   . LYS B  1 397 ? 13.618  -28.535 -0.475  1.00 57.90  ? 397  LYS B N   1 
ATOM   8080  C  CA  . LYS B  1 397 ? 13.313  -27.299 0.233   1.00 59.35  ? 397  LYS B CA  1 
ATOM   8081  C  C   . LYS B  1 397 ? 13.920  -27.310 1.635   1.00 59.16  ? 397  LYS B C   1 
ATOM   8082  O  O   . LYS B  1 397 ? 13.459  -28.029 2.522   1.00 60.80  ? 397  LYS B O   1 
ATOM   8083  C  CB  . LYS B  1 397 ? 11.801  -27.100 0.315   1.00 63.02  ? 397  LYS B CB  1 
ATOM   8084  C  CG  . LYS B  1 397 ? 11.360  -25.873 1.119   1.00 64.70  ? 397  LYS B CG  1 
ATOM   8085  C  CD  . LYS B  1 397 ? 11.513  -24.587 0.313   1.00 64.93  ? 397  LYS B CD  1 
ATOM   8086  C  CE  . LYS B  1 397 ? 10.886  -23.389 1.024   1.00 64.92  ? 397  LYS B CE  1 
ATOM   8087  N  NZ  . LYS B  1 397 ? 11.197  -22.103 0.334   1.00 64.72  ? 397  LYS B NZ  1 
ATOM   8088  N  N   . TYR B  1 398 ? 14.937  -26.477 1.825   1.00 57.58  ? 398  TYR B N   1 
ATOM   8089  C  CA  . TYR B  1 398 ? 15.754  -26.479 3.036   1.00 57.20  ? 398  TYR B CA  1 
ATOM   8090  C  C   . TYR B  1 398 ? 14.933  -26.285 4.314   1.00 58.99  ? 398  TYR B C   1 
ATOM   8091  O  O   . TYR B  1 398 ? 15.126  -26.994 5.307   1.00 59.50  ? 398  TYR B O   1 
ATOM   8092  C  CB  . TYR B  1 398 ? 16.841  -25.402 2.917   1.00 56.25  ? 398  TYR B CB  1 
ATOM   8093  C  CG  . TYR B  1 398 ? 17.850  -25.381 4.043   1.00 57.66  ? 398  TYR B CG  1 
ATOM   8094  C  CD1 . TYR B  1 398 ? 18.897  -26.292 4.083   1.00 58.08  ? 398  TYR B CD1 1 
ATOM   8095  C  CD2 . TYR B  1 398 ? 17.765  -24.438 5.060   1.00 59.07  ? 398  TYR B CD2 1 
ATOM   8096  C  CE1 . TYR B  1 398 ? 19.821  -26.273 5.111   1.00 58.18  ? 398  TYR B CE1 1 
ATOM   8097  C  CE2 . TYR B  1 398 ? 18.684  -24.411 6.089   1.00 58.82  ? 398  TYR B CE2 1 
ATOM   8098  C  CZ  . TYR B  1 398 ? 19.706  -25.331 6.109   1.00 58.89  ? 398  TYR B CZ  1 
ATOM   8099  O  OH  . TYR B  1 398 ? 20.621  -25.301 7.132   1.00 60.35  ? 398  TYR B OH  1 
ATOM   8100  N  N   . GLU B  1 399 ? 14.015  -25.327 4.292   1.00 59.41  ? 399  GLU B N   1 
ATOM   8101  C  CA  . GLU B  1 399 ? 13.250  -25.006 5.490   1.00 60.95  ? 399  GLU B CA  1 
ATOM   8102  C  C   . GLU B  1 399 ? 12.422  -26.180 6.005   1.00 62.49  ? 399  GLU B C   1 
ATOM   8103  O  O   . GLU B  1 399 ? 12.227  -26.323 7.210   1.00 65.47  ? 399  GLU B O   1 
ATOM   8104  C  CB  . GLU B  1 399 ? 12.357  -23.783 5.269   1.00 62.07  ? 399  GLU B CB  1 
ATOM   8105  C  CG  . GLU B  1 399 ? 13.115  -22.473 5.121   1.00 61.02  ? 399  GLU B CG  1 
ATOM   8106  C  CD  . GLU B  1 399 ? 13.437  -22.151 3.680   1.00 59.37  ? 399  GLU B CD  1 
ATOM   8107  O  OE1 . GLU B  1 399 ? 13.414  -23.076 2.842   1.00 57.68  ? 399  GLU B OE1 1 
ATOM   8108  O  OE2 . GLU B  1 399 ? 13.700  -20.968 3.386   1.00 59.50  ? 399  GLU B OE2 1 
ATOM   8109  N  N   . MET B  1 400 ? 11.937  -27.025 5.107   1.00 61.36  ? 400  MET B N   1 
ATOM   8110  C  CA  . MET B  1 400 ? 11.125  -28.153 5.545   1.00 61.09  ? 400  MET B CA  1 
ATOM   8111  C  C   . MET B  1 400 ? 11.972  -29.199 6.275   1.00 62.46  ? 400  MET B C   1 
ATOM   8112  O  O   . MET B  1 400 ? 11.569  -29.714 7.318   1.00 64.90  ? 400  MET B O   1 
ATOM   8113  C  CB  . MET B  1 400 ? 10.368  -28.769 4.370   1.00 59.01  ? 400  MET B CB  1 
ATOM   8114  C  CG  . MET B  1 400 ? 9.428   -27.798 3.681   1.00 57.58  ? 400  MET B CG  1 
ATOM   8115  S  SD  . MET B  1 400 ? 8.800   -28.472 2.142   1.00 57.45  ? 400  MET B SD  1 
ATOM   8116  C  CE  . MET B  1 400 ? 7.676   -27.183 1.635   1.00 57.71  ? 400  MET B CE  1 
ATOM   8117  N  N   . GLN B  1 401 ? 13.154  -29.495 5.749   1.00 59.48  ? 401  GLN B N   1 
ATOM   8118  C  CA  . GLN B  1 401 ? 14.029  -30.451 6.406   1.00 58.16  ? 401  GLN B CA  1 
ATOM   8119  C  C   . GLN B  1 401 ? 14.482  -29.912 7.754   1.00 57.43  ? 401  GLN B C   1 
ATOM   8120  O  O   . GLN B  1 401 ? 14.572  -30.651 8.733   1.00 54.26  ? 401  GLN B O   1 
ATOM   8121  C  CB  . GLN B  1 401 ? 15.238  -30.752 5.528   1.00 58.34  ? 401  GLN B CB  1 
ATOM   8122  C  CG  . GLN B  1 401 ? 14.870  -31.311 4.166   1.00 61.26  ? 401  GLN B CG  1 
ATOM   8123  C  CD  . GLN B  1 401 ? 14.174  -32.654 4.259   1.00 63.46  ? 401  GLN B CD  1 
ATOM   8124  O  OE1 . GLN B  1 401 ? 14.478  -33.465 5.137   1.00 63.95  ? 401  GLN B OE1 1 
ATOM   8125  N  NE2 . GLN B  1 401 ? 13.232  -32.894 3.356   1.00 63.81  ? 401  GLN B NE2 1 
ATOM   8126  N  N   . LEU B  1 402 ? 14.770  -28.616 7.796   1.00 59.24  ? 402  LEU B N   1 
ATOM   8127  C  CA  . LEU B  1 402 ? 15.216  -27.968 9.023   1.00 59.91  ? 402  LEU B CA  1 
ATOM   8128  C  C   . LEU B  1 402 ? 14.158  -28.055 10.120  1.00 62.76  ? 402  LEU B C   1 
ATOM   8129  O  O   . LEU B  1 402 ? 14.425  -28.529 11.225  1.00 63.39  ? 402  LEU B O   1 
ATOM   8130  C  CB  . LEU B  1 402 ? 15.558  -26.499 8.763   1.00 57.78  ? 402  LEU B CB  1 
ATOM   8131  C  CG  . LEU B  1 402 ? 15.984  -25.692 9.994   1.00 56.16  ? 402  LEU B CG  1 
ATOM   8132  C  CD1 . LEU B  1 402 ? 17.317  -26.191 10.526  1.00 55.76  ? 402  LEU B CD1 1 
ATOM   8133  C  CD2 . LEU B  1 402 ? 16.063  -24.213 9.668   1.00 54.40  ? 402  LEU B CD2 1 
ATOM   8134  N  N   . MET B  1 403 ? 12.953  -27.593 9.813   1.00 62.77  ? 403  MET B N   1 
ATOM   8135  C  CA  . MET B  1 403 ? 11.909  -27.534 10.824  1.00 62.85  ? 403  MET B CA  1 
ATOM   8136  C  C   . MET B  1 403 ? 11.398  -28.934 11.193  1.00 64.54  ? 403  MET B C   1 
ATOM   8137  O  O   . MET B  1 403 ? 11.007  -29.176 12.336  1.00 64.10  ? 403  MET B O   1 
ATOM   8138  C  CB  . MET B  1 403 ? 10.779  -26.596 10.383  1.00 61.71  ? 403  MET B CB  1 
ATOM   8139  C  CG  . MET B  1 403 ? 11.254  -25.201 9.977   1.00 60.60  ? 403  MET B CG  1 
ATOM   8140  S  SD  . MET B  1 403 ? 12.126  -24.307 11.288  1.00 63.15  ? 403  MET B SD  1 
ATOM   8141  C  CE  . MET B  1 403 ? 10.827  -24.168 12.509  1.00 90.48  ? 403  MET B CE  1 
ATOM   8142  N  N   . ALA B  1 404 ? 11.427  -29.856 10.232  1.00 64.61  ? 404  ALA B N   1 
ATOM   8143  C  CA  . ALA B  1 404 ? 11.107  -31.256 10.504  1.00 63.36  ? 404  ALA B CA  1 
ATOM   8144  C  C   . ALA B  1 404 ? 12.033  -31.851 11.564  1.00 63.18  ? 404  ALA B C   1 
ATOM   8145  O  O   . ALA B  1 404 ? 11.580  -32.513 12.495  1.00 65.13  ? 404  ALA B O   1 
ATOM   8146  C  CB  . ALA B  1 404 ? 11.167  -32.077 9.229   1.00 62.98  ? 404  ALA B CB  1 
ATOM   8147  N  N   . SER B  1 405 ? 13.332  -31.620 11.420  1.00 62.32  ? 405  SER B N   1 
ATOM   8148  C  CA  . SER B  1 405 ? 14.298  -32.102 12.403  1.00 62.97  ? 405  SER B CA  1 
ATOM   8149  C  C   . SER B  1 405 ? 14.125  -31.400 13.752  1.00 64.02  ? 405  SER B C   1 
ATOM   8150  O  O   . SER B  1 405 ? 14.669  -31.839 14.765  1.00 63.70  ? 405  SER B O   1 
ATOM   8151  C  CB  . SER B  1 405 ? 15.733  -31.918 11.891  1.00 60.17  ? 405  SER B CB  1 
ATOM   8152  O  OG  . SER B  1 405 ? 16.108  -30.551 11.893  1.00 57.31  ? 405  SER B OG  1 
ATOM   8153  N  N   . LYS B  1 406 ? 13.383  -30.298 13.751  1.00 65.06  ? 406  LYS B N   1 
ATOM   8154  C  CA  . LYS B  1 406 ? 13.133  -29.530 14.967  1.00 65.88  ? 406  LYS B CA  1 
ATOM   8155  C  C   . LYS B  1 406 ? 11.810  -29.878 15.672  1.00 66.62  ? 406  LYS B C   1 
ATOM   8156  O  O   . LYS B  1 406 ? 11.420  -29.232 16.652  1.00 64.56  ? 406  LYS B O   1 
ATOM   8157  C  CB  . LYS B  1 406 ? 13.275  -28.036 14.701  1.00 65.51  ? 406  LYS B CB  1 
ATOM   8158  C  CG  . LYS B  1 406 ? 14.673  -27.654 14.269  1.00 65.53  ? 406  LYS B CG  1 
ATOM   8159  C  CD  . LYS B  1 406 ? 14.823  -26.158 14.229  1.00 69.11  ? 406  LYS B CD  1 
ATOM   8160  C  CE  . LYS B  1 406 ? 14.786  -25.565 15.628  1.00 72.46  ? 406  LYS B CE  1 
ATOM   8161  N  NZ  . LYS B  1 406 ? 16.037  -25.863 16.374  1.00 73.70  ? 406  LYS B NZ  1 
ATOM   8162  N  N   . GLY B  1 407 ? 11.127  -30.898 15.158  1.00 67.62  ? 407  GLY B N   1 
ATOM   8163  C  CA  . GLY B  1 407 ? 9.911   -31.399 15.776  1.00 67.32  ? 407  GLY B CA  1 
ATOM   8164  C  C   . GLY B  1 407 ? 8.610   -30.755 15.334  1.00 66.01  ? 407  GLY B C   1 
ATOM   8165  O  O   . GLY B  1 407 ? 7.638   -30.735 16.085  1.00 65.59  ? 407  GLY B O   1 
ATOM   8166  N  N   . TYR B  1 408 ? 8.592   -30.227 14.114  1.00 65.96  ? 408  TYR B N   1 
ATOM   8167  C  CA  . TYR B  1 408 ? 7.373   -29.676 13.530  1.00 64.95  ? 408  TYR B CA  1 
ATOM   8168  C  C   . TYR B  1 408 ? 6.842   -30.599 12.446  1.00 68.04  ? 408  TYR B C   1 
ATOM   8169  O  O   . TYR B  1 408 ? 7.609   -31.272 11.760  1.00 68.07  ? 408  TYR B O   1 
ATOM   8170  C  CB  . TYR B  1 408 ? 7.626   -28.297 12.914  1.00 61.35  ? 408  TYR B CB  1 
ATOM   8171  C  CG  . TYR B  1 408 ? 8.064   -27.233 13.889  1.00 59.67  ? 408  TYR B CG  1 
ATOM   8172  C  CD1 . TYR B  1 408 ? 9.377   -27.177 14.339  1.00 59.92  ? 408  TYR B CD1 1 
ATOM   8173  C  CD2 . TYR B  1 408 ? 7.176   -26.268 14.339  1.00 59.57  ? 408  TYR B CD2 1 
ATOM   8174  C  CE1 . TYR B  1 408 ? 9.788   -26.204 15.220  1.00 60.65  ? 408  TYR B CE1 1 
ATOM   8175  C  CE2 . TYR B  1 408 ? 7.578   -25.287 15.223  1.00 60.61  ? 408  TYR B CE2 1 
ATOM   8176  C  CZ  . TYR B  1 408 ? 8.887   -25.259 15.661  1.00 61.54  ? 408  TYR B CZ  1 
ATOM   8177  O  OH  . TYR B  1 408 ? 9.305   -24.286 16.543  1.00 61.94  ? 408  TYR B OH  1 
ATOM   8178  N  N   . TYR B  1 409 ? 5.523   -30.639 12.300  1.00 71.07  ? 409  TYR B N   1 
ATOM   8179  C  CA  . TYR B  1 409 ? 4.926   -31.242 11.120  1.00 73.27  ? 409  TYR B CA  1 
ATOM   8180  C  C   . TYR B  1 409 ? 5.109   -30.278 9.953   1.00 72.15  ? 409  TYR B C   1 
ATOM   8181  O  O   . TYR B  1 409 ? 5.086   -29.055 10.130  1.00 70.92  ? 409  TYR B O   1 
ATOM   8182  C  CB  . TYR B  1 409 ? 3.437   -31.523 11.332  1.00 75.70  ? 409  TYR B CB  1 
ATOM   8183  C  CG  . TYR B  1 409 ? 3.115   -32.925 11.810  1.00 78.95  ? 409  TYR B CG  1 
ATOM   8184  C  CD1 . TYR B  1 409 ? 2.762   -33.167 13.134  1.00 79.64  ? 409  TYR B CD1 1 
ATOM   8185  C  CD2 . TYR B  1 409 ? 3.148   -34.004 10.934  1.00 81.01  ? 409  TYR B CD2 1 
ATOM   8186  C  CE1 . TYR B  1 409 ? 2.458   -34.443 13.575  1.00 80.78  ? 409  TYR B CE1 1 
ATOM   8187  C  CE2 . TYR B  1 409 ? 2.846   -35.287 11.366  1.00 82.35  ? 409  TYR B CE2 1 
ATOM   8188  C  CZ  . TYR B  1 409 ? 2.501   -35.501 12.688  1.00 82.42  ? 409  TYR B CZ  1 
ATOM   8189  O  OH  . TYR B  1 409 ? 2.199   -36.774 13.127  1.00 82.52  ? 409  TYR B OH  1 
ATOM   8190  N  N   . ILE B  1 410 ? 5.298   -30.831 8.762   1.00 69.89  ? 410  ILE B N   1 
ATOM   8191  C  CA  . ILE B  1 410 ? 5.408   -30.016 7.565   1.00 67.18  ? 410  ILE B CA  1 
ATOM   8192  C  C   . ILE B  1 410 ? 4.310   -30.406 6.586   1.00 67.76  ? 410  ILE B C   1 
ATOM   8193  O  O   . ILE B  1 410 ? 4.270   -31.544 6.122   1.00 70.01  ? 410  ILE B O   1 
ATOM   8194  C  CB  . ILE B  1 410 ? 6.772   -30.211 6.889   1.00 65.36  ? 410  ILE B CB  1 
ATOM   8195  C  CG1 . ILE B  1 410 ? 7.895   -30.094 7.918   1.00 64.79  ? 410  ILE B CG1 1 
ATOM   8196  C  CG2 . ILE B  1 410 ? 6.964   -29.192 5.782   1.00 64.73  ? 410  ILE B CG2 1 
ATOM   8197  C  CD1 . ILE B  1 410 ? 7.928   -28.762 8.624   1.00 63.96  ? 410  ILE B CD1 1 
ATOM   8198  N  N   . VAL B  1 411 ? 3.416   -29.472 6.276   1.00 65.84  ? 411  VAL B N   1 
ATOM   8199  C  CA  . VAL B  1 411 ? 2.350   -29.750 5.315   1.00 65.22  ? 411  VAL B CA  1 
ATOM   8200  C  C   . VAL B  1 411 ? 2.212   -28.681 4.229   1.00 64.36  ? 411  VAL B C   1 
ATOM   8201  O  O   . VAL B  1 411 ? 2.205   -27.488 4.518   1.00 62.88  ? 411  VAL B O   1 
ATOM   8202  C  CB  . VAL B  1 411 ? 0.988   -29.965 6.014   1.00 64.44  ? 411  VAL B CB  1 
ATOM   8203  C  CG1 . VAL B  1 411 ? 0.635   -28.772 6.876   1.00 64.43  ? 411  VAL B CG1 1 
ATOM   8204  C  CG2 . VAL B  1 411 ? -0.099  -30.218 4.985   1.00 64.87  ? 411  VAL B CG2 1 
ATOM   8205  N  N   . TYR B  1 412 ? 2.091   -29.132 2.982   1.00 66.27  ? 412  TYR B N   1 
ATOM   8206  C  CA  . TYR B  1 412 ? 1.961   -28.247 1.826   1.00 67.01  ? 412  TYR B CA  1 
ATOM   8207  C  C   . TYR B  1 412 ? 1.183   -28.917 0.693   1.00 68.88  ? 412  TYR B C   1 
ATOM   8208  O  O   . TYR B  1 412 ? 1.162   -30.140 0.585   1.00 71.30  ? 412  TYR B O   1 
ATOM   8209  C  CB  . TYR B  1 412 ? 3.343   -27.834 1.326   1.00 67.82  ? 412  TYR B CB  1 
ATOM   8210  C  CG  . TYR B  1 412 ? 4.255   -28.995 0.964   1.00 69.79  ? 412  TYR B CG  1 
ATOM   8211  C  CD1 . TYR B  1 412 ? 4.995   -29.659 1.939   1.00 70.76  ? 412  TYR B CD1 1 
ATOM   8212  C  CD2 . TYR B  1 412 ? 4.391   -29.413 -0.351  1.00 69.91  ? 412  TYR B CD2 1 
ATOM   8213  C  CE1 . TYR B  1 412 ? 5.838   -30.712 1.611   1.00 70.30  ? 412  TYR B CE1 1 
ATOM   8214  C  CE2 . TYR B  1 412 ? 5.232   -30.463 -0.687  1.00 70.89  ? 412  TYR B CE2 1 
ATOM   8215  C  CZ  . TYR B  1 412 ? 5.951   -31.109 0.297   1.00 71.56  ? 412  TYR B CZ  1 
ATOM   8216  O  OH  . TYR B  1 412 ? 6.786   -32.155 -0.039  1.00 73.36  ? 412  TYR B OH  1 
ATOM   8217  N  N   . VAL B  1 413 ? 0.562   -28.110 -0.160  1.00 68.23  ? 413  VAL B N   1 
ATOM   8218  C  CA  . VAL B  1 413 ? -0.274  -28.623 -1.250  1.00 66.27  ? 413  VAL B CA  1 
ATOM   8219  C  C   . VAL B  1 413 ? -0.092  -27.863 -2.561  1.00 64.32  ? 413  VAL B C   1 
ATOM   8220  O  O   . VAL B  1 413 ? 0.568   -26.828 -2.610  1.00 61.72  ? 413  VAL B O   1 
ATOM   8221  C  CB  . VAL B  1 413 ? -1.771  -28.622 -0.891  1.00 66.33  ? 413  VAL B CB  1 
ATOM   8222  C  CG1 . VAL B  1 413 ? -2.053  -29.628 0.203   1.00 67.21  ? 413  VAL B CG1 1 
ATOM   8223  C  CG2 . VAL B  1 413 ? -2.222  -27.227 -0.481  1.00 66.64  ? 413  VAL B CG2 1 
ATOM   8224  N  N   . ASN B  1 414 ? -0.685  -28.398 -3.623  1.00 64.97  ? 414  ASN B N   1 
ATOM   8225  C  CA  . ASN B  1 414 ? -0.692  -27.745 -4.923  1.00 64.04  ? 414  ASN B CA  1 
ATOM   8226  C  C   . ASN B  1 414 ? -2.122  -27.388 -5.278  1.00 66.73  ? 414  ASN B C   1 
ATOM   8227  O  O   . ASN B  1 414 ? -2.801  -28.135 -5.975  1.00 71.35  ? 414  ASN B O   1 
ATOM   8228  C  CB  . ASN B  1 414 ? -0.114  -28.653 -6.006  1.00 62.26  ? 414  ASN B CB  1 
ATOM   8229  C  CG  . ASN B  1 414 ? 1.392   -28.693 -5.988  1.00 62.23  ? 414  ASN B CG  1 
ATOM   8230  O  OD1 . ASN B  1 414 ? 2.042   -27.726 -5.595  1.00 64.11  ? 414  ASN B OD1 1 
ATOM   8231  N  ND2 . ASN B  1 414 ? 1.961   -29.815 -6.413  1.00 61.24  ? 414  ASN B ND2 1 
ATOM   8232  N  N   . PRO B  1 415 ? -2.591  -26.245 -4.765  1.00 65.78  ? 415  PRO B N   1 
ATOM   8233  C  CA  . PRO B  1 415 ? -3.944  -25.719 -4.952  1.00 65.12  ? 415  PRO B CA  1 
ATOM   8234  C  C   . PRO B  1 415 ? -4.161  -25.338 -6.402  1.00 65.80  ? 415  PRO B C   1 
ATOM   8235  O  O   . PRO B  1 415 ? -3.198  -25.224 -7.157  1.00 66.52  ? 415  PRO B O   1 
ATOM   8236  C  CB  . PRO B  1 415 ? -3.941  -24.460 -4.090  1.00 64.94  ? 415  PRO B CB  1 
ATOM   8237  C  CG  . PRO B  1 415 ? -2.526  -24.016 -4.116  1.00 64.44  ? 415  PRO B CG  1 
ATOM   8238  C  CD  . PRO B  1 415 ? -1.726  -25.280 -4.067  1.00 65.43  ? 415  PRO B CD  1 
ATOM   8239  N  N   . ARG B  1 416 ? -5.412  -25.153 -6.795  1.00 65.02  ? 416  ARG B N   1 
ATOM   8240  C  CA  . ARG B  1 416 ? -5.690  -24.804 -8.175  1.00 62.53  ? 416  ARG B CA  1 
ATOM   8241  C  C   . ARG B  1 416 ? -4.922  -23.537 -8.533  1.00 59.54  ? 416  ARG B C   1 
ATOM   8242  O  O   . ARG B  1 416 ? -4.746  -22.645 -7.704  1.00 58.79  ? 416  ARG B O   1 
ATOM   8243  C  CB  . ARG B  1 416 ? -7.194  -24.644 -8.411  1.00 62.27  ? 416  ARG B CB  1 
ATOM   8244  C  CG  . ARG B  1 416 ? -7.827  -23.449 -7.731  1.00 60.98  ? 416  ARG B CG  1 
ATOM   8245  C  CD  . ARG B  1 416 ? -9.318  -23.664 -7.587  1.00 61.47  ? 416  ARG B CD  1 
ATOM   8246  N  NE  . ARG B  1 416 ? -9.606  -24.763 -6.669  1.00 61.57  ? 416  ARG B NE  1 
ATOM   8247  C  CZ  . ARG B  1 416 ? -10.704 -25.509 -6.713  1.00 62.35  ? 416  ARG B CZ  1 
ATOM   8248  N  NH1 . ARG B  1 416 ? -11.629 -25.283 -7.637  1.00 63.46  ? 416  ARG B NH1 1 
ATOM   8249  N  NH2 . ARG B  1 416 ? -10.874 -26.487 -5.834  1.00 62.79  ? 416  ARG B NH2 1 
ATOM   8250  N  N   . GLY B  1 417 ? -4.462  -23.487 -9.778  1.00 57.94  ? 417  GLY B N   1 
ATOM   8251  C  CA  . GLY B  1 417 ? -3.561  -22.459 -10.259 1.00 56.70  ? 417  GLY B CA  1 
ATOM   8252  C  C   . GLY B  1 417 ? -2.135  -22.981 -10.323 1.00 58.28  ? 417  GLY B C   1 
ATOM   8253  O  O   . GLY B  1 417 ? -1.336  -22.512 -11.126 1.00 59.69  ? 417  GLY B O   1 
ATOM   8254  N  N   . SER B  1 418 ? -1.839  -24.004 -9.526  1.00 59.46  ? 418  SER B N   1 
ATOM   8255  C  CA  . SER B  1 418 ? -0.503  -24.588 -9.480  1.00 60.58  ? 418  SER B CA  1 
ATOM   8256  C  C   . SER B  1 418 ? -0.127  -25.219 -10.802 1.00 61.54  ? 418  SER B C   1 
ATOM   8257  O  O   . SER B  1 418 ? -0.982  -25.723 -11.519 1.00 63.78  ? 418  SER B O   1 
ATOM   8258  C  CB  . SER B  1 418 ? -0.414  -25.648 -8.384  1.00 63.59  ? 418  SER B CB  1 
ATOM   8259  O  OG  . SER B  1 418 ? -0.598  -25.077 -7.101  1.00 65.83  ? 418  SER B OG  1 
ATOM   8260  N  N   . ASN B  1 419 ? 1.161   -25.175 -11.118 1.00 63.24  ? 419  ASN B N   1 
ATOM   8261  C  CA  . ASN B  1 419 ? 1.715   -25.867 -12.280 1.00 67.42  ? 419  ASN B CA  1 
ATOM   8262  C  C   . ASN B  1 419 ? 1.816   -27.366 -12.022 1.00 69.42  ? 419  ASN B C   1 
ATOM   8263  O  O   . ASN B  1 419 ? 1.801   -27.801 -10.869 1.00 70.24  ? 419  ASN B O   1 
ATOM   8264  C  CB  . ASN B  1 419 ? 3.099   -25.308 -12.624 1.00 68.08  ? 419  ASN B CB  1 
ATOM   8265  C  CG  . ASN B  1 419 ? 3.460   -25.488 -14.083 1.00 68.18  ? 419  ASN B CG  1 
ATOM   8266  O  OD1 . ASN B  1 419 ? 2.825   -26.255 -14.802 1.00 71.42  ? 419  ASN B OD1 1 
ATOM   8267  N  ND2 . ASN B  1 419 ? 4.489   -24.776 -14.530 1.00 66.32  ? 419  ASN B ND2 1 
ATOM   8268  N  N   . GLY B  1 420 ? 1.917   -28.149 -13.092 1.00 70.17  ? 420  GLY B N   1 
ATOM   8269  C  CA  . GLY B  1 420 ? 2.102   -29.584 -12.967 1.00 73.92  ? 420  GLY B CA  1 
ATOM   8270  C  C   . GLY B  1 420 ? 0.824   -30.364 -13.196 1.00 78.34  ? 420  GLY B C   1 
ATOM   8271  O  O   . GLY B  1 420 ? 0.733   -31.556 -12.885 1.00 79.15  ? 420  GLY B O   1 
ATOM   8272  N  N   . TYR B  1 421 ? -0.172  -29.678 -13.741 1.00 79.22  ? 421  TYR B N   1 
ATOM   8273  C  CA  . TYR B  1 421 ? -1.473  -30.274 -13.972 1.00 77.74  ? 421  TYR B CA  1 
ATOM   8274  C  C   . TYR B  1 421 ? -2.041  -29.772 -15.293 1.00 76.07  ? 421  TYR B C   1 
ATOM   8275  O  O   . TYR B  1 421 ? -1.349  -29.115 -16.061 1.00 74.83  ? 421  TYR B O   1 
ATOM   8276  C  CB  . TYR B  1 421 ? -2.407  -29.945 -12.809 1.00 76.50  ? 421  TYR B CB  1 
ATOM   8277  C  CG  . TYR B  1 421 ? -1.860  -30.372 -11.465 1.00 76.11  ? 421  TYR B CG  1 
ATOM   8278  C  CD1 . TYR B  1 421 ? -1.242  -29.460 -10.623 1.00 76.78  ? 421  TYR B CD1 1 
ATOM   8279  C  CD2 . TYR B  1 421 ? -1.952  -31.691 -11.045 1.00 76.70  ? 421  TYR B CD2 1 
ATOM   8280  C  CE1 . TYR B  1 421 ? -0.739  -29.849 -9.391  1.00 77.40  ? 421  TYR B CE1 1 
ATOM   8281  C  CE2 . TYR B  1 421 ? -1.453  -32.089 -9.816  1.00 76.92  ? 421  TYR B CE2 1 
ATOM   8282  C  CZ  . TYR B  1 421 ? -0.847  -31.166 -8.994  1.00 77.66  ? 421  TYR B CZ  1 
ATOM   8283  O  OH  . TYR B  1 421 ? -0.348  -31.563 -7.773  1.00 78.37  ? 421  TYR B OH  1 
ATOM   8284  N  N   . SER B  1 422 ? -3.299  -30.093 -15.558 1.00 76.60  ? 422  SER B N   1 
ATOM   8285  C  CA  . SER B  1 422 ? -3.967  -29.606 -16.753 1.00 78.64  ? 422  SER B CA  1 
ATOM   8286  C  C   . SER B  1 422 ? -3.942  -28.083 -16.803 1.00 76.42  ? 422  SER B C   1 
ATOM   8287  O  O   . SER B  1 422 ? -4.003  -27.410 -15.775 1.00 76.17  ? 422  SER B O   1 
ATOM   8288  C  CB  . SER B  1 422 ? -5.417  -30.093 -16.785 1.00 82.35  ? 422  SER B CB  1 
ATOM   8289  O  OG  . SER B  1 422 ? -6.122  -29.683 -15.620 1.00 84.19  ? 422  SER B OG  1 
ATOM   8290  N  N   . GLU B  1 423 ? -3.863  -27.544 -18.012 1.00 73.81  ? 423  GLU B N   1 
ATOM   8291  C  CA  . GLU B  1 423 ? -3.940  -26.107 -18.209 1.00 71.08  ? 423  GLU B CA  1 
ATOM   8292  C  C   . GLU B  1 423 ? -5.131  -25.478 -17.482 1.00 74.04  ? 423  GLU B C   1 
ATOM   8293  O  O   . GLU B  1 423 ? -4.987  -24.450 -16.821 1.00 74.75  ? 423  GLU B O   1 
ATOM   8294  C  CB  . GLU B  1 423 ? -4.003  -25.786 -19.699 1.00 66.03  ? 423  GLU B CB  1 
ATOM   8295  C  CG  . GLU B  1 423 ? -4.313  -24.343 -19.990 1.00 64.97  ? 423  GLU B CG  1 
ATOM   8296  C  CD  . GLU B  1 423 ? -4.033  -23.980 -21.427 1.00 67.40  ? 423  GLU B CD  1 
ATOM   8297  O  OE1 . GLU B  1 423 ? -4.987  -23.602 -22.139 1.00 68.48  ? 423  GLU B OE1 1 
ATOM   8298  O  OE2 . GLU B  1 423 ? -2.857  -24.070 -21.841 1.00 66.97  ? 423  GLU B OE2 1 
ATOM   8299  N  N   . ASP B  1 424 ? -6.302  -26.097 -17.594 1.00 76.50  ? 424  ASP B N   1 
ATOM   8300  C  CA  . ASP B  1 424 ? -7.503  -25.542 -16.973 1.00 78.31  ? 424  ASP B CA  1 
ATOM   8301  C  C   . ASP B  1 424 ? -7.352  -25.486 -15.463 1.00 75.99  ? 424  ASP B C   1 
ATOM   8302  O  O   . ASP B  1 424 ? -7.893  -24.599 -14.812 1.00 75.90  ? 424  ASP B O   1 
ATOM   8303  C  CB  . ASP B  1 424 ? -8.751  -26.340 -17.356 1.00 83.09  ? 424  ASP B CB  1 
ATOM   8304  C  CG  . ASP B  1 424 ? -9.004  -26.339 -18.854 1.00 87.35  ? 424  ASP B CG  1 
ATOM   8305  O  OD1 . ASP B  1 424 ? -9.600  -25.359 -19.353 1.00 88.65  ? 424  ASP B OD1 1 
ATOM   8306  O  OD2 . ASP B  1 424 ? -8.609  -27.316 -19.533 1.00 88.08  ? 424  ASP B OD2 1 
ATOM   8307  N  N   . PHE B  1 425 ? -6.604  -26.430 -14.907 1.00 74.09  ? 425  PHE B N   1 
ATOM   8308  C  CA  . PHE B  1 425 ? -6.336  -26.422 -13.477 1.00 72.13  ? 425  PHE B CA  1 
ATOM   8309  C  C   . PHE B  1 425 ? -5.643  -25.120 -13.110 1.00 68.15  ? 425  PHE B C   1 
ATOM   8310  O  O   . PHE B  1 425 ? -6.004  -24.461 -12.139 1.00 67.08  ? 425  PHE B O   1 
ATOM   8311  C  CB  . PHE B  1 425 ? -5.468  -27.618 -13.082 1.00 73.77  ? 425  PHE B CB  1 
ATOM   8312  C  CG  . PHE B  1 425 ? -5.179  -27.700 -11.610 1.00 76.41  ? 425  PHE B CG  1 
ATOM   8313  C  CD1 . PHE B  1 425 ? -6.143  -28.158 -10.724 1.00 79.00  ? 425  PHE B CD1 1 
ATOM   8314  C  CD2 . PHE B  1 425 ? -3.945  -27.326 -11.110 1.00 78.79  ? 425  PHE B CD2 1 
ATOM   8315  C  CE1 . PHE B  1 425 ? -5.885  -28.239 -9.360  1.00 80.99  ? 425  PHE B CE1 1 
ATOM   8316  C  CE2 . PHE B  1 425 ? -3.677  -27.403 -9.747  1.00 80.69  ? 425  PHE B CE2 1 
ATOM   8317  C  CZ  . PHE B  1 425 ? -4.650  -27.863 -8.871  1.00 81.38  ? 425  PHE B CZ  1 
ATOM   8318  N  N   . ALA B  1 426 ? -4.651  -24.746 -13.907 1.00 66.60  ? 426  ALA B N   1 
ATOM   8319  C  CA  . ALA B  1 426 ? -3.898  -23.528 -13.659 1.00 65.70  ? 426  ALA B CA  1 
ATOM   8320  C  C   . ALA B  1 426 ? -4.758  -22.294 -13.902 1.00 64.88  ? 426  ALA B C   1 
ATOM   8321  O  O   . ALA B  1 426 ? -4.758  -21.358 -13.103 1.00 64.43  ? 426  ALA B O   1 
ATOM   8322  C  CB  . ALA B  1 426 ? -2.651  -23.489 -14.524 1.00 64.91  ? 426  ALA B CB  1 
ATOM   8323  N  N   . LEU B  1 427 ? -5.498  -22.295 -15.004 1.00 64.08  ? 427  LEU B N   1 
ATOM   8324  C  CA  . LEU B  1 427 ? -6.278  -21.121 -15.371 1.00 64.11  ? 427  LEU B CA  1 
ATOM   8325  C  C   . LEU B  1 427 ? -7.341  -20.783 -14.330 1.00 67.38  ? 427  LEU B C   1 
ATOM   8326  O  O   . LEU B  1 427 ? -7.767  -19.635 -14.220 1.00 69.00  ? 427  LEU B O   1 
ATOM   8327  C  CB  . LEU B  1 427 ? -6.915  -21.304 -16.747 1.00 61.93  ? 427  LEU B CB  1 
ATOM   8328  C  CG  . LEU B  1 427 ? -5.907  -21.399 -17.891 1.00 60.83  ? 427  LEU B CG  1 
ATOM   8329  C  CD1 . LEU B  1 427 ? -6.604  -21.480 -19.244 1.00 58.51  ? 427  LEU B CD1 1 
ATOM   8330  C  CD2 . LEU B  1 427 ? -4.949  -20.213 -17.846 1.00 59.80  ? 427  LEU B CD2 1 
ATOM   8331  N  N   . ARG B  1 428 ? -7.756  -21.776 -13.554 1.00 68.18  ? 428  ARG B N   1 
ATOM   8332  C  CA  . ARG B  1 428 ? -8.862  -21.585 -12.621 1.00 69.56  ? 428  ARG B CA  1 
ATOM   8333  C  C   . ARG B  1 428 ? -8.635  -20.463 -11.605 1.00 66.29  ? 428  ARG B C   1 
ATOM   8334  O  O   . ARG B  1 428 ? -9.594  -19.890 -11.085 1.00 65.93  ? 428  ARG B O   1 
ATOM   8335  C  CB  . ARG B  1 428 ? -9.180  -22.889 -11.892 1.00 73.09  ? 428  ARG B CB  1 
ATOM   8336  C  CG  . ARG B  1 428 ? -9.974  -23.888 -12.711 1.00 75.62  ? 428  ARG B CG  1 
ATOM   8337  C  CD  . ARG B  1 428 ? -9.898  -25.257 -12.066 1.00 78.66  ? 428  ARG B CD  1 
ATOM   8338  N  NE  . ARG B  1 428 ? -10.735 -26.244 -12.736 1.00 80.58  ? 428  ARG B NE  1 
ATOM   8339  C  CZ  . ARG B  1 428 ? -11.946 -26.593 -12.320 1.00 81.75  ? 428  ARG B CZ  1 
ATOM   8340  N  NH1 . ARG B  1 428 ? -12.462 -26.033 -11.233 1.00 81.10  ? 428  ARG B NH1 1 
ATOM   8341  N  NH2 . ARG B  1 428 ? -12.640 -27.501 -12.989 1.00 83.42  ? 428  ARG B NH2 1 
ATOM   8342  N  N   . VAL B  1 429 ? -7.376  -20.145 -11.322 1.00 63.11  ? 429  VAL B N   1 
ATOM   8343  C  CA  . VAL B  1 429 ? -7.078  -19.167 -10.280 1.00 61.26  ? 429  VAL B CA  1 
ATOM   8344  C  C   . VAL B  1 429 ? -7.265  -17.725 -10.746 1.00 60.50  ? 429  VAL B C   1 
ATOM   8345  O  O   . VAL B  1 429 ? -7.352  -16.816 -9.924  1.00 58.18  ? 429  VAL B O   1 
ATOM   8346  C  CB  . VAL B  1 429 ? -5.651  -19.329 -9.724  1.00 59.96  ? 429  VAL B CB  1 
ATOM   8347  C  CG1 . VAL B  1 429 ? -4.651  -18.628 -10.630 1.00 58.28  ? 429  VAL B CG1 1 
ATOM   8348  C  CG2 . VAL B  1 429 ? -5.567  -18.771 -8.309  1.00 59.26  ? 429  VAL B CG2 1 
ATOM   8349  N  N   . LEU B  1 430 ? -7.337  -17.517 -12.059 1.00 61.18  ? 430  LEU B N   1 
ATOM   8350  C  CA  . LEU B  1 430 ? -7.421  -16.162 -12.593 1.00 59.74  ? 430  LEU B CA  1 
ATOM   8351  C  C   . LEU B  1 430 ? -8.605  -15.390 -12.026 1.00 59.72  ? 430  LEU B C   1 
ATOM   8352  O  O   . LEU B  1 430 ? -9.750  -15.811 -12.122 1.00 60.13  ? 430  LEU B O   1 
ATOM   8353  C  CB  . LEU B  1 430 ? -7.509  -16.191 -14.112 1.00 61.39  ? 430  LEU B CB  1 
ATOM   8354  C  CG  . LEU B  1 430 ? -6.275  -16.739 -14.815 1.00 62.71  ? 430  LEU B CG  1 
ATOM   8355  C  CD1 . LEU B  1 430 ? -6.326  -16.333 -16.267 1.00 64.09  ? 430  LEU B CD1 1 
ATOM   8356  C  CD2 . LEU B  1 430 ? -5.018  -16.203 -14.154 1.00 62.44  ? 430  LEU B CD2 1 
ATOM   8357  N  N   . GLU B  1 431 ? -8.285  -14.247 -11.437 1.00 61.85  ? 431  GLU B N   1 
ATOM   8358  C  CA  . GLU B  1 431 ? -9.215  -13.374 -10.729 1.00 63.74  ? 431  GLU B CA  1 
ATOM   8359  C  C   . GLU B  1 431 ? -9.900  -14.138 -9.607  1.00 64.72  ? 431  GLU B C   1 
ATOM   8360  O  O   . GLU B  1 431 ? -10.915 -13.694 -9.076  1.00 65.52  ? 431  GLU B O   1 
ATOM   8361  C  CB  . GLU B  1 431 ? -10.292 -12.856 -11.693 1.00 64.39  ? 431  GLU B CB  1 
ATOM   8362  C  CG  . GLU B  1 431 ? -9.793  -12.498 -13.090 1.00 65.21  ? 431  GLU B CG  1 
ATOM   8363  C  CD  . GLU B  1 431 ? -10.883 -11.915 -13.980 1.00 66.09  ? 431  GLU B CD  1 
ATOM   8364  O  OE1 . GLU B  1 431 ? -10.886 -12.205 -15.194 1.00 68.14  ? 431  GLU B OE1 1 
ATOM   8365  O  OE2 . GLU B  1 431 ? -11.735 -11.161 -13.470 1.00 65.14  ? 431  GLU B OE2 1 
ATOM   8366  N  N   . ARG B  1 432 ? -9.333  -15.279 -9.233  1.00 65.27  ? 432  ARG B N   1 
ATOM   8367  C  CA  . ARG B  1 432 ? -9.816  -16.045 -8.086  1.00 67.80  ? 432  ARG B CA  1 
ATOM   8368  C  C   . ARG B  1 432 ? -8.984  -15.904 -6.821  1.00 68.73  ? 432  ARG B C   1 
ATOM   8369  O  O   . ARG B  1 432 ? -9.258  -16.567 -5.820  1.00 71.87  ? 432  ARG B O   1 
ATOM   8370  C  CB  . ARG B  1 432 ? -10.061 -17.517 -8.438  1.00 68.05  ? 432  ARG B CB  1 
ATOM   8371  C  CG  . ARG B  1 432 ? -11.106 -17.711 -9.530  1.00 68.49  ? 432  ARG B CG  1 
ATOM   8372  C  CD  . ARG B  1 432 ? -12.379 -16.919 -9.256  1.00 67.71  ? 432  ARG B CD  1 
ATOM   8373  N  NE  . ARG B  1 432 ? -13.216 -17.543 -8.236  1.00 68.52  ? 432  ARG B NE  1 
ATOM   8374  C  CZ  . ARG B  1 432 ? -14.402 -17.076 -7.854  1.00 69.73  ? 432  ARG B CZ  1 
ATOM   8375  N  NH1 . ARG B  1 432 ? -14.899 -15.974 -8.405  1.00 69.53  ? 432  ARG B NH1 1 
ATOM   8376  N  NH2 . ARG B  1 432 ? -15.094 -17.710 -6.917  1.00 69.88  ? 432  ARG B NH2 1 
ATOM   8377  N  N   . THR B  1 433 ? -7.941  -15.087 -6.875  1.00 64.89  ? 433  THR B N   1 
ATOM   8378  C  CA  . THR B  1 433 ? -6.917  -15.172 -5.845  1.00 62.47  ? 433  THR B CA  1 
ATOM   8379  C  C   . THR B  1 433 ? -7.507  -15.034 -4.448  1.00 62.40  ? 433  THR B C   1 
ATOM   8380  O  O   . THR B  1 433 ? -8.224  -14.075 -4.142  1.00 60.20  ? 433  THR B O   1 
ATOM   8381  C  CB  . THR B  1 433 ? -5.799  -14.141 -6.060  1.00 60.40  ? 433  THR B CB  1 
ATOM   8382  O  OG1 . THR B  1 433 ? -6.373  -12.861 -6.352  1.00 59.91  ? 433  THR B OG1 1 
ATOM   8383  C  CG2 . THR B  1 433 ? -4.919  -14.564 -7.220  1.00 59.67  ? 433  THR B CG2 1 
ATOM   8384  N  N   . GLY B  1 434 ? -7.201  -16.020 -3.612  1.00 63.72  ? 434  GLY B N   1 
ATOM   8385  C  CA  . GLY B  1 434 ? -7.643  -16.025 -2.231  1.00 63.53  ? 434  GLY B CA  1 
ATOM   8386  C  C   . GLY B  1 434 ? -9.023  -16.613 -1.997  1.00 61.56  ? 434  GLY B C   1 
ATOM   8387  O  O   . GLY B  1 434 ? -9.570  -16.469 -0.902  1.00 61.13  ? 434  GLY B O   1 
ATOM   8388  N  N   . LEU B  1 435 ? -9.598  -17.262 -3.011  1.00 59.74  ? 435  LEU B N   1 
ATOM   8389  C  CA  . LEU B  1 435 ? -10.942 -17.816 -2.855  1.00 59.72  ? 435  LEU B CA  1 
ATOM   8390  C  C   . LEU B  1 435 ? -10.983 -19.336 -2.840  1.00 62.41  ? 435  LEU B C   1 
ATOM   8391  O  O   . LEU B  1 435 ? -11.024 -19.951 -1.779  1.00 65.72  ? 435  LEU B O   1 
ATOM   8392  C  CB  . LEU B  1 435 ? -11.833 -17.317 -3.994  1.00 55.88  ? 435  LEU B CB  1 
ATOM   8393  C  CG  . LEU B  1 435 ? -11.890 -15.799 -4.098  1.00 54.06  ? 435  LEU B CG  1 
ATOM   8394  C  CD1 . LEU B  1 435 ? -12.723 -15.376 -5.294  1.00 51.96  ? 435  LEU B CD1 1 
ATOM   8395  C  CD2 . LEU B  1 435 ? -12.434 -15.213 -2.795  1.00 54.37  ? 435  LEU B CD2 1 
ATOM   8396  N  N   . GLU B  1 436 ? -10.892 -19.946 -4.011  1.00 62.45  ? 436  GLU B N   1 
ATOM   8397  C  CA  . GLU B  1 436 ? -10.950 -21.389 -4.073  1.00 65.72  ? 436  GLU B CA  1 
ATOM   8398  C  C   . GLU B  1 436 ? -9.615  -21.955 -3.631  1.00 65.90  ? 436  GLU B C   1 
ATOM   8399  O  O   . GLU B  1 436 ? -9.563  -22.842 -2.780  1.00 66.94  ? 436  GLU B O   1 
ATOM   8400  C  CB  . GLU B  1 436 ? -11.300 -21.864 -5.483  1.00 69.36  ? 436  GLU B CB  1 
ATOM   8401  C  CG  . GLU B  1 436 ? -12.797 -21.903 -5.780  1.00 72.05  ? 436  GLU B CG  1 
ATOM   8402  C  CD  . GLU B  1 436 ? -13.385 -20.532 -6.078  1.00 74.13  ? 436  GLU B CD  1 
ATOM   8403  O  OE1 . GLU B  1 436 ? -12.626 -19.622 -6.469  1.00 74.86  ? 436  GLU B OE1 1 
ATOM   8404  O  OE2 . GLU B  1 436 ? -14.614 -20.367 -5.927  1.00 74.83  ? 436  GLU B OE2 1 
ATOM   8405  N  N   . ASP B  1 437 ? -8.535  -21.411 -4.186  1.00 64.20  ? 437  ASP B N   1 
ATOM   8406  C  CA  . ASP B  1 437 ? -7.189  -21.876 -3.858  1.00 63.79  ? 437  ASP B CA  1 
ATOM   8407  C  C   . ASP B  1 437 ? -6.909  -21.803 -2.359  1.00 64.14  ? 437  ASP B C   1 
ATOM   8408  O  O   . ASP B  1 437 ? -6.204  -22.648 -1.808  1.00 64.62  ? 437  ASP B O   1 
ATOM   8409  C  CB  . ASP B  1 437 ? -6.125  -21.112 -4.654  1.00 64.12  ? 437  ASP B CB  1 
ATOM   8410  C  CG  . ASP B  1 437 ? -6.169  -19.611 -4.418  1.00 63.83  ? 437  ASP B CG  1 
ATOM   8411  O  OD1 . ASP B  1 437 ? -7.247  -19.080 -4.086  1.00 66.71  ? 437  ASP B OD1 1 
ATOM   8412  O  OD2 . ASP B  1 437 ? -5.121  -18.956 -4.583  1.00 60.57  ? 437  ASP B OD2 1 
ATOM   8413  N  N   . PHE B  1 438 ? -7.473  -20.798 -1.700  1.00 63.58  ? 438  PHE B N   1 
ATOM   8414  C  CA  . PHE B  1 438 ? -7.357  -20.710 -0.254  1.00 63.93  ? 438  PHE B CA  1 
ATOM   8415  C  C   . PHE B  1 438 ? -8.146  -21.852 0.366   1.00 67.74  ? 438  PHE B C   1 
ATOM   8416  O  O   . PHE B  1 438 ? -7.683  -22.498 1.306   1.00 71.24  ? 438  PHE B O   1 
ATOM   8417  C  CB  . PHE B  1 438 ? -7.849  -19.359 0.268   1.00 61.77  ? 438  PHE B CB  1 
ATOM   8418  C  CG  . PHE B  1 438 ? -7.780  -19.227 1.765   1.00 62.07  ? 438  PHE B CG  1 
ATOM   8419  C  CD1 . PHE B  1 438 ? -6.705  -19.741 2.475   1.00 61.22  ? 438  PHE B CD1 1 
ATOM   8420  C  CD2 . PHE B  1 438 ? -8.783  -18.577 2.464   1.00 63.17  ? 438  PHE B CD2 1 
ATOM   8421  C  CE1 . PHE B  1 438 ? -6.640  -19.617 3.856   1.00 59.37  ? 438  PHE B CE1 1 
ATOM   8422  C  CE2 . PHE B  1 438 ? -8.719  -18.451 3.847   1.00 61.25  ? 438  PHE B CE2 1 
ATOM   8423  C  CZ  . PHE B  1 438 ? -7.645  -18.973 4.538   1.00 59.71  ? 438  PHE B CZ  1 
ATOM   8424  N  N   . GLN B  1 439 ? -9.336  -22.106 -0.170  1.00 66.14  ? 439  GLN B N   1 
ATOM   8425  C  CA  . GLN B  1 439 ? -10.151 -23.213 0.305   1.00 64.61  ? 439  GLN B CA  1 
ATOM   8426  C  C   . GLN B  1 439 ? -9.435  -24.548 0.096   1.00 60.73  ? 439  GLN B C   1 
ATOM   8427  O  O   . GLN B  1 439 ? -9.509  -25.431 0.951   1.00 57.93  ? 439  GLN B O   1 
ATOM   8428  C  CB  . GLN B  1 439 ? -11.514 -23.205 -0.381  1.00 68.98  ? 439  GLN B CB  1 
ATOM   8429  C  CG  . GLN B  1 439 ? -12.355 -21.985 -0.038  1.00 72.52  ? 439  GLN B CG  1 
ATOM   8430  C  CD  . GLN B  1 439 ? -12.666 -21.894 1.444   1.00 75.08  ? 439  GLN B CD  1 
ATOM   8431  O  OE1 . GLN B  1 439 ? -12.807 -22.911 2.121   1.00 77.10  ? 439  GLN B OE1 1 
ATOM   8432  N  NE2 . GLN B  1 439 ? -12.768 -20.671 1.956   1.00 74.27  ? 439  GLN B NE2 1 
ATOM   8433  N  N   . ASP B  1 440 ? -8.738  -24.686 -1.032  1.00 58.92  ? 440  ASP B N   1 
ATOM   8434  C  CA  . ASP B  1 440 ? -7.945  -25.880 -1.297  1.00 57.86  ? 440  ASP B CA  1 
ATOM   8435  C  C   . ASP B  1 440 ? -6.939  -26.083 -0.182  1.00 56.76  ? 440  ASP B C   1 
ATOM   8436  O  O   . ASP B  1 440 ? -6.768  -27.187 0.339   1.00 55.82  ? 440  ASP B O   1 
ATOM   8437  C  CB  . ASP B  1 440 ? -7.194  -25.746 -2.616  1.00 58.84  ? 440  ASP B CB  1 
ATOM   8438  C  CG  . ASP B  1 440 ? -8.117  -25.710 -3.806  1.00 60.96  ? 440  ASP B CG  1 
ATOM   8439  O  OD1 . ASP B  1 440 ? -9.341  -25.808 -3.594  1.00 65.32  ? 440  ASP B OD1 1 
ATOM   8440  O  OD2 . ASP B  1 440 ? -7.621  -25.602 -4.949  1.00 57.97  ? 440  ASP B OD2 1 
ATOM   8441  N  N   . ILE B  1 441 ? -6.259  -25.001 0.169   1.00 56.27  ? 441  ILE B N   1 
ATOM   8442  C  CA  . ILE B  1 441 ? -5.262  -25.036 1.221   1.00 56.30  ? 441  ILE B CA  1 
ATOM   8443  C  C   . ILE B  1 441 ? -5.874  -25.495 2.550   1.00 62.75  ? 441  ILE B C   1 
ATOM   8444  O  O   . ILE B  1 441 ? -5.337  -26.388 3.209   1.00 67.04  ? 441  ILE B O   1 
ATOM   8445  C  CB  . ILE B  1 441 ? -4.544  -23.674 1.334   1.00 50.70  ? 441  ILE B CB  1 
ATOM   8446  C  CG1 . ILE B  1 441 ? -3.546  -23.538 0.182   1.00 51.65  ? 441  ILE B CG1 1 
ATOM   8447  C  CG2 . ILE B  1 441 ? -3.832  -23.544 2.662   1.00 47.44  ? 441  ILE B CG2 1 
ATOM   8448  C  CD1 . ILE B  1 441 ? -2.916  -22.171 0.051   1.00 51.60  ? 441  ILE B CD1 1 
ATOM   8449  N  N   . LEU B  1 442 ? -7.005  -24.906 2.931   1.00 62.35  ? 442  LEU B N   1 
ATOM   8450  C  CA  . LEU B  1 442 ? -7.695  -25.305 4.159   1.00 61.80  ? 442  LEU B CA  1 
ATOM   8451  C  C   . LEU B  1 442 ? -8.080  -26.783 4.155   1.00 65.14  ? 442  LEU B C   1 
ATOM   8452  O  O   . LEU B  1 442 ? -7.808  -27.505 5.117   1.00 66.27  ? 442  LEU B O   1 
ATOM   8453  C  CB  . LEU B  1 442 ? -8.941  -24.447 4.382   1.00 57.93  ? 442  LEU B CB  1 
ATOM   8454  C  CG  . LEU B  1 442 ? -8.696  -22.961 4.641   1.00 54.70  ? 442  LEU B CG  1 
ATOM   8455  C  CD1 . LEU B  1 442 ? -9.994  -22.185 4.526   1.00 53.26  ? 442  LEU B CD1 1 
ATOM   8456  C  CD2 . LEU B  1 442 ? -8.029  -22.734 6.000   1.00 53.62  ? 442  LEU B CD2 1 
ATOM   8457  N  N   . ASN B  1 443 ? -8.719  -27.223 3.073   1.00 67.41  ? 443  ASN B N   1 
ATOM   8458  C  CA  . ASN B  1 443 ? -9.171  -28.606 2.951   1.00 69.56  ? 443  ASN B CA  1 
ATOM   8459  C  C   . ASN B  1 443 ? -8.024  -29.611 3.024   1.00 72.22  ? 443  ASN B C   1 
ATOM   8460  O  O   . ASN B  1 443 ? -8.169  -30.692 3.603   1.00 73.36  ? 443  ASN B O   1 
ATOM   8461  C  CB  . ASN B  1 443 ? -9.980  -28.800 1.664   1.00 68.56  ? 443  ASN B CB  1 
ATOM   8462  C  CG  . ASN B  1 443 ? -11.254 -27.969 1.646   1.00 69.81  ? 443  ASN B CG  1 
ATOM   8463  O  OD1 . ASN B  1 443 ? -11.823 -27.651 2.693   1.00 69.71  ? 443  ASN B OD1 1 
ATOM   8464  N  ND2 . ASN B  1 443 ? -11.709 -27.613 0.451   1.00 70.77  ? 443  ASN B ND2 1 
ATOM   8465  N  N   . GLY B  1 444 ? -6.885  -29.249 2.439   1.00 72.02  ? 444  GLY B N   1 
ATOM   8466  C  CA  . GLY B  1 444 ? -5.708  -30.093 2.496   1.00 71.46  ? 444  GLY B CA  1 
ATOM   8467  C  C   . GLY B  1 444 ? -5.247  -30.255 3.930   1.00 70.95  ? 444  GLY B C   1 
ATOM   8468  O  O   . GLY B  1 444 ? -4.693  -31.289 4.299   1.00 71.89  ? 444  GLY B O   1 
ATOM   8469  N  N   . ILE B  1 445 ? -5.474  -29.224 4.739   1.00 68.85  ? 445  ILE B N   1 
ATOM   8470  C  CA  . ILE B  1 445 ? -5.092  -29.267 6.143   1.00 68.18  ? 445  ILE B CA  1 
ATOM   8471  C  C   . ILE B  1 445 ? -6.010  -30.213 6.914   1.00 70.81  ? 445  ILE B C   1 
ATOM   8472  O  O   . ILE B  1 445 ? -5.535  -31.085 7.645   1.00 72.69  ? 445  ILE B O   1 
ATOM   8473  C  CB  . ILE B  1 445 ? -5.115  -27.869 6.797   1.00 65.17  ? 445  ILE B CB  1 
ATOM   8474  C  CG1 . ILE B  1 445 ? -4.220  -26.898 6.025   1.00 63.74  ? 445  ILE B CG1 1 
ATOM   8475  C  CG2 . ILE B  1 445 ? -4.655  -27.951 8.242   1.00 64.01  ? 445  ILE B CG2 1 
ATOM   8476  C  CD1 . ILE B  1 445 ? -4.112  -25.527 6.665   1.00 61.48  ? 445  ILE B CD1 1 
ATOM   8477  N  N   . GLU B  1 446 ? -7.321  -30.040 6.745   1.00 70.40  ? 446  GLU B N   1 
ATOM   8478  C  CA  . GLU B  1 446 ? -8.297  -30.923 7.379   1.00 70.27  ? 446  GLU B CA  1 
ATOM   8479  C  C   . GLU B  1 446 ? -8.003  -32.394 7.060   1.00 71.83  ? 446  GLU B C   1 
ATOM   8480  O  O   . GLU B  1 446 ? -7.991  -33.238 7.961   1.00 73.99  ? 446  GLU B O   1 
ATOM   8481  C  CB  . GLU B  1 446 ? -9.726  -30.558 6.960   1.00 68.64  ? 446  GLU B CB  1 
ATOM   8482  N  N   . GLU B  1 447 ? -7.754  -32.700 5.788   1.00 69.12  ? 447  GLU B N   1 
ATOM   8483  C  CA  . GLU B  1 447 ? -7.450  -34.075 5.408   1.00 69.46  ? 447  GLU B CA  1 
ATOM   8484  C  C   . GLU B  1 447 ? -6.149  -34.545 6.053   1.00 68.70  ? 447  GLU B C   1 
ATOM   8485  O  O   . GLU B  1 447 ? -6.048  -35.688 6.503   1.00 70.43  ? 447  GLU B O   1 
ATOM   8486  C  CB  . GLU B  1 447 ? -7.399  -34.244 3.886   1.00 70.19  ? 447  GLU B CB  1 
ATOM   8487  C  CG  . GLU B  1 447 ? -7.007  -35.657 3.419   1.00 71.07  ? 447  GLU B CG  1 
ATOM   8488  C  CD  . GLU B  1 447 ? -8.019  -36.737 3.807   1.00 71.63  ? 447  GLU B CD  1 
ATOM   8489  O  OE1 . GLU B  1 447 ? -7.729  -37.936 3.580   1.00 71.58  ? 447  GLU B OE1 1 
ATOM   8490  O  OE2 . GLU B  1 447 ? -9.101  -36.390 4.331   1.00 69.60  ? 447  GLU B OE2 1 
ATOM   8491  N  N   . PHE B  1 448 ? -5.157  -33.664 6.104   1.00 65.98  ? 448  PHE B N   1 
ATOM   8492  C  CA  . PHE B  1 448 ? -3.904  -33.996 6.770   1.00 64.60  ? 448  PHE B CA  1 
ATOM   8493  C  C   . PHE B  1 448 ? -4.116  -34.253 8.267   1.00 67.74  ? 448  PHE B C   1 
ATOM   8494  O  O   . PHE B  1 448 ? -3.589  -35.220 8.814   1.00 68.73  ? 448  PHE B O   1 
ATOM   8495  C  CB  . PHE B  1 448 ? -2.854  -32.900 6.557   1.00 59.98  ? 448  PHE B CB  1 
ATOM   8496  C  CG  . PHE B  1 448 ? -1.789  -32.879 7.615   1.00 57.08  ? 448  PHE B CG  1 
ATOM   8497  C  CD1 . PHE B  1 448 ? -0.767  -33.816 7.610   1.00 55.52  ? 448  PHE B CD1 1 
ATOM   8498  C  CD2 . PHE B  1 448 ? -1.825  -31.935 8.632   1.00 57.08  ? 448  PHE B CD2 1 
ATOM   8499  C  CE1 . PHE B  1 448 ? 0.206   -33.807 8.596   1.00 55.95  ? 448  PHE B CE1 1 
ATOM   8500  C  CE2 . PHE B  1 448 ? -0.856  -31.916 9.623   1.00 56.69  ? 448  PHE B CE2 1 
ATOM   8501  C  CZ  . PHE B  1 448 ? 0.161   -32.852 9.607   1.00 56.65  ? 448  PHE B CZ  1 
ATOM   8502  N  N   . LEU B  1 449 ? -4.891  -33.389 8.921   1.00 68.56  ? 449  LEU B N   1 
ATOM   8503  C  CA  . LEU B  1 449 ? -5.155  -33.518 10.351  1.00 70.22  ? 449  LEU B CA  1 
ATOM   8504  C  C   . LEU B  1 449 ? -5.891  -34.812 10.676  1.00 75.19  ? 449  LEU B C   1 
ATOM   8505  O  O   . LEU B  1 449 ? -5.721  -35.386 11.755  1.00 75.95  ? 449  LEU B O   1 
ATOM   8506  C  CB  . LEU B  1 449 ? -5.972  -32.332 10.848  1.00 68.56  ? 449  LEU B CB  1 
ATOM   8507  C  CG  . LEU B  1 449 ? -5.237  -31.003 10.942  1.00 66.78  ? 449  LEU B CG  1 
ATOM   8508  C  CD1 . LEU B  1 449 ? -6.199  -29.918 11.409  1.00 66.67  ? 449  LEU B CD1 1 
ATOM   8509  C  CD2 . LEU B  1 449 ? -4.059  -31.141 11.888  1.00 65.72  ? 449  LEU B CD2 1 
ATOM   8510  N  N   . ARG B  1 450 ? -6.727  -35.254 9.744   1.00 77.90  ? 450  ARG B N   1 
ATOM   8511  C  CA  . ARG B  1 450 ? -7.393  -36.537 9.879   1.00 81.33  ? 450  ARG B CA  1 
ATOM   8512  C  C   . ARG B  1 450 ? -6.350  -37.660 9.894   1.00 80.50  ? 450  ARG B C   1 
ATOM   8513  O  O   . ARG B  1 450 ? -6.288  -38.450 10.839  1.00 79.82  ? 450  ARG B O   1 
ATOM   8514  C  CB  . ARG B  1 450 ? -8.397  -36.737 8.739   1.00 84.92  ? 450  ARG B CB  1 
ATOM   8515  C  CG  . ARG B  1 450 ? -9.414  -37.850 8.987   1.00 88.01  ? 450  ARG B CG  1 
ATOM   8516  C  CD  . ARG B  1 450 ? -10.317 -38.100 7.777   1.00 89.80  ? 450  ARG B CD  1 
ATOM   8517  N  NE  . ARG B  1 450 ? -9.572  -38.538 6.597   1.00 92.09  ? 450  ARG B NE  1 
ATOM   8518  C  CZ  . ARG B  1 450 ? -9.226  -39.799 6.347   1.00 93.81  ? 450  ARG B CZ  1 
ATOM   8519  N  NH1 . ARG B  1 450 ? -9.550  -40.762 7.198   1.00 94.85  ? 450  ARG B NH1 1 
ATOM   8520  N  NH2 . ARG B  1 450 ? -8.550  -40.100 5.247   1.00 93.91  ? 450  ARG B NH2 1 
ATOM   8521  N  N   . LEU B  1 451 ? -5.520  -37.711 8.853   1.00 79.55  ? 451  LEU B N   1 
ATOM   8522  C  CA  . LEU B  1 451 ? -4.546  -38.793 8.671   1.00 78.49  ? 451  LEU B CA  1 
ATOM   8523  C  C   . LEU B  1 451 ? -3.543  -38.905 9.815   1.00 80.29  ? 451  LEU B C   1 
ATOM   8524  O  O   . LEU B  1 451 ? -2.968  -39.972 10.053  1.00 79.81  ? 451  LEU B O   1 
ATOM   8525  C  CB  . LEU B  1 451 ? -3.778  -38.608 7.364   1.00 74.59  ? 451  LEU B CB  1 
ATOM   8526  C  CG  . LEU B  1 451 ? -4.596  -38.623 6.076   1.00 73.86  ? 451  LEU B CG  1 
ATOM   8527  C  CD1 . LEU B  1 451 ? -3.703  -38.271 4.907   1.00 74.18  ? 451  LEU B CD1 1 
ATOM   8528  C  CD2 . LEU B  1 451 ? -5.262  -39.976 5.866   1.00 73.42  ? 451  LEU B CD2 1 
ATOM   8529  N  N   . GLU B  1 452 ? -3.318  -37.792 10.501  1.00 81.09  ? 452  GLU B N   1 
ATOM   8530  C  CA  . GLU B  1 452 ? -2.308  -37.729 11.544  1.00 81.93  ? 452  GLU B CA  1 
ATOM   8531  C  C   . GLU B  1 452 ? -2.883  -37.066 12.784  1.00 82.74  ? 452  GLU B C   1 
ATOM   8532  O  O   . GLU B  1 452 ? -2.791  -35.849 12.952  1.00 82.05  ? 452  GLU B O   1 
ATOM   8533  C  CB  . GLU B  1 452 ? -1.073  -36.978 11.045  1.00 81.44  ? 452  GLU B CB  1 
ATOM   8534  C  CG  . GLU B  1 452 ? -0.323  -37.691 9.923   1.00 80.97  ? 452  GLU B CG  1 
ATOM   8535  C  CD  . GLU B  1 452 ? 0.651   -38.734 10.439  1.00 80.20  ? 452  GLU B CD  1 
ATOM   8536  O  OE1 . GLU B  1 452 ? 1.085   -39.595 9.647   1.00 77.11  ? 452  GLU B OE1 1 
ATOM   8537  O  OE2 . GLU B  1 452 ? 0.993   -38.687 11.639  1.00 83.24  ? 452  GLU B OE2 1 
ATOM   8538  N  N   . PRO B  1 453 ? -3.500  -37.874 13.653  1.00 83.79  ? 453  PRO B N   1 
ATOM   8539  C  CA  . PRO B  1 453 ? -4.101  -37.390 14.897  1.00 82.95  ? 453  PRO B CA  1 
ATOM   8540  C  C   . PRO B  1 453 ? -3.034  -36.844 15.838  1.00 81.84  ? 453  PRO B C   1 
ATOM   8541  O  O   . PRO B  1 453 ? -3.361  -36.137 16.789  1.00 82.38  ? 453  PRO B O   1 
ATOM   8542  C  CB  . PRO B  1 453 ? -4.752  -38.647 15.484  1.00 82.16  ? 453  PRO B CB  1 
ATOM   8543  C  CG  . PRO B  1 453 ? -3.998  -39.780 14.884  1.00 82.64  ? 453  PRO B CG  1 
ATOM   8544  C  CD  . PRO B  1 453 ? -3.624  -39.334 13.507  1.00 83.75  ? 453  PRO B CD  1 
ATOM   8545  N  N   . GLN B  1 454 ? -1.774  -37.179 15.579  1.00 80.49  ? 454  GLN B N   1 
ATOM   8546  C  CA  . GLN B  1 454 ? -0.674  -36.701 16.414  1.00 79.92  ? 454  GLN B CA  1 
ATOM   8547  C  C   . GLN B  1 454 ? -0.313  -35.239 16.122  1.00 80.91  ? 454  GLN B C   1 
ATOM   8548  O  O   . GLN B  1 454 ? 0.487   -34.634 16.840  1.00 82.40  ? 454  GLN B O   1 
ATOM   8549  C  CB  . GLN B  1 454 ? 0.560   -37.602 16.270  1.00 77.66  ? 454  GLN B CB  1 
ATOM   8550  C  CG  . GLN B  1 454 ? 0.480   -38.908 17.051  1.00 74.80  ? 454  GLN B CG  1 
ATOM   8551  C  CD  . GLN B  1 454 ? 1.685   -39.805 16.826  1.00 72.59  ? 454  GLN B CD  1 
ATOM   8552  O  OE1 . GLN B  1 454 ? 1.820   -40.427 15.774  1.00 72.30  ? 454  GLN B OE1 1 
ATOM   8553  N  NE2 . GLN B  1 454 ? 2.565   -39.877 17.817  1.00 71.36  ? 454  GLN B NE2 1 
ATOM   8554  N  N   . ALA B  1 455 ? -0.902  -34.678 15.070  1.00 78.96  ? 455  ALA B N   1 
ATOM   8555  C  CA  . ALA B  1 455 ? -0.724  -33.263 14.764  1.00 76.94  ? 455  ALA B CA  1 
ATOM   8556  C  C   . ALA B  1 455 ? -1.588  -32.427 15.698  1.00 77.04  ? 455  ALA B C   1 
ATOM   8557  O  O   . ALA B  1 455 ? -2.773  -32.702 15.864  1.00 78.55  ? 455  ALA B O   1 
ATOM   8558  C  CB  . ALA B  1 455 ? -1.090  -32.983 13.320  1.00 77.38  ? 455  ALA B CB  1 
ATOM   8559  N  N   . ASP B  1 456 ? -1.015  -31.378 16.273  1.00 76.01  ? 456  ASP B N   1 
ATOM   8560  C  CA  . ASP B  1 456 ? -1.731  -30.620 17.280  1.00 74.60  ? 456  ASP B CA  1 
ATOM   8561  C  C   . ASP B  1 456 ? -2.488  -29.499 16.589  1.00 73.17  ? 456  ASP B C   1 
ATOM   8562  O  O   . ASP B  1 456 ? -1.896  -28.534 16.116  1.00 69.67  ? 456  ASP B O   1 
ATOM   8563  C  CB  . ASP B  1 456 ? -0.732  -30.041 18.284  1.00 75.27  ? 456  ASP B CB  1 
ATOM   8564  C  CG  . ASP B  1 456 ? -1.403  -29.256 19.394  1.00 76.95  ? 456  ASP B CG  1 
ATOM   8565  O  OD1 . ASP B  1 456 ? -2.616  -28.988 19.287  1.00 77.42  ? 456  ASP B OD1 1 
ATOM   8566  O  OD2 . ASP B  1 456 ? -0.715  -28.897 20.373  1.00 77.58  ? 456  ASP B OD2 1 
ATOM   8567  N  N   . ARG B  1 457 ? -3.812  -29.615 16.573  1.00 76.11  ? 457  ARG B N   1 
ATOM   8568  C  CA  . ARG B  1 457 ? -4.653  -28.663 15.859  1.00 79.85  ? 457  ARG B CA  1 
ATOM   8569  C  C   . ARG B  1 457 ? -4.597  -27.317 16.561  1.00 78.40  ? 457  ARG B C   1 
ATOM   8570  O  O   . ARG B  1 457 ? -5.000  -26.293 16.015  1.00 78.68  ? 457  ARG B O   1 
ATOM   8571  C  CB  . ARG B  1 457 ? -6.103  -29.159 15.789  1.00 85.69  ? 457  ARG B CB  1 
ATOM   8572  C  CG  . ARG B  1 457 ? -6.265  -30.677 15.908  1.00 92.19  ? 457  ARG B CG  1 
ATOM   8573  C  CD  . ARG B  1 457 ? -6.860  -31.288 14.639  1.00 96.28  ? 457  ARG B CD  1 
ATOM   8574  N  NE  . ARG B  1 457 ? -7.287  -32.673 14.832  1.00 98.25  ? 457  ARG B NE  1 
ATOM   8575  C  CZ  . ARG B  1 457 ? -8.276  -33.248 14.152  1.00 99.98  ? 457  ARG B CZ  1 
ATOM   8576  N  NH1 . ARG B  1 457 ? -8.945  -32.557 13.237  1.00 100.38 ? 457  ARG B NH1 1 
ATOM   8577  N  NH2 . ARG B  1 457 ? -8.601  -34.512 14.390  1.00 100.55 ? 457  ARG B NH2 1 
ATOM   8578  N  N   . GLU B  1 458 ? -4.096  -27.320 17.786  1.00 77.63  ? 458  GLU B N   1 
ATOM   8579  C  CA  . GLU B  1 458 ? -4.030  -26.098 18.570  1.00 76.79  ? 458  GLU B CA  1 
ATOM   8580  C  C   . GLU B  1 458 ? -2.859  -25.215 18.132  1.00 74.87  ? 458  GLU B C   1 
ATOM   8581  O  O   . GLU B  1 458 ? -2.957  -23.993 18.182  1.00 74.46  ? 458  GLU B O   1 
ATOM   8582  C  CB  . GLU B  1 458 ? -3.968  -26.409 20.067  1.00 76.49  ? 458  GLU B CB  1 
ATOM   8583  N  N   . ARG B  1 459 ? -1.745  -25.819 17.725  1.00 73.02  ? 459  ARG B N   1 
ATOM   8584  C  CA  . ARG B  1 459 ? -0.661  -25.016 17.171  1.00 71.08  ? 459  ARG B CA  1 
ATOM   8585  C  C   . ARG B  1 459 ? -0.407  -25.315 15.695  1.00 69.94  ? 459  ARG B C   1 
ATOM   8586  O  O   . ARG B  1 459 ? 0.242   -26.303 15.349  1.00 70.47  ? 459  ARG B O   1 
ATOM   8587  C  CB  . ARG B  1 459 ? 0.620   -25.272 17.960  1.00 69.46  ? 459  ARG B CB  1 
ATOM   8588  C  CG  . ARG B  1 459 ? 0.492   -25.054 19.450  1.00 67.63  ? 459  ARG B CG  1 
ATOM   8589  C  CD  . ARG B  1 459 ? 1.693   -25.640 20.170  1.00 67.84  ? 459  ARG B CD  1 
ATOM   8590  N  NE  . ARG B  1 459 ? 1.686   -27.099 20.146  1.00 69.42  ? 459  ARG B NE  1 
ATOM   8591  C  CZ  . ARG B  1 459 ? 2.707   -27.859 20.528  1.00 69.88  ? 459  ARG B CZ  1 
ATOM   8592  N  NH1 . ARG B  1 459 ? 3.834   -27.303 20.953  1.00 68.74  ? 459  ARG B NH1 1 
ATOM   8593  N  NH2 . ARG B  1 459 ? 2.601   -29.180 20.476  1.00 70.47  ? 459  ARG B NH2 1 
ATOM   8594  N  N   . ILE B  1 460 ? -0.835  -24.399 14.837  1.00 68.08  ? 460  ILE B N   1 
ATOM   8595  C  CA  . ILE B  1 460 ? -0.583  -24.510 13.411  1.00 67.16  ? 460  ILE B CA  1 
ATOM   8596  C  C   . ILE B  1 460 ? -0.171  -23.148 12.887  1.00 65.88  ? 460  ILE B C   1 
ATOM   8597  O  O   . ILE B  1 460 ? -0.928  -22.177 12.998  1.00 65.33  ? 460  ILE B O   1 
ATOM   8598  C  CB  . ILE B  1 460 ? -1.826  -24.991 12.634  1.00 67.02  ? 460  ILE B CB  1 
ATOM   8599  C  CG1 . ILE B  1 460 ? -2.249  -26.386 13.091  1.00 66.79  ? 460  ILE B CG1 1 
ATOM   8600  C  CG2 . ILE B  1 460 ? -1.543  -25.002 11.142  1.00 67.82  ? 460  ILE B CG2 1 
ATOM   8601  C  CD1 . ILE B  1 460 ? -3.470  -26.908 12.365  1.00 67.62  ? 460  ILE B CD1 1 
ATOM   8602  N  N   . GLY B  1 461 ? 1.037   -23.071 12.345  1.00 64.40  ? 461  GLY B N   1 
ATOM   8603  C  CA  . GLY B  1 461 ? 1.491   -21.861 11.693  1.00 63.96  ? 461  GLY B CA  1 
ATOM   8604  C  C   . GLY B  1 461 ? 1.462   -22.028 10.191  1.00 64.10  ? 461  GLY B C   1 
ATOM   8605  O  O   . GLY B  1 461 ? 1.330   -23.144 9.685   1.00 65.66  ? 461  GLY B O   1 
ATOM   8606  N  N   . ILE B  1 462 ? 1.623   -20.923 9.475   1.00 60.88  ? 462  ILE B N   1 
ATOM   8607  C  CA  . ILE B  1 462 ? 1.642   -20.963 8.023   1.00 58.15  ? 462  ILE B CA  1 
ATOM   8608  C  C   . ILE B  1 462 ? 2.674   -19.971 7.488   1.00 58.57  ? 462  ILE B C   1 
ATOM   8609  O  O   . ILE B  1 462 ? 2.808   -18.859 8.002   1.00 61.85  ? 462  ILE B O   1 
ATOM   8610  C  CB  . ILE B  1 462 ? 0.255   -20.660 7.455   1.00 56.47  ? 462  ILE B CB  1 
ATOM   8611  C  CG1 . ILE B  1 462 ? 0.265   -20.779 5.935   1.00 56.92  ? 462  ILE B CG1 1 
ATOM   8612  C  CG2 . ILE B  1 462 ? -0.219  -19.284 7.910   1.00 55.64  ? 462  ILE B CG2 1 
ATOM   8613  C  CD1 . ILE B  1 462 ? -1.080  -20.494 5.309   1.00 58.10  ? 462  ILE B CD1 1 
ATOM   8614  N  N   . THR B  1 463 ? 3.415   -20.386 6.467   1.00 54.30  ? 463  THR B N   1 
ATOM   8615  C  CA  . THR B  1 463 ? 4.503   -19.577 5.938   1.00 51.90  ? 463  THR B CA  1 
ATOM   8616  C  C   . THR B  1 463 ? 4.542   -19.666 4.422   1.00 50.56  ? 463  THR B C   1 
ATOM   8617  O  O   . THR B  1 463 ? 4.055   -20.626 3.834   1.00 50.84  ? 463  THR B O   1 
ATOM   8618  C  CB  . THR B  1 463 ? 5.858   -20.067 6.466   1.00 52.15  ? 463  THR B CB  1 
ATOM   8619  O  OG1 . THR B  1 463 ? 6.876   -19.107 6.154   1.00 52.73  ? 463  THR B OG1 1 
ATOM   8620  C  CG2 . THR B  1 463 ? 6.212   -21.404 5.828   1.00 51.53  ? 463  THR B CG2 1 
ATOM   8621  N  N   . GLY B  1 464 ? 5.131   -18.659 3.791   1.00 49.91  ? 464  GLY B N   1 
ATOM   8622  C  CA  . GLY B  1 464 ? 5.318   -18.669 2.352   1.00 49.87  ? 464  GLY B CA  1 
ATOM   8623  C  C   . GLY B  1 464 ? 6.045   -17.443 1.840   1.00 48.21  ? 464  GLY B C   1 
ATOM   8624  O  O   . GLY B  1 464 ? 6.111   -16.421 2.524   1.00 46.88  ? 464  GLY B O   1 
ATOM   8625  N  N   . ILE B  1 465 ? 6.579   -17.550 0.625   1.00 49.29  ? 465  ILE B N   1 
ATOM   8626  C  CA  . ILE B  1 465 ? 7.249   -16.435 -0.038  1.00 48.51  ? 465  ILE B CA  1 
ATOM   8627  C  C   . ILE B  1 465 ? 6.470   -16.024 -1.278  1.00 51.25  ? 465  ILE B C   1 
ATOM   8628  O  O   . ILE B  1 465 ? 5.830   -16.860 -1.912  1.00 51.83  ? 465  ILE B O   1 
ATOM   8629  C  CB  . ILE B  1 465 ? 8.658   -16.819 -0.494  1.00 44.60  ? 465  ILE B CB  1 
ATOM   8630  C  CG1 . ILE B  1 465 ? 9.477   -17.372 0.675   1.00 43.63  ? 465  ILE B CG1 1 
ATOM   8631  C  CG2 . ILE B  1 465 ? 9.344   -15.620 -1.131  1.00 43.92  ? 465  ILE B CG2 1 
ATOM   8632  C  CD1 . ILE B  1 465 ? 10.664  -18.195 0.238   1.00 30.02  ? 465  ILE B CD1 1 
ATOM   8633  N  N   . ALA B  1 466 ? 6.533   -14.743 -1.632  1.00 52.52  ? 466  ALA B N   1 
ATOM   8634  C  CA  . ALA B  1 466 ? 5.840   -14.253 -2.824  1.00 52.30  ? 466  ALA B CA  1 
ATOM   8635  C  C   . ALA B  1 466 ? 4.340   -14.496 -2.693  1.00 55.92  ? 466  ALA B C   1 
ATOM   8636  O  O   . ALA B  1 466 ? 3.721   -14.052 -1.724  1.00 57.76  ? 466  ALA B O   1 
ATOM   8637  C  CB  . ALA B  1 466 ? 6.387   -14.924 -4.075  1.00 47.72  ? 466  ALA B CB  1 
ATOM   8638  N  N   . TYR B  1 467 ? 3.753   -15.200 -3.659  1.00 55.29  ? 467  TYR B N   1 
ATOM   8639  C  CA  . TYR B  1 467 ? 2.335   -15.528 -3.574  1.00 53.68  ? 467  TYR B CA  1 
ATOM   8640  C  C   . TYR B  1 467 ? 2.050   -16.302 -2.300  1.00 50.16  ? 467  TYR B C   1 
ATOM   8641  O  O   . TYR B  1 467 ? 0.947   -16.246 -1.767  1.00 48.17  ? 467  TYR B O   1 
ATOM   8642  C  CB  . TYR B  1 467 ? 1.863   -16.340 -4.778  1.00 55.65  ? 467  TYR B CB  1 
ATOM   8643  C  CG  . TYR B  1 467 ? 0.349   -16.436 -4.868  1.00 57.93  ? 467  TYR B CG  1 
ATOM   8644  C  CD1 . TYR B  1 467 ? -0.406  -15.354 -5.299  1.00 58.42  ? 467  TYR B CD1 1 
ATOM   8645  C  CD2 . TYR B  1 467 ? -0.324  -17.601 -4.520  1.00 59.52  ? 467  TYR B CD2 1 
ATOM   8646  C  CE1 . TYR B  1 467 ? -1.779  -15.426 -5.385  1.00 59.08  ? 467  TYR B CE1 1 
ATOM   8647  C  CE2 . TYR B  1 467 ? -1.705  -17.681 -4.606  1.00 60.08  ? 467  TYR B CE2 1 
ATOM   8648  C  CZ  . TYR B  1 467 ? -2.424  -16.587 -5.040  1.00 60.26  ? 467  TYR B CZ  1 
ATOM   8649  O  OH  . TYR B  1 467 ? -3.796  -16.643 -5.133  1.00 62.40  ? 467  TYR B OH  1 
ATOM   8650  N  N   . GLY B  1 468 ? 3.053   -17.032 -1.827  1.00 49.39  ? 468  GLY B N   1 
ATOM   8651  C  CA  . GLY B  1 468 ? 2.938   -17.771 -0.585  1.00 51.62  ? 468  GLY B CA  1 
ATOM   8652  C  C   . GLY B  1 468 ? 2.827   -16.819 0.589   1.00 53.09  ? 468  GLY B C   1 
ATOM   8653  O  O   . GLY B  1 468 ? 2.219   -17.138 1.611   1.00 53.39  ? 468  GLY B O   1 
ATOM   8654  N  N   . GLY B  1 469 ? 3.413   -15.636 0.434   1.00 54.45  ? 469  GLY B N   1 
ATOM   8655  C  CA  . GLY B  1 469 ? 3.343   -14.603 1.453   1.00 56.94  ? 469  GLY B CA  1 
ATOM   8656  C  C   . GLY B  1 469 ? 2.025   -13.854 1.388   1.00 57.90  ? 469  GLY B C   1 
ATOM   8657  O  O   . GLY B  1 469 ? 1.502   -13.388 2.411   1.00 58.16  ? 469  GLY B O   1 
ATOM   8658  N  N   . TYR B  1 470 ? 1.489   -13.731 0.177   1.00 55.89  ? 470  TYR B N   1 
ATOM   8659  C  CA  . TYR B  1 470 ? 0.152   -13.196 -0.009  1.00 55.37  ? 470  TYR B CA  1 
ATOM   8660  C  C   . TYR B  1 470 ? -0.873  -14.089 0.691   1.00 57.45  ? 470  TYR B C   1 
ATOM   8661  O  O   . TYR B  1 470 ? -1.697  -13.617 1.482   1.00 58.50  ? 470  TYR B O   1 
ATOM   8662  C  CB  . TYR B  1 470 ? -0.174  -13.118 -1.491  1.00 54.02  ? 470  TYR B CB  1 
ATOM   8663  C  CG  . TYR B  1 470 ? -1.654  -13.026 -1.757  1.00 52.87  ? 470  TYR B CG  1 
ATOM   8664  C  CD1 . TYR B  1 470 ? -2.348  -11.848 -1.517  1.00 51.88  ? 470  TYR B CD1 1 
ATOM   8665  C  CD2 . TYR B  1 470 ? -2.360  -14.119 -2.229  1.00 52.39  ? 470  TYR B CD2 1 
ATOM   8666  C  CE1 . TYR B  1 470 ? -3.698  -11.760 -1.747  1.00 51.36  ? 470  TYR B CE1 1 
ATOM   8667  C  CE2 . TYR B  1 470 ? -3.709  -14.040 -2.462  1.00 53.16  ? 470  TYR B CE2 1 
ATOM   8668  C  CZ  . TYR B  1 470 ? -4.375  -12.857 -2.218  1.00 52.58  ? 470  TYR B CZ  1 
ATOM   8669  O  OH  . TYR B  1 470 ? -5.725  -12.765 -2.447  1.00 53.29  ? 470  TYR B OH  1 
ATOM   8670  N  N   . MET B  1 471 ? -0.802  -15.385 0.394   1.00 56.26  ? 471  MET B N   1 
ATOM   8671  C  CA  . MET B  1 471 ? -1.675  -16.377 1.006   1.00 57.62  ? 471  MET B CA  1 
ATOM   8672  C  C   . MET B  1 471 ? -1.567  -16.353 2.523   1.00 58.72  ? 471  MET B C   1 
ATOM   8673  O  O   . MET B  1 471 ? -2.573  -16.443 3.226   1.00 59.56  ? 471  MET B O   1 
ATOM   8674  C  CB  . MET B  1 471 ? -1.333  -17.777 0.497   1.00 58.15  ? 471  MET B CB  1 
ATOM   8675  C  CG  . MET B  1 471 ? -2.398  -18.807 0.819   1.00 58.29  ? 471  MET B CG  1 
ATOM   8676  S  SD  . MET B  1 471 ? -3.992  -18.322 0.131   1.00 68.33  ? 471  MET B SD  1 
ATOM   8677  C  CE  . MET B  1 471 ? -3.783  -18.816 -1.582  1.00 49.50  ? 471  MET B CE  1 
ATOM   8678  N  N   . THR B  1 472 ? -0.340  -16.251 3.022   1.00 57.57  ? 472  THR B N   1 
ATOM   8679  C  CA  . THR B  1 472 ? -0.111  -16.141 4.454   1.00 56.97  ? 472  THR B CA  1 
ATOM   8680  C  C   . THR B  1 472 ? -0.811  -14.919 5.037   1.00 60.19  ? 472  THR B C   1 
ATOM   8681  O  O   . THR B  1 472 ? -1.564  -15.037 6.006   1.00 62.45  ? 472  THR B O   1 
ATOM   8682  C  CB  . THR B  1 472 ? 1.374   -16.055 4.776   1.00 54.64  ? 472  THR B CB  1 
ATOM   8683  O  OG1 . THR B  1 472 ? 1.999   -17.299 4.442   1.00 54.50  ? 472  THR B OG1 1 
ATOM   8684  C  CG2 . THR B  1 472 ? 1.570   -15.760 6.255   1.00 54.00  ? 472  THR B CG2 1 
ATOM   8685  N  N   . ASN B  1 473 ? -0.560  -13.747 4.456   1.00 59.90  ? 473  ASN B N   1 
ATOM   8686  C  CA  . ASN B  1 473 ? -1.261  -12.540 4.887   1.00 60.31  ? 473  ASN B CA  1 
ATOM   8687  C  C   . ASN B  1 473 ? -2.760  -12.790 4.870   1.00 60.62  ? 473  ASN B C   1 
ATOM   8688  O  O   . ASN B  1 473 ? -3.468  -12.500 5.836   1.00 61.63  ? 473  ASN B O   1 
ATOM   8689  C  CB  . ASN B  1 473 ? -0.949  -11.356 3.972   1.00 58.84  ? 473  ASN B CB  1 
ATOM   8690  C  CG  . ASN B  1 473 ? 0.499   -10.923 4.040   1.00 57.01  ? 473  ASN B CG  1 
ATOM   8691  O  OD1 . ASN B  1 473 ? 1.203   -11.191 5.014   1.00 57.35  ? 473  ASN B OD1 1 
ATOM   8692  N  ND2 . ASN B  1 473 ? 0.950   -10.233 3.001   1.00 55.88  ? 473  ASN B ND2 1 
ATOM   8693  N  N   . TRP B  1 474 ? -3.226  -13.339 3.753   1.00 57.81  ? 474  TRP B N   1 
ATOM   8694  C  CA  . TRP B  1 474 ? -4.632  -13.647 3.546   1.00 57.36  ? 474  TRP B CA  1 
ATOM   8695  C  C   . TRP B  1 474 ? -5.159  -14.564 4.637   1.00 56.55  ? 474  TRP B C   1 
ATOM   8696  O  O   . TRP B  1 474 ? -6.162  -14.264 5.282   1.00 56.68  ? 474  TRP B O   1 
ATOM   8697  C  CB  . TRP B  1 474 ? -4.803  -14.317 2.186   1.00 57.85  ? 474  TRP B CB  1 
ATOM   8698  C  CG  . TRP B  1 474 ? -6.208  -14.447 1.717   1.00 58.54  ? 474  TRP B CG  1 
ATOM   8699  C  CD1 . TRP B  1 474 ? -6.868  -15.604 1.421   1.00 60.37  ? 474  TRP B CD1 1 
ATOM   8700  C  CD2 . TRP B  1 474 ? -7.132  -13.381 1.468   1.00 59.61  ? 474  TRP B CD2 1 
ATOM   8701  N  NE1 . TRP B  1 474 ? -8.148  -15.325 1.005   1.00 62.18  ? 474  TRP B NE1 1 
ATOM   8702  C  CE2 . TRP B  1 474 ? -8.336  -13.967 1.025   1.00 61.67  ? 474  TRP B CE2 1 
ATOM   8703  C  CE3 . TRP B  1 474 ? -7.058  -11.990 1.577   1.00 59.20  ? 474  TRP B CE3 1 
ATOM   8704  C  CZ2 . TRP B  1 474 ? -9.458  -13.207 0.691   1.00 60.28  ? 474  TRP B CZ2 1 
ATOM   8705  C  CZ3 . TRP B  1 474 ? -8.172  -11.240 1.246   1.00 60.58  ? 474  TRP B CZ3 1 
ATOM   8706  C  CH2 . TRP B  1 474 ? -9.357  -11.850 0.807   1.00 59.89  ? 474  TRP B CH2 1 
ATOM   8707  N  N   . ALA B  1 475 ? -4.473  -15.683 4.840   1.00 55.60  ? 475  ALA B N   1 
ATOM   8708  C  CA  . ALA B  1 475 ? -4.907  -16.669 5.815   1.00 56.40  ? 475  ALA B CA  1 
ATOM   8709  C  C   . ALA B  1 475 ? -5.170  -16.005 7.158   1.00 59.07  ? 475  ALA B C   1 
ATOM   8710  O  O   . ALA B  1 475 ? -6.228  -16.211 7.754   1.00 61.59  ? 475  ALA B O   1 
ATOM   8711  C  CB  . ALA B  1 475 ? -3.877  -17.771 5.954   1.00 55.87  ? 475  ALA B CB  1 
ATOM   8712  N  N   . LEU B  1 476 ? -4.222  -15.191 7.623   1.00 57.46  ? 476  LEU B N   1 
ATOM   8713  C  CA  . LEU B  1 476 ? -4.366  -14.535 8.918   1.00 58.15  ? 476  LEU B CA  1 
ATOM   8714  C  C   . LEU B  1 476 ? -5.536  -13.546 8.983   1.00 59.46  ? 476  LEU B C   1 
ATOM   8715  O  O   . LEU B  1 476 ? -6.037  -13.257 10.071  1.00 60.96  ? 476  LEU B O   1 
ATOM   8716  C  CB  . LEU B  1 476 ? -3.067  -13.851 9.349   1.00 58.55  ? 476  LEU B CB  1 
ATOM   8717  C  CG  . LEU B  1 476 ? -1.839  -14.719 9.633   1.00 58.98  ? 476  LEU B CG  1 
ATOM   8718  C  CD1 . LEU B  1 476 ? -0.786  -13.880 10.335  1.00 57.33  ? 476  LEU B CD1 1 
ATOM   8719  C  CD2 . LEU B  1 476 ? -2.187  -15.940 10.473  1.00 59.63  ? 476  LEU B CD2 1 
ATOM   8720  N  N   . THR B  1 477 ? -5.943  -12.994 7.841   1.00 58.12  ? 477  THR B N   1 
ATOM   8721  C  CA  . THR B  1 477 ? -7.147  -12.163 7.809   1.00 59.11  ? 477  THR B CA  1 
ATOM   8722  C  C   . THR B  1 477 ? -8.447  -12.955 7.718   1.00 62.36  ? 477  THR B C   1 
ATOM   8723  O  O   . THR B  1 477 ? -9.454  -12.542 8.281   1.00 66.54  ? 477  THR B O   1 
ATOM   8724  C  CB  . THR B  1 477 ? -7.134  -11.106 6.690   1.00 59.87  ? 477  THR B CB  1 
ATOM   8725  O  OG1 . THR B  1 477 ? -7.160  -11.757 5.417   1.00 63.29  ? 477  THR B OG1 1 
ATOM   8726  C  CG2 . THR B  1 477 ? -5.908  -10.216 6.796   1.00 58.68  ? 477  THR B CG2 1 
ATOM   8727  N  N   . GLN B  1 478 ? -8.441  -14.062 6.977   1.00 62.45  ? 478  GLN B N   1 
ATOM   8728  C  CA  . GLN B  1 478 ? -9.678  -14.807 6.725   1.00 64.62  ? 478  GLN B CA  1 
ATOM   8729  C  C   . GLN B  1 478 ? -9.944  -16.004 7.643   1.00 66.54  ? 478  GLN B C   1 
ATOM   8730  O  O   . GLN B  1 478 ? -10.962 -16.677 7.495   1.00 65.82  ? 478  GLN B O   1 
ATOM   8731  C  CB  . GLN B  1 478 ? -9.755  -15.259 5.263   1.00 66.28  ? 478  GLN B CB  1 
ATOM   8732  C  CG  . GLN B  1 478 ? -9.620  -14.130 4.238   1.00 68.24  ? 478  GLN B CG  1 
ATOM   8733  C  CD  . GLN B  1 478 ? -10.648 -13.026 4.430   1.00 69.58  ? 478  GLN B CD  1 
ATOM   8734  O  OE1 . GLN B  1 478 ? -11.808 -13.288 4.756   1.00 71.65  ? 478  GLN B OE1 1 
ATOM   8735  N  NE2 . GLN B  1 478 ? -10.222 -11.781 4.231   1.00 66.80  ? 478  GLN B NE2 1 
ATOM   8736  N  N   . SER B  1 479 ? -9.040  -16.287 8.575   1.00 68.33  ? 479  SER B N   1 
ATOM   8737  C  CA  . SER B  1 479 ? -9.194  -17.480 9.402   1.00 71.01  ? 479  SER B CA  1 
ATOM   8738  C  C   . SER B  1 479 ? -8.573  -17.383 10.796  1.00 77.36  ? 479  SER B C   1 
ATOM   8739  O  O   . SER B  1 479 ? -7.562  -16.707 10.995  1.00 79.63  ? 479  SER B O   1 
ATOM   8740  C  CB  . SER B  1 479 ? -8.634  -18.697 8.667   1.00 68.80  ? 479  SER B CB  1 
ATOM   8741  O  OG  . SER B  1 479 ? -8.544  -19.815 9.532   1.00 68.30  ? 479  SER B OG  1 
ATOM   8742  N  N   . ASP B  1 480 ? -9.189  -18.072 11.754  1.00 80.18  ? 480  ASP B N   1 
ATOM   8743  C  CA  . ASP B  1 480 ? -8.670  -18.147 13.118  1.00 82.59  ? 480  ASP B CA  1 
ATOM   8744  C  C   . ASP B  1 480 ? -7.830  -19.400 13.345  1.00 78.36  ? 480  ASP B C   1 
ATOM   8745  O  O   . ASP B  1 480 ? -7.291  -19.604 14.430  1.00 78.13  ? 480  ASP B O   1 
ATOM   8746  C  CB  . ASP B  1 480 ? -9.816  -18.130 14.132  1.00 89.75  ? 480  ASP B CB  1 
ATOM   8747  C  CG  . ASP B  1 480 ? -10.606 -16.841 14.099  1.00 95.25  ? 480  ASP B CG  1 
ATOM   8748  O  OD1 . ASP B  1 480 ? -9.997  -15.779 13.841  1.00 96.82  ? 480  ASP B OD1 1 
ATOM   8749  O  OD2 . ASP B  1 480 ? -11.834 -16.895 14.336  1.00 96.47  ? 480  ASP B OD2 1 
ATOM   8750  N  N   . LEU B  1 481 ? -7.725  -20.239 12.322  1.00 74.85  ? 481  LEU B N   1 
ATOM   8751  C  CA  . LEU B  1 481 ? -7.096  -21.548 12.469  1.00 72.79  ? 481  LEU B CA  1 
ATOM   8752  C  C   . LEU B  1 481 ? -5.621  -21.482 12.854  1.00 70.82  ? 481  LEU B C   1 
ATOM   8753  O  O   . LEU B  1 481 ? -5.138  -22.339 13.596  1.00 72.80  ? 481  LEU B O   1 
ATOM   8754  C  CB  . LEU B  1 481 ? -7.265  -22.372 11.190  1.00 74.85  ? 481  LEU B CB  1 
ATOM   8755  C  CG  . LEU B  1 481 ? -6.517  -23.709 11.151  1.00 75.91  ? 481  LEU B CG  1 
ATOM   8756  C  CD1 . LEU B  1 481 ? -6.889  -24.576 12.345  1.00 76.24  ? 481  LEU B CD1 1 
ATOM   8757  C  CD2 . LEU B  1 481 ? -6.786  -24.443 9.848   1.00 75.28  ? 481  LEU B CD2 1 
ATOM   8758  N  N   . PHE B  1 482 ? -4.912  -20.470 12.352  1.00 66.02  ? 482  PHE B N   1 
ATOM   8759  C  CA  . PHE B  1 482 ? -3.460  -20.389 12.521  1.00 60.00  ? 482  PHE B CA  1 
ATOM   8760  C  C   . PHE B  1 482 ? -3.035  -19.530 13.706  1.00 57.73  ? 482  PHE B C   1 
ATOM   8761  O  O   . PHE B  1 482 ? -3.526  -18.410 13.882  1.00 54.28  ? 482  PHE B O   1 
ATOM   8762  C  CB  . PHE B  1 482 ? -2.805  -19.870 11.245  1.00 57.24  ? 482  PHE B CB  1 
ATOM   8763  C  CG  . PHE B  1 482 ? -3.293  -20.545 10.003  1.00 55.65  ? 482  PHE B CG  1 
ATOM   8764  C  CD1 . PHE B  1 482 ? -4.312  -19.981 9.245   1.00 54.58  ? 482  PHE B CD1 1 
ATOM   8765  C  CD2 . PHE B  1 482 ? -2.740  -21.749 9.592   1.00 55.00  ? 482  PHE B CD2 1 
ATOM   8766  C  CE1 . PHE B  1 482 ? -4.771  -20.604 8.092   1.00 53.82  ? 482  PHE B CE1 1 
ATOM   8767  C  CE2 . PHE B  1 482 ? -3.193  -22.377 8.442   1.00 54.80  ? 482  PHE B CE2 1 
ATOM   8768  C  CZ  . PHE B  1 482 ? -4.212  -21.803 7.692   1.00 54.37  ? 482  PHE B CZ  1 
ATOM   8769  N  N   . LYS B  1 483 ? -2.132  -20.077 14.519  1.00 60.05  ? 483  LYS B N   1 
ATOM   8770  C  CA  . LYS B  1 483 ? -1.595  -19.382 15.693  1.00 61.35  ? 483  LYS B CA  1 
ATOM   8771  C  C   . LYS B  1 483 ? -0.435  -18.428 15.401  1.00 59.32  ? 483  LYS B C   1 
ATOM   8772  O  O   . LYS B  1 483 ? -0.121  -17.567 16.220  1.00 59.50  ? 483  LYS B O   1 
ATOM   8773  C  CB  . LYS B  1 483 ? -1.164  -20.384 16.768  1.00 63.85  ? 483  LYS B CB  1 
ATOM   8774  C  CG  . LYS B  1 483 ? -2.216  -21.419 17.118  1.00 66.52  ? 483  LYS B CG  1 
ATOM   8775  C  CD  . LYS B  1 483 ? -3.542  -20.778 17.508  1.00 68.21  ? 483  LYS B CD  1 
ATOM   8776  C  CE  . LYS B  1 483 ? -4.652  -21.819 17.556  1.00 69.39  ? 483  LYS B CE  1 
ATOM   8777  N  NZ  . LYS B  1 483 ? -4.631  -22.678 16.330  1.00 70.66  ? 483  LYS B NZ  1 
ATOM   8778  N  N   . ALA B  1 484 ? 0.226   -18.614 14.263  1.00 57.63  ? 484  ALA B N   1 
ATOM   8779  C  CA  . ALA B  1 484 ? 1.351   -17.763 13.879  1.00 56.49  ? 484  ALA B CA  1 
ATOM   8780  C  C   . ALA B  1 484 ? 1.599   -17.804 12.374  1.00 55.30  ? 484  ALA B C   1 
ATOM   8781  O  O   . ALA B  1 484 ? 1.194   -18.748 11.695  1.00 54.80  ? 484  ALA B O   1 
ATOM   8782  C  CB  . ALA B  1 484 ? 2.613   -18.175 14.635  1.00 54.82  ? 484  ALA B CB  1 
ATOM   8783  N  N   . GLY B  1 485 ? 2.288   -16.794 11.857  1.00 53.49  ? 485  GLY B N   1 
ATOM   8784  C  CA  . GLY B  1 485 ? 2.677   -16.824 10.462  1.00 54.37  ? 485  GLY B CA  1 
ATOM   8785  C  C   . GLY B  1 485 ? 3.916   -16.015 10.144  1.00 55.28  ? 485  GLY B C   1 
ATOM   8786  O  O   . GLY B  1 485 ? 4.251   -15.047 10.832  1.00 55.82  ? 485  GLY B O   1 
ATOM   8787  N  N   . ILE B  1 486 ? 4.593   -16.425 9.079   1.00 54.85  ? 486  ILE B N   1 
ATOM   8788  C  CA  . ILE B  1 486 ? 5.761   -15.723 8.583   1.00 53.50  ? 486  ILE B CA  1 
ATOM   8789  C  C   . ILE B  1 486 ? 5.552   -15.458 7.109   1.00 54.22  ? 486  ILE B C   1 
ATOM   8790  O  O   . ILE B  1 486 ? 5.527   -16.387 6.303   1.00 54.90  ? 486  ILE B O   1 
ATOM   8791  C  CB  . ILE B  1 486 ? 7.037   -16.558 8.747   1.00 51.03  ? 486  ILE B CB  1 
ATOM   8792  C  CG1 . ILE B  1 486 ? 7.306   -16.847 10.220  1.00 52.92  ? 486  ILE B CG1 1 
ATOM   8793  C  CG2 . ILE B  1 486 ? 8.225   -15.832 8.153   1.00 46.28  ? 486  ILE B CG2 1 
ATOM   8794  C  CD1 . ILE B  1 486 ? 8.655   -17.482 10.460  1.00 53.97  ? 486  ILE B CD1 1 
ATOM   8795  N  N   . SER B  1 487 ? 5.424   -14.182 6.766   1.00 53.72  ? 487  SER B N   1 
ATOM   8796  C  CA  . SER B  1 487 ? 5.117   -13.760 5.407   1.00 53.20  ? 487  SER B CA  1 
ATOM   8797  C  C   . SER B  1 487 ? 6.329   -13.080 4.784   1.00 53.23  ? 487  SER B C   1 
ATOM   8798  O  O   . SER B  1 487 ? 6.868   -12.135 5.355   1.00 53.89  ? 487  SER B O   1 
ATOM   8799  C  CB  . SER B  1 487 ? 3.927   -12.801 5.425   1.00 53.04  ? 487  SER B CB  1 
ATOM   8800  O  OG  . SER B  1 487 ? 3.860   -12.045 4.232   1.00 54.30  ? 487  SER B OG  1 
ATOM   8801  N  N   . GLU B  1 488 ? 6.751   -13.556 3.615   1.00 52.37  ? 488  GLU B N   1 
ATOM   8802  C  CA  . GLU B  1 488 ? 7.954   -13.037 2.979   1.00 49.84  ? 488  GLU B CA  1 
ATOM   8803  C  C   . GLU B  1 488 ? 7.730   -12.567 1.552   1.00 49.68  ? 488  GLU B C   1 
ATOM   8804  O  O   . GLU B  1 488 ? 7.198   -13.303 0.717   1.00 51.37  ? 488  GLU B O   1 
ATOM   8805  C  CB  . GLU B  1 488 ? 9.052   -14.096 2.974   1.00 52.99  ? 488  GLU B CB  1 
ATOM   8806  C  CG  . GLU B  1 488 ? 9.420   -14.624 4.344   1.00 57.79  ? 488  GLU B CG  1 
ATOM   8807  C  CD  . GLU B  1 488 ? 10.495  -15.685 4.273   1.00 59.35  ? 488  GLU B CD  1 
ATOM   8808  O  OE1 . GLU B  1 488 ? 11.648  -15.334 3.954   1.00 60.05  ? 488  GLU B OE1 1 
ATOM   8809  O  OE2 . GLU B  1 488 ? 10.188  -16.869 4.521   1.00 60.11  ? 488  GLU B OE2 1 
ATOM   8810  N  N   . ASN B  1 489 ? 8.163   -11.340 1.277   1.00 47.68  ? 489  ASN B N   1 
ATOM   8811  C  CA  . ASN B  1 489 ? 8.169   -10.815 -0.076  1.00 46.04  ? 489  ASN B CA  1 
ATOM   8812  C  C   . ASN B  1 489 ? 6.842   -11.070 -0.762  1.00 49.69  ? 489  ASN B C   1 
ATOM   8813  O  O   . ASN B  1 489 ? 6.798   -11.599 -1.867  1.00 51.95  ? 489  ASN B O   1 
ATOM   8814  C  CB  . ASN B  1 489 ? 9.306   -11.452 -0.866  1.00 46.21  ? 489  ASN B CB  1 
ATOM   8815  C  CG  . ASN B  1 489 ? 10.657  -11.279 -0.183  1.00 46.35  ? 489  ASN B CG  1 
ATOM   8816  O  OD1 . ASN B  1 489 ? 11.038  -12.082 0.669   1.00 44.78  ? 489  ASN B OD1 1 
ATOM   8817  N  ND2 . ASN B  1 489 ? 11.387  -10.227 -0.559  1.00 45.94  ? 489  ASN B ND2 1 
ATOM   8818  N  N   . GLY B  1 490 ? 5.758   -10.712 -0.083  1.00 52.85  ? 490  GLY B N   1 
ATOM   8819  C  CA  . GLY B  1 490 ? 4.420   -11.051 -0.534  1.00 55.02  ? 490  GLY B CA  1 
ATOM   8820  C  C   . GLY B  1 490 ? 3.621   -9.889  -1.082  1.00 56.11  ? 490  GLY B C   1 
ATOM   8821  O  O   . GLY B  1 490 ? 4.189   -8.887  -1.515  1.00 56.55  ? 490  GLY B O   1 
ATOM   8822  N  N   . ILE B  1 491 ? 2.298   -10.034 -1.071  1.00 56.36  ? 491  ILE B N   1 
ATOM   8823  C  CA  . ILE B  1 491 ? 1.399   -8.974  -1.505  1.00 55.16  ? 491  ILE B CA  1 
ATOM   8824  C  C   . ILE B  1 491 ? 0.353   -8.712  -0.442  1.00 52.65  ? 491  ILE B C   1 
ATOM   8825  O  O   . ILE B  1 491 ? -0.438  -9.592  -0.127  1.00 52.40  ? 491  ILE B O   1 
ATOM   8826  C  CB  . ILE B  1 491 ? 0.642   -9.364  -2.786  1.00 56.71  ? 491  ILE B CB  1 
ATOM   8827  C  CG1 . ILE B  1 491 ? 1.584   -9.387  -3.986  1.00 60.71  ? 491  ILE B CG1 1 
ATOM   8828  C  CG2 . ILE B  1 491 ? -0.501  -8.405  -3.034  1.00 56.06  ? 491  ILE B CG2 1 
ATOM   8829  C  CD1 . ILE B  1 491 ? 2.357   -10.676 -4.118  1.00 63.30  ? 491  ILE B CD1 1 
ATOM   8830  N  N   . SER B  1 492 ? 0.385   -7.539  0.178   1.00 51.74  ? 492  SER B N   1 
ATOM   8831  C  CA  . SER B  1 492 ? -0.772  -7.100  0.944   1.00 51.67  ? 492  SER B CA  1 
ATOM   8832  C  C   . SER B  1 492 ? -1.798  -6.259  0.161   1.00 52.61  ? 492  SER B C   1 
ATOM   8833  O  O   . SER B  1 492 ? -2.949  -6.143  0.578   1.00 54.92  ? 492  SER B O   1 
ATOM   8834  C  CB  . SER B  1 492 ? -0.316  -6.356  2.201   1.00 51.19  ? 492  SER B CB  1 
ATOM   8835  O  OG  . SER B  1 492 ? 0.481   -5.228  1.867   1.00 48.94  ? 492  SER B OG  1 
ATOM   8836  N  N   . TYR B  1 493 ? -1.402  -5.686  -0.971  1.00 50.67  ? 493  TYR B N   1 
ATOM   8837  C  CA  . TYR B  1 493 ? -2.335  -4.871  -1.747  1.00 50.78  ? 493  TYR B CA  1 
ATOM   8838  C  C   . TYR B  1 493 ? -2.094  -5.066  -3.232  1.00 50.95  ? 493  TYR B C   1 
ATOM   8839  O  O   . TYR B  1 493 ? -0.992  -4.815  -3.710  1.00 54.69  ? 493  TYR B O   1 
ATOM   8840  C  CB  . TYR B  1 493 ? -2.156  -3.403  -1.370  1.00 52.30  ? 493  TYR B CB  1 
ATOM   8841  C  CG  . TYR B  1 493 ? -3.214  -2.447  -1.882  1.00 55.37  ? 493  TYR B CG  1 
ATOM   8842  C  CD1 . TYR B  1 493 ? -4.247  -2.874  -2.709  1.00 56.49  ? 493  TYR B CD1 1 
ATOM   8843  C  CD2 . TYR B  1 493 ? -3.167  -1.100  -1.537  1.00 55.79  ? 493  TYR B CD2 1 
ATOM   8844  C  CE1 . TYR B  1 493 ? -5.210  -1.978  -3.172  1.00 56.58  ? 493  TYR B CE1 1 
ATOM   8845  C  CE2 . TYR B  1 493 ? -4.117  -0.203  -1.992  1.00 55.63  ? 493  TYR B CE2 1 
ATOM   8846  C  CZ  . TYR B  1 493 ? -5.134  -0.642  -2.806  1.00 56.51  ? 493  TYR B CZ  1 
ATOM   8847  O  OH  . TYR B  1 493 ? -6.067  0.270   -3.248  1.00 56.90  ? 493  TYR B OH  1 
ATOM   8848  N  N   . TRP B  1 494 ? -3.129  -5.428  -3.981  1.00 46.87  ? 494  TRP B N   1 
ATOM   8849  C  CA  . TRP B  1 494 ? -2.932  -5.768  -5.384  1.00 46.06  ? 494  TRP B CA  1 
ATOM   8850  C  C   . TRP B  1 494 ? -2.762  -4.573  -6.297  1.00 47.50  ? 494  TRP B C   1 
ATOM   8851  O  O   . TRP B  1 494 ? -2.065  -4.665  -7.304  1.00 50.25  ? 494  TRP B O   1 
ATOM   8852  C  CB  . TRP B  1 494 ? -4.066  -6.639  -5.910  1.00 46.34  ? 494  TRP B CB  1 
ATOM   8853  C  CG  . TRP B  1 494 ? -3.990  -8.047  -5.452  1.00 44.35  ? 494  TRP B CG  1 
ATOM   8854  C  CD1 . TRP B  1 494 ? -4.869  -8.685  -4.630  1.00 43.78  ? 494  TRP B CD1 1 
ATOM   8855  C  CD2 . TRP B  1 494 ? -2.971  -8.998  -5.773  1.00 41.64  ? 494  TRP B CD2 1 
ATOM   8856  N  NE1 . TRP B  1 494 ? -4.467  -9.980  -4.427  1.00 44.33  ? 494  TRP B NE1 1 
ATOM   8857  C  CE2 . TRP B  1 494 ? -3.305  -10.199 -5.118  1.00 42.99  ? 494  TRP B CE2 1 
ATOM   8858  C  CE3 . TRP B  1 494 ? -1.816  -8.954  -6.555  1.00 41.50  ? 494  TRP B CE3 1 
ATOM   8859  C  CZ2 . TRP B  1 494 ? -2.522  -11.350 -5.218  1.00 43.92  ? 494  TRP B CZ2 1 
ATOM   8860  C  CZ3 . TRP B  1 494 ? -1.041  -10.096 -6.657  1.00 43.45  ? 494  TRP B CZ3 1 
ATOM   8861  C  CH2 . TRP B  1 494 ? -1.397  -11.278 -5.993  1.00 44.39  ? 494  TRP B CH2 1 
ATOM   8862  N  N   . LEU B  1 495 ? -3.409  -3.461  -5.975  1.00 46.27  ? 495  LEU B N   1 
ATOM   8863  C  CA  . LEU B  1 495 ? -3.318  -2.314  -6.861  1.00 47.25  ? 495  LEU B CA  1 
ATOM   8864  C  C   . LEU B  1 495 ? -1.870  -1.850  -7.001  1.00 47.54  ? 495  LEU B C   1 
ATOM   8865  O  O   . LEU B  1 495 ? -1.385  -1.711  -8.124  1.00 49.42  ? 495  LEU B O   1 
ATOM   8866  C  CB  . LEU B  1 495 ? -4.219  -1.167  -6.412  1.00 50.42  ? 495  LEU B CB  1 
ATOM   8867  C  CG  . LEU B  1 495 ? -4.171  0.052   -7.342  1.00 52.68  ? 495  LEU B CG  1 
ATOM   8868  C  CD1 . LEU B  1 495 ? -4.822  -0.236  -8.689  1.00 50.11  ? 495  LEU B CD1 1 
ATOM   8869  C  CD2 . LEU B  1 495 ? -4.815  1.255   -6.682  1.00 55.78  ? 495  LEU B CD2 1 
ATOM   8870  N  N   . THR B  1 496 ? -1.174  -1.638  -5.878  1.00 45.26  ? 496  THR B N   1 
ATOM   8871  C  CA  . THR B  1 496 ? 0.238   -1.241  -5.926  1.00 43.42  ? 496  THR B CA  1 
ATOM   8872  C  C   . THR B  1 496 ? 1.115   -2.320  -6.540  1.00 45.25  ? 496  THR B C   1 
ATOM   8873  O  O   . THR B  1 496 ? 2.207   -2.031  -7.006  1.00 46.47  ? 496  THR B O   1 
ATOM   8874  C  CB  . THR B  1 496 ? 0.833   -0.910  -4.545  1.00 43.00  ? 496  THR B CB  1 
ATOM   8875  O  OG1 . THR B  1 496 ? 0.851   -2.089  -3.730  1.00 42.81  ? 496  THR B OG1 1 
ATOM   8876  C  CG2 . THR B  1 496 ? 0.054   0.201   -3.855  1.00 44.44  ? 496  THR B CG2 1 
ATOM   8877  N  N   . SER B  1 497 ? 0.659   -3.567  -6.532  1.00 46.68  ? 497  SER B N   1 
ATOM   8878  C  CA  . SER B  1 497 ? 1.399   -4.607  -7.241  1.00 48.99  ? 497  SER B CA  1 
ATOM   8879  C  C   . SER B  1 497 ? 1.354   -4.368  -8.746  1.00 50.84  ? 497  SER B C   1 
ATOM   8880  O  O   . SER B  1 497 ? 2.326   -4.616  -9.456  1.00 52.40  ? 497  SER B O   1 
ATOM   8881  C  CB  . SER B  1 497 ? 0.861   -6.002  -6.934  1.00 47.69  ? 497  SER B CB  1 
ATOM   8882  O  OG  . SER B  1 497 ? 1.260   -6.889  -7.963  1.00 46.19  ? 497  SER B OG  1 
ATOM   8883  N  N   . TYR B  1 498 ? 0.218   -3.885  -9.229  1.00 49.43  ? 498  TYR B N   1 
ATOM   8884  C  CA  . TYR B  1 498 ? 0.062   -3.628  -10.648 1.00 47.71  ? 498  TYR B CA  1 
ATOM   8885  C  C   . TYR B  1 498 ? 0.869   -2.406  -11.062 1.00 44.34  ? 498  TYR B C   1 
ATOM   8886  O  O   . TYR B  1 498 ? 1.527   -2.407  -12.108 1.00 43.10  ? 498  TYR B O   1 
ATOM   8887  C  CB  . TYR B  1 498 ? -1.427  -3.484  -11.016 1.00 47.33  ? 498  TYR B CB  1 
ATOM   8888  C  CG  . TYR B  1 498 ? -1.716  -2.538  -12.164 1.00 46.29  ? 498  TYR B CG  1 
ATOM   8889  C  CD1 . TYR B  1 498 ? -1.684  -2.981  -13.486 1.00 45.00  ? 498  TYR B CD1 1 
ATOM   8890  C  CD2 . TYR B  1 498 ? -2.023  -1.199  -11.925 1.00 46.07  ? 498  TYR B CD2 1 
ATOM   8891  C  CE1 . TYR B  1 498 ? -1.943  -2.114  -14.542 1.00 45.48  ? 498  TYR B CE1 1 
ATOM   8892  C  CE2 . TYR B  1 498 ? -2.286  -0.322  -12.972 1.00 48.17  ? 498  TYR B CE2 1 
ATOM   8893  C  CZ  . TYR B  1 498 ? -2.246  -0.786  -14.280 1.00 47.90  ? 498  TYR B CZ  1 
ATOM   8894  O  OH  . TYR B  1 498 ? -2.504  0.082   -15.320 1.00 45.91  ? 498  TYR B OH  1 
ATOM   8895  N  N   . ALA B  1 499 ? 0.817   -1.362  -10.248 1.00 43.20  ? 499  ALA B N   1 
ATOM   8896  C  CA  . ALA B  1 499 ? 1.424   -0.093  -10.622 1.00 45.30  ? 499  ALA B CA  1 
ATOM   8897  C  C   . ALA B  1 499 ? 2.909   0.041   -10.283 1.00 46.36  ? 499  ALA B C   1 
ATOM   8898  O  O   . ALA B  1 499 ? 3.585   0.928   -10.805 1.00 50.07  ? 499  ALA B O   1 
ATOM   8899  C  CB  . ALA B  1 499 ? 0.638   1.064   -9.986  1.00 44.52  ? 499  ALA B CB  1 
ATOM   8900  N  N   . PHE B  1 500 ? 3.410   -0.837  -9.420  1.00 42.90  ? 500  PHE B N   1 
ATOM   8901  C  CA  . PHE B  1 500 ? 4.734   -0.668  -8.812  1.00 42.77  ? 500  PHE B CA  1 
ATOM   8902  C  C   . PHE B  1 500 ? 5.746   -1.691  -9.317  1.00 46.25  ? 500  PHE B C   1 
ATOM   8903  O  O   . PHE B  1 500 ? 6.809   -1.331  -9.814  1.00 46.25  ? 500  PHE B O   1 
ATOM   8904  C  CB  . PHE B  1 500 ? 4.682   -0.621  -7.287  1.00 43.01  ? 500  PHE B CB  1 
ATOM   8905  C  CG  . PHE B  1 500 ? 5.815   0.168   -6.666  1.00 45.28  ? 500  PHE B CG  1 
ATOM   8906  C  CD1 . PHE B  1 500 ? 6.654   0.943   -7.455  1.00 44.22  ? 500  PHE B CD1 1 
ATOM   8907  C  CD2 . PHE B  1 500 ? 6.044   0.126   -5.295  1.00 44.43  ? 500  PHE B CD2 1 
ATOM   8908  C  CE1 . PHE B  1 500 ? 7.691   1.666   -6.894  1.00 41.70  ? 500  PHE B CE1 1 
ATOM   8909  C  CE2 . PHE B  1 500 ? 7.083   0.845   -4.735  1.00 42.98  ? 500  PHE B CE2 1 
ATOM   8910  C  CZ  . PHE B  1 500 ? 7.907   1.617   -5.540  1.00 42.00  ? 500  PHE B CZ  1 
ATOM   8911  N  N   . SER B  1 501 ? 5.433   -2.967  -9.112  1.00 49.56  ? 501  SER B N   1 
ATOM   8912  C  CA  . SER B  1 501 ? 6.334   -4.059  -9.469  1.00 50.66  ? 501  SER B CA  1 
ATOM   8913  C  C   . SER B  1 501 ? 6.649   -4.156  -10.956 1.00 50.82  ? 501  SER B C   1 
ATOM   8914  O  O   . SER B  1 501 ? 5.905   -3.663  -11.808 1.00 50.22  ? 501  SER B O   1 
ATOM   8915  C  CB  . SER B  1 501 ? 5.746   -5.392  -9.026  1.00 51.45  ? 501  SER B CB  1 
ATOM   8916  O  OG  . SER B  1 501 ? 4.646   -5.728  -9.845  1.00 52.30  ? 501  SER B OG  1 
ATOM   8917  N  N   . ASP B  1 502 ? 7.775   -4.810  -11.233 1.00 50.32  ? 502  ASP B N   1 
ATOM   8918  C  CA  . ASP B  1 502 ? 8.273   -5.029  -12.585 1.00 49.93  ? 502  ASP B CA  1 
ATOM   8919  C  C   . ASP B  1 502 ? 7.247   -5.606  -13.566 1.00 48.01  ? 502  ASP B C   1 
ATOM   8920  O  O   . ASP B  1 502 ? 7.080   -5.088  -14.658 1.00 48.34  ? 502  ASP B O   1 
ATOM   8921  C  CB  . ASP B  1 502 ? 9.538   -5.911  -12.547 1.00 53.40  ? 502  ASP B CB  1 
ATOM   8922  C  CG  . ASP B  1 502 ? 9.352   -7.189  -11.728 1.00 55.74  ? 502  ASP B CG  1 
ATOM   8923  O  OD1 . ASP B  1 502 ? 8.208   -7.497  -11.322 1.00 57.47  ? 502  ASP B OD1 1 
ATOM   8924  O  OD2 . ASP B  1 502 ? 10.358  -7.896  -11.494 1.00 53.65  ? 502  ASP B OD2 1 
ATOM   8925  N  N   . ILE B  1 503 ? 6.573   -6.680  -13.180 1.00 47.36  ? 503  ILE B N   1 
ATOM   8926  C  CA  . ILE B  1 503 ? 5.652   -7.345  -14.099 1.00 49.17  ? 503  ILE B CA  1 
ATOM   8927  C  C   . ILE B  1 503 ? 4.197   -6.897  -13.959 1.00 49.15  ? 503  ILE B C   1 
ATOM   8928  O  O   . ILE B  1 503 ? 3.341   -7.308  -14.733 1.00 50.84  ? 503  ILE B O   1 
ATOM   8929  C  CB  . ILE B  1 503 ? 5.731   -8.875  -13.958 1.00 48.10  ? 503  ILE B CB  1 
ATOM   8930  C  CG1 . ILE B  1 503 ? 4.994   -9.327  -12.709 1.00 45.84  ? 503  ILE B CG1 1 
ATOM   8931  C  CG2 . ILE B  1 503 ? 7.178   -9.334  -13.948 1.00 47.84  ? 503  ILE B CG2 1 
ATOM   8932  C  CD1 . ILE B  1 503 ? 5.081   -10.810 -12.464 1.00 45.66  ? 503  ILE B CD1 1 
ATOM   8933  N  N   . GLY B  1 504 ? 3.933   -6.039  -12.983 1.00 47.83  ? 504  GLY B N   1 
ATOM   8934  C  CA  . GLY B  1 504 ? 2.573   -5.683  -12.624 1.00 48.96  ? 504  GLY B CA  1 
ATOM   8935  C  C   . GLY B  1 504 ? 1.654   -5.185  -13.727 1.00 48.40  ? 504  GLY B C   1 
ATOM   8936  O  O   . GLY B  1 504 ? 0.441   -5.376  -13.647 1.00 49.49  ? 504  GLY B O   1 
ATOM   8937  N  N   . LEU B  1 505 ? 2.207   -4.539  -14.748 1.00 45.18  ? 505  LEU B N   1 
ATOM   8938  C  CA  . LEU B  1 505 ? 1.368   -3.932  -15.774 1.00 45.85  ? 505  LEU B CA  1 
ATOM   8939  C  C   . LEU B  1 505 ? 0.597   -4.963  -16.595 1.00 49.37  ? 505  LEU B C   1 
ATOM   8940  O  O   . LEU B  1 505 ? -0.487  -4.678  -17.102 1.00 50.91  ? 505  LEU B O   1 
ATOM   8941  C  CB  . LEU B  1 505 ? 2.178   -3.005  -16.683 1.00 45.89  ? 505  LEU B CB  1 
ATOM   8942  C  CG  . LEU B  1 505 ? 2.523   -1.640  -16.087 1.00 47.36  ? 505  LEU B CG  1 
ATOM   8943  C  CD1 . LEU B  1 505 ? 3.227   -0.773  -17.108 1.00 47.69  ? 505  LEU B CD1 1 
ATOM   8944  C  CD2 . LEU B  1 505 ? 1.267   -0.955  -15.601 1.00 48.66  ? 505  LEU B CD2 1 
ATOM   8945  N  N   . TRP B  1 506 ? 1.153   -6.160  -16.729 1.00 51.74  ? 506  TRP B N   1 
ATOM   8946  C  CA  . TRP B  1 506 ? 0.457   -7.239  -17.420 1.00 56.60  ? 506  TRP B CA  1 
ATOM   8947  C  C   . TRP B  1 506 ? -0.098  -8.283  -16.451 1.00 57.84  ? 506  TRP B C   1 
ATOM   8948  O  O   . TRP B  1 506 ? -1.306  -8.504  -16.392 1.00 59.01  ? 506  TRP B O   1 
ATOM   8949  C  CB  . TRP B  1 506 ? 1.312   -7.866  -18.532 1.00 62.09  ? 506  TRP B CB  1 
ATOM   8950  C  CG  . TRP B  1 506 ? 2.691   -8.272  -18.131 1.00 66.68  ? 506  TRP B CG  1 
ATOM   8951  C  CD1 . TRP B  1 506 ? 3.805   -7.484  -18.115 1.00 68.40  ? 506  TRP B CD1 1 
ATOM   8952  C  CD2 . TRP B  1 506 ? 3.114   -9.576  -17.711 1.00 69.05  ? 506  TRP B CD2 1 
ATOM   8953  N  NE1 . TRP B  1 506 ? 4.894   -8.214  -17.699 1.00 70.01  ? 506  TRP B NE1 1 
ATOM   8954  C  CE2 . TRP B  1 506 ? 4.496   -9.501  -17.445 1.00 70.98  ? 506  TRP B CE2 1 
ATOM   8955  C  CE3 . TRP B  1 506 ? 2.458   -10.797 -17.529 1.00 68.76  ? 506  TRP B CE3 1 
ATOM   8956  C  CZ2 . TRP B  1 506 ? 5.234   -10.602 -17.006 1.00 71.71  ? 506  TRP B CZ2 1 
ATOM   8957  C  CZ3 . TRP B  1 506 ? 3.191   -11.888 -17.090 1.00 69.68  ? 506  TRP B CZ3 1 
ATOM   8958  C  CH2 . TRP B  1 506 ? 4.563   -11.783 -16.834 1.00 70.82  ? 506  TRP B CH2 1 
ATOM   8959  N  N   . PHE B  1 507 ? 0.800   -8.921  -15.706 1.00 57.07  ? 507  PHE B N   1 
ATOM   8960  C  CA  . PHE B  1 507 ? 0.460   -10.005 -14.789 1.00 54.99  ? 507  PHE B CA  1 
ATOM   8961  C  C   . PHE B  1 507 ? -0.730  -9.720  -13.872 1.00 56.22  ? 507  PHE B C   1 
ATOM   8962  O  O   . PHE B  1 507 ? -1.535  -10.613 -13.606 1.00 57.39  ? 507  PHE B O   1 
ATOM   8963  C  CB  . PHE B  1 507 ? 1.680   -10.363 -13.948 1.00 50.71  ? 507  PHE B CB  1 
ATOM   8964  C  CG  . PHE B  1 507 ? 1.440   -11.469 -12.976 1.00 50.60  ? 507  PHE B CG  1 
ATOM   8965  C  CD1 . PHE B  1 507 ? 1.781   -12.768 -13.294 1.00 51.73  ? 507  PHE B CD1 1 
ATOM   8966  C  CD2 . PHE B  1 507 ? 0.882   -11.213 -11.735 1.00 51.11  ? 507  PHE B CD2 1 
ATOM   8967  C  CE1 . PHE B  1 507 ? 1.569   -13.793 -12.387 1.00 51.53  ? 507  PHE B CE1 1 
ATOM   8968  C  CE2 . PHE B  1 507 ? 0.666   -12.232 -10.827 1.00 50.02  ? 507  PHE B CE2 1 
ATOM   8969  C  CZ  . PHE B  1 507 ? 1.008   -13.519 -11.151 1.00 50.11  ? 507  PHE B CZ  1 
ATOM   8970  N  N   . ASP B  1 508 ? -0.837  -8.495  -13.373 1.00 55.53  ? 508  ASP B N   1 
ATOM   8971  C  CA  . ASP B  1 508 ? -1.965  -8.152  -12.514 1.00 59.10  ? 508  ASP B CA  1 
ATOM   8972  C  C   . ASP B  1 508 ? -3.285  -8.132  -13.293 1.00 61.75  ? 508  ASP B C   1 
ATOM   8973  O  O   . ASP B  1 508 ? -4.297  -8.654  -12.828 1.00 63.79  ? 508  ASP B O   1 
ATOM   8974  C  CB  . ASP B  1 508 ? -1.726  -6.826  -11.782 1.00 63.06  ? 508  ASP B CB  1 
ATOM   8975  C  CG  . ASP B  1 508 ? -0.793  -6.973  -10.577 1.00 68.18  ? 508  ASP B CG  1 
ATOM   8976  O  OD1 . ASP B  1 508 ? 0.197   -7.731  -10.655 1.00 70.16  ? 508  ASP B OD1 1 
ATOM   8977  O  OD2 . ASP B  1 508 ? -1.049  -6.329  -9.541  1.00 70.68  ? 508  ASP B OD2 1 
ATOM   8978  N  N   . LYS B  1 509 ? -3.277  -7.541  -14.481 1.00 61.38  ? 509  LYS B N   1 
ATOM   8979  C  CA  . LYS B  1 509 ? -4.475  -7.521  -15.321 1.00 59.88  ? 509  LYS B CA  1 
ATOM   8980  C  C   . LYS B  1 509 ? -5.040  -8.915  -15.595 1.00 61.08  ? 509  LYS B C   1 
ATOM   8981  O  O   . LYS B  1 509 ? -6.254  -9.110  -15.622 1.00 62.06  ? 509  LYS B O   1 
ATOM   8982  C  CB  . LYS B  1 509 ? -4.196  -6.797  -16.639 1.00 57.36  ? 509  LYS B CB  1 
ATOM   8983  C  CG  . LYS B  1 509 ? -4.272  -5.299  -16.515 1.00 57.37  ? 509  LYS B CG  1 
ATOM   8984  C  CD  . LYS B  1 509 ? -3.871  -4.615  -17.799 1.00 59.23  ? 509  LYS B CD  1 
ATOM   8985  C  CE  . LYS B  1 509 ? -4.025  -3.110  -17.676 1.00 60.59  ? 509  LYS B CE  1 
ATOM   8986  N  NZ  . LYS B  1 509 ? -3.568  -2.416  -18.905 1.00 61.08  ? 509  LYS B NZ  1 
ATOM   8987  N  N   . GLU B  1 510 ? -4.155  -9.875  -15.826 1.00 60.12  ? 510  GLU B N   1 
ATOM   8988  C  CA  . GLU B  1 510 ? -4.576  -11.245 -16.081 1.00 58.58  ? 510  GLU B CA  1 
ATOM   8989  C  C   . GLU B  1 510 ? -4.964  -12.015 -14.817 1.00 63.11  ? 510  GLU B C   1 
ATOM   8990  O  O   . GLU B  1 510 ? -6.008  -12.667 -14.782 1.00 65.88  ? 510  GLU B O   1 
ATOM   8991  C  CB  . GLU B  1 510 ? -3.479  -11.993 -16.832 1.00 54.34  ? 510  GLU B CB  1 
ATOM   8992  C  CG  . GLU B  1 510 ? -3.784  -13.448 -17.105 1.00 54.68  ? 510  GLU B CG  1 
ATOM   8993  C  CD  . GLU B  1 510 ? -2.775  -14.076 -18.052 1.00 55.71  ? 510  GLU B CD  1 
ATOM   8994  O  OE1 . GLU B  1 510 ? -2.313  -15.195 -17.744 1.00 56.42  ? 510  GLU B OE1 1 
ATOM   8995  O  OE2 . GLU B  1 510 ? -2.451  -13.463 -19.102 1.00 53.42  ? 510  GLU B OE2 1 
ATOM   8996  N  N   . VAL B  1 511 ? -4.120  -11.951 -13.790 1.00 62.84  ? 511  VAL B N   1 
ATOM   8997  C  CA  . VAL B  1 511 ? -4.346  -12.716 -12.560 1.00 62.23  ? 511  VAL B CA  1 
ATOM   8998  C  C   . VAL B  1 511 ? -5.334  -12.071 -11.581 1.00 62.88  ? 511  VAL B C   1 
ATOM   8999  O  O   . VAL B  1 511 ? -5.946  -12.757 -10.765 1.00 64.25  ? 511  VAL B O   1 
ATOM   9000  C  CB  . VAL B  1 511 ? -3.020  -13.045 -11.843 1.00 59.85  ? 511  VAL B CB  1 
ATOM   9001  C  CG1 . VAL B  1 511 ? -3.263  -13.959 -10.647 1.00 57.83  ? 511  VAL B CG1 1 
ATOM   9002  C  CG2 . VAL B  1 511 ? -2.048  -13.693 -12.814 1.00 59.30  ? 511  VAL B CG2 1 
ATOM   9003  N  N   . ILE B  1 512 ? -5.475  -10.753 -11.655 1.00 61.03  ? 512  ILE B N   1 
ATOM   9004  C  CA  . ILE B  1 512 ? -6.396  -10.028 -10.777 1.00 59.31  ? 512  ILE B CA  1 
ATOM   9005  C  C   . ILE B  1 512 ? -7.606  -9.504  -11.564 1.00 62.38  ? 512  ILE B C   1 
ATOM   9006  O  O   . ILE B  1 512 ? -8.751  -9.864  -11.265 1.00 62.76  ? 512  ILE B O   1 
ATOM   9007  C  CB  . ILE B  1 512 ? -5.698  -8.885  -10.002 1.00 53.73  ? 512  ILE B CB  1 
ATOM   9008  C  CG1 . ILE B  1 512 ? -4.414  -9.387  -9.335  1.00 50.19  ? 512  ILE B CG1 1 
ATOM   9009  C  CG2 . ILE B  1 512 ? -6.638  -8.284  -8.967  1.00 52.10  ? 512  ILE B CG2 1 
ATOM   9010  C  CD1 . ILE B  1 512 ? -4.631  -10.429 -8.261  1.00 48.25  ? 512  ILE B CD1 1 
ATOM   9011  N  N   . GLY B  1 513 ? -7.358  -8.621  -12.533 1.00 62.04  ? 513  GLY B N   1 
ATOM   9012  C  CA  . GLY B  1 513 ? -8.407  -8.192  -13.446 1.00 61.42  ? 513  GLY B CA  1 
ATOM   9013  C  C   . GLY B  1 513 ? -8.065  -7.001  -14.325 1.00 62.12  ? 513  GLY B C   1 
ATOM   9014  O  O   . GLY B  1 513 ? -7.092  -6.295  -14.078 1.00 64.02  ? 513  GLY B O   1 
ATOM   9015  N  N   . ASP B  1 514 ? -8.872  -6.789  -15.362 1.00 63.77  ? 514  ASP B N   1 
ATOM   9016  C  CA  A ASP B  1 514 ? -8.720  -5.641  -16.253 0.50 63.18  ? 514  ASP B CA  1 
ATOM   9017  C  CA  B ASP B  1 514 ? -8.711  -5.642  -16.249 0.50 63.18  ? 514  ASP B CA  1 
ATOM   9018  C  C   . ASP B  1 514 ? -9.193  -4.354  -15.582 1.00 63.62  ? 514  ASP B C   1 
ATOM   9019  O  O   . ASP B  1 514 ? -9.954  -4.390  -14.609 1.00 60.96  ? 514  ASP B O   1 
ATOM   9020  C  CB  A ASP B  1 514 ? -9.502  -5.854  -17.552 0.50 65.56  ? 514  ASP B CB  1 
ATOM   9021  C  CB  B ASP B  1 514 ? -9.465  -5.879  -17.558 0.50 65.57  ? 514  ASP B CB  1 
ATOM   9022  C  CG  A ASP B  1 514 ? -8.797  -6.789  -18.519 0.50 66.70  ? 514  ASP B CG  1 
ATOM   9023  C  CG  B ASP B  1 514 ? -9.145  -4.841  -18.618 0.50 64.45  ? 514  ASP B CG  1 
ATOM   9024  O  OD1 A ASP B  1 514 ? -7.552  -6.881  -18.462 0.50 68.21  ? 514  ASP B OD1 1 
ATOM   9025  O  OD1 B ASP B  1 514 ? -8.147  -4.105  -18.462 0.50 63.14  ? 514  ASP B OD1 1 
ATOM   9026  O  OD2 A ASP B  1 514 ? -9.489  -7.424  -19.346 0.50 67.95  ? 514  ASP B OD2 1 
ATOM   9027  O  OD2 B ASP B  1 514 ? -9.890  -4.774  -19.618 0.50 65.98  ? 514  ASP B OD2 1 
ATOM   9028  N  N   . ASN B  1 515 ? -8.738  -3.219  -16.104 1.00 63.94  ? 515  ASN B N   1 
ATOM   9029  C  CA  . ASN B  1 515 ? -9.120  -1.913  -15.575 1.00 63.58  ? 515  ASN B CA  1 
ATOM   9030  C  C   . ASN B  1 515 ? -8.888  -1.838  -14.075 1.00 63.99  ? 515  ASN B C   1 
ATOM   9031  O  O   . ASN B  1 515 ? -9.835  -1.646  -13.310 1.00 64.50  ? 515  ASN B O   1 
ATOM   9032  C  CB  . ASN B  1 515 ? -10.591 -1.614  -15.874 1.00 63.65  ? 515  ASN B CB  1 
ATOM   9033  C  CG  . ASN B  1 515 ? -10.984 -1.959  -17.298 1.00 63.20  ? 515  ASN B CG  1 
ATOM   9034  O  OD1 . ASN B  1 515 ? -10.299 -1.595  -18.259 1.00 65.05  ? 515  ASN B OD1 1 
ATOM   9035  N  ND2 . ASN B  1 515 ? -12.096 -2.670  -17.441 1.00 60.82  ? 515  ASN B ND2 1 
ATOM   9036  N  N   . PRO B  1 516 ? -7.623  -1.983  -13.649 1.00 62.92  ? 516  PRO B N   1 
ATOM   9037  C  CA  . PRO B  1 516 ? -7.267  -2.059  -12.226 1.00 60.60  ? 516  PRO B CA  1 
ATOM   9038  C  C   . PRO B  1 516 ? -7.767  -0.856  -11.420 1.00 58.75  ? 516  PRO B C   1 
ATOM   9039  O  O   . PRO B  1 516 ? -8.204  -1.017  -10.276 1.00 58.86  ? 516  PRO B O   1 
ATOM   9040  C  CB  . PRO B  1 516 ? -5.737  -2.081  -12.251 1.00 59.41  ? 516  PRO B CB  1 
ATOM   9041  C  CG  . PRO B  1 516 ? -5.384  -2.581  -13.607 1.00 60.19  ? 516  PRO B CG  1 
ATOM   9042  C  CD  . PRO B  1 516 ? -6.434  -2.032  -14.517 1.00 61.32  ? 516  PRO B CD  1 
ATOM   9043  N  N   . LEU B  1 517 ? -7.711  0.328   -12.022 1.00 56.45  ? 517  LEU B N   1 
ATOM   9044  C  CA  . LEU B  1 517 ? -8.107  1.556   -11.350 1.00 56.40  ? 517  LEU B CA  1 
ATOM   9045  C  C   . LEU B  1 517 ? -9.585  1.555   -10.994 1.00 61.74  ? 517  LEU B C   1 
ATOM   9046  O  O   . LEU B  1 517 ? -9.965  1.977   -9.906  1.00 66.10  ? 517  LEU B O   1 
ATOM   9047  C  CB  . LEU B  1 517 ? -7.801  2.759   -12.235 1.00 55.35  ? 517  LEU B CB  1 
ATOM   9048  C  CG  . LEU B  1 517 ? -6.361  2.900   -12.736 1.00 52.44  ? 517  LEU B CG  1 
ATOM   9049  C  CD1 . LEU B  1 517 ? -6.192  4.183   -13.530 1.00 49.04  ? 517  LEU B CD1 1 
ATOM   9050  C  CD2 . LEU B  1 517 ? -5.376  2.858   -11.578 1.00 52.59  ? 517  LEU B CD2 1 
ATOM   9051  N  N   . GLU B  1 518 ? -10.424 1.125   -11.932 1.00 63.76  ? 518  GLU B N   1 
ATOM   9052  C  CA  . GLU B  1 518 ? -11.861 1.055   -11.688 1.00 62.35  ? 518  GLU B CA  1 
ATOM   9053  C  C   . GLU B  1 518 ? -12.343 -0.274  -11.086 1.00 64.60  ? 518  GLU B C   1 
ATOM   9054  O  O   . GLU B  1 518 ? -13.446 -0.341  -10.550 1.00 69.13  ? 518  GLU B O   1 
ATOM   9055  C  CB  . GLU B  1 518 ? -12.626 1.364   -12.981 1.00 60.45  ? 518  GLU B CB  1 
ATOM   9056  N  N   . ASN B  1 519 ? -11.513 -1.313  -11.133 1.00 62.25  ? 519  ASN B N   1 
ATOM   9057  C  CA  . ASN B  1 519 ? -11.933 -2.650  -10.696 1.00 61.49  ? 519  ASN B CA  1 
ATOM   9058  C  C   . ASN B  1 519 ? -11.891 -2.835  -9.167  1.00 66.34  ? 519  ASN B C   1 
ATOM   9059  O  O   . ASN B  1 519 ? -10.837 -2.686  -8.545  1.00 69.15  ? 519  ASN B O   1 
ATOM   9060  C  CB  . ASN B  1 519 ? -11.097 -3.719  -11.419 1.00 56.76  ? 519  ASN B CB  1 
ATOM   9061  C  CG  . ASN B  1 519 ? -11.534 -5.138  -11.095 1.00 54.32  ? 519  ASN B CG  1 
ATOM   9062  O  OD1 . ASN B  1 519 ? -12.065 -5.407  -10.022 1.00 56.99  ? 519  ASN B OD1 1 
ATOM   9063  N  ND2 . ASN B  1 519 ? -11.292 -6.058  -12.021 1.00 51.34  ? 519  ASN B ND2 1 
ATOM   9064  N  N   . GLU B  1 520 ? -13.037 -3.164  -8.569  1.00 68.88  ? 520  GLU B N   1 
ATOM   9065  C  CA  . GLU B  1 520 ? -13.138 -3.296  -7.110  1.00 75.03  ? 520  GLU B CA  1 
ATOM   9066  C  C   . GLU B  1 520 ? -12.570 -4.626  -6.602  1.00 72.13  ? 520  GLU B C   1 
ATOM   9067  O  O   . GLU B  1 520 ? -12.434 -4.837  -5.393  1.00 71.26  ? 520  GLU B O   1 
ATOM   9068  C  CB  . GLU B  1 520 ? -14.593 -3.104  -6.635  1.00 82.99  ? 520  GLU B CB  1 
ATOM   9069  C  CG  . GLU B  1 520 ? -14.803 -3.073  -5.104  1.00 88.12  ? 520  GLU B CG  1 
ATOM   9070  C  CD  . GLU B  1 520 ? -14.131 -1.883  -4.414  1.00 92.33  ? 520  GLU B CD  1 
ATOM   9071  O  OE1 . GLU B  1 520 ? -14.003 -1.905  -3.168  1.00 92.94  ? 520  GLU B OE1 1 
ATOM   9072  O  OE2 . GLU B  1 520 ? -13.735 -0.924  -5.111  1.00 93.76  ? 520  GLU B OE2 1 
ATOM   9073  N  N   . ASN B  1 521 ? -12.233 -5.522  -7.523  1.00 69.04  ? 521  ASN B N   1 
ATOM   9074  C  CA  . ASN B  1 521 ? -11.649 -6.793  -7.132  1.00 68.19  ? 521  ASN B CA  1 
ATOM   9075  C  C   . ASN B  1 521 ? -10.296 -6.570  -6.468  1.00 69.61  ? 521  ASN B C   1 
ATOM   9076  O  O   . ASN B  1 521 ? -9.871  -7.359  -5.622  1.00 71.82  ? 521  ASN B O   1 
ATOM   9077  C  CB  . ASN B  1 521 ? -11.504 -7.718  -8.337  1.00 68.87  ? 521  ASN B CB  1 
ATOM   9078  C  CG  . ASN B  1 521 ? -11.693 -9.179  -7.976  1.00 70.83  ? 521  ASN B CG  1 
ATOM   9079  O  OD1 . ASN B  1 521 ? -12.460 -9.516  -7.071  1.00 72.01  ? 521  ASN B OD1 1 
ATOM   9080  N  ND2 . ASN B  1 521 ? -10.990 -10.056 -8.684  1.00 70.57  ? 521  ASN B ND2 1 
ATOM   9081  N  N   . TYR B  1 522 ? -9.634  -5.474  -6.835  1.00 67.66  ? 522  TYR B N   1 
ATOM   9082  C  CA  . TYR B  1 522 ? -8.314  -5.167  -6.289  1.00 66.62  ? 522  TYR B CA  1 
ATOM   9083  C  C   . TYR B  1 522 ? -8.325  -4.865  -4.795  1.00 67.69  ? 522  TYR B C   1 
ATOM   9084  O  O   . TYR B  1 522 ? -7.351  -5.156  -4.103  1.00 68.25  ? 522  TYR B O   1 
ATOM   9085  C  CB  . TYR B  1 522 ? -7.626  -4.041  -7.072  1.00 64.02  ? 522  TYR B CB  1 
ATOM   9086  C  CG  . TYR B  1 522 ? -6.987  -4.511  -8.361  1.00 61.20  ? 522  TYR B CG  1 
ATOM   9087  C  CD1 . TYR B  1 522 ? -7.755  -4.716  -9.505  1.00 62.11  ? 522  TYR B CD1 1 
ATOM   9088  C  CD2 . TYR B  1 522 ? -5.624  -4.760  -8.434  1.00 57.20  ? 522  TYR B CD2 1 
ATOM   9089  C  CE1 . TYR B  1 522 ? -7.181  -5.149  -10.687 1.00 59.71  ? 522  TYR B CE1 1 
ATOM   9090  C  CE2 . TYR B  1 522 ? -5.041  -5.192  -9.614  1.00 55.76  ? 522  TYR B CE2 1 
ATOM   9091  C  CZ  . TYR B  1 522 ? -5.827  -5.385  -10.735 1.00 56.82  ? 522  TYR B CZ  1 
ATOM   9092  O  OH  . TYR B  1 522 ? -5.267  -5.817  -11.912 1.00 56.86  ? 522  TYR B OH  1 
ATOM   9093  N  N   . ARG B  1 523 ? -9.403  -4.269  -4.297  1.00 67.55  ? 523  ARG B N   1 
ATOM   9094  C  CA  . ARG B  1 523 ? -9.539  -4.086  -2.858  1.00 66.51  ? 523  ARG B CA  1 
ATOM   9095  C  C   . ARG B  1 523 ? -10.010 -5.367  -2.175  1.00 66.63  ? 523  ARG B C   1 
ATOM   9096  O  O   . ARG B  1 523 ? -9.532  -5.712  -1.097  1.00 66.73  ? 523  ARG B O   1 
ATOM   9097  C  CB  . ARG B  1 523 ? -10.478 -2.926  -2.521  1.00 67.05  ? 523  ARG B CB  1 
ATOM   9098  C  CG  . ARG B  1 523 ? -9.843  -1.545  -2.645  1.00 68.58  ? 523  ARG B CG  1 
ATOM   9099  C  CD  . ARG B  1 523 ? -10.697 -0.468  -1.979  1.00 68.82  ? 523  ARG B CD  1 
ATOM   9100  N  N   . LYS B  1 524 ? -10.936 -6.081  -2.809  1.00 66.18  ? 524  LYS B N   1 
ATOM   9101  C  CA  . LYS B  1 524 ? -11.587 -7.214  -2.153  1.00 65.77  ? 524  LYS B CA  1 
ATOM   9102  C  C   . LYS B  1 524 ? -10.627 -8.365  -1.851  1.00 65.53  ? 524  LYS B C   1 
ATOM   9103  O  O   . LYS B  1 524 ? -10.726 -9.003  -0.802  1.00 65.65  ? 524  LYS B O   1 
ATOM   9104  C  CB  . LYS B  1 524 ? -12.777 -7.712  -2.979  1.00 65.18  ? 524  LYS B CB  1 
ATOM   9105  N  N   . LEU B  1 525 ? -9.699  -8.614  -2.772  1.00 63.72  ? 525  LEU B N   1 
ATOM   9106  C  CA  . LEU B  1 525 ? -8.769  -9.741  -2.675  1.00 61.54  ? 525  LEU B CA  1 
ATOM   9107  C  C   . LEU B  1 525 ? -7.419  -9.409  -2.009  1.00 60.98  ? 525  LEU B C   1 
ATOM   9108  O  O   . LEU B  1 525 ? -6.504  -10.237 -2.006  1.00 60.85  ? 525  LEU B O   1 
ATOM   9109  C  CB  . LEU B  1 525 ? -8.572  -10.394 -4.049  1.00 60.64  ? 525  LEU B CB  1 
ATOM   9110  C  CG  . LEU B  1 525 ? -9.868  -10.880 -4.715  1.00 60.58  ? 525  LEU B CG  1 
ATOM   9111  C  CD1 . LEU B  1 525 ? -9.602  -11.584 -6.040  1.00 60.37  ? 525  LEU B CD1 1 
ATOM   9112  C  CD2 . LEU B  1 525 ? -10.648 -11.792 -3.786  1.00 60.25  ? 525  LEU B CD2 1 
ATOM   9113  N  N   . SER B  1 526 ? -7.287  -8.190  -1.487  1.00 59.50  ? 526  SER B N   1 
ATOM   9114  C  CA  . SER B  1 526 ? -6.053  -7.760  -0.826  1.00 58.06  ? 526  SER B CA  1 
ATOM   9115  C  C   . SER B  1 526 ? -6.122  -7.804  0.694   1.00 59.34  ? 526  SER B C   1 
ATOM   9116  O  O   . SER B  1 526 ? -6.930  -7.107  1.305   1.00 61.39  ? 526  SER B O   1 
ATOM   9117  C  CB  . SER B  1 526 ? -5.685  -6.347  -1.257  1.00 57.10  ? 526  SER B CB  1 
ATOM   9118  O  OG  . SER B  1 526 ? -5.454  -6.305  -2.650  1.00 60.90  ? 526  SER B OG  1 
ATOM   9119  N  N   . PRO B  1 527 ? -5.241  -8.605  1.311   1.00 57.57  ? 527  PRO B N   1 
ATOM   9120  C  CA  . PRO B  1 527 ? -5.166  -8.754  2.767   1.00 56.26  ? 527  PRO B CA  1 
ATOM   9121  C  C   . PRO B  1 527 ? -5.094  -7.426  3.533   1.00 54.89  ? 527  PRO B C   1 
ATOM   9122  O  O   . PRO B  1 527 ? -5.571  -7.370  4.670   1.00 55.34  ? 527  PRO B O   1 
ATOM   9123  C  CB  . PRO B  1 527 ? -3.886  -9.565  2.956   1.00 54.12  ? 527  PRO B CB  1 
ATOM   9124  C  CG  . PRO B  1 527 ? -3.821  -10.407 1.738   1.00 53.38  ? 527  PRO B CG  1 
ATOM   9125  C  CD  . PRO B  1 527 ? -4.313  -9.521  0.625   1.00 55.51  ? 527  PRO B CD  1 
ATOM   9126  N  N   . LEU B  1 528 ? -4.539  -6.382  2.919   1.00 52.11  ? 528  LEU B N   1 
ATOM   9127  C  CA  . LEU B  1 528 ? -4.379  -5.077  3.575   1.00 50.57  ? 528  LEU B CA  1 
ATOM   9128  C  C   . LEU B  1 528 ? -5.667  -4.485  4.170   1.00 54.11  ? 528  LEU B C   1 
ATOM   9129  O  O   . LEU B  1 528 ? -5.632  -3.842  5.220   1.00 55.80  ? 528  LEU B O   1 
ATOM   9130  C  CB  . LEU B  1 528 ? -3.745  -4.068  2.611   1.00 47.97  ? 528  LEU B CB  1 
ATOM   9131  C  CG  . LEU B  1 528 ? -3.416  -2.673  3.149   1.00 47.06  ? 528  LEU B CG  1 
ATOM   9132  C  CD1 . LEU B  1 528 ? -2.315  -2.753  4.202   1.00 48.22  ? 528  LEU B CD1 1 
ATOM   9133  C  CD2 . LEU B  1 528 ? -3.022  -1.707  2.030   1.00 43.26  ? 528  LEU B CD2 1 
ATOM   9134  N  N   . PHE B  1 529 ? -6.798  -4.699  3.503   1.00 55.51  ? 529  PHE B N   1 
ATOM   9135  C  CA  . PHE B  1 529 ? -8.061  -4.100  3.933   1.00 56.21  ? 529  PHE B CA  1 
ATOM   9136  C  C   . PHE B  1 529 ? -8.780  -4.903  5.004   1.00 56.97  ? 529  PHE B C   1 
ATOM   9137  O  O   . PHE B  1 529 ? -9.778  -4.449  5.558   1.00 56.97  ? 529  PHE B O   1 
ATOM   9138  C  CB  . PHE B  1 529 ? -8.984  -3.932  2.735   1.00 56.88  ? 529  PHE B CB  1 
ATOM   9139  C  CG  . PHE B  1 529 ? -8.483  -2.949  1.739   1.00 56.95  ? 529  PHE B CG  1 
ATOM   9140  C  CD1 . PHE B  1 529 ? -7.834  -3.375  0.595   1.00 57.14  ? 529  PHE B CD1 1 
ATOM   9141  C  CD2 . PHE B  1 529 ? -8.636  -1.591  1.960   1.00 56.77  ? 529  PHE B CD2 1 
ATOM   9142  C  CE1 . PHE B  1 529 ? -7.363  -2.464  -0.321  1.00 58.30  ? 529  PHE B CE1 1 
ATOM   9143  C  CE2 . PHE B  1 529 ? -8.171  -0.673  1.052   1.00 57.57  ? 529  PHE B CE2 1 
ATOM   9144  C  CZ  . PHE B  1 529 ? -7.532  -1.107  -0.094  1.00 58.80  ? 529  PHE B CZ  1 
ATOM   9145  N  N   . TYR B  1 530 ? -8.309  -6.124  5.225   1.00 57.17  ? 530  TYR B N   1 
ATOM   9146  C  CA  . TYR B  1 530 ? -8.833  -7.017  6.255   1.00 55.78  ? 530  TYR B CA  1 
ATOM   9147  C  C   . TYR B  1 530 ? -8.022  -7.027  7.554   1.00 58.33  ? 530  TYR B C   1 
ATOM   9148  O  O   . TYR B  1 530 ? -8.290  -7.826  8.452   1.00 59.29  ? 530  TYR B O   1 
ATOM   9149  C  CB  . TYR B  1 530 ? -9.000  -8.422  5.694   1.00 54.29  ? 530  TYR B CB  1 
ATOM   9150  C  CG  . TYR B  1 530 ? -9.901  -8.454  4.483   1.00 54.78  ? 530  TYR B CG  1 
ATOM   9151  C  CD1 . TYR B  1 530 ? -9.417  -8.114  3.226   1.00 54.34  ? 530  TYR B CD1 1 
ATOM   9152  C  CD2 . TYR B  1 530 ? -11.238 -8.813  4.597   1.00 55.81  ? 530  TYR B CD2 1 
ATOM   9153  C  CE1 . TYR B  1 530 ? -10.233 -8.140  2.114   1.00 57.05  ? 530  TYR B CE1 1 
ATOM   9154  C  CE2 . TYR B  1 530 ? -12.067 -8.844  3.489   1.00 57.67  ? 530  TYR B CE2 1 
ATOM   9155  C  CZ  . TYR B  1 530 ? -11.559 -8.506  2.248   1.00 58.62  ? 530  TYR B CZ  1 
ATOM   9156  O  OH  . TYR B  1 530 ? -12.380 -8.533  1.140   1.00 57.16  ? 530  TYR B OH  1 
ATOM   9157  N  N   . ALA B  1 531 ? -7.013  -6.164  7.634   1.00 58.06  ? 531  ALA B N   1 
ATOM   9158  C  CA  . ALA B  1 531 ? -6.032  -6.210  8.721   1.00 58.62  ? 531  ALA B CA  1 
ATOM   9159  C  C   . ALA B  1 531 ? -6.628  -6.230  10.133  1.00 60.28  ? 531  ALA B C   1 
ATOM   9160  O  O   . ALA B  1 531 ? -6.011  -6.758  11.061  1.00 59.32  ? 531  ALA B O   1 
ATOM   9161  C  CB  . ALA B  1 531 ? -5.038  -5.059  8.585   1.00 57.39  ? 531  ALA B CB  1 
ATOM   9162  N  N   . LYS B  1 532 ? -7.814  -5.653  10.300  1.00 61.83  ? 532  LYS B N   1 
ATOM   9163  C  CA  . LYS B  1 532 ? -8.461  -5.636  11.608  1.00 61.77  ? 532  LYS B CA  1 
ATOM   9164  C  C   . LYS B  1 532 ? -8.692  -7.059  12.114  1.00 64.19  ? 532  LYS B C   1 
ATOM   9165  O  O   . LYS B  1 532 ? -8.804  -7.285  13.321  1.00 65.72  ? 532  LYS B O   1 
ATOM   9166  C  CB  . LYS B  1 532 ? -9.787  -4.869  11.552  1.00 59.61  ? 532  LYS B CB  1 
ATOM   9167  N  N   . ASN B  1 533 ? -8.740  -8.012  11.184  1.00 62.45  ? 533  ASN B N   1 
ATOM   9168  C  CA  . ASN B  1 533 ? -9.037  -9.406  11.506  1.00 62.24  ? 533  ASN B CA  1 
ATOM   9169  C  C   . ASN B  1 533 ? -7.891  -10.233 12.094  1.00 64.24  ? 533  ASN B C   1 
ATOM   9170  O  O   . ASN B  1 533 ? -8.136  -11.318 12.621  1.00 65.82  ? 533  ASN B O   1 
ATOM   9171  C  CB  . ASN B  1 533 ? -9.560  -10.150 10.268  1.00 60.38  ? 533  ASN B CB  1 
ATOM   9172  C  CG  . ASN B  1 533 ? -10.893 -9.631  9.785   1.00 58.01  ? 533  ASN B CG  1 
ATOM   9173  O  OD1 . ASN B  1 533 ? -11.632 -8.997  10.533  1.00 59.65  ? 533  ASN B OD1 1 
ATOM   9174  N  ND2 . ASN B  1 533 ? -11.214 -9.908  8.525   1.00 55.42  ? 533  ASN B ND2 1 
ATOM   9175  N  N   . VAL B  1 534 ? -6.648  -9.764  12.004  1.00 64.06  ? 534  VAL B N   1 
ATOM   9176  C  CA  . VAL B  1 534 ? -5.544  -10.661 12.346  1.00 63.46  ? 534  VAL B CA  1 
ATOM   9177  C  C   . VAL B  1 534 ? -5.376  -10.757 13.857  1.00 61.88  ? 534  VAL B C   1 
ATOM   9178  O  O   . VAL B  1 534 ? -5.122  -9.762  14.526  1.00 61.16  ? 534  VAL B O   1 
ATOM   9179  C  CB  . VAL B  1 534 ? -4.203  -10.193 11.729  1.00 61.82  ? 534  VAL B CB  1 
ATOM   9180  C  CG1 . VAL B  1 534 ? -3.101  -11.188 12.050  1.00 62.02  ? 534  VAL B CG1 1 
ATOM   9181  C  CG2 . VAL B  1 534 ? -4.328  -10.015 10.226  1.00 61.26  ? 534  VAL B CG2 1 
ATOM   9182  N  N   . LYS B  1 535 ? -5.569  -11.950 14.405  1.00 62.41  ? 535  LYS B N   1 
ATOM   9183  C  CA  . LYS B  1 535 ? -5.268  -12.161 15.811  1.00 63.30  ? 535  LYS B CA  1 
ATOM   9184  C  C   . LYS B  1 535 ? -3.922  -12.844 16.077  1.00 62.29  ? 535  LYS B C   1 
ATOM   9185  O  O   . LYS B  1 535 ? -3.484  -12.938 17.221  1.00 64.05  ? 535  LYS B O   1 
ATOM   9186  C  CB  . LYS B  1 535 ? -6.415  -12.931 16.481  1.00 64.20  ? 535  LYS B CB  1 
ATOM   9187  C  CG  . LYS B  1 535 ? -7.794  -12.296 16.287  1.00 63.86  ? 535  LYS B CG  1 
ATOM   9188  N  N   . ALA B  1 536 ? -3.249  -13.293 15.026  1.00 59.51  ? 536  ALA B N   1 
ATOM   9189  C  CA  . ALA B  1 536 ? -1.989  -14.014 15.211  1.00 59.85  ? 536  ALA B CA  1 
ATOM   9190  C  C   . ALA B  1 536 ? -0.758  -13.106 15.177  1.00 61.21  ? 536  ALA B C   1 
ATOM   9191  O  O   . ALA B  1 536 ? -0.756  -12.078 14.494  1.00 62.40  ? 536  ALA B O   1 
ATOM   9192  C  CB  . ALA B  1 536 ? -1.855  -15.145 14.197  1.00 59.36  ? 536  ALA B CB  1 
ATOM   9193  N  N   . PRO B  1 537 ? 0.294   -13.481 15.920  1.00 59.90  ? 537  PRO B N   1 
ATOM   9194  C  CA  . PRO B  1 537 ? 1.562   -12.767 15.774  1.00 57.97  ? 537  PRO B CA  1 
ATOM   9195  C  C   . PRO B  1 537 ? 2.135   -13.071 14.393  1.00 57.80  ? 537  PRO B C   1 
ATOM   9196  O  O   . PRO B  1 537 ? 2.079   -14.219 13.939  1.00 58.91  ? 537  PRO B O   1 
ATOM   9197  C  CB  . PRO B  1 537 ? 2.436   -13.373 16.877  1.00 57.70  ? 537  PRO B CB  1 
ATOM   9198  C  CG  . PRO B  1 537 ? 1.860   -14.714 17.118  1.00 59.07  ? 537  PRO B CG  1 
ATOM   9199  C  CD  . PRO B  1 537 ? 0.381   -14.566 16.910  1.00 59.90  ? 537  PRO B CD  1 
ATOM   9200  N  N   . LEU B  1 538 ? 2.667   -12.047 13.734  1.00 53.87  ? 538  LEU B N   1 
ATOM   9201  C  CA  . LEU B  1 538 ? 3.143   -12.174 12.366  1.00 50.24  ? 538  LEU B CA  1 
ATOM   9202  C  C   . LEU B  1 538 ? 4.543   -11.588 12.219  1.00 49.87  ? 538  LEU B C   1 
ATOM   9203  O  O   . LEU B  1 538 ? 4.824   -10.491 12.704  1.00 49.79  ? 538  LEU B O   1 
ATOM   9204  C  CB  . LEU B  1 538 ? 2.181   -11.448 11.424  1.00 49.50  ? 538  LEU B CB  1 
ATOM   9205  C  CG  . LEU B  1 538 ? 2.605   -11.274 9.963   1.00 48.86  ? 538  LEU B CG  1 
ATOM   9206  C  CD1 . LEU B  1 538 ? 2.789   -12.626 9.305   1.00 50.92  ? 538  LEU B CD1 1 
ATOM   9207  C  CD2 . LEU B  1 538 ? 1.594   -10.435 9.193   1.00 46.07  ? 538  LEU B CD2 1 
ATOM   9208  N  N   . LEU B  1 539 ? 5.424   -12.324 11.553  1.00 50.14  ? 539  LEU B N   1 
ATOM   9209  C  CA  . LEU B  1 539 ? 6.735   -11.795 11.190  1.00 48.23  ? 539  LEU B CA  1 
ATOM   9210  C  C   . LEU B  1 539 ? 6.801   -11.566 9.686   1.00 50.43  ? 539  LEU B C   1 
ATOM   9211  O  O   . LEU B  1 539 ? 6.594   -12.487 8.895   1.00 52.50  ? 539  LEU B O   1 
ATOM   9212  C  CB  . LEU B  1 539 ? 7.854   -12.747 11.608  1.00 45.55  ? 539  LEU B CB  1 
ATOM   9213  C  CG  . LEU B  1 539 ? 9.205   -12.460 10.945  1.00 44.96  ? 539  LEU B CG  1 
ATOM   9214  C  CD1 . LEU B  1 539 ? 9.823   -11.172 11.480  1.00 43.98  ? 539  LEU B CD1 1 
ATOM   9215  C  CD2 . LEU B  1 539 ? 10.164  -13.628 11.114  1.00 44.50  ? 539  LEU B CD2 1 
ATOM   9216  N  N   . LEU B  1 540 ? 7.088   -10.330 9.300   1.00 49.89  ? 540  LEU B N   1 
ATOM   9217  C  CA  . LEU B  1 540 ? 7.191   -9.959  7.899   1.00 49.13  ? 540  LEU B CA  1 
ATOM   9218  C  C   . LEU B  1 540 ? 8.645   -9.817  7.477   1.00 50.64  ? 540  LEU B C   1 
ATOM   9219  O  O   . LEU B  1 540 ? 9.396   -9.024  8.041   1.00 50.15  ? 540  LEU B O   1 
ATOM   9220  C  CB  . LEU B  1 540 ? 6.451   -8.649  7.653   1.00 46.85  ? 540  LEU B CB  1 
ATOM   9221  C  CG  . LEU B  1 540 ? 4.937   -8.794  7.581   1.00 42.38  ? 540  LEU B CG  1 
ATOM   9222  C  CD1 . LEU B  1 540 ? 4.256   -7.445  7.710   1.00 38.74  ? 540  LEU B CD1 1 
ATOM   9223  C  CD2 . LEU B  1 540 ? 4.572   -9.467  6.270   1.00 41.49  ? 540  LEU B CD2 1 
ATOM   9224  N  N   . ILE B  1 541 ? 9.029   -10.593 6.472   1.00 51.34  ? 541  ILE B N   1 
ATOM   9225  C  CA  . ILE B  1 541 ? 10.383  -10.570 5.944   1.00 49.12  ? 541  ILE B CA  1 
ATOM   9226  C  C   . ILE B  1 541 ? 10.386  -9.906  4.575   1.00 50.17  ? 541  ILE B C   1 
ATOM   9227  O  O   . ILE B  1 541 ? 9.451   -10.079 3.802   1.00 51.75  ? 541  ILE B O   1 
ATOM   9228  C  CB  . ILE B  1 541 ? 10.934  -11.993 5.834   1.00 46.35  ? 541  ILE B CB  1 
ATOM   9229  C  CG1 . ILE B  1 541 ? 11.123  -12.582 7.234   1.00 48.76  ? 541  ILE B CG1 1 
ATOM   9230  C  CG2 . ILE B  1 541 ? 12.234  -11.998 5.086   1.00 44.39  ? 541  ILE B CG2 1 
ATOM   9231  C  CD1 . ILE B  1 541 ? 11.821  -13.927 7.250   1.00 49.84  ? 541  ILE B CD1 1 
ATOM   9232  N  N   . HIS B  1 542 ? 11.418  -9.119  4.287   1.00 49.47  ? 542  HIS B N   1 
ATOM   9233  C  CA  . HIS B  1 542 ? 11.536  -8.478  2.980   1.00 48.20  ? 542  HIS B CA  1 
ATOM   9234  C  C   . HIS B  1 542 ? 12.977  -8.125  2.632   1.00 48.04  ? 542  HIS B C   1 
ATOM   9235  O  O   . HIS B  1 542 ? 13.855  -8.138  3.491   1.00 46.87  ? 542  HIS B O   1 
ATOM   9236  C  CB  . HIS B  1 542 ? 10.641  -7.244  2.869   1.00 48.10  ? 542  HIS B CB  1 
ATOM   9237  C  CG  . HIS B  1 542 ? 10.008  -7.086  1.524   1.00 51.37  ? 542  HIS B CG  1 
ATOM   9238  N  ND1 . HIS B  1 542 ? 8.834   -7.720  1.176   1.00 52.37  ? 542  HIS B ND1 1 
ATOM   9239  C  CD2 . HIS B  1 542 ? 10.392  -6.382  0.431   1.00 52.61  ? 542  HIS B CD2 1 
ATOM   9240  C  CE1 . HIS B  1 542 ? 8.515   -7.402  -0.068  1.00 52.64  ? 542  HIS B CE1 1 
ATOM   9241  N  NE2 . HIS B  1 542 ? 9.445   -6.594  -0.543  1.00 51.64  ? 542  HIS B NE2 1 
ATOM   9242  N  N   . SER B  1 543 ? 13.207  -7.829  1.356   1.00 48.88  ? 543  SER B N   1 
ATOM   9243  C  CA  . SER B  1 543 ? 14.528  -7.468  0.849   1.00 44.72  ? 543  SER B CA  1 
ATOM   9244  C  C   . SER B  1 543 ? 14.448  -6.248  -0.076  1.00 44.48  ? 543  SER B C   1 
ATOM   9245  O  O   . SER B  1 543 ? 13.610  -6.192  -0.972  1.00 46.17  ? 543  SER B O   1 
ATOM   9246  C  CB  . SER B  1 543 ? 15.150  -8.657  0.118   1.00 41.90  ? 543  SER B CB  1 
ATOM   9247  O  OG  . SER B  1 543 ? 14.295  -9.118  -0.916  1.00 41.80  ? 543  SER B OG  1 
ATOM   9248  N  N   . LEU B  1 544 ? 15.331  -5.278  0.144   1.00 45.07  ? 544  LEU B N   1 
ATOM   9249  C  CA  . LEU B  1 544 ? 15.266  -3.985  -0.540  1.00 45.97  ? 544  LEU B CA  1 
ATOM   9250  C  C   . LEU B  1 544 ? 15.421  -4.031  -2.059  1.00 50.49  ? 544  LEU B C   1 
ATOM   9251  O  O   . LEU B  1 544 ? 15.048  -3.081  -2.751  1.00 52.62  ? 544  LEU B O   1 
ATOM   9252  C  CB  . LEU B  1 544 ? 16.304  -3.026  0.042   1.00 43.09  ? 544  LEU B CB  1 
ATOM   9253  C  CG  . LEU B  1 544 ? 16.001  -2.586  1.469   1.00 44.53  ? 544  LEU B CG  1 
ATOM   9254  C  CD1 . LEU B  1 544 ? 17.015  -1.559  1.932   1.00 44.16  ? 544  LEU B CD1 1 
ATOM   9255  C  CD2 . LEU B  1 544 ? 14.596  -2.020  1.527   1.00 44.93  ? 544  LEU B CD2 1 
ATOM   9256  N  N   . GLU B  1 545 ? 15.998  -5.113  -2.570  1.00 51.69  ? 545  GLU B N   1 
ATOM   9257  C  CA  . GLU B  1 545 ? 16.260  -5.234  -4.004  1.00 53.01  ? 545  GLU B CA  1 
ATOM   9258  C  C   . GLU B  1 545 ? 15.210  -5.995  -4.795  1.00 51.55  ? 545  GLU B C   1 
ATOM   9259  O  O   . GLU B  1 545 ? 15.395  -6.236  -5.995  1.00 50.00  ? 545  GLU B O   1 
ATOM   9260  C  CB  . GLU B  1 545 ? 17.652  -5.789  -4.272  1.00 53.74  ? 545  GLU B CB  1 
ATOM   9261  C  CG  . GLU B  1 545 ? 18.736  -4.795  -3.968  1.00 53.45  ? 545  GLU B CG  1 
ATOM   9262  C  CD  . GLU B  1 545 ? 20.093  -5.336  -4.304  1.00 56.50  ? 545  GLU B CD  1 
ATOM   9263  O  OE1 . GLU B  1 545 ? 20.523  -6.309  -3.650  1.00 57.75  ? 545  GLU B OE1 1 
ATOM   9264  O  OE2 . GLU B  1 545 ? 20.721  -4.799  -5.236  1.00 57.70  ? 545  GLU B OE2 1 
ATOM   9265  N  N   . ASP B  1 546 ? 14.119  -6.366  -4.126  1.00 50.93  ? 546  ASP B N   1 
ATOM   9266  C  CA  . ASP B  1 546 ? 13.108  -7.219  -4.732  1.00 49.75  ? 546  ASP B CA  1 
ATOM   9267  C  C   . ASP B  1 546 ? 12.067  -6.348  -5.416  1.00 49.75  ? 546  ASP B C   1 
ATOM   9268  O  O   . ASP B  1 546 ? 11.276  -5.665  -4.762  1.00 51.10  ? 546  ASP B O   1 
ATOM   9269  C  CB  . ASP B  1 546 ? 12.448  -8.059  -3.631  1.00 49.84  ? 546  ASP B CB  1 
ATOM   9270  C  CG  . ASP B  1 546 ? 11.161  -8.740  -4.084  1.00 52.67  ? 546  ASP B CG  1 
ATOM   9271  O  OD1 . ASP B  1 546 ? 10.859  -8.733  -5.295  1.00 53.82  ? 546  ASP B OD1 1 
ATOM   9272  O  OD2 . ASP B  1 546 ? 10.451  -9.301  -3.221  1.00 53.71  ? 546  ASP B OD2 1 
ATOM   9273  N  N   . TYR B  1 547 ? 12.080  -6.387  -6.747  1.00 47.97  ? 547  TYR B N   1 
ATOM   9274  C  CA  . TYR B  1 547 ? 11.152  -5.615  -7.574  1.00 47.76  ? 547  TYR B CA  1 
ATOM   9275  C  C   . TYR B  1 547 ? 9.952   -6.433  -8.080  1.00 45.92  ? 547  TYR B C   1 
ATOM   9276  O  O   . TYR B  1 547 ? 9.066   -5.906  -8.755  1.00 46.52  ? 547  TYR B O   1 
ATOM   9277  C  CB  . TYR B  1 547 ? 11.919  -4.924  -8.709  1.00 48.98  ? 547  TYR B CB  1 
ATOM   9278  C  CG  . TYR B  1 547 ? 13.176  -4.266  -8.188  1.00 48.24  ? 547  TYR B CG  1 
ATOM   9279  C  CD1 . TYR B  1 547 ? 14.393  -4.411  -8.840  1.00 44.60  ? 547  TYR B CD1 1 
ATOM   9280  C  CD2 . TYR B  1 547 ? 13.147  -3.525  -7.014  1.00 48.77  ? 547  TYR B CD2 1 
ATOM   9281  C  CE1 . TYR B  1 547 ? 15.541  -3.823  -8.344  1.00 43.69  ? 547  TYR B CE1 1 
ATOM   9282  C  CE2 . TYR B  1 547 ? 14.288  -2.932  -6.511  1.00 47.33  ? 547  TYR B CE2 1 
ATOM   9283  C  CZ  . TYR B  1 547 ? 15.483  -3.079  -7.177  1.00 44.95  ? 547  TYR B CZ  1 
ATOM   9284  O  OH  . TYR B  1 547 ? 16.616  -2.479  -6.658  1.00 42.66  ? 547  TYR B OH  1 
ATOM   9285  N  N   . ARG B  1 548 ? 9.935   -7.724  -7.759  1.00 44.05  ? 548  ARG B N   1 
ATOM   9286  C  CA  . ARG B  1 548 ? 8.762   -8.557  -8.025  1.00 46.25  ? 548  ARG B CA  1 
ATOM   9287  C  C   . ARG B  1 548 ? 7.619   -8.197  -7.065  1.00 47.45  ? 548  ARG B C   1 
ATOM   9288  O  O   . ARG B  1 548 ? 6.494   -7.921  -7.482  1.00 46.26  ? 548  ARG B O   1 
ATOM   9289  C  CB  . ARG B  1 548 ? 9.122   -10.043 -7.914  1.00 43.89  ? 548  ARG B CB  1 
ATOM   9290  C  CG  . ARG B  1 548 ? 8.020   -11.002 -8.350  1.00 42.78  ? 548  ARG B CG  1 
ATOM   9291  C  CD  . ARG B  1 548 ? 7.539   -10.699 -9.764  1.00 43.93  ? 548  ARG B CD  1 
ATOM   9292  N  NE  . ARG B  1 548 ? 8.648   -10.409 -10.666 1.00 45.27  ? 548  ARG B NE  1 
ATOM   9293  C  CZ  . ARG B  1 548 ? 9.402   -11.337 -11.248 1.00 46.31  ? 548  ARG B CZ  1 
ATOM   9294  N  NH1 . ARG B  1 548 ? 10.392  -10.973 -12.051 1.00 47.37  ? 548  ARG B NH1 1 
ATOM   9295  N  NH2 . ARG B  1 548 ? 9.172   -12.626 -11.026 1.00 44.79  ? 548  ARG B NH2 1 
ATOM   9296  N  N   . CYS B  1 549 ? 7.928   -8.199  -5.774  1.00 48.10  ? 549  CYS B N   1 
ATOM   9297  C  CA  . CYS B  1 549 ? 6.992   -7.763  -4.750  1.00 47.85  ? 549  CYS B CA  1 
ATOM   9298  C  C   . CYS B  1 549 ? 7.672   -6.666  -3.956  1.00 48.24  ? 549  CYS B C   1 
ATOM   9299  O  O   . CYS B  1 549 ? 8.288   -6.932  -2.924  1.00 50.91  ? 549  CYS B O   1 
ATOM   9300  C  CB  . CYS B  1 549 ? 6.605   -8.915  -3.817  1.00 47.23  ? 549  CYS B CB  1 
ATOM   9301  S  SG  . CYS B  1 549 ? 5.785   -10.317 -4.620  1.00 43.74  ? 549  CYS B SG  1 
ATOM   9302  N  N   . PRO B  1 550 ? 7.557   -5.422  -4.433  1.00 45.37  ? 550  PRO B N   1 
ATOM   9303  C  CA  . PRO B  1 550 ? 8.273   -4.291  -3.839  1.00 43.18  ? 550  PRO B CA  1 
ATOM   9304  C  C   . PRO B  1 550 ? 8.004   -4.102  -2.345  1.00 42.83  ? 550  PRO B C   1 
ATOM   9305  O  O   . PRO B  1 550 ? 7.020   -4.591  -1.803  1.00 41.22  ? 550  PRO B O   1 
ATOM   9306  C  CB  . PRO B  1 550 ? 7.747   -3.103  -4.646  1.00 39.58  ? 550  PRO B CB  1 
ATOM   9307  C  CG  . PRO B  1 550 ? 7.539   -3.678  -5.997  1.00 38.38  ? 550  PRO B CG  1 
ATOM   9308  C  CD  . PRO B  1 550 ? 7.035   -5.090  -5.770  1.00 41.71  ? 550  PRO B CD  1 
ATOM   9309  N  N   . LEU B  1 551 ? 8.922   -3.401  -1.689  1.00 45.10  ? 551  LEU B N   1 
ATOM   9310  C  CA  . LEU B  1 551 ? 8.937   -3.263  -0.241  1.00 43.36  ? 551  LEU B CA  1 
ATOM   9311  C  C   . LEU B  1 551 ? 7.574   -2.890  0.352   1.00 45.71  ? 551  LEU B C   1 
ATOM   9312  O  O   . LEU B  1 551 ? 7.209   -3.373  1.434   1.00 46.07  ? 551  LEU B O   1 
ATOM   9313  C  CB  . LEU B  1 551 ? 9.998   -2.231  0.175   1.00 39.67  ? 551  LEU B CB  1 
ATOM   9314  C  CG  . LEU B  1 551 ? 10.161  -2.022  1.687   1.00 38.81  ? 551  LEU B CG  1 
ATOM   9315  C  CD1 . LEU B  1 551 ? 10.780  -3.246  2.325   1.00 36.78  ? 551  LEU B CD1 1 
ATOM   9316  C  CD2 . LEU B  1 551 ? 11.003  -0.799  1.984   1.00 40.77  ? 551  LEU B CD2 1 
ATOM   9317  N  N   . ASP B  1 552 ? 6.839   -2.019  -0.337  1.00 47.02  ? 552  ASP B N   1 
ATOM   9318  C  CA  . ASP B  1 552 ? 5.576   -1.504  0.193   1.00 51.51  ? 552  ASP B CA  1 
ATOM   9319  C  C   . ASP B  1 552 ? 4.657   -2.633  0.672   1.00 52.71  ? 552  ASP B C   1 
ATOM   9320  O  O   . ASP B  1 552 ? 4.051   -2.546  1.752   1.00 52.92  ? 552  ASP B O   1 
ATOM   9321  C  CB  . ASP B  1 552 ? 4.867   -0.639  -0.849  1.00 52.10  ? 552  ASP B CB  1 
ATOM   9322  C  CG  . ASP B  1 552 ? 4.438   -1.432  -2.061  1.00 56.31  ? 552  ASP B CG  1 
ATOM   9323  O  OD1 . ASP B  1 552 ? 3.334   -1.177  -2.590  1.00 57.27  ? 552  ASP B OD1 1 
ATOM   9324  O  OD2 . ASP B  1 552 ? 5.209   -2.318  -2.484  1.00 59.25  ? 552  ASP B OD2 1 
ATOM   9325  N  N   . GLN B  1 553 ? 4.588   -3.700  -0.122  1.00 49.40  ? 553  GLN B N   1 
ATOM   9326  C  CA  . GLN B  1 553 ? 3.736   -4.842  0.186   1.00 48.21  ? 553  GLN B CA  1 
ATOM   9327  C  C   . GLN B  1 553 ? 3.902   -5.332  1.622   1.00 46.79  ? 553  GLN B C   1 
ATOM   9328  O  O   . GLN B  1 553 ? 2.922   -5.689  2.280   1.00 45.47  ? 553  GLN B O   1 
ATOM   9329  C  CB  . GLN B  1 553 ? 4.016   -5.988  -0.786  1.00 47.13  ? 553  GLN B CB  1 
ATOM   9330  C  CG  . GLN B  1 553 ? 3.757   -5.634  -2.231  1.00 49.43  ? 553  GLN B CG  1 
ATOM   9331  C  CD  . GLN B  1 553 ? 2.300   -5.333  -2.493  1.00 52.25  ? 553  GLN B CD  1 
ATOM   9332  O  OE1 . GLN B  1 553 ? 1.415   -5.819  -1.783  1.00 53.41  ? 553  GLN B OE1 1 
ATOM   9333  N  NE2 . GLN B  1 553 ? 2.039   -4.526  -3.516  1.00 50.43  ? 553  GLN B NE2 1 
ATOM   9334  N  N   . SER B  1 554 ? 5.144   -5.412  2.084   1.00 44.54  ? 554  SER B N   1 
ATOM   9335  C  CA  . SER B  1 554 ? 5.400   -5.778  3.467   1.00 43.09  ? 554  SER B CA  1 
ATOM   9336  C  C   . SER B  1 554 ? 5.228   -4.615  4.428   1.00 42.29  ? 554  SER B C   1 
ATOM   9337  O  O   . SER B  1 554 ? 4.544   -4.730  5.441   1.00 43.62  ? 554  SER B O   1 
ATOM   9338  C  CB  . SER B  1 554 ? 6.793   -6.380  3.609   1.00 45.27  ? 554  SER B CB  1 
ATOM   9339  O  OG  . SER B  1 554 ? 6.917   -7.534  2.799   1.00 47.46  ? 554  SER B OG  1 
ATOM   9340  N  N   . LEU B  1 555 ? 5.829   -3.480  4.099   1.00 42.40  ? 555  LEU B N   1 
ATOM   9341  C  CA  . LEU B  1 555 ? 5.897   -2.394  5.065   1.00 42.96  ? 555  LEU B CA  1 
ATOM   9342  C  C   . LEU B  1 555 ? 4.526   -1.766  5.287   1.00 47.61  ? 555  LEU B C   1 
ATOM   9343  O  O   . LEU B  1 555 ? 4.190   -1.389  6.415   1.00 49.65  ? 555  LEU B O   1 
ATOM   9344  C  CB  . LEU B  1 555 ? 6.919   -1.337  4.646   1.00 40.48  ? 555  LEU B CB  1 
ATOM   9345  C  CG  . LEU B  1 555 ? 7.193   -0.254  5.691   1.00 41.13  ? 555  LEU B CG  1 
ATOM   9346  C  CD1 . LEU B  1 555 ? 7.612   -0.857  7.030   1.00 40.41  ? 555  LEU B CD1 1 
ATOM   9347  C  CD2 . LEU B  1 555 ? 8.246   0.725   5.185   1.00 42.75  ? 555  LEU B CD2 1 
ATOM   9348  N  N   . MET B  1 556 ? 3.735   -1.657  4.220   1.00 47.23  ? 556  MET B N   1 
ATOM   9349  C  CA  . MET B  1 556 ? 2.389   -1.112  4.350   1.00 47.14  ? 556  MET B CA  1 
ATOM   9350  C  C   . MET B  1 556 ? 1.569   -1.970  5.301   1.00 45.63  ? 556  MET B C   1 
ATOM   9351  O  O   . MET B  1 556 ? 0.937   -1.462  6.232   1.00 45.27  ? 556  MET B O   1 
ATOM   9352  C  CB  . MET B  1 556 ? 1.699   -1.006  2.992   1.00 48.19  ? 556  MET B CB  1 
ATOM   9353  C  CG  . MET B  1 556 ? 2.200   0.155   2.160   1.00 48.77  ? 556  MET B CG  1 
ATOM   9354  S  SD  . MET B  1 556 ? 0.986   0.702   0.953   1.00 48.21  ? 556  MET B SD  1 
ATOM   9355  C  CE  . MET B  1 556 ? 0.856   -0.738  -0.087  1.00 37.22  ? 556  MET B CE  1 
ATOM   9356  N  N   . PHE B  1 557 ? 1.598   -3.275  5.072   1.00 44.76  ? 557  PHE B N   1 
ATOM   9357  C  CA  . PHE B  1 557 ? 0.915   -4.206  5.950   1.00 45.63  ? 557  PHE B CA  1 
ATOM   9358  C  C   . PHE B  1 557 ? 1.394   -4.023  7.393   1.00 45.71  ? 557  PHE B C   1 
ATOM   9359  O  O   . PHE B  1 557 ? 0.582   -3.898  8.311   1.00 45.34  ? 557  PHE B O   1 
ATOM   9360  C  CB  . PHE B  1 557 ? 1.140   -5.642  5.479   1.00 45.20  ? 557  PHE B CB  1 
ATOM   9361  C  CG  . PHE B  1 557 ? 0.066   -6.594  5.907   1.00 45.84  ? 557  PHE B CG  1 
ATOM   9362  C  CD1 . PHE B  1 557 ? -1.211  -6.137  6.181   1.00 47.17  ? 557  PHE B CD1 1 
ATOM   9363  C  CD2 . PHE B  1 557 ? 0.335   -7.946  6.049   1.00 45.73  ? 557  PHE B CD2 1 
ATOM   9364  C  CE1 . PHE B  1 557 ? -2.207  -7.013  6.582   1.00 47.25  ? 557  PHE B CE1 1 
ATOM   9365  C  CE2 . PHE B  1 557 ? -0.652  -8.823  6.451   1.00 46.36  ? 557  PHE B CE2 1 
ATOM   9366  C  CZ  . PHE B  1 557 ? -1.926  -8.356  6.716   1.00 47.30  ? 557  PHE B CZ  1 
ATOM   9367  N  N   . TYR B  1 558 ? 2.713   -3.986  7.583   1.00 44.53  ? 558  TYR B N   1 
ATOM   9368  C  CA  . TYR B  1 558 ? 3.298   -3.864  8.920   1.00 44.41  ? 558  TYR B CA  1 
ATOM   9369  C  C   . TYR B  1 558 ? 2.830   -2.618  9.678   1.00 43.44  ? 558  TYR B C   1 
ATOM   9370  O  O   . TYR B  1 558 ? 2.398   -2.698  10.826  1.00 41.52  ? 558  TYR B O   1 
ATOM   9371  C  CB  . TYR B  1 558 ? 4.830   -3.872  8.853   1.00 44.85  ? 558  TYR B CB  1 
ATOM   9372  C  CG  . TYR B  1 558 ? 5.459   -3.528  10.187  1.00 45.14  ? 558  TYR B CG  1 
ATOM   9373  C  CD1 . TYR B  1 558 ? 5.679   -4.510  11.141  1.00 44.53  ? 558  TYR B CD1 1 
ATOM   9374  C  CD2 . TYR B  1 558 ? 5.806   -2.214  10.503  1.00 45.04  ? 558  TYR B CD2 1 
ATOM   9375  C  CE1 . TYR B  1 558 ? 6.231   -4.199  12.361  1.00 46.29  ? 558  TYR B CE1 1 
ATOM   9376  C  CE2 . TYR B  1 558 ? 6.365   -1.894  11.724  1.00 44.72  ? 558  TYR B CE2 1 
ATOM   9377  C  CZ  . TYR B  1 558 ? 6.573   -2.891  12.652  1.00 46.82  ? 558  TYR B CZ  1 
ATOM   9378  O  OH  . TYR B  1 558 ? 7.127   -2.585  13.877  1.00 48.20  ? 558  TYR B OH  1 
ATOM   9379  N  N   . HIS B  1 559 ? 2.947   -1.467  9.028   1.00 44.63  ? 559  HIS B N   1 
ATOM   9380  C  CA  . HIS B  1 559 ? 2.476   -0.202  9.578   1.00 43.49  ? 559  HIS B CA  1 
ATOM   9381  C  C   . HIS B  1 559 ? 0.991   -0.252  9.929   1.00 44.16  ? 559  HIS B C   1 
ATOM   9382  O  O   . HIS B  1 559 ? 0.592   0.115   11.036  1.00 42.49  ? 559  HIS B O   1 
ATOM   9383  C  CB  . HIS B  1 559 ? 2.718   0.918   8.568   1.00 42.25  ? 559  HIS B CB  1 
ATOM   9384  C  CG  . HIS B  1 559 ? 4.100   1.482   8.613   1.00 43.66  ? 559  HIS B CG  1 
ATOM   9385  N  ND1 . HIS B  1 559 ? 4.684   2.107   7.532   1.00 42.74  ? 559  HIS B ND1 1 
ATOM   9386  C  CD2 . HIS B  1 559 ? 5.009   1.536   9.617   1.00 42.99  ? 559  HIS B CD2 1 
ATOM   9387  C  CE1 . HIS B  1 559 ? 5.896   2.512   7.864   1.00 43.45  ? 559  HIS B CE1 1 
ATOM   9388  N  NE2 . HIS B  1 559 ? 6.119   2.177   9.123   1.00 43.21  ? 559  HIS B NE2 1 
ATOM   9389  N  N   . VAL B  1 560 ? 0.171   -0.693  8.979   1.00 45.18  ? 560  VAL B N   1 
ATOM   9390  C  CA  . VAL B  1 560 ? -1.263  -0.771  9.213   1.00 46.84  ? 560  VAL B CA  1 
ATOM   9391  C  C   . VAL B  1 560 ? -1.564  -1.655  10.420  1.00 47.58  ? 560  VAL B C   1 
ATOM   9392  O  O   . VAL B  1 560 ? -2.323  -1.264  11.304  1.00 49.12  ? 560  VAL B O   1 
ATOM   9393  C  CB  . VAL B  1 560 ? -2.029  -1.278  7.983   1.00 48.07  ? 560  VAL B CB  1 
ATOM   9394  C  CG1 . VAL B  1 560 ? -3.464  -1.567  8.354   1.00 49.44  ? 560  VAL B CG1 1 
ATOM   9395  C  CG2 . VAL B  1 560 ? -1.983  -0.244  6.879   1.00 48.47  ? 560  VAL B CG2 1 
ATOM   9396  N  N   . LEU B  1 561 ? -0.956  -2.836  10.466  1.00 46.57  ? 561  LEU B N   1 
ATOM   9397  C  CA  . LEU B  1 561 ? -1.158  -3.733  11.595  1.00 47.72  ? 561  LEU B CA  1 
ATOM   9398  C  C   . LEU B  1 561 ? -0.807  -3.063  12.919  1.00 50.14  ? 561  LEU B C   1 
ATOM   9399  O  O   . LEU B  1 561 ? -1.538  -3.201  13.901  1.00 50.59  ? 561  LEU B O   1 
ATOM   9400  C  CB  . LEU B  1 561 ? -0.365  -5.021  11.410  1.00 48.06  ? 561  LEU B CB  1 
ATOM   9401  C  CG  . LEU B  1 561 ? -0.944  -5.907  10.306  1.00 51.51  ? 561  LEU B CG  1 
ATOM   9402  C  CD1 . LEU B  1 561 ? -0.024  -7.073  9.986   1.00 53.00  ? 561  LEU B CD1 1 
ATOM   9403  C  CD2 . LEU B  1 561 ? -2.337  -6.395  10.682  1.00 51.09  ? 561  LEU B CD2 1 
ATOM   9404  N  N   . LYS B  1 562 ? 0.304   -2.331  12.940  1.00 50.26  ? 562  LYS B N   1 
ATOM   9405  C  CA  . LYS B  1 562 ? 0.746   -1.652  14.153  1.00 50.91  ? 562  LYS B CA  1 
ATOM   9406  C  C   . LYS B  1 562 ? -0.235  -0.558  14.553  1.00 53.36  ? 562  LYS B C   1 
ATOM   9407  O  O   . LYS B  1 562 ? -0.509  -0.366  15.739  1.00 55.08  ? 562  LYS B O   1 
ATOM   9408  C  CB  . LYS B  1 562 ? 2.139   -1.052  13.964  1.00 50.78  ? 562  LYS B CB  1 
ATOM   9409  C  CG  . LYS B  1 562 ? 3.243   -2.074  13.700  1.00 51.55  ? 562  LYS B CG  1 
ATOM   9410  C  CD  . LYS B  1 562 ? 3.521   -2.935  14.918  1.00 51.45  ? 562  LYS B CD  1 
ATOM   9411  C  CE  . LYS B  1 562 ? 3.766   -2.089  16.151  1.00 50.71  ? 562  LYS B CE  1 
ATOM   9412  N  NZ  . LYS B  1 562 ? 4.041   -2.953  17.328  1.00 52.37  ? 562  LYS B NZ  1 
ATOM   9413  N  N   . ASP B  1 563 ? -0.763  0.155   13.560  1.00 53.17  ? 563  ASP B N   1 
ATOM   9414  C  CA  . ASP B  1 563 ? -1.737  1.215   13.811  1.00 54.02  ? 563  ASP B CA  1 
ATOM   9415  C  C   . ASP B  1 563 ? -2.987  0.615   14.443  1.00 54.37  ? 563  ASP B C   1 
ATOM   9416  O  O   . ASP B  1 563 ? -3.737  1.292   15.147  1.00 54.55  ? 563  ASP B O   1 
ATOM   9417  C  CB  . ASP B  1 563 ? -2.096  1.934   12.509  1.00 54.78  ? 563  ASP B CB  1 
ATOM   9418  C  CG  . ASP B  1 563 ? -2.617  3.344   12.741  1.00 56.77  ? 563  ASP B CG  1 
ATOM   9419  O  OD1 . ASP B  1 563 ? -2.240  3.967   13.756  1.00 56.58  ? 563  ASP B OD1 1 
ATOM   9420  O  OD2 . ASP B  1 563 ? -3.398  3.838   11.901  1.00 58.88  ? 563  ASP B OD2 1 
ATOM   9421  N  N   . LEU B  1 564 ? -3.196  -0.670  14.175  1.00 54.20  ? 564  LEU B N   1 
ATOM   9422  C  CA  . LEU B  1 564 ? -4.317  -1.421  14.723  1.00 53.50  ? 564  LEU B CA  1 
ATOM   9423  C  C   . LEU B  1 564 ? -3.938  -2.196  15.986  1.00 52.48  ? 564  LEU B C   1 
ATOM   9424  O  O   . LEU B  1 564 ? -4.756  -2.934  16.538  1.00 54.41  ? 564  LEU B O   1 
ATOM   9425  C  CB  . LEU B  1 564 ? -4.895  -2.355  13.655  1.00 53.16  ? 564  LEU B CB  1 
ATOM   9426  C  CG  . LEU B  1 564 ? -5.480  -1.586  12.464  1.00 50.92  ? 564  LEU B CG  1 
ATOM   9427  C  CD1 . LEU B  1 564 ? -5.741  -2.486  11.253  1.00 50.63  ? 564  LEU B CD1 1 
ATOM   9428  C  CD2 . LEU B  1 564 ? -6.742  -0.860  12.901  1.00 46.53  ? 564  LEU B CD2 1 
ATOM   9429  N  N   . GLY B  1 565 ? -2.692  -2.044  16.423  1.00 48.49  ? 565  GLY B N   1 
ATOM   9430  C  CA  . GLY B  1 565 ? -2.250  -2.616  17.682  1.00 46.47  ? 565  GLY B CA  1 
ATOM   9431  C  C   . GLY B  1 565 ? -2.051  -4.122  17.707  1.00 47.05  ? 565  GLY B C   1 
ATOM   9432  O  O   . GLY B  1 565 ? -1.964  -4.714  18.782  1.00 48.28  ? 565  GLY B O   1 
ATOM   9433  N  N   . LYS B  1 566 ? -1.985  -4.747  16.537  1.00 46.35  ? 566  LYS B N   1 
ATOM   9434  C  CA  . LYS B  1 566 ? -1.706  -6.180  16.454  1.00 48.14  ? 566  LYS B CA  1 
ATOM   9435  C  C   . LYS B  1 566 ? -0.231  -6.463  16.757  1.00 51.15  ? 566  LYS B C   1 
ATOM   9436  O  O   . LYS B  1 566 ? 0.617   -5.564  16.681  1.00 49.20  ? 566  LYS B O   1 
ATOM   9437  C  CB  . LYS B  1 566 ? -2.067  -6.733  15.072  1.00 49.05  ? 566  LYS B CB  1 
ATOM   9438  C  CG  . LYS B  1 566 ? -3.129  -5.931  14.316  1.00 49.16  ? 566  LYS B CG  1 
ATOM   9439  C  CD  . LYS B  1 566 ? -4.448  -6.687  14.176  1.00 46.66  ? 566  LYS B CD  1 
ATOM   9440  C  CE  . LYS B  1 566 ? -5.332  -6.530  15.402  1.00 44.11  ? 566  LYS B CE  1 
ATOM   9441  N  NZ  . LYS B  1 566 ? -6.679  -7.107  15.149  1.00 43.88  ? 566  LYS B NZ  1 
ATOM   9442  N  N   . GLU B  1 567 ? 0.081   -7.708  17.105  1.00 54.83  ? 567  GLU B N   1 
ATOM   9443  C  CA  . GLU B  1 567 ? 1.474   -8.070  17.317  1.00 55.85  ? 567  GLU B CA  1 
ATOM   9444  C  C   . GLU B  1 567 ? 2.091   -8.552  16.010  1.00 57.22  ? 567  GLU B C   1 
ATOM   9445  O  O   . GLU B  1 567 ? 1.711   -9.597  15.470  1.00 59.04  ? 567  GLU B O   1 
ATOM   9446  C  CB  . GLU B  1 567 ? 1.610   -9.157  18.375  1.00 57.27  ? 567  GLU B CB  1 
ATOM   9447  C  CG  . GLU B  1 567 ? 3.059   -9.539  18.627  1.00 59.40  ? 567  GLU B CG  1 
ATOM   9448  C  CD  . GLU B  1 567 ? 3.205   -10.797 19.450  1.00 60.86  ? 567  GLU B CD  1 
ATOM   9449  O  OE1 . GLU B  1 567 ? 4.333   -11.329 19.522  1.00 59.70  ? 567  GLU B OE1 1 
ATOM   9450  O  OE2 . GLU B  1 567 ? 2.194   -11.254 20.022  1.00 62.46  ? 567  GLU B OE2 1 
ATOM   9451  N  N   . VAL B  1 568 ? 3.059   -7.785  15.522  1.00 54.73  ? 568  VAL B N   1 
ATOM   9452  C  CA  . VAL B  1 568 ? 3.692   -8.058  14.243  1.00 53.14  ? 568  VAL B CA  1 
ATOM   9453  C  C   . VAL B  1 568 ? 5.123   -7.538  14.269  1.00 53.93  ? 568  VAL B C   1 
ATOM   9454  O  O   . VAL B  1 568 ? 5.492   -6.736  15.136  1.00 53.35  ? 568  VAL B O   1 
ATOM   9455  C  CB  . VAL B  1 568 ? 2.921   -7.402  13.082  1.00 48.98  ? 568  VAL B CB  1 
ATOM   9456  C  CG1 . VAL B  1 568 ? 3.073   -5.889  13.131  1.00 46.80  ? 568  VAL B CG1 1 
ATOM   9457  C  CG2 . VAL B  1 568 ? 3.394   -7.948  11.748  1.00 47.16  ? 568  VAL B CG2 1 
ATOM   9458  N  N   . TYR B  1 569 ? 5.930   -8.016  13.330  1.00 52.10  ? 569  TYR B N   1 
ATOM   9459  C  CA  . TYR B  1 569 ? 7.320   -7.609  13.254  1.00 50.81  ? 569  TYR B CA  1 
ATOM   9460  C  C   . TYR B  1 569 ? 7.761   -7.632  11.811  1.00 51.19  ? 569  TYR B C   1 
ATOM   9461  O  O   . TYR B  1 569 ? 7.215   -8.373  10.999  1.00 52.06  ? 569  TYR B O   1 
ATOM   9462  C  CB  . TYR B  1 569 ? 8.217   -8.561  14.039  1.00 48.10  ? 569  TYR B CB  1 
ATOM   9463  C  CG  . TYR B  1 569 ? 7.743   -8.892  15.422  1.00 47.08  ? 569  TYR B CG  1 
ATOM   9464  C  CD1 . TYR B  1 569 ? 6.796   -9.885  15.626  1.00 45.96  ? 569  TYR B CD1 1 
ATOM   9465  C  CD2 . TYR B  1 569 ? 8.267   -8.237  16.533  1.00 49.01  ? 569  TYR B CD2 1 
ATOM   9466  C  CE1 . TYR B  1 569 ? 6.365   -10.210 16.892  1.00 49.27  ? 569  TYR B CE1 1 
ATOM   9467  C  CE2 . TYR B  1 569 ? 7.842   -8.555  17.820  1.00 49.31  ? 569  TYR B CE2 1 
ATOM   9468  C  CZ  . TYR B  1 569 ? 6.890   -9.543  17.989  1.00 50.87  ? 569  TYR B CZ  1 
ATOM   9469  O  OH  . TYR B  1 569 ? 6.457   -9.865  19.250  1.00 51.68  ? 569  TYR B OH  1 
ATOM   9470  N  N   . ILE B  1 570 ? 8.771   -6.835  11.495  1.00 49.09  ? 570  ILE B N   1 
ATOM   9471  C  CA  . ILE B  1 570 ? 9.290   -6.812  10.143  1.00 47.49  ? 570  ILE B CA  1 
ATOM   9472  C  C   . ILE B  1 570 ? 10.814  -6.817  10.140  1.00 48.38  ? 570  ILE B C   1 
ATOM   9473  O  O   . ILE B  1 570 ? 11.459  -6.108  10.923  1.00 48.59  ? 570  ILE B O   1 
ATOM   9474  C  CB  . ILE B  1 570 ? 8.741   -5.610  9.349   1.00 43.90  ? 570  ILE B CB  1 
ATOM   9475  C  CG1 . ILE B  1 570 ? 9.210   -5.679  7.893   1.00 44.55  ? 570  ILE B CG1 1 
ATOM   9476  C  CG2 . ILE B  1 570 ? 9.128   -4.302  10.027  1.00 39.40  ? 570  ILE B CG2 1 
ATOM   9477  C  CD1 . ILE B  1 570 ? 8.478   -4.744  6.971   1.00 44.69  ? 570  ILE B CD1 1 
ATOM   9478  N  N   . ALA B  1 571 ? 11.380  -7.655  9.280   1.00 47.01  ? 571  ALA B N   1 
ATOM   9479  C  CA  . ALA B  1 571 ? 12.815  -7.679  9.073   1.00 47.00  ? 571  ALA B CA  1 
ATOM   9480  C  C   . ALA B  1 571 ? 13.093  -7.379  7.610   1.00 48.61  ? 571  ALA B C   1 
ATOM   9481  O  O   . ALA B  1 571 ? 12.707  -8.153  6.726   1.00 51.61  ? 571  ALA B O   1 
ATOM   9482  C  CB  . ALA B  1 571 ? 13.400  -9.030  9.472   1.00 46.49  ? 571  ALA B CB  1 
ATOM   9483  N  N   . ILE B  1 572 ? 13.753  -6.248  7.368   1.00 44.71  ? 572  ILE B N   1 
ATOM   9484  C  CA  . ILE B  1 572 ? 14.067  -5.788  6.024   1.00 43.97  ? 572  ILE B CA  1 
ATOM   9485  C  C   . ILE B  1 572 ? 15.547  -6.001  5.722   1.00 44.08  ? 572  ILE B C   1 
ATOM   9486  O  O   . ILE B  1 572 ? 16.417  -5.359  6.318   1.00 42.07  ? 572  ILE B O   1 
ATOM   9487  C  CB  . ILE B  1 572 ? 13.743  -4.299  5.874   1.00 44.38  ? 572  ILE B CB  1 
ATOM   9488  C  CG1 . ILE B  1 572 ? 12.267  -4.045  6.179   1.00 44.46  ? 572  ILE B CG1 1 
ATOM   9489  C  CG2 . ILE B  1 572 ? 14.122  -3.801  4.481   1.00 43.34  ? 572  ILE B CG2 1 
ATOM   9490  C  CD1 . ILE B  1 572 ? 11.965  -2.608  6.480   1.00 44.42  ? 572  ILE B CD1 1 
ATOM   9491  N  N   . PHE B  1 573 ? 15.829  -6.903  4.789   1.00 43.13  ? 573  PHE B N   1 
ATOM   9492  C  CA  . PHE B  1 573 ? 17.201  -7.231  4.453   1.00 39.98  ? 573  PHE B CA  1 
ATOM   9493  C  C   . PHE B  1 573 ? 17.814  -6.210  3.516   1.00 41.71  ? 573  PHE B C   1 
ATOM   9494  O  O   . PHE B  1 573 ? 17.321  -5.970  2.415   1.00 41.86  ? 573  PHE B O   1 
ATOM   9495  C  CB  . PHE B  1 573 ? 17.286  -8.642  3.889   1.00 40.05  ? 573  PHE B CB  1 
ATOM   9496  C  CG  . PHE B  1 573 ? 17.286  -9.694  4.947   1.00 42.88  ? 573  PHE B CG  1 
ATOM   9497  C  CD1 . PHE B  1 573 ? 16.110  -10.033 5.606   1.00 42.58  ? 573  PHE B CD1 1 
ATOM   9498  C  CD2 . PHE B  1 573 ? 18.471  -10.323 5.316   1.00 44.53  ? 573  PHE B CD2 1 
ATOM   9499  C  CE1 . PHE B  1 573 ? 16.113  -10.993 6.600   1.00 43.76  ? 573  PHE B CE1 1 
ATOM   9500  C  CE2 . PHE B  1 573 ? 18.482  -11.291 6.314   1.00 45.26  ? 573  PHE B CE2 1 
ATOM   9501  C  CZ  . PHE B  1 573 ? 17.299  -11.626 6.956   1.00 44.25  ? 573  PHE B CZ  1 
ATOM   9502  N  N   . LYS B  1 574 ? 18.908  -5.617  3.978   1.00 43.44  ? 574  LYS B N   1 
ATOM   9503  C  CA  . LYS B  1 574 ? 19.536  -4.495  3.301   1.00 42.41  ? 574  LYS B CA  1 
ATOM   9504  C  C   . LYS B  1 574 ? 19.895  -4.823  1.862   1.00 42.02  ? 574  LYS B C   1 
ATOM   9505  O  O   . LYS B  1 574 ? 19.997  -3.933  1.026   1.00 42.30  ? 574  LYS B O   1 
ATOM   9506  C  CB  . LYS B  1 574 ? 20.772  -4.048  4.076   1.00 43.61  ? 574  LYS B CB  1 
ATOM   9507  C  CG  . LYS B  1 574 ? 20.440  -3.361  5.392   1.00 45.44  ? 574  LYS B CG  1 
ATOM   9508  C  CD  . LYS B  1 574 ? 21.696  -3.010  6.153   1.00 47.32  ? 574  LYS B CD  1 
ATOM   9509  C  CE  . LYS B  1 574 ? 21.398  -2.102  7.332   1.00 49.60  ? 574  LYS B CE  1 
ATOM   9510  N  NZ  . LYS B  1 574 ? 22.658  -1.628  7.973   1.00 50.32  ? 574  LYS B NZ  1 
ATOM   9511  N  N   . LYS B  1 575 ? 20.076  -6.106  1.575   1.00 42.88  ? 575  LYS B N   1 
ATOM   9512  C  CA  . LYS B  1 575 ? 20.398  -6.547  0.220   1.00 41.35  ? 575  LYS B CA  1 
ATOM   9513  C  C   . LYS B  1 575 ? 19.611  -7.791  -0.182  1.00 42.91  ? 575  LYS B C   1 
ATOM   9514  O  O   . LYS B  1 575 ? 19.056  -8.491  0.655   1.00 43.26  ? 575  LYS B O   1 
ATOM   9515  C  CB  . LYS B  1 575 ? 21.903  -6.805  0.071   1.00 39.02  ? 575  LYS B CB  1 
ATOM   9516  C  CG  . LYS B  1 575 ? 22.778  -5.554  0.192   1.00 38.24  ? 575  LYS B CG  1 
ATOM   9517  C  CD  . LYS B  1 575 ? 24.263  -5.881  0.060   1.00 35.94  ? 575  LYS B CD  1 
ATOM   9518  N  N   . GLY B  1 576 ? 19.604  -8.070  -1.478  1.00 46.34  ? 576  GLY B N   1 
ATOM   9519  C  CA  . GLY B  1 576 ? 18.919  -9.218  -2.044  1.00 48.20  ? 576  GLY B CA  1 
ATOM   9520  C  C   . GLY B  1 576 ? 17.627  -8.927  -2.787  1.00 48.55  ? 576  GLY B C   1 
ATOM   9521  O  O   . GLY B  1 576 ? 16.874  -8.001  -2.478  1.00 46.05  ? 576  GLY B O   1 
ATOM   9522  N  N   . ALA B  1 577 ? 17.381  -9.763  -3.787  1.00 49.68  ? 577  ALA B N   1 
ATOM   9523  C  CA  . ALA B  1 577 ? 16.241  -9.634  -4.680  1.00 48.41  ? 577  ALA B CA  1 
ATOM   9524  C  C   . ALA B  1 577 ? 15.121  -10.554 -4.213  1.00 52.28  ? 577  ALA B C   1 
ATOM   9525  O  O   . ALA B  1 577 ? 15.170  -11.080 -3.102  1.00 53.37  ? 577  ALA B O   1 
ATOM   9526  C  CB  . ALA B  1 577 ? 16.644  -9.925  -6.113  1.00 44.69  ? 577  ALA B CB  1 
ATOM   9527  N  N   . HIS B  1 578 ? 14.106  -10.720 -5.054  1.00 54.11  ? 578  HIS B N   1 
ATOM   9528  C  CA  . HIS B  1 578 ? 12.930  -11.531 -4.732  1.00 55.25  ? 578  HIS B CA  1 
ATOM   9529  C  C   . HIS B  1 578 ? 13.305  -12.895 -4.121  1.00 56.70  ? 578  HIS B C   1 
ATOM   9530  O  O   . HIS B  1 578 ? 12.679  -13.347 -3.157  1.00 56.42  ? 578  HIS B O   1 
ATOM   9531  C  CB  . HIS B  1 578 ? 12.100  -11.718 -6.011  1.00 52.89  ? 578  HIS B CB  1 
ATOM   9532  C  CG  . HIS B  1 578 ? 10.735  -12.292 -5.789  1.00 54.27  ? 578  HIS B CG  1 
ATOM   9533  N  ND1 . HIS B  1 578 ? 9.769   -11.659 -5.035  1.00 56.29  ? 578  HIS B ND1 1 
ATOM   9534  C  CD2 . HIS B  1 578 ? 10.164  -13.429 -6.253  1.00 54.25  ? 578  HIS B CD2 1 
ATOM   9535  C  CE1 . HIS B  1 578 ? 8.666   -12.389 -5.033  1.00 55.70  ? 578  HIS B CE1 1 
ATOM   9536  N  NE2 . HIS B  1 578 ? 8.880   -13.469 -5.764  1.00 54.64  ? 578  HIS B NE2 1 
ATOM   9537  N  N   . GLY B  1 579 ? 14.344  -13.524 -4.666  1.00 54.85  ? 579  GLY B N   1 
ATOM   9538  C  CA  . GLY B  1 579 ? 14.774  -14.848 -4.242  1.00 54.88  ? 579  GLY B CA  1 
ATOM   9539  C  C   . GLY B  1 579 ? 15.913  -14.883 -3.231  1.00 55.15  ? 579  GLY B C   1 
ATOM   9540  O  O   . GLY B  1 579 ? 16.653  -15.863 -3.146  1.00 55.84  ? 579  GLY B O   1 
ATOM   9541  N  N   . HIS B  1 580 ? 16.082  -13.805 -2.479  1.00 52.81  ? 580  HIS B N   1 
ATOM   9542  C  CA  . HIS B  1 580 ? 17.201  -13.711 -1.550  1.00 51.06  ? 580  HIS B CA  1 
ATOM   9543  C  C   . HIS B  1 580 ? 17.323  -14.898 -0.586  1.00 49.62  ? 580  HIS B C   1 
ATOM   9544  O  O   . HIS B  1 580 ? 18.417  -15.211 -0.125  1.00 47.94  ? 580  HIS B O   1 
ATOM   9545  C  CB  . HIS B  1 580 ? 17.135  -12.397 -0.767  1.00 50.98  ? 580  HIS B CB  1 
ATOM   9546  C  CG  . HIS B  1 580 ? 15.932  -12.278 0.117   1.00 48.57  ? 580  HIS B CG  1 
ATOM   9547  N  ND1 . HIS B  1 580 ? 16.016  -12.292 1.492   1.00 46.11  ? 580  HIS B ND1 1 
ATOM   9548  C  CD2 . HIS B  1 580 ? 14.618  -12.141 -0.180  1.00 48.02  ? 580  HIS B CD2 1 
ATOM   9549  C  CE1 . HIS B  1 580 ? 14.806  -12.167 2.006   1.00 46.75  ? 580  HIS B CE1 1 
ATOM   9550  N  NE2 . HIS B  1 580 ? 13.939  -12.075 1.013   1.00 48.26  ? 580  HIS B NE2 1 
ATOM   9551  N  N   . SER B  1 581 ? 16.212  -15.552 -0.268  1.00 50.76  ? 581  SER B N   1 
ATOM   9552  C  CA  . SER B  1 581 ? 16.264  -16.644 0.702   1.00 51.80  ? 581  SER B CA  1 
ATOM   9553  C  C   . SER B  1 581 ? 17.235  -17.731 0.239   1.00 51.64  ? 581  SER B C   1 
ATOM   9554  O  O   . SER B  1 581 ? 18.084  -18.192 1.002   1.00 51.44  ? 581  SER B O   1 
ATOM   9555  C  CB  . SER B  1 581 ? 14.869  -17.227 0.969   1.00 52.01  ? 581  SER B CB  1 
ATOM   9556  O  OG  . SER B  1 581 ? 14.377  -17.938 -0.149  1.00 52.47  ? 581  SER B OG  1 
ATOM   9557  N  N   . ILE B  1 582 ? 17.070  -18.170 -1.002  1.00 51.62  ? 582  ILE B N   1 
ATOM   9558  C  CA  . ILE B  1 582 ? 18.034  -19.058 -1.647  1.00 49.28  ? 582  ILE B CA  1 
ATOM   9559  C  C   . ILE B  1 582 ? 19.269  -18.378 -2.289  1.00 51.31  ? 582  ILE B C   1 
ATOM   9560  O  O   . ILE B  1 582 ? 20.351  -18.972 -2.324  1.00 50.19  ? 582  ILE B O   1 
ATOM   9561  C  CB  . ILE B  1 582 ? 17.334  -20.005 -2.644  1.00 41.93  ? 582  ILE B CB  1 
ATOM   9562  C  CG1 . ILE B  1 582 ? 16.650  -19.211 -3.755  1.00 41.23  ? 582  ILE B CG1 1 
ATOM   9563  C  CG2 . ILE B  1 582 ? 16.316  -20.863 -1.916  1.00 33.52  ? 582  ILE B CG2 1 
ATOM   9564  C  CD1 . ILE B  1 582 ? 16.074  -20.081 -4.849  1.00 40.52  ? 582  ILE B CD1 1 
ATOM   9565  N  N   . ARG B  1 583 ? 19.085  -17.162 -2.818  1.00 53.72  ? 583  ARG B N   1 
ATOM   9566  C  CA  . ARG B  1 583 ? 20.121  -16.445 -3.585  1.00 55.97  ? 583  ARG B CA  1 
ATOM   9567  C  C   . ARG B  1 583 ? 20.951  -15.393 -2.837  1.00 52.39  ? 583  ARG B C   1 
ATOM   9568  O  O   . ARG B  1 583 ? 21.846  -14.788 -3.423  1.00 49.33  ? 583  ARG B O   1 
ATOM   9569  C  CB  . ARG B  1 583 ? 19.497  -15.762 -4.805  1.00 62.93  ? 583  ARG B CB  1 
ATOM   9570  C  CG  . ARG B  1 583 ? 18.622  -16.663 -5.648  1.00 71.77  ? 583  ARG B CG  1 
ATOM   9571  C  CD  . ARG B  1 583 ? 19.456  -17.544 -6.547  1.00 79.77  ? 583  ARG B CD  1 
ATOM   9572  N  NE  . ARG B  1 583 ? 20.403  -16.759 -7.331  1.00 87.37  ? 583  ARG B NE  1 
ATOM   9573  C  CZ  . ARG B  1 583 ? 20.073  -15.699 -8.066  1.00 93.37  ? 583  ARG B CZ  1 
ATOM   9574  N  NH1 . ARG B  1 583 ? 18.811  -15.285 -8.121  1.00 95.92  ? 583  ARG B NH1 1 
ATOM   9575  N  NH2 . ARG B  1 583 ? 21.008  -15.048 -8.749  1.00 93.92  ? 583  ARG B NH2 1 
ATOM   9576  N  N   . GLY B  1 584 ? 20.647  -15.152 -1.567  1.00 52.03  ? 584  GLY B N   1 
ATOM   9577  C  CA  . GLY B  1 584 ? 21.295  -14.081 -0.826  1.00 47.96  ? 584  GLY B CA  1 
ATOM   9578  C  C   . GLY B  1 584 ? 22.710  -14.484 -0.489  1.00 46.61  ? 584  GLY B C   1 
ATOM   9579  O  O   . GLY B  1 584 ? 23.127  -15.577 -0.848  1.00 49.80  ? 584  GLY B O   1 
ATOM   9580  N  N   . SER B  1 585 ? 23.455  -13.629 0.201   1.00 43.75  ? 585  SER B N   1 
ATOM   9581  C  CA  . SER B  1 585 ? 24.811  -14.006 0.583   1.00 45.48  ? 585  SER B CA  1 
ATOM   9582  C  C   . SER B  1 585 ? 24.754  -15.037 1.693   1.00 48.79  ? 585  SER B C   1 
ATOM   9583  O  O   . SER B  1 585 ? 23.751  -15.139 2.398   1.00 50.58  ? 585  SER B O   1 
ATOM   9584  C  CB  . SER B  1 585 ? 25.667  -12.795 0.990   1.00 45.90  ? 585  SER B CB  1 
ATOM   9585  O  OG  . SER B  1 585 ? 25.200  -12.165 2.170   1.00 45.97  ? 585  SER B OG  1 
ATOM   9586  N  N   . PRO B  1 586 ? 25.829  -15.818 1.849   1.00 49.90  ? 586  PRO B N   1 
ATOM   9587  C  CA  . PRO B  1 586 ? 25.777  -16.891 2.841   1.00 49.95  ? 586  PRO B CA  1 
ATOM   9588  C  C   . PRO B  1 586 ? 25.414  -16.376 4.227   1.00 50.56  ? 586  PRO B C   1 
ATOM   9589  O  O   . PRO B  1 586 ? 24.536  -16.956 4.862   1.00 52.88  ? 586  PRO B O   1 
ATOM   9590  C  CB  . PRO B  1 586 ? 27.202  -17.441 2.823   1.00 49.06  ? 586  PRO B CB  1 
ATOM   9591  C  CG  . PRO B  1 586 ? 27.670  -17.171 1.435   1.00 49.29  ? 586  PRO B CG  1 
ATOM   9592  C  CD  . PRO B  1 586 ? 27.083  -15.837 1.079   1.00 48.52  ? 586  PRO B CD  1 
ATOM   9593  N  N   . ARG B  1 587 ? 26.042  -15.291 4.673   1.00 48.71  ? 587  ARG B N   1 
ATOM   9594  C  CA  . ARG B  1 587 ? 25.773  -14.771 6.011   1.00 46.79  ? 587  ARG B CA  1 
ATOM   9595  C  C   . ARG B  1 587 ? 24.338  -14.262 6.124   1.00 46.23  ? 587  ARG B C   1 
ATOM   9596  O  O   . ARG B  1 587 ? 23.652  -14.515 7.117   1.00 44.10  ? 587  ARG B O   1 
ATOM   9597  C  CB  . ARG B  1 587 ? 26.757  -13.660 6.384   1.00 46.07  ? 587  ARG B CB  1 
ATOM   9598  C  CG  . ARG B  1 587 ? 26.586  -13.179 7.817   1.00 48.57  ? 587  ARG B CG  1 
ATOM   9599  C  CD  . ARG B  1 587 ? 27.433  -11.966 8.123   1.00 50.38  ? 587  ARG B CD  1 
ATOM   9600  N  NE  . ARG B  1 587 ? 27.130  -10.877 7.204   1.00 54.17  ? 587  ARG B NE  1 
ATOM   9601  C  CZ  . ARG B  1 587 ? 28.034  -10.281 6.438   1.00 57.64  ? 587  ARG B CZ  1 
ATOM   9602  N  NH1 . ARG B  1 587 ? 29.305  -10.660 6.492   1.00 59.06  ? 587  ARG B NH1 1 
ATOM   9603  N  NH2 . ARG B  1 587 ? 27.670  -9.303  5.625   1.00 59.56  ? 587  ARG B NH2 1 
ATOM   9604  N  N   . HIS B  1 588 ? 23.900  -13.539 5.096   1.00 45.51  ? 588  HIS B N   1 
ATOM   9605  C  CA  . HIS B  1 588 ? 22.519  -13.083 4.979   1.00 42.90  ? 588  HIS B CA  1 
ATOM   9606  C  C   . HIS B  1 588 ? 21.548  -14.268 5.019   1.00 41.84  ? 588  HIS B C   1 
ATOM   9607  O  O   . HIS B  1 588 ? 20.658  -14.333 5.869   1.00 41.03  ? 588  HIS B O   1 
ATOM   9608  C  CB  . HIS B  1 588 ? 22.370  -12.262 3.689   1.00 40.23  ? 588  HIS B CB  1 
ATOM   9609  C  CG  . HIS B  1 588 ? 20.959  -12.101 3.205   1.00 43.01  ? 588  HIS B CG  1 
ATOM   9610  N  ND1 . HIS B  1 588 ? 20.591  -11.105 2.324   1.00 44.12  ? 588  HIS B ND1 1 
ATOM   9611  C  CD2 . HIS B  1 588 ? 19.835  -12.820 3.445   1.00 42.93  ? 588  HIS B CD2 1 
ATOM   9612  C  CE1 . HIS B  1 588 ? 19.302  -11.208 2.053   1.00 42.76  ? 588  HIS B CE1 1 
ATOM   9613  N  NE2 . HIS B  1 588 ? 18.820  -12.242 2.720   1.00 42.80  ? 588  HIS B NE2 1 
ATOM   9614  N  N   . ARG B  1 589 ? 21.721  -15.216 4.112   1.00 40.64  ? 589  ARG B N   1 
ATOM   9615  C  CA  . ARG B  1 589 ? 20.842  -16.366 4.116   1.00 43.91  ? 589  ARG B CA  1 
ATOM   9616  C  C   . ARG B  1 589 ? 20.814  -17.000 5.498   1.00 47.14  ? 589  ARG B C   1 
ATOM   9617  O  O   . ARG B  1 589 ? 19.759  -17.422 5.968   1.00 46.90  ? 589  ARG B O   1 
ATOM   9618  C  CB  . ARG B  1 589 ? 21.271  -17.388 3.072   1.00 42.59  ? 589  ARG B CB  1 
ATOM   9619  C  CG  . ARG B  1 589 ? 21.022  -16.954 1.652   1.00 41.98  ? 589  ARG B CG  1 
ATOM   9620  C  CD  . ARG B  1 589 ? 21.449  -18.043 0.699   1.00 43.13  ? 589  ARG B CD  1 
ATOM   9621  N  NE  . ARG B  1 589 ? 20.673  -19.260 0.904   1.00 46.72  ? 589  ARG B NE  1 
ATOM   9622  C  CZ  . ARG B  1 589 ? 21.037  -20.460 0.464   1.00 50.15  ? 589  ARG B CZ  1 
ATOM   9623  N  NH1 . ARG B  1 589 ? 22.177  -20.601 -0.192  1.00 50.02  ? 589  ARG B NH1 1 
ATOM   9624  N  NH2 . ARG B  1 589 ? 20.267  -21.518 0.688   1.00 51.23  ? 589  ARG B NH2 1 
ATOM   9625  N  N   . MET B  1 590 ? 21.969  -17.060 6.152   1.00 48.61  ? 590  MET B N   1 
ATOM   9626  C  CA  . MET B  1 590 ? 22.043  -17.724 7.446   1.00 48.91  ? 590  MET B CA  1 
ATOM   9627  C  C   . MET B  1 590 ? 21.161  -17.039 8.474   1.00 46.91  ? 590  MET B C   1 
ATOM   9628  O  O   . MET B  1 590 ? 20.315  -17.676 9.100   1.00 45.96  ? 590  MET B O   1 
ATOM   9629  C  CB  . MET B  1 590 ? 23.467  -17.777 7.977   1.00 48.34  ? 590  MET B CB  1 
ATOM   9630  C  CG  . MET B  1 590 ? 23.526  -18.407 9.350   1.00 47.84  ? 590  MET B CG  1 
ATOM   9631  S  SD  . MET B  1 590 ? 24.960  -17.895 10.281  1.00 60.27  ? 590  MET B SD  1 
ATOM   9632  C  CE  . MET B  1 590 ? 24.495  -16.216 10.663  1.00 30.91  ? 590  MET B CE  1 
ATOM   9633  N  N   . LYS B  1 591 ? 21.364  -15.738 8.650   1.00 46.35  ? 591  LYS B N   1 
ATOM   9634  C  CA  . LYS B  1 591 ? 20.556  -14.978 9.595   1.00 44.06  ? 591  LYS B CA  1 
ATOM   9635  C  C   . LYS B  1 591 ? 19.073  -15.201 9.321   1.00 46.81  ? 591  LYS B C   1 
ATOM   9636  O  O   . LYS B  1 591 ? 18.309  -15.508 10.237  1.00 49.06  ? 591  LYS B O   1 
ATOM   9637  C  CB  . LYS B  1 591 ? 20.922  -13.491 9.572   1.00 38.38  ? 591  LYS B CB  1 
ATOM   9638  C  CG  . LYS B  1 591 ? 22.394  -13.262 9.873   1.00 36.74  ? 591  LYS B CG  1 
ATOM   9639  C  CD  . LYS B  1 591 ? 22.758  -11.807 10.101  1.00 36.17  ? 591  LYS B CD  1 
ATOM   9640  C  CE  . LYS B  1 591 ? 24.175  -11.728 10.665  1.00 38.11  ? 591  LYS B CE  1 
ATOM   9641  N  NZ  . LYS B  1 591 ? 24.695  -10.347 10.882  1.00 37.29  ? 591  LYS B NZ  1 
ATOM   9642  N  N   . ARG B  1 592 ? 18.661  -15.093 8.065   1.00 44.07  ? 592  ARG B N   1 
ATOM   9643  C  CA  . ARG B  1 592 ? 17.261  -15.320 7.786   1.00 44.61  ? 592  ARG B CA  1 
ATOM   9644  C  C   . ARG B  1 592 ? 16.838  -16.657 8.369   1.00 48.10  ? 592  ARG B C   1 
ATOM   9645  O  O   . ARG B  1 592 ? 15.901  -16.712 9.159   1.00 51.54  ? 592  ARG B O   1 
ATOM   9646  C  CB  . ARG B  1 592 ? 16.971  -15.300 6.300   1.00 48.08  ? 592  ARG B CB  1 
ATOM   9647  C  CG  . ARG B  1 592 ? 15.550  -15.731 6.006   1.00 49.15  ? 592  ARG B CG  1 
ATOM   9648  C  CD  . ARG B  1 592 ? 15.261  -15.709 4.530   1.00 48.97  ? 592  ARG B CD  1 
ATOM   9649  N  NE  . ARG B  1 592 ? 14.015  -16.402 4.241   1.00 48.21  ? 592  ARG B NE  1 
ATOM   9650  C  CZ  . ARG B  1 592 ? 13.904  -17.722 4.166   1.00 50.02  ? 592  ARG B CZ  1 
ATOM   9651  N  NH1 . ARG B  1 592 ? 12.729  -18.274 3.901   1.00 52.59  ? 592  ARG B NH1 1 
ATOM   9652  N  NH2 . ARG B  1 592 ? 14.968  -18.490 4.361   1.00 50.36  ? 592  ARG B NH2 1 
ATOM   9653  N  N   . TYR B  1 593 ? 17.542  -17.728 8.002   1.00 48.09  ? 593  TYR B N   1 
ATOM   9654  C  CA  . TYR B  1 593 ? 17.240  -19.057 8.528   1.00 48.48  ? 593  TYR B CA  1 
ATOM   9655  C  C   . TYR B  1 593 ? 17.121  -19.050 10.055  1.00 52.20  ? 593  TYR B C   1 
ATOM   9656  O  O   . TYR B  1 593 ? 16.139  -19.544 10.605  1.00 52.53  ? 593  TYR B O   1 
ATOM   9657  C  CB  . TYR B  1 593 ? 18.295  -20.075 8.084   1.00 49.30  ? 593  TYR B CB  1 
ATOM   9658  C  CG  . TYR B  1 593 ? 18.186  -20.481 6.624   1.00 52.59  ? 593  TYR B CG  1 
ATOM   9659  C  CD1 . TYR B  1 593 ? 16.947  -20.686 6.030   1.00 52.28  ? 593  TYR B CD1 1 
ATOM   9660  C  CD2 . TYR B  1 593 ? 19.322  -20.654 5.840   1.00 51.76  ? 593  TYR B CD2 1 
ATOM   9661  C  CE1 . TYR B  1 593 ? 16.843  -21.054 4.704   1.00 51.53  ? 593  TYR B CE1 1 
ATOM   9662  C  CE2 . TYR B  1 593 ? 19.227  -21.019 4.515   1.00 50.49  ? 593  TYR B CE2 1 
ATOM   9663  C  CZ  . TYR B  1 593 ? 17.985  -21.219 3.947   1.00 50.52  ? 593  TYR B CZ  1 
ATOM   9664  O  OH  . TYR B  1 593 ? 17.882  -21.587 2.616   1.00 47.82  ? 593  TYR B OH  1 
ATOM   9665  N  N   . LYS B  1 594 ? 18.109  -18.483 10.741  1.00 54.27  ? 594  LYS B N   1 
ATOM   9666  C  CA  . LYS B  1 594 ? 18.083  -18.455 12.203  1.00 56.67  ? 594  LYS B CA  1 
ATOM   9667  C  C   . LYS B  1 594 ? 16.834  -17.738 12.694  1.00 60.07  ? 594  LYS B C   1 
ATOM   9668  O  O   . LYS B  1 594 ? 16.202  -18.152 13.666  1.00 61.39  ? 594  LYS B O   1 
ATOM   9669  C  CB  . LYS B  1 594 ? 19.324  -17.754 12.752  1.00 54.73  ? 594  LYS B CB  1 
ATOM   9670  C  CG  . LYS B  1 594 ? 19.348  -17.603 14.267  1.00 53.69  ? 594  LYS B CG  1 
ATOM   9671  C  CD  . LYS B  1 594 ? 19.659  -18.917 14.956  1.00 56.28  ? 594  LYS B CD  1 
ATOM   9672  C  CE  . LYS B  1 594 ? 19.697  -18.756 16.476  1.00 56.88  ? 594  LYS B CE  1 
ATOM   9673  N  NZ  . LYS B  1 594 ? 19.686  -20.066 17.197  1.00 53.61  ? 594  LYS B NZ  1 
ATOM   9674  N  N   . LEU B  1 595 ? 16.489  -16.662 11.997  1.00 59.61  ? 595  LEU B N   1 
ATOM   9675  C  CA  . LEU B  1 595 ? 15.337  -15.832 12.313  1.00 57.47  ? 595  LEU B CA  1 
ATOM   9676  C  C   . LEU B  1 595 ? 14.031  -16.584 12.063  1.00 53.60  ? 595  LEU B C   1 
ATOM   9677  O  O   . LEU B  1 595 ? 13.090  -16.501 12.848  1.00 51.98  ? 595  LEU B O   1 
ATOM   9678  C  CB  . LEU B  1 595 ? 15.398  -14.574 11.450  1.00 60.14  ? 595  LEU B CB  1 
ATOM   9679  C  CG  . LEU B  1 595 ? 14.371  -13.463 11.626  1.00 62.99  ? 595  LEU B CG  1 
ATOM   9680  C  CD1 . LEU B  1 595 ? 14.458  -12.870 13.024  1.00 63.14  ? 595  LEU B CD1 1 
ATOM   9681  C  CD2 . LEU B  1 595 ? 14.610  -12.399 10.565  1.00 63.33  ? 595  LEU B CD2 1 
ATOM   9682  N  N   . PHE B  1 596 ? 13.984  -17.302 10.947  1.00 52.65  ? 596  PHE B N   1 
ATOM   9683  C  CA  . PHE B  1 596 ? 12.853  -18.145 10.579  1.00 51.19  ? 596  PHE B CA  1 
ATOM   9684  C  C   . PHE B  1 596 ? 12.610  -19.136 11.709  1.00 53.00  ? 596  PHE B C   1 
ATOM   9685  O  O   . PHE B  1 596 ? 11.543  -19.173 12.316  1.00 54.12  ? 596  PHE B O   1 
ATOM   9686  C  CB  . PHE B  1 596 ? 13.224  -18.899 9.297   1.00 48.91  ? 596  PHE B CB  1 
ATOM   9687  C  CG  . PHE B  1 596 ? 12.092  -19.660 8.663   1.00 48.77  ? 596  PHE B CG  1 
ATOM   9688  C  CD1 . PHE B  1 596 ? 11.325  -19.083 7.663   1.00 48.52  ? 596  PHE B CD1 1 
ATOM   9689  C  CD2 . PHE B  1 596 ? 11.826  -20.968 9.028   1.00 49.53  ? 596  PHE B CD2 1 
ATOM   9690  C  CE1 . PHE B  1 596 ? 10.293  -19.788 7.058   1.00 48.46  ? 596  PHE B CE1 1 
ATOM   9691  C  CE2 . PHE B  1 596 ? 10.792  -21.677 8.425   1.00 49.53  ? 596  PHE B CE2 1 
ATOM   9692  C  CZ  . PHE B  1 596 ? 10.028  -21.084 7.440   1.00 48.57  ? 596  PHE B CZ  1 
ATOM   9693  N  N   . MET B  1 597 ? 13.649  -19.900 12.010  1.00 54.52  ? 597  MET B N   1 
ATOM   9694  C  CA  . MET B  1 597 ? 13.611  -20.960 13.001  1.00 55.75  ? 597  MET B CA  1 
ATOM   9695  C  C   . MET B  1 597 ? 13.058  -20.454 14.320  1.00 56.06  ? 597  MET B C   1 
ATOM   9696  O  O   . MET B  1 597 ? 12.060  -20.967 14.830  1.00 55.88  ? 597  MET B O   1 
ATOM   9697  C  CB  . MET B  1 597 ? 15.047  -21.421 13.236  1.00 57.26  ? 597  MET B CB  1 
ATOM   9698  C  CG  . MET B  1 597 ? 15.278  -22.908 13.261  1.00 57.87  ? 597  MET B CG  1 
ATOM   9699  S  SD  . MET B  1 597 ? 17.039  -23.250 13.016  1.00 79.58  ? 597  MET B SD  1 
ATOM   9700  C  CE  . MET B  1 597 ? 17.791  -21.915 13.943  1.00 50.15  ? 597  MET B CE  1 
ATOM   9701  N  N   . GLU B  1 598 ? 13.703  -19.421 14.850  1.00 56.68  ? 598  GLU B N   1 
ATOM   9702  C  CA  . GLU B  1 598 ? 13.413  -18.919 16.189  1.00 56.63  ? 598  GLU B CA  1 
ATOM   9703  C  C   . GLU B  1 598 ? 11.993  -18.391 16.368  1.00 58.87  ? 598  GLU B C   1 
ATOM   9704  O  O   . GLU B  1 598 ? 11.381  -18.601 17.412  1.00 59.86  ? 598  GLU B O   1 
ATOM   9705  C  CB  . GLU B  1 598 ? 14.418  -17.835 16.567  1.00 56.48  ? 598  GLU B CB  1 
ATOM   9706  C  CG  . GLU B  1 598 ? 15.837  -18.352 16.713  1.00 60.93  ? 598  GLU B CG  1 
ATOM   9707  C  CD  . GLU B  1 598 ? 16.013  -19.269 17.914  1.00 65.84  ? 598  GLU B CD  1 
ATOM   9708  O  OE1 . GLU B  1 598 ? 15.091  -19.341 18.760  1.00 67.80  ? 598  GLU B OE1 1 
ATOM   9709  O  OE2 . GLU B  1 598 ? 17.080  -19.913 18.012  1.00 66.29  ? 598  GLU B OE2 1 
ATOM   9710  N  N   . PHE B  1 599 ? 11.472  -17.701 15.360  1.00 59.18  ? 599  PHE B N   1 
ATOM   9711  C  CA  . PHE B  1 599 ? 10.138  -17.125 15.463  1.00 58.07  ? 599  PHE B CA  1 
ATOM   9712  C  C   . PHE B  1 599 ? 9.125   -18.223 15.724  1.00 57.88  ? 599  PHE B C   1 
ATOM   9713  O  O   . PHE B  1 599 ? 8.272   -18.095 16.601  1.00 57.26  ? 599  PHE B O   1 
ATOM   9714  C  CB  . PHE B  1 599 ? 9.765   -16.364 14.190  1.00 57.66  ? 599  PHE B CB  1 
ATOM   9715  C  CG  . PHE B  1 599 ? 8.515   -15.532 14.324  1.00 57.96  ? 599  PHE B CG  1 
ATOM   9716  C  CD1 . PHE B  1 599 ? 8.514   -14.376 15.085  1.00 57.74  ? 599  PHE B CD1 1 
ATOM   9717  C  CD2 . PHE B  1 599 ? 7.347   -15.901 13.687  1.00 59.03  ? 599  PHE B CD2 1 
ATOM   9718  C  CE1 . PHE B  1 599 ? 7.367   -13.605 15.208  1.00 57.29  ? 599  PHE B CE1 1 
ATOM   9719  C  CE2 . PHE B  1 599 ? 6.197   -15.132 13.807  1.00 58.65  ? 599  PHE B CE2 1 
ATOM   9720  C  CZ  . PHE B  1 599 ? 6.210   -13.985 14.568  1.00 57.07  ? 599  PHE B CZ  1 
ATOM   9721  N  N   . PHE B  1 600 ? 9.237   -19.310 14.964  1.00 58.38  ? 600  PHE B N   1 
ATOM   9722  C  CA  . PHE B  1 600 ? 8.322   -20.439 15.099  1.00 58.30  ? 600  PHE B CA  1 
ATOM   9723  C  C   . PHE B  1 600 ? 8.461   -21.138 16.440  1.00 57.87  ? 600  PHE B C   1 
ATOM   9724  O  O   . PHE B  1 600 ? 7.471   -21.547 17.031  1.00 57.23  ? 600  PHE B O   1 
ATOM   9725  C  CB  . PHE B  1 600 ? 8.494   -21.431 13.949  1.00 57.63  ? 600  PHE B CB  1 
ATOM   9726  C  CG  . PHE B  1 600 ? 7.646   -21.112 12.757  1.00 56.11  ? 600  PHE B CG  1 
ATOM   9727  C  CD1 . PHE B  1 600 ? 8.190   -21.088 11.483  1.00 55.26  ? 600  PHE B CD1 1 
ATOM   9728  C  CD2 . PHE B  1 600 ? 6.301   -20.829 12.914  1.00 53.87  ? 600  PHE B CD2 1 
ATOM   9729  C  CE1 . PHE B  1 600 ? 7.403   -20.787 10.392  1.00 54.98  ? 600  PHE B CE1 1 
ATOM   9730  C  CE2 . PHE B  1 600 ? 5.515   -20.532 11.833  1.00 53.33  ? 600  PHE B CE2 1 
ATOM   9731  C  CZ  . PHE B  1 600 ? 6.063   -20.508 10.569  1.00 54.65  ? 600  PHE B CZ  1 
ATOM   9732  N  N   . GLU B  1 601 ? 9.688   -21.271 16.921  1.00 58.46  ? 601  GLU B N   1 
ATOM   9733  C  CA  . GLU B  1 601 ? 9.903   -21.817 18.251  1.00 59.98  ? 601  GLU B CA  1 
ATOM   9734  C  C   . GLU B  1 601 ? 9.194   -20.956 19.283  1.00 61.83  ? 601  GLU B C   1 
ATOM   9735  O  O   . GLU B  1 601 ? 8.471   -21.459 20.136  1.00 64.92  ? 601  GLU B O   1 
ATOM   9736  C  CB  . GLU B  1 601 ? 11.396  -21.885 18.568  1.00 60.34  ? 601  GLU B CB  1 
ATOM   9737  C  CG  . GLU B  1 601 ? 12.159  -22.893 17.729  1.00 62.36  ? 601  GLU B CG  1 
ATOM   9738  C  CD  . GLU B  1 601 ? 12.029  -24.303 18.260  1.00 65.00  ? 601  GLU B CD  1 
ATOM   9739  O  OE1 . GLU B  1 601 ? 11.472  -25.152 17.539  1.00 66.82  ? 601  GLU B OE1 1 
ATOM   9740  O  OE2 . GLU B  1 601 ? 12.485  -24.563 19.395  1.00 65.00  ? 601  GLU B OE2 1 
ATOM   9741  N  N   . ARG B  1 602 ? 9.419   -19.651 19.203  1.00 61.17  ? 602  ARG B N   1 
ATOM   9742  C  CA  . ARG B  1 602 ? 8.908   -18.718 20.201  1.00 59.53  ? 602  ARG B CA  1 
ATOM   9743  C  C   . ARG B  1 602 ? 7.459   -18.289 20.030  1.00 57.81  ? 602  ARG B C   1 
ATOM   9744  O  O   . ARG B  1 602 ? 6.809   -17.947 21.008  1.00 60.78  ? 602  ARG B O   1 
ATOM   9745  C  CB  . ARG B  1 602 ? 9.825   -17.500 20.320  1.00 61.79  ? 602  ARG B CB  1 
ATOM   9746  C  CG  . ARG B  1 602 ? 11.268  -17.884 20.580  1.00 66.39  ? 602  ARG B CG  1 
ATOM   9747  C  CD  . ARG B  1 602 ? 12.105  -16.667 20.891  1.00 70.89  ? 602  ARG B CD  1 
ATOM   9748  N  NE  . ARG B  1 602 ? 13.470  -17.020 21.262  1.00 74.50  ? 602  ARG B NE  1 
ATOM   9749  C  CZ  . ARG B  1 602 ? 13.795  -17.650 22.387  1.00 78.65  ? 602  ARG B CZ  1 
ATOM   9750  N  NH1 . ARG B  1 602 ? 12.849  -18.017 23.246  1.00 80.48  ? 602  ARG B NH1 1 
ATOM   9751  N  NH2 . ARG B  1 602 ? 15.066  -17.925 22.651  1.00 79.02  ? 602  ARG B NH2 1 
ATOM   9752  N  N   . LYS B  1 603 ? 6.973   -18.192 18.800  1.00 54.35  ? 603  LYS B N   1 
ATOM   9753  C  CA  . LYS B  1 603 ? 5.552   -17.901 18.619  1.00 52.94  ? 603  LYS B CA  1 
ATOM   9754  C  C   . LYS B  1 603 ? 4.624   -19.085 18.297  1.00 56.29  ? 603  LYS B C   1 
ATOM   9755  O  O   . LYS B  1 603 ? 3.402   -18.922 18.264  1.00 59.89  ? 603  LYS B O   1 
ATOM   9756  C  CB  . LYS B  1 603 ? 5.362   -16.777 17.599  1.00 51.52  ? 603  LYS B CB  1 
ATOM   9757  C  CG  . LYS B  1 603 ? 6.178   -15.525 17.901  1.00 49.25  ? 603  LYS B CG  1 
ATOM   9758  C  CD  . LYS B  1 603 ? 5.664   -14.784 19.119  1.00 47.93  ? 603  LYS B CD  1 
ATOM   9759  C  CE  . LYS B  1 603 ? 6.661   -13.714 19.560  1.00 49.75  ? 603  LYS B CE  1 
ATOM   9760  N  NZ  . LYS B  1 603 ? 6.187   -12.901 20.723  1.00 50.67  ? 603  LYS B NZ  1 
ATOM   9761  N  N   . LEU B  1 604 ? 5.177   -20.277 18.098  1.00 56.22  ? 604  LEU B N   1 
ATOM   9762  C  CA  . LEU B  1 604 ? 4.352   -21.395 17.621  1.00 57.15  ? 604  LEU B CA  1 
ATOM   9763  C  C   . LEU B  1 604 ? 4.455   -22.643 18.489  1.00 60.31  ? 604  LEU B C   1 
ATOM   9764  O  O   . LEU B  1 604 ? 3.459   -23.094 19.046  1.00 60.50  ? 604  LEU B O   1 
ATOM   9765  C  CB  . LEU B  1 604 ? 4.638   -21.740 16.157  1.00 54.35  ? 604  LEU B CB  1 
ATOM   9766  C  CG  . LEU B  1 604 ? 3.728   -22.840 15.601  1.00 51.95  ? 604  LEU B CG  1 
ATOM   9767  C  CD1 . LEU B  1 604 ? 2.310   -22.327 15.470  1.00 49.88  ? 604  LEU B CD1 1 
ATOM   9768  C  CD2 . LEU B  1 604 ? 4.229   -23.342 14.263  1.00 51.65  ? 604  LEU B CD2 1 
ATOM   9769  N  N   . LYS B  1 605 ? 5.648   -23.225 18.565  1.00 62.75  ? 605  LYS B N   1 
ATOM   9770  C  CA  . LYS B  1 605 ? 5.872   -24.355 19.454  1.00 64.94  ? 605  LYS B CA  1 
ATOM   9771  C  C   . LYS B  1 605 ? 5.416   -23.988 20.860  1.00 67.32  ? 605  LYS B C   1 
ATOM   9772  O  O   . LYS B  1 605 ? 4.453   -24.557 21.373  1.00 70.94  ? 605  LYS B O   1 
ATOM   9773  C  CB  . LYS B  1 605 ? 7.342   -24.769 19.466  1.00 63.62  ? 605  LYS B CB  1 
ATOM   9774  C  CG  . LYS B  1 605 ? 7.613   -25.969 20.355  1.00 64.29  ? 605  LYS B CG  1 
ATOM   9775  C  CD  . LYS B  1 605 ? 9.081   -26.355 20.355  1.00 64.79  ? 605  LYS B CD  1 
ATOM   9776  C  CE  . LYS B  1 605 ? 9.500   -26.957 19.025  1.00 64.37  ? 605  LYS B CE  1 
ATOM   9777  N  NZ  . LYS B  1 605 ? 10.926  -27.384 19.047  1.00 63.20  ? 605  LYS B NZ  1 
ATOM   9778  N  N   . LYS B  1 606 ? 6.117   -23.050 21.486  1.00 65.63  ? 606  LYS B N   1 
ATOM   9779  C  CA  . LYS B  1 606 ? 5.687   -22.510 22.767  1.00 67.71  ? 606  LYS B CA  1 
ATOM   9780  C  C   . LYS B  1 606 ? 5.679   -20.990 22.696  1.00 70.36  ? 606  LYS B C   1 
ATOM   9781  O  O   . LYS B  1 606 ? 6.740   -20.375 22.577  1.00 73.57  ? 606  LYS B O   1 
ATOM   9782  C  CB  . LYS B  1 606 ? 6.625   -22.974 23.883  1.00 67.41  ? 606  LYS B CB  1 
AT